1ED7A

Solution structure of the chitin-binding domain of bacillus circulans wl-12 chitinase a1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
AWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHITINASE A1
publication title Solution structure of the chitin-binding domain of Bacillus circulans WL-12 chitinase A1.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 4
structure length 45
sequence length 45
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2000-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 1ed7A00
1E6ZA 1W1TA 4Z2KA 1UR8A 1H0IA 2D49A 1W1YA 3WD0A 4MB4A 1W1VA 4MB5A 1E6NA 3WD4A 4Z2LA 1E15A 3WD2A 1GPFA 1H0GA 1GOIA 4HMEA 1OGGA 4Z2IA 4Z2JA 1E6PA 1E6RA 2RTSA 4MB3A 4TX8A 3WD1A 4HMCA 1O6IA 4Z2HA 1ED7A 3WD3A 1AIWA 1OGBA 4Z2GA 1UR9A 4HMDA 1W1PA
chains in the Genus database with same CATH superfamily
1E6ZA 2Y2MA 4Z2KA 4OJ6A 3WD0A 4NYYA 1W1VA 4MB5A 1YU2A 2JCHA 2Y2PA 3HSHA 4IBKA 2XD1A 2Y2QA 1E15A 2JE5A 4IJEA 3WD2A 4NYUA 1OGGA 2Y2JA 2FN2A 4Z2JA 1E6PA 4IBCA 4TX8A 4OJOA 1W1TA 1CK7A 4IBEA 1W1YA 4NY2A 4MB4A 2Y2GA 3WX7A 4GHLA 4NZ3A 3MQLA 1E6NA 4IJFA 3WD4A 4Z2LA 1EAKA 1H0GA 4HMEA 3FKEA 1L6JA 2RTSA 4IBBA 2Y2OA 1ED7A 4Z2HA 1E8BA 1UR9A 1W1PA 4QNLA 1YU0A 5BPVA 1UR8A 1H0IA 2D49A 2Y2LA 3N3FA 1CXWA 3L2AA 4NZ4A 4IBIA 4IBFA 2Y2KA 3L26A 1H8PA 2BG1A 1GXDA 4OJ5A 3KS8A 1YU1A 1YUEA 1J7MA 4IBJA 1E6RA 3L29A 3WD1A 4HMCA 4OUIA 3WD3A 1OGBA 4IBGA 1YU4A 3M7PA 2FFFB 2Y2NA 3L27A 2UWXA 2IOUA 1QO6A 4NZ1A 4NZ5A 4LG2A 2V5OA 4OJPA 4OJLA 1PDCA 1YU3A 3L28A 1GPFA 1GOIA 2Y2IA 4Z2IA 2XD5A 4IBDA 4MB3A 1KS0A 4GH9A 1O6IA 1E88A 4GHAA 1AIWA 3HONA 2Y2HA 3L25A 4Z2GA 3KS4A 4HMDA
chains in the Genus database with same CATH topology
1E6ZA 1W1TA 4Z2KA 1UR8A 1H0IA 2D49A 1W1YA 3WD0A 4MB4A 1W1VA 4MB5A 1E6NA 3WD4A 4Z2LA 1E15A 3WD2A 1GPFA 1H0GA 1GOIA 4HMEA 1OGGA 4Z2IA 4Z2JA 1E6PA 1E6RA 2RTSA 4MB3A 4TX8A 3WD1A 4HMCA 1O6IA 4Z2HA 1ED7A 3WD3A 1AIWA 1OGBA 4Z2GA 1UR9A 4HMDA 1W1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6Z A;  1W1T A;  4Z2K A;  1UR8 A;  1H0I A;  2D49 A;  1W1Y A;  3WD0 A;  4MB4 A;  1W1V A;  4MB5 A;  1E6N A;  3WD4 A;  4Z2L A;  1E15 A;  3WD2 A;  1GPF A;  1H0G A;  1GOI A;  4HME A;  1OGG A;  4Z2I A;  4Z2J A;  1E6P A;  1E6R A;  2RTS A;  4MB3 A;  4TX8 A;  3WD1 A;  4HMC A;  1O6I A;  4Z2H A;  1ED7 A;  3WD3 A;  1AIW A;  1OGB A;  4Z2G A;  1UR9 A;  4HMD A;  1W1P A; 
#chains in the Genus database with same CATH topology
 1E6Z A;  2Y2M A;  4Z2K A;  4OJ6 A;  3WD0 A;  4NYY A;  1W1V A;  4MB5 A;  1YU2 A;  2JCH A;  2Y2P A;  3HSH A;  4IBK A;  2XD1 A;  2Y2Q A;  1E15 A;  2JE5 A;  4IJE A;  3WD2 A;  4NYU A;  1OGG A;  2Y2J A;  2FN2 A;  4Z2J A;  1E6P A;  4IBC A;  4TX8 A;  4OJO A;  1W1T A;  1CK7 A;  4IBE A;  1W1Y A;  4NY2 A;  4MB4 A;  2Y2G A;  3WX7 A;  4GHL A;  4NZ3 A;  3MQL A;  1E6N A;  4IJF A;  3WD4 A;  4Z2L A;  1EAK A;  1H0G A;  4HME A;  3FKE A;  1L6J A;  2RTS A;  4IBB A;  2Y2O A;  1ED7 A;  4Z2H A;  1E8B A;  1UR9 A;  1W1P A;  4QNL A;  1YU0 A;  5BPV A;  1UR8 A;  1H0I A;  2D49 A;  2Y2L A;  3N3F A;  1CXW A;  3L2A A;  4NZ4 A;  4IBI A;  4IBF A;  2Y2K A;  3L26 A;  1H8P A;  2BG1 A;  1GXD A;  4OJ5 A;  3KS8 A;  1YU1 A;  1YUE A;  1J7M A;  4IBJ A;  1E6R A;  3L29 A;  3WD1 A;  4HMC A;  4OUI A;  3WD3 A;  1OGB A;  4IBG A;  1YU4 A;  3M7P A;  2FFF B;  2Y2N A;  3L27 A;  2UWX A;  2IOU A;  1QO6 A;  4NZ1 A;  4NZ5 A;  4LG2 A;  2V5O A;  4OJP A;  4OJL A;  1PDC A;  1YU3 A;  3L28 A;  1GPF A;  1GOI A;  2Y2I A;  4Z2I A;  2XD5 A;  4IBD A;  4MB3 A;  1KS0 A;  4GH9 A;  1O6I A;  1E88 A;  4GHA A;  1AIW A;  3HON A;  2Y2H A;  3L25 A;  4Z2G A;  3KS4 A;  4HMD A; 
#chains in the Genus database with same CATH homology
 1E6Z A;  1W1T A;  4Z2K A;  1UR8 A;  1H0I A;  2D49 A;  1W1Y A;  3WD0 A;  4MB4 A;  1W1V A;  4MB5 A;  1E6N A;  3WD4 A;  4Z2L A;  1E15 A;  3WD2 A;  1GPF A;  1H0G A;  1GOI A;  4HME A;  1OGG A;  4Z2I A;  4Z2J A;  1E6P A;  1E6R A;  2RTS A;  4MB3 A;  4TX8 A;  3WD1 A;  4HMC A;  1O6I A;  4Z2H A;  1ED7 A;  3WD3 A;  1AIW A;  1OGB A;  4Z2G A;  1UR9 A;  4HMD A;  1W1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...