1EDLA

Staphylococcal protein a e-domain (-60), nmr, 22 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCAL PROTEIN A
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edlA00
1EDLA 1ZW0A 5DJUB 2OTKE 4NPDA 4EYYQ 5CBOA 2Q1KA 1H0TB 2B87A 4JBZA 2LXCB 1JM0A 1FC2C 5C39A 1U7MA 2SPZA 1U7JA 1X0TA 3MZWB 2KS1B 2KUBA 1OVRA 2UWJE 3S1KA 2ZAEB 3PH0A 5DJTB 2QVAA 3ZDMA 2QRXA 1Q2NA 4K35A 5CBNA 1OVUA 1EDKA 1ZXGA 4NPFX 1EC5A 1NVOA 4HKZH 4BXLA 2I8DA 2B88A 3FXEA 4IOIH 1LP1B 2M5AA 1OVVA 3FXDA 2KIKA 2JWDA 1MFTA 4K3AA 2KZJA 1DEEG 2M0BA 4KJMA 4ZMDA 2M5AB 1LT1A 2P58A 1EDIA 4MN4C 1Y47A 2LR2A 1JMBA 4GOEA 2WMMA 4HJGH 2HR3A 2RKLA 2B87B 1H0TA 2KZIA 3QWOC 2B89A 3MHVA 1BDCA 4GOFA 4ASVA 4GODA 1SS1A 1S3JA 4ASWA 5EFWB 2R44A 4ZNCA 2KI7B 4HB1A 3RGUA 1LP1A 4NPEA 2LXBA 4CPGA 1EDJA 4WWIA 5K5GB 2K3RA 1BDDA
chains in the Genus database with same CATH superfamily
1EDLA 1Q82Q 1LNQA 1Z56A 3CCVP 5GTIH 2KYVA 3F89A 5CCHC 3Q5RA 1NTZG 3AE9C 1NTZK 2C0XA 2NPSD 5DJUB 2PFXA 3H1LG 1Q81Q 5B5EE 3ABVC 2K9JB 1GL2C 1NTZE 1NTKG 2WSCH 5CBOA 3L37A 1OX3A 1SFCC 3GMAA 3HTKA 3WU2E 5TJHA 2E75D 1EZVE 1J1EC 3I5CA 1W5CE 4Y99B 5AW6B 4B86A 3I55P 1SQXJ 1HWTC 2P10A 4JBZA 3WUVA 2LXCB 3TF5A 1EQ7A 2XKMA 4UB6E 3VP8A 2QM8A 1FS0E 2M3EA 1L0LJ 1SQBD 4U3FG 2OYIA 2KSEA 3Q5PA 2A45H 1S5LH 1VPCA 2IPPA 1L0LD 1L0NK 1M57D 1KILC 1S1CX 1SFCB 1SQBJ 2ZT9D 3A0HE 3R4YA 4Y99C 3CC4P 3HE4B 3A0HH 2IBZE 1USEA 1L0LK 1M1JA 3C9IA 2QG4A 1WMKA 3KZIH 2ZAEB 2C9LY 3CX5H 3CCSP 2FXOA 1ZP0C 3BCCD 3CL3D 3TNUA 2L5GB 5H2FH 1HJBA 1FBMA 4A7PA 1SQVD 1NAYA 2O1KA 2FBWC 3U1CA 2JKVA 4ZKPA 2Y9YA 3D6ZA 1SQBE 2M8RA 1KILB 1RE3A 2R5BA 4NPFX 4XA4A 4LC1A 1PV3A 1NVOA 4JQ0D 1L0NE 5AVRB 1NJIQ 2QE7H 1FOSE 1PGJA 1FZBA 3AEDC 2I8DA 2W6BA 1LTAC 3M0DA 4JYCA 3SWFA 1M90Q 4U3FD 4EI2A 1M1JC 3M9QA 4XFJA 2KB7P 5M1BA 3BCCG 2AEFA 1NU1G 3IFMA 1BGYD 2M5AA 2NPSC 1K8AQ 1OVVA 2J59M 3CWBD 3B5NB 3V6IA 2HODA 1JY2P 2JWDA 1AA0A 2XU6A 3CPWO 2WT7B 1BE3E 1KZUB 3B5ND 3V2QA 4RJTA 1LTIC 4K3AA 3JC22 2KSJA 3A0BE 2AEJA 4HYTB 1X9VA 2W27A 1MV8A 1LTBC 1M1JB 2A06D 2WPQA 4TT3H 1LT1A 1JTHA 3RK3E 3PHLA 2KS1A 2AXTH 3JSVC 1FE6A 1D7MA 4D6TD 3B5NC 1JY3P 1JMMA 3BVHA 1Y47A 2BCCD 2I1JA 3L72E 4LLHA 1HH0A 1LTJB 3M06A 2WMMA 4GOEA 1PZQA 3II6A 5APSA 2J58A 2QJKC 2WPSA 2HR3A 2W6JH 5L8RJ 3S4RA 1PFIA 2RKLA 1FZCC 3SSUA 4AYCA 2WWWA 2KP8A 1KQSO 2B87B 3FX0A 1SQQK 3GLMA 3KYQA 1EXIA 2B89A 3CCJP 3AE7C 1GW3A 3D70A 1L4AA 1LTJC 3KPEA 2JO1A 1JTHB 2P7JA 4GOFA 3RK2C 3A5TA 3H1ID 2Y0DA 3IAOA 3MP7B 4GODA 1EXJA 1X79B 1JOCA 1S3JA 3LW5H 3MGNA 5AW2B 5AW9B 4PD4H 3H1HE 4BRYB 2QEXP 4ASWA 2FKWB 4RESB 4EIJA 1HGZA 1GZLA 1KMIZ 2R3SA 3AEBC 3B8EB 4BWNA 3L71D 1YBKA 1YHQP 1URQB 2KLVA 1GK6A 4DZOA 5TISE 3CXHH 2PGDA 3L73E 3HUSB 5AW5B 2GA1A 5AVTB 2LXBA 2OGUA 4N6JA 3CCMP 1SLQA 2H8PD 3L36A 3VTPC 1XTCC 1ZOYC 2O1JA 4DT0A 2JDIH 2V4HA 1QL2A 1RF0A 2W83C 4R4MA 3V4QA 2C9NY 1KYOE 5APWA 2OYIC 1RQUA 1FDMA 1UIIA 2WVRA 4WY4A 1KB9I 2E5YA 4I2LC 1OW6A 1AVYA 1HGVA 4I7ZB 1YJWP 1URQC 1NTMG 2A45I 2Q6QA 2WT7A 1HBWA 1G1JA 1OW8A 2FFDC 1VQPP 1A02F 3B5NA 1S9KD 3TGUD 1X22A 1OMIA 1H8AA 5KKZB 4GIFA 1IO4A 1RF1C 2YIUC 3PTZA 3CCRP 3PRJA 1T3JA 3O6QB 4H13D 1LT9A 2QA4P 2ITAA 2CK3H 4I7ZC 2HPCB 1H0TB 1IK9A 1J1DB 1VQ7P 1VQ4P 3PP5A 1URQA 3CCLP 1S4XA 3W67A 4PV1C 1NKZB 5KLIC 1JM0A 3RL0g 4C46A 1HF9A 1SQXD 2V7QJ 1RY3A 3RK2D 2WITA 1FC2C 2C0WA 1EZVD 1QGKB 1U7MA 1L2PA 5C39A 3LIEA 2FXPA 3L70G 3C1LA 3KZIE 1FAVA 1SQXK 1LWUB 2E74C 2E76D 2GUVA 2R32A 1HJ0A 3TK1A 1SQPG 2H89C 4PV1D 1X0TA 3H32B 3L74E 4I1LA 4DJGA 3G3ZA 1J1DC 1RE4A 2O01J 1NTKJ 2UWJE 5AW8B 5KAIE 1NOHA 3V2PA 1SQVJ 3JCUE 5KLVG 4I6MC 3KDPB 2IBZG 3PH0A 5DJTB 4PD4I 1K05A 2QRXA 2I1KA 1NTKD 1SQBG 3A0BH 1SQBK 3Q3DA 1OVUA 1TU3F 1ZLLA 1NWQA 1KFNA 3AEFC 4O9BA 3Q5SA 2YKQA 1NYHA 1GU5A 3QH9A 1LWUC 2E74B 2OTLP 5H2FE 2WPVB 2ZT9C 1QX8A 1YI2P 3HE5A 1BCCJ 4BXLA 1VQ8P 3GHGB 3WU2H 1KB9D 1BGYJ 2KXPB 1URQD 1G2CB 1NU1E 2ZFCA 1SQVE 1RQVA 3RL0C 3SFEC 3VMZA 1YQ3C 1E5WA 3MIWA 4KT0J 3N4XA 3CI9A 3L71G 4OVNF 5AVQB 1ZRTD 1T2KD 2YMKA 3EFFK 2G3AA 5AW7B 2Y0CA 2WTYA 2ZT9B 3VYIA 2ZVNB 3TYYA 3G71P 1OXZA 1GD2E 3RL0D 3V2NA 4DCKA 2RMZA 3MD0A 2KZJA 1GMJA 2R3CA 1PPJG 4OGQC 1DEEG 3L35A 1ZN5A 1NU1J 3VOPA 4H0LC 5CMZA 4ZMDA 5AW0B 3RL0B 1QEXA 1QL1A 2BCCJ 3B4SA 3RK3C 2JJLA 1LT9C 3H32A 3NMDA 2FY8A 3T97B 1NU1D 2PAJA 3CCEP 3CC7P 4C7RA 1CW5A 3L75E 5CCHD 2QM7A 3U59A 3SWKA 2Z5IA 1K73Q 1S2EA 4C7NB 1LGHB 4JYBA 2Y0EA 2YKOA 2Z5HA 4RO0A 2WSFH 4IL6X 4L76A 1RH5B 1LTTC 2GUSA 4H0LB 3BASA 1NTMK 2BEZF 3B71A 3MUDC 1JY2O 2KZIA 1H89A 3H1JJ 3QWOC 3M0AA 3GF3A 1VQOP 3BCCE 1M1KQ 2XDJA 4UB8H 4EDFA 3L75J 1N73B 1ZMEC 1BDCA 1RF0C 3JCUH 1GL2B 2IFMA 3TGUE 1JY3N 2WSEH 5AVUB 1BGYE 3AE2C 1OW7A 1RE3C 1LWUA 2KLUA 3L75G 2OTJP 1FJKA 2FYZA 5AVZB 4IL6E 5GTIE 2CPBA 3O8ZA 1FZAA 5EFWB 5APYA 1K9MQ 1KORA 2R44A 3H1KE 3OJAB 1VF5B 2OYHB 1JUNA 2KI7B 3USSA 2FYNB 4HB1A 3PJSK 3M9HA 3BATA 1R5LA 3VN0A 1M8OB 1RHZB 1JY2N 1SP4A 1LTJA 1VF5D 4NPEA 4CPGA 2RN0A 2BASA 3P8CD 2JEEA 4WWIA 1KILE 4H0LD 5KAFE 3M9BA 3HTKB 5CCGC 3OW2O 1SQQG 3KXDA 1MKMA 2BCCE 3L72D 4OGQD 1L4AC 1GDTA 2E42A 3BRTB 4W80A 2OQQA 2WSEJ 2KNCB 2OYHC 1UIXA 3RK3D 3MUDA 2FYNC 3H1HD 3V5BA 1AFOA 1AJYA 3G4SP 3TGUJ 1DD4A 3VMYA 4BRYA 1FZCA 1L4AD 3AEAC 2HODB 1ZW0A 2ZXEB 2OTKE 3L74D 5E79H 1RF1A 1U57A 2WSFJ 1L4AB 1R5SA 2MJZA 2Z4EA 2E76C 2E74D 4EYYQ 1EDJA 2IFNA 3L70D 1T6AA 2FYUK 4IL6H 3WMM0 1M56D 4U3FE 2B87A 1AQ5A 1BE3J 3L70J 1NH4A 4OWFA 2M3BA 1NHLA 2WSCJ 5CCHA 2FFDA 1QVFO 1L0ND 2IBZI 3L73G 3NXSA 1G1IA 3P32A 5BU5A 4WB4A 1FJPA 3K5BA 2QJYB 2WSSH 4U7JA 3H25A 1A02J 3V4WA 5AVYB 3NFQA 2OYOA 3T97A 1PPJE 2K9JA 2E43A 1NU1K 1R8EA 2KUBA 2A06E 3L71E 3H1IG 3D6YA 3L70E 1QLED 3H1JG 2WQYC 4W7ZA 1QVGO 3AEEC 2H7HA 3P8MC 1FZFA 2GM4A 1PP9E 5GTHE 2QVAA 1L0LE 3FWNA 3ITKA 3ZDMA 2XNXA 3E1RA 4K35A 5CBNA 1PGQA 3P8CE 3SWYA 1KC8Q 2QJKB 3CXHI 1ZXGA 1Y8AA 1N7SB 3CXHE 1IFJA 1P84I 3AECC 3HRNA 3E1IA 5KAFH 2QIWA 1SQVK 2AEMA 3MTUE 4HKZH 2HPCA 4LGDE 2IDBA 1PIXA 1Q90D 2IZ0A 1IJDB 1JB0J 2YXQB 5KLVK 1L0NG 1IFDA 1ZV8A 2J5UA 1BCCG 3FXEA 4HH2A 1BCCD 5AVSB 1SQPE 1CZQA 5AVVB 1Q86Q 3RK2B 2YXRB 1LP1B 2O3JA 4L73A 1SFCD 1KN7A 1SQPK 3H1JE 1OWAA 2H88C 2YO3A 2NRGA 1N7SC 3CWBG 1KYOI 1WRGA 1P84D 1BSHA 1PP9D 1MFTA 1KTMA 3F5HA 4WBAA 3AE6C 5BU8B 5KLVJ 3TNUB 1LTGC 1OFCX 4L75A 4D6TE 2RH0A 4IFDK 3OAKA 3L74G 1DIPA 5APVA 1PP9J 1DH3A 2K1AA 4KJMA 2IBZD 3L72G 1IFMA 1JNMA 1SQPJ 2W8ZA 3RBXA 1GL2A 1EZVI 2P58A 1LTSC 1BGYG 4YTPC 1IFIA 1EDIA 1T8ZA 3L4FA 4MN4C 4PD4E 4PJ0E 4DOJA 5B66E 3GHGA 2WZ7A 2V7QH 5APXA 3CC2P 3WUUA 2OYIB 1NAFA 2G8YA 4HJGH 2BEQD 3S9OA 1HTLC 4D6TJ 1ZR4A 3RBZA 1VL2A 3TDKA 2IX7C 3L73D 2KK7A 2D2CB 2K37A 1DX7A 1SQVG 4D6TG 1H0TA 1OZHA 3VMAA 2R5DA 4N78E 3BRVB 1FU1A 1KYOH 2NPSA 3IF4A 2B9BA 4H13C 5GTHH 4RKUJ 2N9YB 4Y28J 3CXHD 2FYUD 1IZNB 2YIUB 3KHUA 5CCGD 1IFNA 1J2JB 1N86A 2NPSB 1RF1B 2KOGA 4ASVA 2O01H 1NTMJ 2L91A 3M0DC 5BVZA 3GF7A 4WY4D 1KQGB 2D2CC 1YITP 2YNYA 1YJNP 4H44B 3H1HG 1FDIA 3NTNA 1Y9BA 3Q1MA 1LJ2A 1ZRTE 4H13B 2JR8A 4JF7A 1AQTA 1N7SD 2AXTE 4H44D 3H1KG 1E79H 1NTZD 1YTZT 1DEBA 3O6QA 1G2CA 3C8VA 5K5GB 2ZYAA 1NGMB 2FXMA 1X8YA 1PGOA 1BDDA 3H1HJ 5APQA 2Q7CA 1KD1Q 1NKNA 1KQLA 3H6PA 4GT1A 3H1IE 2HG5D 3L72J 2ZXXA 4H44C 1FZGA 5E79E 2OARA 3H1LE 3L74J 3Q2YA 3HD7D 1S5LE 1VDFA 1HUCA 1NTKE 1MZ9A 2YMYA 3A3YB 4W7YA 4EOTA 1NTME 1MUUA 1DD3A 1PPJD 4PJ0H 2Q3EA 1GK4A 3PLNA 4YPCA 4KHXA 5B66H 5KJ7C 1GU4A 3HE4A 1FZCB 1VQNP 4NPDA 3GHGC 1BE3D 2Q1KA 1KILD 2P2UA 1OIPA 2W6AA 1HVVA 1KFMA 1N2DC 1SFCA 2JWAA 3H1KJ 5KTBA 1W2BO 1VQ6P 2CPSA 2P1JA 1L0NJ 5CHXA 5AW1B 5KJ7A 1XTGB 1BCCE 2JP3A 3H1KD 3IN6A 3UIAA 2ZVOB 1FZEA 1KB9H 1KV4A 3E7KA 3CCUP 2OYHA 3M91A 3CCQP 3I56P 3GG2A 1CSBA 2IYPA 2WPRA 3OA7A 4OGQB 5KLVE 3HUSC 2K9YA 2YKPA 1BE3G 2Q9IA 1GTWA 3IR9A 3CMAP 2N1TB 2SPZA 1FOSF 1U7JA 3LW5J 3AEGC 3HD7B 2KS1B 3MZWB 3RK3B 2PP6A 2Q3IA 1PP9G 1OVRA 4XE5B 1GW4A 3S1KA 3U1AA 4AQRD 2IZ1A 2N1TA 2N1TD 3P7KA 2ZYGA 4UB8E 4OH8B 1P84E 1PGPA 1VQMP 1VQKP 2A06G 1EZVG 1PL5A 2HYNA 3CLQA 3EQ2A 4GDOA 1Q2NA 4ZKUA 1W2EA 3AE8C 1EDKA 1FDOA 3V2RA 3G9RA 1CI6A 2Q5UA 1Q7YQ 2FFDB 2HLOA 3BCCJ 1IFPA 1L0LG 1EC5A 2N1TC 3KQGA 4U3FJ 1T2KC 5CJ0A 1JY3O 1SQXE 3HD7C 1RE4C 5AW4B 1N73C 1KQFB 3G6EP 3CX5D 5KKZC 2B88A 1SQXG 4M3LA 2IYOA 2ZYDA 2K88A 3AE5C 5AVXB 5KJ7D 4YXWH 5TISH 4IOIH 3HUSA 4JPZB 4GKGA 1KILA 3FXDA 3FWLA 4PV1B 5KLIB 2KIKA 2XNDH 2N9BA 2E5TA 4N78D 2POHA 3CWBJ 1VF5C 3CMEP 2FYUG 1IK7A 2KNCA 3VMXA 4WY4B 2M0BA 3AE4C 1NTKK 1H88A 5KLVD 1SQQD 2M5AB 4IFFA 2Y9ZA 3FGAD 2FYUE 1YJ9P 2LKMA 3CX5E 1VQ5P 5KAIH 3VP9A 2AXCA 3EWKA 4IFMA 2DW3A 1SQQJ 1SQPD 2QJPC 2LR2A 2O01N 1JMBA 3L73J 3AE1C 3AE3C 3SFDC 5AVWB 1K04A 2XV5A 3WUTA 4YXDC 1N7SA 2NZ2A 1CI6B 4WY4C 4Z1MH 4C7NA 3L75D 1IC2A 2MKVA 4QMAA 1KB9E 4WVZA 1VQ9P 5CJ4A 3H1IJ 3MHVA 5APUA 1WT6A 3R2PA 1SQQE 2E75C 2QJPB 1JCCA 3H1LJ 1NTMD 1S9KE 1P84H 3A7OA 3CWBE 5AW3B 2E76B 3H1JD 3HD7A 1N73A 1NO4A 1YTZI 5B5EH 5CCGA 2XZRA 3H1LD 4R4LA 3LIDA 1SS1A 3N7NA 4L74A 2PRRA 3A2AA 3EFGA 3TGUG 3TSIA 2FYUJ 2HFED 3CX5I 1YYCA 2P67A 1T3UA 4ZNCA 4AUWA 1AV1A 2H43A 1S5LX 1N8RQ 5APTA 1BSNA 1KYOD 3RGUA 2W90A 4UB6H 1LP1A 2E75B 2QJYC 1S72P 2YO2A 3L71J 1LT9B 2ZJSE 1MFZA 1M7LA 4PD4D 1ZR2A 4TLFA 3D71A 2VRSA 2K3RA 1AVOA 1NTZJ 2QSIA 3GW6A 3HE5B 1VQLP 2A45G 1JCDA 2D2CD 3W68A 1YIJP 1N7LA 1JEKA 2BCCG 3CD6P 1J1EB 1SVFA 1USDA 1JO5A 1GL2D 4N3YB 1YQ4C
chains in the Genus database with same CATH topology
1EDLA 1ZW0A 5DJUB 2OTKE 4NPDA 4EYYQ 5CBOA 2Q1KA 1H0TB 2B87A 4JBZA 2LXCB 1JM0A 1FC2C 5C39A 1U7MA 2SPZA 1U7JA 1X0TA 3MZWB 2KS1B 2KUBA 1OVRA 2UWJE 3S1KA 2ZAEB 3PH0A 5DJTB 2QVAA 3ZDMA 2QRXA 1Q2NA 4K35A 5CBNA 1OVUA 1EDKA 1ZXGA 4NPFX 1EC5A 1NVOA 4HKZH 4BXLA 2I8DA 2B88A 3FXEA 4IOIH 1LP1B 2M5AA 1OVVA 3FXDA 2KIKA 2JWDA 1MFTA 4K3AA 2KZJA 1DEEG 2M0BA 4KJMA 4ZMDA 2M5AB 1LT1A 2P58A 1EDIA 4MN4C 1Y47A 2LR2A 1JMBA 4GOEA 2WMMA 4HJGH 2HR3A 2RKLA 2B87B 1H0TA 2KZIA 3QWOC 2B89A 3MHVA 1BDCA 4GOFA 4ASVA 4GODA 1SS1A 1S3JA 4ASWA 5EFWB 2R44A 4ZNCA 2KI7B 4HB1A 3RGUA 1LP1A 4NPEA 2LXBA 4CPGA 1EDJA 4WWIA 5K5GB 2K3RA 1BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDL A;  1ZW0 A;  5DJU B;  2OTK E;  4NPD A;  4EYY Q;  5CBO A;  2Q1K A;  1H0T B;  2B87 A;  4JBZ A;  2LXC B;  1JM0 A;  1FC2 C;  5C39 A;  1U7M A;  2SPZ A;  1U7J A;  1X0T A;  3MZW B;  2KS1 B;  2KUB A;  1OVR A;  2UWJ E;  3S1K A;  2ZAE B;  3PH0 A;  5DJT B;  2QVA A;  3ZDM A;  2QRX A;  1Q2N A;  4K35 A;  5CBN A;  1OVU A;  1EDK A;  1ZXG A;  4NPF X;  1EC5 A;  1NVO A;  4HKZ H;  4BXL A;  2I8D A;  2B88 A;  3FXE A;  4IOI H;  1LP1 B;  2M5A A;  1OVV A;  3FXD A;  2KIK A;  2JWD A;  1MFT A;  4K3A A;  2KZJ A;  1DEE G;  2M0B A;  4KJM A;  4ZMD A;  2M5A B;  1LT1 A;  2P58 A;  1EDI A;  4MN4 C;  1Y47 A;  2LR2 A;  1JMB A;  4GOE A;  2WMM A;  4HJG H;  2HR3 A;  2RKL A;  2B87 B;  1H0T A;  2KZI A;  3QWO C;  2B89 A;  3MHV A;  1BDC A;  4GOF A;  4ASV A;  4GOD A;  1SS1 A;  1S3J A;  4ASW A;  5EFW B;  2R44 A;  4ZNC A;  2KI7 B;  4HB1 A;  3RGU A;  1LP1 A;  4NPE A;  2LXB A;  4CPG A;  1EDJ A;  4WWI A;  5K5G B;  2K3R A;  1BDD A; 
#chains in the Genus database with same CATH topology
 1EDL A;  1Q82 Q;  1LNQ A;  1Z56 A;  3CCV P;  5GTI H;  2KYV A;  3F89 A;  5CCH C;  3Q5R A;  1NTZ G;  3AE9 C;  1NTZ K;  2C0X A;  2NPS D;  5DJU B;  2PFX A;  3H1L G;  1Q81 Q;  5B5E E;  3ABV C;  2K9J B;  1GL2 C;  1NTZ E;  1NTK G;  2WSC H;  5CBO A;  3L37 A;  1OX3 A;  1SFC C;  3GMA A;  3HTK A;  3WU2 E;  5TJH A;  2E75 D;  1EZV E;  1J1E C;  3I5C A;  1W5C E;  4Y99 B;  5AW6 B;  4B86 A;  3I55 P;  1SQX J;  1HWT C;  2P10 A;  4JBZ A;  3WUV A;  2LXC B;  3TF5 A;  1EQ7 A;  2XKM A;  4UB6 E;  3VP8 A;  2QM8 A;  1FS0 E;  2M3E A;  1L0L J;  1SQB D;  4U3F G;  2OYI A;  2KSE A;  3Q5P A;  2A45 H;  1S5L H;  1VPC A;  2IPP A;  1L0L D;  1L0N K;  1M57 D;  1KIL C;  1S1C X;  1SFC B;  1SQB J;  2ZT9 D;  3A0H E;  3R4Y A;  4Y99 C;  3CC4 P;  3HE4 B;  3A0H H;  2IBZ E;  1USE A;  1L0L K;  1M1J A;  3C9I A;  2QG4 A;  1WMK A;  3KZI H;  2ZAE B;  2C9L Y;  3CX5 H;  3CCS P;  2FXO A;  1ZP0 C;  3BCC D;  3CL3 D;  3TNU A;  2L5G B;  5H2F H;  1HJB A;  1FBM A;  4A7P A;  1SQV D;  1NAY A;  2O1K A;  2FBW C;  3U1C A;  2JKV A;  4ZKP A;  2Y9Y A;  3D6Z A;  1SQB E;  2M8R A;  1KIL B;  1RE3 A;  2R5B A;  4NPF X;  4XA4 A;  4LC1 A;  1PV3 A;  1NVO A;  4JQ0 D;  1L0N E;  5AVR B;  1NJI Q;  2QE7 H;  1FOS E;  1PGJ A;  1FZB A;  3AED C;  2I8D A;  2W6B A;  1LTA C;  3M0D A;  4JYC A;  3SWF A;  1M90 Q;  4U3F D;  4EI2 A;  1M1J C;  3M9Q A;  4XFJ A;  2KB7 P;  5M1B A;  3BCC G;  2AEF A;  1NU1 G;  3IFM A;  1BGY D;  2M5A A;  2NPS C;  1K8A Q;  1OVV A;  2J59 M;  3CWB D;  3B5N B;  3V6I A;  2HOD A;  1JY2 P;  2JWD A;  1AA0 A;  2XU6 A;  3CPW O;  2WT7 B;  1BE3 E;  1KZU B;  3B5N D;  3V2Q A;  4RJT A;  1LTI C;  4K3A A;  3JC2 2;  2KSJ A;  3A0B E;  2AEJ A;  4HYT B;  1X9V A;  2W27 A;  1MV8 A;  1LTB C;  1M1J B;  2A06 D;  2WPQ A;  4TT3 H;  1LT1 A;  1JTH A;  3RK3 E;  3PHL A;  2KS1 A;  2AXT H;  3JSV C;  1FE6 A;  1D7M A;  4D6T D;  3B5N C;  1JY3 P;  1JMM A;  3BVH A;  1Y47 A;  2BCC D;  2I1J A;  3L72 E;  4LLH A;  1HH0 A;  1LTJ B;  3M06 A;  2WMM A;  4GOE A;  1PZQ A;  3II6 A;  5APS A;  2J58 A;  2QJK C;  2WPS A;  2HR3 A;  2W6J H;  5L8R J;  3S4R A;  1PFI A;  2RKL A;  1FZC C;  3SSU A;  4AYC A;  2WWW A;  2KP8 A;  1KQS O;  2B87 B;  3FX0 A;  1SQQ K;  3GLM A;  3KYQ A;  1EXI A;  2B89 A;  3CCJ P;  3AE7 C;  1GW3 A;  3D70 A;  1L4A A;  1LTJ C;  3KPE A;  2JO1 A;  1JTH B;  2P7J A;  4GOF A;  3RK2 C;  3A5T A;  3H1I D;  2Y0D A;  3IAO A;  3MP7 B;  4GOD A;  1EXJ A;  1X79 B;  1JOC A;  1S3J A;  3LW5 H;  3MGN A;  5AW2 B;  5AW9 B;  4PD4 H;  3H1H E;  4BRY B;  2QEX P;  4ASW A;  2FKW B;  4RES B;  4EIJ A;  1HGZ A;  1GZL A;  1KMI Z;  2R3S A;  3AEB C;  3B8E B;  4BWN A;  3L71 D;  1YBK A;  1YHQ P;  1URQ B;  2KLV A;  1GK6 A;  4DZO A;  5TIS E;  3CXH H;  2PGD A;  3L73 E;  3HUS B;  5AW5 B;  2GA1 A;  5AVT B;  2LXB A;  2OGU A;  4N6J A;  3CCM P;  1SLQ A;  2H8P D;  3L36 A;  3VTP C;  1XTC C;  1ZOY C;  2O1J A;  4DT0 A;  2JDI H;  2V4H A;  1QL2 A;  1RF0 A;  2W83 C;  4R4M A;  3V4Q A;  2C9N Y;  1KYO E;  5APW A;  2OYI C;  1RQU A;  1FDM A;  1UII A;  2WVR A;  4WY4 A;  1KB9 I;  2E5Y A;  4I2L C;  1OW6 A;  1AVY A;  1HGV A;  4I7Z B;  1YJW P;  1URQ C;  1NTM G;  2A45 I;  2Q6Q A;  2WT7 A;  1HBW A;  1G1J A;  1OW8 A;  2FFD C;  1VQP P;  1A02 F;  3B5N A;  1S9K D;  3TGU D;  1X22 A;  1OMI A;  1H8A A;  5KKZ B;  4GIF A;  1IO4 A;  1RF1 C;  2YIU C;  3PTZ A;  3CCR P;  3PRJ A;  1T3J A;  3O6Q B;  4H13 D;  1LT9 A;  2QA4 P;  2ITA A;  2CK3 H;  4I7Z C;  2HPC B;  1H0T B;  1IK9 A;  1J1D B;  1VQ7 P;  1VQ4 P;  3PP5 A;  1URQ A;  3CCL P;  1S4X A;  3W67 A;  4PV1 C;  1NKZ B;  5KLI C;  1JM0 A;  3RL0 g;  4C46 A;  1HF9 A;  1SQX D;  2V7Q J;  1RY3 A;  3RK2 D;  2WIT A;  1FC2 C;  2C0W A;  1EZV D;  1QGK B;  1U7M A;  1L2P A;  5C39 A;  3LIE A;  2FXP A;  3L70 G;  3C1L A;  3KZI E;  1FAV A;  1SQX K;  1LWU B;  2E74 C;  2E76 D;  2GUV A;  2R32 A;  1HJ0 A;  3TK1 A;  1SQP G;  2H89 C;  4PV1 D;  1X0T A;  3H32 B;  3L74 E;  4I1L A;  4DJG A;  3G3Z A;  1J1D C;  1RE4 A;  2O01 J;  1NTK J;  2UWJ E;  5AW8 B;  5KAI E;  1NOH A;  3V2P A;  1SQV J;  3JCU E;  5KLV G;  4I6M C;  3KDP B;  2IBZ G;  3PH0 A;  5DJT B;  4PD4 I;  1K05 A;  2QRX A;  2I1K A;  1NTK D;  1SQB G;  3A0B H;  1SQB K;  3Q3D A;  1OVU A;  1TU3 F;  1ZLL A;  1NWQ A;  1KFN A;  3AEF C;  4O9B A;  3Q5S A;  2YKQ A;  1NYH A;  1GU5 A;  3QH9 A;  1LWU C;  2E74 B;  2OTL P;  5H2F E;  2WPV B;  2ZT9 C;  1QX8 A;  1YI2 P;  3HE5 A;  1BCC J;  4BXL A;  1VQ8 P;  3GHG B;  3WU2 H;  1KB9 D;  1BGY J;  2KXP B;  1URQ D;  1G2C B;  1NU1 E;  2ZFC A;  1SQV E;  1RQV A;  3RL0 C;  3SFE C;  3VMZ A;  1YQ3 C;  1E5W A;  3MIW A;  4KT0 J;  3N4X A;  3CI9 A;  3L71 G;  4OVN F;  5AVQ B;  1ZRT D;  1T2K D;  2YMK A;  3EFF K;  2G3A A;  5AW7 B;  2Y0C A;  2WTY A;  2ZT9 B;  3VYI A;  2ZVN B;  3TYY A;  3G71 P;  1OXZ A;  1GD2 E;  3RL0 D;  3V2N A;  4DCK A;  2RMZ A;  3MD0 A;  2KZJ A;  1GMJ A;  2R3C A;  1PPJ G;  4OGQ C;  1DEE G;  3L35 A;  1ZN5 A;  1NU1 J;  3VOP A;  4H0L C;  5CMZ A;  4ZMD A;  5AW0 B;  3RL0 B;  1QEX A;  1QL1 A;  2BCC J;  3B4S A;  3RK3 C;  2JJL A;  1LT9 C;  3H32 A;  3NMD A;  2FY8 A;  3T97 B;  1NU1 D;  2PAJ A;  3CCE P;  3CC7 P;  4C7R A;  1CW5 A;  3L75 E;  5CCH D;  2QM7 A;  3U59 A;  3SWK A;  2Z5I A;  1K73 Q;  1S2E A;  4C7N B;  1LGH B;  4JYB A;  2Y0E A;  2YKO A;  2Z5H A;  4RO0 A;  2WSF H;  4IL6 X;  4L76 A;  1RH5 B;  1LTT C;  2GUS A;  4H0L B;  3BAS A;  1NTM K;  2BEZ F;  3B71 A;  3MUD C;  1JY2 O;  2KZI A;  1H89 A;  3H1J J;  3QWO C;  3M0A A;  3GF3 A;  1VQO P;  3BCC E;  1M1K Q;  2XDJ A;  4UB8 H;  4EDF A;  3L75 J;  1N73 B;  1ZME C;  1BDC A;  1RF0 C;  3JCU H;  1GL2 B;  2IFM A;  3TGU E;  1JY3 N;  2WSE H;  5AVU B;  1BGY E;  3AE2 C;  1OW7 A;  1RE3 C;  1LWU A;  2KLU A;  3L75 G;  2OTJ P;  1FJK A;  2FYZ A;  5AVZ B;  4IL6 E;  5GTI E;  2CPB A;  3O8Z A;  1FZA A;  5EFW B;  5APY A;  1K9M Q;  1KOR A;  2R44 A;  3H1K E;  3OJA B;  1VF5 B;  2OYH B;  1JUN A;  2KI7 B;  3USS A;  2FYN B;  4HB1 A;  3PJS K;  3M9H A;  3BAT A;  1R5L A;  3VN0 A;  1M8O B;  1RHZ B;  1JY2 N;  1SP4 A;  1LTJ A;  1VF5 D;  4NPE A;  4CPG A;  2RN0 A;  2BAS A;  3P8C D;  2JEE A;  4WWI A;  1KIL E;  4H0L D;  5KAF E;  3M9B A;  3HTK B;  5CCG C;  3OW2 O;  1SQQ G;  3KXD A;  1MKM A;  2BCC E;  3L72 D;  4OGQ D;  1L4A C;  1GDT A;  2E42 A;  3BRT B;  4W80 A;  2OQQ A;  2WSE J;  2KNC B;  2OYH C;  1UIX A;  3RK3 D;  3MUD A;  2FYN C;  3H1H D;  3V5B A;  1AFO A;  1AJY A;  3G4S P;  3TGU J;  1DD4 A;  3VMY A;  4BRY A;  1FZC A;  1L4A D;  3AEA C;  2HOD B;  1ZW0 A;  2ZXE B;  2OTK E;  3L74 D;  5E79 H;  1RF1 A;  1U57 A;  2WSF J;  1L4A B;  1R5S A;  2MJZ A;  2Z4E A;  2E76 C;  2E74 D;  4EYY Q;  1EDJ A;  2IFN A;  3L70 D;  1T6A A;  2FYU K;  4IL6 H;  3WMM 0;  1M56 D;  4U3F E;  2B87 A;  1AQ5 A;  1BE3 J;  3L70 J;  1NH4 A;  4OWF A;  2M3B A;  1NHL A;  2WSC J;  5CCH A;  2FFD A;  1QVF O;  1L0N D;  2IBZ I;  3L73 G;  3NXS A;  1G1I A;  3P32 A;  5BU5 A;  4WB4 A;  1FJP A;  3K5B A;  2QJY B;  2WSS H;  4U7J A;  3H25 A;  1A02 J;  3V4W A;  5AVY B;  3NFQ A;  2OYO A;  3T97 A;  1PPJ E;  2K9J A;  2E43 A;  1NU1 K;  1R8E A;  2KUB A;  2A06 E;  3L71 E;  3H1I G;  3D6Y A;  3L70 E;  1QLE D;  3H1J G;  2WQY C;  4W7Z A;  1QVG O;  3AEE C;  2H7H A;  3P8M C;  1FZF A;  2GM4 A;  1PP9 E;  5GTH E;  2QVA A;  1L0L E;  3FWN A;  3ITK A;  3ZDM A;  2XNX A;  3E1R A;  4K35 A;  5CBN A;  1PGQ A;  3P8C E;  3SWY A;  1KC8 Q;  2QJK B;  3CXH I;  1ZXG A;  1Y8A A;  1N7S B;  3CXH E;  1IFJ A;  1P84 I;  3AEC C;  3HRN A;  3E1I A;  5KAF H;  2QIW A;  1SQV K;  2AEM A;  3MTU E;  4HKZ H;  2HPC A;  4LGD E;  2IDB A;  1PIX A;  1Q90 D;  2IZ0 A;  1IJD B;  1JB0 J;  2YXQ B;  5KLV K;  1L0N G;  1IFD A;  1ZV8 A;  2J5U A;  1BCC G;  3FXE A;  4HH2 A;  1BCC D;  5AVS B;  1SQP E;  1CZQ A;  5AVV B;  1Q86 Q;  3RK2 B;  2YXR B;  1LP1 B;  2O3J A;  4L73 A;  1SFC D;  1KN7 A;  1SQP K;  3H1J E;  1OWA A;  2H88 C;  2YO3 A;  2NRG A;  1N7S C;  3CWB G;  1KYO I;  1WRG A;  1P84 D;  1BSH A;  1PP9 D;  1MFT A;  1KTM A;  3F5H A;  4WBA A;  3AE6 C;  5BU8 B;  5KLV J;  3TNU B;  1LTG C;  1OFC X;  4L75 A;  4D6T E;  2RH0 A;  4IFD K;  3OAK A;  3L74 G;  1DIP A;  5APV A;  1PP9 J;  1DH3 A;  2K1A A;  4KJM A;  2IBZ D;  3L72 G;  1IFM A;  1JNM A;  1SQP J;  2W8Z A;  3RBX A;  1GL2 A;  1EZV I;  2P58 A;  1LTS C;  1BGY G;  4YTP C;  1IFI A;  1EDI A;  1T8Z A;  3L4F A;  4MN4 C;  4PD4 E;  4PJ0 E;  4DOJ A;  5B66 E;  3GHG A;  2WZ7 A;  2V7Q H;  5APX A;  3CC2 P;  3WUU A;  2OYI B;  1NAF A;  2G8Y A;  4HJG H;  2BEQ D;  3S9O A;  1HTL C;  4D6T J;  1ZR4 A;  3RBZ A;  1VL2 A;  3TDK A;  2IX7 C;  3L73 D;  2KK7 A;  2D2C B;  2K37 A;  1DX7 A;  1SQV G;  4D6T G;  1H0T A;  1OZH A;  3VMA A;  2R5D A;  4N78 E;  3BRV B;  1FU1 A;  1KYO H;  2NPS A;  3IF4 A;  2B9B A;  4H13 C;  5GTH H;  4RKU J;  2N9Y B;  4Y28 J;  3CXH D;  2FYU D;  1IZN B;  2YIU B;  3KHU A;  5CCG D;  1IFN A;  1J2J B;  1N86 A;  2NPS B;  1RF1 B;  2KOG A;  4ASV A;  2O01 H;  1NTM J;  2L91 A;  3M0D C;  5BVZ A;  3GF7 A;  4WY4 D;  1KQG B;  2D2C C;  1YIT P;  2YNY A;  1YJN P;  4H44 B;  3H1H G;  1FDI A;  3NTN A;  1Y9B A;  3Q1M A;  1LJ2 A;  1ZRT E;  4H13 B;  2JR8 A;  4JF7 A;  1AQT A;  1N7S D;  2AXT E;  4H44 D;  3H1K G;  1E79 H;  1NTZ D;  1YTZ T;  1DEB A;  3O6Q A;  1G2C A;  3C8V A;  5K5G B;  2ZYA A;  1NGM B;  2FXM A;  1X8Y A;  1PGO A;  1BDD A;  3H1H J;  5APQ A;  2Q7C A;  1KD1 Q;  1NKN A;  1KQL A;  3H6P A;  4GT1 A;  3H1I E;  2HG5 D;  3L72 J;  2ZXX A;  4H44 C;  1FZG A;  5E79 E;  2OAR A;  3H1L E;  3L74 J;  3Q2Y A;  3HD7 D;  1S5L E;  1VDF A;  1HUC A;  1NTK E;  1MZ9 A;  2YMY A;  3A3Y B;  4W7Y A;  4EOT A;  1NTM E;  1MUU A;  1DD3 A;  1PPJ D;  4PJ0 H;  2Q3E A;  1GK4 A;  3PLN A;  4YPC A;  4KHX A;  5B66 H;  5KJ7 C;  1GU4 A;  3HE4 A;  1FZC B;  1VQN P;  4NPD A;  3GHG C;  1BE3 D;  2Q1K A;  1KIL D;  2P2U A;  1OIP A;  2W6A A;  1HVV A;  1KFM A;  1N2D C;  1SFC A;  2JWA A;  3H1K J;  5KTB A;  1W2B O;  1VQ6 P;  2CPS A;  2P1J A;  1L0N J;  5CHX A;  5AW1 B;  5KJ7 A;  1XTG B;  1BCC E;  2JP3 A;  3H1K D;  3IN6 A;  3UIA A;  2ZVO B;  1FZE A;  1KB9 H;  1KV4 A;  3E7K A;  3CCU P;  2OYH A;  3M91 A;  3CCQ P;  3I56 P;  3GG2 A;  1CSB A;  2IYP A;  2WPR A;  3OA7 A;  4OGQ B;  5KLV E;  3HUS C;  2K9Y A;  2YKP A;  1BE3 G;  2Q9I A;  1GTW A;  3IR9 A;  3CMA P;  2N1T B;  2SPZ A;  1FOS F;  1U7J A;  3LW5 J;  3AEG C;  3HD7 B;  2KS1 B;  3MZW B;  3RK3 B;  2PP6 A;  2Q3I A;  1PP9 G;  1OVR A;  4XE5 B;  1GW4 A;  3S1K A;  3U1A A;  4AQR D;  2IZ1 A;  2N1T A;  2N1T D;  3P7K A;  2ZYG A;  4UB8 E;  4OH8 B;  1P84 E;  1PGP A;  1VQM P;  1VQK P;  2A06 G;  1EZV G;  1PL5 A;  2HYN A;  3CLQ A;  3EQ2 A;  4GDO A;  1Q2N A;  4ZKU A;  1W2E A;  3AE8 C;  1EDK A;  1FDO A;  3V2R A;  3G9R A;  1CI6 A;  2Q5U A;  1Q7Y Q;  2FFD B;  2HLO A;  3BCC J;  1IFP A;  1L0L G;  1EC5 A;  2N1T C;  3KQG A;  4U3F J;  1T2K C;  5CJ0 A;  1JY3 O;  1SQX E;  3HD7 C;  1RE4 C;  5AW4 B;  1N73 C;  1KQF B;  3G6E P;  3CX5 D;  5KKZ C;  2B88 A;  1SQX G;  4M3L A;  2IYO A;  2ZYD A;  2K88 A;  3AE5 C;  5AVX B;  5KJ7 D;  4YXW H;  5TIS H;  4IOI H;  3HUS A;  4JPZ B;  4GKG A;  1KIL A;  3FXD A;  3FWL A;  4PV1 B;  5KLI B;  2KIK A;  2XND H;  2N9B A;  2E5T A;  4N78 D;  2POH A;  3CWB J;  1VF5 C;  3CME P;  2FYU G;  1IK7 A;  2KNC A;  3VMX A;  4WY4 B;  2M0B A;  3AE4 C;  1NTK K;  1H88 A;  5KLV D;  1SQQ D;  2M5A B;  4IFF A;  2Y9Z A;  3FGA D;  2FYU E;  1YJ9 P;  2LKM A;  3CX5 E;  1VQ5 P;  5KAI H;  3VP9 A;  2AXC A;  3EWK A;  4IFM A;  2DW3 A;  1SQQ J;  1SQP D;  2QJP C;  2LR2 A;  2O01 N;  1JMB A;  3L73 J;  3AE1 C;  3AE3 C;  3SFD C;  5AVW B;  1K04 A;  2XV5 A;  3WUT A;  4YXD C;  1N7S A;  2NZ2 A;  1CI6 B;  4WY4 C;  4Z1M H;  4C7N A;  3L75 D;  1IC2 A;  2MKV A;  4QMA A;  1KB9 E;  4WVZ A;  1VQ9 P;  5CJ4 A;  3H1I J;  3MHV A;  5APU A;  1WT6 A;  3R2P A;  1SQQ E;  2E75 C;  2QJP B;  1JCC A;  3H1L J;  1NTM D;  1S9K E;  1P84 H;  3A7O A;  3CWB E;  5AW3 B;  2E76 B;  3H1J D;  3HD7 A;  1N73 A;  1NO4 A;  1YTZ I;  5B5E H;  5CCG A;  2XZR A;  3H1L D;  4R4L A;  3LID A;  1SS1 A;  3N7N A;  4L74 A;  2PRR A;  3A2A A;  3EFG A;  3TGU G;  3TSI A;  2FYU J;  2HFE D;  3CX5 I;  1YYC A;  2P67 A;  1T3U A;  4ZNC A;  4AUW A;  1AV1 A;  2H43 A;  1S5L X;  1N8R Q;  5APT A;  1BSN A;  1KYO D;  3RGU A;  2W90 A;  4UB6 H;  1LP1 A;  2E75 B;  2QJY C;  1S72 P;  2YO2 A;  3L71 J;  1LT9 B;  2ZJS E;  1MFZ A;  1M7L A;  4PD4 D;  1ZR2 A;  4TLF A;  3D71 A;  2VRS A;  2K3R A;  1AVO A;  1NTZ J;  2QSI A;  3GW6 A;  3HE5 B;  1VQL P;  2A45 G;  1JCD A;  2D2C D;  3W68 A;  1YIJ P;  1N7L A;  1JEK A;  2BCC G;  3CD6 P;  1J1E B;  1SVF A;  1USD A;  1JO5 A;  1GL2 D;  4N3Y B;  1YQ4 C; 
#chains in the Genus database with same CATH homology
 1EDL A;  1ZW0 A;  5DJU B;  2OTK E;  4NPD A;  4EYY Q;  5CBO A;  2Q1K A;  1H0T B;  2B87 A;  4JBZ A;  2LXC B;  1JM0 A;  1FC2 C;  5C39 A;  1U7M A;  2SPZ A;  1U7J A;  1X0T A;  3MZW B;  2KS1 B;  2KUB A;  1OVR A;  2UWJ E;  3S1K A;  2ZAE B;  3PH0 A;  5DJT B;  2QVA A;  3ZDM A;  2QRX A;  1Q2N A;  4K35 A;  5CBN A;  1OVU A;  1EDK A;  1ZXG A;  4NPF X;  1EC5 A;  1NVO A;  4HKZ H;  4BXL A;  2I8D A;  2B88 A;  3FXE A;  4IOI H;  1LP1 B;  2M5A A;  1OVV A;  3FXD A;  2KIK A;  2JWD A;  1MFT A;  4K3A A;  2KZJ A;  1DEE G;  2M0B A;  4KJM A;  4ZMD A;  2M5A B;  1LT1 A;  2P58 A;  1EDI A;  4MN4 C;  1Y47 A;  2LR2 A;  1JMB A;  4GOE A;  2WMM A;  4HJG H;  2HR3 A;  2RKL A;  2B87 B;  1H0T A;  2KZI A;  3QWO C;  2B89 A;  3MHV A;  1BDC A;  4GOF A;  4ASV A;  4GOD A;  1SS1 A;  1S3J A;  4ASW A;  5EFW B;  2R44 A;  4ZNC A;  2KI7 B;  4HB1 A;  3RGU A;  1LP1 A;  4NPE A;  2LXB A;  4CPG A;  1EDJ A;  4WWI A;  5K5G B;  2K3R A;  1BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...