1EEFD

Heat-labile enterotoxin b-pentamer complexed with bound ligand pepg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords PROTEIN (HEAT-LABILE ENTEROTOXIN B CHAIN)
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eefD00
1UUPA 1BXTA 3R2TA 1RD9D 2RDGA 1CHQD 3BVMA 1SJHD 1BCPF 1I4XA 1TS3A 1JR0D 3BYTB 1HXYD 1V1PB 2AQ2B 3BVZA 1LTAD 4K6LA 1MD2D 1QILA 1CHPD 1LTID 1RCVD 4RCOA 1SE4A 1EWCA 1LT6D 1S5DD 2NTSA 4RHRA 1D6EC 3R8BA 1LT4D 2G9HD 1FNWA 1FNVA 3GP7A 1PZID 5FKAC 1PYWD 4RHSA 2QILA 1JQYD 1ESFA 1PTOC 1JCKB 1V1PA 1I4QA 2IJ0A 1XTCD 1EEID 4BWGB 1PZKD 1I4HA 1FD7D 3R2IA 5ELBA 1JWSD 1I4GA 1M4VA 1SE3A 4TSSA 4RGNA 1PTOB 1PTOD 5ELEA 5I4DA 2XRQD 2CHBD 1TY0A 1B44D 1S5FD 4RFBA 1PRTC 3BYYB 1SJED 2RDHA 4DXFA 3DWAA 1PZJD 1LT3D 2R61A 1D5ZC 1CQVA 1KLGD 1AW7A 3DWQA 2J4XA 2O2LD 4L63B 1BCPB 1HQRD 1UNSA 5FK9C 1FGBD 3DWPA 3O13A 1L0XB 1TS4A 3EFXD 1I4RA 1D5XC 1LLRD 4ZYSA 1TS2A 1TS5A 4RH6A 1T5XD 2IPKD 1LO5D 2AQ3B 1PTOF 3BZDB 1LTGD 3MC0B 1RDPD 1JWMD 1PTOH 1STEA 1D5MC 2XNAC 1I4PA 1L0YB 4RGOS 1EU4A 4L6TB 1F77A 1KTKA 3CHBD 1PRTF 1DYQA 1DJRD 1SXTA 3W2DA 3OWEB 4RGMA 4C56C 1S5ED 1G8ZD 1ET9A 1EFID 1EU3A 4RGTA 5ELFA 1B1ZA 1TY2A 2SEBD 1AN8A 1FNUA 2TSSA 1BCPC 1XXGA 5D3DA 1SBBB 1HA5A 1ENFA 1V1OA 3TSSA 1ET6A 1PRTB 3BVGA 4DXGA 1LTSD 3KLSX 4OHJA 2AQ1B 4Z9CB 1EEFD 2ICIA 1LTBD 1LTTD 3EA6A 1HTLD 1BCPD 1SE2A 1SEBD 1RF2D 2NTTA 3SEBA 3URYA 1GOZA 2WV6D 4O1NA 2XN9C 2XRSD 2Z8LA 1S5BD 5ELDA 1LTRD 1CT1D 1CK1A 3V05A 1KLUD 2QEJC 5TSSA 4UDUC 1S5CD 5D3IB 1PRTD 1LT5D 1JWUD 3MFGA 5ELCA
chains in the Genus database with same CATH superfamily
3NPPA 2NN6H 2P5ZX 2NVQH 3J80E 2D5DA 5M5WH 2B2YC 1BBWA 1K8AC 4XYQA 1WVLA 1WYDA 1UE1A 4BY1H 3S14B 1S4ZA 2Z6KC 2ZT9C 5EAYA 5FJ8G 2UUCQ 4ALPA 3OHXC 4ZCKA 3T56B 1YIJA 1HNWQ 4JCVE 4LFAQ 5COYA 2JA6G 1S40A 1PTOC 1EYGA 4C3JB 3MXUA 3NTIA 5EBDA 1I4HA 4UPAA 1Y69U 1XNQQ 3T1HQ 4RMFA 4A3GG 4X62Q 4AH6A 1C4QA 4QY7A 2YV5A 2K5HA 2RCNA 2D0OA 4IPDA 3NQTA 4POGA 1SYCA 4YCWA 1U5KA 1LACA 3OTOQ 2Y0SB 1IBKQ 3KYHC 3KLSA 4OELB 2R6GA 1R9TB 2JA8H 4L63B 4UAIA 3U4ZA 2LXJA 1HPCA 2HDMA 1RTOA 3ULJA 3K5OA 3ULPA 2E2JH 1TWGB 4IUTA 2E2IB 4DUYL 2MUYA 4C3HB 4G4KA 3E5SA 3H3VI 1CZGA 3VYUA 1HZAA 2ICEC 3MC0B 5I6WA 5C4XB 4H02A 5EBCA 4IUQA 3UI2A 4J1MA 4CGYB 4JC0A 2F0NA 4J6HA 1EY4A 4R4QA 2J7ZA 3D8GA 3KFUA 3PF4A 1VQLA 2M00A 1Q82C 3LNNA 3F2CA 4DV0Q 1AN8A 4GS3A 3KLRA 5IYBH 3UE0A 4JI4L 2SOBA 1HA5A 3HOZH 1H9SA 4DV2Q 3TP8A 2F0EA 5C4JH 1A8VA 3VYSA 1A3UA 1BNZA 3QOJA 5L37A 1XMQQ 2WAQE 4KHVA 4OXPA 5CGKA 2L4NA 1EUJA 3SK8A 1N32L 2EXDA 4A3CG 1UE6A 4R8IA 4A3JB 3MXGA 2IY5B 5DAUA 3J7ZC 4PZ6A 2BH8A 4LK1C 4UP7A 3MTSA 1PH8A 1IL2A 4TQUS 4WFN3 1VQJA 4QUCA 2M9VA 4HJ5A 2XIWA 2CW0C 3K5NA 5IE8A 2PI2E 4ZRZA 1X3FA 2LS01 3TREA 1OTCA 1IZ6A 1LTID 1E1TA 1U0LA 1VQCA 3KJPA 2NTSA 4KD3A 3ICEA 1IL8A 2A8VA 4F8MA 1WCMB 1NJIC 2HIXA 2FMCA 3CQZH 1K73C 2UXDL 3OIQA 2A73B 3TS2A 1V1PA 1G291 2F0FA 1AP0A 4IJLA 1KNAA 1FD7D 4H44C 5ELBA 4GLXA 3T1YL 3RZOB 1QB5D 5M3FB 5DLQE 2R7DA 2F0OA 4JI4Q 3K57A 4A93G 2VZAA 2B29A 1QE6A 3NWTA 2KCNA 2Q2UA 2FJ2A 4DR5L 4PMCA 2J4XA 3D3RA 5BR8L 1XMQL 4A3FB 1VQHA 5EJWA 1EIYB 5CV7A 4ZQ3A 4A3LH 3EIVA 3CCJA 3TZDA 1PFSA 1TXYA 3PIPA 1WTPA 1NBWA 3I56A 3SHLA 3EQLC 3L9AX 1I94Q 1FYCA 2B63H 3I4NB 3ERSX 3DMUA 1BO0A 1C0AA 3CCSA 5C5LA 2CQAA 4HCEA 1EFID 3BS1A 3PIP3 3AEVA 2OT2A 1DONA 3E3XA 1JB3A 2AWOA 4KI0A 2F0IA 4BBRB 4NB3A 3I4OA 1XPOA 2L12A 4CBVA 2L0CA 2DY7A 3C2PA 1SSOA 4DR1Q 1JC7A 4LWCA 2EJGC 1OXUA 1STBA 2N3SA 1HNZQ 3I72A 3TEHB 1B9NA 3SEBA 3GTOH 4DNRB 1WTHA 3KF6A 4DFAA 2N8NA 4JI8L 2F0JA 2R7ZH 1TWCH 1HR0L 2CH4A 2VB3X 3M3YB 3PCOB 3M9BA 1BOSA 1EIFA 2KENA 3KBXA 5KYLA 1EFWA 2LXKA 3R93A 1X9NA 5IY0A 1K3RA 5C44G 2JA7B 1DGSA 2B2VC 5M3FH 1TVXA 4K6LA 4M8AA 4CDCC 2UXCL 2OQ0A 2L15A 2CFMA 1J9OA 1SYGA 4X3KA 1EY6A 3FPPA 4RHRA 1SMYD 4JI5Q 1FNVA 2F3VA 4LMQD 2MHVA 5FKAC 1TWCB 2V4DA 1PH6A 2EY2A 3PV0A 3L2PA 1MIUA 5IP7G 1GUWA 4ODGA 5C3EH 3CCUA 1KIXA 2NVXH 4HJ7A 3IFDA 3I4MG 3NBHA 1BBUA 1HFGA 3S1QB 1EYDA 1YHBA 2A6HD 3PSIA 5I4DA 4OWWB 1JORA 2WB1E 4A3KG 2F52A 1KQSA 3CXCA 2AUJD 3S1RB 2LFNA 4G57A 3NE5B 3H91A 4KKTA 5CR3A 4UP8A 1UNSA 3DWPA 1HZBA 1SNCA 2Q8TA 3GTGB 1YBYA 2EYFA 2EYLA 4M1UB 3PO3B 3A55A 1KD1C 2H4OA 1MSGA 1C9OA 1D5XC 1Q81C 1TS2A 1ML0D 5IODA 4JK1C 4EQ5A 4XQQA 2ZJRA 4XQNA 2XNAC 1I6HH 1M1KC 4EQPA 3STBC 1DYQA 3W2DA 4C56C 4BY7G 2Z9HA 2PW7A 2TSSA 2LSSA 4KY5A 4KLKA 3TSSA 1ENFA 1VQFA 3U9OA 3K7AB 3QWNA 3HOZG 3KLSX 3LWEA 1LTBD 4JI5L 2L55A 2MO1A 2JA7H 4GZYC 2B63B 4YIJA 2C5CA 2QDBA 2BE5D 2WB1B 4A3JG 5GADC 3HOVG 3MVVA 5BN4A 1IW7D 4BY1B 1W3SA 3M85A 2VUMG 2ZJPA 1S5BD 2PO4A 2F3WA 2Q2IA 1QNKA 2IL8A 2EOTA 2ENBA 1PFMA 2NVTH 3NEMA 3MHBA 3RLOA 4LFCL 3H0GH 5AFWA 4C3JH 2NVXB 1IBLQ 2LY7A 1G51A 3TP5A 3AQQA 4CJ1B 3T4AC 2F0HA 5AJ3Q 3S17B 1CFMA 4DNTB 3FKIH 1QVFA 4DR7L 1SE4A 4DK1A 1Y14B 1D6EC 3OWFA 1MJCA 4AYBG 4RHSA 3GTKH 1X6OA 1JQYD 5DNFA 4MHEA 3HKZE 2JA5B 1IYVA 1GUSA 1RHPA 5IT9c 4JBKA 4LUVA 2BCOA 4NPSA 1TY0A 4C1NK 2OF1A 1PLFA 3H6MA 2VQFL 5JAVA 1LT3D 2R61A 5JJIA 5M5XB 4ILWA 1X3EA 3J7AV 2E74C 3M4OH 4DNIA 1HQRD 4FF3A 5IGBA 2UU9L 1GVPA 4F88A 3K7AH 4RH6A 2IX3A 4B3TL 3EBEA 4N8FA 1LO5D 1D1IA 4ZK9B 1XPRA 3UDIA 5J39A 3KOJA 2K32A 1UEBA 1B3QA 1YHAA 4JI2L 4RGTA 3TS0A 1B1ZA 1JOKA 5JPNC 2F0GA 1I5FA 4A3MG 3STBD 4GKJL 4OIJA 2NWGA 3D0FA 3HOXB 4B3SL 1A3TA 1T5EA 3Q23A 3M7NA 2JP1A 1PH7A 1IXRA 1QUQA 1K3BC 1A0IA 2R93G 4JOIA 1PDQA 1II3A 1BCPD 1SE2A 3CPFA 3RNUA 1JOQA 2A1AA 4A3BB 3I8ZA 3HOYH 1GM5A 2Z8LA 4CDDC 4DGZA 4CHTB 5C5MA 1CT1D 1IKMA 2X6GA 1AH9A 3FP9A 1UE7A 1GXDC 3S2HB 3TBIB 1RIPA 1UUPA 3R2TA 1R4QB 2RDGA 1SN8A 1XNRQ 1I4XA 2MNAA 1HXYD 2AQ2B 2BA1A 1QZGA 1I3QB 1MD2D 1TKWB 3IFTA 2KHIA 3D6CA 1CKOA 3I4NG 1LT6D 4CJ2C 1Q1BA 1HRJA 4YCVA 2KEDA 3L0OA 4BA1I 4DR3L 4B3TQ 2KQ3A 1N8RC 1JT8A 2EE1A 1CA5A 3CKIB 2QEXA 5IP9G 4NXMQ 3I73A 2F4VQ 2YTXA 4HIMA 5M3MB 2JA6B 4MIUA 2JEAI 2PZTA 3PO2H 3K6OA 4C3HH 4JYAL 3RZDB 1IYUA 4OWTB 5D14A 1I3QH 1RL2A 4B3SQ 3NBHB 4A3IB 2JXMB 1TQOA 1PZJD 3ZYYX 1ILPA 3QR8A 3KF6B 3E6ZX 1QG7A 1W6KA 1Q12A 3HKSA 1A2UA 2F0MA 1HNWL 5JJZA 1AZQA 4A3DB 2RSNA 4PNYA 2RHSB 3Q24A 1B8AA 1OXTA 1T5XD 1OXSC 3W5OA 1F2ZA 5ELNA 4B9WA 5EKKA 1JWMD 1STEA 1D5MC 1RKNA 2DN8A 3GTJH 1IBMQ 4A93H 3F1ZA 2NVYB 2DGYA 5LMUL 1F77A 1PA6A 4BY7H 2XWBB 3CP0A 1VQGA 3G48A 3FMCA 1NNXA 5ELFA 1VQ5A 1GO3E 1QJOA 3RR5A 4CDEC 5T1GA 3QOLA 3KJOA 1EY0A 2J0TD 3FDTA 1WFQA 4JI3L 4KK7A 3VR4A 1UEAB 5HY6A 3S2HH 3K0YA 1PRTB 4LF9Q 3T16A 4DXGA 3I3CA 4DV5L 2E2DC 5DM73 4DR6Q 2LKVA 4NXNL 1I6VC 3D4DA 3IL8A 4OO1H 4DR3Q 3EA6A 3JC66 1XX8A 1RODA 4S3SA 4ME5A 5C4XH 5HGQA 4X65Q 1BF4A 4A93B 3W1BA 3H94A 5IYDH 1HH2P 1GOZA 2F4VL 4K14A 1XJVA 1E7ZA 3J81E 2ZXOA 3NUCA 4U68A 4I7ZC 3M4YA 2BA0A 3LWUA 1PV4A 2PMZB 3MFGA 5ELCA 4BA2I 4GOPA 1E2ZA 4JPBW 4C3IG 5EPKA 4RCNA 2YTYA 3BVMA 2PI2A 1BCPF 1MGSA 3N52A 3HOUG 3TN2A 1K8GA 1FGUA 1EY9A 4RCOA 4AYBB 1N32Q 1GJXA 1BVSA 3S1RH 1NY4A 5GROA 2IW3A 4ULLA 3H3VH 4FF4A 1LM0A 2YU9H 1WCMG 4P74A 2NVTB 1JCKB 5IP7H 2Q8RE 2CCZA 1FJGQ 2IJ0A 1EY8A 4H13C 4IZ8A 4LF7L 1DXMA 3HOUH 2N88A 3S16B 3U58A 4R9WA 4KY6A 4R4CA 5ELEA 3K5LA 3GTMH 1K8OA 3CCRA 2RDHA 4HN7A 3OPOA 3CAMA 1SYEA 1BUVT 2AHOB 3A8JE 1WCMH 1CKNB 3A56A 4NXNQ 1F9QA 2O2LD 3M7GA 1H9SB 4IFDG 1Y1VG 3MXNA 3O13A 2PQAA 1HA6A 4NMZA 1KNEA 3PO2B 2OWOA 2NZOA 3HGBA 2EQSA 2I5LX 4A3KH 4Q0FA 1JJ2A 4RAUC 1XPUA 3HEJA 3F2UA 4ZKBB 4A3FG 3D4RA 2MFIA 2NYZD 5LMNL 1F9SA 5BR8Q 1L2FA 1SNDA 3I2ZA 1OXVA 2Z4IA 1SBBB 1X3GA 1OO9B 2B2TC 1A2TA 4PV1C 2F0TA 1ESRA 1M90C 3AYHB 1Q8IA 4A3KB 1LTTD 2NVQB 5ISRA 4K5XA 5T1IA 3S17H 4MTKA 3C1FA 3ND9A 3ZJYC 5JEAG 4A3EH 4L5RC 2XTIA 2OQKA 1GUGA 2E2HH 1JE5A 3J80i 2OCEA 2Q8IB 4CKCA 1MHWC 3JAML 1HTPA 4J8QA 4UDUC 5D3IB 2F0KA 3UDXA 1VQIA 1X3QA 1X3PA 2WP8J 1YNJD 1PYBA 5IGEA 4LF6Q 5BN3A 4DA2A 3G7LA 4PG3A 3SGIA 3S16H 3C46A 1GUOA 3F2DA 2PNRC 1XYIA 4K2KA 1YEZA 3DHQA 3ER0A 3Q8DA 1E3PA 4IJHA 3NWSA 1F2MA 5IWAL 4B3MQ 1YNNC 4OEMB 4JI8Q 2ASBA 3IKJA 3S1MB 4WJ3M 1EYAA 1DCZA 4HTHA 1CUKA 3TP7A 3J81L 1WTQA 1NAPA 5EKLA 4JI0L 2WFWA 4P73A 2QW7A 3PUYA 1HQMC 3HOXG 5C44H 2V1CC 5KEEA 3K59A 4APVA 1AEXA 3A5ZB 4C3HG 2ID0A 1CSPA 1HZ9A 2JYOA 1AFPA 5LMNQ 3PQIA 1YNND 4L5SA 1YHQA 2JA8G 3QB3A 5GAHC 1VMPA 4G7ZC 3S1MH 3HOXH 4X66L 1EQTA 1VQKA 2B8GA 5DM63 4V0BA 1FVIA 4JBJA 2XWJB 3BZCA 4IUVA 5K36G 5E4WC 1BR9A 2EPBA 3DEPA 2O5JC 2KHJA 2L1BA 4DV3L 2Z4HA 5LL6S 5JVH3 1QVGA 5DEHA 1S5ED 3CF5A 2B8FA 4DAYA 3HFZB 1VF5C 4A3JH 1T9HA 4LF6L 4A3FH 2JE6I 4KY7A 3SVMA 2B2VA 2KJXA 4LJZC 3HKZG 1WTWA 1YZ6A 1E2VA 1XXGA 2R92B 5A2QE 2QGQA 5IIFA 1VS0A 2KCMA 5I6YA 5IWAQ 1FR3A 4LAAA 1CA6A 3I55A 4OWXB 3IRBA 4WJ4A 1RF2D 2NTTA 3I90A 5IT9E 3WDNA 1TWHB 2RQXA 3S14H 4NDXA 3S15B 3E9HA 2ZM6L 2X6LA 4A3IG 4RG1A 5TSSA 3NTHA 4OGQC 1QCBD 1PRTD 3NTKA 4RKLA 1HUMA 4FF1A 1WD1A 5CMDA 4AIMA 2HDLA 1P8LA 1QZHA 3PIOA 4LFAL 3UDGA 3QJYA 2FFKB 1A62A 4CJ0B 3BYTB 3RZDH 1DD2A 4GOPB 1B4OA 1HNXL 3MEHA 1KAAA 1X65A 4RA8A 4QCLA 4IUPA 4IPGA 3T1HL 1Z6HA 4BY1G 2VUMB 2HQLA 3NHHA 4JOIC 1SDFA 1SE8A 2QILA 4DR2Q 1RTNA 4LFCQ 4OONA 2ZTDA 3Q22A 1KC8C 1QVCA 3EROA 1ZYRC 3KDFB 2B2UA 1J5EL 1B70B 4A3BG 2VNUD 4I65A 4L5QA 3SR1A 2F03A 3I4NH 4PZ7A 3VR6A 4ZUIA 3Q0AA 1HZCA 2QDLA 4DR1L 3GO5A 3FKIB 1VQNA 3DWAA 2CVRA 3OSOA 4IO9A 3CC4A 1K8MA 5CV9A 4HSPA 2YU9B 2L11A 5KGUA 3J80c 4FXDA 3PO2G 1L0XB 2AMCB 1LLRD 4DV0L 2VL6A 4LF8Q 4IN3A 5KNDA 1HHVA 2K03A 1PH2A 1H9KA 4LNQA 5M5YB 1EU4A 4YWLA 3S24A 1PRTF 1SXTA 2KBNA 1TWHH 2UXCQ 3BZKA 3JAME 1RJTA 1X32A 3TZUA 3PUZA 2M2LA 1BQQT 3OOCA 1SNOA 1O7ZA 3A8IE 4XIGS 1I50H 2UU9Q 4DAPA 4JI7Q 4OL7A 4QIWB 1YJWA 1VQ7A 4X3UA 3J81i 3BDOA 2Z0SA 4YCUA 3CD6A 3MA2B 3QO2A 2NN6G 2WKDA 4POFA 1PH5A 1OXXK 2VY3A 2ZXRA 1BBXC 5IYBG 3FRPB 2A6EC 1IHZA 3HZXA 4A3DG 2YYZA 2EJFC 1LT5D 4BBRH 4LF5L 1QUQB 2R3ZA 2K7VA 1HR0W 2OTLA 3MXNB 3NELA 2UXDQ 2JEBI 4ZKCB 2IHFA 2EYPA 1O78A 2NUCA 1X55A 3E0JA 4EGVA 4A3BH 1D1KA 1CHPD 1HFNA 2KCCA 4GLAC 1VQ4A 4HIDA 1IYJB 2E76C 1PZID 4LF8L 4WORA 5G3LF 4DV6L 1BKBA 4X64L 4L5TA 1W6JA 1C48A 4DR5Q 4BWGB 2JQOA 2WINB 2ZJQA 3I4MH 3W1GA 1WJJA 1KDAA 1I4GA 2K5QA 2KCTA 4YY3L 4KTAA 2K1BA 1ENAA 5CV4A 3MFYA 3CW2C 2NVYH 2WACA 3RUZA 2VS1A 4RFBA 1SJED 3P75A 2B2TA 2K28A 1KL9A 1CQVA 3AMUA 3V96A 3CQZB 1WTRA 1CQFA 4R4TA 1EOVA 1Q8KA 3GTLB 4XT1B 2MP1A 4NW2A 1CI3M 2R92H 4P75A 2LMCB 3KF8A 2JK8A 5M3MH 2DNEA 3WOEA 3CMEA 3HOUB 4PQXA 1WOCA 5FOBB 3D31A 1EIGA 3S1QH 1RDPD 3LX0A 3GV6A 2A6ED 4DN4M 1DJRD 2EY5A 3J7AF 1EQQA 1ET9A 3JAMc 1YJNA 3TDQA 2E5LL 4JBMA 3K5MA 2G9DA 3MZ5A 3GTGH 1V1QA 4FYDA 1Q7YC 2EYJA 1EEFD 3K8AA 4HIKA 5C0XI 4DF7A 2DJGC 5JOBA 2B39A 2HHHL 4GN4B 1TWAH 2WV6D 3SXHA 2B2WA 3X3NA 4HMIA 1J6QA 1TT2A 1Y1VB 3ND8A 3J81c 1ASYA 3V05A 4YY3Q 1YJ9A 3KLWA 2IHEA 1S5CD 1VQEA 2K75A 1PH4A 4C3JG 1XTDA 3X3MA 2UUAQ 4OIKA 4BBRG 2OXPA 4GN3B 4LF9L 5FO8B 3LGJA 1SNMA 2OTJA 4A75A 1U4MA 5IYDG 4Y7NB 2A69D 2GVAA 3H15A 4ZAIA 4JI6Q 1B9MA 2D0PA 4GOPC 4RWSC 3TP6A 5FJ8H 2E2HB 1R9TH 4A4IA 1STHA 5D65A 4JI2Q 2VXWA 1GUNA 2K5WA 2DY8A 1I4QA 1EOTA 4GKJQ 2D2CC 3C3LA 2JJQA 1DZ1A 2R92G 1ZYRD 1EY7A 1LTLA 1E24A 1Q1EA 2CW0D 4NP5A 3CCVA 2UUCL 4DV1L 4Y7NH 2KOLA 1GKHA 1S5FD 5G3LD 1VDZA 3ERQA 4F7XA 5CC4A 3A5UA 3S2DB 4C1NI 4C2MH 2EJMA 4YHHQ 2KHSA 3VA7A 5KYIA 4QUFA 3G6EA 1BCPB 3AFQA 4KV6A 1NMFA 3GTPH 3GTKB 3SK4A 3NBIA 1U9RA 4X62L 1U4LA 4B3RL 3VDYA 4ZYSA 2N49A 1Y1WH 3DXJC 5J22A 1DOMA 3GTMB 1STYA 4TVAB 2N78A 4A3EB 3RMHA 2O5IC 3PIO3 2JSOA 1AE3A 2Z1CA 4CKBA 1B3AA 4BBSG 3AU7A 4DUYQ 2CH4W 2K05A 1YI2A 2PQAB 2E2JB 3K0XA 5FLXL 1PMRA 2F0PA 2R93H 2CQOA 4Z9CB 2DNCA 4FDBA 2BDNA 4GNXC 2NN6I 2MQHA 5M5WB 4N9PA 3H3VC 3DEOA 4JYAQ 3KBGA 1N33Q 4V190 3OYYA 3G4SA 4XXEA 4A3CH 5EPLA 4MTNA 2RVLA 1KLUD 2ALYB 1A63A 2ZXPA 1A15A 1G91A 3KK7A 4EVOA 4BXXH 3GTQH 5C4JB 2XGTA 3ULLA 1ILQA 2MJ8A 2RCFA 4HJ8A 1O7YA 3RZOH 4YHHL 3CPWA 1DOLA 1V1PB 4R4IA 4K6DA 4FP5D 3FKIG 1KAWA 5C3XA 3HOWB 2HD3A 1TWFB 4UHVA 1EWHA 3D4WA 4B3RQ 3HP3A 4HJ9A 2G9HD 3I7FA 5LMUQ 3J80L 2A19A 1PYWD 2FMMA 5IP9H 3M3YH 1TIID 4HJAA 2XVSA 1XTCD 1EQRA 4IFDH 5A2QL 3U50C 5A35A 4A3GH 3R2IA 4A3LG 5KIXA 4GN5A 5I2YA 1STNA 4XTCS 2SNMA 5K5PA 2K5VA 2XRQD 4KD4A 3NENA 1WTVA 1Z47A 2FHTA 3R3OA 3FPUB 4F87A 3T53B 1SMYC 2F4IA 4CDFC 4R8NA 2A69C 5FK9C 4E6IA 4JG2A 1B7YB 2F0UA 1N33L 2K01A 5C3EB 3D6WA 1H9RA 4A3GB 1NR2A 3JAMi 4IPHA 3RLNA 1SAPA 3UE1A 4UP9A 3VA5A 1I4PA 4QL5A 3U9SA 4JI1Q 4LF4Q 3NP8A 1VQBA 1JMCA 3K80C 1MBYA 5FLXE 3B6YA 3QIAA 5FO9B 1TU2B 3EJIA 3PF5A 4Y52H 5NUCA 4HSVA 4A3MH 3GD7A 4G7HC 1N9WA 1SYDA 4DKAC 5F2DA 1Q3LA 3PO3H 4K0KL 1NR4A 2AUKA 1Y1WB 1FJGL 3NSWA 1JJGA 4BXXG 5C4XG 1HTLD 1ICWA 1UWVA 2WKCA 5M5YH 3OTOL 1IBKL 1B53A 4KMUC 5GAEC 1CSQA 3DM3A 5JEAH 2H1EA 2IX0A 5LHY1 2A68D 1CK1A 3CC7A 1ENCA 1KRSA 3PGZA 4AQYL 1SMXA 2F1MA 1XWEA 4IPCA 4X3TA 4QGUA 1RD9D 3BG3A 3OW2A 4OO1I 1LYLA 5CORA 1K83H 5IGDA 4WRDA 1DM0B 4ABNA 3FHWA 4A3IH 1PXUA 1X56A 2PZUA 1F2LA 2KUMA 3E0EA 3U4VA 5IYCH 4HCSA 5FLMG 4B08A 3HS0C 3AFPA 5C6AA 1PZKD 4LF4L 4IFDI 2K5DA 4DU9A 2B3GA 1SYBA 2BH2A 4WJWA 3PMFA 1SRUA 4MN3A 5KNBA 5IGCA 1WTXA 1L1OB 1I6HB 2CHBD 1VQDA 2CWPA 4RKBA 5E7NA 1CKMA 4BY7B 3DLLA 4K0KQ 2A68C 1D5ZC 1KABA 4HR7B 2B2UC 4O0AA 2QKIC 1L1OA 3K7UC 4HAEA 5I2XA 1NMGA 4LFBL 2B2YA 2K50A 4QIWE 5C4HA 4O2DA 1EY5A 4U673 1Q90A 3VYTA 1TS4A 4FXGC 2E8GA 4ZUJA 2KECA 2Z6KA 1DOKA 2A74C 2K52A 2N55A 4JI3Q 1ZEQX 4KJOA 2B63G 1LTGD 1PTOH 1O7IA 1YNXA 3G6JB 4DV5Q 2WB1G 3HOVB 2UXBQ 2RDFA 1G2TA 3HOYB 4XDXA 4RGMA 1QOHA 1G8ZD 4HIOA 4X65L 3GDEA 2NB0A 4K8JA 5J3BA 2SEBD 2RSOA 1KXLA 4P71A 2F0QA 4DUZL 5J1ZA 5D3DA 1V1OA 2OEOA 3WOFA 3J7YW 3BVGA 4KN4C 2DUDA 4N9TA 3KDFA 1K83B 1LABA 1STAA 5KRUA 1KRTA 2PPBC 1PFBA 1JJCB 3VR3A 2JN4A 1QNUA 1E1OA 4O1NA 1LV9A 4KHPL 3TQYA 1U4PA 2EYMA 1C8CA 2F0DA 4G7OC 3A7AB 2K14A 3CRLC 2JA5H 3ONAB 4ME3A 4X66Q 2RBMA 3RLFA 1CHQD 5HGTA 1VMCA 3F8TA 3BVZA 4IUUA 1HJPA 2TMPA 1RCVD 1EWCA 2PQEA 1S5DD 3MWYW 1SLJA 4IALA 5E1FA 1FNWA 1EZ8A 1NTGA 3A74A 5I9OA 2BE5C 1O7LA 1ESFA 1NCVA 1H9MA 1M8AA 2ZTEA 2VQEQ 3H0GB 1PH9A 4DV7Q 4LF5Q 3GTQB 1NE3A 1UAPA 1HNZL 2MGSA 5EQ0A 5JJLA 1SE3A 3VYRA 1W2BA 1PTOD 1Z7TA 1EZ6A 3A0JA 1A3VA 1SNQA 4DK0A 4N8X1 1PRTC 5EGTA 1Y8NB 3F2BA 4GNXB 2BDOA 2L9HA 1H9JA 2KVMA 2O4XA 1E22A 1SFOH 1Y8PB 4X3SA 1HR0Q 1Y8OB 4BBSB 1VF7A 3RD4A 1KLGD 1AW7A 4DK6C 5LL6X 3BJUA 3DWQA 2SDFA 4JBWA 1V8QA 2Q2HA 1FGBD 1HUNA 3J81j 4DV2L 1I4RA 2R93B 3I4MB 3M4PA 2AQ3B 4KHPQ 2VQFQ 1SNPA 1L0YB 5JEAJ 4L6TB 3CHBD 1PH3A 1HNXQ 2PYKA 3BDLA 5ELOA 1SFOB 4GLVB 3PUXA 3HOWG 2QCPX 3ITPA 1Y1VH 4PZ8A 5M5XH 4FF2A 2VB2X 3I91A 3WWVA 3NXWA 1BCPC 1N34Q 4HEDA 4DAMA 2NBFA 4A3DH 2IWHA 4O42A 1LTSD 2B2WC 4JW0A 2AQ1B 4IURA 4GKKL 5I9PA 3QG1A 2WAQG 3I70A 4EQOA 3HOVH 1J5EQ 3HOWH 3OMCA 2VQEL 1MJEA 4DV7L 4P2CB 5E3FA 5BN5A 1JB7A 2E5LQ 1C7YA 3RN5A 1Z9FA 5IOCA 3L3OC 3VR2A 2EYOA 4B3ML 3HOZB 4DV4L 2JA6H 5FLXc 3T1YQ 2EXZA 1SJHD 1R4PB 2RF4A 1AZPA 4X6AH 1EWIA 4DK3C 3BU2A 1H95A 4FVMA 3PUVA 1LT4D 1EQVA 3CCLA 1V43A 4C2MB 3GP7A 1E0BA 2R7FA 1WI5A 2R7ZB 1KDCA 1MKHA 1CM9A 2GA4B 5JVG3 3CRKC 3KF8B 1TR5A 3MAQA 5C3EG 3N6RA 2UUAL 1S72A 3I4LA 4XQJA 3SE0A 1JWSD 2HIVA 5M3FG 1I94L 5M9OA 2Y0SE 1Y1WG 4JV5Q 2EZVA 5C0XJ 3CCEA 2C9OA 3FEWX 1N34L 3H09A 1P16A 3CCMA 2F3IA 4DAVA 4NXML 2NZ1D 3TRZA 2F0LA 3HG9A 4GKKQ 1JICA 1IKLA 1VQOA 1JE4A 2MPMA 4UY8C 1B2TA 1L0WA 3OIPA 2ATWA 1SROA 4A76A 5AJ3L 3HRZC 2HCCA 4IQZA 3BZDB 1G2SA 1E2WA 4OO1G 1MI2A 1K0RA 5GAGC 1XMOQ 1PYSB 4DV4Q 2PW5A 5CBAE 2UUBQ 1PH1A 4KKSA 3RN2A 1TY2A 4A3EG 2JA8B 1U4RA 2RHQB 1BDOA 4P72A 3GTLH 1EIHA 1VQPA 5CBEE 3EN2A 5K36H 4C3IB 2ZM6Q 4EQNA 2QF7A 5EPJA 2ICIA 3K58A 4R4OA 2CKZB 3DUZA 4QMGA 1AE2A 1ASZA 2EY1A 3URYA 4IOAA 3EVQA 2VUMH 4QJFA 4J15A 5ELDA 2FXQA 2WIIB 3L7ZC 3T51B 2QEJC 4A3MB 3W3AA 2GVBA 4JV5L 4QF4A 5HURA 3HKZB 1PVOA 4QQBX 1G6ZA 1V9PA 1UE5A 3MEFA 5C44B 2JA7G 2HCIA 1L1OC 4DR2L 3CMAA 3CC2A 2K5NA 1D7QA 1LTAD 1STGA 2F0SA 5H1SE 1NUCA 1TWAB 4R1JA 2HUGA 4L8JA 1GD7A 3S2DH 2EYHA 2G5DA 5E4XA 1O80A 4LW1A 3GTPB 4FNFA 2RA4A 3P20A 2E75C 1CKNA 1MSHA 4TKOB 2H5XA 1XMOL 2UUBL 5IGFA 1M4VA 4RGNA 5C3WA 1GHKA 1PTOB 2C35B 5GQOA 1B44D 2AWNA 3P7JA 2I07B 1F9PA 4CKEA 4FXKC 3P1HA 4LUZA 4GNXA 2Y0SG 1JOOA 4NKLA 1VQ8A 1EYCA 2JA9A 4FO2A 5M3MG 3E9IA 3S1NH 1GHJA 2GN5A 4OX9L 1ICFB 1TS5A 2FINB 2I46A 2BOSA 2IPKD 4DR4Q 1PTOF 5IGGA 1VQAA 1A6XA 1S3OA 2VW9A 3DM1A 4K5VA 4JI7L 3OWEB 4K2LA 1F9RA 4MZ9A 2X69A 4JI6L 4ID6A 3S15H 1KDBA 2F0VA 1FNUA 5CV5A 1ZXTA 2XSCA 1TWGH 2K4KA 4IFDJ 1LUZA 2HQEA 2IT1A 1ONLA 1IBLL 4IUNA 4EX5A 3H0GG 3SK6A 1Q86C 1NSNS 3NK9A 3Q6SA 1YNJC 1SEBD 2A5HA 2F0WA 5C0XG 4KN7C 1N36L 4DR7Q 2HT1A 1VCIA 4JI1L 5FO7B 4DV1Q 3K81C 2XN9C 1LTRD 3NQIA 3A8KE 2D9UA 1SR3A 2SNSA 5JPMC 4I7AA 2PCFB 3PUWA 1CTMA 4B9XA 5CYUA 3M4QA 1BXTA 4YWKA 1IBML 2AKWB 4DV6Q 4AYBE 1YITA 4X64Q 2Z6BA 5C0XH 1TS3A 1JR0D 3T13A 2MO0A 3BDCA 1F2YA 2YTVA 1QILA 2KEEA 3KUPA 3GTOB 1J8IA 3R8BA 2CWAA 3S9WA 4PMBA 3A54A 4OX9Q 4IOCA 4PMWA 5C4ZA 1IW7C 4KKUA 1YVCA 4DR4L 2K04A 3G71A 4K5WA 4DR6L 4AQYQ 1VQ9A 1GUTA 1EEID 1PHJA 2EDGA 3CU7A 2Q2TA 1K0SA 3FVQA 4KHZA 2DJFC 4TSSA 3C1EA 3IAYA 1HCZA 5KNCA 2KA7A 3SDZA 2WAQB 3BYYB 1D8LA 4MNOA 4DXFA 2ZTCA 1TWFH 4HMJA 5IYCG 2I0QA 4JI0Q 4BS9A 5FLMH 4JVZA 1K28A 4XT3B 3GV3A 3SK5A 2D62A 2EVBA 5CV6A 1WTOA 1FL0A 3VR5A 1VQMA 3GQBA 3MXPA 4ZLTF 5JJKA 1N36Q 3EFXD 2QA4A 1VQ6A 4K8IA 5CV8A 4YWMA 1QWYA 4RGOS 1Q46A 1WD0A 3V2TA 4DPGA 1KTKA 3AB9A 4QB4A 2PNHA 1XNQL 2NZHA 1EU3A 3UDFA 4BBSH 4H7BA 2HHHQ 3HOYG 4KJNA 3M4OB 2K6AA 4LUOA 4LFBQ 4LF7Q 2A6HC 3S1NB 5LMNW 3J7A5 1ET6A 1ZKOA 2EIFA 4DV3Q 2PMZE 2E2IH 3PO3G 2JA5G 2K33A 2RKSA 4OHJA 1X54A 3TMEA 1XNRL 2IX1A 4Q5VA 5EKIA 3GTJB 1CZWA 1EL0A 1G6PA 4H0LC 2ES2A 1D2BA 2UXBL 3OW7A 1B50A 4TRDA 2XRSD 1K9MC 4XYOA 2R7ZG 3A7LA 1PFNA 2L5TA 2PZWA 3CCQA 1KHIA 2I5MX 2EY6A 5IT9L 4DAYB 1JWUD 2I5HA 3OMGA 1SYFA 4DUZQ 1I50B 4C3IH
chains in the Genus database with same CATH topology
3NPPA 2NN6H 3J80E 2D5DA 2B2YC 4XYQA 1WVLA 3S14B 1S4ZA 2ZT9C 3OHXC 3T56B 5COYA 1PTOC 4C3JB 3MXUA 3NTIA 5EBDA 1I4HA 1Y69U 1C4QA 3NQTA 1SYCA 1LACA 2Y0SB 3KLSA 2R6GA 1R9TB 4L63B 4UAIA 1HPCA 2HDMA 1RTOA 3K5OA 1TWGB 4IUTA 2E2IB 2MUYA 4C3HB 4G4KA 3E5SA 1CZGA 3VYUA 2ICEC 3MC0B 5I6WA 5C4XB 5EBCA 4IUQA 3UI2A 4J1MA 4CGYB 2F0NA 4J6HA 1EY4A 2J7ZA 3D8GA 2M00A 3LNNA 1AN8A 3KLRA 2SOBA 1HA5A 1H9SA 3TP8A 2F0EA 3VYSA 1A3UA 1BNZA 3QOJA 4KHVA 5CGKA 2L4NA 3SK8A 4R8IA 4A3JB 3MXGA 5DAUA 4LK1C 3MTSA 4TQUS 4WFN3 4QUCA 2M9VA 2XIWA 2CW0C 3K5NA 4ZRZA 2LS01 1LTID 2NTSA 4KD3A 1IL8A 4F8MA 1WCMB 2FMCA 3OIQA 2A73B 1V1PA 1G291 2F0FA 1AP0A 1KNAA 1FD7D 4H44C 5ELBA 3RZOB 1QB5D 5M3FB 2F0OA 3K57A 1QE6A 3NWTA 2KCNA 2FJ2A 4PMCA 2J4XA 3D3RA 4A3FB 5EJWA 5CV7A 4ZQ3A 3TZDA 1WTPA 3SHLA 3EQLC 3L9AX 1FYCA 3I4NB 3DMUA 1BO0A 5C5LA 2CQAA 4HCEA 1EFID 3BS1A 3PIP3 2OT2A 1DONA 1JB3A 2AWOA 4KI0A 2F0IA 4BBRB 2L12A 4CBVA 2L0CA 2DY7A 3C2PA 1SSOA 1JC7A 2EJGC 1OXUA 1STBA 3I72A 1B9NA 3SEBA 4DNRB 4DFAA 2F0JA 2VB3X 3M3YB 1BOSA 3KBXA 5KYLA 3R93A 2JA7B 2B2VC 1TVXA 4K6LA 4M8AA 1J9OA 1SYGA 4X3KA 1EY6A 3FPPA 4RHRA 1SMYD 1FNVA 2F3VA 4LMQD 2MHVA 5FKAC 1TWCB 2V4DA 2EY2A 3PV0A 1GUWA 4ODGA 3IFDA 3NBHA 1HFGA 3S1QB 1EYDA 2A6HD 5I4DA 1JORA 2AUJD 3S1RB 2LFNA 4G57A 3NE5B 3H91A 4KKTA 5CR3A 1UNSA 3DWPA 1SNCA 2Q8TA 3GTGB 2EYFA 2EYLA 4M1UB 3PO3B 3A55A 2H4OA 1MSGA 1D5XC 1TS2A 1ML0D 5IODA 4JK1C 4XQQA 4XQNA 2XNAC 4EQPA 1DYQA 3W2DA 4C56C 2PW7A 2TSSA 4KY5A 3TSSA 1ENFA 3U9OA 3K7AB 3QWNA 3KLSX 3LWEA 1LTBD 2L55A 4GZYC 2B63B 4YIJA 2C5CA 2QDBA 2BE5D 2WB1B 3MVVA 5BN4A 1IW7D 4BY1B 3M85A 1S5BD 2PO4A 2F3WA 1QNKA 2IL8A 2EOTA 2ENBA 1PFMA 3MHBA 5AFWA 2NVXB 2LY7A 3TP5A 4CJ1B 3T4AC 2F0HA 3S17B 1CFMA 4DNTB 1SE4A 4DK1A 1D6EC 3OWFA 4RHSA 1JQYD 5DNFA 4MHEA 2JA5B 1IYVA 1GUSA 1RHPA 2BCOA 1TY0A 4C1NK 2OF1A 1PLFA 3H6MA 5JAVA 1LT3D 2R61A 5M5XB 4ILWA 3J7AV 2E74C 1HQRD 4FF3A 5IGBA 4F88A 4RH6A 2IX3A 1LO5D 1D1IA 4ZK9B 5J39A 2K32A 4RGTA 1B1ZA 1JOKA 5JPNC 2F0GA 4OIJA 2NWGA 3HOXB 1A3TA 1T5EA 3Q23A 3M7NA 2JP1A 1PDQA 1II3A 1BCPD 1SE2A 1JOQA 4A3BB 3I8ZA 2Z8LA 4DGZA 4CHTB 5C5MA 1CT1D 1IKMA 2X6GA 1GXDC 3S2HB 3TBIB 1UUPA 3R2TA 1R4QB 2RDGA 1I4XA 1HXYD 2AQ2B 2BA1A 1I3QB 1MD2D 1TKWB 3IFTA 3D6CA 1LT6D 4CJ2C 1Q1BA 1HRJA 2KEDA 4BA1I 2KQ3A 2EE1A 1CA5A 3CKIB 3I73A 5M3MB 2JA6B 4MIUA 2JEAI 2PZTA 3K6OA 3RZDB 1IYUA 5D14A 4A3IB 2JXMB 1TQOA 1PZJD 3ZYYX 1ILPA 3E6ZX 1QG7A 1W6KA 1Q12A 1A2UA 2F0MA 5JJZA 1AZQA 4A3DB 2RSNA 4PNYA 3Q24A 1OXTA 1T5XD 1OXSC 1F2ZA 4B9WA 5EKKA 1STEA 1JWMD 1D5MC 1RKNA 2DN8A 2NVYB 1F77A 2XWBB 3FMCA 5ELFA 1QJOA 5T1GA 3QOLA 1EY0A 2J0TD 3FDTA 4KK7A 3VR4A 1UEAB 3K0YA 1PRTB 3T16A 4DXGA 3I3CA 2E2DC 5DM73 2LKVA 1I6VC 3D4DA 3IL8A 4OO1H 3EA6A 1XX8A 1RODA 4S3SA 4ME5A 1BF4A 4A93B 3H94A 1GOZA 4K14A 3J81E 2ZXOA 3NUCA 4U68A 4I7ZC 3M4YA 2BA0A 3LWUA 2PMZB 3MFGA 5ELCA 4BA2I 1E2ZA 4C3IG 5EPKA 4RCNA 3BVMA 1BCPF 1MGSA 3N52A 3TN2A 1EY9A 4RCOA 4AYBB 1GJXA 2IW3A 4ULLA 4FF4A 2NVTB 1JCKB 2Q8RE 2IJ0A 1EY8A 4H13C 4IZ8A 1DXMA 2N88A 3S16B 4R9WA 4KY6A 5ELEA 3K5LA 1K8OA 2RDHA 4HN7A 3OPOA 1SYEA 1BUVT 3A8JE 3A56A 1F9QA 2O2LD 3M7GA 1H9SB 4IFDG 3MXNA 3O13A 1HA6A 4NMZA 1KNEA 3PO2B 3HGBA 4Q0FA 4RAUC 3HEJA 3F2UA 4ZKBB 3D4RA 2NYZD 1F9SA 1SNDA 1OXVA 2Z4IA 1SBBB 1OO9B 2B2TC 1A2TA 4PV1C 2F0TA 1ESRA 1Q8IA 4A3KB 1LTTD 2NVQB 5ISRA 4K5XA 5T1IA 3C1FA 3ND9A 5JEAG 1GUGA 2Q8IB 4CKCA 3JAML 1HTPA 4J8QA 4UDUC 5D3IB 2F0KA 1X3QA 1X3PA 2WP8J 1YNJD 5IGEA 5BN3A 4DA2A 3G7LA 3C46A 1GUOA 2PNRC 1XYIA 4K2KA 3DHQA 3NWSA 1F2MA 1YNNC 3IKJA 3S1MB 1EYAA 1DCZA 4HTHA 1WTQA 3TP7A 3J81L 1NAPA 5EKLA 3PUYA 1HQMC 5KEEA 3K59A 1AEXA 4C3HG 2ID0A 2JYOA 1AFPA 1YNND 3QB3A 1VMPA 4G7ZC 1EQTA 2B8GA 5DM63 4V0BA 2XWJB 5K36G 4IUVA 5E4WC 1BR9A 2EPBA 3DEPA 2O5JC 2L1BA 2Z4HA 5LL6S 5JVH3 5DEHA 1S5ED 2B8FA 4DAYA 1VF5C 2JE6I 3SVMA 4KY7A 2B2VA 2KJXA 4LJZC 1WTWA 1E2VA 1XXGA 2R92B 5A2QE 5IIFA 5I6YA 1FR3A 4LAAA 1CA6A 1RF2D 2NTTA 3I90A 5IT9E 3WDNA 1TWHB 2RQXA 4NDXA 3S15B 2X6LA 5TSSA 3NTHA 4OGQC 1QCBD 1PRTD 3NTKA 4RKLA 1HUMA 4FF1A 1WD1A 5CMDA 2HDLA 3QJYA 2FFKB 4CJ0B 3BYTB 1DD2A 1B4OA 3MEHA 1KAAA 4RA8A 4QCLA 4IUPA 1Z6HA 2VUMB 3NHHA 1SDFA 2QILA 1RTNA 3Q22A 3EROA 1ZYRC 2B2UA 2VNUD 4I65A 2F03A 3SR1A 3VR6A 4ZUIA 3Q0AA 3GO5A 3FKIB 3DWAA 2CVRA 3OSOA 1K8MA 5CV9A 2YU9B 4HSPA 5KGUA 2L11A 4FXDA 1L0XB 1LLRD 4IN3A 5KNDA 1HHVA 2K03A 1H9KA 5M5YB 1EU4A 1PRTF 1SXTA 3JAME 1RJTA 1X32A 3TZUA 3PUZA 2M2LA 1BQQT 3OOCA 1SNOA 1O7ZA 3A8IE 4XIGS 4DAPA 4OL7A 4QIWB 4X3UA 3BDOA 3MA2B 3QO2A 2NN6G 2WKDA 1OXXK 2ZXRA 1BBXC 3FRPB 2A6EC 1IHZA 3HZXA 2YYZA 2EJFC 1LT5D 2R3ZA 2K7VA 2JEBI 4ZKCB 2EYPA 1O78A 2NUCA 3E0JA 4EGVA 1D1KA 1CHPD 1HFNA 2KCCA 2E76C 1PZID 4WORA 5G3LF 1W6JA 1C48A 4BWGB 2WINB 1KDAA 1I4GA 2K5QA 4KTAA 2K1BA 1ENAA 5CV4A 3MFYA 2WACA 3RUZA 4RFBA 1SJED 3P75A 2B2TA 2K28A 1CQVA 3AMUA 3V96A 3CQZB 1WTRA 1CQFA 3GTLB 4XT1B 2MP1A 4NW2A 1CI3M 2LMCB 3KF8A 2DNEA 3WOEA 3HOUB 4PQXA 5FOBB 3D31A 1EIGA 1RDPD 3LX0A 3GV6A 2A6ED 4DN4M 1DJRD 2EY5A 3J7AF 1ET9A 3TDQA 3K5MA 2G9DA 3MZ5A 4FYDA 2EYJA 1EEFD 5C0XI 4DF7A 5JOBA 2B39A 2WV6D 3SXHA 2B2WA 3X3NA 4HMIA 1TT2A 1Y1VB 3ND8A 3V05A 1S5CD 4C3JG 3X3MA 4OIKA 2OXPA 5FO8B 1SNMA 1U4MA 4Y7NB 2A69D 4ZAIA 1B9MA 4RWSC 3TP6A 2E2HB 1STHA 5D65A 2VXWA 1GUNA 2K5WA 2DY8A 1I4QA 1EOTA 2D2CC 3C3LA 1DZ1A 1ZYRD 1EY7A 1Q1EA 2CW0D 4NP5A 2KOLA 1S5FD 5G3LD 1VDZA 3ERQA 4F7XA 5CC4A 3S2DB 4C1NI 2EJMA 2KHSA 3VA7A 5KYIA 4QUFA 1BCPB 4KV6A 3GTKB 3SK4A 3NBIA 1U9RA 1U4LA 4ZYSA 3DXJC 5J22A 1DOMA 3GTMB 1STYA 4A3EB 3RMHA 2O5IC 3PIO3 2JSOA 2Z1CA 4CKBA 1B3AA 3AU7A 2K05A 2E2JB 5FLXL 1PMRA 2F0PA 4Z9CB 2DNCA 2BDNA 2NN6I 5M5WB 4N9PA 3H3VC 3DEOA 3KBGA 4V190 4XXEA 5EPLA 2RVLA 1KLUD 2ZXPA 1A15A 1G91A 3KK7A 4EVOA 5C4JB 1ILQA 2MJ8A 1O7YA 1DOLA 1V1PB 4K6DA 4FP5D 5C3XA 3HOWB 1TWFB 1EWHA 3D4WA 3HP3A 2G9HD 3J80L 1PYWD 2FMMA 1TIID 2XVSA 1XTCD 4IFDH 5A2QL 5A35A 3R2IA 5KIXA 5I2YA 1STNA 4XTCS 2SNMA 5K5PA 2XRQD 4KD4A 1WTVA 1Z47A 2FHTA 3R3OA 3FPUB 4F87A 3T53B 1SMYC 2F4IA 4R8NA 2A69C 5FK9C 4E6IA 2F0UA 2K01A 5C3EB 3D6WA 1H9RA 4A3GB 1NR2A 1SAPA 3VA5A 1I4PA 3U9SA 3NP8A 1MBYA 5FLXE 3QIAA 5FO9B 1TU2B 3EJIA 5NUCA 4HSVA 3GD7A 4G7HC 1SYDA 5F2DA 1Q3LA 1NR4A 2AUKA 1Y1WB 3NSWA 1HTLD 1ICWA 2WKCA 1B53A 4KMUC 5JEAH 2H1EA 2IX0A 5LHY1 2A68D 1CK1A 1ENCA 2F1MA 1XWEA 4X3TA 1RD9D 3BG3A 4OO1I 5CORA 5IGDA 4WRDA 1DM0B 4ABNA 1PXUA 2PZUA 1F2LA 2KUMA 4HCSA 4B08A 3HS0C 5C6AA 1PZKD 4IFDI 2K5DA 4DU9A 1SYBA 4WJWA 3PMFA 4MN3A 5KNBA 5IGCA 1WTXA 1I6HB 2CHBD 4RKBA 4BY7B 2A68C 1D5ZC 1KABA 4HR7B 2B2UC 2QKIC 5I2XA 4HAEA 2B2YA 5C4HA 1EY5A 4U673 1Q90A 3VYTA 1TS4A 4FXGC 4ZUJA 2KECA 1DOKA 2A74C 2N55A 1ZEQX 4KJOA 1LTGD 1PTOH 3G6JB 3HOVB 2RDFA 1G2TA 3HOYB 4XDXA 4RGMA 1QOHA 1G8ZD 2NB0A 4K8JA 2SEBD 2RSOA 2F0QA 5J1ZA 5D3DA 1V1OA 2OEOA 3WOFA 3J7YW 3BVGA 4KN4C 4N9TA 1K83B 1LABA 1STAA 5KRUA 2PPBC 1PFBA 3VR3A 1QNUA 4O1NA 1LV9A 1U4PA 2EYMA 1C8CA 2F0DA 4G7OC 3A7AB 3CRLC 3ONAB 2RBMA 3RLFA 1CHQD 5HGTA 1VMCA 3BVZA 4IUUA 2TMPA 1RCVD 1EWCA 2PQEA 1S5DD 3MWYW 4IALA 5E1FA 1FNWA 1EZ8A 5I9OA 2BE5C 1O7LA 1ESFA 1NCVA 1H9MA 1M8AA 3H0GB 3GTQB 1UAPA 2MGSA 5EQ0A 1SE3A 3VYRA 1PTOD 1Z7TA 1EZ6A 1A3VA 1SNQA 4DK0A 1PRTC 5EGTA 1Y8NB 2BDOA 2L9HA 1H9JA 2KVMA 2O4XA 1Y8PB 4X3SA 1Y8OB 4BBSB 1VF7A 3RD4A 1KLGD 1AW7A 5LL6X 3DWQA 2SDFA 4JBWA 1V8QA 1FGBD 1HUNA 1I4RA 2R93B 3I4MB 2AQ3B 1SNPA 1L0YB 5JEAJ 4L6TB 3CHBD 2PYKA 3BDLA 1SFOB 3PUXA 2QCPX 3ITPA 4FF2A 2VB2X 3I91A 3NXWA 1BCPC 4HEDA 2NBFA 2IWHA 4O42A 1LTSD 2B2WC 2AQ1B 4IURA 5I9PA 3QG1A 3I70A 4EQOA 3OMCA 4P2CB 5E3FA 5BN5A 5IOCA 3L3OC 3VR2A 2EYOA 3HOZB 2EXZA 1SJHD 1R4PB 1AZPA 4FVMA 3PUVA 1LT4D 1EQVA 1V43A 4C2MB 3GP7A 1E0BA 2R7ZB 1KDCA 1CM9A 2GA4B 5JVG3 3CRKC 1TR5A 3MAQA 3N6RA 3I4LA 4XQJA 3SE0A 1JWSD 5M9OA 2EZVA 5C0XJ 2C9OA 3FEWX 3H09A 4DAVA 2NZ1D 2F0LA 3HG9A 1JICA 1IKLA 1JE4A 2MPMA 1B2TA 3OIPA 3HRZC 2HCCA 4IQZA 3BZDB 1G2SA 1E2WA 4OO1G 1MI2A 2PW5A 5CBAE 4KKSA 1TY2A 2JA8B 1U4RA 1BDOA 1EIHA 5CBEE 5K36H 4C3IB 4EQNA 2QF7A 5EPJA 2ICIA 3K58A 3DUZA 4QMGA 2EY1A 3URYA 3EVQA 5ELDA 2WIIB 3L7ZC 3T51B 2QEJC 4A3MB 3W3AA 4QF4A 5HURA 3HKZB 1G6ZA 5C44B 2HCIA 1LTAD 1STGA 2F0SA 1NUCA 1TWAB 2HUGA 4L8JA 2EYHA 5E4XA 1O80A 3GTPB 4FNFA 2RA4A 3P20A 2E75C 1MSHA 4TKOB 5IGFA 1M4VA 4RGNA 5C3WA 1GHKA 1PTOB 1B44D 2AWNA 3P7JA 2I07B 1F9PA 4CKEA 4FXKC 3P1HA 1JOOA 4NKLA 1EYCA 4FO2A 1GHJA 1TS5A 2FINB 2I46A 2BOSA 2IPKD 1PTOF 5IGGA 1A6XA 3DM1A 4K5VA 3OWEB 4K2LA 1F9RA 2X69A 4ID6A 1KDBA 2F0VA 1FNUA 5CV5A 1ZXTA 2XSCA 4IFDJ 2HQEA 2IT1A 1ONLA 4IUNA 3SK6A 1NSNS 3NK9A 3Q6SA 1YNJC 1SEBD 2A5HA 2F0WA 5C0XG 4KN7C 1VCIA 5FO7B 2XN9C 1LTRD 3NQIA 3A8KE 2D9UA 2SNSA 5JPMC 2PCFB 3PUWA 1CTMA 4B9XA 5CYUA 1BXTA 5C0XH 1TS3A 1JR0D 3T13A 3BDCA 1F2YA 1QILA 2KEEA 3KUPA 3GTOB 1J8IA 3R8BA 3S9WA 4PMBA 3A54A 4PMWA 5C4ZA 1IW7C 4KKUA 2K04A 4K5WA 1GUTA 1EEID 2EDGA 3CU7A 3FVQA 4KHZA 4TSSA 3C1EA 3IAYA 1HCZA 5KNCA 2KA7A 3SDZA 2WAQB 3BYYB 4DXFA 4HMJA 4BS9A 4XT3B 3GV3A 3SK5A 2D62A 1WTOA 2EVBA 5CV6A 3VR5A 3GQBA 3MXPA 4ZLTF 3EFXD 4K8IA 5CV8A 1QWYA 4RGOS 1WD0A 3V2TA 1KTKA 3AB9A 4QB4A 1EU3A 4H7BA 4KJNA 3M4OB 2K6AA 2A6HC 3S1NB 1ET6A 1ZKOA 2K33A 2RKSA 4OHJA 3TMEA 2IX1A 4Q5VA 5EKIA 3GTJB 1CZWA 1EL0A 4H0LC 1D2BA 3OW7A 1B50A 4TRDA 2XRSD 4XYOA 3A7LA 1PFNA 2L5TA 2PZWA 2EY6A 5IT9L 1JWUD 3OMGA 1SYFA 1I50B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUP A;  1BXT A;  3R2T A;  1RD9 D;  2RDG A;  1CHQ D;  3BVM A;  1SJH D;  1BCP F;  1I4X A;  1TS3 A;  1JR0 D;  3BYT B;  1HXY D;  1V1P B;  2AQ2 B;  3BVZ A;  1LTA D;  4K6L A;  1MD2 D;  1QIL A;  1CHP D;  1LTI D;  1RCV D;  4RCO A;  1SE4 A;  1EWC A;  1LT6 D;  1S5D D;  2NTS A;  4RHR A;  1D6E C;  3R8B A;  1LT4 D;  2G9H D;  1FNW A;  1FNV A;  3GP7 A;  1PZI D;  5FKA C;  1PYW D;  4RHS A;  2QIL A;  1JQY D;  1ESF A;  1PTO C;  1JCK B;  1V1P A;  1I4Q A;  2IJ0 A;  1XTC D;  1EEI D;  4BWG B;  1PZK D;  1I4H A;  1FD7 D;  3R2I A;  5ELB A;  1JWS D;  1I4G A;  1M4V A;  1SE3 A;  4TSS A;  4RGN A;  1PTO B;  1PTO D;  5ELE A;  5I4D A;  2XRQ D;  2CHB D;  1TY0 A;  1B44 D;  1S5F D;  4RFB A;  1PRT C;  3BYY B;  1SJE D;  2RDH A;  4DXF A;  3DWA A;  1PZJ D;  1LT3 D;  2R61 A;  1D5Z C;  1CQV A;  1KLG D;  1AW7 A;  3DWQ A;  2J4X A;  2O2L D;  4L63 B;  1BCP B;  1HQR D;  1UNS A;  5FK9 C;  1FGB D;  3DWP A;  3O13 A;  1L0X B;  1TS4 A;  3EFX D;  1I4R A;  1D5X C;  1LLR D;  4ZYS A;  1TS2 A;  1TS5 A;  4RH6 A;  1T5X D;  2IPK D;  1LO5 D;  2AQ3 B;  1PTO F;  3BZD B;  1LTG D;  3MC0 B;  1RDP D;  1JWM D;  1PTO H;  1STE A;  1D5M C;  2XNA C;  1I4P A;  1L0Y B;  4RGO S;  1EU4 A;  4L6T B;  1F77 A;  1KTK A;  3CHB D;  1PRT F;  1DYQ A;  1DJR D;  1SXT A;  3W2D A;  3OWE B;  4RGM A;  4C56 C;  1S5E D;  1G8Z D;  1ET9 A;  1EFI D;  1EU3 A;  4RGT A;  5ELF A;  1B1Z A;  1TY2 A;  2SEB D;  1AN8 A;  1FNU A;  2TSS A;  1BCP C;  1XXG A;  5D3D A;  1SBB B;  1HA5 A;  1ENF A;  1V1O A;  3TSS A;  1ET6 A;  1PRT B;  3BVG A;  4DXG A;  1LTS D;  3KLS X;  4OHJ A;  2AQ1 B;  4Z9C B;  1EEF D;  2ICI A;  1LTB D;  1LTT D;  3EA6 A;  1HTL D;  1BCP D;  1SE2 A;  1SEB D;  1RF2 D;  2NTT A;  3SEB A;  3URY A;  1GOZ A;  2WV6 D;  4O1N A;  2XN9 C;  2XRS D;  2Z8L A;  1S5B D;  5ELD A;  1LTR D;  1CT1 D;  1CK1 A;  3V05 A;  1KLU D;  2QEJ C;  5TSS A;  4UDU C;  1S5C D;  5D3I B;  1PRT D;  1LT5 D;  1JWU D;  3MFG A;  5ELC A; 
#chains in the Genus database with same CATH topology
 3NPP A;  2NN6 H;  2P5Z X;  2NVQ H;  3J80 E;  2D5D A;  5M5W H;  2B2Y C;  1BBW A;  1K8A C;  4XYQ A;  1WVL A;  1WYD A;  1UE1 A;  4BY1 H;  3S14 B;  1S4Z A;  2Z6K C;  2ZT9 C;  5EAY A;  5FJ8 G;  2UUC Q;  4ALP A;  3OHX C;  4ZCK A;  3T56 B;  1YIJ A;  1HNW Q;  4JCV E;  4LFA Q;  5COY A;  2JA6 G;  1S40 A;  1PTO C;  1EYG A;  4C3J B;  3MXU A;  3NTI A;  5EBD A;  1I4H A;  4UPA A;  1Y69 U;  1XNQ Q;  3T1H Q;  4RMF A;  4A3G G;  4X62 Q;  4AH6 A;  1C4Q A;  4QY7 A;  2YV5 A;  2K5H A;  2RCN A;  2D0O A;  4IPD A;  3NQT A;  4POG A;  1SYC A;  4YCW A;  1U5K A;  1LAC A;  3OTO Q;  2Y0S B;  1IBK Q;  3KYH C;  3KLS A;  4OEL B;  2R6G A;  1R9T B;  2JA8 H;  4L63 B;  4UAI A;  3U4Z A;  2LXJ A;  1HPC A;  2HDM A;  1RTO A;  3ULJ A;  3K5O A;  3ULP A;  2E2J H;  1TWG B;  4IUT A;  2E2I B;  4DUY L;  2MUY A;  4C3H B;  4G4K A;  3E5S A;  3H3V I;  1CZG A;  3VYU A;  1HZA A;  2ICE C;  3MC0 B;  5I6W A;  5C4X B;  4H02 A;  5EBC A;  4IUQ A;  3UI2 A;  4J1M A;  4CGY B;  4JC0 A;  2F0N A;  4J6H A;  1EY4 A;  4R4Q A;  2J7Z A;  3D8G A;  3KFU A;  3PF4 A;  1VQL A;  2M00 A;  1Q82 C;  3LNN A;  3F2C A;  4DV0 Q;  1AN8 A;  4GS3 A;  3KLR A;  5IYB H;  3UE0 A;  4JI4 L;  2SOB A;  1HA5 A;  3HOZ H;  1H9S A;  4DV2 Q;  3TP8 A;  2F0E A;  5C4J H;  1A8V A;  3VYS A;  1A3U A;  1BNZ A;  3QOJ A;  5L37 A;  1XMQ Q;  2WAQ E;  4KHV A;  4OXP A;  5CGK A;  2L4N A;  1EUJ A;  3SK8 A;  1N32 L;  2EXD A;  4A3C G;  1UE6 A;  4R8I A;  4A3J B;  3MXG A;  2IY5 B;  5DAU A;  3J7Z C;  4PZ6 A;  2BH8 A;  4LK1 C;  4UP7 A;  3MTS A;  1PH8 A;  1IL2 A;  4TQU S;  4WFN 3;  1VQJ A;  4QUC A;  2M9V A;  4HJ5 A;  2XIW A;  2CW0 C;  3K5N A;  5IE8 A;  2PI2 E;  4ZRZ A;  1X3F A;  2LS0 1;  3TRE A;  1OTC A;  1IZ6 A;  1LTI D;  1E1T A;  1U0L A;  1VQC A;  3KJP A;  2NTS A;  4KD3 A;  3ICE A;  1IL8 A;  2A8V A;  4F8M A;  1WCM B;  1NJI C;  2HIX A;  2FMC A;  3CQZ H;  1K73 C;  2UXD L;  3OIQ A;  2A73 B;  3TS2 A;  1V1P A;  1G29 1;  2F0F A;  1AP0 A;  4IJL A;  1KNA A;  1FD7 D;  4H44 C;  5ELB A;  4GLX A;  3T1Y L;  3RZO B;  1QB5 D;  5M3F B;  5DLQ E;  2R7D A;  2F0O A;  4JI4 Q;  3K57 A;  4A93 G;  2VZA A;  2B29 A;  1QE6 A;  3NWT A;  2KCN A;  2Q2U A;  2FJ2 A;  4DR5 L;  4PMC A;  2J4X A;  3D3R A;  5BR8 L;  1XMQ L;  4A3F B;  1VQH A;  5EJW A;  1EIY B;  5CV7 A;  4ZQ3 A;  4A3L H;  3EIV A;  3CCJ A;  3TZD A;  1PFS A;  1TXY A;  3PIP A;  1WTP A;  1NBW A;  3I56 A;  3SHL A;  3EQL C;  3L9A X;  1I94 Q;  1FYC A;  2B63 H;  3I4N B;  3ERS X;  3DMU A;  1BO0 A;  1C0A A;  3CCS A;  5C5L A;  2CQA A;  4HCE A;  1EFI D;  3BS1 A;  3PIP 3;  3AEV A;  2OT2 A;  1DON A;  3E3X A;  1JB3 A;  2AWO A;  4KI0 A;  2F0I A;  4BBR B;  4NB3 A;  3I4O A;  1XPO A;  2L12 A;  4CBV A;  2L0C A;  2DY7 A;  3C2P A;  1SSO A;  4DR1 Q;  1JC7 A;  4LWC A;  2EJG C;  1OXU A;  1STB A;  2N3S A;  1HNZ Q;  3I72 A;  3TEH B;  1B9N A;  3SEB A;  3GTO H;  4DNR B;  1WTH A;  3KF6 A;  4DFA A;  2N8N A;  4JI8 L;  2F0J A;  2R7Z H;  1TWC H;  1HR0 L;  2CH4 A;  2VB3 X;  3M3Y B;  3PCO B;  3M9B A;  1BOS A;  1EIF A;  2KEN A;  3KBX A;  5KYL A;  1EFW A;  2LXK A;  3R93 A;  1X9N A;  5IY0 A;  1K3R A;  5C44 G;  2JA7 B;  1DGS A;  2B2V C;  5M3F H;  1TVX A;  4K6L A;  4M8A A;  4CDC C;  2UXC L;  2OQ0 A;  2L15 A;  2CFM A;  1J9O A;  1SYG A;  4X3K A;  1EY6 A;  3FPP A;  4RHR A;  1SMY D;  4JI5 Q;  1FNV A;  2F3V A;  4LMQ D;  2MHV A;  5FKA C;  1TWC B;  2V4D A;  1PH6 A;  2EY2 A;  3PV0 A;  3L2P A;  1MIU A;  5IP7 G;  1GUW A;  4ODG A;  5C3E H;  3CCU A;  1KIX A;  2NVX H;  4HJ7 A;  3IFD A;  3I4M G;  3NBH A;  1BBU A;  1HFG A;  3S1Q B;  1EYD A;  1YHB A;  2A6H D;  3PSI A;  5I4D A;  4OWW B;  1JOR A;  2WB1 E;  4A3K G;  2F52 A;  1KQS A;  3CXC A;  2AUJ D;  3S1R B;  2LFN A;  4G57 A;  3NE5 B;  3H91 A;  4KKT A;  5CR3 A;  4UP8 A;  1UNS A;  3DWP A;  1HZB A;  1SNC A;  2Q8T A;  3GTG B;  1YBY A;  2EYF A;  2EYL A;  4M1U B;  3PO3 B;  3A55 A;  1KD1 C;  2H4O A;  1MSG A;  1C9O A;  1D5X C;  1Q81 C;  1TS2 A;  1ML0 D;  5IOD A;  4JK1 C;  4EQ5 A;  4XQQ A;  2ZJR A;  4XQN A;  2XNA C;  1I6H H;  1M1K C;  4EQP A;  3STB C;  1DYQ A;  3W2D A;  4C56 C;  4BY7 G;  2Z9H A;  2PW7 A;  2TSS A;  2LSS A;  4KY5 A;  4KLK A;  3TSS A;  1ENF A;  1VQF A;  3U9O A;  3K7A B;  3QWN A;  3HOZ G;  3KLS X;  3LWE A;  1LTB D;  4JI5 L;  2L55 A;  2MO1 A;  2JA7 H;  4GZY C;  2B63 B;  4YIJ A;  2C5C A;  2QDB A;  2BE5 D;  2WB1 B;  4A3J G;  5GAD C;  3HOV G;  3MVV A;  5BN4 A;  1IW7 D;  4BY1 B;  1W3S A;  3M85 A;  2VUM G;  2ZJP A;  1S5B D;  2PO4 A;  2F3W A;  2Q2I A;  1QNK A;  2IL8 A;  2EOT A;  2ENB A;  1PFM A;  2NVT H;  3NEM A;  3MHB A;  3RLO A;  4LFC L;  3H0G H;  5AFW A;  4C3J H;  2NVX B;  1IBL Q;  2LY7 A;  1G51 A;  3TP5 A;  3AQQ A;  4CJ1 B;  3T4A C;  2F0H A;  5AJ3 Q;  3S17 B;  1CFM A;  4DNT B;  3FKI H;  1QVF A;  4DR7 L;  1SE4 A;  4DK1 A;  1Y14 B;  1D6E C;  3OWF A;  1MJC A;  4AYB G;  4RHS A;  3GTK H;  1X6O A;  1JQY D;  5DNF A;  4MHE A;  3HKZ E;  2JA5 B;  1IYV A;  1GUS A;  1RHP A;  5IT9 c;  4JBK A;  4LUV A;  2BCO A;  4NPS A;  1TY0 A;  4C1N K;  2OF1 A;  1PLF A;  3H6M A;  2VQF L;  5JAV A;  1LT3 D;  2R61 A;  5JJI A;  5M5X B;  4ILW A;  1X3E A;  3J7A V;  2E74 C;  3M4O H;  4DNI A;  1HQR D;  4FF3 A;  5IGB A;  2UU9 L;  1GVP A;  4F88 A;  3K7A H;  4RH6 A;  2IX3 A;  4B3T L;  3EBE A;  4N8F A;  1LO5 D;  1D1I A;  4ZK9 B;  1XPR A;  3UDI A;  5J39 A;  3KOJ A;  2K32 A;  1UEB A;  1B3Q A;  1YHA A;  4JI2 L;  4RGT A;  3TS0 A;  1B1Z A;  1JOK A;  5JPN C;  2F0G A;  1I5F A;  4A3M G;  3STB D;  4GKJ L;  4OIJ A;  2NWG A;  3D0F A;  3HOX B;  4B3S L;  1A3T A;  1T5E A;  3Q23 A;  3M7N A;  2JP1 A;  1PH7 A;  1IXR A;  1QUQ A;  1K3B C;  1A0I A;  2R93 G;  4JOI A;  1PDQ A;  1II3 A;  1BCP D;  1SE2 A;  3CPF A;  3RNU A;  1JOQ A;  2A1A A;  4A3B B;  3I8Z A;  3HOY H;  1GM5 A;  2Z8L A;  4CDD C;  4DGZ A;  4CHT B;  5C5M A;  1CT1 D;  1IKM A;  2X6G A;  1AH9 A;  3FP9 A;  1UE7 A;  1GXD C;  3S2H B;  3TBI B;  1RIP A;  1UUP A;  3R2T A;  1R4Q B;  2RDG A;  1SN8 A;  1XNR Q;  1I4X A;  2MNA A;  1HXY D;  2AQ2 B;  2BA1 A;  1QZG A;  1I3Q B;  1MD2 D;  1TKW B;  3IFT A;  2KHI A;  3D6C A;  1CKO A;  3I4N G;  1LT6 D;  4CJ2 C;  1Q1B A;  1HRJ A;  4YCV A;  2KED A;  3L0O A;  4BA1 I;  4DR3 L;  4B3T Q;  2KQ3 A;  1N8R C;  1JT8 A;  2EE1 A;  1CA5 A;  3CKI B;  2QEX A;  5IP9 G;  4NXM Q;  3I73 A;  2F4V Q;  2YTX A;  4HIM A;  5M3M B;  2JA6 B;  4MIU A;  2JEA I;  2PZT A;  3PO2 H;  3K6O A;  4C3H H;  4JYA L;  3RZD B;  1IYU A;  4OWT B;  5D14 A;  1I3Q H;  1RL2 A;  4B3S Q;  3NBH B;  4A3I B;  2JXM B;  1TQO A;  1PZJ D;  3ZYY X;  1ILP A;  3QR8 A;  3KF6 B;  3E6Z X;  1QG7 A;  1W6K A;  1Q12 A;  3HKS A;  1A2U A;  2F0M A;  1HNW L;  5JJZ A;  1AZQ A;  4A3D B;  2RSN A;  4PNY A;  2RHS B;  3Q24 A;  1B8A A;  1OXT A;  1T5X D;  1OXS C;  3W5O A;  1F2Z A;  5ELN A;  4B9W A;  5EKK A;  1JWM D;  1STE A;  1D5M C;  1RKN A;  2DN8 A;  3GTJ H;  1IBM Q;  4A93 H;  3F1Z A;  2NVY B;  2DGY A;  5LMU L;  1F77 A;  1PA6 A;  4BY7 H;  2XWB B;  3CP0 A;  1VQG A;  3G48 A;  3FMC A;  1NNX A;  5ELF A;  1VQ5 A;  1GO3 E;  1QJO A;  3RR5 A;  4CDE C;  5T1G A;  3QOL A;  3KJO A;  1EY0 A;  2J0T D;  3FDT A;  1WFQ A;  4JI3 L;  4KK7 A;  3VR4 A;  1UEA B;  5HY6 A;  3S2H H;  3K0Y A;  1PRT B;  4LF9 Q;  3T16 A;  4DXG A;  3I3C A;  4DV5 L;  2E2D C;  5DM7 3;  4DR6 Q;  2LKV A;  4NXN L;  1I6V C;  3D4D A;  3IL8 A;  4OO1 H;  4DR3 Q;  3EA6 A;  3JC6 6;  1XX8 A;  1ROD A;  4S3S A;  4ME5 A;  5C4X H;  5HGQ A;  4X65 Q;  1BF4 A;  4A93 B;  3W1B A;  3H94 A;  5IYD H;  1HH2 P;  1GOZ A;  2F4V L;  4K14 A;  1XJV A;  1E7Z A;  3J81 E;  2ZXO A;  3NUC A;  4U68 A;  4I7Z C;  3M4Y A;  2BA0 A;  3LWU A;  1PV4 A;  2PMZ B;  3MFG A;  5ELC A;  4BA2 I;  4GOP A;  1E2Z A;  4JPB W;  4C3I G;  5EPK A;  4RCN A;  2YTY A;  3BVM A;  2PI2 A;  1BCP F;  1MGS A;  3N52 A;  3HOU G;  3TN2 A;  1K8G A;  1FGU A;  1EY9 A;  4RCO A;  4AYB B;  1N32 Q;  1GJX A;  1BVS A;  3S1R H;  1NY4 A;  5GRO A;  2IW3 A;  4ULL A;  3H3V H;  4FF4 A;  1LM0 A;  2YU9 H;  1WCM G;  4P74 A;  2NVT B;  1JCK B;  5IP7 H;  2Q8R E;  2CCZ A;  1FJG Q;  2IJ0 A;  1EY8 A;  4H13 C;  4IZ8 A;  4LF7 L;  1DXM A;  3HOU H;  2N88 A;  3S16 B;  3U58 A;  4R9W A;  4KY6 A;  4R4C A;  5ELE A;  3K5L A;  3GTM H;  1K8O A;  3CCR A;  2RDH A;  4HN7 A;  3OPO A;  3CAM A;  1SYE A;  1BUV T;  2AHO B;  3A8J E;  1WCM H;  1CKN B;  3A56 A;  4NXN Q;  1F9Q A;  2O2L D;  3M7G A;  1H9S B;  4IFD G;  1Y1V G;  3MXN A;  3O13 A;  2PQA A;  1HA6 A;  4NMZ A;  1KNE A;  3PO2 B;  2OWO A;  2NZO A;  3HGB A;  2EQS A;  2I5L X;  4A3K H;  4Q0F A;  1JJ2 A;  4RAU C;  1XPU A;  3HEJ A;  3F2U A;  4ZKB B;  4A3F G;  3D4R A;  2MFI A;  2NYZ D;  5LMN L;  1F9S A;  5BR8 Q;  1L2F A;  1SND A;  3I2Z A;  1OXV A;  2Z4I A;  1SBB B;  1X3G A;  1OO9 B;  2B2T C;  1A2T A;  4PV1 C;  2F0T A;  1ESR A;  1M90 C;  3AYH B;  1Q8I A;  4A3K B;  1LTT D;  2NVQ B;  5ISR A;  4K5X A;  5T1I A;  3S17 H;  4MTK A;  3C1F A;  3ND9 A;  3ZJY C;  5JEA G;  4A3E H;  4L5R C;  2XTI A;  2OQK A;  1GUG A;  2E2H H;  1JE5 A;  3J80 i;  2OCE A;  2Q8I B;  4CKC A;  1MHW C;  3JAM L;  1HTP A;  4J8Q A;  4UDU C;  5D3I B;  2F0K A;  3UDX A;  1VQI A;  1X3Q A;  1X3P A;  2WP8 J;  1YNJ D;  1PYB A;  5IGE A;  4LF6 Q;  5BN3 A;  4DA2 A;  3G7L A;  4PG3 A;  3SGI A;  3S16 H;  3C46 A;  1GUO A;  3F2D A;  2PNR C;  1XYI A;  4K2K A;  1YEZ A;  3DHQ A;  3ER0 A;  3Q8D A;  1E3P A;  4IJH A;  3NWS A;  1F2M A;  5IWA L;  4B3M Q;  1YNN C;  4OEM B;  4JI8 Q;  2ASB A;  3IKJ A;  3S1M B;  4WJ3 M;  1EYA A;  1DCZ A;  4HTH A;  1CUK A;  3TP7 A;  3J81 L;  1WTQ A;  1NAP A;  5EKL A;  4JI0 L;  2WFW A;  4P73 A;  2QW7 A;  3PUY A;  1HQM C;  3HOX G;  5C44 H;  2V1C C;  5KEE A;  3K59 A;  4APV A;  1AEX A;  3A5Z B;  4C3H G;  2ID0 A;  1CSP A;  1HZ9 A;  2JYO A;  1AFP A;  5LMN Q;  3PQI A;  1YNN D;  4L5S A;  1YHQ A;  2JA8 G;  3QB3 A;  5GAH C;  1VMP A;  4G7Z C;  3S1M H;  3HOX H;  4X66 L;  1EQT A;  1VQK A;  2B8G A;  5DM6 3;  4V0B A;  1FVI A;  4JBJ A;  2XWJ B;  3BZC A;  4IUV A;  5K36 G;  5E4W C;  1BR9 A;  2EPB A;  3DEP A;  2O5J C;  2KHJ A;  2L1B A;  4DV3 L;  2Z4H A;  5LL6 S;  5JVH 3;  1QVG A;  5DEH A;  1S5E D;  3CF5 A;  2B8F A;  4DAY A;  3HFZ B;  1VF5 C;  4A3J H;  1T9H A;  4LF6 L;  4A3F H;  2JE6 I;  4KY7 A;  3SVM A;  2B2V A;  2KJX A;  4LJZ C;  3HKZ G;  1WTW A;  1YZ6 A;  1E2V A;  1XXG A;  2R92 B;  5A2Q E;  2QGQ A;  5IIF A;  1VS0 A;  2KCM A;  5I6Y A;  5IWA Q;  1FR3 A;  4LAA A;  1CA6 A;  3I55 A;  4OWX B;  3IRB A;  4WJ4 A;  1RF2 D;  2NTT A;  3I90 A;  5IT9 E;  3WDN A;  1TWH B;  2RQX A;  3S14 H;  4NDX A;  3S15 B;  3E9H A;  2ZM6 L;  2X6L A;  4A3I G;  4RG1 A;  5TSS A;  3NTH A;  4OGQ C;  1QCB D;  1PRT D;  3NTK A;  4RKL A;  1HUM A;  4FF1 A;  1WD1 A;  5CMD A;  4AIM A;  2HDL A;  1P8L A;  1QZH A;  3PIO A;  4LFA L;  3UDG A;  3QJY A;  2FFK B;  1A62 A;  4CJ0 B;  3BYT B;  3RZD H;  1DD2 A;  4GOP B;  1B4O A;  1HNX L;  3MEH A;  1KAA A;  1X65 A;  4RA8 A;  4QCL A;  4IUP A;  4IPG A;  3T1H L;  1Z6H A;  4BY1 G;  2VUM B;  2HQL A;  3NHH A;  4JOI C;  1SDF A;  1SE8 A;  2QIL A;  4DR2 Q;  1RTN A;  4LFC Q;  4OON A;  2ZTD A;  3Q22 A;  1KC8 C;  1QVC A;  3ERO A;  1ZYR C;  3KDF B;  2B2U A;  1J5E L;  1B70 B;  4A3B G;  2VNU D;  4I65 A;  4L5Q A;  3SR1 A;  2F03 A;  3I4N H;  4PZ7 A;  3VR6 A;  4ZUI A;  3Q0A A;  1HZC A;  2QDL A;  4DR1 L;  3GO5 A;  3FKI B;  1VQN A;  3DWA A;  2CVR A;  3OSO A;  4IO9 A;  3CC4 A;  1K8M A;  5CV9 A;  4HSP A;  2YU9 B;  2L11 A;  5KGU A;  3J80 c;  4FXD A;  3PO2 G;  1L0X B;  2AMC B;  1LLR D;  4DV0 L;  2VL6 A;  4LF8 Q;  4IN3 A;  5KND A;  1HHV A;  2K03 A;  1PH2 A;  1H9K A;  4LNQ A;  5M5Y B;  1EU4 A;  4YWL A;  3S24 A;  1PRT F;  1SXT A;  2KBN A;  1TWH H;  2UXC Q;  3BZK A;  3JAM E;  1RJT A;  1X32 A;  3TZU A;  3PUZ A;  2M2L A;  1BQQ T;  3OOC A;  1SNO A;  1O7Z A;  3A8I E;  4XIG S;  1I50 H;  2UU9 Q;  4DAP A;  4JI7 Q;  4OL7 A;  4QIW B;  1YJW A;  1VQ7 A;  4X3U A;  3J81 i;  3BDO A;  2Z0S A;  4YCU A;  3CD6 A;  3MA2 B;  3QO2 A;  2NN6 G;  2WKD A;  4POF A;  1PH5 A;  1OXX K;  2VY3 A;  2ZXR A;  1BBX C;  5IYB G;  3FRP B;  2A6E C;  1IHZ A;  3HZX A;  4A3D G;  2YYZ A;  2EJF C;  1LT5 D;  4BBR H;  4LF5 L;  1QUQ B;  2R3Z A;  2K7V A;  1HR0 W;  2OTL A;  3MXN B;  3NEL A;  2UXD Q;  2JEB I;  4ZKC B;  2IHF A;  2EYP A;  1O78 A;  2NUC A;  1X55 A;  3E0J A;  4EGV A;  4A3B H;  1D1K A;  1CHP D;  1HFN A;  2KCC A;  4GLA C;  1VQ4 A;  4HID A;  1IYJ B;  2E76 C;  1PZI D;  4LF8 L;  4WOR A;  5G3L F;  4DV6 L;  1BKB A;  4X64 L;  4L5T A;  1W6J A;  1C48 A;  4DR5 Q;  4BWG B;  2JQO A;  2WIN B;  2ZJQ A;  3I4M H;  3W1G A;  1WJJ A;  1KDA A;  1I4G A;  2K5Q A;  2KCT A;  4YY3 L;  4KTA A;  2K1B A;  1ENA A;  5CV4 A;  3MFY A;  3CW2 C;  2NVY H;  2WAC A;  3RUZ A;  2VS1 A;  4RFB A;  1SJE D;  3P75 A;  2B2T A;  2K28 A;  1KL9 A;  1CQV A;  3AMU A;  3V96 A;  3CQZ B;  1WTR A;  1CQF A;  4R4T A;  1EOV A;  1Q8K A;  3GTL B;  4XT1 B;  2MP1 A;  4NW2 A;  1CI3 M;  2R92 H;  4P75 A;  2LMC B;  3KF8 A;  2JK8 A;  5M3M H;  2DNE A;  3WOE A;  3CME A;  3HOU B;  4PQX A;  1WOC A;  5FOB B;  3D31 A;  1EIG A;  3S1Q H;  1RDP D;  3LX0 A;  3GV6 A;  2A6E D;  4DN4 M;  1DJR D;  2EY5 A;  3J7A F;  1EQQ A;  1ET9 A;  3JAM c;  1YJN A;  3TDQ A;  2E5L L;  4JBM A;  3K5M A;  2G9D A;  3MZ5 A;  3GTG H;  1V1Q A;  4FYD A;  1Q7Y C;  2EYJ A;  1EEF D;  3K8A A;  4HIK A;  5C0X I;  4DF7 A;  2DJG C;  5JOB A;  2B39 A;  2HHH L;  4GN4 B;  1TWA H;  2WV6 D;  3SXH A;  2B2W A;  3X3N A;  4HMI A;  1J6Q A;  1TT2 A;  1Y1V B;  3ND8 A;  3J81 c;  1ASY A;  3V05 A;  4YY3 Q;  1YJ9 A;  3KLW A;  2IHE A;  1S5C D;  1VQE A;  2K75 A;  1PH4 A;  4C3J G;  1XTD A;  3X3M A;  2UUA Q;  4OIK A;  4BBR G;  2OXP A;  4GN3 B;  4LF9 L;  5FO8 B;  3LGJ A;  1SNM A;  2OTJ A;  4A75 A;  1U4M A;  5IYD G;  4Y7N B;  2A69 D;  2GVA A;  3H15 A;  4ZAI A;  4JI6 Q;  1B9M A;  2D0P A;  4GOP C;  4RWS C;  3TP6 A;  5FJ8 H;  2E2H B;  1R9T H;  4A4I A;  1STH A;  5D65 A;  4JI2 Q;  2VXW A;  1GUN A;  2K5W A;  2DY8 A;  1I4Q A;  1EOT A;  4GKJ Q;  2D2C C;  3C3L A;  2JJQ A;  1DZ1 A;  2R92 G;  1ZYR D;  1EY7 A;  1LTL A;  1E24 A;  1Q1E A;  2CW0 D;  4NP5 A;  3CCV A;  2UUC L;  4DV1 L;  4Y7N H;  2KOL A;  1GKH A;  1S5F D;  5G3L D;  1VDZ A;  3ERQ A;  4F7X A;  5CC4 A;  3A5U A;  3S2D B;  4C1N I;  4C2M H;  2EJM A;  4YHH Q;  2KHS A;  3VA7 A;  5KYI A;  4QUF A;  3G6E A;  1BCP B;  3AFQ A;  4KV6 A;  1NMF A;  3GTP H;  3GTK B;  3SK4 A;  3NBI A;  1U9R A;  4X62 L;  1U4L A;  4B3R L;  3VDY A;  4ZYS A;  2N49 A;  1Y1W H;  3DXJ C;  5J22 A;  1DOM A;  3GTM B;  1STY A;  4TVA B;  2N78 A;  4A3E B;  3RMH A;  2O5I C;  3PIO 3;  2JSO A;  1AE3 A;  2Z1C A;  4CKB A;  1B3A A;  4BBS G;  3AU7 A;  4DUY Q;  2CH4 W;  2K05 A;  1YI2 A;  2PQA B;  2E2J B;  3K0X A;  5FLX L;  1PMR A;  2F0P A;  2R93 H;  2CQO A;  4Z9C B;  2DNC A;  4FDB A;  2BDN A;  4GNX C;  2NN6 I;  2MQH A;  5M5W B;  4N9P A;  3H3V C;  3DEO A;  4JYA Q;  3KBG A;  1N33 Q;  4V19 0;  3OYY A;  3G4S A;  4XXE A;  4A3C H;  5EPL A;  4MTN A;  2RVL A;  1KLU D;  2ALY B;  1A63 A;  2ZXP A;  1A15 A;  1G91 A;  3KK7 A;  4EVO A;  4BXX H;  3GTQ H;  5C4J B;  2XGT A;  3ULL A;  1ILQ A;  2MJ8 A;  2RCF A;  4HJ8 A;  1O7Y A;  3RZO H;  4YHH L;  3CPW A;  1DOL A;  1V1P B;  4R4I A;  4K6D A;  4FP5 D;  3FKI G;  1KAW A;  5C3X A;  3HOW B;  2HD3 A;  1TWF B;  4UHV A;  1EWH A;  3D4W A;  4B3R Q;  3HP3 A;  4HJ9 A;  2G9H D;  3I7F A;  5LMU Q;  3J80 L;  2A19 A;  1PYW D;  2FMM A;  5IP9 H;  3M3Y H;  1TII D;  4HJA A;  2XVS A;  1XTC D;  1EQR A;  4IFD H;  5A2Q L;  3U50 C;  5A35 A;  4A3G H;  3R2I A;  4A3L G;  5KIX A;  4GN5 A;  5I2Y A;  1STN A;  4XTC S;  2SNM A;  5K5P A;  2K5V A;  2XRQ D;  4KD4 A;  3NEN A;  1WTV A;  1Z47 A;  2FHT A;  3R3O A;  3FPU B;  4F87 A;  3T53 B;  1SMY C;  2F4I A;  4CDF C;  4R8N A;  2A69 C;  5FK9 C;  4E6I A;  4JG2 A;  1B7Y B;  2F0U A;  1N33 L;  2K01 A;  5C3E B;  3D6W A;  1H9R A;  4A3G B;  1NR2 A;  3JAM i;  4IPH A;  3RLN A;  1SAP A;  3UE1 A;  4UP9 A;  3VA5 A;  1I4P A;  4QL5 A;  3U9S A;  4JI1 Q;  4LF4 Q;  3NP8 A;  1VQB A;  1JMC A;  3K80 C;  1MBY A;  5FLX E;  3B6Y A;  3QIA A;  5FO9 B;  1TU2 B;  3EJI A;  3PF5 A;  4Y52 H;  5NUC A;  4HSV A;  4A3M H;  3GD7 A;  4G7H C;  1N9W A;  1SYD A;  4DKA C;  5F2D A;  1Q3L A;  3PO3 H;  4K0K L;  1NR4 A;  2AUK A;  1Y1W B;  1FJG L;  3NSW A;  1JJG A;  4BXX G;  5C4X G;  1HTL D;  1ICW A;  1UWV A;  2WKC A;  5M5Y H;  3OTO L;  1IBK L;  1B53 A;  4KMU C;  5GAE C;  1CSQ A;  3DM3 A;  5JEA H;  2H1E A;  2IX0 A;  5LHY 1;  2A68 D;  1CK1 A;  3CC7 A;  1ENC A;  1KRS A;  3PGZ A;  4AQY L;  1SMX A;  2F1M A;  1XWE A;  4IPC A;  4X3T A;  4QGU A;  1RD9 D;  3BG3 A;  3OW2 A;  4OO1 I;  1LYL A;  5COR A;  1K83 H;  5IGD A;  4WRD A;  1DM0 B;  4ABN A;  3FHW A;  4A3I H;  1PXU A;  1X56 A;  2PZU A;  1F2L A;  2KUM A;  3E0E A;  3U4V A;  5IYC H;  4HCS A;  5FLM G;  4B08 A;  3HS0 C;  3AFP A;  5C6A A;  1PZK D;  4LF4 L;  4IFD I;  2K5D A;  4DU9 A;  2B3G A;  1SYB A;  2BH2 A;  4WJW A;  3PMF A;  1SRU A;  4MN3 A;  5KNB A;  5IGC A;  1WTX A;  1L1O B;  1I6H B;  2CHB D;  1VQD A;  2CWP A;  4RKB A;  5E7N A;  1CKM A;  4BY7 B;  3DLL A;  4K0K Q;  2A68 C;  1D5Z C;  1KAB A;  4HR7 B;  2B2U C;  4O0A A;  2QKI C;  1L1O A;  3K7U C;  4HAE A;  5I2X A;  1NMG A;  4LFB L;  2B2Y A;  2K50 A;  4QIW E;  5C4H A;  4O2D A;  1EY5 A;  4U67 3;  1Q90 A;  3VYT A;  1TS4 A;  4FXG C;  2E8G A;  4ZUJ A;  2KEC A;  2Z6K A;  1DOK A;  2A74 C;  2K52 A;  2N55 A;  4JI3 Q;  1ZEQ X;  4KJO A;  2B63 G;  1LTG D;  1PTO H;  1O7I A;  1YNX A;  3G6J B;  4DV5 Q;  2WB1 G;  3HOV B;  2UXB Q;  2RDF A;  1G2T A;  3HOY B;  4XDX A;  4RGM A;  1QOH A;  1G8Z D;  4HIO A;  4X65 L;  3GDE A;  2NB0 A;  4K8J A;  5J3B A;  2SEB D;  2RSO A;  1KXL A;  4P71 A;  2F0Q A;  4DUZ L;  5J1Z A;  5D3D A;  1V1O A;  2OEO A;  3WOF A;  3J7Y W;  3BVG A;  4KN4 C;  2DUD A;  4N9T A;  3KDF A;  1K83 B;  1LAB A;  1STA A;  5KRU A;  1KRT A;  2PPB C;  1PFB A;  1JJC B;  3VR3 A;  2JN4 A;  1QNU A;  1E1O A;  4O1N A;  1LV9 A;  4KHP L;  3TQY A;  1U4P A;  2EYM A;  1C8C A;  2F0D A;  4G7O C;  3A7A B;  2K14 A;  3CRL C;  2JA5 H;  3ONA B;  4ME3 A;  4X66 Q;  2RBM A;  3RLF A;  1CHQ D;  5HGT A;  1VMC A;  3F8T A;  3BVZ A;  4IUU A;  1HJP A;  2TMP A;  1RCV D;  1EWC A;  2PQE A;  1S5D D;  3MWY W;  1SLJ A;  4IAL A;  5E1F A;  1FNW A;  1EZ8 A;  1NTG A;  3A74 A;  5I9O A;  2BE5 C;  1O7L A;  1ESF A;  1NCV A;  1H9M A;  1M8A A;  2ZTE A;  2VQE Q;  3H0G B;  1PH9 A;  4DV7 Q;  4LF5 Q;  3GTQ B;  1NE3 A;  1UAP A;  1HNZ L;  2MGS A;  5EQ0 A;  5JJL A;  1SE3 A;  3VYR A;  1W2B A;  1PTO D;  1Z7T A;  1EZ6 A;  3A0J A;  1A3V A;  1SNQ A;  4DK0 A;  4N8X 1;  1PRT C;  5EGT A;  1Y8N B;  3F2B A;  4GNX B;  2BDO A;  2L9H A;  1H9J A;  2KVM A;  2O4X A;  1E22 A;  1SFO H;  1Y8P B;  4X3S A;  1HR0 Q;  1Y8O B;  4BBS B;  1VF7 A;  3RD4 A;  1KLG D;  1AW7 A;  4DK6 C;  5LL6 X;  3BJU A;  3DWQ A;  2SDF A;  4JBW A;  1V8Q A;  2Q2H A;  1FGB D;  1HUN A;  3J81 j;  4DV2 L;  1I4R A;  2R93 B;  3I4M B;  3M4P A;  2AQ3 B;  4KHP Q;  2VQF Q;  1SNP A;  1L0Y B;  5JEA J;  4L6T B;  3CHB D;  1PH3 A;  1HNX Q;  2PYK A;  3BDL A;  5ELO A;  1SFO B;  4GLV B;  3PUX A;  3HOW G;  2QCP X;  3ITP A;  1Y1V H;  4PZ8 A;  5M5X H;  4FF2 A;  2VB2 X;  3I91 A;  3WWV A;  3NXW A;  1BCP C;  1N34 Q;  4HED A;  4DAM A;  2NBF A;  4A3D H;  2IWH A;  4O42 A;  1LTS D;  2B2W C;  4JW0 A;  2AQ1 B;  4IUR A;  4GKK L;  5I9P A;  3QG1 A;  2WAQ G;  3I70 A;  4EQO A;  3HOV H;  1J5E Q;  3HOW H;  3OMC A;  2VQE L;  1MJE A;  4DV7 L;  4P2C B;  5E3F A;  5BN5 A;  1JB7 A;  2E5L Q;  1C7Y A;  3RN5 A;  1Z9F A;  5IOC A;  3L3O C;  3VR2 A;  2EYO A;  4B3M L;  3HOZ B;  4DV4 L;  2JA6 H;  5FLX c;  3T1Y Q;  2EXZ A;  1SJH D;  1R4P B;  2RF4 A;  1AZP A;  4X6A H;  1EWI A;  4DK3 C;  3BU2 A;  1H95 A;  4FVM A;  3PUV A;  1LT4 D;  1EQV A;  3CCL A;  1V43 A;  4C2M B;  3GP7 A;  1E0B A;  2R7F A;  1WI5 A;  2R7Z B;  1KDC A;  1MKH A;  1CM9 A;  2GA4 B;  5JVG 3;  3CRK C;  3KF8 B;  1TR5 A;  3MAQ A;  5C3E G;  3N6R A;  2UUA L;  1S72 A;  3I4L A;  4XQJ A;  3SE0 A;  1JWS D;  2HIV A;  5M3F G;  1I94 L;  5M9O A;  2Y0S E;  1Y1W G;  4JV5 Q;  2EZV A;  5C0X J;  3CCE A;  2C9O A;  3FEW X;  1N34 L;  3H09 A;  1P16 A;  3CCM A;  2F3I A;  4DAV A;  4NXM L;  2NZ1 D;  3TRZ A;  2F0L A;  3HG9 A;  4GKK Q;  1JIC A;  1IKL A;  1VQO A;  1JE4 A;  2MPM A;  4UY8 C;  1B2T A;  1L0W A;  3OIP A;  2ATW A;  1SRO A;  4A76 A;  5AJ3 L;  3HRZ C;  2HCC A;  4IQZ A;  3BZD B;  1G2S A;  1E2W A;  4OO1 G;  1MI2 A;  1K0R A;  5GAG C;  1XMO Q;  1PYS B;  4DV4 Q;  2PW5 A;  5CBA E;  2UUB Q;  1PH1 A;  4KKS A;  3RN2 A;  1TY2 A;  4A3E G;  2JA8 B;  1U4R A;  2RHQ B;  1BDO A;  4P72 A;  3GTL H;  1EIH A;  1VQP A;  5CBE E;  3EN2 A;  5K36 H;  4C3I B;  2ZM6 Q;  4EQN A;  2QF7 A;  5EPJ A;  2ICI A;  3K58 A;  4R4O A;  2CKZ B;  3DUZ A;  4QMG A;  1AE2 A;  1ASZ A;  2EY1 A;  3URY A;  4IOA A;  3EVQ A;  2VUM H;  4QJF A;  4J15 A;  5ELD A;  2FXQ A;  2WII B;  3L7Z C;  3T51 B;  2QEJ C;  4A3M B;  3W3A A;  2GVB A;  4JV5 L;  4QF4 A;  5HUR A;  3HKZ B;  1PVO A;  4QQB X;  1G6Z A;  1V9P A;  1UE5 A;  3MEF A;  5C44 B;  2JA7 G;  2HCI A;  1L1O C;  4DR2 L;  3CMA A;  3CC2 A;  2K5N A;  1D7Q A;  1LTA D;  1STG A;  2F0S A;  5H1S E;  1NUC A;  1TWA B;  4R1J A;  2HUG A;  4L8J A;  1GD7 A;  3S2D H;  2EYH A;  2G5D A;  5E4X A;  1O80 A;  4LW1 A;  3GTP B;  4FNF A;  2RA4 A;  3P20 A;  2E75 C;  1CKN A;  1MSH A;  4TKO B;  2H5X A;  1XMO L;  2UUB L;  5IGF A;  1M4V A;  4RGN A;  5C3W A;  1GHK A;  1PTO B;  2C35 B;  5GQO A;  1B44 D;  2AWN A;  3P7J A;  2I07 B;  1F9P A;  4CKE A;  4FXK C;  3P1H A;  4LUZ A;  4GNX A;  2Y0S G;  1JOO A;  4NKL A;  1VQ8 A;  1EYC A;  2JA9 A;  4FO2 A;  5M3M G;  3E9I A;  3S1N H;  1GHJ A;  2GN5 A;  4OX9 L;  1ICF B;  1TS5 A;  2FIN B;  2I46 A;  2BOS A;  2IPK D;  4DR4 Q;  1PTO F;  5IGG A;  1VQA A;  1A6X A;  1S3O A;  2VW9 A;  3DM1 A;  4K5V A;  4JI7 L;  3OWE B;  4K2L A;  1F9R A;  4MZ9 A;  2X69 A;  4JI6 L;  4ID6 A;  3S15 H;  1KDB A;  2F0V A;  1FNU A;  5CV5 A;  1ZXT A;  2XSC A;  1TWG H;  2K4K A;  4IFD J;  1LUZ A;  2HQE A;  2IT1 A;  1ONL A;  1IBL L;  4IUN A;  4EX5 A;  3H0G G;  3SK6 A;  1Q86 C;  1NSN S;  3NK9 A;  3Q6S A;  1YNJ C;  1SEB D;  2A5H A;  2F0W A;  5C0X G;  4KN7 C;  1N36 L;  4DR7 Q;  2HT1 A;  1VCI A;  4JI1 L;  5FO7 B;  4DV1 Q;  3K81 C;  2XN9 C;  1LTR D;  3NQI A;  3A8K E;  2D9U A;  1SR3 A;  2SNS A;  5JPM C;  4I7A A;  2PCF B;  3PUW A;  1CTM A;  4B9X A;  5CYU A;  3M4Q A;  1BXT A;  4YWK A;  1IBM L;  2AKW B;  4DV6 Q;  4AYB E;  1YIT A;  4X64 Q;  2Z6B A;  5C0X H;  1TS3 A;  1JR0 D;  3T13 A;  2MO0 A;  3BDC A;  1F2Y A;  2YTV A;  1QIL A;  2KEE A;  3KUP A;  3GTO B;  1J8I A;  3R8B A;  2CWA A;  3S9W A;  4PMB A;  3A54 A;  4OX9 Q;  4IOC A;  4PMW A;  5C4Z A;  1IW7 C;  4KKU A;  1YVC A;  4DR4 L;  2K04 A;  3G71 A;  4K5W A;  4DR6 L;  4AQY Q;  1VQ9 A;  1GUT A;  1EEI D;  1PHJ A;  2EDG A;  3CU7 A;  2Q2T A;  1K0S A;  3FVQ A;  4KHZ A;  2DJF C;  4TSS A;  3C1E A;  3IAY A;  1HCZ A;  5KNC A;  2KA7 A;  3SDZ A;  2WAQ B;  3BYY B;  1D8L A;  4MNO A;  4DXF A;  2ZTC A;  1TWF H;  4HMJ A;  5IYC G;  2I0Q A;  4JI0 Q;  4BS9 A;  5FLM H;  4JVZ A;  1K28 A;  4XT3 B;  3GV3 A;  3SK5 A;  2D62 A;  2EVB A;  5CV6 A;  1WTO A;  1FL0 A;  3VR5 A;  1VQM A;  3GQB A;  3MXP A;  4ZLT F;  5JJK A;  1N36 Q;  3EFX D;  2QA4 A;  1VQ6 A;  4K8I A;  5CV8 A;  4YWM A;  1QWY A;  4RGO S;  1Q46 A;  1WD0 A;  3V2T A;  4DPG A;  1KTK A;  3AB9 A;  4QB4 A;  2PNH A;  1XNQ L;  2NZH A;  1EU3 A;  3UDF A;  4BBS H;  4H7B A;  2HHH Q;  3HOY G;  4KJN A;  3M4O B;  2K6A A;  4LUO A;  4LFB Q;  4LF7 Q;  2A6H C;  3S1N B;  5LMN W;  3J7A 5;  1ET6 A;  1ZKO A;  2EIF A;  4DV3 Q;  2PMZ E;  2E2I H;  3PO3 G;  2JA5 G;  2K33 A;  2RKS A;  4OHJ A;  1X54 A;  3TME A;  1XNR L;  2IX1 A;  4Q5V A;  5EKI A;  3GTJ B;  1CZW A;  1EL0 A;  1G6P A;  4H0L C;  2ES2 A;  1D2B A;  2UXB L;  3OW7 A;  1B50 A;  4TRD A;  2XRS D;  1K9M C;  4XYO A;  2R7Z G;  3A7L A;  1PFN A;  2L5T A;  2PZW A;  3CCQ A;  1KHI A;  2I5M X;  2EY6 A;  5IT9 L;  4DAY B;  1JWU D;  2I5H A;  3OMG A;  1SYF A;  4DUZ Q;  1I50 B;  4C3I H; 
#chains in the Genus database with same CATH homology
 3NPP A;  2NN6 H;  3J80 E;  2D5D A;  2B2Y C;  4XYQ A;  1WVL A;  3S14 B;  1S4Z A;  2ZT9 C;  3OHX C;  3T56 B;  5COY A;  1PTO C;  4C3J B;  3MXU A;  3NTI A;  5EBD A;  1I4H A;  1Y69 U;  1C4Q A;  3NQT A;  1SYC A;  1LAC A;  2Y0S B;  3KLS A;  2R6G A;  1R9T B;  4L63 B;  4UAI A;  1HPC A;  2HDM A;  1RTO A;  3K5O A;  1TWG B;  4IUT A;  2E2I B;  2MUY A;  4C3H B;  4G4K A;  3E5S A;  1CZG A;  3VYU A;  2ICE C;  3MC0 B;  5I6W A;  5C4X B;  5EBC A;  4IUQ A;  3UI2 A;  4J1M A;  4CGY B;  2F0N A;  4J6H A;  1EY4 A;  2J7Z A;  3D8G A;  2M00 A;  3LNN A;  1AN8 A;  3KLR A;  2SOB A;  1HA5 A;  1H9S A;  3TP8 A;  2F0E A;  3VYS A;  1A3U A;  1BNZ A;  3QOJ A;  4KHV A;  5CGK A;  2L4N A;  3SK8 A;  4R8I A;  4A3J B;  3MXG A;  5DAU A;  4LK1 C;  3MTS A;  4TQU S;  4WFN 3;  4QUC A;  2M9V A;  2XIW A;  2CW0 C;  3K5N A;  4ZRZ A;  2LS0 1;  1LTI D;  2NTS A;  4KD3 A;  1IL8 A;  4F8M A;  1WCM B;  2FMC A;  3OIQ A;  2A73 B;  1V1P A;  1G29 1;  2F0F A;  1AP0 A;  1KNA A;  1FD7 D;  4H44 C;  5ELB A;  3RZO B;  1QB5 D;  5M3F B;  2F0O A;  3K57 A;  1QE6 A;  3NWT A;  2KCN A;  2FJ2 A;  4PMC A;  2J4X A;  3D3R A;  4A3F B;  5EJW A;  5CV7 A;  4ZQ3 A;  3TZD A;  1WTP A;  3SHL A;  3EQL C;  3L9A X;  1FYC A;  3I4N B;  3DMU A;  1BO0 A;  5C5L A;  2CQA A;  4HCE A;  1EFI D;  3BS1 A;  3PIP 3;  2OT2 A;  1DON A;  1JB3 A;  2AWO A;  4KI0 A;  2F0I A;  4BBR B;  2L12 A;  4CBV A;  2L0C A;  2DY7 A;  3C2P A;  1SSO A;  1JC7 A;  2EJG C;  1OXU A;  1STB A;  3I72 A;  1B9N A;  3SEB A;  4DNR B;  4DFA A;  2F0J A;  2VB3 X;  3M3Y B;  1BOS A;  3KBX A;  5KYL A;  3R93 A;  2JA7 B;  2B2V C;  1TVX A;  4K6L A;  4M8A A;  1J9O A;  1SYG A;  4X3K A;  1EY6 A;  3FPP A;  4RHR A;  1SMY D;  1FNV A;  2F3V A;  4LMQ D;  2MHV A;  5FKA C;  1TWC B;  2V4D A;  2EY2 A;  3PV0 A;  1GUW A;  4ODG A;  3IFD A;  3NBH A;  1HFG A;  3S1Q B;  1EYD A;  2A6H D;  5I4D A;  1JOR A;  2AUJ D;  3S1R B;  2LFN A;  4G57 A;  3NE5 B;  3H91 A;  4KKT A;  5CR3 A;  1UNS A;  3DWP A;  1SNC A;  2Q8T A;  3GTG B;  2EYF A;  2EYL A;  4M1U B;  3PO3 B;  3A55 A;  2H4O A;  1MSG A;  1D5X C;  1TS2 A;  1ML0 D;  5IOD A;  4JK1 C;  4XQQ A;  4XQN A;  2XNA C;  4EQP A;  1DYQ A;  3W2D A;  4C56 C;  2PW7 A;  2TSS A;  4KY5 A;  3TSS A;  1ENF A;  3U9O A;  3K7A B;  3QWN A;  3KLS X;  3LWE A;  1LTB D;  2L55 A;  4GZY C;  2B63 B;  4YIJ A;  2C5C A;  2QDB A;  2BE5 D;  2WB1 B;  3MVV A;  5BN4 A;  1IW7 D;  4BY1 B;  3M85 A;  1S5B D;  2PO4 A;  2F3W A;  1QNK A;  2IL8 A;  2EOT A;  2ENB A;  1PFM A;  3MHB A;  5AFW A;  2NVX B;  2LY7 A;  3TP5 A;  4CJ1 B;  3T4A C;  2F0H A;  3S17 B;  1CFM A;  4DNT B;  1SE4 A;  4DK1 A;  1D6E C;  3OWF A;  4RHS A;  1JQY D;  5DNF A;  4MHE A;  2JA5 B;  1IYV A;  1GUS A;  1RHP A;  2BCO A;  1TY0 A;  4C1N K;  2OF1 A;  1PLF A;  3H6M A;  5JAV A;  1LT3 D;  2R61 A;  5M5X B;  4ILW A;  3J7A V;  2E74 C;  1HQR D;  4FF3 A;  5IGB A;  4F88 A;  4RH6 A;  2IX3 A;  1LO5 D;  1D1I A;  4ZK9 B;  5J39 A;  2K32 A;  4RGT A;  1B1Z A;  1JOK A;  5JPN C;  2F0G A;  4OIJ A;  2NWG A;  3HOX B;  1A3T A;  1T5E A;  3Q23 A;  3M7N A;  2JP1 A;  1PDQ A;  1II3 A;  1BCP D;  1SE2 A;  1JOQ A;  4A3B B;  3I8Z A;  2Z8L A;  4DGZ A;  4CHT B;  5C5M A;  1CT1 D;  1IKM A;  2X6G A;  1GXD C;  3S2H B;  3TBI B;  1UUP A;  3R2T A;  1R4Q B;  2RDG A;  1I4X A;  1HXY D;  2AQ2 B;  2BA1 A;  1I3Q B;  1MD2 D;  1TKW B;  3IFT A;  3D6C A;  1LT6 D;  4CJ2 C;  1Q1B A;  1HRJ A;  2KED A;  4BA1 I;  2KQ3 A;  2EE1 A;  1CA5 A;  3CKI B;  3I73 A;  5M3M B;  2JA6 B;  4MIU A;  2JEA I;  2PZT A;  3K6O A;  3RZD B;  1IYU A;  5D14 A;  4A3I B;  2JXM B;  1TQO A;  1PZJ D;  3ZYY X;  1ILP A;  3E6Z X;  1QG7 A;  1W6K A;  1Q12 A;  1A2U A;  2F0M A;  5JJZ A;  1AZQ A;  4A3D B;  2RSN A;  4PNY A;  3Q24 A;  1OXT A;  1T5X D;  1OXS C;  1F2Z A;  4B9W A;  5EKK A;  1STE A;  1JWM D;  1D5M C;  1RKN A;  2DN8 A;  2NVY B;  1F77 A;  2XWB B;  3FMC A;  5ELF A;  1QJO A;  5T1G A;  3QOL A;  1EY0 A;  2J0T D;  3FDT A;  4KK7 A;  3VR4 A;  1UEA B;  3K0Y A;  1PRT B;  3T16 A;  4DXG A;  3I3C A;  2E2D C;  5DM7 3;  2LKV A;  1I6V C;  3D4D A;  3IL8 A;  4OO1 H;  3EA6 A;  1XX8 A;  1ROD A;  4S3S A;  4ME5 A;  1BF4 A;  4A93 B;  3H94 A;  1GOZ A;  4K14 A;  3J81 E;  2ZXO A;  3NUC A;  4U68 A;  4I7Z C;  3M4Y A;  2BA0 A;  3LWU A;  2PMZ B;  3MFG A;  5ELC A;  4BA2 I;  1E2Z A;  4C3I G;  5EPK A;  4RCN A;  3BVM A;  1BCP F;  1MGS A;  3N52 A;  3TN2 A;  1EY9 A;  4RCO A;  4AYB B;  1GJX A;  2IW3 A;  4ULL A;  4FF4 A;  2NVT B;  1JCK B;  2Q8R E;  2IJ0 A;  1EY8 A;  4H13 C;  4IZ8 A;  1DXM A;  2N88 A;  3S16 B;  4R9W A;  4KY6 A;  5ELE A;  3K5L A;  1K8O A;  2RDH A;  4HN7 A;  3OPO A;  1SYE A;  1BUV T;  3A8J E;  3A56 A;  1F9Q A;  2O2L D;  3M7G A;  1H9S B;  4IFD G;  3MXN A;  3O13 A;  1HA6 A;  4NMZ A;  1KNE A;  3PO2 B;  3HGB A;  4Q0F A;  4RAU C;  3HEJ A;  3F2U A;  4ZKB B;  3D4R A;  2NYZ D;  1F9S A;  1SND A;  1OXV A;  2Z4I A;  1SBB B;  1OO9 B;  2B2T C;  1A2T A;  4PV1 C;  2F0T A;  1ESR A;  1Q8I A;  4A3K B;  1LTT D;  2NVQ B;  5ISR A;  4K5X A;  5T1I A;  3C1F A;  3ND9 A;  5JEA G;  1GUG A;  2Q8I B;  4CKC A;  3JAM L;  1HTP A;  4J8Q A;  4UDU C;  5D3I B;  2F0K A;  1X3Q A;  1X3P A;  2WP8 J;  1YNJ D;  5IGE A;  5BN3 A;  4DA2 A;  3G7L A;  3C46 A;  1GUO A;  2PNR C;  1XYI A;  4K2K A;  3DHQ A;  3NWS A;  1F2M A;  1YNN C;  3IKJ A;  3S1M B;  1EYA A;  1DCZ A;  4HTH A;  1WTQ A;  3TP7 A;  3J81 L;  1NAP A;  5EKL A;  3PUY A;  1HQM C;  5KEE A;  3K59 A;  1AEX A;  4C3H G;  2ID0 A;  2JYO A;  1AFP A;  1YNN D;  3QB3 A;  1VMP A;  4G7Z C;  1EQT A;  2B8G A;  5DM6 3;  4V0B A;  2XWJ B;  5K36 G;  4IUV A;  5E4W C;  1BR9 A;  2EPB A;  3DEP A;  2O5J C;  2L1B A;  2Z4H A;  5LL6 S;  5JVH 3;  5DEH A;  1S5E D;  2B8F A;  4DAY A;  1VF5 C;  2JE6 I;  3SVM A;  4KY7 A;  2B2V A;  2KJX A;  4LJZ C;  1WTW A;  1E2V A;  1XXG A;  2R92 B;  5A2Q E;  5IIF A;  5I6Y A;  1FR3 A;  4LAA A;  1CA6 A;  1RF2 D;  2NTT A;  3I90 A;  5IT9 E;  3WDN A;  1TWH B;  2RQX A;  4NDX A;  3S15 B;  2X6L A;  5TSS A;  3NTH A;  4OGQ C;  1QCB D;  1PRT D;  3NTK A;  4RKL A;  1HUM A;  4FF1 A;  1WD1 A;  5CMD A;  2HDL A;  3QJY A;  2FFK B;  4CJ0 B;  3BYT B;  1DD2 A;  1B4O A;  3MEH A;  1KAA A;  4RA8 A;  4QCL A;  4IUP A;  1Z6H A;  2VUM B;  3NHH A;  1SDF A;  2QIL A;  1RTN A;  3Q22 A;  3ERO A;  1ZYR C;  2B2U A;  2VNU D;  4I65 A;  2F03 A;  3SR1 A;  3VR6 A;  4ZUI A;  3Q0A A;  3GO5 A;  3FKI B;  3DWA A;  2CVR A;  3OSO A;  1K8M A;  5CV9 A;  2YU9 B;  4HSP A;  5KGU A;  2L11 A;  4FXD A;  1L0X B;  1LLR D;  4IN3 A;  5KND A;  1HHV A;  2K03 A;  1H9K A;  5M5Y B;  1EU4 A;  1PRT F;  1SXT A;  3JAM E;  1RJT A;  1X32 A;  3TZU A;  3PUZ A;  2M2L A;  1BQQ T;  3OOC A;  1SNO A;  1O7Z A;  3A8I E;  4XIG S;  4DAP A;  4OL7 A;  4QIW B;  4X3U A;  3BDO A;  3MA2 B;  3QO2 A;  2NN6 G;  2WKD A;  1OXX K;  2ZXR A;  1BBX C;  3FRP B;  2A6E C;  1IHZ A;  3HZX A;  2YYZ A;  2EJF C;  1LT5 D;  2R3Z A;  2K7V A;  2JEB I;  4ZKC B;  2EYP A;  1O78 A;  2NUC A;  3E0J A;  4EGV A;  1D1K A;  1CHP D;  1HFN A;  2KCC A;  2E76 C;  1PZI D;  4WOR A;  5G3L F;  1W6J A;  1C48 A;  4BWG B;  2WIN B;  1KDA A;  1I4G A;  2K5Q A;  4KTA A;  2K1B A;  1ENA A;  5CV4 A;  3MFY A;  2WAC A;  3RUZ A;  4RFB A;  1SJE D;  3P75 A;  2B2T A;  2K28 A;  1CQV A;  3AMU A;  3V96 A;  3CQZ B;  1WTR A;  1CQF A;  3GTL B;  4XT1 B;  2MP1 A;  4NW2 A;  1CI3 M;  2LMC B;  3KF8 A;  2DNE A;  3WOE A;  3HOU B;  4PQX A;  5FOB B;  3D31 A;  1EIG A;  1RDP D;  3LX0 A;  3GV6 A;  2A6E D;  4DN4 M;  1DJR D;  2EY5 A;  3J7A F;  1ET9 A;  3TDQ A;  3K5M A;  2G9D A;  3MZ5 A;  4FYD A;  2EYJ A;  1EEF D;  5C0X I;  4DF7 A;  5JOB A;  2B39 A;  2WV6 D;  3SXH A;  2B2W A;  3X3N A;  4HMI A;  1TT2 A;  1Y1V B;  3ND8 A;  3V05 A;  1S5C D;  4C3J G;  3X3M A;  4OIK A;  2OXP A;  5FO8 B;  1SNM A;  1U4M A;  4Y7N B;  2A69 D;  4ZAI A;  1B9M A;  4RWS C;  3TP6 A;  2E2H B;  1STH A;  5D65 A;  2VXW A;  1GUN A;  2K5W A;  2DY8 A;  1I4Q A;  1EOT A;  2D2C C;  3C3L A;  1DZ1 A;  1ZYR D;  1EY7 A;  1Q1E A;  2CW0 D;  4NP5 A;  2KOL A;  1S5F D;  5G3L D;  1VDZ A;  3ERQ A;  4F7X A;  5CC4 A;  3S2D B;  4C1N I;  2EJM A;  2KHS A;  3VA7 A;  5KYI A;  4QUF A;  1BCP B;  4KV6 A;  3GTK B;  3SK4 A;  3NBI A;  1U9R A;  1U4L A;  4ZYS A;  3DXJ C;  5J22 A;  1DOM A;  3GTM B;  1STY A;  4A3E B;  3RMH A;  2O5I C;  3PIO 3;  2JSO A;  2Z1C A;  4CKB A;  1B3A A;  3AU7 A;  2K05 A;  2E2J B;  5FLX L;  1PMR A;  2F0P A;  4Z9C B;  2DNC A;  2BDN A;  2NN6 I;  5M5W B;  4N9P A;  3H3V C;  3DEO A;  3KBG A;  4V19 0;  4XXE A;  5EPL A;  2RVL A;  1KLU D;  2ZXP A;  1A15 A;  1G91 A;  3KK7 A;  4EVO A;  5C4J B;  1ILQ A;  2MJ8 A;  1O7Y A;  1DOL A;  1V1P B;  4K6D A;  4FP5 D;  5C3X A;  3HOW B;  1TWF B;  1EWH A;  3D4W A;  3HP3 A;  2G9H D;  3J80 L;  1PYW D;  2FMM A;  1TII D;  2XVS A;  1XTC D;  4IFD H;  5A2Q L;  5A35 A;  3R2I A;  5KIX A;  5I2Y A;  1STN A;  4XTC S;  2SNM A;  5K5P A;  2XRQ D;  4KD4 A;  1WTV A;  1Z47 A;  2FHT A;  3R3O A;  3FPU B;  4F87 A;  3T53 B;  1SMY C;  2F4I A;  4R8N A;  2A69 C;  5FK9 C;  4E6I A;  2F0U A;  2K01 A;  5C3E B;  3D6W A;  1H9R A;  4A3G B;  1NR2 A;  1SAP A;  3VA5 A;  1I4P A;  3U9S A;  3NP8 A;  1MBY A;  5FLX E;  3QIA A;  5FO9 B;  1TU2 B;  3EJI A;  5NUC A;  4HSV A;  3GD7 A;  4G7H C;  1SYD A;  5F2D A;  1Q3L A;  1NR4 A;  2AUK A;  1Y1W B;  3NSW A;  1HTL D;  1ICW A;  2WKC A;  1B53 A;  4KMU C;  5JEA H;  2H1E A;  2IX0 A;  5LHY 1;  2A68 D;  1CK1 A;  1ENC A;  2F1M A;  1XWE A;  4X3T A;  1RD9 D;  3BG3 A;  4OO1 I;  5COR A;  5IGD A;  4WRD A;  1DM0 B;  4ABN A;  1PXU A;  2PZU A;  1F2L A;  2KUM A;  4HCS A;  4B08 A;  3HS0 C;  5C6A A;  1PZK D;  4IFD I;  2K5D A;  4DU9 A;  1SYB A;  4WJW A;  3PMF A;  4MN3 A;  5KNB A;  5IGC A;  1WTX A;  1I6H B;  2CHB D;  4RKB A;  4BY7 B;  2A68 C;  1D5Z C;  1KAB A;  4HR7 B;  2B2U C;  2QKI C;  5I2X A;  4HAE A;  2B2Y A;  5C4H A;  1EY5 A;  4U67 3;  1Q90 A;  3VYT A;  1TS4 A;  4FXG C;  4ZUJ A;  2KEC A;  1DOK A;  2A74 C;  2N55 A;  1ZEQ X;  4KJO A;  1LTG D;  1PTO H;  3G6J B;  3HOV B;  2RDF A;  1G2T A;  3HOY B;  4XDX A;  4RGM A;  1QOH A;  1G8Z D;  2NB0 A;  4K8J A;  2SEB D;  2RSO A;  2F0Q A;  5J1Z A;  5D3D A;  1V1O A;  2OEO A;  3WOF A;  3J7Y W;  3BVG A;  4KN4 C;  4N9T A;  1K83 B;  1LAB A;  1STA A;  5KRU A;  2PPB C;  1PFB A;  3VR3 A;  1QNU A;  4O1N A;  1LV9 A;  1U4P A;  2EYM A;  1C8C A;  2F0D A;  4G7O C;  3A7A B;  3CRL C;  3ONA B;  2RBM A;  3RLF A;  1CHQ D;  5HGT A;  1VMC A;  3BVZ A;  4IUU A;  2TMP A;  1RCV D;  1EWC A;  2PQE A;  1S5D D;  3MWY W;  4IAL A;  5E1F A;  1FNW A;  1EZ8 A;  5I9O A;  2BE5 C;  1O7L A;  1ESF A;  1NCV A;  1H9M A;  1M8A A;  3H0G B;  3GTQ B;  1UAP A;  2MGS A;  5EQ0 A;  1SE3 A;  3VYR A;  1PTO D;  1Z7T A;  1EZ6 A;  1A3V A;  1SNQ A;  4DK0 A;  1PRT C;  5EGT A;  1Y8N B;  2BDO A;  2L9H A;  1H9J A;  2KVM A;  2O4X A;  1Y8P B;  4X3S A;  1Y8O B;  4BBS B;  1VF7 A;  3RD4 A;  1KLG D;  1AW7 A;  5LL6 X;  3DWQ A;  2SDF A;  4JBW A;  1V8Q A;  1FGB D;  1HUN A;  1I4R A;  2R93 B;  3I4M B;  2AQ3 B;  1SNP A;  1L0Y B;  5JEA J;  4L6T B;  3CHB D;  2PYK A;  3BDL A;  1SFO B;  3PUX A;  2QCP X;  3ITP A;  4FF2 A;  2VB2 X;  3I91 A;  3NXW A;  1BCP C;  4HED A;  2NBF A;  2IWH A;  4O42 A;  1LTS D;  2B2W C;  2AQ1 B;  4IUR A;  5I9P A;  3QG1 A;  3I70 A;  4EQO A;  3OMC A;  4P2C B;  5E3F A;  5BN5 A;  5IOC A;  3L3O C;  3VR2 A;  2EYO A;  3HOZ B;  2EXZ A;  1SJH D;  1R4P B;  1AZP A;  4FVM A;  3PUV A;  1LT4 D;  1EQV A;  1V43 A;  4C2M B;  3GP7 A;  1E0B A;  2R7Z B;  1KDC A;  1CM9 A;  2GA4 B;  5JVG 3;  3CRK C;  1TR5 A;  3MAQ A;  3N6R A;  3I4L A;  4XQJ A;  3SE0 A;  1JWS D;  5M9O A;  2EZV A;  5C0X J;  2C9O A;  3FEW X;  3H09 A;  4DAV A;  2NZ1 D;  2F0L A;  3HG9 A;  1JIC A;  1IKL A;  1JE4 A;  2MPM A;  1B2T A;  3OIP A;  3HRZ C;  2HCC A;  4IQZ A;  3BZD B;  1G2S A;  1E2W A;  4OO1 G;  1MI2 A;  2PW5 A;  5CBA E;  4KKS A;  1TY2 A;  2JA8 B;  1U4R A;  1BDO A;  1EIH A;  5CBE E;  5K36 H;  4C3I B;  4EQN A;  2QF7 A;  5EPJ A;  2ICI A;  3K58 A;  3DUZ A;  4QMG A;  2EY1 A;  3URY A;  3EVQ A;  5ELD A;  2WII B;  3L7Z C;  3T51 B;  2QEJ C;  4A3M B;  3W3A A;  4QF4 A;  5HUR A;  3HKZ B;  1G6Z A;  5C44 B;  2HCI A;  1LTA D;  1STG A;  2F0S A;  1NUC A;  1TWA B;  2HUG A;  4L8J A;  2EYH A;  5E4X A;  1O80 A;  3GTP B;  4FNF A;  2RA4 A;  3P20 A;  2E75 C;  1MSH A;  4TKO B;  5IGF A;  1M4V A;  4RGN A;  5C3W A;  1GHK A;  1PTO B;  1B44 D;  2AWN A;  3P7J A;  2I07 B;  1F9P A;  4CKE A;  4FXK C;  3P1H A;  1JOO A;  4NKL A;  1EYC A;  4FO2 A;  1GHJ A;  1TS5 A;  2FIN B;  2I46 A;  2BOS A;  2IPK D;  1PTO F;  5IGG A;  1A6X A;  3DM1 A;  4K5V A;  3OWE B;  4K2L A;  1F9R A;  2X69 A;  4ID6 A;  1KDB A;  2F0V A;  1FNU A;  5CV5 A;  1ZXT A;  2XSC A;  4IFD J;  2HQE A;  2IT1 A;  1ONL A;  4IUN A;  3SK6 A;  1NSN S;  3NK9 A;  3Q6S A;  1YNJ C;  1SEB D;  2A5H A;  2F0W A;  5C0X G;  4KN7 C;  1VCI A;  5FO7 B;  2XN9 C;  1LTR D;  3NQI A;  3A8K E;  2D9U A;  2SNS A;  5JPM C;  2PCF B;  3PUW A;  1CTM A;  4B9X A;  5CYU A;  1BXT A;  5C0X H;  1TS3 A;  1JR0 D;  3T13 A;  3BDC A;  1F2Y A;  1QIL A;  2KEE A;  3KUP A;  3GTO B;  1J8I A;  3R8B A;  3S9W A;  4PMB A;  3A54 A;  4PMW A;  5C4Z A;  1IW7 C;  4KKU A;  2K04 A;  4K5W A;  1GUT A;  1EEI D;  2EDG A;  3CU7 A;  3FVQ A;  4KHZ A;  4TSS A;  3C1E A;  3IAY A;  1HCZ A;  5KNC A;  2KA7 A;  3SDZ A;  2WAQ B;  3BYY B;  4DXF A;  4HMJ A;  4BS9 A;  4XT3 B;  3GV3 A;  3SK5 A;  2D62 A;  1WTO A;  2EVB A;  5CV6 A;  3VR5 A;  3GQB A;  3MXP A;  4ZLT F;  3EFX D;  4K8I A;  5CV8 A;  1QWY A;  4RGO S;  1WD0 A;  3V2T A;  1KTK A;  3AB9 A;  4QB4 A;  1EU3 A;  4H7B A;  4KJN A;  3M4O B;  2K6A A;  2A6H C;  3S1N B;  1ET6 A;  1ZKO A;  2K33 A;  2RKS A;  4OHJ A;  3TME A;  2IX1 A;  4Q5V A;  5EKI A;  3GTJ B;  1CZW A;  1EL0 A;  4H0L C;  1D2B A;  3OW7 A;  1B50 A;  4TRD A;  2XRS D;  4XYO A;  3A7L A;  1PFN A;  2L5T A;  2PZW A;  2EY6 A;  5IT9 L;  1JWU D;  3OMG A;  1SYF A;  1I50 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...