1EDLA

Staphylococcal protein a e-domain (-60), nmr, 22 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCAL PROTEIN A
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edlA00
1LT1A 1EDLA 4NPDA 5C39A 2WMMA 2ZAEB 4ZMDA 1DEEG 1LP1B 5CBNA 2QRXA 2LXCB 4JBZA 1EDKA 2B88A 2M5AA 4HB1A 2KS1B 2B89A 2I8DA 4CPGA 5EFWB 1EC5A 1X0TA 2OTKE 2UWJE 1EDIA 1LP1A 1SS1A 5DJUB 3QWOC 2KZJA 1JM0A 4GOEA 3MHVA 4EYYQ 1ZXGA 2KI7B 2P58A 1Y47A 2LXBA 4ZNCA 1Q2NA 1H0TB 1OVRA 4ASWA 2K3RA 2KIKA 2M0BA 1U7MA 1BDDA 5DJTB 4HJGH 3FXDA 4GODA 4NPEA 2R44A 4KJMA 2QVAA 3S1KA 5CBOA 2KZIA 1U7JA 2B87B 2Q1KA 4BXLA 2SPZA 3FXEA 3MZWB 1H0TA 2LR2A 2M5AB 3PH0A 1NVOA 4K35A 1BDCA 4ASVA 4MN4C 5K5GB 4GOFA 2KUBA 1ZW0A 3RGUA 4IOIH 4K3AA 4WWIA 2HR3A 1MFTA 4HKZH 2B87A 2RKLA 1FC2C 2JWDA 3ZDMA 1OVUA 1EDJA 1JMBA 1S3JA 1OVVA 4NPFX
chains in the Genus database with same CATH superfamily
3A0BE 1FOSF 1LT1A 2E5TA 1S9KD 3MIWA 1RF1C 2P1JA 4H44D 4NPDA 1EDLA 2WMMA 4PD4E 1YIJP 1KB9E 2Y9ZA 2ZAEB 1FBMA 1Q90D 3TNUA 1DEEG 5GTIE 1N86A 2XDJA 1Z56A 3L74J 4UB8H 2QRXA 5AVSB 3L70G 1NTKG 3Q5SA 1DH3A 1EDKA 1LWUA 4I7ZB 1RE4C 2M5AA 1RHZB 3A2AA 3JCUH 3V2QA 1VQOP 2O3JA 3CXHI 5CCGD 1NU1K 1JY3N 1ZRTD 2I8DA 2GA1A 4L75A 1LTIC 1BE3D 5AW3B 2QA4P 1AVYA 2A06G 4CPGA 2OYHB 1LTJA 3O8ZA 4C46A 2YMKA 2UWJE 3USSA 3V6IA 5AW9B 2E74B 3CPWO 2BCCD 5KTBA 2XNDH 2ZFCA 1SQXJ 1S2EA 3PRJA 1FZCA 3H1LJ 4XA4A 3B8EB 1IJDB 3V5BA 1BGYJ 1G1JA 4I6MC 1YI2P 1AQTA 3CLQA 1L4AD 2C0XA 2KI7B 1ZOYC 2P58A 5H2FH 1HGZA 4BWNA 3H1LE 2OQQA 1E79H 1ZRTE 2H43A 3F5HA 1YTZI 3B5NB 2GUSA 3EWKA 2I1KA 3AE8C 3CCLP 2AEMA 1SQVE 1DIPA 2CPSA 1OW8A 1S5LE 2WWWA 3B4SA 1LT9A 5B5EH 5CJ4A 3LW5J 2M0BA 3EFFK 1FDIA 3TYYA 1WT6A 4UB6H 1L0NG 1QL2A 2DW3A 2P10A 4C7RA 3C9IA 3MUDC 3AECC 3H1JJ 3G71P 1JTHB 4HJGH 4TT3H 2P7JA 4W7ZA 5AW7B 1KILB 2K88A 3RK2D 3CX5D 3SFDC 1PP9D 4NPEA 4UB8E 1ZV8A 5CCHA 1M90Q 1T2KC 1KV4A 4C7NA 4KJMA 2QJYB 1IFIA 1JY3O 2Z4EA 1SQPK 2IBZE 2M3BA 4PD4H 3S1KA 3H1JD 1KFNA 2CK3H 1L0LK 3KHUA 2K9JA 3KPEA 1L0LD 4GKGA 3CCRP 3Q2YA 1HF9A 2PAJA 3HE5A 4GIFA 4N78E 3EFGA 1K04A 4N78D 2NPSA 1FJKA 2JKVA 1LT9C 2ZYGA 1KTMA 3JCUE 3H1KJ 3P7KA 1EXIA 2W90A 3AE9C 2IFNA 3E1RA 4DCKA 1ZMEC 2JJLA 2C9NY 1JOCA 3CX5H 3L4FA 3MD0A 3FXEA 3CI9A 5CCGC 2NPSB 4D6TD 1IFMA 4ZKUA 1KN7A 3M0DA 2KP8A 1G1IA 4JPZB 2QIWA 3H1KE 3HUSA 3L72G 2D2CC 1SQVD 5KLIC 2K9JB 2Y0CA 1SQVK 1GL2D 2Q6QA 3MGNA 3WUUA 4IFDK 4PD4I 4PV1D 1KILC 4C7NB 1HGVA 3O6QA 2JP3A 4OGQB 3WU2H 3AEEC 2WSEJ 2HFED 1PGQA 2QJYC 2AXTH 2WZ7A 4LLHA 3U59A 3WU2E 1K73Q 4PJ0H 1BCCJ 1NTZJ 1UIIA 3VOPA 1EXJA 4WBAA 3CXHE 3G9RA 2FXMA 1FZGA 1QVFO 3LW5H 2FYUJ 3TGUD 1LT9B 4K3AA 4H0LB 5KJ7A 1M56D 2JDIH 2N1TC 1SQQJ 2GUVA 1KQLA 2WPQA 1L0LE 3B71A 3BCCG 4N3YB 3H1IE 1NU1J 2W83C 2KNCB 3RBXA 1LWUC 1BCCG 1FS0E 3ZDMA 1S1CX 1SQBG 2QJKB 1E5WA 2J58A 2XZRA 2ZVOB 3H1HE 4WY4D 1T8ZA 3D71A 1BE3E 1SQQE 1ZLLA 4WY4B 4W80A 1ZR4A 2AXCA 1OVVA 5AVVB 5AW6B 3S4RA 3GG2A 2KSJA 4WWIA 3Q5RA 2FXOA 3JC22 3CD6P 2QM7A 1KQFB 1W2EA 2R3SA 2I1JA 1BE3J 1GMJA 1NKZB 3A5TA 1OXZA 3IAOA 3WUVA 5B66H 4ZKPA 1YBKA 3L71E 2HPCA 4ZMDA 3PLNA 2Z5HA 5BU8B 2HODB 3G4SP 2LXCB 3BVHA 1CI6B 2B88A 3GMAA 3H1LD 1VF5C 1G2CB 5AVZB 1J1DB 4HB1A 3T97B 1N73C 1HJ0A 1SFCC 1LNQA 1SFCD 2QG4A 1M1JA 2V7QJ 1VPCA 1BGYG 1IFPA 1IFDA 3C8VA 3CXHH 3D6ZA 2E75C 2IPPA 4AYCA 3KDPB 1EC5A 1X0TA 1RH5B 1PV3A 2QEXP 3Q5PA 2QE7H 2ZJSE 4H13D 4DOJA 4AUWA 1RF1A 2HG5D 4XFJA 1QLED 2O01N 2FXPA 3BASA 1SQPE 4GT1A 5DJUB 3S9OA 3TDKA 3VP9A 1RQUA 2G8YA 1SQQK 2FBWC 5AVTB 1JM0A 2W8ZA 1BSNA 1BGYD 4BRYA 2BCCG 3M06A 3IN6A 1RE4A 1SQBK 1JY2N 1L4AC 4EYYQ 4JYCA 1ZXGA 1TU3F 5CCHC 1JY2O 5APYA 2M3EA 1J1DC 1N73B 4QMAA 2FKWB 3L70J 1M1JB 2A45I 2PGDA 5TISE 2D2CB 5KAFH 1H0TB 3T97A 1LTSC 1IFNA 1PGOA 3OW2O 5AVUB 4B86A 1CI6A 2G3AA 2K3RA 2PRRA 1RY3A 1URQA 1WRGA 2BASA 2C0WA 2BEZF 3AE6C 3H1LG 1JY3P 3M9QA 4R4LA 3L70D 3CCUP 1PFIA 1U7MA 1LGHB 2YKPA 2YKQA 3FWLA 3NXSA 2H89C 2N9YB 4HH2A 1OIPA 4OH8B 2E5YA 4WVZA 1QX8A 2ZXEB 2R5DA 3A0HH 2FFDB 1SQPD 2KK7A 2YO3A 3B5ND 3L74E 3HD7D 2IDBA 2Z5IA 3HD7C 1VQMP 3LIEA 2W6BA 1YQ4C 5AW0B 1OX3A 1L0NE 3P32A 2R44A 4IL6X 5BVZA 4BRYB 2YIUB 1L4AB 5KLIB 3AEAC 4EI2A 1NH4A 3RL0C 2IZ0A 4HYTB 4YPCA 2RMZA 4LGDE 2OYIC 2C9LY 1PGJA 2QJPC 1YTZT 3HTKA 2Q7CA 1H88A 3HRNA 1RF1B 1IC2A 4RESB 4U7JA 2KNCA 1JO5A 1BCCD 2E74D 1NTZG 1R5SA 4BXLA 2KYVA 1NTME 4W7YA 2IZ1A 3R2PA 1N7SC 5APWA 5APVA 1N7SD 2N1TA 5APXA 1NHLA 5GTHH 3TGUJ 5BU5A 4OWFA 1SQXE 1M8OB 3Q3DA 2WSFJ 3E1IA 5B66E 1S9KE 1MKMA 4L74A 4RO0A 2YKOA 1VQ7P 1KILD 2ITAA 1NVOA 3H32B 4K35A 4RKUJ 4Y28J 5KLVE 1T6AA 2MKVA 2A45G 2IX7C 3R4YA 1QVGO 3KYQA 4GOFA 4D6TG 3VMYA 1NTKE 3P8CD 4PD4D 1NTZD 3CCVP 2HPCB 1VQ4P 2JR8A 1P84H 1USDA 2NPSC 3GF3A 4YXWH 3L72D 3KXDA 2AEFA 3L37A 3E7KA 1ZR2A 1FE6A 4H0LC 3L75J 2J5UA 1VQLP 2ZVNB 2A06E 3B5NC 3V2PA 1NO4A 2OYIB 4HKZH 3RK3B 2RKLA 2KB7P 3ITKA 3HE5B 5GTIH 1OVUA 2OGUA 3AEBC 4YXDC 3CC2P 1KB9H 3L75D 3RL0D 1R8EA 5AVYB 1FOSE 1L0LG 1SFCB 3H1IG 2BCCJ 3HD7B 1NTMK 3H1JG 3I5CA 2FYNB 1L0ND 1SQBD 2ZYDA 1SQBE 1JEKA 1SQXK 1MUUA 1CZQA 3GHGB 5AW1B 2FFDA 1GK6A 1SQQG 2ZT9B 1JTHA 1AVOA 1N2DC 3U1CA 5C39A 1L2PA 3PTZA 2GM4A 5KJ7C 1HUCA 1L0NJ 2IBZD 1FZCC 5AVXB 1LP1B 1VL2A 5CBNA 3M9BA 2XU6A 3GHGC 3O6QB 1R5LA 2D2CD 1NTKK 2NRGA 1PPJG 2BEQD 1SQVG 2RN0A 2Y0DA 3L73E 1MV8A 2YNYA 4R4MA 3OJAB 3TSIA 1ZP0C 3F89A 2YIUC 2E75D 3CC7P 1USEA 3LIDA 5EFWB 1BSHA 1YQ3C 1J2JB 2OTKE 3C1LA 1KYOI 1PP9E 2MJZA 4H44B 1EZVE 1L0NK 1BGYE 2L5GB 4GDOA 2K9YA 2XV5A 1LJ2A 1VQ5P 1H8AA 1IK7A 2KZJA 3AE3C 3BRTB 4H13B 1IO4A 1VQKP 2WSCJ 3NTNA 1QL1A 1JUNA 3MUDA 4GOEA 4Y99B 1JCCA 1T3UA 2WSSH 3RBZA 3N4XA 2QSIA 5GTHE 2YO2A 1QEXA 4JQ0D 1L0LJ 4WY4C 1SQPG 2YMYA 2POHA 3I56P 5APQA 3Q1MA 3CWBJ 1Y47A 1KMIZ 1AA0A 4Y99C 2E76C 5APTA 3VN0A 1LTAC 2E76D 2LXBA 2FFDC 1NU1G 4ZNCA 1Q2NA 2N1TB 4IFFA 1QGKB 3L70E 1LTJC 1OVRA 1AJYA 5KKZC 1JB0J 3U1AA 3CWBE 2YXRB 4N6JA 3RK3E 1LWUB 1NTZK 3CWBD 2KIKA 4TLFA 2QJPB 5H2FE 3RK3D 1JNMA 5KLVK 1K9MQ 1GZLA 3I55P 5APSA 1KC8Q 5DJTB 1FU1A 3L71J 2WPSA 3CMEP 1EQ7A 3NFQA 1VQ6P 1CSBA 1L4AA 1X79B 2JWAA 3M9HA 2VRSA 3RK2C 1S4XA 1EZVD 1OWAA 1DEBA 4I7ZC 2E75B 3GLMA 1T2KD 1GL2A 3BATA 2OTJP 1RF0C 1DX7A 5CHXA 2QVAA 3L71D 1CW5A 1OZHA 3BCCD 3WMM0 2WITA 1Q86Q 1K05A 3BCCE 3SFEC 2AEJA 2FYUD 2XNXA 2WQYC 3A0BH 4Z1MH 2B87B 1HVVA 3KZIH 2Q1KA 3CCQP 1K8AQ 1SLQA 2WPVB 1LTJB 1BE3G 1URQB 1GTWA 3BCCJ 3PP5A 2E74C 4LC1A 3AEGC 1N7SB 1YHQP 1LTBC 2CPBA 3L73J 1HWTC 1HH0A 2SPZA 2B9BA 2M8RA 1IK9A 3MZWB 2JO1A 3SWKA 2WSFH 1YJ9P 1H0TA 4IFMA 1YJWP 2LR2A 2WPRA 5CCHD 3VYIA 3CX5E 4A7PA 3K5BA 3H25A 1DD4A 2M5AB 3FGAD 4U3FD 1NTKD 3P8CE 4U3FE 1NTZE 2O01H 3BRVB 1NTMG 2R5BA 5KAIH 3A7OA 1GL2B 3KZIE 2PP6A 3CCMP 4ASVA 1KFMA 4AQRD 2FYUE 2KUBA 1IZNB 1P84E 1PP9J 1NTKJ 2NPSD 3V4QA 1GD2E 1XTGB 1NWQA 2QM8A 1UIXA 1FJPA 3D6YA 3KQGA 4IOIH 4XE5B 2L91A 4D6TE 2H88C 4KT0J 3MP7B 1M57D 2HR3A 5L8RJ 3SSUA 3W67A 1A02F 3VP8A 3L75E 2WVRA 4L73A 1YYCA 3H1KD 1X9VA 3HUSC 1Q7YQ 2OYOA 4DZOA 1Q82Q 2O1KA 1VQ8P 1EDJA 2JWDA 1JMBA 3GW6A 1MFZA 4D6TJ 1G2CA 3OA7A 1S3JA 2Y0EA 1M1JC 1S5LH 3TF5A 2KLUA 3CMAP 3TGUG 3RL0g 3RK2B 1JMMA 3TNUB 3V2RA 1SQBJ 4NPFX 1SQVJ 3VMAA 1AQ5A 2HODA 3H1HJ 2BCCE 2IYOA 4KHXA 5CJ0A 5KLVD 5TJHA 1S72P 1GU4A 3P8MC 3H1KG 1RE3A 4EIJA 1GW4A 3CXHD 3II6A 1FAVA 3JSVC 1U57A 3SWFA 2Q3EA 4H44C 1P84D 1X22A 1RQVA 5KJ7D 1YITP 3H1JE 2NZ2A 3TGUE 2Q5UA 1T3JA 2O1JA 5AVQB 1VDFA 5AW2B 4WB4A 1KYOH 5M1BA 3RL0B 2IYPA 5KKZB 1KD1Q 3CCEP 1NTMJ 1WMKA 4JBZA 1KORA 2R32A 2FY8A 2J59M 2W6JH 1PIXA 3A0HE 3AE5C 3HE4A 4WY4A 3TK1A 1FZFA 2N9BA 1PGPA 2KS1B 3VTPC 2WT7A 1LTTC 2E42A 1NU1D 2ZXXA 3M91A 2B89A 3UIAA 1NTMD 3ABVC 3L73G 1XTCC 1PPJE 4PJ0E 1FDMA 5AW4B 1OFCX 3L74G 2AXTE 1LTGC 2Q3IA 3AEFC 1RE3C 4IL6H 2XKMA 1KYOD 1EDIA 1LP1A 1SS1A 2ZT9C 2ZYAA 1YJNP 1W2BO 3L74D 5KAIE 1OW6A 1NAFA 3QWOC 5AW8B 1GDTA 1DD3A 1OMIA 3GHGA 1Y8AA 1J1EB 3MHVA 3FX0A 5AW5B 1PP9G 1Y9BA 2WSCH 4RJTA 2HLOA 3W68A 3HD7A 2WTYA 1FZBA 1SFCA 2HYNA 3VMZA 2W6AA 2FYZA 1VQPP 2FYNC 3AE4C 1PZQA 3D70A 1NAYA 1RF0A 3HUSB 1KB9I 3L71G 4PV1C 1GU5A 5KAFE 5TISH 1FZAA 1SQXG 3OAKA 1D7MA 2KS1A 2H7HA 2OYIA 1NOHA 3CX5I 3L36A 3PHLA 4ASWA 2W27A 3HE4B 3RK3C 5E79E 1SQXD 1PPJD 2P67A 5AVWB 4DJGA 5KLVG 3AE7C 1NU1E 1PL5A 3CCJP 1BDDA 2FYUK 1GK4A 2JEEA 2IBZG 2V4HA 1P84I 3MTUE 3CWBG 1VF5D 2KXPB 3FXDA 2E76B 2K37A 3PJSK 4GODA 1KYOE 4UB6E 1EZVI 1NKNA 4I2LC 1IFJA 2V7QH 3H32A 2OYHC 1KILA 4IL6E 5APUA 5B5EE 3L72J 4OGQC 5CBOA 1NJIQ 1KQSO 2E43A 3IR9A 1J1EC 5AVRB 2KZIA 1VQ9P 1U7JA 1KZUB 1MZ9A 3AE1C 1URQD 3FWNA 1M7LA 1URQC 2WSEH 3NMDA 2A06D 3L72E 2K1AA 3L73D 1JY2P 2LKMA 3AEDC 3G6EP 1N7LA 1H89A 1N8RQ 3HTKB 5CMZA 1SVFA 2H8PD 3B5NA 3SWYA 1NGMB 1VQNP 3WUTA 1SP4A 2WT7B 4U3FJ 2YXQB 4DT0A 3M0AA 2QJKC 1Q81Q 3PH0A 2Q9IA 2R3CA 1GL2C 1OW7A 2KLVA 2KSEA 2P2UA 2KOGA 1KQGB 4M3LA 3CCSP 2OYHA 1BDCA 1X8YA 1AFOA 3V2NA 1SQPJ 2O01J 3AE2C 3GF7A 4MN4C 5K5GB 2PFXA 1ZW0A 4YTPC 1KB9D 3QH9A 1FZEA 4EDFA 1JCDA 1FZCB 1A02J 4U3FG 3VMXA 3V4WA 5KLVJ 1BCCE 1FDOA 3G3ZA 3N7NA 2OARA 1HJBA 4H13C 3RGUA 3H1HG 4H0LD 2OTLP 2ZT9D 4OVNF 5CCGA 4JYBA 2FYUG 1ZN5A 1N7SA 2IBZI 2N1TD 3H1IJ 4O9BA 3M0DC 2RH0A 1SQQD 4L76A 1MFTA 2B87A 2A45H 1EZVG 1FC2C 1HBWA 1S5LX 2Y9YA 1GW3A 1N73A 1W5CE 1HTLC 3L35A 5E79H 1AV1A 3H1ID 4OGQD 3CC4P 4EOTA 3IF4A 3IFMA 3L75G 4PV1B 3A3YB 3EQ2A 1VF5B 2IFMA 3H1HD 3H6PA 4JF7A 1M1KQ 3CL3D 1NYHA 4I1LA 1KILE
chains in the Genus database with same CATH topology
1LT1A 1EDLA 4NPDA 5C39A 2WMMA 2ZAEB 4ZMDA 1DEEG 1LP1B 5CBNA 2QRXA 2LXCB 4JBZA 1EDKA 2B88A 2M5AA 4HB1A 2KS1B 2B89A 2I8DA 4CPGA 5EFWB 1EC5A 1X0TA 2OTKE 2UWJE 1EDIA 1LP1A 1SS1A 5DJUB 3QWOC 2KZJA 1JM0A 4GOEA 3MHVA 4EYYQ 1ZXGA 2KI7B 2P58A 1Y47A 2LXBA 4ZNCA 1Q2NA 1H0TB 1OVRA 4ASWA 2K3RA 2KIKA 2M0BA 1U7MA 1BDDA 5DJTB 4HJGH 3FXDA 4GODA 4NPEA 2R44A 4KJMA 2QVAA 3S1KA 5CBOA 2KZIA 1U7JA 2B87B 2Q1KA 4BXLA 2SPZA 3FXEA 3MZWB 1H0TA 2LR2A 2M5AB 3PH0A 1NVOA 4K35A 1BDCA 4ASVA 4MN4C 5K5GB 4GOFA 2KUBA 1ZW0A 3RGUA 4IOIH 4K3AA 4WWIA 2HR3A 1MFTA 4HKZH 2B87A 2RKLA 1FC2C 2JWDA 3ZDMA 1OVUA 1EDJA 1JMBA 1S3JA 1OVVA 4NPFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT1 A;  1EDL A;  4NPD A;  5C39 A;  2WMM A;  2ZAE B;  4ZMD A;  1DEE G;  1LP1 B;  5CBN A;  2QRX A;  2LXC B;  4JBZ A;  1EDK A;  2B88 A;  2M5A A;  4HB1 A;  2KS1 B;  2B89 A;  2I8D A;  4CPG A;  5EFW B;  1EC5 A;  1X0T A;  2OTK E;  2UWJ E;  1EDI A;  1LP1 A;  1SS1 A;  5DJU B;  3QWO C;  2KZJ A;  1JM0 A;  4GOE A;  3MHV A;  4EYY Q;  1ZXG A;  2KI7 B;  2P58 A;  1Y47 A;  2LXB A;  4ZNC A;  1Q2N A;  1H0T B;  1OVR A;  4ASW A;  2K3R A;  2KIK A;  2M0B A;  1U7M A;  1BDD A;  5DJT B;  4HJG H;  3FXD A;  4GOD A;  4NPE A;  2R44 A;  4KJM A;  2QVA A;  3S1K A;  5CBO A;  2KZI A;  1U7J A;  2B87 B;  2Q1K A;  4BXL A;  2SPZ A;  3FXE A;  3MZW B;  1H0T A;  2LR2 A;  2M5A B;  3PH0 A;  1NVO A;  4K35 A;  1BDC A;  4ASV A;  4MN4 C;  5K5G B;  4GOF A;  2KUB A;  1ZW0 A;  3RGU A;  4IOI H;  4K3A A;  4WWI A;  2HR3 A;  1MFT A;  4HKZ H;  2B87 A;  2RKL A;  1FC2 C;  2JWD A;  3ZDM A;  1OVU A;  1EDJ A;  1JMB A;  1S3J A;  1OVV A;  4NPF X; 
#chains in the Genus database with same CATH topology
 3A0B E;  1FOS F;  1LT1 A;  2E5T A;  1S9K D;  3MIW A;  1RF1 C;  2P1J A;  4H44 D;  4NPD A;  1EDL A;  2WMM A;  4PD4 E;  1YIJ P;  1KB9 E;  2Y9Z A;  2ZAE B;  1FBM A;  1Q90 D;  3TNU A;  1DEE G;  5GTI E;  1N86 A;  2XDJ A;  1Z56 A;  3L74 J;  4UB8 H;  2QRX A;  5AVS B;  3L70 G;  1NTK G;  3Q5S A;  1DH3 A;  1EDK A;  1LWU A;  4I7Z B;  1RE4 C;  2M5A A;  1RHZ B;  3A2A A;  3JCU H;  3V2Q A;  1VQO P;  2O3J A;  3CXH I;  5CCG D;  1NU1 K;  1JY3 N;  1ZRT D;  2I8D A;  2GA1 A;  4L75 A;  1LTI C;  1BE3 D;  5AW3 B;  2QA4 P;  1AVY A;  2A06 G;  4CPG A;  2OYH B;  1LTJ A;  3O8Z A;  4C46 A;  2YMK A;  2UWJ E;  3USS A;  3V6I A;  5AW9 B;  2E74 B;  3CPW O;  2BCC D;  5KTB A;  2XND H;  2ZFC A;  1SQX J;  1S2E A;  3PRJ A;  1FZC A;  3H1L J;  4XA4 A;  3B8E B;  1IJD B;  3V5B A;  1BGY J;  1G1J A;  4I6M C;  1YI2 P;  1AQT A;  3CLQ A;  1L4A D;  2C0X A;  2KI7 B;  1ZOY C;  2P58 A;  5H2F H;  1HGZ A;  4BWN A;  3H1L E;  2OQQ A;  1E79 H;  1ZRT E;  2H43 A;  3F5H A;  1YTZ I;  3B5N B;  2GUS A;  3EWK A;  2I1K A;  3AE8 C;  3CCL P;  2AEM A;  1SQV E;  1DIP A;  2CPS A;  1OW8 A;  1S5L E;  2WWW A;  3B4S A;  1LT9 A;  5B5E H;  5CJ4 A;  3LW5 J;  2M0B A;  3EFF K;  1FDI A;  3TYY A;  1WT6 A;  4UB6 H;  1L0N G;  1QL2 A;  2DW3 A;  2P10 A;  4C7R A;  3C9I A;  3MUD C;  3AEC C;  3H1J J;  3G71 P;  1JTH B;  4HJG H;  4TT3 H;  2P7J A;  4W7Z A;  5AW7 B;  1KIL B;  2K88 A;  3RK2 D;  3CX5 D;  3SFD C;  1PP9 D;  4NPE A;  4UB8 E;  1ZV8 A;  5CCH A;  1M90 Q;  1T2K C;  1KV4 A;  4C7N A;  4KJM A;  2QJY B;  1IFI A;  1JY3 O;  2Z4E A;  1SQP K;  2IBZ E;  2M3B A;  4PD4 H;  3S1K A;  3H1J D;  1KFN A;  2CK3 H;  1L0L K;  3KHU A;  2K9J A;  3KPE A;  1L0L D;  4GKG A;  3CCR P;  3Q2Y A;  1HF9 A;  2PAJ A;  3HE5 A;  4GIF A;  4N78 E;  3EFG A;  1K04 A;  4N78 D;  2NPS A;  1FJK A;  2JKV A;  1LT9 C;  2ZYG A;  1KTM A;  3JCU E;  3H1K J;  3P7K A;  1EXI A;  2W90 A;  3AE9 C;  2IFN A;  3E1R A;  4DCK A;  1ZME C;  2JJL A;  2C9N Y;  1JOC A;  3CX5 H;  3L4F A;  3MD0 A;  3FXE A;  3CI9 A;  5CCG C;  2NPS B;  4D6T D;  1IFM A;  4ZKU A;  1KN7 A;  3M0D A;  2KP8 A;  1G1I A;  4JPZ B;  2QIW A;  3H1K E;  3HUS A;  3L72 G;  2D2C C;  1SQV D;  5KLI C;  2K9J B;  2Y0C A;  1SQV K;  1GL2 D;  2Q6Q A;  3MGN A;  3WUU A;  4IFD K;  4PD4 I;  4PV1 D;  1KIL C;  4C7N B;  1HGV A;  3O6Q A;  2JP3 A;  4OGQ B;  3WU2 H;  3AEE C;  2WSE J;  2HFE D;  1PGQ A;  2QJY C;  2AXT H;  2WZ7 A;  4LLH A;  3U59 A;  3WU2 E;  1K73 Q;  4PJ0 H;  1BCC J;  1NTZ J;  1UII A;  3VOP A;  1EXJ A;  4WBA A;  3CXH E;  3G9R A;  2FXM A;  1FZG A;  1QVF O;  3LW5 H;  2FYU J;  3TGU D;  1LT9 B;  4K3A A;  4H0L B;  5KJ7 A;  1M56 D;  2JDI H;  2N1T C;  1SQQ J;  2GUV A;  1KQL A;  2WPQ A;  1L0L E;  3B71 A;  3BCC G;  4N3Y B;  3H1I E;  1NU1 J;  2W83 C;  2KNC B;  3RBX A;  1LWU C;  1BCC G;  1FS0 E;  3ZDM A;  1S1C X;  1SQB G;  2QJK B;  1E5W A;  2J58 A;  2XZR A;  2ZVO B;  3H1H E;  4WY4 D;  1T8Z A;  3D71 A;  1BE3 E;  1SQQ E;  1ZLL A;  4WY4 B;  4W80 A;  1ZR4 A;  2AXC A;  1OVV A;  5AVV B;  5AW6 B;  3S4R A;  3GG2 A;  2KSJ A;  4WWI A;  3Q5R A;  2FXO A;  3JC2 2;  3CD6 P;  2QM7 A;  1KQF B;  1W2E A;  2R3S A;  2I1J A;  1BE3 J;  1GMJ A;  1NKZ B;  3A5T A;  1OXZ A;  3IAO A;  3WUV A;  5B66 H;  4ZKP A;  1YBK A;  3L71 E;  2HPC A;  4ZMD A;  3PLN A;  2Z5H A;  5BU8 B;  2HOD B;  3G4S P;  2LXC B;  3BVH A;  1CI6 B;  2B88 A;  3GMA A;  3H1L D;  1VF5 C;  1G2C B;  5AVZ B;  1J1D B;  4HB1 A;  3T97 B;  1N73 C;  1HJ0 A;  1SFC C;  1LNQ A;  1SFC D;  2QG4 A;  1M1J A;  2V7Q J;  1VPC A;  1BGY G;  1IFP A;  1IFD A;  3C8V A;  3CXH H;  3D6Z A;  2E75 C;  2IPP A;  4AYC A;  3KDP B;  1EC5 A;  1X0T A;  1RH5 B;  1PV3 A;  2QEX P;  3Q5P A;  2QE7 H;  2ZJS E;  4H13 D;  4DOJ A;  4AUW A;  1RF1 A;  2HG5 D;  4XFJ A;  1QLE D;  2O01 N;  2FXP A;  3BAS A;  1SQP E;  4GT1 A;  5DJU B;  3S9O A;  3TDK A;  3VP9 A;  1RQU A;  2G8Y A;  1SQQ K;  2FBW C;  5AVT B;  1JM0 A;  2W8Z A;  1BSN A;  1BGY D;  4BRY A;  2BCC G;  3M06 A;  3IN6 A;  1RE4 A;  1SQB K;  1JY2 N;  1L4A C;  4EYY Q;  4JYC A;  1ZXG A;  1TU3 F;  5CCH C;  1JY2 O;  5APY A;  2M3E A;  1J1D C;  1N73 B;  4QMA A;  2FKW B;  3L70 J;  1M1J B;  2A45 I;  2PGD A;  5TIS E;  2D2C B;  5KAF H;  1H0T B;  3T97 A;  1LTS C;  1IFN A;  1PGO A;  3OW2 O;  5AVU B;  4B86 A;  1CI6 A;  2G3A A;  2K3R A;  2PRR A;  1RY3 A;  1URQ A;  1WRG A;  2BAS A;  2C0W A;  2BEZ F;  3AE6 C;  3H1L G;  1JY3 P;  3M9Q A;  4R4L A;  3L70 D;  3CCU P;  1PFI A;  1U7M A;  1LGH B;  2YKP A;  2YKQ A;  3FWL A;  3NXS A;  2H89 C;  2N9Y B;  4HH2 A;  1OIP A;  4OH8 B;  2E5Y A;  4WVZ A;  1QX8 A;  2ZXE B;  2R5D A;  3A0H H;  2FFD B;  1SQP D;  2KK7 A;  2YO3 A;  3B5N D;  3L74 E;  3HD7 D;  2IDB A;  2Z5I A;  3HD7 C;  1VQM P;  3LIE A;  2W6B A;  1YQ4 C;  5AW0 B;  1OX3 A;  1L0N E;  3P32 A;  2R44 A;  4IL6 X;  5BVZ A;  4BRY B;  2YIU B;  1L4A B;  5KLI B;  3AEA C;  4EI2 A;  1NH4 A;  3RL0 C;  2IZ0 A;  4HYT B;  4YPC A;  2RMZ A;  4LGD E;  2OYI C;  2C9L Y;  1PGJ A;  2QJP C;  1YTZ T;  3HTK A;  2Q7C A;  1H88 A;  3HRN A;  1RF1 B;  1IC2 A;  4RES B;  4U7J A;  2KNC A;  1JO5 A;  1BCC D;  2E74 D;  1NTZ G;  1R5S A;  4BXL A;  2KYV A;  1NTM E;  4W7Y A;  2IZ1 A;  3R2P A;  1N7S C;  5APW A;  5APV A;  1N7S D;  2N1T A;  5APX A;  1NHL A;  5GTH H;  3TGU J;  5BU5 A;  4OWF A;  1SQX E;  1M8O B;  3Q3D A;  2WSF J;  3E1I A;  5B66 E;  1S9K E;  1MKM A;  4L74 A;  4RO0 A;  2YKO A;  1VQ7 P;  1KIL D;  2ITA A;  1NVO A;  3H32 B;  4K35 A;  4RKU J;  4Y28 J;  5KLV E;  1T6A A;  2MKV A;  2A45 G;  2IX7 C;  3R4Y A;  1QVG O;  3KYQ A;  4GOF A;  4D6T G;  3VMY A;  1NTK E;  3P8C D;  4PD4 D;  1NTZ D;  3CCV P;  2HPC B;  1VQ4 P;  2JR8 A;  1P84 H;  1USD A;  2NPS C;  3GF3 A;  4YXW H;  3L72 D;  3KXD A;  2AEF A;  3L37 A;  3E7K A;  1ZR2 A;  1FE6 A;  4H0L C;  3L75 J;  2J5U A;  1VQL P;  2ZVN B;  2A06 E;  3B5N C;  3V2P A;  1NO4 A;  2OYI B;  4HKZ H;  3RK3 B;  2RKL A;  2KB7 P;  3ITK A;  3HE5 B;  5GTI H;  1OVU A;  2OGU A;  3AEB C;  4YXD C;  3CC2 P;  1KB9 H;  3L75 D;  3RL0 D;  1R8E A;  5AVY B;  1FOS E;  1L0L G;  1SFC B;  3H1I G;  2BCC J;  3HD7 B;  1NTM K;  3H1J G;  3I5C A;  2FYN B;  1L0N D;  1SQB D;  2ZYD A;  1SQB E;  1JEK A;  1SQX K;  1MUU A;  1CZQ A;  3GHG B;  5AW1 B;  2FFD A;  1GK6 A;  1SQQ G;  2ZT9 B;  1JTH A;  1AVO A;  1N2D C;  3U1C A;  5C39 A;  1L2P A;  3PTZ A;  2GM4 A;  5KJ7 C;  1HUC A;  1L0N J;  2IBZ D;  1FZC C;  5AVX B;  1LP1 B;  1VL2 A;  5CBN A;  3M9B A;  2XU6 A;  3GHG C;  3O6Q B;  1R5L A;  2D2C D;  1NTK K;  2NRG A;  1PPJ G;  2BEQ D;  1SQV G;  2RN0 A;  2Y0D A;  3L73 E;  1MV8 A;  2YNY A;  4R4M A;  3OJA B;  3TSI A;  1ZP0 C;  3F89 A;  2YIU C;  2E75 D;  3CC7 P;  1USE A;  3LID A;  5EFW B;  1BSH A;  1YQ3 C;  1J2J B;  2OTK E;  3C1L A;  1KYO I;  1PP9 E;  2MJZ A;  4H44 B;  1EZV E;  1L0N K;  1BGY E;  2L5G B;  4GDO A;  2K9Y A;  2XV5 A;  1LJ2 A;  1VQ5 P;  1H8A A;  1IK7 A;  2KZJ A;  3AE3 C;  3BRT B;  4H13 B;  1IO4 A;  1VQK P;  2WSC J;  3NTN A;  1QL1 A;  1JUN A;  3MUD A;  4GOE A;  4Y99 B;  1JCC A;  1T3U A;  2WSS H;  3RBZ A;  3N4X A;  2QSI A;  5GTH E;  2YO2 A;  1QEX A;  4JQ0 D;  1L0L J;  4WY4 C;  1SQP G;  2YMY A;  2POH A;  3I56 P;  5APQ A;  3Q1M A;  3CWB J;  1Y47 A;  1KMI Z;  1AA0 A;  4Y99 C;  2E76 C;  5APT A;  3VN0 A;  1LTA C;  2E76 D;  2LXB A;  2FFD C;  1NU1 G;  4ZNC A;  1Q2N A;  2N1T B;  4IFF A;  1QGK B;  3L70 E;  1LTJ C;  1OVR A;  1AJY A;  5KKZ C;  1JB0 J;  3U1A A;  3CWB E;  2YXR B;  4N6J A;  3RK3 E;  1LWU B;  1NTZ K;  3CWB D;  2KIK A;  4TLF A;  2QJP B;  5H2F E;  3RK3 D;  1JNM A;  5KLV K;  1K9M Q;  1GZL A;  3I55 P;  5APS A;  1KC8 Q;  5DJT B;  1FU1 A;  3L71 J;  2WPS A;  3CME P;  1EQ7 A;  3NFQ A;  1VQ6 P;  1CSB A;  1L4A A;  1X79 B;  2JWA A;  3M9H A;  2VRS A;  3RK2 C;  1S4X A;  1EZV D;  1OWA A;  1DEB A;  4I7Z C;  2E75 B;  3GLM A;  1T2K D;  1GL2 A;  3BAT A;  2OTJ P;  1RF0 C;  1DX7 A;  5CHX A;  2QVA A;  3L71 D;  1CW5 A;  1OZH A;  3BCC D;  3WMM 0;  2WIT A;  1Q86 Q;  1K05 A;  3BCC E;  3SFE C;  2AEJ A;  2FYU D;  2XNX A;  2WQY C;  3A0B H;  4Z1M H;  2B87 B;  1HVV A;  3KZI H;  2Q1K A;  3CCQ P;  1K8A Q;  1SLQ A;  2WPV B;  1LTJ B;  1BE3 G;  1URQ B;  1GTW A;  3BCC J;  3PP5 A;  2E74 C;  4LC1 A;  3AEG C;  1N7S B;  1YHQ P;  1LTB C;  2CPB A;  3L73 J;  1HWT C;  1HH0 A;  2SPZ A;  2B9B A;  2M8R A;  1IK9 A;  3MZW B;  2JO1 A;  3SWK A;  2WSF H;  1YJ9 P;  1H0T A;  4IFM A;  1YJW P;  2LR2 A;  2WPR A;  5CCH D;  3VYI A;  3CX5 E;  4A7P A;  3K5B A;  3H25 A;  1DD4 A;  2M5A B;  3FGA D;  4U3F D;  1NTK D;  3P8C E;  4U3F E;  1NTZ E;  2O01 H;  3BRV B;  1NTM G;  2R5B A;  5KAI H;  3A7O A;  1GL2 B;  3KZI E;  2PP6 A;  3CCM P;  4ASV A;  1KFM A;  4AQR D;  2FYU E;  2KUB A;  1IZN B;  1P84 E;  1PP9 J;  1NTK J;  2NPS D;  3V4Q A;  1GD2 E;  1XTG B;  1NWQ A;  2QM8 A;  1UIX A;  1FJP A;  3D6Y A;  3KQG A;  4IOI H;  4XE5 B;  2L91 A;  4D6T E;  2H88 C;  4KT0 J;  3MP7 B;  1M57 D;  2HR3 A;  5L8R J;  3SSU A;  3W67 A;  1A02 F;  3VP8 A;  3L75 E;  2WVR A;  4L73 A;  1YYC A;  3H1K D;  1X9V A;  3HUS C;  1Q7Y Q;  2OYO A;  4DZO A;  1Q82 Q;  2O1K A;  1VQ8 P;  1EDJ A;  2JWD A;  1JMB A;  3GW6 A;  1MFZ A;  4D6T J;  1G2C A;  3OA7 A;  1S3J A;  2Y0E A;  1M1J C;  1S5L H;  3TF5 A;  2KLU A;  3CMA P;  3TGU G;  3RL0 g;  3RK2 B;  1JMM A;  3TNU B;  3V2R A;  1SQB J;  4NPF X;  1SQV J;  3VMA A;  1AQ5 A;  2HOD A;  3H1H J;  2BCC E;  2IYO A;  4KHX A;  5CJ0 A;  5KLV D;  5TJH A;  1S72 P;  1GU4 A;  3P8M C;  3H1K G;  1RE3 A;  4EIJ A;  1GW4 A;  3CXH D;  3II6 A;  1FAV A;  3JSV C;  1U57 A;  3SWF A;  2Q3E A;  4H44 C;  1P84 D;  1X22 A;  1RQV A;  5KJ7 D;  1YIT P;  3H1J E;  2NZ2 A;  3TGU E;  2Q5U A;  1T3J A;  2O1J A;  5AVQ B;  1VDF A;  5AW2 B;  4WB4 A;  1KYO H;  5M1B A;  3RL0 B;  2IYP A;  5KKZ B;  1KD1 Q;  3CCE P;  1NTM J;  1WMK A;  4JBZ A;  1KOR A;  2R32 A;  2FY8 A;  2J59 M;  2W6J H;  1PIX A;  3A0H E;  3AE5 C;  3HE4 A;  4WY4 A;  3TK1 A;  1FZF A;  2N9B A;  1PGP A;  2KS1 B;  3VTP C;  2WT7 A;  1LTT C;  2E42 A;  1NU1 D;  2ZXX A;  3M91 A;  2B89 A;  3UIA A;  1NTM D;  3ABV C;  3L73 G;  1XTC C;  1PPJ E;  4PJ0 E;  1FDM A;  5AW4 B;  1OFC X;  3L74 G;  2AXT E;  1LTG C;  2Q3I A;  3AEF C;  1RE3 C;  4IL6 H;  2XKM A;  1KYO D;  1EDI A;  1LP1 A;  1SS1 A;  2ZT9 C;  2ZYA A;  1YJN P;  1W2B O;  3L74 D;  5KAI E;  1OW6 A;  1NAF A;  3QWO C;  5AW8 B;  1GDT A;  1DD3 A;  1OMI A;  3GHG A;  1Y8A A;  1J1E B;  3MHV A;  3FX0 A;  5AW5 B;  1PP9 G;  1Y9B A;  2WSC H;  4RJT A;  2HLO A;  3W68 A;  3HD7 A;  2WTY A;  1FZB A;  1SFC A;  2HYN A;  3VMZ A;  2W6A A;  2FYZ A;  1VQP P;  2FYN C;  3AE4 C;  1PZQ A;  3D70 A;  1NAY A;  1RF0 A;  3HUS B;  1KB9 I;  3L71 G;  4PV1 C;  1GU5 A;  5KAF E;  5TIS H;  1FZA A;  1SQX G;  3OAK A;  1D7M A;  2KS1 A;  2H7H A;  2OYI A;  1NOH A;  3CX5 I;  3L36 A;  3PHL A;  4ASW A;  2W27 A;  3HE4 B;  3RK3 C;  5E79 E;  1SQX D;  1PPJ D;  2P67 A;  5AVW B;  4DJG A;  5KLV G;  3AE7 C;  1NU1 E;  1PL5 A;  3CCJ P;  1BDD A;  2FYU K;  1GK4 A;  2JEE A;  2IBZ G;  2V4H A;  1P84 I;  3MTU E;  3CWB G;  1VF5 D;  2KXP B;  3FXD A;  2E76 B;  2K37 A;  3PJS K;  4GOD A;  1KYO E;  4UB6 E;  1EZV I;  1NKN A;  4I2L C;  1IFJ A;  2V7Q H;  3H32 A;  2OYH C;  1KIL A;  4IL6 E;  5APU A;  5B5E E;  3L72 J;  4OGQ C;  5CBO A;  1NJI Q;  1KQS O;  2E43 A;  3IR9 A;  1J1E C;  5AVR B;  2KZI A;  1VQ9 P;  1U7J A;  1KZU B;  1MZ9 A;  3AE1 C;  1URQ D;  3FWN A;  1M7L A;  1URQ C;  2WSE H;  3NMD A;  2A06 D;  3L72 E;  2K1A A;  3L73 D;  1JY2 P;  2LKM A;  3AED C;  3G6E P;  1N7L A;  1H89 A;  1N8R Q;  3HTK B;  5CMZ A;  1SVF A;  2H8P D;  3B5N A;  3SWY A;  1NGM B;  1VQN P;  3WUT A;  1SP4 A;  2WT7 B;  4U3F J;  2YXQ B;  4DT0 A;  3M0A A;  2QJK C;  1Q81 Q;  3PH0 A;  2Q9I A;  2R3C A;  1GL2 C;  1OW7 A;  2KLV A;  2KSE A;  2P2U A;  2KOG A;  1KQG B;  4M3L A;  3CCS P;  2OYH A;  1BDC A;  1X8Y A;  1AFO A;  3V2N A;  1SQP J;  2O01 J;  3AE2 C;  3GF7 A;  4MN4 C;  5K5G B;  2PFX A;  1ZW0 A;  4YTP C;  1KB9 D;  3QH9 A;  1FZE A;  4EDF A;  1JCD A;  1FZC B;  1A02 J;  4U3F G;  3VMX A;  3V4W A;  5KLV J;  1BCC E;  1FDO A;  3G3Z A;  3N7N A;  2OAR A;  1HJB A;  4H13 C;  3RGU A;  3H1H G;  4H0L D;  2OTL P;  2ZT9 D;  4OVN F;  5CCG A;  4JYB A;  2FYU G;  1ZN5 A;  1N7S A;  2IBZ I;  2N1T D;  3H1I J;  4O9B A;  3M0D C;  2RH0 A;  1SQQ D;  4L76 A;  1MFT A;  2B87 A;  2A45 H;  1EZV G;  1FC2 C;  1HBW A;  1S5L X;  2Y9Y A;  1GW3 A;  1N73 A;  1W5C E;  1HTL C;  3L35 A;  5E79 H;  1AV1 A;  3H1I D;  4OGQ D;  3CC4 P;  4EOT A;  3IF4 A;  3IFM A;  3L75 G;  4PV1 B;  3A3Y B;  3EQ2 A;  1VF5 B;  2IFM A;  3H1H D;  3H6P A;  4JF7 A;  1M1K Q;  3CL3 D;  1NYH A;  4I1L A;  1KIL E; 
#chains in the Genus database with same CATH homology
 1LT1 A;  1EDL A;  4NPD A;  5C39 A;  2WMM A;  2ZAE B;  4ZMD A;  1DEE G;  1LP1 B;  5CBN A;  2QRX A;  2LXC B;  4JBZ A;  1EDK A;  2B88 A;  2M5A A;  4HB1 A;  2KS1 B;  2B89 A;  2I8D A;  4CPG A;  5EFW B;  1EC5 A;  1X0T A;  2OTK E;  2UWJ E;  1EDI A;  1LP1 A;  1SS1 A;  5DJU B;  3QWO C;  2KZJ A;  1JM0 A;  4GOE A;  3MHV A;  4EYY Q;  1ZXG A;  2KI7 B;  2P58 A;  1Y47 A;  2LXB A;  4ZNC A;  1Q2N A;  1H0T B;  1OVR A;  4ASW A;  2K3R A;  2KIK A;  2M0B A;  1U7M A;  1BDD A;  5DJT B;  4HJG H;  3FXD A;  4GOD A;  4NPE A;  2R44 A;  4KJM A;  2QVA A;  3S1K A;  5CBO A;  2KZI A;  1U7J A;  2B87 B;  2Q1K A;  4BXL A;  2SPZ A;  3FXE A;  3MZW B;  1H0T A;  2LR2 A;  2M5A B;  3PH0 A;  1NVO A;  4K35 A;  1BDC A;  4ASV A;  4MN4 C;  5K5G B;  4GOF A;  2KUB A;  1ZW0 A;  3RGU A;  4IOI H;  4K3A A;  4WWI A;  2HR3 A;  1MFT A;  4HKZ H;  2B87 A;  2RKL A;  1FC2 C;  2JWD A;  3ZDM A;  1OVU A;  1EDJ A;  1JMB A;  1S3J A;  1OVV A;  4NPF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...