1EDIA

Staphylococcal protein a e-domain (180), nmr, minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
b'AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL PROTEIN A
molecule tags Immunoglobulin-binding protein
source organism Staphylococcus aureus
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
total genus 19
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ediA00
2B88A 4ZMDA 2ZAEB 2UWJE 1EDKA 1DEEG 4BXLA 2K3RA 1ZW0A 1MFTA 1BDCA 2B87A 3PH0A 2KZIA 4K3AA 1EDIA 1Y47A 2B89A 4MN4C 2B87B 1Q2NA 2QVAA 1U7JA 3MHVA 1LP1B 4WWIA 2KIKA 2RKLA 5K5GB 2OTKE 4NPDA 4GODA 1JM0A 1OVUA 4EYYQ 2WMMA 2R44A 4HJGH 2KUBA 2JWDA 2M5AA 2QRXA 4NPFX 2I8DA 3FXDA 2LXCB 1LT1A 2M5AB 1EDJA 1FC2C 2M0BA 1ZXGA 1EC5A 2LR2A 1EDLA 2KS1B 2P58A 1LP1A 1NVOA 5CBNA 4GOFA 3QWOC 3RGUA 2SPZA 4JBZA 4ASWA 2Q1KA 1OVRA 4CPGA 5C39A 1H0TB 1BDDA 2HR3A 1H0TA 4HKZH 1SS1A 3ZDMA 1X0TA 2KI7B 5EFWB 3FXEA 4NPEA 4HB1A 4KJMA 4K35A 5CBOA 4GOEA 2KZJA 1U7MA 3MZWB 1S3JA 4ZNCA 4ASVA 1JMBA 4IOIH 2LXBA 1OVVA 5DJTB 3S1KA 5DJUB
chains in the Genus database with same CATH superfamily
3P8CE 2K9JB 2FYNB 2K37A 2NPSC 2XDJA 2V7QH 3HE5B 4WY4C 5AW8B 1FOSF 1VQMP 3PJSK 3HD7A 1VQPP 3PTZA 4U3FD 3KDPB 3AE4C 1L0LK 2YIUC 1LT9C 1U57A 1NKNA 3V6IA 1KB9E 2I1KA 2B9BA 2MJZA 1KC8Q 3L75D 5TISE 3MUDC 1AVYA 1JB0J 4W7ZA 2C9NY 2IYOA 3VMYA 1EDKA 1KQGB 3AEDC 1X22A 4RJTA 1FU1A 1NTZE 1Z56A 1P84I 1KB9H 2HLOA 2L5GB 2O01J 1KMIZ 1NTME 1L0NE 2AXTE 3TDKA 4OVNF 3TYYA 1RE3C 3BCCG 2OYIA 1YI2P 1YJNP 2WPSA 2FYNC 1S2EA 1KORA 2KZIA 2XU6A 2YO3A 4H13C 4Y99B 2JWAA 1BE3E 3CCMP 2FYUG 2NPSA 2YMKA 1FOSE 3ABVC 5GTHH 2B87B 5KAIE 1L0NJ 1LT9B 2KSEA 3MTUE 1NGMB 1JCDA 1Q2NA 2IFNA 2OYHA 1QEXA 4OH8B 1PIXA 2ZT9D 1JY3N 3KHUA 1IFNA 3AEEC 5TISH 4WWIA 1BCCD 2KIKA 2N9YB 3CD6P 1OW7A 3QH9A 4W80A 1NTKK 2E42A 4IFDK 3T97B 3CXHE 1Y8AA 3TGUG 2FYUE 1T3UA 3C8VA 3LIDA 3RBXA 2OTKE 1FS0E 4NPDA 1NU1K 1EZVE 1FZAA 3II6A 3L71G 3PP5A 1JM0A 1L4AC 4IFMA 5AW2B 4EYYQ 1JMMA 1IFIA 1LTAC 1PP9G 1YTZT 3A0HH 1HH0A 4D6TG 5KKZB 2BEZF 2YKPA 1URQD 3B71A 3HTKA 1VF5C 1LTBC 1HJBA 2JWDA 3NTNA 2BCCJ 1GTWA 2QRXA 3Q2YA 4IFFA 3CMEP 4WB4A 4IL6E 1BCCE 1X79B 3GHGC 3WU2E 3H1HG 4DJGA 4OGQD 1NU1D 3JCUE 3O6QB 2Z5IA 2QJKB 3B5NA 5APTA 1N73A 2ZT9B 3A0BE 1EQ7A 2M5AB 1EDJA 2Q7CA 3L75G 2C9LY 1FAVA 3T97A 3WU2H 4BRYB 1OW8A 2LR2A 3AE3C 3RK2D 5KKZC 1EDLA 2P58A 1H88A 4KT0J 2XZRA 3QWOC 5AVQB 1E79H 3TGUE 1J1EC 1EZVI 4QMAA 5APSA 5KJ7A 4H44D 1NTMD 3IFMA 3U1CA 5KLVE 1YQ4C 3A0HE 3V4WA 1ZRTD 1OVRA 3L37A 3CCVP 4CPGA 1WMKA 3GMAA 3CL3D 2NRGA 4PV1C 1A02J 2QJKC 1BE3D 1BGYD 1R5SA 2OYOA 3CXHH 1XTGB 4OGQC 1FE6A 4WVZA 2C0XA 2W90A 3WMM0 1H0TB 1LNQA 4OGQB 1L0ND 1QX8A 4JQ0D 4HKZH 1BCCG 1GL2D 2KI7B 1S4XA 2P1JA 1N7SA 5AW4B 1IK9A 1NYHA 1GK6A 1GW3A 4M3LA 2KYVA 3TGUD 2IX7C 1NO4A 2WVRA 1SQVK 3EQ2A 2W6BA 3L71D 3RK2B 4NPEA 4HB1A 1KILE 4JPZB 4L74A 4XE5B 3BRVB 4ZKPA 1J2JB 1NTMJ 5BU5A 1KQSO 3BVHA 3AEGC 2Q3EA 4KJMA 5APUA 3H1JE 4K35A 4D6TD 3H1HE 5APVA 3G4SP 4C7RA 4TT3H 3H1JG 4LLHA 1PPJD 5M1BA 2KZJA 5AVYB 1FBMA 4AQRD 5CJ4A 1K8AQ 5CCGD 3CCJP 1OX3A 3MZWB 5AW6B 2GM4A 3VP8A 2R5BA 4DZOA 4U3FJ 5KAIH 1NU1G 3HD7B 4UB8H 1SQXD 2Q9IA 1SFCA 3OA7A 3L70E 3LW5J 3P8MC 1NH4A 3CWBG 2JO1A 2O1KA 3CMAP 1GL2B 2NZ2A 3WUUA 5B5EE 2QJYC 4GDOA 2MKVA 1QGKB 1GMJA 1SQBJ 1HGVA 4IOIH 4GIFA 2WZ7A 1YJ9P 1IO4A 3EFFK 3H1KJ 2V7QJ 2HG5D 3IR9A 3BASA 1QL2A 3TSIA 3BRTB 1FZGA 1HF9A 1G1IA 3CCQP 1NTMG 1SQXJ 1SQPG 2LKMA 3L70G 2O3JA 3AE2C 5AVTB 2A45I 3H1IE 2H43A 1QL1A 3FWNA 3M9QA 3A5TA 2Z4EA 5CCHD 4XFJA 4GT1A 4H0LD 2ZVOB 5APXA 1BCCJ 2E43A 1H8AA 1ZV8A 2QJYB 1SLQA 1N7SC 1JY3P 1QLED 2E5TA 2JEEA 2RH0A 4JYCA 3HUSC 4KHXA 1S5LH 1LTIC 1LT9A 1ZW0A 2P67A 3HUSB 2FKWB 2E76C 3HRNA 2B87A 2O01H 3B5NC 2KNCA 3LIEA 1HVVA 1HGZA 2HFED 2YXRB 3BATA 3GHGB 3PH0A 3SWFA 2E75C 4MN4C 2KNCB 2ZYGA 4RKUJ 1VQ5P 3V2PA 1KILD 2WWWA 3IF4A 1VQOP 5KTBA 3H1HD 2XNDH 3H1JD 1JY2N 2N9BA 3GG2A 5KJ7C 3RL0C 2K1AA 3L36A 1KILC 2RKLA 3RL0B 2W83C 2A06E 2FBWC 1UIXA 3EFGA 3L71E 4BRYA 1URQA 2YKOA 4H0LB 4XA4A 3AE9C 2FY8A 2XKMA 2YKQA 1CSBA 1ZP0C 3P32A 4GODA 1JO5A 3KZIH 1SP4A 3FWLA 1KILA 4UB6H 3Q5PA 2KS1A 1OW6A 3M0DA 3H1KD 2GA1A 4DT0A 2WSFH 3VMXA 2M5AA 1NTKD 1L4AB 3PLNA 1RH5B 2AEMA 1BE3G 1BGYG 1FJKA 4NPFX 1SQPD 2WT7A 3CXHI 1NTMK 3VN0A 1PP9E 4TLFA 3RK2C 1GU4A 1L0NG 2NPSD 1Q86Q 2BCCD 3H25A 2IZ0A 1M1JC 5E79H 1N7LA 2WPVB 3F5HA 5CCHA 2HODA 1N86A 3A2AA 3E1IA 1SQQE 1MFZA 3P8CD 5KLVK 3G71P 1YJWP 3MUDA 3TK1A 1SFCB 5CBNA 1VL2A 2N1TB 3H1LG 1PGOA 2ZYDA 4D6TJ 4YTPC 1YTZI 1PZQA 3CCUP 3AEFC 4DOJA 3RL0g 3CX5I 2Q1KA 1VQ6P 2BEQD 1LTGC 3GLMA 1SQVD 2IBZE 2IFMA 2FYUK 1PPJG 2K9YA 1VF5B 3KQGA 4N6JA 3H1HJ 1NTZD 1AQ5A 4L75A 5KLVD 5TJHA 2AEJA 1CW5A 4EDFA 1KN7A 2WSFJ 1K9MQ 1SQXG 1H0TA 1SQVE 1NTZJ 1FZBA 2H8PD 2IBZD 3AE5C 3ZDMA 3CWBD 3JCUH 1S1CX 1SFCC 2K88A 1PV3A 3CX5H 3FXEA 4IL6H 3RBZA 1M57D 2GUSA 1PFIA 3P7KA 1PGJA 2QSIA 1JTHB 3OJAB 1KYOD 4WY4D 2PGDA 1N8RQ 1VQ7P 1SFCD 3CPWO 3L72D 2C0WA 1S5LX 3GF7A 3BCCE 1XTCC 2W6JH 3L74E 3I56P 4LC1A 3CCLP 1LTSC 5L8RJ 4WY4A 1RHZB 5B66H 1S9KD 4BWNA 1S5LE 3H1KE 3L70D 3L74G 4O9BA 3D6ZA 3M91A 1U7MA 1LGHB 2I1JA 3WUVA 1VF5D 2QA4P 1GL2A 2E76B 1KB9D 2WSCH 2D2CB 2ITAA 4ZNCA 1CI6A 3AE8C 4ASVA 4L76A 2O1JA 2A45G 1USEA 2HODB 3D71A 1PGQA 2OQQA 2RMZA 1KV4A 1SQBD 2LXBA 1RE4C 4U3FE 1YQ3C 2YXQB 2P7JA 3C9IA 3FGAD 1FDOA 2WITA 4OWFA 2B88A 2JP3A 2VRSA 4WY4B 1LTJC 1AA0A 1EXJA 1ZR4A 1SQXK 1IFJA 3HE4B 1J1DB 1MUUA 3VMZA 1VDFA 2ZAEB 1SQVG 3CC4P 4N3YB 4H44C 4YPCA 2GUVA 2UWJE 3H32B 1LTJA 1AFOA 1NTZG 2QEXP 5BU8B 2Q6QA 2WTYA 2QE7H 1Y9BA 1SQQK 2KLUA 2QM8A 2M8RA 5CHXA 4AYCA 2E76D 1OXZA 2OGUA 3B5ND 1SQBE 3U59A 4YXDC 1OZHA 4I6MC 2K3RA 1YHQP 1Q82Q 1M1KQ 1WT6A 2FYUJ 3F89A 2OARA 1KZUB 1YYCA 3L71J 4R4MA 1DIPA 1SQQG 2FFDA 1EDIA 1Y47A 3H1KG 2B89A 1AQTA 3BCCJ 4RESB 3U1AA 3L73J 1FZCC 1T8ZA 1VQNP 1K05A 2CPBA 3KPEA 3L72G 1NTKG 3MD0A 4PD4D 3WUTA 1RE3A 1W2BO 2QVAA 2JDIH 1JOCA 5KLVJ 1FJPA 2L91A 1ZOYC 1H89A 1U7JA 1MV8A 3MHVA 5AW7B 1JNMA 2W8ZA 1LP1B 3G6EP 2HPCB 3W67A 1SQVJ 2A45H 2JJLA 4EOTA 1K04A 2BCCG 5GTIH 1JY3O 1VQLP 2J58A 3HUSA 1IJDB 2RN0A 4UB6E 2Q5UA 1OVUA 2N1TA 2R5DA 5AW5B 2PFXA 3HE5A 1JUNA 4HJGH 1WRGA 3H1LD 4GKGA 2WT7B 2K9JA 1PPJE 1SQBG 4PV1D 5AVWB 5CCGC 1S72P 1BSHA 3S9OA 3PHLA 2KOGA 3H1IJ 3VTPC 2QM7A 2Y0EA 2A06G 1M1JB 3V4QA 1NAYA 3MGNA 1NWQA 1SQXE 1N73C 3MP7B 2OTJP 2V4HA 3N4XA 3O6QA 1N73B 3FXDA 2LXCB 1LWUA 1LT1A 2P2UA 5KLVG 1M7LA 4I1LA 1M90Q 1FC2C 2IBZG 1ZMEC 3C1LA 1L2PA 2ZVNB 2KS1B 2PP6A 1LP1A 2Y0CA 1YIJP 2HPCA 4GOFA 2ZXXA 3VYIA 1RF0C 1BGYE 4H0LC 3L72J 3SFDC 1R8EA 3ITKA 1FZFA 2SPZA 4JBZA 1X9VA 5CMZA 4ASWA 1RF1B 1URQB 4PV1B 2AEFA 4A7PA 5AVUB 2AXCA 2J5UA 2KLVA 2BASA 3L74D 3OAKA 2H88C 3H1JJ 2QIWA 2IPPA 3HD7D 5AVSB 4Z1MH 1KD1Q 3R2PA 1USDA 4N78E 1Q81Q 1ZRTE 4UB8E 2OYIB 1JEKA 1IK7A 1JY2O 2QJPC 1JTHA 5APQA 2XNXA 2JKVA 1X0TA 1N2DC 2QJPB 1VPCA 5EFWB 3AEAC 1FDIA 1BGYJ 4L73A 1VQ4P 2FFDB 4IL6X 1LTJB 3M9BA 3AE6C 3L73G 2FXPA 3V2QA 1ZR2A 3Q3DA 5KAFE 3LW5H 2Y0DA 1MKMA 2O01N 3RK3C 1URQC 3G9RA 1LJ2A 2WSCJ 3Q5RA 2P10A 3CWBE 2ZJSE 5CBOA 3A7OA 4AUWA 2FXOA 3CI9A 1P84D 4H44B 1L0NK 2CK3H 5E79E 3SWYA 2HYNA 3H1LE 2E74D 1SQBK 2KK7A 3JSVC 3UIAA 4DCKA 1DEBA 3AE1C 2CPSA 1DH3A 4ZKUA 4Y28J 2E5YA 1N7SD 1GDTA 3D6YA 3Q5SA 1EZVD 1GZLA 1FZCA 5AW1B 1A02F 3A3YB 3VOPA 2IZ1A 1SQPJ 3CCSP 1FZCB 3D70A 1M1JA 2Z5HA 1G1JA 1GL2C 1JMBA 2WPRA 5AVZB 5AVRB 1OVVA 3V2NA 3NFQA 1T2KC 1IFMA 1NJIQ 1SQQD 2D2CC 3AEBC 5DJUB 1D7MA 3B8EB 1SQPE 3H1LJ 2QG4A 2KP8A 5AW0B 4ZMDA 1PL5A 2PAJA 2R3CA 5KJ7D 4R4LA 1L4AA 3G3ZA 1P84H 3SFEC 2E74B 4B86A 5AW9B 5AW3B 3SWKA 3L70J 3USSA 3W68A 3H1IG 1AV1A 2G3AA 3IN6A 3KYQA 3L73E 1L0LE 3B4SA 4H13B 1N7SB 3V5BA 2R32A 1JY2P 3CCEP 1DEEG 3Q1MA 2YIUB 2IDBA 3E7KA 3NMDA 4BXLA 5B66E 2WSEJ 1OWAA 1NAFA 1GD2E 1VQ8P 1KTMA 1KFNA 3L75E 1MFTA 4EI2A 3R4YA 1BDCA 3TNUB 3L73D 1L0LD 4RO0A 1RQUA 3TGUJ 3SSUA 3CC7P 4K3AA 1T2KD 1X8YA 1GU5A 3TNUA 1KB9I 4C7NB 2A06D 4WBAA 3A0BH 1IFDA 3H6PA 3N7NA 4I2LC 4C7NA 3AE7C 1R5LA 3GF3A 1MZ9A 3L4FA 3L72E 4JYBA 4W7YA 1RF0A 5KLIC 1BE3J 2NPSB 5GTIE 3RK3E 2R3SA 2J59M 3VMAA 1G2CB 1T6AA 3L75J 4HYTB 3V2RA 4YXWH 1J1DC 5APYA 5K5GB 1NHLA 1GW4A 1Q90D 2PRRA 5CCHC 2KXPB 1SQPK 1SVFA 2BCCE 3E1RA 2N1TD 1UIIA 3PRJA 4H13D 2H89C 4U7JA 1NTKE 5CJ0A 5H2FE 1LWUB 1HUCA 2WMMA 2R44A 5GTHE 1LWUC 1KQLA 1HBWA 2KUBA 2YNYA 3H32A 3M0AA 1SQQJ 1HJ0A 2IBZI 1KYOH 1LTTC 2ZT9C 2OTLP 2Y9YA 3AECC 5B5EH 2OYHC 3GW6A 2W27A 1YITP 2AXTH 2YMYA 3HTKB 4HH2A 4Y99C 2KSJA 2I8DA 5CCGA 1KILB 1NU1J 1KYOI 3M0DC 1ZN5A 2W6AA 4C46A 1K73Q 2ZFCA 1NOHA 3L35A 1OMIA 4EIJA 1NTKJ 2WQYC 3O8ZA 3FX0A 2M0BA 2M3EA 1ZXGA 3H1ID 1KQFB 1EC5A 3RK3B 3RL0D 5APWA 3S4RA 4JF7A 4PD4I 1IZNB 1CI6B 2N1TC 1NVOA 1PP9D 2G8YA 2POHA 1KFMA 2WSSH 5BVZA 5KLIB 3CC2P 1AVOA 1HTLC 2OYHB 3I5CA 1EXIA 3RGUA 3M06A 5KAFH 1DX7A 4N78D 1W5CE 4U3FG 1VQKP 3HD7C 1NU1E 1G2CA 3NXSA 1DD3A 5H2FH 5C39A 5AVXB 3GHGA 3CWBJ 3EWKA 1J1EB 1L4AD 1DD4A 2WSEH 1S9KE 3OW2O 2FFDC 1QVFO 1BDDA 1BSNA 1M56D 2D2CD 2Q3IA 2HR3A 2IYPA 3M9HA 1EZVG 4I7ZB 1RF1C 2E75D 1FDMA 1KYOE 1YBKA 1SS1A 4PJ0H 2FXMA 4D6TE 3BCCD 3L74J 1PGPA 2KB7P 3CLQA 3RK3D 3KZIE 1IC2A 1L0LJ 1RY3A 2FYZA 2FYUD 1RF1A 1IFPA 3CXHD 3TF5A 4PD4E 1E5WA 1NKZB 1VQ9P 5AVVB 1NTZK 2E74C 4PD4H 1AJYA 1TU3F 1JCCA 1RQVA 1PP9J 4GOEA 1Q7YQ 1ZLLA 1OFCX 2JR8A 1T3JA 2WPQA 2YO2A 2XV5A 3CX5E 1W2EA 3K5BA 4I7ZC 3VP9A 1OIPA 2ZXEB 1QVGO 1S3JA 3HE4A 1P84E 2ZYAA 1M8OB 3KXDA 4LGDE 3B5NB 2Y9ZA 2M3BA 1HWTC 3MIWA 2H7HA 3CCRP 3CX5D 2DW3A 2E75B 1FZEA 3I55P 1RE4A 2OYIC 1CZQA 3IAOA 4PJ0E 3JC22 1GK4A 5DJTB 3S1KA 1L0LG
chains in the Genus database with same CATH topology
2B88A 4ZMDA 2ZAEB 2UWJE 1EDKA 1DEEG 4BXLA 2K3RA 1ZW0A 1MFTA 1BDCA 2B87A 3PH0A 2KZIA 4K3AA 1EDIA 1Y47A 2B89A 4MN4C 2B87B 1Q2NA 2QVAA 1U7JA 3MHVA 1LP1B 4WWIA 2KIKA 2RKLA 5K5GB 2OTKE 4NPDA 4GODA 1JM0A 1OVUA 4EYYQ 2WMMA 2R44A 4HJGH 2KUBA 2JWDA 2M5AA 2QRXA 4NPFX 2I8DA 3FXDA 2LXCB 1LT1A 2M5AB 1EDJA 1FC2C 2M0BA 1ZXGA 1EC5A 2LR2A 1EDLA 2KS1B 2P58A 1LP1A 1NVOA 5CBNA 4GOFA 3QWOC 3RGUA 2SPZA 4JBZA 4ASWA 2Q1KA 1OVRA 4CPGA 5C39A 1H0TB 1BDDA 2HR3A 1H0TA 4HKZH 1SS1A 3ZDMA 1X0TA 2KI7B 5EFWB 3FXEA 4NPEA 4HB1A 4KJMA 4K35A 5CBOA 4GOEA 2KZJA 1U7MA 3MZWB 1S3JA 4ZNCA 4ASVA 1JMBA 4IOIH 2LXBA 1OVVA 5DJTB 3S1KA 5DJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B88 A;  4ZMD A;  2ZAE B;  2UWJ E;  1EDK A;  1DEE G;  4BXL A;  2K3R A;  1ZW0 A;  1MFT A;  1BDC A;  2B87 A;  3PH0 A;  2KZI A;  4K3A A;  1EDI A;  1Y47 A;  2B89 A;  4MN4 C;  2B87 B;  1Q2N A;  2QVA A;  1U7J A;  3MHV A;  1LP1 B;  4WWI A;  2KIK A;  2RKL A;  5K5G B;  2OTK E;  4NPD A;  4GOD A;  1JM0 A;  1OVU A;  4EYY Q;  2WMM A;  2R44 A;  4HJG H;  2KUB A;  2JWD A;  2M5A A;  2QRX A;  4NPF X;  2I8D A;  3FXD A;  2LXC B;  1LT1 A;  2M5A B;  1EDJ A;  1FC2 C;  2M0B A;  1ZXG A;  1EC5 A;  2LR2 A;  1EDL A;  2KS1 B;  2P58 A;  1LP1 A;  1NVO A;  5CBN A;  4GOF A;  3QWO C;  3RGU A;  2SPZ A;  4JBZ A;  4ASW A;  2Q1K A;  1OVR A;  4CPG A;  5C39 A;  1H0T B;  1BDD A;  2HR3 A;  1H0T A;  4HKZ H;  1SS1 A;  3ZDM A;  1X0T A;  2KI7 B;  5EFW B;  3FXE A;  4NPE A;  4HB1 A;  4KJM A;  4K35 A;  5CBO A;  4GOE A;  2KZJ A;  1U7M A;  3MZW B;  1S3J A;  4ZNC A;  4ASV A;  1JMB A;  4IOI H;  2LXB A;  1OVV A;  5DJT B;  3S1K A;  5DJU B; 
#chains in the Genus database with same CATH topology
 3P8C E;  2K9J B;  2FYN B;  2K37 A;  2NPS C;  2XDJ A;  2V7Q H;  3HE5 B;  4WY4 C;  5AW8 B;  1FOS F;  1VQM P;  3PJS K;  3HD7 A;  1VQP P;  3PTZ A;  4U3F D;  3KDP B;  3AE4 C;  1L0L K;  2YIU C;  1LT9 C;  1U57 A;  1NKN A;  3V6I A;  1KB9 E;  2I1K A;  2B9B A;  2MJZ A;  1KC8 Q;  3L75 D;  5TIS E;  3MUD C;  1AVY A;  1JB0 J;  4W7Z A;  2C9N Y;  2IYO A;  3VMY A;  1EDK A;  1KQG B;  3AED C;  1X22 A;  4RJT A;  1FU1 A;  1NTZ E;  1Z56 A;  1P84 I;  1KB9 H;  2HLO A;  2L5G B;  2O01 J;  1KMI Z;  1NTM E;  1L0N E;  2AXT E;  3TDK A;  4OVN F;  3TYY A;  1RE3 C;  3BCC G;  2OYI A;  1YI2 P;  1YJN P;  2WPS A;  2FYN C;  1S2E A;  1KOR A;  2KZI A;  2XU6 A;  2YO3 A;  4H13 C;  4Y99 B;  2JWA A;  1BE3 E;  3CCM P;  2FYU G;  2NPS A;  2YMK A;  1FOS E;  3ABV C;  5GTH H;  2B87 B;  5KAI E;  1L0N J;  1LT9 B;  2KSE A;  3MTU E;  1NGM B;  1JCD A;  1Q2N A;  2IFN A;  2OYH A;  1QEX A;  4OH8 B;  1PIX A;  2ZT9 D;  1JY3 N;  3KHU A;  1IFN A;  3AEE C;  5TIS H;  4WWI A;  1BCC D;  2KIK A;  2N9Y B;  3CD6 P;  1OW7 A;  3QH9 A;  4W80 A;  1NTK K;  2E42 A;  4IFD K;  3T97 B;  3CXH E;  1Y8A A;  3TGU G;  2FYU E;  1T3U A;  3C8V A;  3LID A;  3RBX A;  2OTK E;  1FS0 E;  4NPD A;  1NU1 K;  1EZV E;  1FZA A;  3II6 A;  3L71 G;  3PP5 A;  1JM0 A;  1L4A C;  4IFM A;  5AW2 B;  4EYY Q;  1JMM A;  1IFI A;  1LTA C;  1PP9 G;  1YTZ T;  3A0H H;  1HH0 A;  4D6T G;  5KKZ B;  2BEZ F;  2YKP A;  1URQ D;  3B71 A;  3HTK A;  1VF5 C;  1LTB C;  1HJB A;  2JWD A;  3NTN A;  2BCC J;  1GTW A;  2QRX A;  3Q2Y A;  4IFF A;  3CME P;  4WB4 A;  4IL6 E;  1BCC E;  1X79 B;  3GHG C;  3WU2 E;  3H1H G;  4DJG A;  4OGQ D;  1NU1 D;  3JCU E;  3O6Q B;  2Z5I A;  2QJK B;  3B5N A;  5APT A;  1N73 A;  2ZT9 B;  3A0B E;  1EQ7 A;  2M5A B;  1EDJ A;  2Q7C A;  3L75 G;  2C9L Y;  1FAV A;  3T97 A;  3WU2 H;  4BRY B;  1OW8 A;  2LR2 A;  3AE3 C;  3RK2 D;  5KKZ C;  1EDL A;  2P58 A;  1H88 A;  4KT0 J;  2XZR A;  3QWO C;  5AVQ B;  1E79 H;  3TGU E;  1J1E C;  1EZV I;  4QMA A;  5APS A;  5KJ7 A;  4H44 D;  1NTM D;  3IFM A;  3U1C A;  5KLV E;  1YQ4 C;  3A0H E;  3V4W A;  1ZRT D;  1OVR A;  3L37 A;  3CCV P;  4CPG A;  1WMK A;  3GMA A;  3CL3 D;  2NRG A;  4PV1 C;  1A02 J;  2QJK C;  1BE3 D;  1BGY D;  1R5S A;  2OYO A;  3CXH H;  1XTG B;  4OGQ C;  1FE6 A;  4WVZ A;  2C0X A;  2W90 A;  3WMM 0;  1H0T B;  1LNQ A;  4OGQ B;  1L0N D;  1QX8 A;  4JQ0 D;  4HKZ H;  1BCC G;  1GL2 D;  2KI7 B;  1S4X A;  2P1J A;  1N7S A;  5AW4 B;  1IK9 A;  1NYH A;  1GK6 A;  1GW3 A;  4M3L A;  2KYV A;  3TGU D;  2IX7 C;  1NO4 A;  2WVR A;  1SQV K;  3EQ2 A;  2W6B A;  3L71 D;  3RK2 B;  4NPE A;  4HB1 A;  1KIL E;  4JPZ B;  4L74 A;  4XE5 B;  3BRV B;  4ZKP A;  1J2J B;  1NTM J;  5BU5 A;  1KQS O;  3BVH A;  3AEG C;  2Q3E A;  4KJM A;  5APU A;  3H1J E;  4K35 A;  4D6T D;  3H1H E;  5APV A;  3G4S P;  4C7R A;  4TT3 H;  3H1J G;  4LLH A;  1PPJ D;  5M1B A;  2KZJ A;  5AVY B;  1FBM A;  4AQR D;  5CJ4 A;  1K8A Q;  5CCG D;  3CCJ P;  1OX3 A;  3MZW B;  5AW6 B;  2GM4 A;  3VP8 A;  2R5B A;  4DZO A;  4U3F J;  5KAI H;  1NU1 G;  3HD7 B;  4UB8 H;  1SQX D;  2Q9I A;  1SFC A;  3OA7 A;  3L70 E;  3LW5 J;  3P8M C;  1NH4 A;  3CWB G;  2JO1 A;  2O1K A;  3CMA P;  1GL2 B;  2NZ2 A;  3WUU A;  5B5E E;  2QJY C;  4GDO A;  2MKV A;  1QGK B;  1GMJ A;  1SQB J;  1HGV A;  4IOI H;  4GIF A;  2WZ7 A;  1YJ9 P;  1IO4 A;  3EFF K;  3H1K J;  2V7Q J;  2HG5 D;  3IR9 A;  3BAS A;  1QL2 A;  3TSI A;  3BRT B;  1FZG A;  1HF9 A;  1G1I A;  3CCQ P;  1NTM G;  1SQX J;  1SQP G;  2LKM A;  3L70 G;  2O3J A;  3AE2 C;  5AVT B;  2A45 I;  3H1I E;  2H43 A;  1QL1 A;  3FWN A;  3M9Q A;  3A5T A;  2Z4E A;  5CCH D;  4XFJ A;  4GT1 A;  4H0L D;  2ZVO B;  5APX A;  1BCC J;  2E43 A;  1H8A A;  1ZV8 A;  2QJY B;  1SLQ A;  1N7S C;  1JY3 P;  1QLE D;  2E5T A;  2JEE A;  2RH0 A;  4JYC A;  3HUS C;  4KHX A;  1S5L H;  1LTI C;  1LT9 A;  1ZW0 A;  2P67 A;  3HUS B;  2FKW B;  2E76 C;  3HRN A;  2B87 A;  2O01 H;  3B5N C;  2KNC A;  3LIE A;  1HVV A;  1HGZ A;  2HFE D;  2YXR B;  3BAT A;  3GHG B;  3PH0 A;  3SWF A;  2E75 C;  4MN4 C;  2KNC B;  2ZYG A;  4RKU J;  1VQ5 P;  3V2P A;  1KIL D;  2WWW A;  3IF4 A;  1VQO P;  5KTB A;  3H1H D;  2XND H;  3H1J D;  1JY2 N;  2N9B A;  3GG2 A;  5KJ7 C;  3RL0 C;  2K1A A;  3L36 A;  1KIL C;  2RKL A;  3RL0 B;  2W83 C;  2A06 E;  2FBW C;  1UIX A;  3EFG A;  3L71 E;  4BRY A;  1URQ A;  2YKO A;  4H0L B;  4XA4 A;  3AE9 C;  2FY8 A;  2XKM A;  2YKQ A;  1CSB A;  1ZP0 C;  3P32 A;  4GOD A;  1JO5 A;  3KZI H;  1SP4 A;  3FWL A;  1KIL A;  4UB6 H;  3Q5P A;  2KS1 A;  1OW6 A;  3M0D A;  3H1K D;  2GA1 A;  4DT0 A;  2WSF H;  3VMX A;  2M5A A;  1NTK D;  1L4A B;  3PLN A;  1RH5 B;  2AEM A;  1BE3 G;  1BGY G;  1FJK A;  4NPF X;  1SQP D;  2WT7 A;  3CXH I;  1NTM K;  3VN0 A;  1PP9 E;  4TLF A;  3RK2 C;  1GU4 A;  1L0N G;  2NPS D;  1Q86 Q;  2BCC D;  3H25 A;  2IZ0 A;  1M1J C;  5E79 H;  1N7L A;  2WPV B;  3F5H A;  5CCH A;  2HOD A;  1N86 A;  3A2A A;  3E1I A;  1SQQ E;  1MFZ A;  3P8C D;  5KLV K;  3G71 P;  1YJW P;  3MUD A;  3TK1 A;  1SFC B;  5CBN A;  1VL2 A;  2N1T B;  3H1L G;  1PGO A;  2ZYD A;  4D6T J;  4YTP C;  1YTZ I;  1PZQ A;  3CCU P;  3AEF C;  4DOJ A;  3RL0 g;  3CX5 I;  2Q1K A;  1VQ6 P;  2BEQ D;  1LTG C;  3GLM A;  1SQV D;  2IBZ E;  2IFM A;  2FYU K;  1PPJ G;  2K9Y A;  1VF5 B;  3KQG A;  4N6J A;  3H1H J;  1NTZ D;  1AQ5 A;  4L75 A;  5KLV D;  5TJH A;  2AEJ A;  1CW5 A;  4EDF A;  1KN7 A;  2WSF J;  1K9M Q;  1SQX G;  1H0T A;  1SQV E;  1NTZ J;  1FZB A;  2H8P D;  2IBZ D;  3AE5 C;  3ZDM A;  3CWB D;  3JCU H;  1S1C X;  1SFC C;  2K88 A;  1PV3 A;  3CX5 H;  3FXE A;  4IL6 H;  3RBZ A;  1M57 D;  2GUS A;  1PFI A;  3P7K A;  1PGJ A;  2QSI A;  1JTH B;  3OJA B;  1KYO D;  4WY4 D;  2PGD A;  1N8R Q;  1VQ7 P;  1SFC D;  3CPW O;  3L72 D;  2C0W A;  1S5L X;  3GF7 A;  3BCC E;  1XTC C;  2W6J H;  3L74 E;  3I56 P;  4LC1 A;  3CCL P;  1LTS C;  5L8R J;  4WY4 A;  1RHZ B;  5B66 H;  1S9K D;  4BWN A;  1S5L E;  3H1K E;  3L70 D;  3L74 G;  4O9B A;  3D6Z A;  3M91 A;  1U7M A;  1LGH B;  2I1J A;  3WUV A;  1VF5 D;  2QA4 P;  1GL2 A;  2E76 B;  1KB9 D;  2WSC H;  2D2C B;  2ITA A;  4ZNC A;  1CI6 A;  3AE8 C;  4ASV A;  4L76 A;  2O1J A;  2A45 G;  1USE A;  2HOD B;  3D71 A;  1PGQ A;  2OQQ A;  2RMZ A;  1KV4 A;  1SQB D;  2LXB A;  1RE4 C;  4U3F E;  1YQ3 C;  2YXQ B;  2P7J A;  3C9I A;  3FGA D;  1FDO A;  2WIT A;  4OWF A;  2B88 A;  2JP3 A;  2VRS A;  4WY4 B;  1LTJ C;  1AA0 A;  1EXJ A;  1ZR4 A;  1SQX K;  1IFJ A;  3HE4 B;  1J1D B;  1MUU A;  3VMZ A;  1VDF A;  2ZAE B;  1SQV G;  3CC4 P;  4N3Y B;  4H44 C;  4YPC A;  2GUV A;  2UWJ E;  3H32 B;  1LTJ A;  1AFO A;  1NTZ G;  2QEX P;  5BU8 B;  2Q6Q A;  2WTY A;  2QE7 H;  1Y9B A;  1SQQ K;  2KLU A;  2QM8 A;  2M8R A;  5CHX A;  4AYC A;  2E76 D;  1OXZ A;  2OGU A;  3B5N D;  1SQB E;  3U59 A;  4YXD C;  1OZH A;  4I6M C;  2K3R A;  1YHQ P;  1Q82 Q;  1M1K Q;  1WT6 A;  2FYU J;  3F89 A;  2OAR A;  1KZU B;  1YYC A;  3L71 J;  4R4M A;  1DIP A;  1SQQ G;  2FFD A;  1EDI A;  1Y47 A;  3H1K G;  2B89 A;  1AQT A;  3BCC J;  4RES B;  3U1A A;  3L73 J;  1FZC C;  1T8Z A;  1VQN P;  1K05 A;  2CPB A;  3KPE A;  3L72 G;  1NTK G;  3MD0 A;  4PD4 D;  3WUT A;  1RE3 A;  1W2B O;  2QVA A;  2JDI H;  1JOC A;  5KLV J;  1FJP A;  2L91 A;  1ZOY C;  1H89 A;  1U7J A;  1MV8 A;  3MHV A;  5AW7 B;  1JNM A;  2W8Z A;  1LP1 B;  3G6E P;  2HPC B;  3W67 A;  1SQV J;  2A45 H;  2JJL A;  4EOT A;  1K04 A;  2BCC G;  5GTI H;  1JY3 O;  1VQL P;  2J58 A;  3HUS A;  1IJD B;  2RN0 A;  4UB6 E;  2Q5U A;  1OVU A;  2N1T A;  2R5D A;  5AW5 B;  2PFX A;  3HE5 A;  1JUN A;  4HJG H;  1WRG A;  3H1L D;  4GKG A;  2WT7 B;  2K9J A;  1PPJ E;  1SQB G;  4PV1 D;  5AVW B;  5CCG C;  1S72 P;  1BSH A;  3S9O A;  3PHL A;  2KOG A;  3H1I J;  3VTP C;  2QM7 A;  2Y0E A;  2A06 G;  1M1J B;  3V4Q A;  1NAY A;  3MGN A;  1NWQ A;  1SQX E;  1N73 C;  3MP7 B;  2OTJ P;  2V4H A;  3N4X A;  3O6Q A;  1N73 B;  3FXD A;  2LXC B;  1LWU A;  1LT1 A;  2P2U A;  5KLV G;  1M7L A;  4I1L A;  1M90 Q;  1FC2 C;  2IBZ G;  1ZME C;  3C1L A;  1L2P A;  2ZVN B;  2KS1 B;  2PP6 A;  1LP1 A;  2Y0C A;  1YIJ P;  2HPC A;  4GOF A;  2ZXX A;  3VYI A;  1RF0 C;  1BGY E;  4H0L C;  3L72 J;  3SFD C;  1R8E A;  3ITK A;  1FZF A;  2SPZ A;  4JBZ A;  1X9V A;  5CMZ A;  4ASW A;  1RF1 B;  1URQ B;  4PV1 B;  2AEF A;  4A7P A;  5AVU B;  2AXC A;  2J5U A;  2KLV A;  2BAS A;  3L74 D;  3OAK A;  2H88 C;  3H1J J;  2QIW A;  2IPP A;  3HD7 D;  5AVS B;  4Z1M H;  1KD1 Q;  3R2P A;  1USD A;  4N78 E;  1Q81 Q;  1ZRT E;  4UB8 E;  2OYI B;  1JEK A;  1IK7 A;  1JY2 O;  2QJP C;  1JTH A;  5APQ A;  2XNX A;  2JKV A;  1X0T A;  1N2D C;  2QJP B;  1VPC A;  5EFW B;  3AEA C;  1FDI A;  1BGY J;  4L73 A;  1VQ4 P;  2FFD B;  4IL6 X;  1LTJ B;  3M9B A;  3AE6 C;  3L73 G;  2FXP A;  3V2Q A;  1ZR2 A;  3Q3D A;  5KAF E;  3LW5 H;  2Y0D A;  1MKM A;  2O01 N;  3RK3 C;  1URQ C;  3G9R A;  1LJ2 A;  2WSC J;  3Q5R A;  2P10 A;  3CWB E;  2ZJS E;  5CBO A;  3A7O A;  4AUW A;  2FXO A;  3CI9 A;  1P84 D;  4H44 B;  1L0N K;  2CK3 H;  5E79 E;  3SWY A;  2HYN A;  3H1L E;  2E74 D;  1SQB K;  2KK7 A;  3JSV C;  3UIA A;  4DCK A;  1DEB A;  3AE1 C;  2CPS A;  1DH3 A;  4ZKU A;  4Y28 J;  2E5Y A;  1N7S D;  1GDT A;  3D6Y A;  3Q5S A;  1EZV D;  1GZL A;  1FZC A;  5AW1 B;  1A02 F;  3A3Y B;  3VOP A;  2IZ1 A;  1SQP J;  3CCS P;  1FZC B;  3D70 A;  1M1J A;  2Z5H A;  1G1J A;  1GL2 C;  1JMB A;  2WPR A;  5AVZ B;  5AVR B;  1OVV A;  3V2N A;  3NFQ A;  1T2K C;  1IFM A;  1NJI Q;  1SQQ D;  2D2C C;  3AEB C;  5DJU B;  1D7M A;  3B8E B;  1SQP E;  3H1L J;  2QG4 A;  2KP8 A;  5AW0 B;  4ZMD A;  1PL5 A;  2PAJ A;  2R3C A;  5KJ7 D;  4R4L A;  1L4A A;  3G3Z A;  1P84 H;  3SFE C;  2E74 B;  4B86 A;  5AW9 B;  5AW3 B;  3SWK A;  3L70 J;  3USS A;  3W68 A;  3H1I G;  1AV1 A;  2G3A A;  3IN6 A;  3KYQ A;  3L73 E;  1L0L E;  3B4S A;  4H13 B;  1N7S B;  3V5B A;  2R32 A;  1JY2 P;  3CCE P;  1DEE G;  3Q1M A;  2YIU B;  2IDB A;  3E7K A;  3NMD A;  4BXL A;  5B66 E;  2WSE J;  1OWA A;  1NAF A;  1GD2 E;  1VQ8 P;  1KTM A;  1KFN A;  3L75 E;  1MFT A;  4EI2 A;  3R4Y A;  1BDC A;  3TNU B;  3L73 D;  1L0L D;  4RO0 A;  1RQU A;  3TGU J;  3SSU A;  3CC7 P;  4K3A A;  1T2K D;  1X8Y A;  1GU5 A;  3TNU A;  1KB9 I;  4C7N B;  2A06 D;  4WBA A;  3A0B H;  1IFD A;  3H6P A;  3N7N A;  4I2L C;  4C7N A;  3AE7 C;  1R5L A;  3GF3 A;  1MZ9 A;  3L4F A;  3L72 E;  4JYB A;  4W7Y A;  1RF0 A;  5KLI C;  1BE3 J;  2NPS B;  5GTI E;  3RK3 E;  2R3S A;  2J59 M;  3VMA A;  1G2C B;  1T6A A;  3L75 J;  4HYT B;  3V2R A;  4YXW H;  1J1D C;  5APY A;  5K5G B;  1NHL A;  1GW4 A;  1Q90 D;  2PRR A;  5CCH C;  2KXP B;  1SQP K;  1SVF A;  2BCC E;  3E1R A;  2N1T D;  1UII A;  3PRJ A;  4H13 D;  2H89 C;  4U7J A;  1NTK E;  5CJ0 A;  5H2F E;  1LWU B;  1HUC A;  2WMM A;  2R44 A;  5GTH E;  1LWU C;  1KQL A;  1HBW A;  2KUB A;  2YNY A;  3H32 A;  3M0A A;  1SQQ J;  1HJ0 A;  2IBZ I;  1KYO H;  1LTT C;  2ZT9 C;  2OTL P;  2Y9Y A;  3AEC C;  5B5E H;  2OYH C;  3GW6 A;  2W27 A;  1YIT P;  2AXT H;  2YMY A;  3HTK B;  4HH2 A;  4Y99 C;  2KSJ A;  2I8D A;  5CCG A;  1KIL B;  1NU1 J;  1KYO I;  3M0D C;  1ZN5 A;  2W6A A;  4C46 A;  1K73 Q;  2ZFC A;  1NOH A;  3L35 A;  1OMI A;  4EIJ A;  1NTK J;  2WQY C;  3O8Z A;  3FX0 A;  2M0B A;  2M3E A;  1ZXG A;  3H1I D;  1KQF B;  1EC5 A;  3RK3 B;  3RL0 D;  5APW A;  3S4R A;  4JF7 A;  4PD4 I;  1IZN B;  1CI6 B;  2N1T C;  1NVO A;  1PP9 D;  2G8Y A;  2POH A;  1KFM A;  2WSS H;  5BVZ A;  5KLI B;  3CC2 P;  1AVO A;  1HTL C;  2OYH B;  3I5C A;  1EXI A;  3RGU A;  3M06 A;  5KAF H;  1DX7 A;  4N78 D;  1W5C E;  4U3F G;  1VQK P;  3HD7 C;  1NU1 E;  1G2C A;  3NXS A;  1DD3 A;  5H2F H;  5C39 A;  5AVX B;  3GHG A;  3CWB J;  3EWK A;  1J1E B;  1L4A D;  1DD4 A;  2WSE H;  1S9K E;  3OW2 O;  2FFD C;  1QVF O;  1BDD A;  1BSN A;  1M56 D;  2D2C D;  2Q3I A;  2HR3 A;  2IYP A;  3M9H A;  1EZV G;  4I7Z B;  1RF1 C;  2E75 D;  1FDM A;  1KYO E;  1YBK A;  1SS1 A;  4PJ0 H;  2FXM A;  4D6T E;  3BCC D;  3L74 J;  1PGP A;  2KB7 P;  3CLQ A;  3RK3 D;  3KZI E;  1IC2 A;  1L0L J;  1RY3 A;  2FYZ A;  2FYU D;  1RF1 A;  1IFP A;  3CXH D;  3TF5 A;  4PD4 E;  1E5W A;  1NKZ B;  1VQ9 P;  5AVV B;  1NTZ K;  2E74 C;  4PD4 H;  1AJY A;  1TU3 F;  1JCC A;  1RQV A;  1PP9 J;  4GOE A;  1Q7Y Q;  1ZLL A;  1OFC X;  2JR8 A;  1T3J A;  2WPQ A;  2YO2 A;  2XV5 A;  3CX5 E;  1W2E A;  3K5B A;  4I7Z C;  3VP9 A;  1OIP A;  2ZXE B;  1QVG O;  1S3J A;  3HE4 A;  1P84 E;  2ZYA A;  1M8O B;  3KXD A;  4LGD E;  3B5N B;  2Y9Z A;  2M3B A;  1HWT C;  3MIW A;  2H7H A;  3CCR P;  3CX5 D;  2DW3 A;  2E75 B;  1FZE A;  3I55 P;  1RE4 A;  2OYI C;  1CZQ A;  3IAO A;  4PJ0 E;  3JC2 2;  1GK4 A;  5DJT B;  3S1K A;  1L0L G; 
#chains in the Genus database with same CATH homology
 2B88 A;  4ZMD A;  2ZAE B;  2UWJ E;  1EDK A;  1DEE G;  4BXL A;  2K3R A;  1ZW0 A;  1MFT A;  1BDC A;  2B87 A;  3PH0 A;  2KZI A;  4K3A A;  1EDI A;  1Y47 A;  2B89 A;  4MN4 C;  2B87 B;  1Q2N A;  2QVA A;  1U7J A;  3MHV A;  1LP1 B;  4WWI A;  2KIK A;  2RKL A;  5K5G B;  2OTK E;  4NPD A;  4GOD A;  1JM0 A;  1OVU A;  4EYY Q;  2WMM A;  2R44 A;  4HJG H;  2KUB A;  2JWD A;  2M5A A;  2QRX A;  4NPF X;  2I8D A;  3FXD A;  2LXC B;  1LT1 A;  2M5A B;  1EDJ A;  1FC2 C;  2M0B A;  1ZXG A;  1EC5 A;  2LR2 A;  1EDL A;  2KS1 B;  2P58 A;  1LP1 A;  1NVO A;  5CBN A;  4GOF A;  3QWO C;  3RGU A;  2SPZ A;  4JBZ A;  4ASW A;  2Q1K A;  1OVR A;  4CPG A;  5C39 A;  1H0T B;  1BDD A;  2HR3 A;  1H0T A;  4HKZ H;  1SS1 A;  3ZDM A;  1X0T A;  2KI7 B;  5EFW B;  3FXE A;  4NPE A;  4HB1 A;  4KJM A;  4K35 A;  5CBO A;  4GOE A;  2KZJ A;  1U7M A;  3MZW B;  1S3J A;  4ZNC A;  4ASV A;  1JMB A;  4IOI H;  2LXB A;  1OVV A;  5DJT B;  3S1K A;  5DJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...