1EEFD

Heat-labile enterotoxin b-pentamer complexed with bound ligand pepg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEAT-LABILE ENTEROTOXIN B CHAIN)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eefD00
3O13A 1JWSD 1PTOH 1B1ZA 1I4PA 1PTOC 1PZKD 1GOZA 1LLRD 1SEBD 1KTKA 5D3IB 5ELEA 3TSSA 1I4RA 1XTCD 4DXFA 3DWAA 1D6EC 1JCKB 1PZID 1HQRD 3R2TA 1CHPD 2XRQD 1S5ED 4RGMA 1EEFD 4TSSA 1JR0D 1L0YB 4RHRA 1HTLD 2AQ2B 2IJ0A 1L0XB 1S5DD 1LTSD 1PTOF 1LO5D 1RCVD 1PTOB 1ESFA 1SBBB 2NTTA 3CHBD 1FGBD 1SXTA 1D5ZC 4L63B 1EWCA 1LTRD 4DXGA 4RHSA 1V1OA 1CT1D 1HXYD 1RF2D 3DWPA 3MC0B 5ELCA 5FKAC 1DYQA 1AN8A 1PRTD 2R61A 3BYTB 1CHQD 2O2LD 1TS2A 2G9HD 2TSSA 4ZYSA 1D5XC 3BYYB 1S5FD 2QEJC 4BWGB 1LTGD 5ELFA 4L6TB 1HA5A 1TS4A 1UNSA 3W2DA 4C56C 1PRTF 1EU4A 1LTID 1PRTB 1I4XA 1TY2A 2RDGA 1TS5A 1UUPA 2IPKD 1EEID 3URYA 1KLGD 4RGTA 4RCOA 1BCPD 2XRSD 1F77A 4RFBA 1CK1A 1LT4D 1PZJD 1M4VA 1PRTC 2QILA 1LTAD 1QILA 1LT6D 2XNAC 1FNWA 1BCPF 4K6LA 1SE3A 3OWEB 1LTBD 1CQVA 1EU3A 1JWUD 1I4QA 1LT3D 1JQYD 1XXGA 1SJED 3MFGA 1V1PB 4RGOS 3SEBA 1V1PA 1FNUA 1S5CD 5FK9C 2AQ1B 1FNVA 3EFXD 1I4GA 1BCPC 1T5XD 2J4XA 3DWQA 4RGNA 1SJHD 1I4HA 1B44D 1EFID 3BVMA 5TSSA 1MD2D 1DJRD 1STEA 1G8ZD 1RDPD 3R2IA 1ET6A 1PTOD 1RD9D 2Z8LA 3BVZA 3BVGA 1AW7A 5ELBA 4UDUC 1BCPB 1SE2A 1FD7D 2CHBD 1TS3A 2AQ3B 1D5MC 1S5BD 4O1NA 1JWMD 3V05A 1LTTD 2XN9C 3EA6A 1TY0A 2SEBD 4Z9CB 5I4DA 4OHJA 4RH6A 2WV6D 1ET9A 2NTSA 3BZDB 5ELDA 1SE4A 1ENFA 1PYWD 1KLUD 3GP7A 1BXTA 3R8BA 2RDHA 2ICIA 3KLSX 1LT5D 5D3DA
chains in the Genus database with same CATH superfamily
2UXCQ 3N52A 3PO3B 5M3MH 3F2DA 3V2TA 4O2DA 1XTCD 2VB2X 5M5YH 2B2YA 4F88A 3I4MG 2L15A 5ISRA 2N78A 1YJNA 1L1OC 3C1FA 5EAYA 2M00A 3P7JA 4QIWE 1HNXQ 3K5LA 1D5ZC 2DN8A 2MHVA 1F2YA 2ZTEA 5C4XH 1Q3LA 3X3NA 2OWOA 4DAYB 4POFA 2D5DA 3PIO3 1DYQA 4HJ7A 4Y7NH 2Z1CA 5KNCA 1O80A 1TR5A 1Y8OB 3PUZA 4PG3A 1Y69U 1QB5D 4YIJA 1FGUA 4RG1A 1YJ9A 2Q2UA 2AUJD 3GTKB 1SNMA 1PRTF 3PUXA 3EBEA 1V8QA 2C35B 2MJ8A 5EKIA 3J81i 4RCNA 2Z6KA 1E0BA 3RR5A 1DD2A 1T9HA 2NVXH 4RGTA 2GA4B 4JI0L 1PMRA 1EYAA 3QWNA 4CJ1B 3RZOH 1CK1A 5BR8Q 4DPGA 5C4JH 1EQQA 1DXMA 4DAMA 5M5XB 4FDBA 3L0OA 5IT9E 5GQOA 3VR5A 1CA6A 2PCFB 4JOIC 2B63H 3QOLA 3ICEA 4CKCA 4JI7L 4B3SL 1R4QB 4DK0A 2MO0A 2B39A 5HGQA 3T1YQ 1BBUA 5KNBA 3ERQA 1EFID 3V96A 3TS0A 3NK9A 1SAPA 4C3JB 3CU7A 1KQSA 4BY7G 1G2SA 1A2UA 1EQVA 2EZVA 4A3KG 3BDOA 5GAGC 1XMQQ 2XWJB 3S1MB 2NYZD 4C2MB 4K6DA 2SEBD 1B8AA 2KQ3A 4B3TQ 2MP1A 2MFIA 2JP1A 2Z4HA 1TWFH 1B3QA 2B2TA 5EBDA 1EIFA 5K36H 1K83H 2PI2E 3U4VA 4GKKQ 1Y1WG 1AH9A 3NBIA 4XDXA 1B3AA 4L5SA 4DXFA 3NWSA 2F0OA 1HZAA 2KHIA 2JK8A 4JI8Q 4XTCS 3S1RB 4HSVA 2FMMA 3HOXG 4DAVA 2R3ZA 5M3FG 4HJ9A 4QCLA 2IT1A 2EY1A 2F4IA 3S2DH 4PMWA 1YBYA 3S2HH 2J7ZA 4A3BG 3NTIA 4ZCKA 4FP5D 1WCMB 2KJXA 5JAVA 3E3XA 5C44B 5LMUQ 3GTOB 2CQOA 2F0KA 2TSSA 5C5LA 1JJGA 1LUZA 2MGSA 5IYDH 1IBLQ 5ELFA 1MI2A 2IX0A 5E7NA 1UNSA 4BBSH 3TDQA 2ZXOA 4C56C 2B2UA 2A5HA 4Q0FA 1RHPA 3I4MB 2LKVA 3PUYA 5CC4A 1TS5A 1UUPA 2H4OA 4DGZA 3CC4A 2R93H 4XXEA 3S17H 1A2TA 1K0RA 4ILWA 2XNAC 3I2ZA 2A68D 2Y0SE 2R92H 3H91A 4X62Q 1IYJB 3GD7A 1XXGA 1EU3A 1I94Q 1B7YB 4H02A 3SEBA 1K0SA 4JI4L 5FK9C 1PH3A 2R7DA 1FNVA 2D2CC 2L1BA 3F8TA 1GUOA 2OT2A 4J15A 4V0BA 4DUYQ 3GTPB 1HHVA 3MHBA 1CTMA 1EY6A 4LF6Q 1VQNA 3AYHB 1UAPA 4UDUC 2IWHA 4QF4A 3WOFA 4DV5Q 3H0GB 4WRDA 3TS2A 1IKLA 3H3VH 5M3MG 3RN2A 3QB3A 1NAPA 4RH6A 4U68A 1IKMA 1QE6A 4LFBL 4LF7Q 3RLOA 3KK7A 1GUNA 1RL2A 3T1HL 1OXXK 4A4IA 4NB3A 4DN4M 4LF9L 2VW9A 1KTKA 5D3IB 5EJWA 2VNUD 4N8FA 3QOJA 3J81j 1D6EC 2A6HC 5C4XG 2E5LQ 1GM5A 1A3VA 4TKOB 3G71A 3CP0A 5IGCA 1U0LA 3A8IE 2AQ2B 4JI1Q 3QO2A 3K5MA 4YWMA 3I7FA 1WTRA 1G2TA 3J81E 2I0QA 1SBBB 1SRUA 2F3IA 1FGBD 5HY6A 5E3FA 2K5QA 1E22A 4IJLA 1KDAA 1H9KA 4RWSC 1IBMQ 5JJLA 1BO0A 3PIPA 3DWPA 2E2JB 2NUCA 4KY6A 1AN8A 3CXCA 5LMNW 1CI3M 3MAQA 3GDEA 1SMXA 2CW0D 1Y1WB 1LTGD 2EDGA 2MQHA 4B3MQ 2B8FA 2ZXPA 5FO8B 4I7ZC 3VR3A 1YHAA 2ES2A 3NEMA 1G6PA 1DZ1A 2B63G 3FP9A 2VQFL 3HOXB 4OEMB 5M3FB 3I70A 4HIKA 1H9SA 1MBYA 1LT4D 1PZJD 2I5HA 2IHFA 3K58A 3CMEA 4A3BB 3BJUA 4BA1I 2N49A 4GNXC 4R8IA 1MKHA 3Q8DA 3RD4A 3J7AV 4G4KA 2IL8A 2NVQH 3TEHB 1X32A 2EYMA 1N34L 5AJ3L 3SVMA 4A3MH 4LNQA 2Q8RE 4JC0A 3DWQA 3NELA 5IT9c 2IX1A 1GUTA 3PF4A 4B9XA 2LMCB 2A68C 2Z4IA 2J0TD 1G291 4EGVA 3BZCA 3SE0A 1ESRA 2P5ZX 2RHQB 1EY5A 2KUMA 1RJTA 3PSIA 4FYDA 2IHEA 5CYUA 3RZDH 5K36G 1PH2A 2K75A 1CUKA 4A3GH 1AP0A 2B2YC 1YI2A 4LF5Q 1HRJA 2JA8H 1IBKL 5FO9B 3KLSA 2LY7A 4MZ9A 3O13A 1TWHB 1KC8C 1O7LA 1STHA 2HUGA 4X65Q 1CKNA 1I3QH 1H9JA 2XTIA 4JI7Q 1BF4A 4B3SQ 1JOKA 1R9TB 1L0XB 1S5DD 1F9RA 3SGIA 5JPMC 1M90C 4YWKA 1VQMA 2F0QA 3PIOA 4OXPA 1JB3A 5AFWA 5IYDG 1ASYA 3CQZH 4BBSG 2UUBQ 2Z6KC 1FJGL 3MC0B 1J6QA 1A3TA 3MXGA 4KK7A 4ZKCB 1S72A 4NXNL 1U4LA 1PV4A 2R93G 1X3QA 4KHZA 1I6VC 2L9HA 1CZGA 1B2TA 2F3WA 2K04A 5KIXA 1F9SA 2WAQE 5CORA 3QG1A 4IPCA 2F0VA 2I5LX 5DAUA 1I4XA 2R92G 4M1UB 5C5MA 3GTJH 4LMQD 1KDCA 3D6WA 4Y7NB 3D31A 5KYIA 3G7LA 4GOPA 3G48A 2F4VL 2R7ZH 3D8GA 3VYUA 2UU9Q 2CW0C 2ZM6L 3I90A 1BBXC 1LTBD 2ID0A 1I4QA 2UXBL 3MFGA 3JC66 1HJPA 1D1KA 4A3JH 3RZOB 3E6ZX 3M85A 4FF2A 1GHJA 5FJ8H 5IWAL 1EY0A 2BA0A 2F0DA 1XMOL 4UP7A 1GO3E 4TQUS 2PNRC 1B44D 1QUQB 4XQQA 2CQAA 2VZAA 2B63B 1WTHA 2Y0SG 2PW5A 3M4OH 4IJHA 1ET6A 1C9OA 1HQMC 1EOVA 2V4DA 4HIOA 3CPFA 2B2TC 1KRTA 4XT1B 3P1HA 2L12A 1ENCA 1BCPB 4JI6Q 1HUNA 1JOQA 2QF7A 1XNQL 3I4LA 4JK1C 3VYTA 4BBRB 1TWGB 4KV6A 4KN4C 4M8AA 5DEHA 4CDCC 2L0CA 5E1FA 1DOLA 2PZWA 4JPBW 3R8BA 3DHQA 2E74C 2E2IB 1I4PA 2OQKA 2YYZA 2LXJA 1WJJA 1N9WA 1L1OB 2ENBA 3IFDA 2RCFA 1X6OA 2JA7B 5IGDA 3F2UA 1WYDA 4JI4Q 1EEFD 1ICWA 2EJFC 3P20A 2KOLA 1TWFB 1SYBA 2NZ1D 5I9OA 3KJPA 4KKTA 3K5NA 1X9NA 3MWYW 1CKOA 4ZUJA 3A5ZB 2B2UC 4LW1A 2OTLA 1VQ6A 4GKJL 1WTVA 2VUMB 4X6AH 4LUVA 2RHSB 2KHSA 2RVLA 3I8ZA 3PCOB 4NDXA 1O78A 4J8QA 3UDFA 1YHBA 2NN6H 1PRTD 3I91A 3J81c 3HGBA 3S16H 2SNSA 2QEJC 5C0XH 1WTQA 3JAML 3S2DB 1U9RA 4LFBQ 3S2HB 2K52A 2Q2TA 4IALA 4F87A 4QGUA 3LNNA 3T16A 1MJCA 3K57A 2NZOA 3T1HQ 2K01A 1X3PA 1MJEA 4ME5A 1JC7A 4LF9Q 5IP9H 4XIGS 1K3RA 3RN5A 1KHIA 3MEFA 4A3MG 4O0AA 4BBSB 1EYDA 1EIGA 5I6YA 2JXMB 1MGSA 4DV4L 1LTLA 3DM3A 1L2FA 4ZUIA 2F0GA 3NQTA 1PVOA 3I56A 4R1JA 2R93B 2HT1A 1STNA 2MO1A 3DMUA 4HTHA 1VMCA 2JYOA 2XSCA 1HZCA 2HCIA 3SR1A 1KAWA 3CCRA 5KRUA 1K9MC 4MIUA 4HMIA 3BVMA 2R92B 2XGTA 4A3GG 3TBIB 2BOSA 1PH1A 2OEOA 3S14B 3EIVA 4FNFA 1PTOD 2JA8G 5M9OA 3VYRA 2DY7A 2Q8TA 2Z8LA 1HPCA 3VA5A 4DU9A 4R4IA 1VQCA 2KA7A 2XN9C 2VQFQ 4IOCA 2EY5A 2EQSA 1TWAH 1PH9A 4A3CH 2UUAL 4DR7Q 1NMGA 2SOBA 3NHHA 5D3DA 2F1MA 4DR2L 1JWSD 1OXVA 3QIAA 4R4QA 2Z6BA 3FEWX 2K03A 4DR1L 1QNKA 2Y0SB 3KLRA 1PH5A 3R2TA 3BDCA 1N34Q 5AJ3Q 1JT8A 2D0OA 4POGA 5E4WC 5LL6S 4GN5A 1XPUA 2JN4A 4JCVE 1B53A 2KHJA 4KTAA 1YJWA 1SXTA 2F0MA 5GAEC 3AFPA 3UDXA 1UEBA 3J7ZC 1G91A 1AEXA 3TREA 3HOWH 1B4OA 2N55A 1EY4A 1FVIA 4JBMA 3PMFA 1Z47A 2K28A 4QY7A 2K32A 4L6TB 1IBKQ 2R7ZG 4DK3C 4YWLA 4EQOA 1VS0A 2JJQA 1A63A 2D62A 4KI0A 4FVMA 3URYA 1UE5A 3GTGB 5JVG3 2FINB 3KF6B 4LUZA 4A3JG 1PRTC 1Q86C 1Q12A 4EQNA 5FJ8G 3MXPA 3SDZA 2WAQG 1BCPF 4MNOA 3HOVH 3ZYYX 3K7UC 1Q90A 1NMFA 5EKKA 1IYUA 1JQYD 4IUVA 1E7ZA 1FNUA 1TWCH 4CJ0B 3I55A 1JJ2A 3EFXD 4HJ5A 2HDMA 2KCMA 4RGNA 1SJHD 4IN3A 2FHTA 1VQBA 4NXNQ 1QVFA 2QEXA 2F0FA 1RDPD 2C9OA 2A1AA 2NVQB 2YV5A 3OOCA 4B3RQ 2VQEL 2CH4W 2Z0SA 4A3MB 1FL0A 2YU9H 4BXXH 1FD7D 1BUVT 1IL2A 2E8GA 2AMCB 4A3FH 2K6AA 2NTSA 4X3KA 1SE4A 2F0SA 1PA6A 2F4VQ 1UE1A 4RMFA 3M7NA 1PTOC 2CWPA 1LLRD 5EGTA 2ZM6Q 1RTNA 4GLVB 1Y8PB 3NBHB 2UXBQ 2JA8B 1JCKB 1S40A 1LYLA 1JR0D 4HIMA 1L0YB 5IWAQ 5KYLA 1OTCA 2ZJPA 3A0JA 1LTSD 1PTOF 1XMOQ 2NN6G 2B3GA 1EZ6A 3FMCA 3NSWA 3R93A 3Q0AA 2V1CC 3OTOQ 2EY2A 4UP9A 5C0XG 4L63B 3UDIA 1I3QB 3KJOA 1UWVA 2A74C 1M1KC 2PQEA 1SNQA 2FMCA 1LACA 2FJ2A 3F2BA 1CFMA 1CHQD 5KEEA 4GOPC 3FPUB 3IAYA 5IP9G 1XNQQ 1J9OA 1JE4A 3E0JA 2RSNA 4CHTB 1RIPA 4ZAIA 4KKSA 3HG9A 4CGYB 3DEPA 1SYCA 3UDGA 3IFTA 4IZ8A 2WB1B 2NZHA 3I73A 4C1NK 3T13A 1LTAD 4UAIA 1LT6D 2WFWA 2CH4A 3LX0A 1V1QA 4DV6L 3H3VI 1JICA 2KBNA 1XTDA 1EQTA 3GTJB 5BN4A 1LT3D 3KDFB 4X64L 2F0EA 5IODA 1VQLA 1SR3A 2K14A 5LHY1 2R7ZB 1X3EA 2J4XA 3DLLA 2M9VA 1K8MA 3K59A 1XWEA 4AIMA 4NKLA 3J80L 3IL8A 1ILQA 4OONA 2F0LA 5EBCA 4A3CG 4DV3L 4ZRZA 2N88A 4N9TA 4A3JB 2NVTH 3OHXC 5IE8A 2QW7A 3T51B 2WAQB 2WACA 5GADC 5LMNL 1QWYA 4OWXB 1WTPA 1YVCA 4R4TA 3ZJYC 4AQYQ 3IKJA 1NR4A 2LXKA 3SK8A 3M4OB 2ICIA 3KLSX 1LT5D 1Q1BA 2ZT9C 4OX9L 4OELB 1TVXA 3KFUA 1Y1VH 4X3UA 1HFNA 4JV5Q 5HURA 2VS1A 4ZK9B 3C1EA 2DNEA 3TP6A 1D2BA 3EQLC 2XRQD 2BA1A 1ONLA 1IHZA 3HOWG 2VXWA 2NVYH 2JA9A 4DV2L 3AMUA 3N6RA 2UUCL 1YNXA 5L37A 4MTNA 2I5MX 5IGGA 4DK1A 3JAMi 5JJZA 4XT3B 3CCVA 4DV0Q 4V190 1SYEA 1CT1D 1FR3A 2ASBA 1EWIA 1ZYRD 4DR3Q 3CRLC 1U5KA 2JSOA 4IPDA 4NPSA 4GN4B 3CCUA 2DUDA 5J1ZA 1QVGA 1P8LA 4NP5A 3S1QH 2UUAQ 4RAUC 4LK1C 4KKUA 4BY7B 1TKWB 3J7A5 4A3KB 2JA6H 2F0IA 4HEDA 5EPLA 3A74A 5I6WA 3HOVG 2F0HA 3L7ZC 3OMCA 4XYOA 3NUCA 5EPJA 2M2LA 5C4ZA 3S16B 2EOTA 5I2YA 1XNRL 1X54A 2LSSA 1HNWL 3DEOA 2F0UA 3GTMH 4PMCA 5JEAH 3K5OA 3PQIA 2N3SA 3E5SA 4KN7C 3SK5A 3RUZA 1I4GA 2OF1A 4J6HA 4DV1L 4BXXG 4YCWA 3ITPA 2F0NA 1QUQA 4OWTB 3MZ5A 2RKSA 4PZ8A 4DV7L 3E9IA 4A3FG 1MSHA 2Q2IA 1VF5C 2KCCA 3CF5A 3A54A 1N8RC 1YNND 3BVGA 4PQXA 4BY1H 3KBGA 1SE2A 2AQ3B 1F9PA 1JJCB 3K7AH 2ZTDA 3RNUA 5H1SE 1PYBA 4LUOA 4H0LC 2AWOA 1K8OA 3I4NH 2K05A 5DM63 3BZDB 3CW2C 5BN5A 1Q46A 1PYWD 1BXTA 1O7YA 5FLMH 1JORA 2I07B 2L4NA 3GTQH 3MXNB 3NQIA 1SFOH 1K73C 1P16A 2PZTA 1MSGA 1PDQA 1SNDA 2R7FA 4LJZC 2O5JC 1L1OA 1QCBD 2KCNA 3NTKA 4BS9A 1U4RA 1KL9A 3DWAA 1TWAB 1AZQA 5M5XH 1S5ED 3D6CA 3LGJA 4RGMA 1X56A 2RBMA 2PO4A 1BVSA 4TVAB 3CMAA 4JI0Q 1HA6A 3WWVA 5IGEA 4P73A 3CCJA 4WJWA 5M5WH 4HAEA 4L5QA 4QUFA 1Z9FA 1ZKOA 2VQEQ 1HCZA 3C2PA 2OTJA 2JEBI 2A19A 1VMPA 1I5FA 1J8IA 1PFSA 4IUTA 1BDOA 4K0KL 1BR9A 1D5XC 3J7AF 4BWGB 3AU7A 1ASZA 3KF8B 4PNYA 5JVH3 1X55A 3I3CA 1WD0A 2ZJRA 2BH2A 1SE8A 3T56B 3PGZA 2SNMA 1H9MA 3HOWB 1F2MA 3D4DA 3VR6A 5EPKA 3K6OA 3L9AX 5M3MB 1XPRA 4RCOA 3S1MH 5JJIA 1BOSA 4IUQA 4RFBA 4DNTB 1EIYB 4JOIA 5M5YB 1ZYRC 2XIWA 4P75A 5CV6A 1IYVA 1QILA 2PI2A 4NMZA 4DKAC 2PMZE 4OIKA 4IUNA 3QR8A 2B2VA 1PLFA 1CM9A 4LFCL 3S15H 3CAMA 1YIJA 3E0EA 3KBXA 3TMEA 2KVMA 4PV1C 3T53B 5C4XB 1CSPA 1N32L 3S1RH 1I4HA 5TSSA 5GROA 3HOVB 2GVAA 5ELOA 2ALYB 1A0IA 1DCZA 1VQKA 1TWCB 2HD3A 2F0PA 4JW0A 3KOJA 3VR4A 3K8AA 4CKEA 4G57A 4R4CA 5C44H 3CCQA 3OPOA 1Y1VG 2NVXB 1LTTD 1YZ6A 1HR0W 1G6ZA 2O4XA 4JYAL 2EPBA 5C4JB 1EUJA 4B08A 3G4SA 2D0PA 3JAME 4L5RC 4QIWB 1YNJD 2RDHA 4KJOA 4C3IH 1GHKA 3I4MH 5CV5A 2NN6I 4NXML 4XYQA 3HEJA 4MHEA 1YNNC 1TXYA 2YU9B 4DR6L 1AE2A 4DV6Q 2EYPA 1SNPA 4R4OA 4GZYC 5C0XI 2ICEC 4A3FB 4FXDA 3TP7A 1CHPD 4A76A 1OXTA 5D65A 5IOCA 4CKBA 4DFAA 4ID6A 3TN2A 1LO5D 1XMQL 1ICFB 1ESFA 1HFGA 4DR5L 4K8JA 3CHBD 3L3OC 2LFNA 4N9PA 4DXGA 1XPOA 4B3TL 4RHSA 3D4RA 2JA6G 3MXUA 2QDLA 2EXDA 5D14A 4GKKL 1I6HH 5K5PA 1DOKA 2HIXA 3HZXA 5LMNQ 1B70B 3S1NH 4P74A 5JJKA 3PUWA 4RA8A 3IRBA 1LTID 1PRTB 2K33A 4JI8L 4OX9Q 4G7HC 3K81C 3H0GH 1K83B 1WVLA 2I46A 4JI3L 3PV0A 5JEAG 1D8LA 1VQDA 1BCPD 1F77A 1V9PA 2K7VA 3KF6A 1NY4A 1PH4A 2EYLA 4GLAC 2K50A 4EVOA 3HOUH 4DAYA 3CC7A 4K6LA 4KMUC 1E2ZA 1CQFA 1OO9B 2K5DA 2HHHL 3Q6SA 3B6YA 3J80i 4DV2Q 1V1PB 2QDBA 2CCZA 5CV7A 4QUCA 1IBLL 3HOZH 2R6GA 2OQ0A 1ILPA 2KCTA 2F0WA 4BY1G 5EQ0A 1Q81C 3AFQA 4PZ6A 5C6AA 1H95A 1STEA 3TZUA 3FDTA 4IO9A 3I4NG 3FKIH 2K5NA 2CVRA 1Z6HA 4HIDA 4IPGA 4P71A 5CV4A 4C1NI 4WORA 4YCUA 1EY8A 5FLMG 5F2DA 2A69D 4KD3A 4X62L 4JBWA 1NSNS 1TY0A 1NTGA 3Q22A 4AYBE 4RKLA 1XYIA 1RODA 3S17B 1ET9A 1EL0A 1Q8IA 1MHWC 5KGUA 3ULLA 4K5XA 2NVTB 3OIQA 5IIFA 1XNRQ 4DNRB 3M7GA 1PZKD 4UY8C 3ND9A 2QA4A 1GJXA 2KECA 4LF6L 2E2DC 4GS3A 4TSSA 5C4HA 5IGFA 2AUKA 2EJMA 4DV5L 3NPPA 4A3LH 1H9RA 4K8IA 1YNJC 1Y1VB 2F52A 4DNIA 3U9OA 3AB9A 4DV7Q 1EWCA 1LTRD 4GOPB 4LF7L 4DR4L 1V1OA 2AWNA 4DA2A 1RF2D 4L5TA 5FKAC 3K0XA 4H44C 1JMCA 4KY5A 3A56A 2KEEA 1VQJA 2FFKB 2G9HD 2NVYB 1TS4A 1WTWA 1O7ZA 2PQAB 2E5LL 4OO1H 1W6KA 1EU4A 1A62A 1IXRA 1SNCA 4FF4A 1C48A 4G7OC 1AFPA 4TRDA 2C5CA 1LV9A 2RSOA 2HIVA 1HNZL 1IZ6A 5DNFA 1SYDA 3OW2A 3LWUA 1SYGA 1TWHH 1FYCA 4QMGA 2JA6B 1SE3A 4IQZA 4H7BA 4RGOS 1K28A 1OXUA 2PYKA 1BCPC 1R9TH 1VQ9A 4QQBX 5C44G 4KHPL 4JI5L 3GTMB 5JPNC 1KAAA 4K0KQ 1SSOA 4A3EH 2K1BA 4C3IG 5DM73 4IFDH 1TU2B 3A8KE 1D5MC 3ONAB 4KJNA 4L8JA 3EA6A 4DUZL 5JOBA 4B9WA 1EYGA 2JA5H 1I50H 2BDOA 1VQHA 4IPHA 4DAPA 2RQXA 5E4XA 4A93H 1GUSA 3GP7A 3CC2A 1FJGQ 5DLQE 4A3IH 4BY1B 1GOZA 1ZEQX 2JQOA 3H09A 3K7AB 4J1MA 1N33L 3H6MA 1J5EL 4LFCQ 2N8NA 3I4NB 3AQQA 3RLFA 2A69C 5NUCA 1PZID 2ZTCA 3P75A 1SN8A 4R8NA 3JAMc 4JBKA 1DGSA 3M4PA 3CCEA 1WOCA 2IJ0A 3KLWA 1QJOA 1N32Q 4A75A 3GTQB 5A2QE 4IUUA 1SFOB 4LF5L 1Q1EA 1UEAB 4ABNA 5J39A 2PZUA 4O42A 3HRZC 1O7IA 3NTHA 4CDDC 1IW7D 1STYA 5ELCA 2PPBC 2MPMA 2L5TA 1VCIA 1N36L 1AZPA 3RZDB 1E3PA 1HH2P 3H0GG 2R61A 3HFZB 4A3GB 1GUWA 2DNCA 3KYHC 4X65L 2B2WA 3BYYB 3J80E 1MIUA 5COYA 4QB4A 4JYAQ 1QZHA 1QVCA 4LF8L 5M5WB 4I65A 3HOUG 2CFMA 2B2VC 1Y8NB 1KRSA 2CKZB 4HCEA 2RDGA 4NXMQ 1B50A 3SK4A 1B9NA 3KUPA 3BG3A 4DR6Q 5CBAE 2F0TA 1W2BA 1R4PB 3OW7A 3BU2A 4BBRH 1TWGH 4X3TA 5CV9A 4KLKA 3HOZG 1X65A 2UUBL 2EYFA 3PF5A 3AEVA 2QCPX 2E2IH 1BNZA 2Z9HA 2A6HD 3A8JE 3W1BA 3FKIG 4DR5Q 2JA7H 3UE1A 1K3BC 3CQZB 3HOYH 4FXKC 4LFAL 5I2XA 4GNXB 1PFBA 4PMBA 3MFYA 3HP3A 2DJFC 3S15B 1ENAA 3GTLH 4DF7A 2VUMH 3PO2H 2X6LA 2CWAA 1AW7A 1PFNA 2RCNA 2UU9L 5A2QL 1D1IA 2CHBD 1STGA 1WTXA 1TS3A 3H3VC 4JI3Q 4Z9CB 1JOOA 5C0XJ 4APVA 1BKBA 4A3DH 4GKJQ 1RTOA 1PYSB 4OIJA 4JI2L 1HTPA 3Q23A 5IT9L 1EQRA 2E2HH 4IURA 2SDFA 3A7LA 4S3SA 1PTOH 2PW7A 4GLXA 2IY5B 5I9PA 3MXNA 4A3LG 3F2CA 1NJIC 2HHHQ 3WOEA 3TSSA 5ELEA 4ME3A 3D3RA 3HKZE 2PMZB 1EWHA 1DOMA 1HQRD 4MTKA 5IP7H 3GO5A 4AYBG 3FVQA 1HTLD 4C3IB 4JI6L 2RDFA 2BH8A 3EVQA 1NBWA 4ZLTF 5IGBA 3NXWA 5T1GA 1LABA 1EIHA 3CCMA 2MNAA 4FF3A 2HDLA 2G5DA 3M3YH 4OO1G 2UXDL 3TP8A 1HXYD 4OWWB 3VYSA 4DV4Q 2DGYA 3BYTB 1TIID 3I4OA 3RMHA 2O2LD 1VQ8A 3S14H 1YEZA 2A8VA 4JBJA 1S5FD 1VQFA 1JB7A 1PH7A 3STBD 1ML0D 3W2DA 1KXLA 3A7AB 4KD4A 3KF8A 3U9SA 1K8GA 3OIPA 3ULJA 4UPAA 5FLXE 5CV8A 3X3MA 1IW7C 2XRSD 3ND8A 2K4KA 2EJGC 4JG2A 4C3HH 4HR7B 1I6HB 4K5VA 1QNUA 2FXQA 2X6GA 1G51A 1WD1A 1QZGA 3S1NB 3BZKA 1A15A 1FNWA 3OYYA 3CPWA 4R9WA 5C3EH 1U4MA 1QG7A 1VQIA 3OSOA 4HN7A 3H94A 1A8VA 4A3EG 4YHHL 4AH6A 4IUPA 4DR4Q 3K80C 4DR2Q 2H5XA 3M4YA 4IFDG 3HOUB 3LWEA 1GUGA 2DJGC 3HS0C 4K5WA 3C46A 3R2IA 2JA5G 4DR1Q 2F3VA 2GN5A 1ZXTA 4A93G 4X66L 1WFQA 3BVZA 3HOZB 4CDEC 4WJ3M 3PO3H 4K2KA 4A3IG 2ZJQA 2ATWA 1KABA 1D7QA 1EOTA 4NW2A 4LF4L 3FKIB 2AKWB 2JEAI 4ALPA 1GVPA 1HNZQ 5EKLA 4YY3L 4E6IA 5IYCH 5FOBB 1KNAA 3M4QA 1VQOA 2HQEA 4ULLA 3DUZA 3GTGH 1WTOA 3M9BA 3CCLA 4EQ5A 4K2LA 1OXSC 1TT2A 5FLXL 1GXDC 3I72A 4RHRA 2A6ED 4IFDJ 4WJ4A 1RCVD 2RA4A 2L11A 4KHPQ 4JI5Q 3ER0A 2F0JA 2DY8A 4FF1A 1Y14B 3GTKH 4DR7L 1KDBA 2OCEA 4I7AA 4XQNA 2EYOA 1STBA 2D9UA 1SLJA 1XX8A 1GD7A 1XJVA 3W1GA 1TS2A 1HZ9A 2HCCA 2F03A 4DUZQ 4P2CB 2VB3X 4BBRG 4YCVA 4WFN3 2L55A 3L2PA 2QKIC 3UI2A 4AYBB 3MEHA 2IPKD 1KLGD 1NE3A 5LL6X 1M8AA 3NENA 1N33Q 2JA7G 1VQAA 3J80c 1J5EQ 1HR0L 3HOYG 3GV3A 2BDNA 2UXCL 3SHLA 4RKBA 1YITA 3J81L 4CDFC 3STBC 5J22A 3OWEB 5HGTA 1JWUD 1U4PA 1SMYD 4Y52H 3TP5A 4C3JH 1CA5A 1V1PA 2NWGA 2VUMG 2AQ1B 3PO2G 3FRPB 1F9QA 1T5XD 2AHOB 2NBFA 1STAA 2WB1E 4C2MH 1N36Q 3T4AC 1DJRD 3U4ZA 1HNXL 1G8ZD 3TQYA 4KY7A 3W5OA 4A3DG 1RD9D 1BBWA 4LF8Q 5ELBA 1CSQA 1W3SA 2EIFA 2A73B 2Q8IB 4HJ8A 4O1NA 3V05A 5IYBH 3J7YW 1EZ8A 3Q24A 3U58A 3G6JB 2B8GA 3D4WA 2EE1A 5ELDA 1PXUA 2EXZA 5C3XA 1NUCA 1KLUD 2VY3A 3W3AA 4MN3A 4A3EB 5IP7G 3VA7A 3NP8A 1B1ZA 1VQPA 1Q7YC 2GVBA 4HCSA 1SEBD 4UP8A 5FO7B 5BR8L 1I4RA 2LS01 3FHWA 2JA5B 1I50B 4ZQ3A 1PFMA 3S24A 1WCMH 1X3GA 2QGQA 4B3RL 4A93B 5CGKA 4KHVA 1SDFA 1E2VA 3GTOH 4LFAQ 3PUVA 3MTSA 2B2WC 4A3IB 1E1OA 1C7YA 1VQ5A 2YTYA 1IL8A 1SNOA 2EY6A 2OXPA 2G9DA 4LWCA 2RF4A 3T1YL 4CBVA 1YHQA 4HJAA 3HKZG 3SXHA 5C3WA 4CJ2C 3VDYA 4ZYSA 3CRKC 2A6EC 4X64Q 2X69A 4C3HG 1NR2A 1HA5A 1E2WA 5CMDA 4JI2Q 2K5VA 2PQAA 2KEDA 4X3SA 2XVSA 1EEID 2BE5D 2KENA 1H9SB 2IW3A 3UE0A 5C3EG 1W6JA 2EYHA 3OTOL 1NCVA 1Q82C 4DV3Q 3WDNA 1S4ZA 2Q2HA 3DXJC 4N8X1 3RLNA 3K0YA 5FLXc 4P72A 2HQLA 3GTPH 1KIXA 2E76C 1CQVA 5G3LD 4BA2I 4F8MA 3FPPA 4FXGC 1EY9A 4ODGA 1VQ4A 2ZXRA 1HZBA 3S9WA 4U673 3F1ZA 2B29A 2E75C 5T1IA 2UXDQ 4PZ7A 3PO3G 5CBEE 3VR2A 1PH8A 1MD2D 3GV6A 1EFWA 2H1EA 1E1TA 1A6XA 2BCOA 3HOYB 1JE5A 3NE5B 1SMYC 4G7ZC 5LMUL 5IYCG 1DONA 1JWMD 5CR3A 3TZDA 2O5IC 2UUCQ 3G6EA 4XQJA 1EY7A 3OWFA 5I4DA 4OHJA 3C3LA 4QJFA 1HUMA 3GTLB 2WINB 3PO2B 2WKDA 1II3A 3TRZA 4BY7H 1GKHA 3U50C 4A3KH 5A35A 1A3UA 3CD6A 2K5WA 4QL5A 1CKNB 3A5UA 1VDZA 2YTVA 4OO1I 1T5EA 2TMPA 3EROA 2EVBA 4IOAA 4A3DB 4YHHQ 2E2JH 1C8CA 3GQBA 2E2HB 3H15A 1UE7A 1F2ZA 4DK6C 1VQEA 5JEAJ 1EYCA 1PTOB 2WKCA 1Y1WH 1S3OA 1I94L 2NTTA 1RKNA 3ERSX 3R3OA 4AQYL 3MA2B 5KNDA 2MUYA 4X66Q 1HNWQ 1AE3A 3HOXH 5M3FH 5BN3A 4DUYL 3BS1A 1VQ7A 4JV5L 3PIP3 3NBHA 1KD1C 1QOHA 3D0FA 4ZKBB 3MVVA 4A3BH 4LF4Q 3NWTA 1X3FA 3EJIA 3M3YB 1PH6A 2JE6I 4Q5VA 2YTXA 4DV1Q 1TY2A 1SROA 4K14A 4HMJA 1WI5A 4YY3Q 4OL7A 5ELNA 5GAHC 1CZWA 3E9HA 4C3JG 4FO2A 4EQPA 1M4VA 5J3BA 2IX3A 2PNHA 2QILA 4DV0L 1C0AA 1UE6A 1E24A 4IFDI 1CKMA 3HKSA 2VL6A 3HKZB 1VF7A 2WIIB 1V43A 4DR3L 4OGQC 1SJED 4UHVA 1BQQT 1L0WA 1S5CD 2BE5C 4JVZA 3BDLA 4EX5A 4C3HB 1NNXA 1PHJA 4JI1L 1LM0A 1TQOA 1C4QA 3OMGA 4HSPA 3SK6A 1K8AC 3CCSA 5IYBG 4LAAA 3ULPA 2K5HA 1Q8KA 4GNXA 5C3EB 2EYJA 4GN3B 1DM0B 1IBML 3EN2A 3S1QB 4F7XA 3DM1A 2WP8J 3CKIB 1S5BD 4H13C 1SYFA 1B9MA 3KDFA 1VQGA 2WV6D 2WB1G 1F2LA 4B3ML 3A55A 5IY0A 1ENFA 2NB0A 1HR0Q 1Z7TA 1WCMG 2XWBB 1KNEA 3QJYA 5G3LF
chains in the Genus database with same CATH topology
3N52A 3PO3B 3V2TA 1XTCD 2VB2X 2B2YA 4F88A 5ISRA 3C1FA 2M00A 3P7JA 3K5LA 1D5ZC 2DN8A 2MHVA 1F2YA 1Q3LA 3X3NA 3PIO3 2D5DA 1DYQA 2Z1CA 5KNCA 1O80A 1TR5A 1Y8OB 3PUZA 1Y69U 1QB5D 4YIJA 2AUJD 3GTKB 1SNMA 1PRTF 3PUXA 1V8QA 2MJ8A 5EKIA 4RCNA 1E0BA 1DD2A 4RGTA 2GA4B 1PMRA 1EYAA 3QWNA 4CJ1B 1CK1A 1DXMA 5M5XB 5IT9E 3VR5A 1CA6A 2PCFB 3QOLA 4CKCA 1R4QB 4DK0A 2B39A 5KNBA 3ERQA 1EFID 3V96A 3NK9A 1SAPA 4C3JB 3CU7A 1G2SA 1A2UA 1EQVA 2EZVA 3BDOA 2XWJB 3S1MB 2NYZD 4C2MB 4K6DA 2SEBD 2KQ3A 2MP1A 2JP1A 2Z4HA 2B2TA 5EBDA 5K36H 3NBIA 4XDXA 1B3AA 4DXFA 3NWSA 2F0OA 4XTCS 3S1RB 4HSVA 2FMMA 4DAVA 2R3ZA 4QCLA 2IT1A 2EY1A 2F4IA 4PMWA 2J7ZA 3NTIA 4FP5D 1WCMB 2KJXA 5JAVA 5C44B 3GTOB 2F0KA 2TSSA 5C5LA 2MGSA 5ELFA 1MI2A 2IX0A 1UNSA 3TDQA 2ZXOA 4C56C 2B2UA 2A5HA 4Q0FA 1RHPA 3I4MB 2LKVA 3PUYA 5CC4A 1TS5A 1UUPA 2H4OA 4DGZA 4XXEA 1A2TA 4ILWA 2XNAC 2A68D 3H91A 3GD7A 1XXGA 1EU3A 3SEBA 5FK9C 1FNVA 2D2CC 2L1BA 1GUOA 2OT2A 4V0BA 3GTPB 1HHVA 3MHBA 1CTMA 1EY6A 1UAPA 4UDUC 2IWHA 4QF4A 3WOFA 3H0GB 4WRDA 1IKLA 3QB3A 1NAPA 4RH6A 4U68A 1IKMA 1QE6A 3KK7A 1GUNA 1OXXK 4DN4M 1KTKA 5D3IB 5EJWA 2VNUD 3QOJA 1D6EC 2A6HC 1A3VA 4TKOB 5IGCA 3A8IE 2AQ2B 3QO2A 3K5MA 1G2TA 1WTRA 3J81E 1SBBB 1FGBD 5E3FA 2K5QA 1KDAA 1H9KA 4RWSC 1BO0A 3DWPA 2E2JB 2NUCA 4KY6A 1AN8A 1CI3M 3MAQA 2CW0D 1Y1WB 1LTGD 2EDGA 2B8FA 2ZXPA 5FO8B 4I7ZC 3VR3A 1DZ1A 3HOXB 5M3FB 3I70A 1H9SA 1MBYA 1LT4D 1PZJD 3K58A 4A3BB 4BA1I 4R8IA 3RD4A 3J7AV 4G4KA 2IL8A 1X32A 2EYMA 3SVMA 2Q8RE 3DWQA 2IX1A 1GUTA 4B9XA 2LMCB 2A68C 2Z4IA 2J0TD 1G291 4EGVA 3SE0A 1ESRA 1EY5A 2KUMA 1RJTA 4FYDA 5CYUA 5K36G 1AP0A 2B2YC 1HRJA 5FO9B 3KLSA 2LY7A 3O13A 1TWHB 1O7LA 1STHA 2HUGA 1H9JA 1BF4A 1JOKA 1R9TB 1L0XB 1S5DD 1F9RA 5JPMC 2F0QA 1JB3A 5AFWA 3MC0B 1A3TA 3MXGA 4KK7A 4ZKCB 1U4LA 1X3QA 4KHZA 1I6VC 2L9HA 1CZGA 1B2TA 2F3WA 2K04A 5KIXA 1F9SA 5CORA 3QG1A 2F0VA 5DAUA 1I4XA 4M1UB 5C5MA 4LMQD 1KDCA 3D6WA 4Y7NB 3D31A 5KYIA 3G7LA 3D8GA 3VYUA 2CW0C 3I90A 1BBXC 1LTBD 2ID0A 1I4QA 3MFGA 1D1KA 3RZOB 3E6ZX 3M85A 4FF2A 1GHJA 1EY0A 2BA0A 2F0DA 4TQUS 2PNRC 1B44D 4XQQA 2CQAA 2B63B 2PW5A 1ET6A 1HQMC 2V4DA 2B2TC 4XT1B 3P1HA 2L12A 1ENCA 1BCPB 1HUNA 1JOQA 2QF7A 3I4LA 4JK1C 3VYTA 4BBRB 1TWGB 4KV6A 4KN4C 4M8AA 5DEHA 2L0CA 5E1FA 1DOLA 2PZWA 3R8BA 3DHQA 2E74C 2E2IB 1I4PA 2YYZA 2ENBA 3IFDA 2JA7B 5IGDA 3F2UA 1EEFD 1ICWA 2EJFC 3P20A 2KOLA 1TWFB 1SYBA 2NZ1D 5I9OA 4KKTA 3K5NA 3MWYW 4ZUJA 2B2UC 2VUMB 1WTVA 2KHSA 2RVLA 3I8ZA 4NDXA 1O78A 4J8QA 2NN6H 1PRTD 3I91A 3HGBA 2SNSA 2QEJC 5C0XH 1WTQA 3JAML 3S2DB 1U9RA 3S2HB 4IALA 4F87A 3LNNA 3T16A 3K57A 2K01A 1X3PA 4ME5A 1JC7A 4XIGS 4BBSB 1EYDA 1EIGA 5I6YA 2JXMB 1MGSA 4ZUIA 2F0GA 3NQTA 2R93B 1STNA 3DMUA 4HTHA 1VMCA 2JYOA 2XSCA 2HCIA 3SR1A 5KRUA 4MIUA 4HMIA 3BVMA 2R92B 3TBIB 2BOSA 2OEOA 3S14B 4FNFA 1PTOD 5M9OA 3VYRA 2DY7A 2Q8TA 2Z8LA 1HPCA 3VA5A 4DU9A 2KA7A 2XN9C 2EY5A 2SOBA 3NHHA 5D3DA 2F1MA 1JWSD 1OXVA 3QIAA 3FEWX 2K03A 1QNKA 2Y0SB 3KLRA 3R2TA 3BDCA 5E4WC 5LL6S 1B53A 4KTAA 1SXTA 2F0MA 1G91A 1AEXA 1B4OA 2N55A 1EY4A 3PMFA 1Z47A 2K28A 2K32A 4L6TB 2D62A 4KI0A 4FVMA 3URYA 3GTGB 5JVG3 2FINB 1PRTC 1Q12A 4EQNA 3MXPA 3SDZA 1BCPF 3ZYYX 1Q90A 5EKKA 1IYUA 1JQYD 4IUVA 1FNUA 4CJ0B 3EFXD 2HDMA 4RGNA 1SJHD 4IN3A 2FHTA 2F0FA 1RDPD 2C9OA 2NVQB 3OOCA 4A3MB 1FD7D 1BUVT 2K6AA 2NTSA 4X3KA 1SE4A 2F0SA 3M7NA 1PTOC 1LLRD 5EGTA 1RTNA 1Y8PB 2JA8B 1JCKB 1JR0D 1L0YB 5KYLA 1LTSD 1PTOF 2NN6G 1EZ6A 3FMCA 3NSWA 3R93A 3Q0AA 2EY2A 5C0XG 4L63B 1I3QB 2A74C 2PQEA 1SNQA 2FMCA 1LACA 2FJ2A 1CFMA 1CHQD 5KEEA 3FPUB 3IAYA 1J9OA 1JE4A 3E0JA 2RSNA 4CHTB 4ZAIA 4KKSA 3HG9A 4CGYB 3DEPA 1SYCA 3IFTA 4IZ8A 2WB1B 3I73A 4C1NK 3T13A 1LTAD 4UAIA 1LT6D 3LX0A 1JICA 1EQTA 3GTJB 5BN4A 1LT3D 2F0EA 5IODA 5LHY1 2R7ZB 2J4XA 2M9VA 1K8MA 3K59A 1XWEA 4NKLA 3J80L 3IL8A 1ILQA 2F0LA 5EBCA 4ZRZA 2N88A 4N9TA 4A3JB 3OHXC 3T51B 2WAQB 2WACA 1QWYA 1WTPA 3IKJA 1NR4A 3M4OB 3SK8A 2ICIA 3KLSX 1Q1BA 1LT5D 2ZT9C 1TVXA 4X3UA 1HFNA 5HURA 4ZK9B 3C1EA 2DNEA 3TP6A 1D2BA 3EQLC 2XRQD 2BA1A 1ONLA 1IHZA 2VXWA 3AMUA 3N6RA 5IGGA 4DK1A 5JJZA 4XT3B 4V190 1SYEA 1CT1D 1FR3A 1ZYRD 3CRLC 2JSOA 5J1ZA 4NP5A 4RAUC 4LK1C 4KKUA 4BY7B 1TKWB 4A3KB 2F0IA 4HEDA 5EPLA 5I6WA 2F0HA 3L7ZC 3OMCA 4XYOA 5C4ZA 3NUCA 2M2LA 5EPJA 3S16B 2EOTA 5I2YA 3DEOA 2F0UA 4PMCA 5JEAH 3K5OA 3E5SA 4KN7C 3SK5A 3RUZA 1I4GA 2OF1A 4J6HA 3ITPA 2F0NA 3MZ5A 2RKSA 1MSHA 1VF5C 2KCCA 3A54A 1YNND 3BVGA 4PQXA 3KBGA 1SE2A 2AQ3B 1F9PA 4H0LC 2AWOA 1K8OA 2K05A 5DM63 3BZDB 5BN5A 1PYWD 1BXTA 1O7YA 1JORA 2I07B 2L4NA 3NQIA 2PZTA 1MSGA 1PDQA 1SNDA 4LJZC 2O5JC 1QCBD 2KCNA 3NTKA 4BS9A 1U4RA 3DWAA 1TWAB 1AZQA 1S5ED 3D6CA 4RGMA 2RBMA 2PO4A 1HA6A 5IGEA 4WJWA 4HAEA 4QUFA 1ZKOA 1HCZA 3C2PA 2JEBI 1VMPA 1J8IA 4IUTA 1BDOA 1BR9A 1D5XC 3J7AF 4BWGB 3AU7A 4PNYA 5JVH3 3I3CA 1WD0A 3T56B 2SNMA 1H9MA 3HOWB 1F2MA 3D4DA 3VR6A 5EPKA 3K6OA 3L9AX 5M3MB 4RCOA 1BOSA 4IUQA 4RFBA 4DNTB 5M5YB 1ZYRC 2XIWA 5CV6A 1IYVA 1QILA 4NMZA 4OIKA 4IUNA 2B2VA 1PLFA 1CM9A 3KBXA 3TMEA 2KVMA 4PV1C 3T53B 5C4XB 1I4HA 5TSSA 3HOVB 1DCZA 1TWCB 2F0PA 3VR4A 4CKEA 4G57A 3OPOA 2NVXB 1LTTD 1G6ZA 2O4XA 2EPBA 5C4JB 4B08A 3JAME 4QIWB 1YNJD 2RDHA 4KJOA 1GHKA 5CV5A 2NN6I 4XYQA 3HEJA 4MHEA 1YNNC 2YU9B 2EYPA 1SNPA 4GZYC 5C0XI 2ICEC 4A3FB 4FXDA 3TP7A 1CHPD 1OXTA 5D65A 5IOCA 4CKBA 4DFAA 4ID6A 3TN2A 1LO5D 1ESFA 1HFGA 4K8JA 3CHBD 3L3OC 2LFNA 4N9PA 4DXGA 4RHSA 3D4RA 3MXUA 5D14A 5K5PA 1DOKA 3HZXA 3PUWA 4RA8A 1LTID 1PRTB 2K33A 4G7HC 1K83B 1WVLA 2I46A 3PV0A 5JEAG 1BCPD 1F77A 2K7VA 2EYLA 4EVOA 4DAYA 4K6LA 4KMUC 1E2ZA 1CQFA 1OO9B 2K5DA 3Q6SA 1V1PB 2QDBA 5CV7A 4QUCA 2R6GA 1ILPA 2F0WA 5EQ0A 5C6AA 1STEA 3TZUA 3FDTA 2CVRA 1Z6HA 5CV4A 4C1NI 4WORA 1EY8A 5F2DA 2A69D 4KD3A 4JBWA 1NSNS 1TY0A 3Q22A 4RKLA 1XYIA 1RODA 3S17B 1ET9A 1EL0A 1Q8IA 5KGUA 4K5XA 2NVTB 3OIQA 5IIFA 4DNRB 3M7GA 1PZKD 3ND9A 1GJXA 2KECA 2E2DC 4TSSA 5IGFA 5C4HA 2AUKA 2EJMA 3NPPA 1H9RA 4K8IA 1YNJC 1Y1VB 3U9OA 3AB9A 1EWCA 1LTRD 1V1OA 2AWNA 4DA2A 1RF2D 5FKAC 4H44C 4KY5A 3A56A 2KEEA 2FFKB 2G9HD 2NVYB 1TS4A 1WTWA 1O7ZA 4OO1H 1W6KA 1EU4A 1SNCA 4FF4A 1C48A 4G7OC 1AFPA 4TRDA 2C5CA 1LV9A 2RSOA 5DNFA 1SYDA 3LWUA 1SYGA 1FYCA 4QMGA 2JA6B 1SE3A 4IQZA 4H7BA 4RGOS 1OXUA 2PYKA 1BCPC 3GTMB 5JPNC 1KAAA 1SSOA 2K1BA 4C3IG 5DM73 4IFDH 1TU2B 3A8KE 1D5MC 3ONAB 4KJNA 4L8JA 1KNEA 3EA6A 5JOBA 4B9WA 2BDOA 4DAPA 2RQXA 5E4XA 1GUSA 3GP7A 4BY1B 1GOZA 1ZEQX 3H09A 3K7AB 4J1MA 3H6MA 3I4NB 3RLFA 2A69C 5NUCA 1PZID 3P75A 4R8NA 2IJ0A 1QJOA 3GTQB 5A2QE 4IUUA 1SFOB 1Q1EA 1UEAB 4ABNA 5J39A 2PZUA 4O42A 3HRZC 3NTHA 1IW7D 1STYA 5ELCA 2PPBC 2MPMA 2L5TA 1VCIA 1AZPA 3RZDB 2R61A 4A3GB 1GUWA 2DNCA 2B2WA 3BYYB 3J80E 5COYA 4QB4A 5M5WB 4I65A 2B2VC 1Y8NB 4HCEA 2RDGA 1B50A 3SK4A 1B9NA 3KUPA 3BG3A 5CBAE 2F0TA 1R4PB 3OW7A 4X3TA 5CV9A 2EYFA 2QCPX 1BNZA 2A6HD 3A8JE 3CQZB 4FXKC 5I2XA 1PFBA 4PMBA 3MFYA 3HP3A 3S15B 1ENAA 4DF7A 2X6LA 1AW7A 1PFNA 5A2QL 1D1IA 2CHBD 1STGA 1WTXA 1TS3A 3H3VC 4Z9CB 1JOOA 5C0XJ 1RTOA 4OIJA 1HTPA 3Q23A 5IT9L 4IURA 2SDFA 3A7LA 4S3SA 1PTOH 2PW7A 5I9PA 3MXNA 3WOEA 3TSSA 5ELEA 3D3RA 2PMZB 1EWHA 1DOMA 1HQRD 3GO5A 3FVQA 1HTLD 4C3IB 2RDFA 3EVQA 4ZLTF 5IGBA 3NXWA 5T1GA 1LABA 1EIHA 4FF3A 2HDLA 4OO1G 3TP8A 1HXYD 3VYSA 3BYTB 1TIID 3RMHA 2O2LD 1S5FD 1ML0D 3W2DA 3A7AB 4KD4A 3KF8A 3U9SA 3OIPA 5FLXE 5CV8A 3X3MA 1IW7C 2XRSD 3ND8A 2EJGC 4HR7B 1I6HB 4K5VA 1QNUA 2X6GA 1WD1A 3S1NB 1A15A 1FNWA 4R9WA 1U4MA 1QG7A 3OSOA 4HN7A 3H94A 4IUPA 3M4YA 4IFDG 3HOUB 3LWEA 1GUGA 3HS0C 4K5WA 3C46A 3R2IA 2F3VA 1ZXTA 3BVZA 3HOZB 4K2KA 1KABA 1EOTA 4NW2A 3FKIB 2JEAI 5EKLA 4E6IA 5FOBB 1KNAA 2HQEA 4ULLA 3DUZA 1WTOA 4K2LA 1OXSC 1TT2A 5FLXL 1GXDC 3I72A 4RHRA 2A6ED 4IFDJ 1RCVD 2RA4A 2L11A 2F0JA 2DY8A 4FF1A 1KDBA 4XQNA 2EYOA 1STBA 2D9UA 1XX8A 1TS2A 2HCCA 2F03A 4P2CB 2VB3X 4WFN3 2L55A 2QKIC 3UI2A 4AYBB 3MEHA 2IPKD 1KLGD 5LL6X 1M8AA 3GV3A 2BDNA 3SHLA 4RKBA 3J81L 5J22A 3OWEB 5HGTA 1JWUD 1U4PA 1SMYD 3TP5A 1CA5A 1V1PA 2NWGA 2AQ1B 3FRPB 1F9QA 1T5XD 2NBFA 1STAA 3T4AC 1DJRD 1G8ZD 4KY7A 1RD9D 5ELBA 2A73B 2Q8IB 4O1NA 3V05A 3J7YW 1EZ8A 3Q24A 3G6JB 2B8GA 3D4WA 2EE1A 5ELDA 1PXUA 2EXZA 5C3XA 1NUCA 1KLUD 3W3AA 4MN3A 4A3EB 3VA7A 3NP8A 1B1ZA 4HCSA 1SEBD 5FO7B 1I4RA 2LS01 2JA5B 1I50B 4ZQ3A 1PFMA 4A93B 5CGKA 4KHVA 1SDFA 1E2VA 3PUVA 3MTSA 2B2WC 4A3IB 1IL8A 1SNOA 2EY6A 2OXPA 2G9DA 4CBVA 3SXHA 5C3WA 4CJ2C 4ZYSA 3CRKC 2A6EC 2X69A 4C3HG 1NR2A 1HA5A 1E2WA 5CMDA 2KEDA 4X3SA 2XVSA 1EEID 2BE5D 1H9SB 2IW3A 1W6JA 2EYHA 1NCVA 3WDNA 1S4ZA 3DXJC 3K0YA 2E76C 1CQVA 5G3LD 4BA2I 4F8MA 3FPPA 4FXGC 1EY9A 4ODGA 2ZXRA 3S9WA 4U673 2E75C 5T1IA 5CBEE 3VR2A 1MD2D 3GV6A 2H1EA 1A6XA 2BCOA 3HOYB 3NE5B 1SMYC 4G7ZC 1DONA 1JWMD 5CR3A 3TZDA 2O5IC 4XQJA 1EY7A 3OWFA 5I4DA 4OHJA 3C3LA 1HUMA 3GTLB 2WINB 3PO2B 2WKDA 1II3A 5A35A 1A3UA 2K5WA 1VDZA 4OO1I 1T5EA 2TMPA 3EROA 2EVBA 4A3DB 1C8CA 3GQBA 2E2HB 1F2ZA 5JEAJ 1EYCA 1PTOB 2WKCA 2NTTA 1RKNA 3R3OA 3MA2B 5KNDA 2MUYA 5BN3A 3BS1A 3PIP3 3NBHA 1QOHA 4ZKBB 3MVVA 3NWTA 3EJIA 3M3YB 2JE6I 4Q5VA 1TY2A 4K14A 4HMJA 4OL7A 1CZWA 4C3JG 4FO2A 4EQPA 1M4VA 2IX3A 2QILA 4IFDI 3HKZB 1VF7A 2WIIB 1V43A 4OGQC 1SJED 1BQQT 1S5CD 2BE5C 3BDLA 4C3HB 1TQOA 1C4QA 3OMGA 4HSPA 3SK6A 4LAAA 5C3EB 2EYJA 1DM0B 3S1QB 4F7XA 3DM1A 2WP8J 3CKIB 1S5BD 4H13C 1SYFA 1B9MA 2WV6D 1F2LA 3A55A 1ENFA 2NB0A 1Z7TA 2XWBB 4EQOA 3QJYA 5G3LF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O13 A;  1JWS D;  1PTO H;  1B1Z A;  1I4P A;  1PTO C;  1PZK D;  1GOZ A;  1LLR D;  1SEB D;  1KTK A;  5D3I B;  5ELE A;  3TSS A;  1I4R A;  1XTC D;  4DXF A;  3DWA A;  1D6E C;  1JCK B;  1PZI D;  1HQR D;  3R2T A;  1CHP D;  2XRQ D;  1S5E D;  4RGM A;  1EEF D;  4TSS A;  1JR0 D;  1L0Y B;  4RHR A;  1HTL D;  2AQ2 B;  2IJ0 A;  1L0X B;  1S5D D;  1LTS D;  1PTO F;  1LO5 D;  1RCV D;  1PTO B;  1ESF A;  1SBB B;  2NTT A;  3CHB D;  1FGB D;  1SXT A;  1D5Z C;  4L63 B;  1EWC A;  1LTR D;  4DXG A;  4RHS A;  1V1O A;  1CT1 D;  1HXY D;  1RF2 D;  3DWP A;  3MC0 B;  5ELC A;  5FKA C;  1DYQ A;  1AN8 A;  1PRT D;  2R61 A;  3BYT B;  1CHQ D;  2O2L D;  1TS2 A;  2G9H D;  2TSS A;  4ZYS A;  1D5X C;  3BYY B;  1S5F D;  2QEJ C;  4BWG B;  1LTG D;  5ELF A;  4L6T B;  1HA5 A;  1TS4 A;  1UNS A;  3W2D A;  4C56 C;  1PRT F;  1EU4 A;  1LTI D;  1PRT B;  1I4X A;  1TY2 A;  2RDG A;  1TS5 A;  1UUP A;  2IPK D;  1EEI D;  3URY A;  1KLG D;  4RGT A;  4RCO A;  1BCP D;  2XRS D;  1F77 A;  4RFB A;  1CK1 A;  1LT4 D;  1PZJ D;  1M4V A;  1PRT C;  2QIL A;  1LTA D;  1QIL A;  1LT6 D;  2XNA C;  1FNW A;  1BCP F;  4K6L A;  1SE3 A;  3OWE B;  1LTB D;  1CQV A;  1EU3 A;  1JWU D;  1I4Q A;  1LT3 D;  1JQY D;  1XXG A;  1SJE D;  3MFG A;  1V1P B;  4RGO S;  3SEB A;  1V1P A;  1FNU A;  1S5C D;  5FK9 C;  2AQ1 B;  1FNV A;  3EFX D;  1I4G A;  1BCP C;  1T5X D;  2J4X A;  3DWQ A;  4RGN A;  1SJH D;  1I4H A;  1B44 D;  1EFI D;  3BVM A;  5TSS A;  1MD2 D;  1DJR D;  1STE A;  1G8Z D;  1RDP D;  3R2I A;  1ET6 A;  1PTO D;  1RD9 D;  2Z8L A;  3BVZ A;  3BVG A;  1AW7 A;  5ELB A;  4UDU C;  1BCP B;  1SE2 A;  1FD7 D;  2CHB D;  1TS3 A;  2AQ3 B;  1D5M C;  1S5B D;  4O1N A;  1JWM D;  3V05 A;  1LTT D;  2XN9 C;  3EA6 A;  1TY0 A;  2SEB D;  4Z9C B;  5I4D A;  4OHJ A;  4RH6 A;  2WV6 D;  1ET9 A;  2NTS A;  3BZD B;  5ELD A;  1SE4 A;  1ENF A;  1PYW D;  1KLU D;  3GP7 A;  1BXT A;  3R8B A;  2RDH A;  2ICI A;  3KLS X;  1LT5 D;  5D3D A; 
#chains in the Genus database with same CATH topology
 2UXC Q;  3N52 A;  3PO3 B;  5M3M H;  3F2D A;  3V2T A;  4O2D A;  1XTC D;  2VB2 X;  5M5Y H;  2B2Y A;  4F88 A;  3I4M G;  2L15 A;  5ISR A;  2N78 A;  1YJN A;  1L1O C;  3C1F A;  5EAY A;  2M00 A;  3P7J A;  4QIW E;  1HNX Q;  3K5L A;  1D5Z C;  2DN8 A;  2MHV A;  1F2Y A;  2ZTE A;  5C4X H;  1Q3L A;  3X3N A;  2OWO A;  4DAY B;  4POF A;  2D5D A;  3PIO 3;  1DYQ A;  4HJ7 A;  4Y7N H;  2Z1C A;  5KNC A;  1O80 A;  1TR5 A;  1Y8O B;  3PUZ A;  4PG3 A;  1Y69 U;  1QB5 D;  4YIJ A;  1FGU A;  4RG1 A;  1YJ9 A;  2Q2U A;  2AUJ D;  3GTK B;  1SNM A;  1PRT F;  3PUX A;  3EBE A;  1V8Q A;  2C35 B;  2MJ8 A;  5EKI A;  3J81 i;  4RCN A;  2Z6K A;  1E0B A;  3RR5 A;  1DD2 A;  1T9H A;  2NVX H;  4RGT A;  2GA4 B;  4JI0 L;  1PMR A;  1EYA A;  3QWN A;  4CJ1 B;  3RZO H;  1CK1 A;  5BR8 Q;  4DPG A;  5C4J H;  1EQQ A;  1DXM A;  4DAM A;  5M5X B;  4FDB A;  3L0O A;  5IT9 E;  5GQO A;  3VR5 A;  1CA6 A;  2PCF B;  4JOI C;  2B63 H;  3QOL A;  3ICE A;  4CKC A;  4JI7 L;  4B3S L;  1R4Q B;  4DK0 A;  2MO0 A;  2B39 A;  5HGQ A;  3T1Y Q;  1BBU A;  5KNB A;  3ERQ A;  1EFI D;  3V96 A;  3TS0 A;  3NK9 A;  1SAP A;  4C3J B;  3CU7 A;  1KQS A;  4BY7 G;  1G2S A;  1A2U A;  1EQV A;  2EZV A;  4A3K G;  3BDO A;  5GAG C;  1XMQ Q;  2XWJ B;  3S1M B;  2NYZ D;  4C2M B;  4K6D A;  2SEB D;  1B8A A;  2KQ3 A;  4B3T Q;  2MP1 A;  2MFI A;  2JP1 A;  2Z4H A;  1TWF H;  1B3Q A;  2B2T A;  5EBD A;  1EIF A;  5K36 H;  1K83 H;  2PI2 E;  3U4V A;  4GKK Q;  1Y1W G;  1AH9 A;  3NBI A;  4XDX A;  1B3A A;  4L5S A;  4DXF A;  3NWS A;  2F0O A;  1HZA A;  2KHI A;  2JK8 A;  4JI8 Q;  4XTC S;  3S1R B;  4HSV A;  2FMM A;  3HOX G;  4DAV A;  2R3Z A;  5M3F G;  4HJ9 A;  4QCL A;  2IT1 A;  2EY1 A;  2F4I A;  3S2D H;  4PMW A;  1YBY A;  3S2H H;  2J7Z A;  4A3B G;  3NTI A;  4ZCK A;  4FP5 D;  1WCM B;  2KJX A;  5JAV A;  3E3X A;  5C44 B;  5LMU Q;  3GTO B;  2CQO A;  2F0K A;  2TSS A;  5C5L A;  1JJG A;  1LUZ A;  2MGS A;  5IYD H;  1IBL Q;  5ELF A;  1MI2 A;  2IX0 A;  5E7N A;  1UNS A;  4BBS H;  3TDQ A;  2ZXO A;  4C56 C;  2B2U A;  2A5H A;  4Q0F A;  1RHP A;  3I4M B;  2LKV A;  3PUY A;  5CC4 A;  1TS5 A;  1UUP A;  2H4O A;  4DGZ A;  3CC4 A;  2R93 H;  4XXE A;  3S17 H;  1A2T A;  1K0R A;  4ILW A;  2XNA C;  3I2Z A;  2A68 D;  2Y0S E;  2R92 H;  3H91 A;  4X62 Q;  1IYJ B;  3GD7 A;  1XXG A;  1EU3 A;  1I94 Q;  1B7Y B;  4H02 A;  3SEB A;  1K0S A;  4JI4 L;  5FK9 C;  1PH3 A;  2R7D A;  1FNV A;  2D2C C;  2L1B A;  3F8T A;  1GUO A;  2OT2 A;  4J15 A;  4V0B A;  4DUY Q;  3GTP B;  1HHV A;  3MHB A;  1CTM A;  1EY6 A;  4LF6 Q;  1VQN A;  3AYH B;  1UAP A;  4UDU C;  2IWH A;  4QF4 A;  3WOF A;  4DV5 Q;  3H0G B;  4WRD A;  3TS2 A;  1IKL A;  3H3V H;  5M3M G;  3RN2 A;  3QB3 A;  1NAP A;  4RH6 A;  4U68 A;  1IKM A;  1QE6 A;  4LFB L;  4LF7 Q;  3RLO A;  3KK7 A;  1GUN A;  1RL2 A;  3T1H L;  1OXX K;  4A4I A;  4NB3 A;  4DN4 M;  4LF9 L;  2VW9 A;  1KTK A;  5D3I B;  5EJW A;  2VNU D;  4N8F A;  3QOJ A;  3J81 j;  1D6E C;  2A6H C;  5C4X G;  2E5L Q;  1GM5 A;  1A3V A;  4TKO B;  3G71 A;  3CP0 A;  5IGC A;  1U0L A;  3A8I E;  2AQ2 B;  4JI1 Q;  3QO2 A;  3K5M A;  4YWM A;  3I7F A;  1WTR A;  1G2T A;  3J81 E;  2I0Q A;  1SBB B;  1SRU A;  2F3I A;  1FGB D;  5HY6 A;  5E3F A;  2K5Q A;  1E22 A;  4IJL A;  1KDA A;  1H9K A;  4RWS C;  1IBM Q;  5JJL A;  1BO0 A;  3PIP A;  3DWP A;  2E2J B;  2NUC A;  4KY6 A;  1AN8 A;  3CXC A;  5LMN W;  1CI3 M;  3MAQ A;  3GDE A;  1SMX A;  2CW0 D;  1Y1W B;  1LTG D;  2EDG A;  2MQH A;  4B3M Q;  2B8F A;  2ZXP A;  5FO8 B;  4I7Z C;  3VR3 A;  1YHA A;  2ES2 A;  3NEM A;  1G6P A;  1DZ1 A;  2B63 G;  3FP9 A;  2VQF L;  3HOX B;  4OEM B;  5M3F B;  3I70 A;  4HIK A;  1H9S A;  1MBY A;  1LT4 D;  1PZJ D;  2I5H A;  2IHF A;  3K58 A;  3CME A;  4A3B B;  3BJU A;  4BA1 I;  2N49 A;  4GNX C;  4R8I A;  1MKH A;  3Q8D A;  3RD4 A;  3J7A V;  4G4K A;  2IL8 A;  2NVQ H;  3TEH B;  1X32 A;  2EYM A;  1N34 L;  5AJ3 L;  3SVM A;  4A3M H;  4LNQ A;  2Q8R E;  4JC0 A;  3DWQ A;  3NEL A;  5IT9 c;  2IX1 A;  1GUT A;  3PF4 A;  4B9X A;  2LMC B;  2A68 C;  2Z4I A;  2J0T D;  1G29 1;  4EGV A;  3BZC A;  3SE0 A;  1ESR A;  2P5Z X;  2RHQ B;  1EY5 A;  2KUM A;  1RJT A;  3PSI A;  4FYD A;  2IHE A;  5CYU A;  3RZD H;  5K36 G;  1PH2 A;  2K75 A;  1CUK A;  4A3G H;  1AP0 A;  2B2Y C;  1YI2 A;  4LF5 Q;  1HRJ A;  2JA8 H;  1IBK L;  5FO9 B;  3KLS A;  2LY7 A;  4MZ9 A;  3O13 A;  1TWH B;  1KC8 C;  1O7L A;  1STH A;  2HUG A;  4X65 Q;  1CKN A;  1I3Q H;  1H9J A;  2XTI A;  4JI7 Q;  1BF4 A;  4B3S Q;  1JOK A;  1R9T B;  1L0X B;  1S5D D;  1F9R A;  3SGI A;  5JPM C;  1M90 C;  4YWK A;  1VQM A;  2F0Q A;  3PIO A;  4OXP A;  1JB3 A;  5AFW A;  5IYD G;  1ASY A;  3CQZ H;  4BBS G;  2UUB Q;  2Z6K C;  1FJG L;  3MC0 B;  1J6Q A;  1A3T A;  3MXG A;  4KK7 A;  4ZKC B;  1S72 A;  4NXN L;  1U4L A;  1PV4 A;  2R93 G;  1X3Q A;  4KHZ A;  1I6V C;  2L9H A;  1CZG A;  1B2T A;  2F3W A;  2K04 A;  5KIX A;  1F9S A;  2WAQ E;  5COR A;  3QG1 A;  4IPC A;  2F0V A;  2I5L X;  5DAU A;  1I4X A;  2R92 G;  4M1U B;  5C5M A;  3GTJ H;  4LMQ D;  1KDC A;  3D6W A;  4Y7N B;  3D31 A;  5KYI A;  3G7L A;  4GOP A;  3G48 A;  2F4V L;  2R7Z H;  3D8G A;  3VYU A;  2UU9 Q;  2CW0 C;  2ZM6 L;  3I90 A;  1BBX C;  1LTB D;  2ID0 A;  1I4Q A;  2UXB L;  3MFG A;  3JC6 6;  1HJP A;  1D1K A;  4A3J H;  3RZO B;  3E6Z X;  3M85 A;  4FF2 A;  1GHJ A;  5FJ8 H;  5IWA L;  1EY0 A;  2BA0 A;  2F0D A;  1XMO L;  4UP7 A;  1GO3 E;  4TQU S;  2PNR C;  1B44 D;  1QUQ B;  4XQQ A;  2CQA A;  2VZA A;  2B63 B;  1WTH A;  2Y0S G;  2PW5 A;  3M4O H;  4IJH A;  1ET6 A;  1C9O A;  1HQM C;  1EOV A;  2V4D A;  4HIO A;  3CPF A;  2B2T C;  1KRT A;  4XT1 B;  3P1H A;  2L12 A;  1ENC A;  1BCP B;  4JI6 Q;  1HUN A;  1JOQ A;  2QF7 A;  1XNQ L;  3I4L A;  4JK1 C;  3VYT A;  4BBR B;  1TWG B;  4KV6 A;  4KN4 C;  4M8A A;  5DEH A;  4CDC C;  2L0C A;  5E1F A;  1DOL A;  2PZW A;  4JPB W;  3R8B A;  3DHQ A;  2E74 C;  2E2I B;  1I4P A;  2OQK A;  2YYZ A;  2LXJ A;  1WJJ A;  1N9W A;  1L1O B;  2ENB A;  3IFD A;  2RCF A;  1X6O A;  2JA7 B;  5IGD A;  3F2U A;  1WYD A;  4JI4 Q;  1EEF D;  1ICW A;  2EJF C;  3P20 A;  2KOL A;  1TWF B;  1SYB A;  2NZ1 D;  5I9O A;  3KJP A;  4KKT A;  3K5N A;  1X9N A;  3MWY W;  1CKO A;  4ZUJ A;  3A5Z B;  2B2U C;  4LW1 A;  2OTL A;  1VQ6 A;  4GKJ L;  1WTV A;  2VUM B;  4X6A H;  4LUV A;  2RHS B;  2KHS A;  2RVL A;  3I8Z A;  3PCO B;  4NDX A;  1O78 A;  4J8Q A;  3UDF A;  1YHB A;  2NN6 H;  1PRT D;  3I91 A;  3J81 c;  3HGB A;  3S16 H;  2SNS A;  2QEJ C;  5C0X H;  1WTQ A;  3JAM L;  3S2D B;  1U9R A;  4LFB Q;  3S2H B;  2K52 A;  2Q2T A;  4IAL A;  4F87 A;  4QGU A;  3LNN A;  3T16 A;  1MJC A;  3K57 A;  2NZO A;  3T1H Q;  2K01 A;  1X3P A;  1MJE A;  4ME5 A;  1JC7 A;  4LF9 Q;  5IP9 H;  4XIG S;  1K3R A;  3RN5 A;  1KHI A;  3MEF A;  4A3M G;  4O0A A;  4BBS B;  1EYD A;  1EIG A;  5I6Y A;  2JXM B;  1MGS A;  4DV4 L;  1LTL A;  3DM3 A;  1L2F A;  4ZUI A;  2F0G A;  3NQT A;  1PVO A;  3I56 A;  4R1J A;  2R93 B;  2HT1 A;  1STN A;  2MO1 A;  3DMU A;  4HTH A;  1VMC A;  2JYO A;  2XSC A;  1HZC A;  2HCI A;  3SR1 A;  1KAW A;  3CCR A;  5KRU A;  1K9M C;  4MIU A;  4HMI A;  3BVM A;  2R92 B;  2XGT A;  4A3G G;  3TBI B;  2BOS A;  1PH1 A;  2OEO A;  3S14 B;  3EIV A;  4FNF A;  1PTO D;  2JA8 G;  5M9O A;  3VYR A;  2DY7 A;  2Q8T A;  2Z8L A;  1HPC A;  3VA5 A;  4DU9 A;  4R4I A;  1VQC A;  2KA7 A;  2XN9 C;  2VQF Q;  4IOC A;  2EY5 A;  2EQS A;  1TWA H;  1PH9 A;  4A3C H;  2UUA L;  4DR7 Q;  1NMG A;  2SOB A;  3NHH A;  5D3D A;  2F1M A;  4DR2 L;  1JWS D;  1OXV A;  3QIA A;  4R4Q A;  2Z6B A;  3FEW X;  2K03 A;  4DR1 L;  1QNK A;  2Y0S B;  3KLR A;  1PH5 A;  3R2T A;  3BDC A;  1N34 Q;  5AJ3 Q;  1JT8 A;  2D0O A;  4POG A;  5E4W C;  5LL6 S;  4GN5 A;  1XPU A;  2JN4 A;  4JCV E;  1B53 A;  2KHJ A;  4KTA A;  1YJW A;  1SXT A;  2F0M A;  5GAE C;  3AFP A;  3UDX A;  1UEB A;  3J7Z C;  1G91 A;  1AEX A;  3TRE A;  3HOW H;  1B4O A;  2N55 A;  1EY4 A;  1FVI A;  4JBM A;  3PMF A;  1Z47 A;  2K28 A;  4QY7 A;  2K32 A;  4L6T B;  1IBK Q;  2R7Z G;  4DK3 C;  4YWL A;  4EQO A;  1VS0 A;  2JJQ A;  1A63 A;  2D62 A;  4KI0 A;  4FVM A;  3URY A;  1UE5 A;  3GTG B;  5JVG 3;  2FIN B;  3KF6 B;  4LUZ A;  4A3J G;  1PRT C;  1Q86 C;  1Q12 A;  4EQN A;  5FJ8 G;  3MXP A;  3SDZ A;  2WAQ G;  1BCP F;  4MNO A;  3HOV H;  3ZYY X;  3K7U C;  1Q90 A;  1NMF A;  5EKK A;  1IYU A;  1JQY D;  4IUV A;  1E7Z A;  1FNU A;  1TWC H;  4CJ0 B;  3I55 A;  1JJ2 A;  3EFX D;  4HJ5 A;  2HDM A;  2KCM A;  4RGN A;  1SJH D;  4IN3 A;  2FHT A;  1VQB A;  4NXN Q;  1QVF A;  2QEX A;  2F0F A;  1RDP D;  2C9O A;  2A1A A;  2NVQ B;  2YV5 A;  3OOC A;  4B3R Q;  2VQE L;  2CH4 W;  2Z0S A;  4A3M B;  1FL0 A;  2YU9 H;  4BXX H;  1FD7 D;  1BUV T;  1IL2 A;  2E8G A;  2AMC B;  4A3F H;  2K6A A;  2NTS A;  4X3K A;  1SE4 A;  2F0S A;  1PA6 A;  2F4V Q;  1UE1 A;  4RMF A;  3M7N A;  1PTO C;  2CWP A;  1LLR D;  5EGT A;  2ZM6 Q;  1RTN A;  4GLV B;  1Y8P B;  3NBH B;  2UXB Q;  2JA8 B;  1JCK B;  1S40 A;  1LYL A;  1JR0 D;  4HIM A;  1L0Y B;  5IWA Q;  5KYL A;  1OTC A;  2ZJP A;  3A0J A;  1LTS D;  1PTO F;  1XMO Q;  2NN6 G;  2B3G A;  1EZ6 A;  3FMC A;  3NSW A;  3R93 A;  3Q0A A;  2V1C C;  3OTO Q;  2EY2 A;  4UP9 A;  5C0X G;  4L63 B;  3UDI A;  1I3Q B;  3KJO A;  1UWV A;  2A74 C;  1M1K C;  2PQE A;  1SNQ A;  2FMC A;  1LAC A;  2FJ2 A;  3F2B A;  1CFM A;  1CHQ D;  5KEE A;  4GOP C;  3FPU B;  3IAY A;  5IP9 G;  1XNQ Q;  1J9O A;  1JE4 A;  3E0J A;  2RSN A;  4CHT B;  1RIP A;  4ZAI A;  4KKS A;  3HG9 A;  4CGY B;  3DEP A;  1SYC A;  3UDG A;  3IFT A;  4IZ8 A;  2WB1 B;  2NZH A;  3I73 A;  4C1N K;  3T13 A;  1LTA D;  4UAI A;  1LT6 D;  2WFW A;  2CH4 A;  3LX0 A;  1V1Q A;  4DV6 L;  3H3V I;  1JIC A;  2KBN A;  1XTD A;  1EQT A;  3GTJ B;  5BN4 A;  1LT3 D;  3KDF B;  4X64 L;  2F0E A;  5IOD A;  1VQL A;  1SR3 A;  2K14 A;  5LHY 1;  2R7Z B;  1X3E A;  2J4X A;  3DLL A;  2M9V A;  1K8M A;  3K59 A;  1XWE A;  4AIM A;  4NKL A;  3J80 L;  3IL8 A;  1ILQ A;  4OON A;  2F0L A;  5EBC A;  4A3C G;  4DV3 L;  4ZRZ A;  2N88 A;  4N9T A;  4A3J B;  2NVT H;  3OHX C;  5IE8 A;  2QW7 A;  3T51 B;  2WAQ B;  2WAC A;  5GAD C;  5LMN L;  1QWY A;  4OWX B;  1WTP A;  1YVC A;  4R4T A;  3ZJY C;  4AQY Q;  3IKJ A;  1NR4 A;  2LXK A;  3SK8 A;  3M4O B;  2ICI A;  3KLS X;  1LT5 D;  1Q1B A;  2ZT9 C;  4OX9 L;  4OEL B;  1TVX A;  3KFU A;  1Y1V H;  4X3U A;  1HFN A;  4JV5 Q;  5HUR A;  2VS1 A;  4ZK9 B;  3C1E A;  2DNE A;  3TP6 A;  1D2B A;  3EQL C;  2XRQ D;  2BA1 A;  1ONL A;  1IHZ A;  3HOW G;  2VXW A;  2NVY H;  2JA9 A;  4DV2 L;  3AMU A;  3N6R A;  2UUC L;  1YNX A;  5L37 A;  4MTN A;  2I5M X;  5IGG A;  4DK1 A;  3JAM i;  5JJZ A;  4XT3 B;  3CCV A;  4DV0 Q;  4V19 0;  1SYE A;  1CT1 D;  1FR3 A;  2ASB A;  1EWI A;  1ZYR D;  4DR3 Q;  3CRL C;  1U5K A;  2JSO A;  4IPD A;  4NPS A;  4GN4 B;  3CCU A;  2DUD A;  5J1Z A;  1QVG A;  1P8L A;  4NP5 A;  3S1Q H;  2UUA Q;  4RAU C;  4LK1 C;  4KKU A;  4BY7 B;  1TKW B;  3J7A 5;  4A3K B;  2JA6 H;  2F0I A;  4HED A;  5EPL A;  3A74 A;  5I6W A;  3HOV G;  2F0H A;  3L7Z C;  3OMC A;  4XYO A;  3NUC A;  5EPJ A;  2M2L A;  5C4Z A;  3S16 B;  2EOT A;  5I2Y A;  1XNR L;  1X54 A;  2LSS A;  1HNW L;  3DEO A;  2F0U A;  3GTM H;  4PMC A;  5JEA H;  3K5O A;  3PQI A;  2N3S A;  3E5S A;  4KN7 C;  3SK5 A;  3RUZ A;  1I4G A;  2OF1 A;  4J6H A;  4DV1 L;  4BXX G;  4YCW A;  3ITP A;  2F0N A;  1QUQ A;  4OWT B;  3MZ5 A;  2RKS A;  4PZ8 A;  4DV7 L;  3E9I A;  4A3F G;  1MSH A;  2Q2I A;  1VF5 C;  2KCC A;  3CF5 A;  3A54 A;  1N8R C;  1YNN D;  3BVG A;  4PQX A;  4BY1 H;  3KBG A;  1SE2 A;  2AQ3 B;  1F9P A;  1JJC B;  3K7A H;  2ZTD A;  3RNU A;  5H1S E;  1PYB A;  4LUO A;  4H0L C;  2AWO A;  1K8O A;  3I4N H;  2K05 A;  5DM6 3;  3BZD B;  3CW2 C;  5BN5 A;  1Q46 A;  1PYW D;  1BXT A;  1O7Y A;  5FLM H;  1JOR A;  2I07 B;  2L4N A;  3GTQ H;  3MXN B;  3NQI A;  1SFO H;  1K73 C;  1P16 A;  2PZT A;  1MSG A;  1PDQ A;  1SND A;  2R7F A;  4LJZ C;  2O5J C;  1L1O A;  1QCB D;  2KCN A;  3NTK A;  4BS9 A;  1U4R A;  1KL9 A;  3DWA A;  1TWA B;  1AZQ A;  5M5X H;  1S5E D;  3D6C A;  3LGJ A;  4RGM A;  1X56 A;  2RBM A;  2PO4 A;  1BVS A;  4TVA B;  3CMA A;  4JI0 Q;  1HA6 A;  3WWV A;  5IGE A;  4P73 A;  3CCJ A;  4WJW A;  5M5W H;  4HAE A;  4L5Q A;  4QUF A;  1Z9F A;  1ZKO A;  2VQE Q;  1HCZ A;  3C2P A;  2OTJ A;  2JEB I;  2A19 A;  1VMP A;  1I5F A;  1J8I A;  1PFS A;  4IUT A;  1BDO A;  4K0K L;  1BR9 A;  1D5X C;  3J7A F;  4BWG B;  3AU7 A;  1ASZ A;  3KF8 B;  4PNY A;  5JVH 3;  1X55 A;  3I3C A;  1WD0 A;  2ZJR A;  2BH2 A;  1SE8 A;  3T56 B;  3PGZ A;  2SNM A;  1H9M A;  3HOW B;  1F2M A;  3D4D A;  3VR6 A;  5EPK A;  3K6O A;  3L9A X;  5M3M B;  1XPR A;  4RCO A;  3S1M H;  5JJI A;  1BOS A;  4IUQ A;  4RFB A;  4DNT B;  1EIY B;  4JOI A;  5M5Y B;  1ZYR C;  2XIW A;  4P75 A;  5CV6 A;  1IYV A;  1QIL A;  2PI2 A;  4NMZ A;  4DKA C;  2PMZ E;  4OIK A;  4IUN A;  3QR8 A;  2B2V A;  1PLF A;  1CM9 A;  4LFC L;  3S15 H;  3CAM A;  1YIJ A;  3E0E A;  3KBX A;  3TME A;  2KVM A;  4PV1 C;  3T53 B;  5C4X B;  1CSP A;  1N32 L;  3S1R H;  1I4H A;  5TSS A;  5GRO A;  3HOV B;  2GVA A;  5ELO A;  2ALY B;  1A0I A;  1DCZ A;  1VQK A;  1TWC B;  2HD3 A;  2F0P A;  4JW0 A;  3KOJ A;  3VR4 A;  3K8A A;  4CKE A;  4G57 A;  4R4C A;  5C44 H;  3CCQ A;  3OPO A;  1Y1V G;  2NVX B;  1LTT D;  1YZ6 A;  1HR0 W;  1G6Z A;  2O4X A;  4JYA L;  2EPB A;  5C4J B;  1EUJ A;  4B08 A;  3G4S A;  2D0P A;  3JAM E;  4L5R C;  4QIW B;  1YNJ D;  2RDH A;  4KJO A;  4C3I H;  1GHK A;  3I4M H;  5CV5 A;  2NN6 I;  4NXM L;  4XYQ A;  3HEJ A;  4MHE A;  1YNN C;  1TXY A;  2YU9 B;  4DR6 L;  1AE2 A;  4DV6 Q;  2EYP A;  1SNP A;  4R4O A;  4GZY C;  5C0X I;  2ICE C;  4A3F B;  4FXD A;  3TP7 A;  1CHP D;  4A76 A;  1OXT A;  5D65 A;  5IOC A;  4CKB A;  4DFA A;  4ID6 A;  3TN2 A;  1LO5 D;  1XMQ L;  1ICF B;  1ESF A;  1HFG A;  4DR5 L;  4K8J A;  3CHB D;  3L3O C;  2LFN A;  4N9P A;  4DXG A;  1XPO A;  4B3T L;  4RHS A;  3D4R A;  2JA6 G;  3MXU A;  2QDL A;  2EXD A;  5D14 A;  4GKK L;  1I6H H;  5K5P A;  1DOK A;  2HIX A;  3HZX A;  5LMN Q;  1B70 B;  3S1N H;  4P74 A;  5JJK A;  3PUW A;  4RA8 A;  3IRB A;  1LTI D;  1PRT B;  2K33 A;  4JI8 L;  4OX9 Q;  4G7H C;  3K81 C;  3H0G H;  1K83 B;  1WVL A;  2I46 A;  4JI3 L;  3PV0 A;  5JEA G;  1D8L A;  1VQD A;  1BCP D;  1F77 A;  1V9P A;  2K7V A;  3KF6 A;  1NY4 A;  1PH4 A;  2EYL A;  4GLA C;  2K50 A;  4EVO A;  3HOU H;  4DAY A;  3CC7 A;  4K6L A;  4KMU C;  1E2Z A;  1CQF A;  1OO9 B;  2K5D A;  2HHH L;  3Q6S A;  3B6Y A;  3J80 i;  4DV2 Q;  1V1P B;  2QDB A;  2CCZ A;  5CV7 A;  4QUC A;  1IBL L;  3HOZ H;  2R6G A;  2OQ0 A;  1ILP A;  2KCT A;  2F0W A;  4BY1 G;  5EQ0 A;  1Q81 C;  3AFQ A;  4PZ6 A;  5C6A A;  1H95 A;  1STE A;  3TZU A;  3FDT A;  4IO9 A;  3I4N G;  3FKI H;  2K5N A;  2CVR A;  1Z6H A;  4HID A;  4IPG A;  4P71 A;  5CV4 A;  4C1N I;  4WOR A;  4YCU A;  1EY8 A;  5FLM G;  5F2D A;  2A69 D;  4KD3 A;  4X62 L;  4JBW A;  1NSN S;  1TY0 A;  1NTG A;  3Q22 A;  4AYB E;  4RKL A;  1XYI A;  1ROD A;  3S17 B;  1ET9 A;  1EL0 A;  1Q8I A;  1MHW C;  5KGU A;  3ULL A;  4K5X A;  2NVT B;  3OIQ A;  5IIF A;  1XNR Q;  4DNR B;  3M7G A;  1PZK D;  4UY8 C;  3ND9 A;  2QA4 A;  1GJX A;  2KEC A;  4LF6 L;  2E2D C;  4GS3 A;  4TSS A;  5C4H A;  5IGF A;  2AUK A;  2EJM A;  4DV5 L;  3NPP A;  4A3L H;  1H9R A;  4K8I A;  1YNJ C;  1Y1V B;  2F52 A;  4DNI A;  3U9O A;  3AB9 A;  4DV7 Q;  1EWC A;  1LTR D;  4GOP B;  4LF7 L;  4DR4 L;  1V1O A;  2AWN A;  4DA2 A;  1RF2 D;  4L5T A;  5FKA C;  3K0X A;  4H44 C;  1JMC A;  4KY5 A;  3A56 A;  2KEE A;  1VQJ A;  2FFK B;  2G9H D;  2NVY B;  1TS4 A;  1WTW A;  1O7Z A;  2PQA B;  2E5L L;  4OO1 H;  1W6K A;  1EU4 A;  1A62 A;  1IXR A;  1SNC A;  4FF4 A;  1C48 A;  4G7O C;  1AFP A;  4TRD A;  2C5C A;  1LV9 A;  2RSO A;  2HIV A;  1HNZ L;  1IZ6 A;  5DNF A;  1SYD A;  3OW2 A;  3LWU A;  1SYG A;  1TWH H;  1FYC A;  4QMG A;  2JA6 B;  1SE3 A;  4IQZ A;  4H7B A;  4RGO S;  1K28 A;  1OXU A;  2PYK A;  1BCP C;  1R9T H;  1VQ9 A;  4QQB X;  5C44 G;  4KHP L;  4JI5 L;  3GTM B;  5JPN C;  1KAA A;  4K0K Q;  1SSO A;  4A3E H;  2K1B A;  4C3I G;  5DM7 3;  4IFD H;  1TU2 B;  3A8K E;  1D5M C;  3ONA B;  4KJN A;  4L8J A;  3EA6 A;  4DUZ L;  5JOB A;  4B9W A;  1EYG A;  2JA5 H;  1I50 H;  2BDO A;  1VQH A;  4IPH A;  4DAP A;  2RQX A;  5E4X A;  4A93 H;  1GUS A;  3GP7 A;  3CC2 A;  1FJG Q;  5DLQ E;  4A3I H;  4BY1 B;  1GOZ A;  1ZEQ X;  2JQO A;  3H09 A;  3K7A B;  4J1M A;  1N33 L;  3H6M A;  1J5E L;  4LFC Q;  2N8N A;  3I4N B;  3AQQ A;  3RLF A;  2A69 C;  5NUC A;  1PZI D;  2ZTC A;  3P75 A;  1SN8 A;  4R8N A;  3JAM c;  4JBK A;  1DGS A;  3M4P A;  3CCE A;  1WOC A;  2IJ0 A;  3KLW A;  1QJO A;  1N32 Q;  4A75 A;  3GTQ B;  5A2Q E;  4IUU A;  1SFO B;  4LF5 L;  1Q1E A;  1UEA B;  4ABN A;  5J39 A;  2PZU A;  4O42 A;  3HRZ C;  1O7I A;  3NTH A;  4CDD C;  1IW7 D;  1STY A;  5ELC A;  2PPB C;  2MPM A;  2L5T A;  1VCI A;  1N36 L;  1AZP A;  3RZD B;  1E3P A;  1HH2 P;  3H0G G;  2R61 A;  3HFZ B;  4A3G B;  1GUW A;  2DNC A;  3KYH C;  4X65 L;  2B2W A;  3BYY B;  3J80 E;  1MIU A;  5COY A;  4QB4 A;  4JYA Q;  1QZH A;  1QVC A;  4LF8 L;  5M5W B;  4I65 A;  3HOU G;  2CFM A;  2B2V C;  1Y8N B;  1KRS A;  2CKZ B;  4HCE A;  2RDG A;  4NXM Q;  1B50 A;  3SK4 A;  1B9N A;  3KUP A;  3BG3 A;  4DR6 Q;  5CBA E;  2F0T A;  1W2B A;  1R4P B;  3OW7 A;  3BU2 A;  4BBR H;  1TWG H;  4X3T A;  5CV9 A;  4KLK A;  3HOZ G;  1X65 A;  2UUB L;  2EYF A;  3PF5 A;  3AEV A;  2QCP X;  2E2I H;  1BNZ A;  2Z9H A;  2A6H D;  3A8J E;  3W1B A;  3FKI G;  4DR5 Q;  2JA7 H;  3UE1 A;  1K3B C;  3CQZ B;  3HOY H;  4FXK C;  4LFA L;  5I2X A;  4GNX B;  1PFB A;  4PMB A;  3MFY A;  3HP3 A;  2DJF C;  3S15 B;  1ENA A;  3GTL H;  4DF7 A;  2VUM H;  3PO2 H;  2X6L A;  2CWA A;  1AW7 A;  1PFN A;  2RCN A;  2UU9 L;  5A2Q L;  1D1I A;  2CHB D;  1STG A;  1WTX A;  1TS3 A;  3H3V C;  4JI3 Q;  4Z9C B;  1JOO A;  5C0X J;  4APV A;  1BKB A;  4A3D H;  4GKJ Q;  1RTO A;  1PYS B;  4OIJ A;  4JI2 L;  1HTP A;  3Q23 A;  5IT9 L;  1EQR A;  2E2H H;  4IUR A;  2SDF A;  3A7L A;  4S3S A;  1PTO H;  2PW7 A;  4GLX A;  2IY5 B;  5I9P A;  3MXN A;  4A3L G;  3F2C A;  1NJI C;  2HHH Q;  3WOE A;  3TSS A;  5ELE A;  4ME3 A;  3D3R A;  3HKZ E;  2PMZ B;  1EWH A;  1DOM A;  1HQR D;  4MTK A;  5IP7 H;  3GO5 A;  4AYB G;  3FVQ A;  1HTL D;  4C3I B;  4JI6 L;  2RDF A;  2BH8 A;  3EVQ A;  1NBW A;  4ZLT F;  5IGB A;  3NXW A;  5T1G A;  1LAB A;  1EIH A;  3CCM A;  2MNA A;  4FF3 A;  2HDL A;  2G5D A;  3M3Y H;  4OO1 G;  2UXD L;  3TP8 A;  1HXY D;  4OWW B;  3VYS A;  4DV4 Q;  2DGY A;  3BYT B;  1TII D;  3I4O A;  3RMH A;  2O2L D;  1VQ8 A;  3S14 H;  1YEZ A;  2A8V A;  4JBJ A;  1S5F D;  1VQF A;  1JB7 A;  1PH7 A;  3STB D;  1ML0 D;  3W2D A;  1KXL A;  3A7A B;  4KD4 A;  3KF8 A;  3U9S A;  1K8G A;  3OIP A;  3ULJ A;  4UPA A;  5FLX E;  5CV8 A;  3X3M A;  1IW7 C;  2XRS D;  3ND8 A;  2K4K A;  2EJG C;  4JG2 A;  4C3H H;  4HR7 B;  1I6H B;  4K5V A;  1QNU A;  2FXQ A;  2X6G A;  1G51 A;  1WD1 A;  1QZG A;  3S1N B;  3BZK A;  1A15 A;  1FNW A;  3OYY A;  3CPW A;  4R9W A;  5C3E H;  1U4M A;  1QG7 A;  1VQI A;  3OSO A;  4HN7 A;  3H94 A;  1A8V A;  4A3E G;  4YHH L;  4AH6 A;  4IUP A;  4DR4 Q;  3K80 C;  4DR2 Q;  2H5X A;  3M4Y A;  4IFD G;  3HOU B;  3LWE A;  1GUG A;  2DJG C;  3HS0 C;  4K5W A;  3C46 A;  3R2I A;  2JA5 G;  4DR1 Q;  2F3V A;  2GN5 A;  1ZXT A;  4A93 G;  4X66 L;  1WFQ A;  3BVZ A;  3HOZ B;  4CDE C;  4WJ3 M;  3PO3 H;  4K2K A;  4A3I G;  2ZJQ A;  2ATW A;  1KAB A;  1D7Q A;  1EOT A;  4NW2 A;  4LF4 L;  3FKI B;  2AKW B;  2JEA I;  4ALP A;  1GVP A;  1HNZ Q;  5EKL A;  4YY3 L;  4E6I A;  5IYC H;  5FOB B;  1KNA A;  3M4Q A;  1VQO A;  2HQE A;  4ULL A;  3DUZ A;  3GTG H;  1WTO A;  3M9B A;  3CCL A;  4EQ5 A;  4K2L A;  1OXS C;  1TT2 A;  5FLX L;  1GXD C;  3I72 A;  4RHR A;  2A6E D;  4IFD J;  4WJ4 A;  1RCV D;  2RA4 A;  2L11 A;  4KHP Q;  4JI5 Q;  3ER0 A;  2F0J A;  2DY8 A;  4FF1 A;  1Y14 B;  3GTK H;  4DR7 L;  1KDB A;  2OCE A;  4I7A A;  4XQN A;  2EYO A;  1STB A;  2D9U A;  1SLJ A;  1XX8 A;  1GD7 A;  1XJV A;  3W1G A;  1TS2 A;  1HZ9 A;  2HCC A;  2F03 A;  4DUZ Q;  4P2C B;  2VB3 X;  4BBR G;  4YCV A;  4WFN 3;  2L55 A;  3L2P A;  2QKI C;  3UI2 A;  4AYB B;  3MEH A;  2IPK D;  1KLG D;  1NE3 A;  5LL6 X;  1M8A A;  3NEN A;  1N33 Q;  2JA7 G;  1VQA A;  3J80 c;  1J5E Q;  1HR0 L;  3HOY G;  3GV3 A;  2BDN A;  2UXC L;  3SHL A;  4RKB A;  1YIT A;  3J81 L;  4CDF C;  3STB C;  5J22 A;  3OWE B;  5HGT A;  1JWU D;  1U4P A;  1SMY D;  4Y52 H;  3TP5 A;  4C3J H;  1CA5 A;  1V1P A;  2NWG A;  2VUM G;  2AQ1 B;  3PO2 G;  3FRP B;  1F9Q A;  1T5X D;  2AHO B;  2NBF A;  1STA A;  2WB1 E;  4C2M H;  1N36 Q;  3T4A C;  1DJR D;  3U4Z A;  1HNX L;  1G8Z D;  3TQY A;  4KY7 A;  3W5O A;  4A3D G;  1RD9 D;  1BBW A;  4LF8 Q;  5ELB A;  1CSQ A;  1W3S A;  2EIF A;  2A73 B;  2Q8I B;  4HJ8 A;  4O1N A;  3V05 A;  5IYB H;  3J7Y W;  1EZ8 A;  3Q24 A;  3U58 A;  3G6J B;  2B8G A;  3D4W A;  2EE1 A;  5ELD A;  1PXU A;  2EXZ A;  5C3X A;  1NUC A;  1KLU D;  2VY3 A;  3W3A A;  4MN3 A;  4A3E B;  5IP7 G;  3VA7 A;  3NP8 A;  1B1Z A;  1VQP A;  1Q7Y C;  2GVB A;  4HCS A;  1SEB D;  4UP8 A;  5FO7 B;  5BR8 L;  1I4R A;  2LS0 1;  3FHW A;  2JA5 B;  1I50 B;  4ZQ3 A;  1PFM A;  3S24 A;  1WCM H;  1X3G A;  2QGQ A;  4B3R L;  4A93 B;  5CGK A;  4KHV A;  1SDF A;  1E2V A;  3GTO H;  4LFA Q;  3PUV A;  3MTS A;  2B2W C;  4A3I B;  1E1O A;  1C7Y A;  1VQ5 A;  2YTY A;  1IL8 A;  1SNO A;  2EY6 A;  2OXP A;  2G9D A;  4LWC A;  2RF4 A;  3T1Y L;  4CBV A;  1YHQ A;  4HJA A;  3HKZ G;  3SXH A;  5C3W A;  4CJ2 C;  3VDY A;  4ZYS A;  3CRK C;  2A6E C;  4X64 Q;  2X69 A;  4C3H G;  1NR2 A;  1HA5 A;  1E2W A;  5CMD A;  4JI2 Q;  2K5V A;  2PQA A;  2KED A;  4X3S A;  2XVS A;  1EEI D;  2BE5 D;  2KEN A;  1H9S B;  2IW3 A;  3UE0 A;  5C3E G;  1W6J A;  2EYH A;  3OTO L;  1NCV A;  1Q82 C;  4DV3 Q;  3WDN A;  1S4Z A;  2Q2H A;  3DXJ C;  4N8X 1;  3RLN A;  3K0Y A;  5FLX c;  4P72 A;  2HQL A;  3GTP H;  1KIX A;  2E76 C;  1CQV A;  5G3L D;  4BA2 I;  4F8M A;  3FPP A;  4FXG C;  1EY9 A;  4ODG A;  1VQ4 A;  2ZXR A;  1HZB A;  3S9W A;  4U67 3;  3F1Z A;  2B29 A;  2E75 C;  5T1I A;  2UXD Q;  4PZ7 A;  3PO3 G;  5CBE E;  3VR2 A;  1PH8 A;  1MD2 D;  3GV6 A;  1EFW A;  2H1E A;  1E1T A;  1A6X A;  2BCO A;  3HOY B;  1JE5 A;  3NE5 B;  1SMY C;  4G7Z C;  5LMU L;  5IYC G;  1DON A;  1JWM D;  5CR3 A;  3TZD A;  2O5I C;  2UUC Q;  3G6E A;  4XQJ A;  1EY7 A;  3OWF A;  5I4D A;  4OHJ A;  3C3L A;  4QJF A;  1HUM A;  3GTL B;  2WIN B;  3PO2 B;  2WKD A;  1II3 A;  3TRZ A;  4BY7 H;  1GKH A;  3U50 C;  4A3K H;  5A35 A;  1A3U A;  3CD6 A;  2K5W A;  4QL5 A;  1CKN B;  3A5U A;  1VDZ A;  2YTV A;  4OO1 I;  1T5E A;  2TMP A;  3ERO A;  2EVB A;  4IOA A;  4A3D B;  4YHH Q;  2E2J H;  1C8C A;  3GQB A;  2E2H B;  3H15 A;  1UE7 A;  1F2Z A;  4DK6 C;  1VQE A;  5JEA J;  1EYC A;  1PTO B;  2WKC A;  1Y1W H;  1S3O A;  1I94 L;  2NTT A;  1RKN A;  3ERS X;  3R3O A;  4AQY L;  3MA2 B;  5KND A;  2MUY A;  4X66 Q;  1HNW Q;  1AE3 A;  3HOX H;  5M3F H;  5BN3 A;  4DUY L;  3BS1 A;  1VQ7 A;  4JV5 L;  3PIP 3;  3NBH A;  1KD1 C;  1QOH A;  3D0F A;  4ZKB B;  3MVV A;  4A3B H;  4LF4 Q;  3NWT A;  1X3F A;  3EJI A;  3M3Y B;  1PH6 A;  2JE6 I;  4Q5V A;  2YTX A;  4DV1 Q;  1TY2 A;  1SRO A;  4K14 A;  4HMJ A;  1WI5 A;  4YY3 Q;  4OL7 A;  5ELN A;  5GAH C;  1CZW A;  3E9H A;  4C3J G;  4FO2 A;  4EQP A;  1M4V A;  5J3B A;  2IX3 A;  2PNH A;  2QIL A;  4DV0 L;  1C0A A;  1UE6 A;  1E24 A;  4IFD I;  1CKM A;  3HKS A;  2VL6 A;  3HKZ B;  1VF7 A;  2WII B;  1V43 A;  4DR3 L;  4OGQ C;  1SJE D;  4UHV A;  1BQQ T;  1L0W A;  1S5C D;  2BE5 C;  4JVZ A;  3BDL A;  4EX5 A;  4C3H B;  1NNX A;  1PHJ A;  4JI1 L;  1LM0 A;  1TQO A;  1C4Q A;  3OMG A;  4HSP A;  3SK6 A;  1K8A C;  3CCS A;  5IYB G;  4LAA A;  3ULP A;  2K5H A;  1Q8K A;  4GNX A;  5C3E B;  2EYJ A;  4GN3 B;  1DM0 B;  1IBM L;  3EN2 A;  3S1Q B;  4F7X A;  3DM1 A;  2WP8 J;  3CKI B;  1S5B D;  4H13 C;  1SYF A;  1B9M A;  3KDF A;  1VQG A;  2WV6 D;  2WB1 G;  1F2L A;  4B3M L;  3A55 A;  5IY0 A;  1ENF A;  2NB0 A;  1HR0 Q;  1Z7T A;  1WCM G;  2XWB B;  1KNE A;  3QJY A;  5G3L F; 
#chains in the Genus database with same CATH homology
 3N52 A;  3PO3 B;  3V2T A;  1XTC D;  2VB2 X;  2B2Y A;  4F88 A;  5ISR A;  3C1F A;  2M00 A;  3P7J A;  3K5L A;  1D5Z C;  2DN8 A;  2MHV A;  1F2Y A;  1Q3L A;  3X3N A;  3PIO 3;  2D5D A;  1DYQ A;  2Z1C A;  5KNC A;  1O80 A;  1TR5 A;  1Y8O B;  3PUZ A;  1Y69 U;  1QB5 D;  4YIJ A;  2AUJ D;  3GTK B;  1SNM A;  1PRT F;  3PUX A;  1V8Q A;  2MJ8 A;  5EKI A;  4RCN A;  1E0B A;  1DD2 A;  4RGT A;  2GA4 B;  1PMR A;  1EYA A;  3QWN A;  4CJ1 B;  1CK1 A;  1DXM A;  5M5X B;  5IT9 E;  3VR5 A;  1CA6 A;  2PCF B;  3QOL A;  4CKC A;  1R4Q B;  4DK0 A;  2B39 A;  5KNB A;  3ERQ A;  1EFI D;  3V96 A;  3NK9 A;  1SAP A;  4C3J B;  3CU7 A;  1G2S A;  1A2U A;  1EQV A;  2EZV A;  3BDO A;  2XWJ B;  3S1M B;  2NYZ D;  4C2M B;  4K6D A;  2SEB D;  2KQ3 A;  2MP1 A;  2JP1 A;  2Z4H A;  2B2T A;  5EBD A;  5K36 H;  3NBI A;  4XDX A;  1B3A A;  4DXF A;  3NWS A;  2F0O A;  4XTC S;  3S1R B;  4HSV A;  2FMM A;  4DAV A;  2R3Z A;  4QCL A;  2IT1 A;  2EY1 A;  2F4I A;  4PMW A;  2J7Z A;  3NTI A;  4FP5 D;  1WCM B;  2KJX A;  5JAV A;  5C44 B;  3GTO B;  2F0K A;  2TSS A;  5C5L A;  2MGS A;  5ELF A;  1MI2 A;  2IX0 A;  1UNS A;  3TDQ A;  2ZXO A;  4C56 C;  2B2U A;  2A5H A;  4Q0F A;  1RHP A;  3I4M B;  2LKV A;  3PUY A;  5CC4 A;  1TS5 A;  1UUP A;  2H4O A;  4DGZ A;  4XXE A;  1A2T A;  4ILW A;  2XNA C;  2A68 D;  3H91 A;  3GD7 A;  1XXG A;  1EU3 A;  3SEB A;  5FK9 C;  1FNV A;  2D2C C;  2L1B A;  1GUO A;  2OT2 A;  4V0B A;  3GTP B;  1HHV A;  3MHB A;  1CTM A;  1EY6 A;  1UAP A;  4UDU C;  2IWH A;  4QF4 A;  3WOF A;  3H0G B;  4WRD A;  1IKL A;  3QB3 A;  1NAP A;  4RH6 A;  4U68 A;  1IKM A;  1QE6 A;  3KK7 A;  1GUN A;  1OXX K;  4DN4 M;  1KTK A;  5D3I B;  5EJW A;  2VNU D;  3QOJ A;  1D6E C;  2A6H C;  1A3V A;  4TKO B;  5IGC A;  3A8I E;  2AQ2 B;  3QO2 A;  3K5M A;  1G2T A;  1WTR A;  3J81 E;  1SBB B;  1FGB D;  5E3F A;  2K5Q A;  1KDA A;  1H9K A;  4RWS C;  1BO0 A;  3DWP A;  2E2J B;  2NUC A;  4KY6 A;  1AN8 A;  1CI3 M;  3MAQ A;  2CW0 D;  1Y1W B;  1LTG D;  2EDG A;  2B8F A;  2ZXP A;  5FO8 B;  4I7Z C;  3VR3 A;  1DZ1 A;  3HOX B;  5M3F B;  3I70 A;  1H9S A;  1MBY A;  1LT4 D;  1PZJ D;  3K58 A;  4A3B B;  4BA1 I;  4R8I A;  3RD4 A;  3J7A V;  4G4K A;  2IL8 A;  1X32 A;  2EYM A;  3SVM A;  2Q8R E;  3DWQ A;  2IX1 A;  1GUT A;  4B9X A;  2LMC B;  2A68 C;  2Z4I A;  2J0T D;  1G29 1;  4EGV A;  3SE0 A;  1ESR A;  1EY5 A;  2KUM A;  1RJT A;  4FYD A;  5CYU A;  5K36 G;  1AP0 A;  2B2Y C;  1HRJ A;  5FO9 B;  3KLS A;  2LY7 A;  3O13 A;  1TWH B;  1O7L A;  1STH A;  2HUG A;  1H9J A;  1BF4 A;  1JOK A;  1R9T B;  1L0X B;  1S5D D;  1F9R A;  5JPM C;  2F0Q A;  1JB3 A;  5AFW A;  3MC0 B;  1A3T A;  3MXG A;  4KK7 A;  4ZKC B;  1U4L A;  1X3Q A;  4KHZ A;  1I6V C;  2L9H A;  1CZG A;  1B2T A;  2F3W A;  2K04 A;  5KIX A;  1F9S A;  5COR A;  3QG1 A;  2F0V A;  5DAU A;  1I4X A;  4M1U B;  5C5M A;  4LMQ D;  1KDC A;  3D6W A;  4Y7N B;  3D31 A;  5KYI A;  3G7L A;  3D8G A;  3VYU A;  2CW0 C;  3I90 A;  1BBX C;  1LTB D;  2ID0 A;  1I4Q A;  3MFG A;  1D1K A;  3RZO B;  3E6Z X;  3M85 A;  4FF2 A;  1GHJ A;  1EY0 A;  2BA0 A;  2F0D A;  4TQU S;  2PNR C;  1B44 D;  4XQQ A;  2CQA A;  2B63 B;  2PW5 A;  1ET6 A;  1HQM C;  2V4D A;  2B2T C;  4XT1 B;  3P1H A;  2L12 A;  1ENC A;  1BCP B;  1HUN A;  1JOQ A;  2QF7 A;  3I4L A;  4JK1 C;  3VYT A;  4BBR B;  1TWG B;  4KV6 A;  4KN4 C;  4M8A A;  5DEH A;  2L0C A;  5E1F A;  1DOL A;  2PZW A;  3R8B A;  3DHQ A;  2E74 C;  2E2I B;  1I4P A;  2YYZ A;  2ENB A;  3IFD A;  2JA7 B;  5IGD A;  3F2U A;  1EEF D;  1ICW A;  2EJF C;  3P20 A;  2KOL A;  1TWF B;  1SYB A;  2NZ1 D;  5I9O A;  4KKT A;  3K5N A;  3MWY W;  4ZUJ A;  2B2U C;  2VUM B;  1WTV A;  2KHS A;  2RVL A;  3I8Z A;  4NDX A;  1O78 A;  4J8Q A;  2NN6 H;  1PRT D;  3I91 A;  3HGB A;  2SNS A;  2QEJ C;  5C0X H;  1WTQ A;  3JAM L;  3S2D B;  1U9R A;  3S2H B;  4IAL A;  4F87 A;  3LNN A;  3T16 A;  3K57 A;  2K01 A;  1X3P A;  4ME5 A;  1JC7 A;  4XIG S;  4BBS B;  1EYD A;  1EIG A;  5I6Y A;  2JXM B;  1MGS A;  4ZUI A;  2F0G A;  3NQT A;  2R93 B;  1STN A;  3DMU A;  4HTH A;  1VMC A;  2JYO A;  2XSC A;  2HCI A;  3SR1 A;  5KRU A;  4MIU A;  4HMI A;  3BVM A;  2R92 B;  3TBI B;  2BOS A;  2OEO A;  3S14 B;  4FNF A;  1PTO D;  5M9O A;  3VYR A;  2DY7 A;  2Q8T A;  2Z8L A;  1HPC A;  3VA5 A;  4DU9 A;  2KA7 A;  2XN9 C;  2EY5 A;  2SOB A;  3NHH A;  5D3D A;  2F1M A;  1JWS D;  1OXV A;  3QIA A;  3FEW X;  2K03 A;  1QNK A;  2Y0S B;  3KLR A;  3R2T A;  3BDC A;  5E4W C;  5LL6 S;  1B53 A;  4KTA A;  1SXT A;  2F0M A;  1G91 A;  1AEX A;  1B4O A;  2N55 A;  1EY4 A;  3PMF A;  1Z47 A;  2K28 A;  2K32 A;  4L6T B;  2D62 A;  4KI0 A;  4FVM A;  3URY A;  3GTG B;  5JVG 3;  2FIN B;  1PRT C;  1Q12 A;  4EQN A;  3MXP A;  3SDZ A;  1BCP F;  3ZYY X;  1Q90 A;  5EKK A;  1IYU A;  1JQY D;  4IUV A;  1FNU A;  4CJ0 B;  3EFX D;  2HDM A;  4RGN A;  1SJH D;  4IN3 A;  2FHT A;  2F0F A;  1RDP D;  2C9O A;  2NVQ B;  3OOC A;  4A3M B;  1FD7 D;  1BUV T;  2K6A A;  2NTS A;  4X3K A;  1SE4 A;  2F0S A;  3M7N A;  1PTO C;  1LLR D;  5EGT A;  1RTN A;  1Y8P B;  2JA8 B;  1JCK B;  1JR0 D;  1L0Y B;  5KYL A;  1LTS D;  1PTO F;  2NN6 G;  1EZ6 A;  3FMC A;  3NSW A;  3R93 A;  3Q0A A;  2EY2 A;  5C0X G;  4L63 B;  1I3Q B;  2A74 C;  2PQE A;  1SNQ A;  2FMC A;  1LAC A;  2FJ2 A;  1CFM A;  1CHQ D;  5KEE A;  3FPU B;  3IAY A;  1J9O A;  1JE4 A;  3E0J A;  2RSN A;  4CHT B;  4ZAI A;  4KKS A;  3HG9 A;  4CGY B;  3DEP A;  1SYC A;  3IFT A;  4IZ8 A;  2WB1 B;  3I73 A;  4C1N K;  3T13 A;  1LTA D;  4UAI A;  1LT6 D;  3LX0 A;  1JIC A;  1EQT A;  3GTJ B;  5BN4 A;  1LT3 D;  2F0E A;  5IOD A;  5LHY 1;  2R7Z B;  2J4X A;  2M9V A;  1K8M A;  3K59 A;  1XWE A;  4NKL A;  3J80 L;  3IL8 A;  1ILQ A;  2F0L A;  5EBC A;  4ZRZ A;  2N88 A;  4N9T A;  4A3J B;  3OHX C;  3T51 B;  2WAQ B;  2WAC A;  1QWY A;  1WTP A;  3IKJ A;  1NR4 A;  3M4O B;  3SK8 A;  2ICI A;  3KLS X;  1Q1B A;  1LT5 D;  2ZT9 C;  1TVX A;  4X3U A;  1HFN A;  5HUR A;  4ZK9 B;  3C1E A;  2DNE A;  3TP6 A;  1D2B A;  3EQL C;  2XRQ D;  2BA1 A;  1ONL A;  1IHZ A;  2VXW A;  3AMU A;  3N6R A;  5IGG A;  4DK1 A;  5JJZ A;  4XT3 B;  4V19 0;  1SYE A;  1CT1 D;  1FR3 A;  1ZYR D;  3CRL C;  2JSO A;  5J1Z A;  4NP5 A;  4RAU C;  4LK1 C;  4KKU A;  4BY7 B;  1TKW B;  4A3K B;  2F0I A;  4HED A;  5EPL A;  5I6W A;  2F0H A;  3L7Z C;  3OMC A;  4XYO A;  5C4Z A;  3NUC A;  2M2L A;  5EPJ A;  3S16 B;  2EOT A;  5I2Y A;  3DEO A;  2F0U A;  4PMC A;  5JEA H;  3K5O A;  3E5S A;  4KN7 C;  3SK5 A;  3RUZ A;  1I4G A;  2OF1 A;  4J6H A;  3ITP A;  2F0N A;  3MZ5 A;  2RKS A;  1MSH A;  1VF5 C;  2KCC A;  3A54 A;  1YNN D;  3BVG A;  4PQX A;  3KBG A;  1SE2 A;  2AQ3 B;  1F9P A;  4H0L C;  2AWO A;  1K8O A;  2K05 A;  5DM6 3;  3BZD B;  5BN5 A;  1PYW D;  1BXT A;  1O7Y A;  1JOR A;  2I07 B;  2L4N A;  3NQI A;  2PZT A;  1MSG A;  1PDQ A;  1SND A;  4LJZ C;  2O5J C;  1QCB D;  2KCN A;  3NTK A;  4BS9 A;  1U4R A;  3DWA A;  1TWA B;  1AZQ A;  1S5E D;  3D6C A;  4RGM A;  2RBM A;  2PO4 A;  1HA6 A;  5IGE A;  4WJW A;  4HAE A;  4QUF A;  1ZKO A;  1HCZ A;  3C2P A;  2JEB I;  1VMP A;  1J8I A;  4IUT A;  1BDO A;  1BR9 A;  1D5X C;  3J7A F;  4BWG B;  3AU7 A;  4PNY A;  5JVH 3;  3I3C A;  1WD0 A;  3T56 B;  2SNM A;  1H9M A;  3HOW B;  1F2M A;  3D4D A;  3VR6 A;  5EPK A;  3K6O A;  3L9A X;  5M3M B;  4RCO A;  1BOS A;  4IUQ A;  4RFB A;  4DNT B;  5M5Y B;  1ZYR C;  2XIW A;  5CV6 A;  1IYV A;  1QIL A;  4NMZ A;  4OIK A;  4IUN A;  2B2V A;  1PLF A;  1CM9 A;  3KBX A;  3TME A;  2KVM A;  4PV1 C;  3T53 B;  5C4X B;  1I4H A;  5TSS A;  3HOV B;  1DCZ A;  1TWC B;  2F0P A;  3VR4 A;  4CKE A;  4G57 A;  3OPO A;  2NVX B;  1LTT D;  1G6Z A;  2O4X A;  2EPB A;  5C4J B;  4B08 A;  3JAM E;  4QIW B;  1YNJ D;  2RDH A;  4KJO A;  1GHK A;  5CV5 A;  2NN6 I;  4XYQ A;  3HEJ A;  4MHE A;  1YNN C;  2YU9 B;  2EYP A;  1SNP A;  4GZY C;  5C0X I;  2ICE C;  4A3F B;  4FXD A;  3TP7 A;  1CHP D;  1OXT A;  5D65 A;  5IOC A;  4CKB A;  4DFA A;  4ID6 A;  3TN2 A;  1LO5 D;  1ESF A;  1HFG A;  4K8J A;  3CHB D;  3L3O C;  2LFN A;  4N9P A;  4DXG A;  4RHS A;  3D4R A;  3MXU A;  5D14 A;  5K5P A;  1DOK A;  3HZX A;  3PUW A;  4RA8 A;  1LTI D;  1PRT B;  2K33 A;  4G7H C;  1K83 B;  1WVL A;  2I46 A;  3PV0 A;  5JEA G;  1BCP D;  1F77 A;  2K7V A;  2EYL A;  4EVO A;  4DAY A;  4K6L A;  4KMU C;  1E2Z A;  1CQF A;  1OO9 B;  2K5D A;  3Q6S A;  1V1P B;  2QDB A;  5CV7 A;  4QUC A;  2R6G A;  1ILP A;  2F0W A;  5EQ0 A;  5C6A A;  1STE A;  3TZU A;  3FDT A;  2CVR A;  1Z6H A;  5CV4 A;  4C1N I;  4WOR A;  1EY8 A;  5F2D A;  2A69 D;  4KD3 A;  4JBW A;  1NSN S;  1TY0 A;  3Q22 A;  4RKL A;  1XYI A;  1ROD A;  3S17 B;  1ET9 A;  1EL0 A;  1Q8I A;  5KGU A;  4K5X A;  2NVT B;  3OIQ A;  5IIF A;  4DNR B;  3M7G A;  1PZK D;  3ND9 A;  1GJX A;  2KEC A;  2E2D C;  4TSS A;  5IGF A;  5C4H A;  2AUK A;  2EJM A;  3NPP A;  1H9R A;  4K8I A;  1YNJ C;  1Y1V B;  3U9O A;  3AB9 A;  1EWC A;  1LTR D;  1V1O A;  2AWN A;  4DA2 A;  1RF2 D;  5FKA C;  4H44 C;  4KY5 A;  3A56 A;  2KEE A;  2FFK B;  2G9H D;  2NVY B;  1TS4 A;  1WTW A;  1O7Z A;  4OO1 H;  1W6K A;  1EU4 A;  1SNC A;  4FF4 A;  1C48 A;  4G7O C;  1AFP A;  4TRD A;  2C5C A;  1LV9 A;  2RSO A;  5DNF A;  1SYD A;  3LWU A;  1SYG A;  1FYC A;  4QMG A;  2JA6 B;  1SE3 A;  4IQZ A;  4H7B A;  4RGO S;  1OXU A;  2PYK A;  1BCP C;  3GTM B;  5JPN C;  1KAA A;  1SSO A;  2K1B A;  4C3I G;  5DM7 3;  4IFD H;  1TU2 B;  3A8K E;  1D5M C;  3ONA B;  4KJN A;  4L8J A;  1KNE A;  3EA6 A;  5JOB A;  4B9W A;  2BDO A;  4DAP A;  2RQX A;  5E4X A;  1GUS A;  3GP7 A;  4BY1 B;  1GOZ A;  1ZEQ X;  3H09 A;  3K7A B;  4J1M A;  3H6M A;  3I4N B;  3RLF A;  2A69 C;  5NUC A;  1PZI D;  3P75 A;  4R8N A;  2IJ0 A;  1QJO A;  3GTQ B;  5A2Q E;  4IUU A;  1SFO B;  1Q1E A;  1UEA B;  4ABN A;  5J39 A;  2PZU A;  4O42 A;  3HRZ C;  3NTH A;  1IW7 D;  1STY A;  5ELC A;  2PPB C;  2MPM A;  2L5T A;  1VCI A;  1AZP A;  3RZD B;  2R61 A;  4A3G B;  1GUW A;  2DNC A;  2B2W A;  3BYY B;  3J80 E;  5COY A;  4QB4 A;  5M5W B;  4I65 A;  2B2V C;  1Y8N B;  4HCE A;  2RDG A;  1B50 A;  3SK4 A;  1B9N A;  3KUP A;  3BG3 A;  5CBA E;  2F0T A;  1R4P B;  3OW7 A;  4X3T A;  5CV9 A;  2EYF A;  2QCP X;  1BNZ A;  2A6H D;  3A8J E;  3CQZ B;  4FXK C;  5I2X A;  1PFB A;  4PMB A;  3MFY A;  3HP3 A;  3S15 B;  1ENA A;  4DF7 A;  2X6L A;  1AW7 A;  1PFN A;  5A2Q L;  1D1I A;  2CHB D;  1STG A;  1WTX A;  1TS3 A;  3H3V C;  4Z9C B;  1JOO A;  5C0X J;  1RTO A;  4OIJ A;  1HTP A;  3Q23 A;  5IT9 L;  4IUR A;  2SDF A;  3A7L A;  4S3S A;  1PTO H;  2PW7 A;  5I9P A;  3MXN A;  3WOE A;  3TSS A;  5ELE A;  3D3R A;  2PMZ B;  1EWH A;  1DOM A;  1HQR D;  3GO5 A;  3FVQ A;  1HTL D;  4C3I B;  2RDF A;  3EVQ A;  4ZLT F;  5IGB A;  3NXW A;  5T1G A;  1LAB A;  1EIH A;  4FF3 A;  2HDL A;  4OO1 G;  3TP8 A;  1HXY D;  3VYS A;  3BYT B;  1TII D;  3RMH A;  2O2L D;  1S5F D;  1ML0 D;  3W2D A;  3A7A B;  4KD4 A;  3KF8 A;  3U9S A;  3OIP A;  5FLX E;  5CV8 A;  3X3M A;  1IW7 C;  2XRS D;  3ND8 A;  2EJG C;  4HR7 B;  1I6H B;  4K5V A;  1QNU A;  2X6G A;  1WD1 A;  3S1N B;  1A15 A;  1FNW A;  4R9W A;  1U4M A;  1QG7 A;  3OSO A;  4HN7 A;  3H94 A;  4IUP A;  3M4Y A;  4IFD G;  3HOU B;  3LWE A;  1GUG A;  3HS0 C;  4K5W A;  3C46 A;  3R2I A;  2F3V A;  1ZXT A;  3BVZ A;  3HOZ B;  4K2K A;  1KAB A;  1EOT A;  4NW2 A;  3FKI B;  2JEA I;  5EKL A;  4E6I A;  5FOB B;  1KNA A;  2HQE A;  4ULL A;  3DUZ A;  1WTO A;  4K2L A;  1OXS C;  1TT2 A;  5FLX L;  1GXD C;  3I72 A;  4RHR A;  2A6E D;  4IFD J;  1RCV D;  2RA4 A;  2L11 A;  2F0J A;  2DY8 A;  4FF1 A;  1KDB A;  4XQN A;  2EYO A;  1STB A;  2D9U A;  1XX8 A;  1TS2 A;  2HCC A;  2F03 A;  4P2C B;  2VB3 X;  4WFN 3;  2L55 A;  2QKI C;  3UI2 A;  4AYB B;  3MEH A;  2IPK D;  1KLG D;  5LL6 X;  1M8A A;  3GV3 A;  2BDN A;  3SHL A;  4RKB A;  3J81 L;  5J22 A;  3OWE B;  5HGT A;  1JWU D;  1U4P A;  1SMY D;  3TP5 A;  1CA5 A;  1V1P A;  2NWG A;  2AQ1 B;  3FRP B;  1F9Q A;  1T5X D;  2NBF A;  1STA A;  3T4A C;  1DJR D;  1G8Z D;  4KY7 A;  1RD9 D;  5ELB A;  2A73 B;  2Q8I B;  4O1N A;  3V05 A;  3J7Y W;  1EZ8 A;  3Q24 A;  3G6J B;  2B8G A;  3D4W A;  2EE1 A;  5ELD A;  1PXU A;  2EXZ A;  5C3X A;  1NUC A;  1KLU D;  3W3A A;  4MN3 A;  4A3E B;  3VA7 A;  3NP8 A;  1B1Z A;  4HCS A;  1SEB D;  5FO7 B;  1I4R A;  2LS0 1;  2JA5 B;  1I50 B;  4ZQ3 A;  1PFM A;  4A93 B;  5CGK A;  4KHV A;  1SDF A;  1E2V A;  3PUV A;  3MTS A;  2B2W C;  4A3I B;  1IL8 A;  1SNO A;  2EY6 A;  2OXP A;  2G9D A;  4CBV A;  3SXH A;  5C3W A;  4CJ2 C;  4ZYS A;  3CRK C;  2A6E C;  2X69 A;  4C3H G;  1NR2 A;  1HA5 A;  1E2W A;  5CMD A;  2KED A;  4X3S A;  2XVS A;  1EEI D;  2BE5 D;  1H9S B;  2IW3 A;  1W6J A;  2EYH A;  1NCV A;  3WDN A;  1S4Z A;  3DXJ C;  3K0Y A;  2E76 C;  1CQV A;  5G3L D;  4BA2 I;  4F8M A;  3FPP A;  4FXG C;  1EY9 A;  4ODG A;  2ZXR A;  3S9W A;  4U67 3;  2E75 C;  5T1I A;  5CBE E;  3VR2 A;  1MD2 D;  3GV6 A;  2H1E A;  1A6X A;  2BCO A;  3HOY B;  3NE5 B;  1SMY C;  4G7Z C;  1DON A;  1JWM D;  5CR3 A;  3TZD A;  2O5I C;  4XQJ A;  1EY7 A;  3OWF A;  5I4D A;  4OHJ A;  3C3L A;  1HUM A;  3GTL B;  2WIN B;  3PO2 B;  2WKD A;  1II3 A;  5A35 A;  1A3U A;  2K5W A;  1VDZ A;  4OO1 I;  1T5E A;  2TMP A;  3ERO A;  2EVB A;  4A3D B;  1C8C A;  3GQB A;  2E2H B;  1F2Z A;  5JEA J;  1EYC A;  1PTO B;  2WKC A;  2NTT A;  1RKN A;  3R3O A;  3MA2 B;  5KND A;  2MUY A;  5BN3 A;  3BS1 A;  3PIP 3;  3NBH A;  1QOH A;  4ZKB B;  3MVV A;  3NWT A;  3EJI A;  3M3Y B;  2JE6 I;  4Q5V A;  1TY2 A;  4K14 A;  4HMJ A;  4OL7 A;  1CZW A;  4C3J G;  4FO2 A;  4EQP A;  1M4V A;  2IX3 A;  2QIL A;  4IFD I;  3HKZ B;  1VF7 A;  2WII B;  1V43 A;  4OGQ C;  1SJE D;  1BQQ T;  1S5C D;  2BE5 C;  3BDL A;  4C3H B;  1TQO A;  1C4Q A;  3OMG A;  4HSP A;  3SK6 A;  4LAA A;  5C3E B;  2EYJ A;  1DM0 B;  3S1Q B;  4F7X A;  3DM1 A;  2WP8 J;  3CKI B;  1S5B D;  4H13 C;  1SYF A;  1B9M A;  2WV6 D;  1F2L A;  3A55 A;  1ENF A;  2NB0 A;  1Z7T A;  2XWB B;  4EQO A;  3QJY A;  5G3L F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...