1ED3B

Crystal structure of rat minor histocompatibility antigen complex rt1-aa/mtf-e.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I MAJOR HISTOCOMPATIBILITY ANTIGEN RT1-AA
publication title Two different, highly exposed, bulged structures for an unusually long peptide bound to rat MHC class I RT1-Aa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ed3B00
3FOLB 4WHCA 3QEQD 1EFXB 1QEWA 4Z7UF 2F53A 5DRNB 5ILTL 4XP9L 1KIUA 5E9DD 1HSAB 2A38A 1RURH 4AQOA 4GQ9H 4YXLL 1WWBX 4LK4A 4RISL 3MV01 4PRPB 5HHPB 4WUUB 3WIHA 5IJVB 1Q9WA 1K8IA 4WI6A 4LPWA 1D5BA 2EDRA 1GPOH 2GEEA 1VGKB 2DQUL 4MQTB 1RHFA 3QUMB 4ERSL 4M4RA 2YOCA 5J6HB 4JKPH 3OV6A 3JV4B 2J6EH 1G9NC 4NNXB 1ONQB 4P99A 4JFEE 1WZLA 2XPGA 3QPQD 1E27B 1FNHA 3QUXA 4H5SB 5E5UB 3FT2A 4N8VB 3SOBH 1YEHL 2BDNH 1G7PA 1YYLL 4HCRL 1XIWD 4L1DA 4Z7WE 2WMPA 2ADGB 4OIBA 1QO3A 1TZHA 4IRJA 1AO7B 3VE0A 4LCUB 1I1AD 1P69B 4OUUB 5GS1A 4KK9C 3RZCB 1MI5D 2IGFL 5FCUL 1CDYA 5GISH 1NLBL 4YDKL 1JI2A 1RUML 1CXKA 3KNBA 1J8HB 5HJ3A 4M1DH 1I7ZA 4WNQB 4X7SH 4MDIB 4E0RA 1I8IA 4A2LA 3NA9L 1OD9A 1YQ2A 4KAQL 4XVTH 2OK0L 2EXYD 1TJHL 3BRFA 4Z0BL 3PABB 2V5SA 3AFLA 4FZ8H 1J86A 3SKNB 5C0JB 1C5BH 2Z91B 1L7IL 3MRRB 3T65B 4OGAD 3VGHA 3D69A 2F58L 5GS0H 3L3JB 1QBMH 1M7IB 1MRDH 5CIPB 3WD5H 1ZT7A 3BDYL 3NCJL 3C8DA 5J12B 2R4SL 3I84A 1D9KD 4S0SD 2FJHB 4QO1A 3NH7H 3TBSB 4Z7QF 1XAUA 2IH1A 1D5XA 1RK0A 4J3UA 4XXDB 1MOEA 1ZT1A 2AK1H 3NBNA 4NC1C 3GJEB 1FV1A 5BW7C 4RMWA 5FYJD 2J6EA 4C54A 1HXMA 4X0KA 2VZTA 4O51B 1SEBB 1NBZB 4I0KA 4PP2B 5D7JB 1S7UB 5FO7B 3G5ZA 5C92A 4XP6L 1J05A 2YS4A 5MERB 4PJ5D 2CIIB 4NM4L 3VFMA 3KPSB 1Y0LA 1FQ9C 3QWOA 3RWCA 3OKEA 4L4TE 3ROLB 5C0BE 2B39A 5TQ2H 3RUGE 2WWKO 5BQ7A 3S8WA 5GXBB 1P7QB 3ARGA 3NIFE 3QPQC 3HZKA 3MRPA 2DJSA 1TVDA 1E28B 4M5YL 5D9SA 3VI3E 1WFUA 4TUJA 3QIWA 5JW5A 2G75A 3FT3A 4MJ6B 2BVEA 1A6UH 2YZ8A 3B2UD 2HFGH 4YPGA 3X3GL 1I1AC 1WCQA 4R96A 3MLSH 5L6YH 4YDVB 3BZDA 3O6KL 4JFYA 1P2CA 3PP4L 5T5NF 5C0FB 4Y5VC 4L5FH 1U8LA 1MRFH 5D7IB 1EMTH 3VXTA 3LSOB 2EXYC 4JZOB 2HKFL 1P4LB 3PGFH 3V6FB 1ZKAA 4GSDH 3BKYH 1ULVA 3KJ6L 3WNLA 3ULUH 5HHOE 3EYQD 5E7BA 1N5YL 3TT1L 5D1XD 5EORH 4HBCL 4YAQA 3KS0J 3W5NA 1DQMH 4MNHA 1J0KA 4DZBA 4EDXB 4M8VA 3T1FB 4P46B 3D2UB 3JWNC 1CLZH 3FB6A 4OJFL 4HXBH 2EH8H 4UZGA 2QKIB 4ZTOH 2DBJA 1QEWB 4NKQB 2F53B 1QKZH 2V6HA 4PJGA 5IT2L 2QQNL 4EXKA 3JV5A 2YMXH 5AG8A 2ZOKA 3AAZA 5MENA 1L6ZA 2WAHA 4YE4H 3VFRA 1S7RA 1QRND 5KJRH 3JSSA 4LIQL 1KFAH 1JGVL 1Q9WB 2OZ4L 1K8IB 3FFCD 3EHBD 4G6ML 1D5BB 2AJYH 4PRIE 1OP3H 1HE7A 4H8WH 4J3VA 4NN5C 3E8UH 2JB5H 3VXRA 3MJ9H 4UAOC 4ZAKA 3GSOA 2Q3AA 3ZE0F 2APVA 2XPGB 4R4FH 4YDJA 1GJIA 3QUXB 1YY8A 2BNRA 3FT2B 4NNPH 3B2UC 1MY7A 3MRQB 1FVEA 4BFEA 1SEQL 2EDWA 1G7PB 4X6CF 1BZ7A 2XYCA 4JPWH 5FYLL 4Z7VE 1E4KA 5F72S 1QO3B 1TZHB 4IRJB 5H8DA 5DR5H 3VE0B 3S37H 3UJIH 5GS1B 4X8XA 2XN9D 5IFHH 5F7WC 3GIVA 1A9EA 4UT9L 1CFVL 3KNBB 3KS0H 3HNVL 4M1CC 4NQXA 4OD2A 4J6RL 4G8IA 2IEPA 5HJ3B 3UAJD 4E0RB 1I7ZB 1I8IB 3S4SG 2YEZA 3RVVD 1A3QA 5L7XL 2YZ1A 1C12A 3VGDA 1FPTH 3EYQC 1Q0XL 4Y2OA 4PGJA 4R2GD 2NY6D 5D1XC 1KF9B 2ICWA 5IW1A 4QF1A 2VYRE 3UPRA 4MNGA 3WUWA 4FMFA 2QBWA 4PYHA 1QLFA 5IQ7L 2BP3A 3UZQA 3WN5C 3ZDYE 2E8YA 3D69B 3KGRA 1CR9H 2VLJE 4E9LA 3QJHB 4EXPX 5IB1A 5C70A 5ADPH 1ZT7B 1P7KA 1A6VH 4XWOC 4ZOAA 4I2XA 1DUYA 1BJ8A 2AV1A 3QI9C 2AVGA 2ITDA 4ISVA 1G9MH 5CP3H 3ETBF 1PY9A 2IH1B 1D5XB 1RK0B 4GBXC 1ZT1B 1KIPB 3DJ9A 4LSQL 5I9QC 4JR9H 1FV1B 2P5ED 2L7UA 3CFJA 2VXSL 4PUBL 4Y5XC 1A8JH 1HXMB 4X0KB 2R4RH 2YD8A 4ZS6D 3SKMA 3UZEA 3U48A 4MVBD 1YEIL 4IRSC 2UWEE 4NSKA 1IAII 1G84A 4DKDC 2OMBA 5I1CH 3G5ZB 4LCCB 1J05B 1MVFA 4R4BA 4JDTL 1U2HA 3VFMB 1CBVL 1Y0LB 3QWOB 4BYHA 4RX4D 3BFOA 4XX1G 4JPKH 4MNQA 3RWCB 5I1IH 3OKEB 5BQ7B 4LVHB 4XPFH 2XQBH 1GVIA 1NFDF 1FSKC 3ARGB 3VXUE 2BXZA 2K9UA 3HZKB 4RZCA 5IVZA 1RULH 3MRPB 4YHPA 3VRLE 3BGAA 4RAUA 3P30H 4UI2A 5D9SB 2VL4A 2HT2D 3GNML 4LNRA 4TUJB 1QLEH 3BQUA 1QSFE 3QIWB 4WCYH 5JW5B 2G75B 3FT3B 4JRYE 3MV8D 2Q8BH 3S9DB 5AD0A 2M1KA 4RRPG 1OSPL 4WWKA 4YPGB 5TE7H 4R96B 3QIBA 1KJVA 5IGXL 2FX8H 4JFYB 4YIQA 1P2CB 3MLRL 1NBVL 3BX7C 1FGVH 1M7XA 3F12A 1U8LB 1R3IL 2J12B 3MV7A 3MCKA 4LP5A 3VXOA 3UTZA 1FO0L 1DN2A 3PDDA 5E4IA 2MKLC 3VXTB 2FL5A 4KRNA 1HNGA 4R2GC 2ZUQC 5DTFA 3ESUF 1FNEA 4D9LL 5HYSG 3NABH 2OI9B 1T03L 1IGIL 1WBXA 3TESA 1EGJA 4BUHA 3CMOL 4WFFE 5IMLA 2EE6A 4HK0A 4YAQB 4ALAH 1A4KA 4PREA 4ODXB 4OI9A 1XGUA 4MNHB 1IL1B 3LQAC 5A2JH 1D5ZA 1F8TL 4DZBB 5GGVL 2V2XA 3MLVL 3RA7L 1X4ZA 4CVXA 5LWYH 4P57A 3FB6B 3K81A 4LLAA 4YX2H 2PF6A 1VESA 1Z9OA 2CLZA 4B50A 3ULVC 1G7LA 2E3VA 1EJOH 3QWQB 4ZS6C 2VXUL 3IVKA 2QSTA 4MVBC 1ZLSL 3C08H 4KV5F 4HXAH 2ZOKB 3AAZB 5MENB 4XVUC 2BVPA 4KMTH 4F9LC 3VFRB 4DW2L 1S7RB 4PJBE 5HGBA 1F90H 3QXUA 3B6SA 4U7SA 5ESAA 1VEPA 5DFVD 3Q5OA 3MBEA 1ORSB 1VGEH 1UWGL 4MQ7A 5JTWA 3BN3B 2DM4A 3RVWD 4MD4A 4PJEE 4RGOH 2BY0A 1SM3H 3MTRA 3LVEA 5M95B 3IRZA 1MCDA 4PP1D 2XY2A 4LBEA 2BK8A 3SE8L 3VXRB 2IMMA 1U8IA 2HT2C 5C71A 4ZAKB 1FG2A 1L9NA 2E9JA 3GSOB 4YDJB 2CUMA 3KR3L 1YY8B 2BNRB 5DRXB 1J1XL 5SX5K 5F7DA 3VXQA 5D4QA 4XNYL 4ZS7H 1FVEB 4Y89A 1BQHA 1BZ7B 3D9AL 2JIXD 4X4ME 5DA4A 1MREH 3HE7D 3HC3H 3IS1X 4LCWD 2IANE 2DIJA 3GIVB 4FQIH 3NFNA 1A9EB 1KIRA 3K8MA 5EO0A 4OD2B 1ZLWK 3THML 1FVDA 5IBTL 1P84K 4G8IB 3KWWA 4HW6A 5CS7A 5FOBA 3NVQA 1U8PA 3I3EA 4RWYL 1NMCC 4KC3B 2YEZB 5TJWK 4D9QE 3SGEI 4OLZL 1C12B 1TETL 4J4PA 5BO1L 1HH9A 3V4PH 4GG6E 4LRIC 3I6KA 4MGXA 2ICWB 5IW1B 4QF1B 3UPRB 2ILLA 5D7SL 4MNGB 5C0ND 3WUWB 1QLFB 1RZ7L 4EI6A 5IB1B 2Q20A 3IFOA 5GSRA 2FEDD 3WFBH 1P7KB 2DD8L 1FDLH 2LQRA 4OLVL 4I2XB 1DUYB 2AV1B 2VXQH 4JVPA 4M00A 5LXGH 2IC2A 2ITDB 4ISVB 3G5XA 5I30L 3J8F7 3U7YH 1AGBA 2AAVA 5I71C 2B2XH 5DVKA 1EBAA 3CFJB 3G04A 1JHLH 4LPTA 4UIMA 3SKMB 1NGPH 5DFVC 4NSKB 4BFGA 5J89A 3O2WH 4I8DA 5DK2A 2ZUYA 4R4BB 4J23A 3FOMA 1NMBH 3QDJD 2F54E 4PP1C 5JXAL 1OWRM 4QNPE 2E9WA 5C08E 2BSTA 4QOKD 4MNQB 3TA3A 3WCYA 5I0DA 1YN6A 3CSYA 1F3RB 5L8KB 4KQ4H 3DYOA 2HP4A 3BZFA 1M71A 2I60H 1I9JL 4RGMC 4RZCB 2A77L 5KW9L 1UCBL 4YHPB 3LKQA 5AYQA 4RAUB 5EA0H 3UP1A 1CWVA 4LNRB 3BQUB 4K8RD 2IPTL 5AD0B 5DT1L 5E94A 3MNVA 4G5ZH 3TT3H 2NQCA 4WWKB 5DQDH 2GTZA 1SBSL 4H25A 4L8CA 3X3FL 3QIBB 1KJVB 3QEGH 3JZ7A 4LHQB 3VFOA 3W81A 4YIQB 4BQ6A 2CDGA 3EYSH 4L3AA 2RHEA 1UWXK 3L6FA 5CAYB 3BSZL 3EYOA 1LK3L 3F12B 3MV7B 3MCKB 3VXOB 2L4OA 1I1YA 3UTZB 2GY7B 4Y0GA 2FL5B 1MNUL 3TV3H 2A6JA 5DUPL 4U1IA 1GZQA 5DTFB 4OI8A 1FNEB 1J18A 2ATPA 1WBXB 3GSQA 3PGDA 4UT7L 3LZFL 2VNCA 5IMLB 3L3GA 4HK0B 2NZIA 4KUCD 2XTJE 2EXWD 3OKMA 1A4KB 2YPLD 4PREB 1XGUB 4LSRL 1K8DA 1D5ZB 3GBNL 4KXZH 2V2XB 1HN1A 1P4BH 4CVXB 1HHIA 2BVYA 2ZUUA 3ZDZF 4P57B 5DMJB 1MCRA 2B0SH 4JPVL 5GGTL 4LARL 4OGZA 5DJXA 2CLZB 2V9QA 4LOUC 1G7LB 1AQKL 3BZEA 3S35L 2YR3A 1DJSA 3IVKB 1CN4A 2DB8A 3EO9H 3E0GA 4G9FE 3HNSL 1YNKH 1LGVA 3QEHA 5HGBB 4E5XB 3B6SB 5ESAB 4KY1L 1A7QL 3MLUH 4FFYL 5EN2A 3MBEB 5HPMA 3QRGH 3SHSA 5EZLA 5IP4A 4MQ7B 4OCXH 1ZLUH 3MLXH 1LWRA 4MD4B 4YHML 5KTEL 2Y06L 5I76A 2NY0B 1CYGA 1GOGA 3RAJL 3OJMB 3GSRA 3PQYD 5DEFA 1IAKA 3MODH 3RWHA 1U8IB 1FG2B 4K8RC 4OZIA 1KJ2L 4JFEA 2VDNH 1BBJA 3HRZA 3VRIA 1D5IL 3BMVA 1F2QA 4TSAL 5F7DB 3AY4A 2NXYB 3VXQB 1KPRA 3MO1A 5ANME 1BQHB 4NZJA 5ALCH 4YDLB 2H8PA 4M62L 4LVEA 4MHHG 3X12A 3CK0L 2QJDA 4WFGD 5LG1A 4X6DA 5BRZE 4S1SL 3M8OH 3HRPA 3NFNB 1KIRB 4KHTL 4KJWD 5EO0B 2ZNWA 1FVDB 3KWWB 5FOBB 3MUHL 3HFMH 4DWHA 3QXWA 2EYRA 3GM0A 1U8PB 4Y4KD 5FA4A 3NIDE 3IT8D 5HI5D 1UWXH 1HH9B 5LCVL 1JV5A 1AXIB 3I6KB 2KUTA 1KT2A 4JQVA 2X7LA 1H15A 2X4PA 1X44A 3C5JA 5FYJL 3QISA 4KVNL 1PY4A 3QIUA 1X4XA 3C8HA 4OCNC 5FF6A 4XTRD 4EI6B 5I15H 1U3HA 3IFOB 3D87B 5GSRB 3S3SA 1QBLH 2LAAA 4DVRH 1VDGA 3G5XB 3B5GA 5TE4H 5CKGA 4LVOC 1SY6H 1P5UA 1FL5B 2DQTL 2QQLH 4HH9A 3B9KC 3G04B 2V5RA 4UIMB 3VXNA 1J0HA 2XXCB 4OKVB 5SWZA 1Q9OA 2B5IB 5D72L 3G6AA 4JG0L 2X41A 3QDGD 5E2TH 4N8VG 1EH9A 3FOMB 5C6TL 4OLUH 1JPTL 4D9RD 4HUVA 4P5TD 5DJCA 5KS9E 2BHUA 2BSTB 2EDTA 3TA3B 2BERA 3CSYB 5HI4C 3IDUA 4L4TA 4BSWA 3Q3GA 4F7PA 3BZFB 1M71B 1XT5A 3HUJE 3OTTA 4PRHA 1A14L 3LKQB 4HEPG 3HG1D 1MFBL 4YBHA 3SE9L 2R2BA 4FQ1L 4YFLI 1JGUL 5HSFA 1YPZA 3MNVB 5E94B 1CL7H 4ODHL 1WFOA 2DBLL 1IZJA 2GTZB 4MJ5B 4XCNA 5DK3A 3H7LA 4H25B 4ZNEA 4L8CB 3O4OB 4KJWC 3H3PH 3P0YH 3VFOB 4BSJA 2E7MA 2CDGB 2OTWA 3GI8L 3L6FB 3EYOB 3LQMA 4Y4KC 2VJXA 3NPSC 5HVFB 3KYAA 4PRDA 3LEXA 2A6JB 4OD3L 5E99H 1FJ1A 4U1IB 1GZQB 4O9HH 1SY6A 4Z7OE 5DSCB 3UYPA 2ADFH 2A9MH 4NUJA 5TF0A 2WBWB 2IQAA 2FX9H 3GSQB 2NY5L 3PGDB 3E3QC 3ZE2F 4UTBL 3PWPA 3HNTH 2I26N 3L3GB 1JZ2A 2ZUXA 1QVOA 3OKMB 2QSCL 4DAGL 3T1WA 1K8DB 3ZKND 2H32B 4PG2A 1HHIB 3HE6D 2Y5TA 2MKWA 1J1OH 3EOTH 4L9LA 2AJXH 4X6EA 5BV7C 1A64A 1R3HA 5C3LD 5DJXB 4P2YA 3BZEB 3LPFA 2Z93A 5IBLD 1JRHH 1J9CT 2HTKD 4WFHD 4I4WA 3U1SL 4ENED 4U0RC 3RY5A 3QEHB 4HAFA 1K5NA 1DBJH 5E7FA 5EN2B 2JJTC 3PHOA 1KENH 5DVLA 1FYTD 5HPMB 5EZLB 2KZWA 4OTXL 4EVNA 4LCYA 1PW3A 3H0TA 1A3LH 4EN3C 5I76B 4PRIA 4MZ3A 1I1CA 3UTPD 3MLZH 1RMFH 4U1JA 2ZSWA 1MCCA 4X4XA 3UTSD 4APQC 2XZAL 3GSRB 5DEFB 1CD8A 2ZWLT 4WHTA 4YH6A 1IAKB 4OBRA 2VB5A 4TSBH 4BZYA 4AY0A 5C0AD 4OZIB 3BYYA 4JFEB 3DUUA 1BBJB 3HRZB 4OCSL 3VRIB 2I9LA 5ILTH 4M7LT 4S1RH 2XICA 1GOFA 1KPRB 2D7MA 3MO1B 4YFLF 4ZFGL 4K94C 2VXTH 4OLEA 2DQCL 1P9MA 2H8PB 2X4TA 4RISH 3X12B 2YUXA 4P4KC 2BFVL 4FHBD 3DVNA 1PKQE 3GSWA 1E6OL 4X6DB 3OF6A 4BQ8A 1JWUA 2F5BL 2CO6B 2V9RA 1J5OL 5JOFA 5B39A 4XMKL 1G7QA 3MRCA 3LQAL 2VQUA 1NCDL 1L0XA 1U8JA 2EYRB 4LQ1A 1PX4A 5FA4B 2I25N 4K7PH 2AS5M 3P77A 2I24N 1JV5B 4MCYA 4JE4B 2N7AA 5DURB 1KT2B 1GL4B 1PX3A 1S8DA 1ZLVK 4PJ9C 2X7LB 5I19H 1H15B 2X4PB 3C5JB 4HJ0D 2A2QT 1JUFA 3S5LA 2P7TA 1OP9A 2HKHH 4LEOA 2GUOA 3QEQE 4TVPH 1NLDL 5J11B 3QIUB 5EIIA 4YHZL 1FP5A 1YYLH 1XF5A 2ESVD 1OAYL 3W0WD 4M9PA 5E9DE 1U3HB 2Y9RT 2H2PD 3BEWA 4NC1E 3MOAL 3HE6C 5EU7C 4OZFH 4FQ2L 4R6UA 4IEFB 3ZHDA 5TQ0L 3SDAC 2BRRL 1NLBH 4LU5H 4YDKH 1HEZA 1JFQH 2Y6SD 3UC0L 1ERNA 4UV7H 2EEBA 4HH9B 2HTKC 4EIGB 1V7ML 3NA9H 5IG7A 4ZOEA 1X7QA 3F6IA 5JHDD 5E08L 3VXNB 4KAQH 1H3WM 3QDHA 1L7TL 2NLJA 1AIFA 1KXVC 1WAAA 1TJHH 2UWEA 4Z0BH 5SWZB 1Q9OB 4JHAL 4YDIL 4KKNA 3G6AB 4POYA 3ROOA 5HDLA 5HGDA 5FFLA 5JA8B 4H26A 4HUVB 5DJCB 2GAZA 5TDNA 4RMQA 3BDYH 3MRJA 2CK2A 4L4TB 4BSWB 4K2UH 3Q3GB 4F7PB 1GOHA 3C9NA 1INDL 1O5DT 5FGBC 4HJJH 1MI5E 4XI5D 1S78C 2R2BB 1QSFA 4KZDL 4CMMB 1YPZB 5FM8A 1L4IA 4IOIA 4XCNB 1S9KC 5I1GL 2JJWA 1DUZA 3DIFA 3HPLA 4R7DA 4XP6H 3RY4A 3O4LD 4NM4H 1HQRA 2OTWB 3ARUA 4OZFA 2AXHA 4JLRA 4G6JL 5I74B 4HHAA 4PRDB 1TQBB 3LEXB 3NTCL 2AQ1A 3WO4B 2NY2B 3WJJA 1FJ1B 2OBGA 3BZ4A 3Q6GH 3QUZD 5CJXC 3RWJA 4TUKL 1CDGA 1ZV5A 4NUJB 4GAFB 2IQAB 3FRPG 3EZ8A 3G6DL 3LAFA 4M5YH 1MCIA 5I16B 1MAJA 3PWPB 2NY3B 4UQ3A 2H2PC 1QVOB 3RTQA 5JQ6H 3BPLC 3QPXL 4LGRB 4XMPL 3X3GH 4N8CL 5FYJE 2VABA 1ZLVH 3WSQL 1CFTA 2DLFL 4XBEL 5BVJA 2Y5TB 3LMJH 4L9LB 3IDMA 3N9GL 4X6EB 4XH2A 4H88L 1R3HB 2HA1A 4GO6B 4PJ5E 3D25A 5E8OA 2J8OA 4HGMA 2Z93B 3ARQA 1BFTA 2PNDA 3I2CL 2Q7YA 2X1PA 2ENSA 1BD2E 2CRIA 2Y7QB 1NQBA 3MRDA 4I4WB 2ARJQ 2C3XA 4UB0L 4P23A 3NZHL 1TPXC 1K5NB 4K3DH 3Q5TA 1N5YH 2WP3O 5DMGD 2HG5A 1J12A 3PHOB 4P4RA 3TT1H 5MHSD 4OT1L 1ZT4A 3V5HA 1BF8A 4EVNB 4LCYB 2E6QA 5F9JB 3DV4A 1S3KL 3BGMA 3H0TB 4PJEA 1IEAA 3RUGF 3W2DL 4PRIB 3GHBL 4U1JB 2ZSWB 1EO8L 4X4XB 2GKIA 1IM9D 5J13C 4OJFH 4RWHA 1UKQA 4GG8A 5T3ZD 3VI3F 3LEVH 5TE6H 1RY7B 1AE6L 3DUUB 3ZTNL 2EDEA 2I9LB 3V7AG 3DO7A 1YEEL 4JO3L 4JFDD 5FYKD 4DJMA 4Q6YA 3TYGH 2BVOA 3QDMD 4G6AD 2X4TB 2LABA 4ODVH 3DVNB 4PBWD 3IAQA 3CLFL 3DI2B 1RIUH 4NKIL 4LIQH 4PGZA 3H3KA 2AJSH 3P4LA 1JWUB 2IANA 4KQ3L 1JGVH 2AXGA 5JOFB 5B39B 4BA8A 1G7QB 5F9DC 5B8CC 3MRCB 2E5EA 1MCLA 5C07D 5DVMA 1U8JB 1XGTA 3QUZC 2I07A 3FHAA 5C0RL 2P8MA 1FYHB 1X6NA 5CJ5A 2NPLX 3LN5B 3LS5L 3LD8B 2XACC 3P77B 4MCYB 5I1KH 1G7IA 1S8DB 5FB8A 5CJBA 1JUFB 3S5LB 2P7TB 1TTUA 4LEOB 2GUOB 5D1QC 5JW3L 4PBXA 5EIIB 1N6VA 3D3VE 1CFSA 3FQWA 4YNYA 1XF5B 2A6DB 5FYLH 4WI5A 1LO2H 3BEWB 3GSNL 4ZUVA 4DUWA 5GPRA 3L3HA 2R1YA 1QRNE 4UT9H 5IVXF 1HEZB 3HNVH 3AS3A 3FFCE 3K2UH 2PTTA 4GRWH 3VGEA 5KSBA 5IG7B 2Z8RA 2Z0BA 1X7QB 5L7XH 3DSNA 3VFVA 2NLJB 1JF1A 1Q0XH 3NCYS 5E1AA 1AIFB 4HF5H 2UWEB 4K8RL 2W92A 4EUPH 1OPGH 2B4CC 2W0PA 3ROOB 3CVHH 1KXTB 3C09B 3S88H 5HGDB 2LFGA 4H26B 2F54A 2GAZB 5TDNB 4FQQA 4QRSA 3UJJH 1NC4A 3RKDD 3STZA 3MRJB 3IDYC 4YFDB 1D7FA 2BY1A 4MB5A 3QUKA 1ZA6A 3C9NB 1N0LA 3VFGH 4PJAE 1FAIH 3V2AR 5T1DH 2HT3D 5IWLC 1LDSA 3BEVA 1QSFB 2BSED 4R0LC 4YHYC 1YEFL 4Z7VF 4JRYB 4G6AC 2GSGA 5FEBA 4IOIB 1YEIH 5FM5O 2CKBL 4PJ7E 1DUZB 3B43A 1BWMA 1IFHH 3HPLB 3DIFB 2QADC 4PV9A 4R7DB 3G6JE 4JDTH 1HQRB 3WUWG 4OZFB 3G9VA 4KPHL 4HHAB 1WWWX 1B3JA 3OWEA 3C5ZD 3UDWC 5JUEH 3ECBB 5I2IA 3BZ4B 4GKSA 3RWJB 1MF2L 1H3XA 2QSQA 1YC7A 1T20A 3MV9A 6FABL 4HWBH 2OP4L 3D85D 2R9HD 3IFNL 4UQ3B 2P5WD 3RTQB 3ULVE 2P5EE 4X80L 1BM3L 2VABB 3CVHA 3QQ3A 3BXNA 5BVJB 1FN4A 2AXFA 3IDMB 4UINH 2OM5A 1MCJA 4XH2B 4WHDA 3DETC 3D25B 4PS4L 5CSBA 5E8OB 3TO4D 1M1SA 1U0QA 1RUQL 1JWSA 3A67L 4ZPVA 1JP5A 5KSVB 2Q7YB 5E0QA 3SKOA 2PW1A 3MRDB 1Q72L 2YPKA 3WDIA 3ARFD 4NN7C 5CEYA 1T03H 3C6LD 4P23B 1VSCA 1WIUA 1QBAA 2HG5B 3ZMRA 4P4RB 1C5CH 5I6XB 4LSPL 1ZT4B 3V5HB 4NDMA 3RKDC 3V5DA 1CGYA 5F1SA 5T5FL 3DV4B 4KROB 2F5AH 3BGMB 4PJEB 1IEAB 5ENWA 5JPNA 1N0XL 1K85A 3LPWA 4HWEL 5FGSA 4QHNA 5HDBE 3VRLF 4KKLC 4PG9A 4MJID 2HT3C 2XXMB 4GG8B 4MZ2A 3L3OA 3WBDA 4Z0XA 4GKOA 3HR5A 3OPZH 5TGBA 2ICES 2MFNA 2VXUH 3DO7B 4RMSA 2WBJA 5JIKA 2BVOB 1YMMA 4DTGL 3CPLA 3UEZA 4ZTPL 1OD7A 3QEUB 4HWBA 5E8DL 2IANB 2AXGB 1UWGH 3W82A 4F37K 3NFSL 4Q0XH 3OKKA 4QHKJ 3BAEL 1I8KA 1RUPL 5KSAA 2YD6A 1ES0A 1A6AA 2HWZH 4LKXA 3EYVA 4N0RA 4ZYKA 1XGTB 2Q86A 2I07B 2P8MB 3VXMD 2VN7A 3SE8H 3DXAD 1LO0L 3JV0A 5BV7L 1G7IB 1DP0A 3I9GL 4XNXL 5FB8B 2RB8A 2R9HC 2C3WA 2K7QA 1FFRA 5MP6L 4RFNC 4XNYH 4AQ1B 5KBNC 1CFSB 3FQWB 4YNYB 3D9AH 3IKKA 4TSCL 1SHMA 4QYOA 5D71L 4DGIL 3ARRA 3X17A 4ZUVB 3WUZA 5IMOA 3L3HB 2NW2A 3UMTA 5GZOC 2R1YB 3JUZA 1KSRA 1CU4L 1G1YA 3TO4C 1MEXL 4HLJA 4F8QA 3THMH 5IBTH 2PTTB 2Q87A 4ETYA 1A0QL 3M1BA 4RWYH 4OCWL 5KSBB 5ICXA 3ARFC 1CGTA 4N1HB 4PJBF 1TETH 1WZMA 5BO1H 3VFVB 1JF1B 1IC7H 4WV1A 4CMHC 2DTML 4NQED 3JTTA 1EFQA 1YQVH 5JNYA 4GJTB 3OXRA 1Z6JT 1V05A 4AM0A 1RZ7H 4K94L 2F54B 3MCLH 1BQHG 4FQQB 4QRSB 1NC4B 2DD8H 3PNWA 3STZB 1JZ4A 2PTVA 4OLVH 1DLFH 3QUKB 1ZA6B 1KGCE 1HWHB 4HIXL 3HUJA 3U82B 4LCWE 1U6AL 4ZMAT 2XNAA 3U83A 4KJPD 3BEVB 3IJYA 5D2NA 4GRMA 4U1SA 2GSGB 1A6WL 3SDDD 1DE4A 1RJLA 1V8HA 4GXUN 1BZ9A 4PLNC 4PV9B 4I3SL 1PG7W 4LAQH 2XZQH 3TWCL 2IAMD 4DKFH 3V4VL 2A0LD 1XF2A 3DMMD 1HZHH 5JXAH 1AI1H 4H0HB 1CLCA 5C0CA 4MCZA 4JJHA 1IGML 3BPOC 3CJJA 4GG6F 5I2IB 4GKSB 4J8RA 1VADA 5KW9H 2A77H 2FLRT 3E6HA 3WE6B 4GRWB 5D6DC 4ZPTA 2AK4A 2G2RB 1T20B 3MV9B 3SDYH 3B83A 1ZVHA 3PJSA 1KYOK 4RGND 2OJZH 3A6CL 4LSSL 2R15A 2VDKL 4P0DA 3HMXH 3X3FH 3OX8A 1YEDA 3HMWL 3QQ3B 3FZUD 4JFHD 3MRMA 1F4XH 1FN4B 2AXFB 3VDBA 3BSZH 4KK8D 2X2YA 3BP7A 5ECJE 4UDUA 3QDJE 4TQEL 3V6OA 1JWSB 2FX7H 4ZPVB 3EOBA 1MNUH 5DUPH 4QOKE 3SKOB 2PW1B 5DMIL 2YPKB 3FAWA 5CEYB 4K71C 5TDPA 3GMMB 1JTOA 2WINB 1PG7H 4JFQA 4UT7H 3RI5F 3LZFH 3VGAB 4FP8H 3JUYA 5HYQA 4U3HA 1B9ZA 5IHBA 1UZ6E 4D0BB 4NDMB 3V5DB 4LSRH 3C60A 4JRXA 5ENWB 4W81A 5JPNB 3RVXD 3GBNH 1NCTA 4IHOA 2Q76A 3OHXA 1MJ8L 4WUKL 3RL2A 4QHNB 1I3UA 5JA9A 1OAXL 4PG9B 4JPVH 2DWDA 5GGTH 3L3OB 1N6QL 1KCVH 4Z0XB 3HR5B 5TGBB 1TVHA 4QCIA 4GAJH 2FDBP 3L3IA 3E2HB 1V3LA 3SDDC 3KJ4C 4JHBA 2WBJB 3GBLA 4P3CH 1YMMB 5E8PA 1OTSC 3HNSH 3CPLB 4Z7NF 3FCTA 3OBAA 1U8KA 5F7UA 1YJDC 1TJGL 4XP4L 5DJZA 1RIHL 3OKKB 4YHMH 1I8KB 3CZFA 3EOYG 3QXDA 5KSAB 5KTEH 1KEGL 3TBWA 1AGEA 1A6AB 1ES0B 4LKXB 3EYVB 3CLEL 4G8EA 4ZYKB 4HGWA 2Q86B 5IQ9A 5TFSL 1Y18A 1EXUA 2RCSL 2R0KH 4YZFF 1MCOL 2ZKHL 5CGTA 4KJQD 4RGNC 5CEZE 3SDXA 5D2LE 5B3JE 2OR8A 4PIRF 5ACZA 1UH3A 4NGHH 4UQ2A 2Q3ZA 2Y23A 3FZUC 3WL9A 4O02L 3LKOA 1EX0A 2D03L 4JFOA 4PJ8D 1QFWM 2E7CA 3HI5L 2VLRA 5IMOB 2EZ0D 3VMNA 2NW2B 3BP6A 4KK8C 1AR1D 4GMSL 3SO3B 3BN9D 3QHFL 4PGEA 3VH8A 2YD4A 3M1BB 1TJIL 2P8LA 4PJGF 2VUOA 4NN6B 5GGTA 1ZSDB 3PP3K 4Q6IA 5LQBL 4JY5L 4WV1B 4KVNH 3JTTB 4S1QL 3WKML 1MHPL 3HI6L 5JNYB 4HUUA 5C09D 1LP9E 3OXRB 4MAYD 4ZUWA 3BGFC 4AM0B 3BDBA 1E4XH 3LIZH 4JKWA 4WU5A 1XCQB 3PNWB 1S9WA 1LVEA 2Z8VC 1XR8A 5CBAA 1WBYA 1X5YA 1XIWA 3HC0A 1CK0H 1U3YA 4JREC 4DQOL 2R69L 1WZ1L 3HUJB 4TPRH 4POZD 3TCXA 1I1AA 2XNAB 3RWEA 5D2NB 2J5LC 3IJYB 4GRMB 4U1SB 2N4IA 2AJZA 3WFCL 3L95A 1E4WL 1NCBL 1DE4B 1RJLB 3MOBH 4Y2DA 3QXAB 5JLZA 1BZ9B 2AI0L 4YQXH 4PV8A 5HPOA 5F9OL 5C6TH 1JPTH 1XF2B 1AHWA 4OF3A 4Q9RH 2HTLD 5C0CB 2FECL 4MCZB 3E3QE 3RGVD 2FEEI 3B2VL 3BKML 4K23L 5E6IA 1RQ5A 5IESL 1MCPL 3BPNB 4X7DC 3TZVA 5EUKA 4J8RB 1VADB 4U7MA 1A14H 3E6HB 1ACZA 4YXHL 1D9KA 1P53A 4BQ9A 3DRTB 1MFBH 4ZPTB 2AK4B 2PYED 5LGKA 4FQ1H 3PJSB 2UVFA 1QTYT 1QLRA 4PJ8C 5KANI 1FCGA 2DBLH 4HGKC 3VWKA 1CQYA 2EZ0C 4AEFA 4LLYA 3WHE1 3OX8B 2VKWA 3ESVF 4FG6D 1YEDB 4N9GA 3HAEH 1J1PL 3MRMB 3BN9C 2EC9U 4UILL 1EAPA 1RU9L 5CUSH 5HDQL 3C2SA 4HC1L 3BP7B 3QDGE 2P48B 4PJ5A 3UX9B 4D9RE 1PLGH 5T1KD 2AEPH 4UDUB 3DRQA 3EOBB 3HTLX 5T3ZL 1OM3L 5HVHC 3TIEA 4C58B 4OQTH 3JTSA 5FYKL 2BZDA 1BMGA 1N7ML 4FQJL 4JFQB 1U42A 2IBGA 4MAYC 4UTBH 5HYQB 3HG1E 5KS9F 3MRIA 2QSCH 4I18A 3C60B 4JRXB 4K3GA 2E27L 1QPPA 2QV2A 3I02A 1GC1C 4IHOB 2Q76B 3OHXB 2FO1A 1I75A 3RL2B 4KTYA 4POZC 4MA7H 1CDJA 2DWDB 5FUCC 3BWUC 4XPBL 3O3DA 4QCIB 1ZVYA 3L3IB 1ACYL 3UPAA 4WVRA 5HYJD 5IHLB 1PYWA 3SE3C 5JHLL 4ZXBC 5E8PB 3MUZ1 3U1SH 1Z9LA 3FCTB 1PKQB 1U8KB 4ZD3L 4YXKL 1WUNT 5JW4M 5FUZL 1ZWIA 4XCCL 4Z6AT 2HTLC 3MA7A 5DRWA 2B1AL 4MAUL 5DJZB 3RGVC 5DWUL 3CZFB 1I8LC 1IQWL 2ED8A 3PE9A 4XNUH 5E5RB 3HAEA 1AGEB 5BS0D 4G8EB 4Z7OF 1YYML 4HGWB 4JM4H 3GMRA 4NO2A 5IQ9B 1Y18B 1EXUB 2FCBA 2ZOLA 5A1AA 3PL6C 2WIMA 1QYGH 1UJ3A 4ZO9A 5MEPA 3DECA 3SDXB 1KG0A 3N50A 1SBBA 3VXSA 5ACZB 2X09A 4OQTA 1UH4A 3BH9A 4ZFGH 2J8UA 4FG6C 4UQ2B 4HEME 4X98A 3WL9B 2VDMH 3LKOB 4HZLA 4JFOB 4O5LL 2BFVH 1NCWL 2VLRB 3O3AB 5GGQH 4P9HC 3BP6B 3ZYZA 1J5OH 4XMKH 43CAA 4HKZA 2XIDA 3QB7C 4XHQA 4PGEB 5I0ZA 4ODTL 4Y1AA 3VH8B 3I50L 1NCDH 1UEYA 4G6KL 1T6VN 3QFJD 4NYLA 3LDBB 3UTPE 4FFZH 1M7DA 2GT9A 3UTSE 5H94A 4C4KT 4Q6IB 4FNLL 5GGRY 4MA3A 3ARDC 1R5VA 2V5MA 1NEUA 5C0AE 3U30C 1VB9A 1F02I 1NLDH 4HUUB 4OB5L 1G1CA 4YHZH 2P44B 4ZUWB 1B4RA 1OAYH 4UV4L 1P4IL 4IDLA 4WU5B 1O7SA 3MOAH 4LLMA 1S9WB 3DTXA 1XR8B 5DA0B 2VDLH 5CBAB 1SJHA 1WBYB 4W4OA 1MHCA 2AJVL 1XIWB 3BIBX 3HC0B 5TQ0H 2FR4A 2BRRH 3EO1A 5T33L 4PJAA 1I1AB 5B39G 3UC0H 3QFDA 3RWEB 2XN9A 2FNBA 5DLML 4DEPC 1XH3A 5E08H 2AJZB 2V17H 4AG4H 3L95B 1W2KT 3JWOC 2NR6D 4Y2DB 1GGYA 5JLZB 4GLRH 4JHAH 5FECA 1X5LA 4PV8B 4RFOL 3S5LG 2UZIH 1S7QA 1DVFD 1AHWB 3CSBA 2FRGP 3HPJA 1CZ8L 4Z7QE 2Z31C 3HCVA 2EDXA 4YGVA 1KTKE 2BNQA 1SQ2N 2ESVE 4KTEL 1AD0A 5E6IB 2OQJA 3W0WE 4D3CL 1YNLH 3MACH 4XC1H 4QXWA 2FIRT 3RQ3A 2IFFL 1D9KB 2EKSA 4K7FA 4UNUA 2VLKD 2XQYG 4NQVA 4KZDH 1ZTXL 1QLRB 2WWMC 3LRGA 3N1GC 2OTUA 3VWKB 3ARBD 4LLYB 5JHDE 5I1GH 4RIRA 1LE5A 4N9GB 3T0VA 4OIIL 2W65A 5F88A 3CFDA 3B3IA 1CXIA 5K9QG 3KPTA 4FQHA 5ELIA 4PJ5B 1ZA3A 3DRQB 5DFWH 3NTCH 1UM4L 4JDZA 5EU3A 5AEAA 3IB4A 5C0BD 3DX8A 3TIEB 2JJSA 3VFSA 3JTSB 4RBPK 3VFUA 2YWYA 1AC6A 1KB5L 3G6DH 3T08A 4KRLB 4QWWD 4ACPA 1RUKH 2VDPH 4O00A 4F57H 3QA3A 1UFUA 4FQXC 5JQHC 8FABA 3MRIB 2IMNA 4OF5A 4I18B 4XMPH 3MV8A 1CG9A 3I02B 3WSQH 1YEGL 4HJGA 4V2BA 1JHKL 4XBEH 2GI7A 3KPQA 1R3KA 4NWTH 4H88H 4KZEH 1HDMA 1T1XA 4P2RE 3P0GB 3O4LE 3O3DB 4NBYB 4OZFG 1NEZG 4RMRA 2NR6C 4OCRL 1TXKA 1BIIA 3MLYL 1PYWB 2X4OA 1HYSD 4UB0H 4YHNA 3L7FA 1Z2KA 5C6WH 4JO1L 3GMLA 1DVFC 1DBBH 3MA7B 4OZGA 3QRFM 1WC7A 5DRWB 3O9WD 1GCFA 2PO6A 3HAEB 1TZGH 5EWIH 3GMRB 4NO2B 3KYKH 5D93C 4TRPH 3BKJH 1T2XA 2XWJA 2ZOLB 2P24A 4U1HA 2CUIA 1AE6H 2DJ4A 1UJ3B 5MEPB 1A9BA 3ZTNH 3KXFE 1KG0B 1YEEH 2A73A 4JO3H 5F9WB 3VXSB 2FH6A 4TTGA 5CMAA 3BH9B 1BLNA 1XGYL 5F96L 4HZLB 2Z9TA 2P4AB 4Y5YA 3TO2A 5J0BA 1RZJC 4MSWA 4EBQH 1MCBA 3RWDA 4X9HA 3ZO0A 5F7FA 43CAB 4HKZB 4PRPD 5GJTL 5MHSE 3LN4A 4WUUD 1IC4H 4Y1AB 5JIPA 3ZE0E 2D3VA 1LDPH 3U46A 5HHXH 3SCMA 4NYLB 1BQLL 4X6CE 1M7DB 2GT9B 5H94B 3FKUS 2IPKA 4QWWC 1S7VA 2ZUVA 1FFQA 3BDXA 4MA3B 3MR9B 2HRLA 5T3ZE 1R5VB 5JW3H 1JNJA 4NHCH 3S36L 4NZRL 4M6OL 4JFDE 2IFGA 3GSNH 1U2CA 3QQ4A 4LLMB 3A6OA 4OGXL 2K7PA 4PJFA 1EEQA 3RX7A 1SJHB 4U1NA 3HS0A 1MHCB 4JEGB 5BMFL 2FR4B 1MHEA 5GS2H 1YJDL 3EO1B 3QO0A 4PJAB 2HH0L 3HE7A 1AXTL 1I3VA 3QFDB 2XN9B 4OZIF 2XWBA 4LGPB 4JANA 4YHLH 1HYSC 1XH3B 1FLRL 3OG6B 4PJCA 3T0ED 4HUWA 3CMGA 1RAMA 1NANI 5FECB 1CTNA 2R1WA 3ARPA 4FFWD 3O9WC 3Q0HA 5BVPH 4UTAH 3V0WL 2NY6B 4M4PA 2ZUQB 4MA1C 4HUMB 1MIEL 4KRPD 1S7QB 1RZKC 3HPJB 3HCVB 4YGVB 2Y07L 5KVDH 2BNQB 4KUZH 2GJZA 5FM4A 1GGCH 1AD0B 4IJ3B 2OQJB 1AFVL 1WT5C 2Y25A 2X1QA 3PGCA 2KDGA 2VLMD 4NQTA 5I8EA 4J2XA 2EKSB 4K7FB 4NQVB 1IGYA 5J9PA 2DIBA 2EYSA 1S9VA 1YEFH 4HULB 2OTUB 4F7TA 3EJZD 4UMGA 3ZKMD 4RIRB 1LE5B 4UOJA 4Y4FA 2W65B 5TF1L 5F88B 3CFDB 5IVOA 3B3IB 4AJ0A 1NFDE 2KKQA 1KEML 5TPWH 1MIMH 3L1OL 5D7JD 3GSNA 2YRZA 4FQHB 1NDMA 5AZ2L 1F6AA 4CVUA 5DMYA 1F58L 3P9WB 1ZA3B 3F8UB 5EU3B 3KPSD 4IDJL 3DX8B 4DUXA 4QOKA 3BJLA 3K80A 1MF2H 4C56E 4OKDA 3VFUB 3ZDXE 5FUOH 3CSGA 4B41A 4EOWL 1LE9A 1CGXA 1P7QD 4QTIL 4V1DA 2Y1VA 3TN0D 3QA3B 4L4VD 8FABB 2VSDA 4HUXA 2E7LC 4X80H 3MV8B 1CG9B 4AK1A 3QDAA 4HJGB 1TENA 3IU4L 3DLQR 2IBZX 4PPTA 3TM6A 1CVRA 3KPQB 1HDMB 2PCPA 2V2TA 2HLFD 1A7NH 4P48A 1RUQH 3A67H 2X10A 4LSUL 1BIIB 2N1KA 3KYNA 4PJ7F 2A9NL 1AP2A 1Q72H 2X4OB 5ALBL 2B1HL 4FFWC 4YHNB 3L7FB 3O8XD 1GGIL 5KAQF 5F70A 2A6KA 1BAFH 4KRPC 1EUTA 1FIEA 1NMCB 4JY4A 4OZGB 1F4HA 4LSPH 1WC7B 4Y16D 2CXKA 3LCYA 5T5FH 2CKBA 1Q1JL 1LO3L 2P5WE 2YPLA 3SGDH 4H1LA 3B9AA 4ZO6A 2XWJB 5J12C 5K9JL 4HDIA 2P24B 4U1HB 3MGAA 4U2YA 4WO4D 2YD2A 4P46D 5C8JA 1A9BB 2A73B 4HUKB 3ULVF 2EDYA 3EJZC 3S37X 5CMAB 1BLNB 5KZCD 5B38A 1MJ7L 3I85A 1KJMA 1HKLL 3TO2B 4Y5YB 5I71B 4MSWB 3RWDB 3OZ9L 5I1DA 4QGYA 2FO4A 5D7JC 4M61A 4EQ2A 3SPVB 2WK2A 3CDCA 3LN4B 1RUPH 1ZEAL 1MCSA 3PWLA 4NM8H 2AV7A 5LVEA 1GC1L 3U46B 3FFDA 4FOMA 2OTPA 1DFBL 2IG2L 4D2NA 3SCMB 3T04D 2B8OT 1A5FH 1LO0H 2IPKB 2PN5A 3I9GH 3PQYA 4PJDA 1S7VB 1H9VA 3N85L 1C1EL 4MJIE 4URTB 2V7HA 3T0AA 4XT1C 1GRWA 1LP9A 4F3FA 5SX4H 4BZ2H 5D71H 4DGIH 1OHQA 1CFNA 3QQ4B 4PJFB 1QNZH 4U1NB 3TCLA 3HS0B 5FGCE 1Y6NR 4GAGH 1MHEB 1CU4H 3QO0B 4PY8I 1F2XK 4PYGA 3HE7B 3K1KC 4IRJD 1K2DB 3WIFA 2XWBB 3UBXI 4JANB 5ITBL 2YUWA 1WF5A 4GKNA 4PJCB 3O8XC 1U3JA 4NO0D 4DK6A 4D9QD 4XXCA 1OGAE 4KK5D 4WTZA 2GITA 3BRDA 4OM0L 2FHFA 2DTMH 3DXAE 1IT9L 1F4WH 2R1WB 1CLYH 1YZZA 5HTSA 5ABDE 1JZ5A 1EHLL 3JVGA 3VCLA 4KHXL 4K9EC 1DTUA 2YKLL 2WUCH 2MWCA 3QR2A 4LDLB 4XMLL 5HHVL 1A7PL 2GJZB 3QWRD 1G0XA 3S97C 4N68A 4P9HL 4WO4C 1RHHA 4P46C 3BO8A 4HIXH 5CGMA 3O6ML 4X7CC 4OGYH 5I8EB 1IGYB 5J9PB 2EYSB 1PEZA 1S9VB 4OM1L 1EO5A 1T5WA 1A6WH 2YK1L 1LILA 4F7TB 3VD7A 5GRUL 4Y4FB 5JPMB 2ZCKH 1JTTA 2ZUTA 3TWCH 1MPAH 3JXAA 4QRPD 4NQEE 1P6AB 3GSNB 2QSVA 3BIAX 1NDMB 3QDGA 1F6AB 3CNKA 3MXVL 2JJTA 4P5TA 5CCKL 3GMOA 2UUDH 3KPPA 4QOKB 1F42A 4U7KA 5L2JA 1LE9B 4FTVA 2DMCA 3S3JA 4V1DB 1JF5A 4QTHA 2UVEA 4JFZL 4QXGL 5C0EA 3A6CH 4XCFH 5F8QC 4HUXB 2ADJA 2BOCA 5DEGA 2VDKH 3NPZB 2UV3A 3H9YA 4P2QD 1F3DH 4IRJC 5K9KA 2X1WL 5GS1C 4U33A 1V7NH 4JZJA 2LVEA 2PCPB 2V2TB 4GUPA 3KLSA 1A22B 1KTLA 3FONA 3WFZA 1T7VA 3LKSA 5GS0D 3QO1A 1JPSH 3OKOA 1Z3GH 4KK5C 3U7WL 4YBLB 5DMIH 4AEHL 5IB3A 3TIDA 1IC5H 3R4DA 3P4OA 1ZHLA 2A6KB 4IOSD 4S1DC 1KELL 3U4EA 4JY4B 5GRVK 5CZVH 3ZDZE 5EIQA 5FIEA 2EE2A 1DANT 2CKBB 2XTJD 4Q97A 2J4WH 3ARED 3CXHJ 4RGNE 5F1NA 5IM7A 2UZYB 4Z7UA 4WUKH 1JYXA 1I9IL 2YPLB 4H1LB 4FFVD 2W9EH 5KANG 4LLQA 1E6JL 2JJUA 4LFHD 4JHZA 4HDIB 4JFHE 2X4SA 4K3JH 4M9OA 4X4ZA 3P0VL 3UTTE 5C8JB 1H8OA 2NXZB 3WNNA 3OAYH 4TULH 4I9WD 4LVOB 2VN4A 4PGBA 4WI4A 5B38B 5F7NC 1KJMB 1JWMA 4CDGC 3FQXA 1I85A 3N1MC 3QAZB 3BISA 5I1DB 2FO4B 3FO0L 1BX2A 1D6EA 3ARSA 1T5XA 4XP4H 4M61B 5GGSY 1I3GL 1RZFL 4MB3A 1OAZH 1FYTA 2H45A 4U05A 3PWLB 4OLWH 2AXJA 2E8ZA 2QQKH 1L0QA 2AV7B 1UM6H 3FFDB 3VFPA 4AEIL 3KPNB 4ZFZA 3T2NH 1A6TB 1X5XA 3TBTB 4LVHC 3QJFA 2B7DT 1MCOH 4PJDB 3PQYB 1DBAL 3W39A 1U8QA 3QUMH 4JG1L 2V7HB 2X40A 4ZAKD 1LP9B 3DROA 3QIWC 3JWDH 4F3FB 1TDQA 1MWAL 3GI9L 1OTUD 2EO1A 3VWJD 5I75B 2D03H 3VG9B 1CFNB 1T89A 4JCMA 3HI5H 4MA8H 3WIIL 3TCLB 4GRLD 1D6VL 1MAMH 2W07A 1LO4L 4GMSH 3NAAH 1NGYA 3EAKA 3FJTA 1OQOA 4GW4A 1OF2A 1FGNL 2AEQL 3WIFB 4O2FA 5GS0C 3MA9L 5D7KD 1TJIH 3WNOA 2A1WL 2FBJL 2GY5A 3OB8A 4GKNB 1OAQL 5IFAL 5HI3D 1JPST 1GSMA 4WIQA 5LQBH 4OZHA 1A2YA 2A83A 4JY5H 2GITB 4S1QH 1MHPH 5FDYA 1BVZA 3AREC 3VCLB 2I27N 2YXMA 5E2UL 4Z18A 4XBGA 2NX5A 4FFVC 2ESVA 3MJ7A 5T1MB 3GIZL 1YEJL 1RHHB 3HB3D 4DQOH 3BO8B 3BYTA 2R69H 5IVNA 1CICD 4ONFH 3L5XH 3IDXL 4Y19A 1QSEE 4G80A 5GZND 5I1JL 2PTUA 3U6RA 3VH8G 2E6JA 3K4AA 1T5WB 5BV7B 1T66C 3WFCH 1NCBH 1MAKA 4M93B 1JPFA 3TJHD 4XP1L 4DOHB 1IBGL 3JV4A 1IM3A 2X4NA 4NP4L 3DUSA 2GJ6A 3KLAA 5CD5C 1I7RA 2X44D 4DKEL 2AJUL 1GGTA 1BF2A 4ZUTA 3QDGB 4KVCL 5LGJA 3BKMH 4K23H 4P5TB 5IESH 5KSBF 5KVMC 5L88L 1S7WA 3GMOB 3KPPB 5F6IC 3DURA 2DKMA 2ZJSH 4FZEH 5L2JB 3Q48A 4FTVB 1UXWA 1W72L 4ZAKC 4QTHB 5DEZA 4RAVA 3RZCA 1HSBA 1OTUC 4JB9L 3VD5A 5C0EB 5FUCE 4FA8A 2ADJB 2BOCB 5DEGB 2W1NA 3BQUD 2G5BA 2OLDA 4R4ND 4OLYL 4NQDE 3ULUC 1E4KC 4UILH 5EU5B 4JKMA 1ZE3C 5K9KB 5HDQH 1FFPA 4HC1H 4ZOCA 3QIBD 1KPVA 1WGOA 4GUPB 4HS3B 3FONB 5HI3C 1OT1A 4TOYL 3ZE2E 3LKSB 3CFBA 3QO1B 3OKOB 3MV7D 1JE6A 5EUOA 3LKNA 5IB3B 1FZMA 3TIDB 1UA6L 3P4OB 1ZHLB 3CCHA 3O45A 5FYKH 1JYWA 3BKCL 4JO4L 4JDVA 2AP2A 3D39A 1T2QH 4IRZL 3U4EB 3UCRA 1SVZA 2PYEE 5JMRA 5FK9A 2WIIA 5F1NB 5IM7B 4Z7UB 3HB3C 4CJ0A 5DC9B 5ISZA 2NYYD 4UT6L 5IK3A 4LLQB 2X4SB 4K55A 5FO7A 5CEXA 1UM5L 3TNMA 1KCLA 4XPBH 3UO1L 4I48A 1R5WA 5IJKA 2CIIA 4GRWF 2F8OA 1QA9A 4QT5A 1CGSL 3P11H 4HK3N 4H8WC 4PGBB 5JHLH 1QZ1A 4M7JH 1IGCH 1JWMB 1UB5A 4HKBA 3FQXB 3O3BA 4YXKH 4HZAA 1BVKA 1DSFH 4GH7B 4XCCH 1BX2B 1D6EB 5IFJA 3MV11 3CD4A 1T5XB 4MAUH 3WJLA 2JKXA 5F3HB 5C86A 2YSSA 1B4JH 1FYTB 3IDNA 3MJ6A 1YYMH 3VFPB 5ITFA 4HC1A 4ZFZB 3QJFB 2OS7A 2YRPA 4G3YL 2EEDA 4PJHA 2P46B 2X89D 2V2WA 3W39B 1U8QB 4MMZC 1EHNA 1IVLA 1WEJH 3WXWH 3HHRB 4KK9D 3BQUC 3DROB 1KBGL 5D5ME 2VAAA 4JFDA 3ZKQD 1G9EA 4BJLA 5HYJE 4WWKC 5K33A 3OAUL 2BY2A 3IFLL 3QDMA 3QIBC 2VZ3A 3EO0A 4TVSa 5GJSH 3SEPA 1NGYB 4WFED 3KPRE 3LH2L 4JM2F 4YWGH 3MCG1 4GW4B 1OF2B 4OFIA 4XWGL 4O2FB 2JTDA 4L3ED 5BS0E 5C07A 1G9MC 3SJVA 4OZHB 2A83B 4FNLH 4KH2A 4NBXB 1H8NA 3FB5A 4Z5RA 1JGLH 3P4NA 5ESVA 1FAKT 4U6YB 1P4IH 2NYYC 3HZMA 3ORJA 4XBGB 1IEBA 2NX5B 2FD6L 1W0VA 2ESVB 3D1MC 3MJ7B 1KN4H 4QRRE 2FGWL 3VFTA 5DXWA 2BC4A 5H2BA 5T33H 5T3XE 1FNLA 2BVQA 1KB9K 5CJOH 4CNIA 4Y19B 1JN6A 1DEDA 4G80B 4L4JA 3U9PL 1OP5K 4QY8B 5DLMH 3WFEL 3BD5A 3U6RB 3OKLA 5JW4Q 3CX2A 1CFQA 4NOBA 1NAKH 1NCUA 1ZANL 1UT9A 3QFJE 4YUEH 1JPFB 1L6XA 5JHDB 4N1EA 1IM3B 2X4NB 3DUSB 2GJ6B 3KLAB 1NFDA 1I7RB 3MBEC 2NNAA 1G7JA 2OL3L 1FRGH 4ZUTB 5LGJB 4JFFE 1T83A 1ZHKA 3MRQA 2QHRH 5CZKA 4D3CH 3UZVB 1FNAA 1IAIH 2DLTA 2NY0C 1S7WB 1X9QA 3DURB 1KB9J 1JNNH 4NQSA 4Q74A 3TA3D 3W5MA 3MRGA 1TIUA 3CZJA 1AD9A 1UXWB 3QCUH 4N8PA 5I1HL 4RAVB 1HSBB 1SMOA 5GGVY 2ADIA 1ZTXH 2WUBL 3NCBB 2NXYC 1MFAL 1NSNH 2WLYA 2VZOA 2G5BB 4LHUD 2YN3A 1JBJA 4YDLC 4OCYL 2X05A 2DQJL 5E5MA 3QUYA 1FFPB 2DQEH 2HRPL 1J0JA 4K9EL 1KPVB 5DZLA 4Y8AA 5JIHA 3MREA 1U8OA 4X83A 1O0VA 5BXFA 5JOEA 1DL7L 3CX5J 4Q9BA 3CFBB 4M5ZH 4JPIA 3QJHA 5EUOB 3LKNB 4CDHA 1FZMB 2YPVH 3PF2A 3CCHB 3C5ZA 3O45B 5B8CB 1FE8H 4J4PC 1RIVH 3QUZB 4JDVB 4LASL 3D39B 3WHXB 4B53A 3FRPA 3BI9X 3QQ9D 2VLKE 1ADQL 3DBXA 3HC4L 3WXVL 1H3PL 1KIPA 5FK9B 1HILA 2J88H 2WIIB 3S96A 5EOQL 2ED7A 1OTTC 3CFKB 4OD1L 5ISZB 1CT8A 2FECI 5IK3B 1CGWA 1JHKH 1H8SA 2ED9A 5DHYA 4U3XA 3AXLA 1OP3K 3WIHL 5CEXB 3TNMB 3ZYIA 4LCCA 3WDJA 2AW2A 4NC2B 4I48B 1A7RH 1NCCL 1R5WB 2VR5A 4F9PC 3MLWH 4TTDD 2DMKA 4OCRH 3RIAK 1QA9B 4QT5B 2CJUH 4QHLA 1HIML 1A7OH 3ARVA 3K74B 1BD2D 4LEXL 2G5RA 1UB5B 4HKBB 1T0MA 4JO1H 2LVCA 3LPGA 5AWNL 3O3BB 1OP5H 1BVKB 5IROA 4KDTA 4MLIA 3C6LA 5SWQA 5IFJB 1QBBA 1IILE 1INQA 4K7PX 4PBVC 2R29L 5EU6A 3ILPA 2YSSB 3IDNB 5FYKU 1BJMA 2W0LA 1G6RL 5ITFB 3TA3C 1ZOXA 4R97B 3GJFA 2FHCA 1BGXH 1U3ZA 5I73B 4X6CB 4ELME 4PJHB 1C7SA 1DQLL 2V2WB 3QHZL 5CILL 1CS6A 1FL6A 1FIGH 5MI0C 5D7LD 2MMXA 3INUH 1U91A 1XGYH 4HFUH 2VAAB 4JFDB 3ZKXB 5IW6A 4PLKC 4M1CD 12E8H 1GGBH 3KLHC 1P7HL 4LSTL 3AU1A 1KTDA 2UY7A 4N90D 3QDMB 5CZXD 2ARWA 3EO0B 4XAKD 3GSUA 3O4OC 4XPHH 1KULA 1OCWH 5I8OL 5FA3A 1VFOA 1VFUA 3DX7A 4ODXA 3STLA 1IL1A 4F37F 5C07B 1OQXA 1DBML 3SJVB 4LRNH 5HGAA 1EEUA 3VXMA 1U93A 3BE1H 3FB5B 3QQ9C 4XWOD 3SGJA 1U8MA 1K4DA 3QI9D 4Z5RB 3P4NB 1NGZA 3S36H 2EDJA 5ESVB 4M6OH 4M1GH 3D3VD 5IVXE 3HZMB 4GBXD 2EKJA 1IEBB 3SGEH 1KPUA 1M05A 5GSVA 1W0VB 35C8H 1CE6A 3GMNA 3NIGE 5BMFH 1QFWI 3VFTB 2VWEE 3SOBL 2BC4B 3O2DL 5H2BB 1U3HD 2BDNL 2XKUA 2BVQB 3DHJA 1AXTH 5GQBA 4CNIB 4IRSD 4TTDC 1CXEA 1JN6B 1ORSA 2AERT 4PRPE 1QR4A 3OKLB 1IGJA 2BOBA 5GRJL 2ORBL 3SDXF 1CFQB 4WUUE 1FLRH 1YMHA 1RZIA 4ODBD 5GISL 3GKWH 1MQKL 1H3UA 1HINL 3P3YA 4LMQE 1EZVY 2P42B 1F6FB 4X7SL 1NFDB 2NNAB 2YXFA 2QHLA 1G7JB 4ETQA 5DRXA 1ZHKB 4BELD 2CMRL 3RPIA 1BFOA 4J3XA 4FZ8L 1BFSA 4NQSB 1C5BL 3MYJA 2X9WA 3MRGB 3V52H 1AD9B 1CDBA 3IFPA 25C8L 4CAGA 3WD5L 1IEHA 2ADIB 4PRHD 2QQQA 1QD0A 4XNZB 3AY4C 5T1LD 1ZAGA 4W68A 5CZXC 1J8HE 3UBXG 4KDWA 3T0EE 5TF1H 5E5MB 3SDDA 2AK1L 3RBSA 4WRLA 3QUYB 1HCFX 4XRCA 5B3NA 4Q9QL 2IAMA 1TVBA 1F58H 3LRSA 3DMMA 3MREB 1U8OB 5BXFB 1T0PB 4CUCA 3QNYA 4L8SA 4CL7A 4JPIB 3WS6A 3F7RA 4OSUL 3C5ZB 3EDFA 2D0GA 3MOQA 5K93A 2NY2D 2VLME 3F7PC 4LHJB 1ED3A 2DQDH 3H9HA 2WSKA 3CVIH 2X6MA 5TQ2L 2Q1EA 3DBXB 3RWIB 3UYRL 2YUZA 4O2CA 1AXSA 1HILB 3QIUC 3S96B 3ULVD 1EGJH 3PWPD 1CT8B 3IU4H 1U3HC 1NMAH 1RI8A 4ELKA 5DHYB 3F7VA 4GW1B 5GIRA 4M7KH 3AXLB 4HQQL 2LU7A 4XVUD 4JVUA 3PWVA 2DTSA 2HFGL 2ZCLH 3P4MA 2EYTA 2D7NA 4LCIL 3DARA 3MXWL 4LSUH 5L6YL 4IIQA 4QHLB 2B1HH 3KPSE 2EIZA 1T0MB 3RDTA 1MRFL 2CLRA 2BRQA 4MQXC 5EZOH 5JZ7D 3E1F1 3C6LB 5SWQB 2GFBA 4J3SA 3T3ME 2EDFA 1INQB 4YO0A 4I3RL 1R24A 2CDFA 4DFHA 5EU6B 3ILPB 1Q1JH 4L4VE 4U49A 1C08A 1LO3H 4GSDL 2VERN 3FAXA 4BZ1H 5SV3A 3GJFB 3ZDXF 1KNOA 5EORL 1XFPA 3Q2CA 2BNUA 3LV3A 1DQML 3TBYA 2AJ3A 1FL6B 3W9EA 5IHUL 1JMZA 4OF6A 3FMGH 1KC5L 3I6LD 1U91B 1CLZL 1MJ7H 2CQVA 3OKYA 5IW6B 1HKLH 1KCRL 2EH8L 4ZTOL 5EG6C 5D7IE 3AU1B 1RD6A 5GGUA 1KTDB 4Z77A 1Q0YH 3GSUB 3U36A 3WNMA 5CHNA 2FWOA 4U1LB 3VD4A 1ZEAH 5FA3B 5SWSA 4YE4L 2D4FA 1DFBH 3DX7B 5I74C 2IG2H 5KJRL 4H1LG 3O0RH 3STLB 1GHFH 1TQBC 4LVNB 1WLHA 3WO4C 2NY2C 3BVNA 4WI7A 4ZSOA 5HGAB 1XGQA 2GYSA 3VXMB 1U93B 5J06A 2AABL 2AJYL 5FHAH 3D0LA 1U8MB 1K4DB 5GGRA 1OAUH 5CLWA 1NGZB 2CK0H 4H8WL 2DAVA 4W6YB 2VMFA 4KFZC 3MJ9L 5B38G 1KPUB 1M05B 5GSVB 3GMNB 1CE6B 4R4FL 1MLBA 2HFFA 4PJ8A 3O3UN 3AB0B 5C9JA 4E5XA 3RWGB 4BK4A 3L9RA 3GMPA 4L9LC 3OJ2C 3WKNA 4KGLA 1IGJB 2BOBB 5ITBH 1EDQA 1HHJA 2W9DL 4IMLA 5F7MC 1YMHB 5JZ7C 1FH5H 2J8UF 1RZIB 3DOSA 4YHKL 3S98A 4PB0H 1FG9C 1IT9H 5DF0A 3MUGA 4GMTH 1A02N 2B20A 1QHOA 4ETQB 3C8KA 5C09A 4OLXL 3UJTH 2KQMA 1IE5A 3RPIB 3QG7L 1DQJA 1BFOB 8CGTA 4D8PA 1KGCD 1FNSL 4EEEA 3MYJB 3O6MH 3TJEH 4E41A 5EZIH 4H20L 3IFPB 4LPVA 5ADPL 4G8FA 5DO2D 1VPOL 1A6VL 2DL2A 3QP3A 1FC2D 4CBPA 2FEEL 1OGTA 3VA2C 5EBWA 5ADOH 2IALA 3W11C 1P9MC 4WTZG 3BUTA 1FHGA 2EE3A 3EDJA 3SDDB 1DR9A 1MLCA 4J7RA 2O61A 2OMNA 4XRCB 4TN9A 2CD0A 2YD9A 4TVPD 2IAMB 2DDQH 1TVBB 3LRSB 3DMMB 3MXVH 4JO2L 2D9QB 2VXVH 1X5HA 4MB4A 3QNYB 4JHWH 4L8SB 3WFDH 2Z92A 1I7UA 3QBTB 2EICA 2D7PA 3CFIC 5KG9A 3SQBA 4YHOH 1ED3B 4RMVA 4JFZH 3H9HB 4QXGH 5I1IL 4MLSA 1V3KA 2XQBL 1FL5A 4O2CB 1AXSB 4O58H 2DWEA 5A43C 4RGNB 4LOUD 1ZLUK 3P30L 4UOW1 4ELKB 3F7VB 1QLEL 4OKVA 5GIRB 1CI5A 4WCYL 1G9NL 5IHZA 4CADA 1JYVA 1S5IH 3PWVB 3VRJA 2H32H 5TE7L 3P4MB 4QRPE 5DYOA 2EYTB 2ZUWA 3F65A 3KVQA 4IIQB 2X70A 3U7WH 5T1KA 4AIZA 2EIZB 4U1KA 4NJ9H 4GXUM 3RDTB 2CLRB 4HIHA 3DVGA 2APFA 2MPAH 2GFBB 4YO0B 1MELA 5L9DL 2AGJH 1R24B 2CDFB 2OJEA 5ACLA 1GIGL 5E2VH 1C08B 3TBVA 2RR3A 4YK4C 5D1ZA 2ZPKL 3T09A 5LJYH 3AS1A 4MJ5A 2J7LA 4I0PA 1E6JH 1NGWA 4KROD 1KNOB 1YUHA 3O2VH 3OAZK 4P2QE 3P0VH 4MJ2A 1V5JA 1RVFH 5DO2C 2BNUB 3LV3B 2KPNA 3TBYB 4Z7NE 2AJ3B 3AUVA 3I6GA 3W9EB 3MBXL 1RJYA 2DI7A 5LWYL 2R8SH 2HAZA 4HH8A 5HYJA 3NCCB 2J5LB 3V7AE 5GGUB 5DSCA 4Z77B 2XWTA 3T0DA 1PFCA 2JCCF 3BP4A 3U36B 4NWUH 5CHNB 1I3GH 2YD1A 3WV0A 2FWOB 1I8MA 4HXAL 4YZFE 4HX1A 4WDIB 5LGHH 5SWSB 3RJDA 1M4KA 1F90L 4HMCA 4LDOB 2WQRA 3EYUL 3SQOL 5AYUL 3BVNB 1VGEL 3WJJC 4ZSOB 4M6AA 1XGQB 2H32A 4ORGA 3EJYD 1DBAH 5DJ6A 5AG9A 2EH7L 4RGOL 1SM3L 2NZ9C 4X4YA 5CEZD 3D0LB 5GGRB 2RAMA 5JW4R 3GO1L 2DQGH 4P59H 4G7VH 5DMKA 1YECL 1MWAH 3GI9H 1NAMH 3RTQC 1X5JA 4I9WE 3RGHA 3SBWA 3WIIH 1MLBB 3B9KD 4PJGE 2HFFB 4PJ8B 2X4UA 5C9JB 4I0CC 4X7TA 3L9RB 4ZS7L 3RU8H 2FATL 4QHUA 3GMPB 1FGNH 5MENE 2AEQH 1U9KA 3MA9H 4NPYA 4XC3L 3RNKA 5HYIA 4DGYH 1MREL 3IJHB 4ZFFA 1OAQH 5IFAH 1HHJB 4IMLB 4KRMB 4U0QB 2XY1A 4FQIL 2E7BA 3MQIA 1NGQH 1P5VA 2PR4H 3MUGB 5HI4D 4P23C 3C5SA 5IOPB 1B88A 1MFDH 4JFPA 4A2MA 1AH1A 3D0VA 3C8KB 3NOIA 1KCSH 5C09B 1LQSR 2CGRH 1TZIA 4KROC 3LKRA 4C55A 1DQJB 3WMSA 4ORZC 3SE4A 2BNRE 1TQCB 2CRYA 3CAFA 4Z7WA 4D8PB 4KTDL 1QR1A 2H26A 2L0DA 4YEEA 4E41B 5D8JH 5I1JH 5MEQA 4NT6A 4G8FB 4G8GD 3BD4A 4KDVA 1F97A 2GCYA 2VXQL 5D7KE 4P2OA 3OAZH 2N7BA 5D96C 1OGTB 5IEHA 4XP1H 4K3EH 1QFHA 3UROR 5EBWB 1RJZA 4DN3H 1IBGH 2IALB 5DJ8B 3FHQA 3U7YL 4HBQA 2AQ2A 5DD1L 4BH8A 1EZVX 3N1PC 1MLCB 2O61B 1MWAA 3MC0A 3RX5A 1JHLL 1NAMA 5I8CA 2NY1B 1JPGA 2A6IA 1T1YA 1NGPL 1FBIL 5FYLD 3O2WL 1PG7X 5CINH 5L88H 2Z92B 1I7UB 3EJYC 4MNGE 4PJCF 2FJGA 4UBDD 3T77A 2XFXA 4P2CG 3CIQA 1W72H 5KSUB 5KG9B 1MFCH 4M6NH 2P49B 2Z35A 4I2XE 3QG6A 4JB9H 4JGMA 3E6FA 4KQ4L 3GHEL 1BP3B 3PHQA 2I60L 2DWEB 3MV9D 4F2MA 4TUOA 1IKFL 1FFNA 3ARBA 5IHZB 3K0WA 4CADB 4JQIL 2XQYK 3V8OA 3B4NA 3NGBB 2VL5A 3U4BH 1MCKA 4G5ZL 5FKAA 3TT3L 3VRJB 1VEMA 5DYOB 1T7ZA 1OARL 4TOYH 2R0ZH 3TFKD 5EBLA 4FMKA 2X70B 4PJXF 3LEYL 5T1KB 4AIZB 4JZNA 3VI4F 1UA6H 4XPAL 1R3LA 3DO3A 3VDCA 4U1KB 5C0BA 4EN3D 5E00A 2MCPL 2DQIL 4JO4H 3RUGA 3EDEA 4HIHB 3DVGB 4IRZH 1RZ8A 4MNQE 5CGYD 1K4CA 4APQD 4LLVB 1NBQA 1OB1A 3TH2T 3TV3L 2OJEB 5DVOA 5T5NG 2MTPA 4YEFA 3TBVB 5D1ZB 4CMMA 4UT6H 2CUHA 1WWCA 3QCVH 5DHXB 4I0PB 1NGWB 1YUHB 3HI1A 4LSVH 1UM5H 4ONHA 3UO1H 4P4KD 1CD0A 2MCG1 2XZCL 2PXYA 3W9DA 1DQDL 5I1LA 3I6GB 5HYEA 4BM7A 5EPMA 4JM2D 4L1HA 2HT4D 3LRHA 1CGSH 1P4BL 1RJYB 4NFBA 4NRZA 1WSST 4M3JA 5A3ID 4U1GB 1W72A 3MV7E 3FQTA 4GAYA 5HYJB 5FKPA 2XWTB 2WBJD 4OV6F 5L8JB 3BP4B 1YMMD 4YBQD 1FNFA 3KPLA 1I8MB 2XKSA 5DUML 3EO9L 2MSPA 4HX1B 1I9RL 5HHOA 4XPTL 1L9MA 5I16A 4PJ9D 3EDKA 1YNKL 4UBDC 4AL8H 3MLUL 4R8WH 2NY4D 5KSAD 5DD3H 2ERJB 5E4EB 2O5ZH 3MLXL 4ORGB 1NDGA 5DJ6B 4IS6A 3C87A 4X4YB 1VCAA 4KI1A 3TVMD 1KBGH 4PRNA 3SDAD 5DMKB 1KN2L 1QFPA 5C2BH 3MODL 4ZFOL 4Z8FH 3O41A 3RP1A 4O4YL 2VDOL 5E2WH 2VDNL 2Y7QA 4X9IA 3TYFB 2X4UB 3LH2H 4X7TB 4QHUB 2VISA 4XWGH 5ALCL 3TFKC 5TH2A 3GBMH 4NPYB 3RNKB 5F9JA 4ZFFB 1INEL 2VH5H 4PJIF 3M8OL 1BVLA 5AZEL 5CGYC 1P1ZA 4ONGH 5F7EL 3RBGA 2VDQL 5JXEA 3C5SB 3HFML 4JFPB 2FSEA 3VGAC 3D0VB 4J1UA 5E70A 4XP9H 4M48L 1TZIB 1MJJA 3MMEA 3LKRB 5MEOA 3DYMA 4MXWL 1S78D 2FGWH 2L7JA 4Z7VA 4YXLH 4Z7WB 1XGPA 1QR1B 2H26B 2CLVA 4JM2C 2HT4C 4PJDF 3U9PH 5MEQB 3AC0A 4WFEE 4NT6B 1OY3B 4U31A 5I15L 4GS7B 5D5MF 3HLAA 2E9BA 5A3IC 1QBLL 2GCYB 4L3EE 3E2HC 3OB0H 1ZANH 4P2OB 2DQUH 5IEHB 5TE4L 4X7FC 2EDDA 2WBJC 4ERSH 1RJZB 3FT4A 4QRQA 4YBQC 4LGSB 2C1OA 4BH8B 3LN5A 3T0EA 2DLHA 4HUNB 1CD9B 2F8XC 3PWUB 1QOKA 1MWAB 1NAMB 3ULVL 4I13B 5C0DA 5I8CB 1JPGB 4R3SB 2A6IB 1T1YB 2VLLA 1YEHH 2LTQB 2NY4C 5KSAC 3FN9A 4IMKC 2A6DA 4C4KO 4HCRH 2VLJA 1MCEA 4NZTL 5IEKA 2FJGB 3T77B 5E2TL 4OLUL 2XFXB 3TVMC 5I1HH 3WLBA 5B21A 2IGFH 5FCUH 5FHBL 3NCYP 5M7QA 5E56A 2Z35B 1RUMH 3QG6B 3E6FB 2WUBH 2Z4QA 3FN0L 2YD3A 1MFAH 1X6LA 4HKJB 1JNLL 3PHQB 5L2KD 5ESQA 4F2MB 4OCYH 4TUOB 2DQJH 1RV6X 4M7LL 1FFNB 3ARBB 2OK0H 2EIDA 4KI5C 2VL5B 3BWAA 4CW1A 3SO3C 4CU6A 5FKAB 2O26U 2R23A 1L7IH 5F97E 1TNNA 4LF3A 5E6YA 5EBLB 2F58H 3P0YL 4JZNB 3NCJH 4U6XA 1EHXA 4NN6C 2APBA 1R3LB 2JE8A 2R4SH 2GJJA 1WK0A 5C0BB 3QCTL 4PTTA 5E00B 3RUGB 5E03A 4R26L 3WO3B 1RZ8B 3VXUA 4WV1C 1K4CB 3HN3A 4RCAA 4S2SA 1OB1B 1RPQA 1ADQH 3HC4H 5FV2A 3TN0A 1C5DA 15C8L 4L4VA 5EOQH 4MYWB 4JRYA 1GAFL 2GSIB 2FX9L 3C60D 2I5YL 2OL3A 1KIQA 3HI1B 3MLTA 3HZVA 3TC9A 3NCEB 4ONHB 3NCFB 4P2RD 3MFFA 3L7EA 5I1LB 4HG4J 3W9DB 2PXYB 5EPMB 4HCRA 5FGRA 4UDTA 5HYFA 3FQNA 4L8BA 4NRZB 5D2NC 4XCYA 1NEZA 2RIKA 3VJ6B 1LK2A 3EOTL 1W72B 3P2TA 5GRWA 3FQTB 4GAYB 1T0NA 3ECBA 1S7XA 5FKPB 4MHHI 4WI9A 1JJUA 3O8XA 2RFXA 5ICZA 5EULV 3KPLB 1JRHL 2HJKA 4OFDA 5EC1A 3DPBA 4KKBD 5HHOB 4HPOL 5GGSA 4Y16A 5IIEA 1G6RH 4J3OC 1N5AA 5D1QD 1DBJL 1IMHC 3PDOA 3MLPA 5FO8A 3O6KH 1NDGB 1DQLH 1ZHNA 5CILH 4IS6B 3PP4H 4WHYG 5IV2A 1TITA 3KXFD 4TNVK 3MLZL 1RMFL 4PRNB 4WW2A 4X5XA 4TSBL 3X14A 1N4XL 4U6HA 4J3WA 5KSVA 4LSTH 3O41B 2D0FA 2HKFH 4A6YL 3MGTA 4O2EA 1ADQA 4S1RL 2Z8SA 5A2FA 3KJ6H 5EFIA 4PJBA 1R3JA 1MCQA 4RQQA 2VISB 5I8OH 4CU8A 2VLRD 2VXTL 5TH2B 4HBCH 3VW3L 5L0QB 4X5WA 1FVCA 3BHBA 3V6OC 2EDNA 3BT2L 1DBMH 4LMQI 2XA8L 2BHZA 1BVLB 4YR6A 1P1ZB 2VQ1A 3RY6A 3V95A 4DCQA 1CIUA 2FSEB 3PIQA 4K7PL 4YC2B 5D7LE 3IAGC 2BSSA 3ZLQC 4J1UB 5IT2H 4L29A 5DRZA 2QQNH 1MJJB 4OZIE 3MMEB 3C60C 1VENA 5MEOB 5I19L 2DYPA 4C57C 4ELMF 4Z7VB 3O2DH 2VZUA 2HKHL 1I9EA 1RZGA 1IKNA 1KCUL 4TVPL 1XGPB 2JELL 4N90E 4X4MA 5BCAA 5AUMA 2CLVB 3QEUA 3U9UA 4XAKE 1G6RA 2OZ4H 3MX0A 2QADD 5GRJH 2ORBH 5I17A 1WISA 2BHYA 3HLAB 4X6DE 4G6MH 4NNYA 3ALWA 4ODSL 1FZJA 4OIAA 3RHWK 4LU5L 2R0LL 3FT4B 1MQKH 2ITCA 1JFQL 4QRQB 4NO0A 2C1OB 1HINH 2PETA 1I1FA 4UV7L 3T0EB 4KKBC 4GG6A 4Y2DD 4PY7A 5C0DB 4OAWA 4FABL 2CIKA 2VLLB 2IQ9L 1SJEA 4KRPB 2LAGB 1SEQH 2CMRH 2H1PL 4Y4HA 1MFEL 2VLJB 5IEKB 3IDJA 3QWRA 2VAJA 4F58L 3WEXA 3QQNA 4OZHF 5E6ID 3ARWA 4RNRB 25C8H 2FGZA 3WLBB 2H2SC 4E42A 3TZVD 1CFVH 4DFIA 4J6RH 4EKXA 4K2UL 2Z4QB 1T3FA 1EVUA 3V6ZA 3DETD 3NIGF 4OBSA 3IXTA 5ESQB 3LS4L 4HJJL 1SYVA 3VWKD 1H5BA 2O93L 1SJVA 4Q9QH 2HMID 3BWAB 4NZUL 4CW1B 1SJXA 3AM8A 4GFTB 2R23B 3T3PE 4QRPA 3F5WA 5SWZE 4LF3B 2LV4A 5IQ7H 3MUY1 3L3DA 3O2DA 5TDOA 5LBSL 4U6XB 5C08A 2JK5A 3CDGA 4OSUH 3LDBC 2HLAA 3H7BA 4PTTB 2OZ4A 4C56D 4NQCD 2ICWJ 4Q6IC 3VXUB 4YHIB 3G08A 4S2SB 4KKLD 1JHTA 2MQ0A 2RJMA 2AEIT 3UYRH 3Q6GL 4LSQH 3TN0B 1C5DB 4L4VB 4PRHE 3SGKA 4PUBH 2VXSH 2C4XA 1W8OA 5HD8D 4KJYA 2OL3B 1KIQB 4HQQH 4P2QA 1XIWC 3MLTB 1YPZE 3HZVB 4HWUA 4MXVF 5JQ6L 2ZG1A 3MFFB 1CIDA 2RGSA 3L7EB 4ZNEE 4LCIH 1U8HA 3MXWH 1CBVH 4UDTB 1T1ZA 3FQNB 4L8BB 3P9LA 4XCYB 1DLHA 1NEZB 2DOCA 3LMJL 2GIYA 3R1GL 1LK2B 1HH6A 5CEZL 1T0NB 1MH5B 4Y2DC 1S7XB 3RWFA 2ARJA 3O8XB 2RFXB 5ICZB 3WE6A 2HJKB 4I3RH 5I8KL 3GNMH 2BY3A 2CDEA 2G2RA 4PR5A 5EC1B 4JFXA 5GGSB 1AHWC 4Y16B 5IIEB 3L3KB 4K3DL 1OSPH 1N5AB 3AREA 3TLRA 2W60A 4OGAC 3PDOB 3PWPE 5E6IC 1YEKL 5EUOF 4OI7A 5IGXH 5FO8B 5JORA 3TZVC 1ZHNB 3MLRH 1T6WA 1NBVH 5IV2B 5IHUH 5DFTA 1D9KC 3NMEA 4WO4B 1R3IH 1KC5H 4JCLA 4WI2A 5GZOD 2QL1A 1NH6A 1FO0H 4WW2B 4X6FA 2ENYA 4X5XB 4MS8D 3X14B 1KCRH 4U6HB 3LEVL 5TE6L 5KZCB 3VXSD 3VWKC 2J8HA 4Q2ZA 3MGTB 4KMQA 4O2EB 2HMIC 4G9FA 4D9LH 4MDJA 4F15B 5F3BA 2WZPD 5EFIB 2JJVA 1IGIH 3Q5YA 4PJBB 3RNQA 2WINA 1R3JB 3GMMA 4RQQB 4S11A 3TYGL 3CMOH 1JVKA 4X5WB 1FVCB 4ODVL 3WLWD 3BHBB 4D0BA 4X6BA 1RIUL 3DX6A 2XI9A 2AJSL 1F8TH 4Y1AD 5GGVH 4WEUD 4YR6B 3MLVH 3OG4B 3RA7H 2AABH 3WNKA 4HFWA 3T3MF 2VQ1B 3EGSA 4AMKL 2X4QA 4DCQB 1PZUB 3PIQB 2QTEA 2UZXB 2BSSB 4HIIA 3N1QC 3I6LE 1B0WA 4L29B 4I18C 1BZQK 3Q1SL 5DRZB 1ZLSH 1TFHA 5HD8C 5I1KL 5ANMA 3IKCA 3VWJA 2DYPB 4V2CB 1OLLA 3PV7A 4DW2H 1RZGB 4GRLA 5AUMB 1MQ8A 3U9UB 4PJHF 3D5OF 1G6RB 1LO2L 5BRZA 5BJTA 1DN0A 5I17B 1LNUA 3FQUA 4NNYB 3KYOA 4TNWK 2W9DH 4OZ4A 1FZJB 4N5ED 5D7IF 5D6CA 3RVUD 4YHKH 1OGAD 5J7CC 2ITCB 4NO0B 5A16A 1I1FB 3K2UL 2EDLA 4R90L 4GG6B 1FO0A 4PY7B 4OAWB 4PB9L 3KR3H 1EA9C 2EDQA 1J1XH 2CIKB 3V5KA 1S7TA 4QRUA 4OLXH 1SJEB 3VMPA 5BZDA 4HF5L 3Q6FA 3QG7H 4PLJD 3TF7C 2X42A 4Y4HB 4UIKL 1OPGL 1I7TA 4M43L 3CVHL 1FNSH 3S88L 2ZCHL 3IDJB 3WEXB 2BNQD 4WI8A 1VFAA 3FTGA 1I3RA 4H20H 1T7XA 1CICA 4EI5D 1J0IA 1UJ3C 2YUVA 3OR7A 3UJJL 4E42B 4KKAD 1VPOH 1DZBA 4MS8C 1N6UA 3K8KA 4N0YL 1T3FB 5F9WC 4M8QA 3V6ZB 2NCMA 3VFGL 3IXTB 3AVEA 1FAIL 3ZYOA 4OLZH 5T1DL 1SYVB 2NY5C 1ZSDA 1ZXQA 1H5BB 3MJ9A 4FXLA 3WLWC 4HT1L 4YJZL 1UKSA 5D7SH 4HMDA 1WAAE 4QRPB 3F5WB 1PAMA 4JO2H 1IFHL 3L3DB 5TDOB 2ZZUT 3EHBC 5KS9A 5C08B 2JK5B 5A2IH 1XCQA 2IF7A 3CDGB 2HLAB 1WVZA 2GW5A 3H7BB 3O6FD 5I30H 3G08B 1CFBA 1T21A 2JF1A 5DK0A 1ZHBA 1FORL 5JUEL 1JHTB 5HDOA 3HKFA 3UPCA 4FN0A 4KJYB 1G9NH 3QXAA 4W4OC 4HWBL 4P2QB 1OTSD 3DVIA 2EDKA 1OW0A 1U8HB 4N5EC 5DJ2A 1T1ZB 4TVPE 3RVUC 4CGTA 3P9LB 1DLHB 1QFUL 4NHUA 2EECA 2BJML 1HH6B 4UINL 32C2A 3UAJC 3CFEA 4HLZH 4XAWL 1HHGA 3RWFB 3V0VA 1B6UA 1I9JH 3RVVC 3GM8A 2EDBA 3H42L 2ARJB 1UCBH 2N56A 3FB7A 5K59E 5L9DH 3F7QA 5CP3A 3DRTA 2CDEB 2NY6C 1GIGH 1F4AA 4PLJC 4JFXB 4PR5B 2IPTH 1YA5A 5DT1H 2ZPKH 1JF6A 2XTJB 2YD7A 3AREB 2W60B 1XMWA 1SBSH 2PO6D 4IJ3C 4ZG1A 1OAKL 1C5CL 4EI5C 5JORB 4KKAC 2A74A 2F5AL 3JBG7 3N1FC 3UTTD 1LK3H 2NTSP 3MBXH 1NUNB 4BUGA 4X6FB 2M8XA