1EDIA

Staphylococcal protein a e-domain (180), nmr, minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL PROTEIN A
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 19
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ediA00
1H0TA 5CBOA 3PH0A 4KJMA 5DJTB 3S1KA 1EC5A 3MZWB 2KZJA 1EDJA 1H0TB 1LP1B 2B87A 4WWIA 4ASVA 2LR2A 1EDLA 4GODA 1JM0A 2M5AB 1DEEG 4GOEA 2ZAEB 3RGUA 4K3AA 4CPGA 1SS1A 2B88A 1OVVA 1LP1A 2B89A 2WMMA 1LT1A 3FXDA 1EDKA 2KZIA 2M5AA 1NVOA 2Q1KA 1ZW0A 1FC2C 4HKZH 4JBZA 4ZNCA 2M0BA 2KIKA 1JMBA 1EDIA 2JWDA 1BDDA 1Y47A 2P58A 1OVUA 2KUBA 1MFTA 2QVAA 4K35A 2I8DA 3QWOC 2R44A 2RKLA 2OTKE 1S3JA 1U7MA 4MN4C 5EFWB 5DJUB 3FXEA 4NPEA 4HJGH 1ZXGA 2KS1B 4HB1A 4NPDA 1BDCA 4IOIH 5K5GB 4ZMDA 2KI7B 4BXLA 2QRXA 1OVRA 3MHVA 1U7JA 2SPZA 1Q2NA 2LXBA 5CBNA 2HR3A 4NPFX 2LXCB 4EYYQ 4ASWA 2K3RA 2UWJE 5C39A 3ZDMA 1X0TA 4GOFA 2B87B
chains in the Genus database with same CATH superfamily
2HPCB 3AE5C 4W7YA 1G1JA 1BCCE 1IK7A 1FZEA 1OMIA 3L72D 2BCCJ 1EDJA 2Z5IA 2WSEH 1CSBA 2FYNC 1S5LE 1RQUA 3HD7C 2WSCH 3O6QA 1EXIA 5KLVD 1NTMJ 5GTHE 2YMYA 1KQGB 1BGYD 1PP9J 5AW6B 2O01N 3L36A 2HYNA 1YI2P 1ZW0A 4PD4H 4PV1D 1KB9D 4WY4D 2M0BA 1JEKA 1NTKE 4N3YB 3HTKB 1PGJA 2JWDA 1PV3A 2WVRA 1Q81Q 2OYHC 2KUBA 3CCMP 3L75E 3CL3D 1KILD 1LT9B 5KTBA 2C9NY 4L75A 2NRGA 2E43A 3SWKA 2FFDB 1P84H 3CWBJ 3RK2D 1SQBJ 1SFCD 1EZVE 2O3JA 1LTSC 1USEA 1FAVA 4YXWH 2QRXA 2JP3A 3L70E 3M0AA 4PV1C 2WSSH 3C9IA 2Q3IA 3TSIA 1JTHA 1T6AA 1QLED 4PD4I 2GM4A 3JC22 1LTIC 5APSA 3WU2H 3ZDMA 1LTJC 2LKMA 1L0LD 1KILC 1Z56A 1ZRTE 3A2AA 3OA7A 4JYCA 3FX0A 2W8ZA 1SQQD 2C0XA 3RK2C 3IR9A 3D6YA 1A02J 3H32A 2LR2A 1QVFO 1P84I 3AEGC 3TNUA 4GODA 2W83C 2JDIH 3TYYA 3WMM0 1VQNP 3BCCG 3FXDA 1XTGB 3CX5E 1G2CB 2Y9YA 1GMJA 3CPWO 4IL6X 1QEXA 1L0ND 3AE6C 1NAFA 3OJAB 3LIEA 4H13D 2A45G 1FZAA 4Z1MH 3JCUH 2R44A 1N7SA 3CCRP 2IFMA 1S3JA 2RH0A 5KLVK 3L72G 1HBWA 1M1JA 2FYUJ 1YHQP 4NPDA 3H1LD 1RF0C 4RO0A 2YMKA 1FDOA 2FY8A 1FDIA 3AEFC 3H1JJ 5AW5B 1BGYG 4IFFA 2I1KA 1YYCA 4H13C 3IFMA 3TGUD 3M9QA 1PPJG 3U1AA 2R3SA 5B66H 2I1JA 1X22A 3KDPB 4WWIA 2HPCA 1KYOI 4KT0J 3MUDC 3GW6A 1OX3A 1BE3D 4OVNF 4XA4A 1W2BO 1SS1A 1BSNA 1SQPD 3HUSA 3ABVC 2Y9ZA 3MP7B 4KHXA 2N1TD 1NTZJ 2WZ7A 1L0LK 1VQ8P 3H6PA 1YITP 3PRJA 1S9KD 1A02F 2D2CB 3U1CA 1KORA 4PD4E 1SQQK 2WTYA 1L0LG 2JO1A 1WRGA 3FWNA 1SQXE 3HTKA 1OW6A 3AE8C 1SQQG 1U57A 4D6TE 1NH4A 2IX7C 1LT9A 2NPSC 5CCHA 2N1TC 1P84E 3A5TA 5TJHA 2FFDA 1E79H 3PP5A 1M90Q 1NTKJ 1L0NK 4NPFX 1GTWA 3L75J 1AQ5A 1SQVD 1L4AC 1JO5A 2XKMA 2ZYDA 1L0NG 2AEJA 1PZQA 4KJMA 4I7ZB 5KJ7D 3WU2E 4U7JA 3CCQP 3H1KJ 1GU4A 1T2KD 1RE3C 4U3FG 1UIIA 1NU1J 1FZGA 3T97B 1YJ9P 1PGQA 1FE6A 2ZXXA 4CPGA 2OYIC 3PHLA 2R5BA 2FXMA 3H1LG 2OTJP 1KB9I 1LT1A 3CCSP 1NO4A 1VDFA 4PJ0E 4UB6H 3B71A 1FC2C 2QM7A 1DD4A 5GTHH 4H0LC 5KJ7C 3TK1A 2P2UA 3G4SP 1GL2C 1G2CA 1VQ6P 1J1DC 3TGUG 1T2KC 2POHA 3Q5SA 4I1LA 5B5EH 1SQBE 3VN0A 4A7PA 2C9LY 4BWNA 1FZCC 3MTUE 3JCUE 1ZN5A 3KQGA 1N73B 2E74B 4BXLA 2AEMA 1BE3G 5KAFH 1KYOE 3C1LA 3H1HE 1KQLA 3PLNA 4GKGA 3NXSA 1Q82Q 4HYTB 3L74G 4ASWA 1JMMA 1AFOA 2E76B 1SVFA 2ZYGA 5CJ0A 3LW5H 4AYCA 4LC1A 2KXPB 2OTLP 1FZFA 5GTIH 1HUCA 1EC5A 3A0BE 3AEBC 1HVVA 5B66E 2PP6A 2H88C 1W5CE 1NYHA 1LWUB 1K73Q 2YNYA 3BATA 3NMDA 2PGDA 2E42A 3H1ID 1X9VA 1NVOA 1SQVK 3CMAP 2KIKA 3GHGC 2P7JA 2N9BA 1DEBA 1RF1C 1SQVG 2FYUE 2QIWA 1Y9BA 1AA0A 2V7QH 4K35A 3AE3C 4DOJA 2ZFCA 5AVQB 2WSEJ 4HJGH 2KS1B 1BDCA 3H1JE 5KLVE 1OW8A 4GDOA 1JOCA 3P8CE 3FGAD 3V2PA 2JKVA 2W6AA 1BGYE 5AW9B 1N86A 2Q6QA 2A06E 4EIJA 1PL5A 3VMYA 1ZR4A 1KB9E 1GW4A 3MD0A 1MKMA 3KZIH 3RL0D 3HD7B 1PGPA 1SP4A 3N7NA 1N7SD 4H44B 4LGDE 1LNQA 2ITAA 5DJTB 3S1KA 1KILE 1LTTC 5AW8B 5BU5A 1YQ4C 4OGQD 2M3EA 3S9OA 2OYHB 4OWFA 2WMMA 3VMXA 3Q3DA 3T97A 2YKOA 2ZT9C 1GU5A 2JEEA 1KQFB 3HUSB 3M9HA 4R4MA 5KAIE 1FDMA 3WUUA 4UB6E 5L8RJ 1M1JC 2P58A 2K9JB 1NOHA 1Q86Q 2O1JA 2W27A 3G3ZA 2YIUC 3SSUA 1GDTA 1NTMG 4MN4C 4OGQC 5DJUB 5B5EE 3L73D 2J58A 1PPJD 2IYPA 3F5HA 2QJPC 4ZMDA 5BU8B 4N6JA 1URQA 3KPEA 2WPSA 3H1IG 5KAFE 1N73A 2M8RA 1H8AA 3AEAC 3MIWA 1VF5B 3H1KE 2AEFA 1CW5A 2WPVB 1T3JA 1NU1E 2R5DA 5APTA 2WWWA 1NKZB 3CWBG 4WY4C 1IO4A 1R5LA 5GTIE 1RE4A 3CXHD 3I55P 3H1HJ 2ZAEB 4WBAA 1VL2A 1GK6A 1BCCD 2XV5A 1PFIA 1DH3A 1LWUA 3KHUA 1HJ0A 3V2RA 1E5WA 2C0WA 1SFCC 4JBZA 3B8EB 1FJPA 2IBZG 1Y8AA 3BVHA 1L2PA 4PJ0H 4XFJA 3M0DC 5M1BA 2HODB 2G8YA 4YTPC 1RY3A 3BCCJ 2IYOA 3L71D 3R2PA 5CCGA 3FXEA 1YJNP 3U59A 1SQPE 1H88A 4U3FD 2KS1A 1MFZA 3M06A 3B5NB 5APWA 1KYOH 1VQLP 3D70A 3L72J 1N2DC 3L70D 3KZIE 1KZUB 4BRYB 1K9MQ 1PIXA 3HD7A 5KLIC 5KLVJ 1KN7A 4TLFA 2AXTH 4GIFA 2E75B 4GOEA 1BGYJ 1IFMA 3A0BH 3L73G 2WITA 2GUVA 5AVWB 2Z4EA 4I6MC 3II6A 2KLUA 2FYZA 3KYQA 2OYHA 1S5LX 3PJSK 2K9YA 1N7LA 2Q9IA 1ZR2A 2NPSB 3G6EP 1TU3F 1OVUA 2QSIA 3GLMA 1YJWP 1H89A 2XNDH 3CX5D 1HWTC 1M1KQ 3OAKA 3L74D 2QJKB 1DX7A 2A45H 2OGUA 3A3YB 2Y0CA 1NTZK 2K9JA 3VYIA 3V6IA 3VP9A 1L4AB 3I56P 3IAOA 2FBWC 1NTZG 2WPQA 1OWAA 5KKZB 1BCCG 1L0LJ 1SLQA 1KILA 4XE5B 4WB4A 4EI2A 1SQQJ 1H0TA 2QA4P 2OYIB 1AVOA 3VTPC 3WUVA 1IFIA 2D2CD 4IFMA 3CC7P 1K04A 2JR8A 1KB9H 2BEZF 4IL6H 3CC2P 2QJYC 3SFDC 1YTZT 3VMAA 2A45I 2W6JH 3E7KA 2QG4A 3E1RA 1QVGO 3L71G 2ZJSE 4H0LB 1K05A 1AVYA 1NTKG 1GL2B 3CMEP 1J1DB 1M7LA 1X79B 1OW7A 2ZXEB 1L0NJ 1GK4A 3ITKA 3L75G 1ZV8A 1VQ7P 2H89C 2KYVA 4HKZH 3LW5J 1EDIA 4U3FJ 2CPSA 1AJYA 2KOGA 4Y99C 3CXHH 1OZHA 3L70G 2QE7H 5KAIH 3H1LJ 1VQOP 5AVRB 1RF0A 2HODA 4NPEA 3CCUP 1ZXGA 4PD4D 5AVVB 1LTAC 1K8AQ 4RKUJ 4I2LC 3NFQA 1SQXD 1Q2NA 3A7OA 5AW2B 3TGUJ 2IDBA 5TISH 2IFNA 4D6TD 1S4XA 2FXOA 3L4FA 1URQB 2B9BA 5AVTB 1HTLC 3EFGA 4YXDC 2R3CA 3AE1C 1P84D 3B5NA 2V7QJ 3CXHI 5E79E 3MUDA 2XU6A 1BE3J 2QEXP 3BRVB 2FXPA 1SQPJ 1S1CX 4OH8B 1R8EA 3GHGB 4BRYA 2QM8A 2BCCD 3FWLA 3F89A 2AXTE 2B88A 4DT0A 1RF1B 3G71P 4JYBA 2E74D 3QH9A 1J1EB 1JCDA 1NTMD 5AVSB 1N8RQ 1WT6A 1PP9D 2E76D 3BCCE 1MV8A 1NHLA 1BDDA 1VQ4P 2I8DA 3CD6P 2XNXA 3GG2A 2OTKE 2NPSA 1BSHA 2G3AA 4IOIH 4N78D 1RHZB 1NJIQ 3K5BA 2MJZA 5APQA 1KQSO 5AW3B 3CWBD 2KK7A 1SQBD 3MHVA 4AQRD 1JUNA 4C7RA 3CCVP 5CBNA 4C7NB 3L72E 1SQVJ 1L4AA 2BASA 3MGNA 4EYYQ 2E76C 4DCKA 3AE2C 1M56D 4GOFA 2K1AA 5H2FH 1RE3A 3O8ZA 1DD3A 3OW2O 5CCGD 2ZT9B 5CHXA 3CI9A 4DZOA 3P8MC 2IBZD 2OYIA 3EFFK 2Q7CA 4IL6E 1FBMA 2FYNB 1PPJE 2M5AB 1DEEG 3SFEC 2KNCB 1SQXK 3SWYA 1ZP0C 3L35A 1M57D 2YIUB 2YKQA 5KJ7A 2H8PD 1SQXG 1GL2A 3LIDA 3RK3D 1VQKP 3KXDA 3R4YA 2WSFH 4D6TG 1XTCC 3N4XA 1IFDA 5CCGC 2WPRA 1FZBA 4IFDK 1QX8A 2QJPB 3HD7D 2GUSA 3QWOC 4H44D 2RMZA 3RL0C 3IN6A 1U7MA 3CXHE 1N7SC 5K5GB 1L0LE 2BCCG 2FYUD 1NTMK 2HLOA 1U7JA 3RK3C 1HJBA 4PV1B 3Q2YA 1SQQE 4WY4B 4ZKUA 4L73A 3USSA 1QL2A 2IZ1A 3A0HH 2K3RA 3H1JD 1LTJB 1USDA 5TISE 1PP9G 2JWAA 2P67A 4H44C 3P8CD 4DJGA 1KILB 5APUA 2CK3H 2A06D 1H0TB 4YPCA 3L71E 3RK2B 1SFCB 1L0NE 3H1IJ 4O9BA 1VQMP 1JM0A 4RJTA 2IPPA 1SQBK 2J59M 1OVVA 3H25A 2Q3EA 3GHGA 2KZIA 4U3FE 3EWKA 1SQBG 3HUSC 3V2NA 1D7MA 1RF1A 3GF7A 2V4HA 1NGMB 5CCHD 3IF4A 1NTZD 3H1LE 1KV4A 1VF5D 2DW3A 5AVZB 4L76A 2FKWB 1JY2N 3D71A 5BVZA 3H1HG 1HF9A 4B86A 1IFJA 1OIPA 1Q7YQ 3TF5A 1W2EA 3TGUE 1MUUA 3P32A 2W6BA 2KI7B 4HH2A 2YO3A 2JJLA 1LT9C 1YQ3C 2L5GB 1AV1A 5KLIB 1FU1A 5CCHC 1FJKA 2FFDC 1FOSF 1VF5C 1NTKD 4H13B 3AEDC 1BE3E 1R5SA 3GMAA 1LJ2A 4C7NA 4UB8H 3PH0A 1HGZA 2O01J 3L75D 1NKNA 1EQ7A 3L74E 5H2FE 1JNMA 1HH0A 1VQPP 2L91A 1T3UA 2FYUK 3H1KD 1OXZA 1S9KE 1EZVD 5E79H 1WMKA 5AW0B 1NU1D 3CCJP 1CI6A 4QMAA 1IZNB 3AECC 2FYUG 2M5AA 1S2EA 3AE4C 2KNCA 4ZKPA 2W90A 3Q5PA 3B5ND 2O1KA 3HE5B 3C8VA 1ZRTD 3H1JG 5KLVG 1MFTA 2P10A 2Q5UA 2M3BA 2QVAA 3L73J 1GW3A 2WT7B 2KSJA 3I5CA 5EFWB 2A06G 4HB1A 1SQVE 1JY3N 2E75D 2Y0DA 3HRNA 1OVRA 4WVZA 2O01H 2N1TB 2K88A 1VQ9P 2SPZA 2QJYB 1NAYA 3B5NC 2YXRB 4JF7A 2K37A 5APXA 1X0TA 2B87B 1IFNA 1KFNA 4WY4A 3M91A 2OYOA 5CBOA 3W68A 3A0HE 2IBZI 2RN0A 5APYA 2NPSD 2KZJA 1LTJA 1LP1B 2NZ2A 4M3LA 1KTMA 1BCCJ 2PFXA 3V4QA 4AUWA 2E75C 1Q90D 3GF3A 1NWQA 1OFCX 4K3AA 2KSEA 3HE4B 1DIPA 1JY2P 1L4AD 1IJDB 1SFCA 1ZLLA 4Y99B 1EDKA 2KLVA 1IK9A 3RL0g 1NTKK 3M0DA 4ZNCA 1QGKB 5AVXB 2VRSA 1JMBA 2YXQB 1YTZI 1FOSE 1Y47A 4R4LA 3L71J 1YIJP 1QL1A 1JB0J 2HG5D 1G1IA 3G9RA 2QJKC 2KP8A 2P1JA 1FZCB 1NU1K 3L37A 2BCCE 2D2CC 3H1KG 1FS0E 4H0LD 3Q5RA 5AW7B 3UIAA 2ZVOB 5KKZC 1EZVG 1GL2D 1GZLA 1NU1G 1KMIZ 1NTME 2LXCB 4W7ZA 3AE7C 3NTNA 3VMZA 2Z5HA 3L70J 1PP9E 4L74A 1S72P 3Q1MA 2BEQD 2PRRA 1VQ5P 3CLQA 1LTGC 3CC4P 1JY2O 3H1IE 4GT1A 1S5LH 3O6QB 3CCLP 4Y28J 3MZWB 4UB8E 2MKVA 1KD1Q 1KC8Q 4W80A 1EDLA 4N78E 1VPCA 2B89A 3BRTB 4I7ZC 3CWBE 1ZMEC 5CJ4A 2Q1KA 2H7HA 1YBKA 1SQPK 1JY3P 3PTZA 4TT3H 1PGOA 1URQD 1RQVA 3L74J 3SWFA 2Y0EA 3W67A 1SQPG 2RKLA 3HE5A 2IBZE 2YO2A 1IC2A 1JTHB 1HGVA 5AW4B 2WT7A 2CPBA 1X8YA 2LXBA 2HR3A 3V4WA 4C46A 3AE9C 5APVA 1AQTA 3RK3E 1URQC 2KB7P 3TDKA 2UWJE 2WSFJ 2N1TA 3V5BA 1JCCA 1N73C 2E74C 3H32B 2ZYAA 3TNUB 5CMZA 2XDJA 4JPZB 3WUTA 4LLHA 3AEEC 3EQ2A 2B87A 1EZVI 1J2JB 1EXJA 4ASVA 2PAJA 5AVYB 3S4RA 1JY3O 1T8ZA 3CX5H 3RGUA 2IZ0A 1LP1A 1RE4C 1KYOD 3JSVC 1IFPA 3H1HD 5AVUB 3VOPA 2E5YA 1J1EC 3B4SA 4RESB 1RH5B 2XZRA 2H43A 3RL0B 3V2QA 1UIXA 3HE4A 1CI6B 2OQQA 2WQYC 4EOTA 1LWUC 2OARA 4EDFA 3L73E 2WSCJ 1N7SB 3VP8A 2AXCA 1M1JB 4JQ0D 3RK3B 3RBZA 1CZQA 2J5UA 2N9YB 3CCEP 2GA1A 2ZT9D 4OGQB 3BASA 2R32A 3BCCD 3CX5I 1SQXJ 1ZOYC 3RBXA 3D6ZA 1LGHB 1KFMA 1GD2E 1FZCA 4D6TJ 1M8OB 1LTBC 2YKPA 2E5TA 1MZ9A 5AW1B 3P7KA 3E1IA 5C39A 2HFED 2ZVNB 3M9BA 1NTZE
chains in the Genus database with same CATH topology
1H0TA 5CBOA 3PH0A 4KJMA 5DJTB 3S1KA 1EC5A 3MZWB 2KZJA 1EDJA 1H0TB 1LP1B 2B87A 4WWIA 4ASVA 2LR2A 1EDLA 4GODA 1JM0A 2M5AB 1DEEG 4GOEA 2ZAEB 3RGUA 4K3AA 4CPGA 1SS1A 2B88A 1OVVA 1LP1A 2B89A 2WMMA 1LT1A 3FXDA 1EDKA 2KZIA 2M5AA 1NVOA 2Q1KA 1ZW0A 1FC2C 4HKZH 4JBZA 4ZNCA 2M0BA 2KIKA 1JMBA 1EDIA 2JWDA 1BDDA 1Y47A 2P58A 1OVUA 2KUBA 1MFTA 2QVAA 4K35A 2I8DA 3QWOC 2R44A 2RKLA 2OTKE 1S3JA 1U7MA 4MN4C 5EFWB 5DJUB 3FXEA 4NPEA 4HJGH 1ZXGA 2KS1B 4HB1A 4NPDA 1BDCA 4IOIH 5K5GB 4ZMDA 2KI7B 4BXLA 2QRXA 1OVRA 3MHVA 1U7JA 2SPZA 1Q2NA 2LXBA 5CBNA 2HR3A 4NPFX 2LXCB 4EYYQ 4ASWA 2K3RA 2UWJE 5C39A 3ZDMA 1X0TA 4GOFA 2B87B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0T A;  5CBO A;  3PH0 A;  4KJM A;  5DJT B;  3S1K A;  1EC5 A;  3MZW B;  2KZJ A;  1EDJ A;  1H0T B;  1LP1 B;  2B87 A;  4WWI A;  4ASV A;  2LR2 A;  1EDL A;  4GOD A;  1JM0 A;  2M5A B;  1DEE G;  4GOE A;  2ZAE B;  3RGU A;  4K3A A;  4CPG A;  1SS1 A;  2B88 A;  1OVV A;  1LP1 A;  2B89 A;  2WMM A;  1LT1 A;  3FXD A;  1EDK A;  2KZI A;  2M5A A;  1NVO A;  2Q1K A;  1ZW0 A;  1FC2 C;  4HKZ H;  4JBZ A;  4ZNC A;  2M0B A;  2KIK A;  1JMB A;  1EDI A;  2JWD A;  1BDD A;  1Y47 A;  2P58 A;  1OVU A;  2KUB A;  1MFT A;  2QVA A;  4K35 A;  2I8D A;  3QWO C;  2R44 A;  2RKL A;  2OTK E;  1S3J A;  1U7M A;  4MN4 C;  5EFW B;  5DJU B;  3FXE A;  4NPE A;  4HJG H;  1ZXG A;  2KS1 B;  4HB1 A;  4NPD A;  1BDC A;  4IOI H;  5K5G B;  4ZMD A;  2KI7 B;  4BXL A;  2QRX A;  1OVR A;  3MHV A;  1U7J A;  2SPZ A;  1Q2N A;  2LXB A;  5CBN A;  2HR3 A;  4NPF X;  2LXC B;  4EYY Q;  4ASW A;  2K3R A;  2UWJ E;  5C39 A;  3ZDM A;  1X0T A;  4GOF A;  2B87 B; 
#chains in the Genus database with same CATH topology
 2HPC B;  3AE5 C;  4W7Y A;  1G1J A;  1BCC E;  1IK7 A;  1FZE A;  1OMI A;  3L72 D;  2BCC J;  1EDJ A;  2Z5I A;  2WSE H;  1CSB A;  2FYN C;  1S5L E;  1RQU A;  3HD7 C;  2WSC H;  3O6Q A;  1EXI A;  5KLV D;  1NTM J;  5GTH E;  2YMY A;  1KQG B;  1BGY D;  1PP9 J;  5AW6 B;  2O01 N;  3L36 A;  2HYN A;  1YI2 P;  1ZW0 A;  4PD4 H;  4PV1 D;  1KB9 D;  4WY4 D;  2M0B A;  1JEK A;  1NTK E;  4N3Y B;  3HTK B;  1PGJ A;  2JWD A;  1PV3 A;  2WVR A;  1Q81 Q;  2OYH C;  2KUB A;  3CCM P;  3L75 E;  3CL3 D;  1KIL D;  1LT9 B;  5KTB A;  2C9N Y;  4L75 A;  2NRG A;  2E43 A;  3SWK A;  2FFD B;  1P84 H;  3CWB J;  3RK2 D;  1SQB J;  1SFC D;  1EZV E;  2O3J A;  1LTS C;  1USE A;  1FAV A;  4YXW H;  2QRX A;  2JP3 A;  3L70 E;  3M0A A;  4PV1 C;  2WSS H;  3C9I A;  2Q3I A;  3TSI A;  1JTH A;  1T6A A;  1QLE D;  4PD4 I;  2GM4 A;  3JC2 2;  1LTI C;  5APS A;  3WU2 H;  3ZDM A;  1LTJ C;  2LKM A;  1L0L D;  1KIL C;  1Z56 A;  1ZRT E;  3A2A A;  3OA7 A;  4JYC A;  3FX0 A;  2W8Z A;  1SQQ D;  2C0X A;  3RK2 C;  3IR9 A;  3D6Y A;  1A02 J;  3H32 A;  2LR2 A;  1QVF O;  1P84 I;  3AEG C;  3TNU A;  4GOD A;  2W83 C;  2JDI H;  3TYY A;  3WMM 0;  1VQN P;  3BCC G;  3FXD A;  1XTG B;  3CX5 E;  1G2C B;  2Y9Y A;  1GMJ A;  3CPW O;  4IL6 X;  1QEX A;  1L0N D;  3AE6 C;  1NAF A;  3OJA B;  3LIE A;  4H13 D;  2A45 G;  1FZA A;  4Z1M H;  3JCU H;  2R44 A;  1N7S A;  3CCR P;  2IFM A;  1S3J A;  2RH0 A;  5KLV K;  3L72 G;  1HBW A;  1M1J A;  2FYU J;  1YHQ P;  4NPD A;  3H1L D;  1RF0 C;  4RO0 A;  2YMK A;  1FDO A;  2FY8 A;  1FDI A;  3AEF C;  3H1J J;  5AW5 B;  1BGY G;  4IFF A;  2I1K A;  1YYC A;  4H13 C;  3IFM A;  3TGU D;  3M9Q A;  1PPJ G;  3U1A A;  2R3S A;  5B66 H;  2I1J A;  1X22 A;  3KDP B;  4WWI A;  2HPC A;  1KYO I;  4KT0 J;  3MUD C;  3GW6 A;  1OX3 A;  1BE3 D;  4OVN F;  4XA4 A;  1W2B O;  1SS1 A;  1BSN A;  1SQP D;  3HUS A;  3ABV C;  2Y9Z A;  3MP7 B;  4KHX A;  2N1T D;  1NTZ J;  2WZ7 A;  1L0L K;  1VQ8 P;  3H6P A;  1YIT P;  3PRJ A;  1S9K D;  1A02 F;  2D2C B;  3U1C A;  1KOR A;  4PD4 E;  1SQQ K;  2WTY A;  1L0L G;  2JO1 A;  1WRG A;  3FWN A;  1SQX E;  3HTK A;  1OW6 A;  3AE8 C;  1SQQ G;  1U57 A;  4D6T E;  1NH4 A;  2IX7 C;  1LT9 A;  2NPS C;  5CCH A;  2N1T C;  1P84 E;  3A5T A;  5TJH A;  2FFD A;  1E79 H;  3PP5 A;  1M90 Q;  1NTK J;  1L0N K;  4NPF X;  1GTW A;  3L75 J;  1AQ5 A;  1SQV D;  1L4A C;  1JO5 A;  2XKM A;  2ZYD A;  1L0N G;  2AEJ A;  1PZQ A;  4KJM A;  4I7Z B;  5KJ7 D;  3WU2 E;  4U7J A;  3CCQ P;  3H1K J;  1GU4 A;  1T2K D;  1RE3 C;  4U3F G;  1UII A;  1NU1 J;  1FZG A;  3T97 B;  1YJ9 P;  1PGQ A;  1FE6 A;  2ZXX A;  4CPG A;  2OYI C;  3PHL A;  2R5B A;  2FXM A;  3H1L G;  2OTJ P;  1KB9 I;  1LT1 A;  3CCS P;  1NO4 A;  1VDF A;  4PJ0 E;  4UB6 H;  3B71 A;  1FC2 C;  2QM7 A;  1DD4 A;  5GTH H;  4H0L C;  5KJ7 C;  3TK1 A;  2P2U A;  3G4S P;  1GL2 C;  1G2C A;  1VQ6 P;  1J1D C;  3TGU G;  1T2K C;  2POH A;  3Q5S A;  4I1L A;  5B5E H;  1SQB E;  3VN0 A;  4A7P A;  2C9L Y;  4BWN A;  1FZC C;  3MTU E;  3JCU E;  1ZN5 A;  3KQG A;  1N73 B;  2E74 B;  4BXL A;  2AEM A;  1BE3 G;  5KAF H;  1KYO E;  3C1L A;  3H1H E;  1KQL A;  3PLN A;  4GKG A;  3NXS A;  1Q82 Q;  4HYT B;  3L74 G;  4ASW A;  1JMM A;  1AFO A;  2E76 B;  1SVF A;  2ZYG A;  5CJ0 A;  3LW5 H;  4AYC A;  4LC1 A;  2KXP B;  2OTL P;  1FZF A;  5GTI H;  1HUC A;  1EC5 A;  3A0B E;  3AEB C;  1HVV A;  5B66 E;  2PP6 A;  2H88 C;  1W5C E;  1NYH A;  1LWU B;  1K73 Q;  2YNY A;  3BAT A;  3NMD A;  2PGD A;  2E42 A;  3H1I D;  1X9V A;  1NVO A;  1SQV K;  3CMA P;  2KIK A;  3GHG C;  2P7J A;  2N9B A;  1DEB A;  1RF1 C;  1SQV G;  2FYU E;  2QIW A;  1Y9B A;  1AA0 A;  2V7Q H;  4K35 A;  3AE3 C;  4DOJ A;  2ZFC A;  5AVQ B;  2WSE J;  4HJG H;  2KS1 B;  1BDC A;  3H1J E;  5KLV E;  1OW8 A;  4GDO A;  1JOC A;  3P8C E;  3FGA D;  3V2P A;  2JKV A;  2W6A A;  1BGY E;  5AW9 B;  1N86 A;  2Q6Q A;  2A06 E;  4EIJ A;  1PL5 A;  3VMY A;  1ZR4 A;  1KB9 E;  1GW4 A;  3MD0 A;  1MKM A;  3KZI H;  3RL0 D;  3HD7 B;  1PGP A;  1SP4 A;  3N7N A;  1N7S D;  4H44 B;  4LGD E;  1LNQ A;  2ITA A;  5DJT B;  3S1K A;  1KIL E;  1LTT C;  5AW8 B;  5BU5 A;  1YQ4 C;  4OGQ D;  2M3E A;  3S9O A;  2OYH B;  4OWF A;  2WMM A;  3VMX A;  3Q3D A;  3T97 A;  2YKO A;  2ZT9 C;  1GU5 A;  2JEE A;  1KQF B;  3HUS B;  3M9H A;  4R4M A;  5KAI E;  1FDM A;  3WUU A;  4UB6 E;  5L8R J;  1M1J C;  2P58 A;  2K9J B;  1NOH A;  1Q86 Q;  2O1J A;  2W27 A;  3G3Z A;  2YIU C;  3SSU A;  1GDT A;  1NTM G;  4MN4 C;  4OGQ C;  5DJU B;  5B5E E;  3L73 D;  2J58 A;  1PPJ D;  2IYP A;  3F5H A;  2QJP C;  4ZMD A;  5BU8 B;  4N6J A;  1URQ A;  3KPE A;  2WPS A;  3H1I G;  5KAF E;  1N73 A;  2M8R A;  1H8A A;  3AEA C;  3MIW A;  1VF5 B;  3H1K E;  2AEF A;  1CW5 A;  2WPV B;  1T3J A;  1NU1 E;  2R5D A;  5APT A;  2WWW A;  1NKZ B;  3CWB G;  4WY4 C;  1IO4 A;  1R5L A;  5GTI E;  1RE4 A;  3CXH D;  3I55 P;  3H1H J;  2ZAE B;  4WBA A;  1VL2 A;  1GK6 A;  1BCC D;  2XV5 A;  1PFI A;  1DH3 A;  1LWU A;  3KHU A;  1HJ0 A;  3V2R A;  1E5W A;  2C0W A;  1SFC C;  4JBZ A;  3B8E B;  1FJP A;  2IBZ G;  1Y8A A;  3BVH A;  1L2P A;  4PJ0 H;  4XFJ A;  3M0D C;  5M1B A;  2HOD B;  2G8Y A;  4YTP C;  1RY3 A;  3BCC J;  2IYO A;  3L71 D;  3R2P A;  5CCG A;  3FXE A;  1YJN P;  3U59 A;  1SQP E;  1H88 A;  4U3F D;  2KS1 A;  1MFZ A;  3M06 A;  3B5N B;  5APW A;  1KYO H;  1VQL P;  3D70 A;  3L72 J;  1N2D C;  3L70 D;  3KZI E;  1KZU B;  4BRY B;  1K9M Q;  1PIX A;  3HD7 A;  5KLI C;  5KLV J;  1KN7 A;  4TLF A;  2AXT H;  4GIF A;  2E75 B;  4GOE A;  1BGY J;  1IFM A;  3A0B H;  3L73 G;  2WIT A;  2GUV A;  5AVW B;  2Z4E A;  4I6M C;  3II6 A;  2KLU A;  2FYZ A;  3KYQ A;  2OYH A;  1S5L X;  3PJS K;  2K9Y A;  1N7L A;  2Q9I A;  1ZR2 A;  2NPS B;  3G6E P;  1TU3 F;  1OVU A;  2QSI A;  3GLM A;  1YJW P;  1H89 A;  2XND H;  3CX5 D;  1HWT C;  1M1K Q;  3OAK A;  3L74 D;  2QJK B;  1DX7 A;  2A45 H;  2OGU A;  3A3Y B;  2Y0C A;  1NTZ K;  2K9J A;  3VYI A;  3V6I A;  3VP9 A;  1L4A B;  3I56 P;  3IAO A;  2FBW C;  1NTZ G;  2WPQ A;  1OWA A;  5KKZ B;  1BCC G;  1L0L J;  1SLQ A;  1KIL A;  4XE5 B;  4WB4 A;  4EI2 A;  1SQQ J;  1H0T A;  2QA4 P;  2OYI B;  1AVO A;  3VTP C;  3WUV A;  1IFI A;  2D2C D;  4IFM A;  3CC7 P;  1K04 A;  2JR8 A;  1KB9 H;  2BEZ F;  4IL6 H;  3CC2 P;  2QJY C;  3SFD C;  1YTZ T;  3VMA A;  2A45 I;  2W6J H;  3E7K A;  2QG4 A;  3E1R A;  1QVG O;  3L71 G;  2ZJS E;  4H0L B;  1K05 A;  1AVY A;  1NTK G;  1GL2 B;  3CME P;  1J1D B;  1M7L A;  1X79 B;  1OW7 A;  2ZXE B;  1L0N J;  1GK4 A;  3ITK A;  3L75 G;  1ZV8 A;  1VQ7 P;  2H89 C;  2KYV A;  4HKZ H;  3LW5 J;  1EDI A;  4U3F J;  2CPS A;  1AJY A;  2KOG A;  4Y99 C;  3CXH H;  1OZH A;  3L70 G;  2QE7 H;  5KAI H;  3H1L J;  1VQO P;  5AVR B;  1RF0 A;  2HOD A;  4NPE A;  3CCU P;  1ZXG A;  4PD4 D;  5AVV B;  1LTA C;  1K8A Q;  4RKU J;  4I2L C;  3NFQ A;  1SQX D;  1Q2N A;  3A7O A;  5AW2 B;  3TGU J;  2IDB A;  5TIS H;  2IFN A;  4D6T D;  1S4X A;  2FXO A;  3L4F A;  1URQ B;  2B9B A;  5AVT B;  1HTL C;  3EFG A;  4YXD C;  2R3C A;  3AE1 C;  1P84 D;  3B5N A;  2V7Q J;  3CXH I;  5E79 E;  3MUD A;  2XU6 A;  1BE3 J;  2QEX P;  3BRV B;  2FXP A;  1SQP J;  1S1C X;  4OH8 B;  1R8E A;  3GHG B;  4BRY A;  2QM8 A;  2BCC D;  3FWL A;  3F89 A;  2AXT E;  2B88 A;  4DT0 A;  1RF1 B;  3G71 P;  4JYB A;  2E74 D;  3QH9 A;  1J1E B;  1JCD A;  1NTM D;  5AVS B;  1N8R Q;  1WT6 A;  1PP9 D;  2E76 D;  3BCC E;  1MV8 A;  1NHL A;  1BDD A;  1VQ4 P;  2I8D A;  3CD6 P;  2XNX A;  3GG2 A;  2OTK E;  2NPS A;  1BSH A;  2G3A A;  4IOI H;  4N78 D;  1RHZ B;  1NJI Q;  3K5B A;  2MJZ A;  5APQ A;  1KQS O;  5AW3 B;  3CWB D;  2KK7 A;  1SQB D;  3MHV A;  4AQR D;  1JUN A;  4C7R A;  3CCV P;  5CBN A;  4C7N B;  3L72 E;  1SQV J;  1L4A A;  2BAS A;  3MGN A;  4EYY Q;  2E76 C;  4DCK A;  3AE2 C;  1M56 D;  4GOF A;  2K1A A;  5H2F H;  1RE3 A;  3O8Z A;  1DD3 A;  3OW2 O;  5CCG D;  2ZT9 B;  5CHX A;  3CI9 A;  4DZO A;  3P8M C;  2IBZ D;  2OYI A;  3EFF K;  2Q7C A;  4IL6 E;  1FBM A;  2FYN B;  1PPJ E;  2M5A B;  1DEE G;  3SFE C;  2KNC B;  1SQX K;  3SWY A;  1ZP0 C;  3L35 A;  1M57 D;  2YIU B;  2YKQ A;  5KJ7 A;  2H8P D;  1SQX G;  1GL2 A;  3LID A;  3RK3 D;  1VQK P;  3KXD A;  3R4Y A;  2WSF H;  4D6T G;  1XTC C;  3N4X A;  1IFD A;  5CCG C;  2WPR A;  1FZB A;  4IFD K;  1QX8 A;  2QJP B;  3HD7 D;  2GUS A;  3QWO C;  4H44 D;  2RMZ A;  3RL0 C;  3IN6 A;  1U7M A;  3CXH E;  1N7S C;  5K5G B;  1L0L E;  2BCC G;  2FYU D;  1NTM K;  2HLO A;  1U7J A;  3RK3 C;  1HJB A;  4PV1 B;  3Q2Y A;  1SQQ E;  4WY4 B;  4ZKU A;  4L73 A;  3USS A;  1QL2 A;  2IZ1 A;  3A0H H;  2K3R A;  3H1J D;  1LTJ B;  1USD A;  5TIS E;  1PP9 G;  2JWA A;  2P67 A;  4H44 C;  3P8C D;  4DJG A;  1KIL B;  5APU A;  2CK3 H;  2A06 D;  1H0T B;  4YPC A;  3L71 E;  3RK2 B;  1SFC B;  1L0N E;  3H1I J;  4O9B A;  1VQM P;  1JM0 A;  4RJT A;  2IPP A;  1SQB K;  2J59 M;  1OVV A;  3H25 A;  2Q3E A;  3GHG A;  2KZI A;  4U3F E;  3EWK A;  1SQB G;  3HUS C;  3V2N A;  1D7M A;  1RF1 A;  3GF7 A;  2V4H A;  1NGM B;  5CCH D;  3IF4 A;  1NTZ D;  3H1L E;  1KV4 A;  1VF5 D;  2DW3 A;  5AVZ B;  4L76 A;  2FKW B;  1JY2 N;  3D71 A;  5BVZ A;  3H1H G;  1HF9 A;  4B86 A;  1IFJ A;  1OIP A;  1Q7Y Q;  3TF5 A;  1W2E A;  3TGU E;  1MUU A;  3P32 A;  2W6B A;  2KI7 B;  4HH2 A;  2YO3 A;  2JJL A;  1LT9 C;  1YQ3 C;  2L5G B;  1AV1 A;  5KLI B;  1FU1 A;  5CCH C;  1FJK A;  2FFD C;  1FOS F;  1VF5 C;  1NTK D;  4H13 B;  3AED C;  1BE3 E;  1R5S A;  3GMA A;  1LJ2 A;  4C7N A;  4UB8 H;  3PH0 A;  1HGZ A;  2O01 J;  3L75 D;  1NKN A;  1EQ7 A;  3L74 E;  5H2F E;  1JNM A;  1HH0 A;  1VQP P;  2L91 A;  1T3U A;  2FYU K;  3H1K D;  1OXZ A;  1S9K E;  1EZV D;  5E79 H;  1WMK A;  5AW0 B;  1NU1 D;  3CCJ P;  1CI6 A;  4QMA A;  1IZN B;  3AEC C;  2FYU G;  2M5A A;  1S2E A;  3AE4 C;  2KNC A;  4ZKP A;  2W90 A;  3Q5P A;  3B5N D;  2O1K A;  3HE5 B;  3C8V A;  1ZRT D;  3H1J G;  5KLV G;  1MFT A;  2P10 A;  2Q5U A;  2M3B A;  2QVA A;  3L73 J;  1GW3 A;  2WT7 B;  2KSJ A;  3I5C A;  5EFW B;  2A06 G;  4HB1 A;  1SQV E;  1JY3 N;  2E75 D;  2Y0D A;  3HRN A;  1OVR A;  4WVZ A;  2O01 H;  2N1T B;  2K88 A;  1VQ9 P;  2SPZ A;  2QJY B;  1NAY A;  3B5N C;  2YXR B;  4JF7 A;  2K37 A;  5APX A;  1X0T A;  2B87 B;  1IFN A;  1KFN A;  4WY4 A;  3M91 A;  2OYO A;  5CBO A;  3W68 A;  3A0H E;  2IBZ I;  2RN0 A;  5APY A;  2NPS D;  2KZJ A;  1LTJ A;  1LP1 B;  2NZ2 A;  4M3L A;  1KTM A;  1BCC J;  2PFX A;  3V4Q A;  4AUW A;  2E75 C;  1Q90 D;  3GF3 A;  1NWQ A;  1OFC X;  4K3A A;  2KSE A;  3HE4 B;  1DIP A;  1JY2 P;  1L4A D;  1IJD B;  1SFC A;  1ZLL A;  4Y99 B;  1EDK A;  2KLV A;  1IK9 A;  3RL0 g;  1NTK K;  3M0D A;  4ZNC A;  1QGK B;  5AVX B;  2VRS A;  1JMB A;  2YXQ B;  1YTZ I;  1FOS E;  1Y47 A;  4R4L A;  3L71 J;  1YIJ P;  1QL1 A;  1JB0 J;  2HG5 D;  1G1I A;  3G9R A;  2QJK C;  2KP8 A;  2P1J A;  1FZC B;  1NU1 K;  3L37 A;  2BCC E;  2D2C C;  3H1K G;  1FS0 E;  4H0L D;  3Q5R A;  5AW7 B;  3UIA A;  2ZVO B;  5KKZ C;  1EZV G;  1GL2 D;  1GZL A;  1NU1 G;  1KMI Z;  1NTM E;  2LXC B;  4W7Z A;  3AE7 C;  3NTN A;  3VMZ A;  2Z5H A;  3L70 J;  1PP9 E;  4L74 A;  1S72 P;  3Q1M A;  2BEQ D;  2PRR A;  1VQ5 P;  3CLQ A;  1LTG C;  3CC4 P;  1JY2 O;  3H1I E;  4GT1 A;  1S5L H;  3O6Q B;  3CCL P;  4Y28 J;  3MZW B;  4UB8 E;  2MKV A;  1KD1 Q;  1KC8 Q;  4W80 A;  1EDL A;  4N78 E;  1VPC A;  2B89 A;  3BRT B;  4I7Z C;  3CWB E;  1ZME C;  5CJ4 A;  2Q1K A;  2H7H A;  1YBK A;  1SQP K;  1JY3 P;  3PTZ A;  4TT3 H;  1PGO A;  1URQ D;  1RQV A;  3L74 J;  3SWF A;  2Y0E A;  3W67 A;  1SQP G;  2RKL A;  3HE5 A;  2IBZ E;  2YO2 A;  1IC2 A;  1JTH B;  1HGV A;  5AW4 B;  2WT7 A;  2CPB A;  1X8Y A;  2LXB A;  2HR3 A;  3V4W A;  4C46 A;  3AE9 C;  5APV A;  1AQT A;  3RK3 E;  1URQ C;  2KB7 P;  3TDK A;  2UWJ E;  2WSF J;  2N1T A;  3V5B A;  1JCC A;  1N73 C;  2E74 C;  3H32 B;  2ZYA A;  3TNU B;  5CMZ A;  2XDJ A;  4JPZ B;  3WUT A;  4LLH A;  3AEE C;  3EQ2 A;  2B87 A;  1EZV I;  1J2J B;  1EXJ A;  4ASV A;  2PAJ A;  5AVY B;  3S4R A;  1JY3 O;  1T8Z A;  3CX5 H;  3RGU A;  2IZ0 A;  1LP1 A;  1RE4 C;  1KYO D;  3JSV C;  1IFP A;  3H1H D;  5AVU B;  3VOP A;  2E5Y A;  1J1E C;  3B4S A;  4RES B;  1RH5 B;  2XZR A;  2H43 A;  3RL0 B;  3V2Q A;  1UIX A;  3HE4 A;  1CI6 B;  2OQQ A;  2WQY C;  4EOT A;  1LWU C;  2OAR A;  4EDF A;  3L73 E;  2WSC J;  1N7S B;  3VP8 A;  2AXC A;  1M1J B;  4JQ0 D;  3RK3 B;  3RBZ A;  1CZQ A;  2J5U A;  2N9Y B;  3CCE P;  2GA1 A;  2ZT9 D;  4OGQ B;  3BAS A;  2R32 A;  3BCC D;  3CX5 I;  1SQX J;  1ZOY C;  3RBX A;  3D6Z A;  1LGH B;  1KFM A;  1GD2 E;  1FZC A;  4D6T J;  1M8O B;  1LTB C;  2YKP A;  2E5T A;  1MZ9 A;  5AW1 B;  3P7K A;  3E1I A;  5C39 A;  2HFE D;  2ZVN B;  3M9B A;  1NTZ E; 
#chains in the Genus database with same CATH homology
 1H0T A;  5CBO A;  3PH0 A;  4KJM A;  5DJT B;  3S1K A;  1EC5 A;  3MZW B;  2KZJ A;  1EDJ A;  1H0T B;  1LP1 B;  2B87 A;  4WWI A;  4ASV A;  2LR2 A;  1EDL A;  4GOD A;  1JM0 A;  2M5A B;  1DEE G;  4GOE A;  2ZAE B;  3RGU A;  4K3A A;  4CPG A;  1SS1 A;  2B88 A;  1OVV A;  1LP1 A;  2B89 A;  2WMM A;  1LT1 A;  3FXD A;  1EDK A;  2KZI A;  2M5A A;  1NVO A;  2Q1K A;  1ZW0 A;  1FC2 C;  4HKZ H;  4JBZ A;  4ZNC A;  2M0B A;  2KIK A;  1JMB A;  1EDI A;  2JWD A;  1BDD A;  1Y47 A;  2P58 A;  1OVU A;  2KUB A;  1MFT A;  2QVA A;  4K35 A;  2I8D A;  3QWO C;  2R44 A;  2RKL A;  2OTK E;  1S3J A;  1U7M A;  4MN4 C;  5EFW B;  5DJU B;  3FXE A;  4NPE A;  4HJG H;  1ZXG A;  2KS1 B;  4HB1 A;  4NPD A;  1BDC A;  4IOI H;  5K5G B;  4ZMD A;  2KI7 B;  4BXL A;  2QRX A;  1OVR A;  3MHV A;  1U7J A;  2SPZ A;  1Q2N A;  2LXB A;  5CBN A;  2HR3 A;  4NPF X;  2LXC B;  4EYY Q;  4ASW A;  2K3R A;  2UWJ E;  5C39 A;  3ZDM A;  1X0T A;  4GOF A;  2B87 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...