1EEFD

Heat-labile enterotoxin b-pentamer complexed with bound ligand pepg
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEAT-LABILE ENTEROTOXIN B CHAIN)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eefD00
2O2LD 1FNWA 1JQYD 3BYTB 1GOZA 3DWAA 2G9HD 4BWGB 1AN8A 1SE4A 1JWUD 1SEBD 4K6LA 5ELCA 1D5XC 1EEID 5ELEA 1JR0D 1PTOF 1LT5D 1TY0A 1I4PA 3CHBD 1DJRD 4L6TB 4RGOS 1FNVA 1G8ZD 1ESFA 1BCPC 1CK1A 1TY2A 1I4QA 1EU4A 1SBBB 1PRTF 1B1ZA 2NTTA 2WV6D 2J4XA 2QEJC 1I4HA 1L0YB 1EWCA 1D5ZC 2ICIA 3URYA 1LTBD 1SJHD 1S5ED 1FGBD 2NTSA 3O13A 1TS5A 1RF2D 1PTOC 1UUPA 1FD7D 5ELBA 1BXTA 4O1NA 3BVMA 2XN9C 1STEA 1HA5A 1PRTD 1AW7A 1S5FD 4RCOA 3SEBA 1RD9D 4L63B 1PRTC 3MC0B 1I4RA 2QILA 1HQRD 1CHPD 1B44D 1LTAD 1PZKD 4UDUC 5D3IB 1MD2D 3KLSX 4Z9CB 1JWSD 1PTOH 1RDPD 4RH6A 1KTKA 1V1OA 3BVZA 4ZYSA 1JWMD 1F77A 2CHBD 1KLGD 5I4DA 1BCPB 3EA6A 3R8BA 1TS2A 1LTSD 2XRQD 1LT3D 5FKAC 2IPKD 1LO5D 1M4VA 1D5MC 1PZID 1XTCD 2Z8LA 2RDHA 1LTTD 1LTID 1L0XB 3R2TA 1SE3A 3TSSA 1V1PA 1XXGA 1DYQA 1S5DD 1LTGD 1SXTA 1EEFD 1PTOB 1UNSA 4C56C 5D3DA 1QILA 1CHQD 1LT6D 1RCVD 3W2DA 4RHRA 1S5BD 1I4GA 2SEBD 3OWEB 2AQ1B 3DWQA 1LTRD 1PRTB 2XRSD 2TSSA 4TSSA 1T5XD 3EFXD 1TS3A 1ET6A 1D6EC 1BCPD 1SE2A 2IJ0A 4DXGA 4RGTA 4DXFA 1I4XA 1PYWD 3BZDB 4RGMA 1TS4A 4RGNA 1ET9A 3V05A 1FNUA 1KLUD 1LLRD 3BYYB 1HTLD 2AQ3B 4OHJA 2XNAC 3BVGA 1V1PB 5TSSA 5ELDA 3GP7A 1BCPF 1EU3A 2R61A 1ENFA 2AQ2B 3MFGA 1JCKB 1SJED 1EFID 4RHSA 5ELFA 2RDGA 1HXYD 3DWPA 1PZJD 3R2IA 1PTOD 1CT1D 1CQVA 1S5CD 4RFBA 5FK9C 1LT4D
chains in the Genus database with same CATH superfamily
1JQYD 4JI7Q 3DWAA 4CGYB 4O2DA 3IRBA 2B39A 1JR0D 4IALA 3G6EA 1B3QA 3PGZA 4L5RC 4DV7Q 1Z9FA 3NWSA 1SMXA 5M3MG 3HKZE 3HKZB 1OTCA 1KXLA 4GN5A 1E1TA 4DK6C 2I5HA 1FYCA 2D62A 4JC0A 1SJHD 5IT9E 1FGBD 4XT1B 2F0LA 1EFWA 1PTOC 2EJGC 1DONA 5FO9B 4H7BA 5FLXL 2UUBQ 1MSGA 2XN9C 2B29A 1UE6A 2ATWA 2N78A 2NN6G 3RLOA 4GKJL 4N9PA 4A3DG 2RHQB 3KF6B 4GN3B 3K5NA 4A4IA 3LWEA 3ULPA 4I65A 2WP8J 2K03A 3IAYA 1GHKA 5FLMG 1VQ5A 1ML0D 4LWCA 1C0AA 1TS2A 5D14A 4A3IH 1C9OA 4XT3B 1YNNC 4C3HB 1GJXA 2MHVA 3RLNA 3AEVA 3TSSA 4BY1H 1S72A 2MO0A 1PDQA 1UWVA 1S5DD 1HFNA 4QF4A 5GAHC 4H44C 3A55A 1SYDA 4KHPL 2QDLA 1X3PA 4WORA 2JA8H 3F8TA 4NB3A 2EY1A 2BH2A 2WAQE 2WAQB 4R4OA 4DGZA 3ICEA 1XX8A 5HGTA 1EL0A 1M8AA 1L1OC 3ND9A 3P7JA 1IKLA 4B3SQ 1WCMG 1SYFA 1JB3A 4BBRB 4KMUC 1LLRD 4PMBA 1IBML 1OXSC 4A3GB 5ELDA 3SK8A 1EYGA 1MHWC 2KENA 2UXDQ 3MFGA 3VR5A 2B63B 2F0DA 1CQVA 4RAUC 5IGCA 2AWOA 1G291 4KN4C 3SXHA 1KD1C 2AWNA 2HQEA 3B6YA 4C2MH 4LK1C 3Q0AA 4DR4Q 1G91A 4BWGB 3PIO3 2NVYB 4DPGA 2F0WA 3NBHA 1A15A 4ID6A 1MIUA 3HOXH 2VZAA 2Z4IA 4HIDA 1SYEA 1CKOA 2A68C 3T53B 3A5UA 3H15A 1F9RA 3W5OA 2FXQA 2K32A 2JA9A 2G5DA 4ZAIA 3CP0A 4GS3A 5K36H 3OPOA 5JEAH 4A3MB 1B50A 2MPMA 1UE1A 3ERSX 4GLAC 2JQOA 4LUZA 1B4OA 3RN2A 3M4OH 1EYCA 2F0GA 3URYA 4J1MA 5M3MB 2NTSA 4PV1C 4IUPA 1TWHH 4B3ML 1CUKA 1STEA 1N8RC 4EQNA 4DR6L 2CWPA 1H9MA 4DA2A 1SYBA 5BR8Q 4LF6L 5EKKA 3GTJH 4PMCA 3NQIA 5LMUL 4XQJA 3PIPA 1LTAD 2PNHA 3TZUA 3FMCA 3S1NB 2F0PA 3PSIA 1XMQQ 1KTKA 4X3UA 4A3JH 1KLGD 3J80c 3VA5A 1YNND 2E2HB 2VNUD 1LTSD 5FKAC 4A3DB 2IPKD 1PH6A 4Y7NH 3GTOB 2RDHA 2KCTA 2BA0A 1LTID 5CMDA 2A6HC 4A3BB 5JVG3 4L5QA 3TP7A 1Y69U 2NUCA 1QUQA 5C4XH 2J0TD 1WTOA 4IJLA 4JBMA 5JPMC 3KOJA 2DY8A 2B2TC 2FJ2A 4I7AA 3VR6A 4O0AA 1PHJA 3J7A5 3Q6SA 3CD6A 1PRTB 2ZM6L 4YHHQ 1CKMA 4RA8A 1NMFA 1SE2A 2D0OA 2VB3X 3NENA 4DK0A 2EPBA 4HJAA 1TS4A 4JBWA 3V05A 4N8X1 3V2TA 1TKWB 1RHPA 3JAME 3GTKH 2IX1A 3QG1A 1NUCA 2PQAB 1AFPA 5KYLA 2AQ2B 2RDGA 1PFBA 1I50B 1E2WA 1WCMB 2C9OA 1SLJA 1LT4D 3CAMA 4V190 1GOZA 3MXPA 1A8VA 5ELCA 5EPJA 2JA6B 3S15B 4JI2L 3S2DH 2A68D 1I4PA 2EYFA 3KLSA 1YZ6A 2E74C 1PFSA 3PF5A 1CK1A 3DM3A 3I4LA 4JCVE 2LKVA 1WTHA 4IFDI 3TRZA 1AP0A 2WV6D 2J4XA 3T1YQ 1EQVA 1QVGA 2EIFA 3A5ZB 3H94A 1TWGB 5DM73 1PH9A 2K6AA 1RODA 4X3KA 2R3ZA 4KKTA 5EBDA 2E76C 4KHPQ 3LNNA 4L63B 3R93A 1XPRA 1Q1BA 4IPHA 4MTNA 2JK8A 3HOXG 3H0GH 3T51B 4TKOB 3BU2A 4JI6Q 4JI3Q 1CFMA 1JWMD 5K36G 4LF5L 5JEAG 3PO2B 4BXXG 2F0SA 4G57A 3CCVA 4LFAL 4DR3Q 1GUGA 2IX0A 1IBMQ 2H1EA 2JP1A 3ZYYX 1V1PA 4DF7A 1GUSA 2QDBA 1BR9A 1C8CA 1XTDA 2KA7A 5LMNQ 1VQ9A 2RA4A 4JV5L 5COYA 3AFQA 1RCVD 4A3EH 3IL8A 1VQ7A 1RKNA 1CQFA 5KNCA 4HSPA 1GHJA 3TP8A 2WACA 4JI8L 3CKIB 3F2DA 5M5XB 1EIHA 5C0XI 2DJFC 1PYSB 1ZYRC 5G3LF 2JYOA 4IPGA 4PMWA 4RGNA 4H13C 3FRPB 4X6AH 1L1OA 3MXGA 3ERQA 3Q23A 1BCPF 1TVXA 4HIKA 1SJED 4K6DA 2Q2UA 1HXYD 1KAAA 4OO1I 3K57A 1YITA 1S5CD 1R4PB 4RKBA 4B3MQ 1JJ2A 1D8LA 3CW2C 1DXMA 1AH9A 3C3LA 2LXKA 2RBMA 2NYZD 2RKSA 1WJJA 3CCSA 1EEID 4LF6Q 2L4NA 1B9NA 5IGDA 3I72A 5CR3A 3EQLC 5LMUQ 5IP7G 1EOTA 3S14B 2HCIA 4ABNA 3CRKC 1IXRA 1LUZA 3QWNA 2QEJC 4FVMA 2K7VA 1AEXA 2F4IA 4NDXA 1D5ZC 2ICIA 2Q2HA 4CKCA 4XQNA 1TS5A 3CCUA 1ZKOA 4IUVA 3BS1A 4HMJA 3BVMA 5LL6X 4C3HH 2OEOA 1MI2A 2DNEA 1I3QB 3CF5A 1JICA 4LUVA 4QCLA 5IY0A 1JORA 3I4OA 5C44B 2L15A 3L2PA 1JWSD 3HOUG 2PW7A 4RH6A 2RQXA 4KI0A 1N33L 1ESRA 1VQ8A 3I91A 2PZTA 3EA6A 4B9WA 2WIIB 4KN7C 4J6HA 2R6GA 1LTTD 4QUCA 1VDZA 4JI7L 4Q5VA 2OQKA 4OWTB 1VMCA 4HCSA 1YNJC 5FLXc 5JVH3 3TZDA 3M9BA 1X3QA 2K33A 1VQ4A 1CHQD 4A3GH 1DD2A 5IYBH 3H0GG 4PG3A 4YCUA 1F9QA 4CJ1B 2B63H 2B2TA 1VQEA 4KK7A 1Z7TA 2GVBA 2JSOA 4K14A 1K73C 4F87A 2O5IC 2R93G 1MKHA 3BZDB 2NVYH 1VS0A 4G7ZC 1A2TA 1H9RA 3CCQA 2K14A 3MXUA 4K8JA 3HGBA 1QUQB 5ISRA 2B2WC 3I73A 5J3BA 1EFID 3C2PA 4KTAA 4AH6A 3PUXA 4A3MH 5IT9L 5JJIA 4RFBA 2E5LL 1O7ZA 3PUWA 2O2LD 1ASYA 3QO2A 1HZAA 5HURA 2M9VA 5C4JB 5JPNC 1E3PA 1NMGA 4EGVA 4KKSA 2SNMA 3CHBD 2UXBL 4M1UB 2F0QA 4G7HC 1P8LA 3J81i 1B1ZA 4LF5Q 2QA4A 3SVMA 4LFAQ 1RL2A 2A6ED 2BH8A 3S1NH 1O7IA 2DJGC 3FP9A 4U673 3PO3G 1NY4A 4R1JA 2CFMA 4DAMA 2E2HH 1VQGA 4QB4A 2NN6H 5DEHA 2EYJA 3NBIA 4A3DH 2LSSA 2PCFB 5EKIA 3QB3A 3KJPA 3U4ZA 3GTOH 3GTKB 5J1ZA 4A3BH 1TXYA 1PH8A 1BBWA 4B3SL 4JBJA 1D7QA 1EIGA 4HEDA 3OW2A 5FLMH 1HNZQ 2KCCA 2K5VA 2EYMA 4JI8Q 1RDPD 5FJ8H 4FXGC 4A3LG 4JVZA 2UXDL 1U4LA 3S2DB 3J81c 3A7AB 1WTQA 3OW7A 4K5XA 3MWYW 3H6MA 3C1FA 1ENCA 3K6OA 4DUYQ 4MHEA 1YNJD 4CDDC 4JPBW 3HOUB 3UI2A 2FINB 1NSNS 3VYUA 3NSWA 1PTOB 2VXWA 4C3HG 3BDOA 4LF8Q 3KUPA 1C48A 1QILA 3WDNA 1SE8A 1S5BD 5IGGA 3HRZC 4R4QA 3DUZA 2ZT9C 1J9OA 5G3LD 1I50H 3TP6A 2EXDA 4HSVA 3RZOB 1BCPD 4X3TA 1V9PA 3I4NG 1WFQA 1JJGA 1PYWD 2JA6H 1N36L 4KKUA 2F0NA 2Q8IB 4P75A 4P71A 4OHJA 1V1PB 2EYPA 3CMEA 3KF8A 3HZXA 2EY5A 2M2LA 1KL9A 1D1IA 5JJLA 5BR8L 2R93B 4UHVA 3FKIG 2F0OA 1KDBA 2VUMG 1QVFA 3FPPA 5IYCG 2YTVA 3CCEA 3VYRA 1G6PA 3K81C 4XIGS 1AN8A 4DU9A 5IYBG 1TWGH 1D5XC 2MO1A 2Z0SA 3NWTA 4WJ3M 5CYUA 1TY0A 2Z6KC 2AHOB 2B63G 2QCPX 4IUQA 1EUJA 3KLRA 1M90C 4DKAC 5KRUA 4JYAL 1EU4A 1L1OB 5H1SE 2O4XA 4H0LC 4ZQ3A 3NQTA 1IW7C 1IYUA 1UAPA 3AB9A 4X3SA 1LTBD 1U9RA 2L1BA 4JBKA 1A6XA 3F2UA 5LMNW 1RF2D 2EVBA 4A3MG 3PO2H 3STBC 2PZWA 3S1MH 3E6ZX 1S5FD 1EZ6A 4YHHL 3VYTA 3EVQA 3QOLA 2KUMA 5M5YB 5GAEC 2BCOA 2A73B 1I4RA 5FO8B 1GUNA 2L55A 4KY5A 3PO3B 1F2ZA 1HUMA 4A3CH 3FVQA 4PQXA 4ULLA 3NK9A 3DEOA 3SE0A 1E22A 2MGSA 2PMZE 2PMZB 1F2MA 2CH4A 5I2XA 4NP5A 1XXGA 5M5XH 3JAML 1VF7A 1GUTA 1STYA 2ZTDA 2NVXB 1K8MA 1Q7YC 4X66L 3OHXC 4HJ9A 2E5LQ 5KNDA 4LFBQ 4A3BG 3OWEB 4BS9A 4LNQA 4ZKBB 4K2LA 5E1FA 4DAVA 3H3VC 1LTRD 2BA1A 3M4PA 3T1YL 1GD7A 2TSSA 1IKMA 2UXBQ 1E2VA 1VQDA 3PCOB 4O42A 4PZ7A 4JI5L 5FJ8G 4LFCQ 3DEPA 3G48A 4Q0FA 2OWOA 1QZHA 4CDCC 1RIPA 4F88A 1FNUA 5DLQE 5ELOA 2XNAC 4C1NI 2L9HA 4IOCA 5E7NA 3S14H 2R61A 2DUDA 1B7YB 5C6AA 5DNFA 1DOLA 3R2IA 2EXZA 1TWCB 2ALYB 3WOFA 5CBEE 3I4NB 1NNXA 4TQUS 4HR7B 2B2WA 3OSOA 2IT1A 4HCEA 2PPBC 4JI3L 4JI6L 2Y0SE 2Y0SB 2QGQA 3LWUA 1Y8NB 1A63A 3FKIB 4DR3L 4QIWE 2VUMB 4QIWB 1PFNA 2RHSB 3RD4A 2JA6G 5I9OA 1IW7D 4L8JA 3T4AC 1I3QH 1O7LA 2DNCA 4OEMB 5LMNL 5C44H 3QOJA 3STBD 4NMZA 4JI4L 2NN6I 1T9HA 2R7DA 1STBA 3TQYA 2R92B 1WTVA 3HOWH 4GNXC 1ZEQX 2LXJA 3OOCA 1CZWA 3K5OA 4XXEA 3KJOA 4A3FG 1QE6A 3J80i 2E8GA 4GKKL 1PZKD 2UXCQ 1MD2D 3KLSX 2F0JA 4BXXH 1JOOA 4DFAA 3T56B 2PQEA 3A8KE 1A62A 1X55A 4R8NA 1SAPA 1STNA 3R8BA 1K8OA 1I6VC 4LF9Q 1N36Q 1PZID 5F2DA 1SE3A 3A7LA 2N55A 1Z6HA 3HKSA 1A3TA 3PO2G 2D9UA 3KBXA 1EY6A 1QB5D 1H9SA 2JA7G 3J7AV 4GN4B 3FDTA 1M1KC 1HR0Q 2NVTB 4FXDA 1C4QA 3GTPB 4A3CG 4IN3A 3MXNA 2XIWA 3G7LA 4NXNL 4GOPC 2ES2A 1MJCA 4IFDJ 4HJ8A 4DV1Q 4JYAQ 1ILPA 1YHAA 5C4JH 3I70A 4X64L 3TMEA 4AQYL 3CCJA 4CKBA 3GP7A 1WD0A 3GV6A 2YV5A 3PV0A 2MQHA 3M3YB 3N52A 3VYSA 4DAYA 3I90A 3DWPA 2UUCL 2K5HA 1XNQL 1CT1D 1HJPA 2RVLA 1Y14B 4C56C 5GQOA 4JI1Q 3SK4A 3L9AX 5IP7H 1WD1A 1EQTA 5EGTA 1JE5A 3PUVA 5JJZA 1HZCA 4L6TB 2NVQB 3CPFA 5AJ3Q 4J15A 4R4TA 1IBLL 4YY3Q 3RNUA 1SNMA 2Z6KA 3UDFA 3HOZG 1PRTF 2JA5B 1RJTA 4R4CA 1FJGL 4FF4A 2ZTCA 3KF8B 1O80A 1T5EA 4RKLA 5IE8A 2VB2X 3D0FA 4K0KQ 1TT2A 1UUPA 4A93B 2OQ0A 5KYIA 1Q86C 2IWHA 3UDIA 5IT9c 1HNXQ 1D2BA 3SK5A 2NWGA 4X66Q 2V4DA 4YWMA 5I9PA 3CXCA 2CCZA 4P74A 3HOUH 2ID0A 1JOQA 3S1RB 1QWYA 1BQQT 1ICWA 2WINB 1CHPD 1BNZA 1K0SA 2NZHA 4YIJA 1E24A 1PTOH 5C0XJ 4JI5Q 3S17B 1YI2A 4LW1A 2J7ZA 3MVVA 1SMYC 1ZXTA 2NBFA 2RSOA 4A3FB 3FHWA 5C44G 5EQ0A 4ZUJA 4BA1I 1DOMA 3RZOH 3CCRA 1XNRL 2R7ZB 4X62L 2MUYA 1SXTA 3HOWG 4AYBE 4M8AA 4AYBB 1UNSA 1TIID 5CV5A 5M3FB 1K83B 2EYOA 4AIMA 3NEMA 4FF1A 4OWXB 1P16A 2MP1A 4HAEA 2EZVA 4UPAA 2R93H 2F4VL 5DAUA 4OWWB 3S1MB 1Q46A 4IPDA 4KJOA 2EE1A 1I4XA 2JA7B 1K8GA 2GN5A 1HTPA 4WFN3 1H9JA 3M85A 1VQ6A 3EIVA 4OXPA 5EPLA 1JCKB 2KQ3A 5DM63 4KHZA 4JI4Q 4CBVA 4LF4L 4DNIA 5KGUA 1BVSA 3CCMA 1ICFB 1FNWA 3P1HA 3L3OC 1HNZL 1DCZA 1SE4A 4LJZC 2H5XA 4WJWA 3KK7A 2RF4A 3CMAA 2DGYA 1NR2A 4GKKQ 1SR3A 1HFGA 1LYLA 3JC66 4YCVA 2VQEL 4HJ7A 4UY8C 1Y8OB 3GO5A 4DUYL 2ZTEA 4RMFA 5M5YH 2WKCA 3M4YA 4HN7A 3PO3H 5IGFA 4LF8L 5BN3A 1Q81C 3E3XA 4DN4M 2HD3A 1V1QA 4H02A 2NZOA 1BXTA 3HOZB 3G4SA 2A5HA 1EIFA 1QVCA 5IWAQ 1OO9B 3SDZA 3UDGA 3PF4A 1X3FA 3MC0B 4GNXA 2BE5D 3PMFA 2QILA 3CU7A 1DZ1A 5HY6A 1F2YA 2NVXH 5D3IB 4A3LH 4POFA 3CRLC 4R4IA 5K5PA 2N3SA 4FF3A 1KNEA 1VQPA 1SMYD 4NXNQ 1I94L 1YVCA 3VDYA 1CTMA 2F0FA 2CWAA 4X65Q 3A8JE 4ZCKA 4YCWA 2K5DA 2HIVA 4EVOA 1HPCA 2M00A 1H95A 2A6EC 4X64Q 3SR1A 4AQYQ 3GQBA 4JW0A 2L11A 3OMCA 1FL0A 2CQAA 3M4QA 3HS0C 4ZUIA 3EBEA 1R4QB 3I55A 2UUCQ 1PH3A 1SNDA 1VQHA 1XNQQ 2KJXA 2K05A 3F1ZA 5CV9A 1F9SA 1Q82C 4TRDA 4NXMQ 5AFWA 1C7YA 2EDGA 2I5MX 1DOKA 4BA2I 4B08A 1TWCH 3I4NH 1T5XD 3HOWB 2XVSA 5KEEA 2F52A 4DNTB 5M9OA 3G71A 1J8IA 2K1BA 1EY7A 1IBLQ 1K0RA 1HHVA 2QF7A 3TS0A 1FJGQ 1I6HB 4K5WA 4GOPA 3BVGA 3I8ZA 2VS1A 2VY3A 4IJHA 3WOEA 3FKIH 4FP5D 2WFWA 2VUMH 1AZPA 3TBIB 4RHSA 5IYCH 4DUZL 2L0CA 5CV4A 2F0EA 1H9SB 5T1GA 1SFOH 2B2YC 1NJIC 4FNFA 2E2IB 4ZRZA 2JJQA 3HFZB 1B53A 4DR2Q 2F0KA 1HZBA 2XWBB 5A2QE 3MXNB 3E0JA 2R92H 3UE1A 1ESFA 2N8NA 5JJKA 1BCPC 4DR7L 2A1AA 5GADC 3GDEA 1HCZA 5EJWA 3OTOQ 1STAA 4DAYB 3T1HQ 2FMMA 3SHLA 3HEJA 3CC4A 1R9TB 4LFBL 2EY6A 1DM0B 3AYHB 1WYDA 1CKNA 3OWFA 4O1NA 1XNRQ 2KHIA 4X62Q 2H4OA 1XMOQ 2PYKA 1HR0W 4LFCL 3EROA 3Q22A 1HQRD 1B44D 1MBYA 3SGIA 1X54A 4N8FA 1KQSA 2F4VQ 3P20A 1W6KA 4BY7G 1F2LA 1PYBA 3DM1A 2Z8LA 2NVTH 1CZGA 2FMCA 2WB1G 3QIAA 3GTPH 3NUCA 3OIQA 1U4PA 1CSQA 2CVRA 3PUYA 1Q3LA 1O78A 2L5TA 1JOKA 1EEFD 2CW0D 5LL6S 2HUGA 3K7UC 5C4HA 1CA5A 2KEEA 2OCEA 3VR2A 4LF4Q 1FGUA 1PH1A 2B2UC 1ILQA 3S2HB 2K50A 3GTQB 3J7YW 3M3YH 1LV9A 4ME3A 4PZ8A 1QJOA 4FYDA 4OGQC 2IL8A 1VQJA 3NPPA 3UDXA 3A8IE 3X3MA 2VQEQ 1SRUA 1RTOA 3W3AA 4C3IB 1BOSA 2N88A 3PQIA 3L7ZC 1EQQA 4S3SA 2OF1A 3R3OA 2Q8TA 2HT1A 2NVQH 1EU3A 2A74C 1X56A 2EYLA 1E7ZA 1EY9A 5KIXA 2JA5H 4LF7L 1SYGA 5FK9C 2KCMA 4IOAA 2UXCL 2F1MA 4A75A 3S1QB 1X9NA 1SEBD 4EQPA 4HIMA 3TEHB 1I5FA 2ZJRA 2PO4A 1KIXA 2OTLA 1PTOF 4UP9A 3I4MG 5CV7A 1DJRD 4IUUA 4LF9L 4A93H 1YHBA 4QMGA 2IHFA 1UE7A 3TN2A 1SBBB 1I94Q 2R7FA 1OXTA 2BDNA 2NTTA 2Y0SG 4XTCS 1KC8C 1GM5A 4GZYC 1KRSA 1I4HA 3DMUA 1L0YB 3S1RH 3AMUA 3N6RA 4WRDA 1PH4A 3J7ZC 3S17H 1JC7A 1PA6A 3HOVB 4A3FH 1HR0L 2JE6I 4RCOA 4CDFC 1AW7A 1VMPA 3KDFA 3OYYA 1YEZA 1EY5A 4DV1L 1W6JA 2R7ZH 2R92G 1HQMC 3J80E 4F8MA 2IW3A 1HRJA 1IL2A 5M3FH 1Y8PB 4QY7A 1ENAA 1HZ9A 1II3A 1QCBD 1K83H 5I4DA 5C3EH 3PIOA 3Q8DA 4XQQA 3CQZB 1PH5A 5LHY1 1M4VA 1KNAA 4GLVB 2SOBA 2JEAI 3BDCA 4B3TL 4A3KB 2CH4W 1L0XB 3CC7A 5I2YA 3OIPA 4ALPA 4MTKA 3BZKA 3K8AA 4JI1L 1TWFB 2F3IA 5GAGC 4G7OC 4DUZQ 1N34Q 2JA7H 1VQBA 2KECA 1J5EL 4BY7B 1TWAB 3E5SA 1Y1VG 1KDCA 1SNPA 2QW7A 3W2DA 5AJ3L 4GNXB 5IYDG 2WB1E 4RHRA 2WB1B 1TR5A 4FO2A 1L2FA 3K7AB 4YY3L 1PLFA 4ME5A 5EAYA 2KEDA 1JE4A 4POGA 3EFXD 2B8GA 2EJFC 2IJ0A 4DR7Q 4RCNA 1YHQA 1SN8A 1A2UA 4K0KL 4NW2A 1VF5C 2KCNA 2Z6BA 4DV5Q 5TSSA 4QUFA 1HNXL 4ZK9B 4JG2A 5BN5A 5ELFA 4IFDH 3ZJYC 2KVMA 4LUOA 1QZGA 3D4DA 1B2TA 1PVOA 4DK3C 2EYHA 3NTHA 4IPCA 4I7ZC 4QL5A 1JWUD 1F9PA 2OT2A 3I2ZA 4K6LA 1STGA 2F03A 5ELEA 3K5MA 1V43A 1LT5D 2BDOA 1U4MA 2B2YA 1BBUA 1K3BC 4Y52H 1SDFA 3OMGA 3HOZH 1G8ZD 1VQOA 3A0JA 4ILWA 2ICEC 1TY2A 1EWHA 4GOPB 4L5TA 1VQIA 2EJMA 2CQOA 1X3GA 2HHHL 3I56A 3H09A 3I4MB 2Q8RE 4B3RL 3AFPA 2E2JB 1PXUA 1S5ED 2UUAL 4CHTB 3MEHA 3S16B 2ENBA 2JA5G 1FD7D 4DR1Q 3NHHA 1EYAA 1YIJA 4MIUA 1GUWA 3MTSA 1DGSA 2A69C 1KRTA 3SEBA 1J6QA 3S9WA 1L0WA 1SNCA 4P73A 2IY5B 4A93G 1GKHA 3S24A 2PW5A 1Y1WG 1SFOB 1F77A 2CHBD 1LTLA 4KJNA 2E2DC 3RZDB 1K8AC 2X69A 1S40A 4L5SA 4OELB 1CKNB 5C0XH 1N32Q 4MNOA 4N9TA 1LTGD 2TMPA 1G2SA 3MFYA 1Q12A 2EOTA 4LF7Q 4UP7A 1I6HH 2VQFL 4C3JB 2O5JC 4JI0Q 2AQ1B 4IUTA 2R7ZG 4OO1H 2CKZB 1STHA 2B2VC 2HCCA 3DWQA 5I6YA 1LABA 1PV4A 1X65A 2AUKA 4RG1A 1YJNA 4AYBG 4OIJA 3MAQA 5FOBB 4DV6Q 1EIYB 2B2UA 5M3FG 5EKLA 1YJ9A 1UEAB 3DXJC 1D6EC 1PFMA 2RCFA 4P2CB 3G6JB 1Y1VB 4DXFA 5C3EG 1O7YA 2E2IH 1G2TA 3U9SA 2YTYA 1KLUD 4ZKCB 1B9MA 4RWSC 4K2KA 3J81L 5C3XA 5IWAL 3GD7A 1KAWA 1E0BA 4ODGA 1X32A 2F0HA 1PTOD 4BBSG 1SNOA 2SDFA 5EPKA 1KABA 2YU9B 4KHVA 3HOYG 1IYVA 4DR5Q 1R9TH 1UEBA 4X65L 3D31A 1PH2A 1X3EA 2NB0A 1G51A 1I4QA 1GUOA 4DV3L 1E1OA 1PMRA 2KBNA 3BG3A 1ONLA 3F2CA 1W2BA 5CV6A 1U0LA 4KD3A 4IZ8A 4B3TQ 3V96A 1EY4A 2MNAA 4IFDG 1CSPA 1TU2B 4TVAB 3D6CA 4NXML 3D4WA 2Q2IA 1N9WA 3A74A 4JK1C 3HG9A 4DV0Q 1SROA 1SSOA 2PI2E 2A69D 2RDFA 4LAAA 1WVLA 2ZJQA 1J5EQ 1HA5A 3U4VA 3IFDA 1CA6A 5JOBA 1EY0A 1NBWA 4DV4Q 1BBXC 3ND8A 4XYOA 1EOVA 4XYQA 4QQBX 1K3RA 2LS01 5IGBA 4KV6A 4K5VA 3K59A 3S2HH 2EY2A 3GTQH 1B8AA 1D5MC 4OX9L 5JAVA 3GTMB 1FR3A 1IL8A 1LM0A 3R2TA 4A3IG 5FLXE 3AU7A 2WKDA 4KLKA 1Y1WB 4MN3A 4C3IH 4DR2L 1NTGA 4BY1G 5IIFA 1BUVT 3KDFB 4E6IA 1VQKA 4R8IA 1UE5A 2F0VA 2KHJA 2MJ8A 5D3DA 2BE5C 2AMCB 3SK6A 2JA8G 2XRSD 5FO7B 3OTOL 5A2QL 2E75C 3GTLB 1ET6A 4GKJQ 3FPUB 1B70B 1IZ6A 1EQRA 3T1HL 3S1QH 4NKLA 1QNUA 5M5WB 1Q1EA 1HNWL 1VQMA 2AQ3B 2I07B 2HHHQ 4IURA 2UU9L 2A8VA 4EQOA 4OIKA 2HDLA 5C0XG 4QJFA 3H3VH 5CC4A 1AE3A 2K4KA 5D65A 3P75A 1IBKL 4B3RQ 4R9WA 1XMOL 2UUAQ 3D8GA 5C3EB 1GXDC 2GVAA 2F3VA 1KDAA 1EYDA 2KOLA 2L12A 2VW9A 1S4ZA 4OO1G 5JEAJ 2ZXOA 2C35B 2KHSA 1Q8KA 1XYIA 4RGOS 1FNVA 1Q90A 4JOIC 1KHIA 3HOVH 4BBSB 3K0XA 3W1GA 3E9IA 5J22A 3HOYB 3GTGB 1EZ8A 2HDMA 1BO0A 2F0IA 3PIP3 1FVIA 3I3CA 3TDQA 4KY6A 5IP9H 3CCLA 3BZCA 1HH2P 2SNSA 2XSCA 1CI3M 4DNRB 1XWEA 2RCNA 2A6HD 3HP3A 2K75A 2Z9HA 2HIXA 3KBGA 3CQZH 3IFTA 3K5LA 2B3GA 3NELA 3J7AF 2G9DA 2VQFQ 4DK1A 4A3KH 1XPUA 3TS2A 1PRTC 5J39A 2X6GA 3ULLA 1WTWA 3MHBA 1IHZA 1TWFH 1JB7A 4BY7H 3J81E 1TWAH 4ZYSA 4EX5A 3D6WA 2BOSA 2LY7A 1BCPB 2XWJB 2A19A 2XRQD 3K7AH 4A3JG 4CJ0B 1TQOA 1ASZA 2RSNA 1VQLA 3A54A 3EJIA 1A3UA 4K8IA 1W3SA 1NAPA 3AQQA 5I6WA 4UAIA 3CC2A 4YWLA 1LT6D 5GROA 3T16A 5C4XG 1HUNA 2JEBI 1U5KA 4A3IB 2NZ1D 4DR6Q 5E4XA 3M7NA 4ZLTF 4BY1B 3MEFA 1SYCA 2ZXRA 2OXPA 1U4RA 2MFIA 2B2VA 5ELNA 4DV3Q 1QOHA 4RGMA 2P5ZX 2ASBA 4U68A 3JAMi 3D3RA 1WTPA 1HTLD 3IKJA 4HTHA 4YWKA 5BN4A 2K52A 3RN5A 2JA8B 4IQZA 1ENFA 3TREA 2F0MA 3DHQA 1LACA 4C3IG 2CW0C 1VQFA 2K28A 5T1IA 2QEXA 1NCVA 1WOCA 3LGJA 1CM9A 2G9HD 3I4MH 1BKBA 2E2JH 2I0QA 3MA2B 1BDOA 3S16H 3WWVA 2I46A 3NBHB 2D2CC 3KF6A 5L37A 4DV2L 2JXMB 4FXKC 1H9KA 4OONA 1V8QA 1X6OA 4MZ9A 3NTKA 4G4KA 3J80L 2QKIC 3RUZA 2YYZA 2PNRC 4C1NK 1MGSA 2K01A 5IGEA 5CV8A 4DAPA 2ZM6Q 3U50C 3JAMc 4C2MB 1N34L 1AZQA 2C5CA 4HJ5A 4OX9Q 1SNQA 3J81j 3NE5B 1VQCA 3KLWA 5C5LA 3HOXB 5ELBA 1B3AA 1A0IA 5HGQA 1VCIA 3RLFA 3RR5A 3RZDH 3T13A 1PRTD 2V1CC 2K5QA 3M7GA 1MJEA 3H91A 1OXXK 2LMCB 1WTRA 4BBRH 2ZJPA 3LX0A 2ZXPA 4DV7L 1GO3E 4WJ4A 2K04A 1QG7A 4PZ6A 1QNKA 3HOVG 3M4OB 1EWIA 1OXVA 2GA4B 3GV3A 2D5DA 4Z9CB 4OL7A 1V1OA 4DV5L 4JI2Q 4C3JH 2B8FA 1TWHB 2HQLA 2DY7A 1ZYRD 4B9XA 3BJUA 3QR8A 4HMIA 4NPSA 1LT3D 1LO5D 2VL6A 3MZ5A 4IO9A 5IP9G 1HNWQ 1IYJB 2F3WA 1XPOA 1PH7A 2UU9Q 3GTJB 3A56A 5CORA 3X3NA 3ULJA 1IBKQ 2UUBL 1Y1VH 3RMHA 5IYDH 3K0YA 2Z4HA 2AUJD 5NUCA 3ONAB 4A3JB 4GLXA 4A3KG 1MSHA 3E0EA 2SEBD 1I4GA 4CKEA 4Y7NB 3I7FA 4QGUA 4A3EG 3CPWA 3ER0A 3E9HA 2Q2TA 3VR4A 3C46A 2AKWB 5M3MH 2YU9H 4DXGA 1K9MC 2DN8A 4LMQD 5C4XB 1ET9A 3H3VI 3BYYB 3VR3A 2K5WA 4DR1L 3NP8A 2F0TA 4KD4A 4CJ2C 3L0OA 1PZJD 1WI5A 3VA7A 3HKZG 4PNYA 3BYTB 5KNBA 3F2BA 2OTJA 3U9OA 4A76A 4HIOA 2EQSA 4KY7A 5A35A 4JV5Q 1JJCB 3BDLA 4FDBA 3K80C 5IODA 1G6ZA 1Z47A 3D4RA 5E4WC 1NR4A 1BF4A 1N32L 1E2ZA 4JOIA 1A3VA 3Q24A 1EWCA 1GVPA 2YTXA 2F0UA 2X6LA 2JN4A 3O13A 4JI0L 5C5MA 2PI2A 4F7XA 2FFKB 2N49A 5CGKA 4DR4L 3EN2A 2FHTA 3K58A 4DV6L 3GTMH 1JT8A 1VQAA 1RD9D 3ITPA 1OXUA 3UE0A 1Y1WH 4XDXA 4J8QA 4UDUC 2IHEA 1YNXA 1NE3A 3BVZA 1RTNA 2I5LX 5EBCA 2K5NA 1WCMH 3DLLA 4CDEC 5E3FA 4V0BA 1XTCD 3KYHC 3QJYA 3S15H 2WAQG 1JMCA 3GTLH 3H0GB 1DYQA 2PQAA 4DR5L 2XTIA 3C1EA 4EQ5A 4UP8A 1EY8A 5M5WH 1AE2A 1D1KA 5C3WA 4BBRG 3U58A 4APVA 4A3GG 2LFNA 1Q8IA 2XGTA 4IUNA 5C4ZA 1XMQL 4TSSA 2D0PA 3NXWA 5CBAE 1TS3A 4DV2Q 4C3JG 1YBYA 4RGTA 1S3OA 1XJVA 3KFUA 3TP5A 2PZUA 4DV0L 1YJWA 4A3EB 1K28A 1HA6A 1N33Q 1VQNA 4FF2A 4BBSH 3PUZA 3NTIA 4P72A 4DV4L 3GTGH 3HOYH 2IX3A 3W1BA 1WTXA 2Z1CA 3FEWX 5IOCA
chains in the Genus database with same CATH topology
1JQYD 3DWAA 4CGYB 2B39A 1JR0D 4IALA 3NWSA 3HKZB 1FYCA 2D62A 1SJHD 5IT9E 1FGBD 4XT1B 2F0LA 1PTOC 2EJGC 1DONA 5FO9B 4H7BA 5FLXL 1MSGA 2XN9C 2NN6G 4N9PA 3K5NA 3LWEA 4I65A 2WP8J 2K03A 3IAYA 1GHKA 1ML0D 1TS2A 5D14A 4XT3B 1YNNC 4C3HB 1GJXA 2MHVA 3TSSA 1PDQA 1S5DD 1HFNA 4QF4A 4H44C 3A55A 1SYDA 1X3PA 4WORA 2EY1A 2WAQB 4DGZA 1XX8A 5HGTA 1EL0A 1M8AA 3ND9A 3P7JA 1IKLA 1SYFA 1JB3A 4BBRB 4KMUC 1LLRD 4PMBA 1OXSC 4A3GB 5ELDA 3SK8A 3MFGA 3VR5A 2B63B 2F0DA 1CQVA 4RAUC 5IGCA 2AWOA 1G291 4KN4C 3SXHA 2AWNA 2HQEA 1G91A 4LK1C 3Q0AA 4BWGB 3PIO3 2NVYB 2F0WA 3NBHA 1A15A 4ID6A 2Z4IA 1SYEA 2A68C 3T53B 1F9RA 2K32A 4ZAIA 5K36H 3OPOA 5JEAH 4A3MB 1B50A 2MPMA 1B4OA 1EYCA 2F0GA 3URYA 4J1MA 5M3MB 2NTSA 4PV1C 4IUPA 1STEA 4EQNA 1H9MA 4DA2A 1SYBA 5EKKA 4PMCA 3NQIA 4XQJA 1LTAD 3TZUA 3FMCA 3S1NB 2F0PA 1KTKA 4X3UA 1KLGD 3VA5A 1YNND 2E2HB 2VNUD 1LTSD 5FKAC 4A3DB 2IPKD 3GTOB 2RDHA 2BA0A 1LTID 5CMDA 2A6HC 4A3BB 5JVG3 3TP7A 1Y69U 2NUCA 2J0TD 1WTOA 5JPMC 2DY8A 2B2TC 2FJ2A 3VR6A 3Q6SA 1PRTB 4RA8A 1SE2A 2VB3X 4DK0A 2EPBA 1TS4A 4JBWA 3V05A 3V2TA 1TKWB 1RHPA 3JAME 2IX1A 3QG1A 1NUCA 1AFPA 5KYLA 2AQ2B 2RDGA 1PFBA 1I50B 1E2WA 1WCMB 2C9OA 1LT4D 4V190 1GOZA 3MXPA 5ELCA 5EPJA 2JA6B 3S15B 2A68D 1I4PA 2EYFA 3KLSA 2E74C 1CK1A 3I4LA 2LKVA 4IFDI 1AP0A 2WV6D 2J4XA 1EQVA 3H94A 1TWGB 5DM73 2K6AA 1RODA 4X3KA 2R3ZA 4KKTA 5EBDA 2E76C 3LNNA 4L63B 3R93A 1Q1BA 3T51B 4TKOB 1CFMA 1JWMD 5K36G 5JEAG 3PO2B 2F0SA 4G57A 1GUGA 2IX0A 2H1EA 2JP1A 3ZYYX 1V1PA 4DF7A 1GUSA 2QDBA 1BR9A 1C8CA 2KA7A 2RA4A 5COYA 1RCVD 3IL8A 1RKNA 1CQFA 5KNCA 4HSPA 1GHJA 3TP8A 2WACA 3CKIB 5M5XB 1EIHA 5C0XI 1ZYRC 5G3LF 2JYOA 4PMWA 4RGNA 4H13C 3FRPB 3MXGA 3ERQA 3Q23A 1BCPF 1TVXA 1SJED 4K6DA 1HXYD 1KAAA 4OO1I 3K57A 1S5CD 1R4PB 4RKBA 1DXMA 3C3LA 2RBMA 2NYZD 2RKSA 1EEID 2L4NA 1B9NA 5IGDA 3I72A 5CR3A 3EQLC 1EOTA 3S14B 2HCIA 4ABNA 3CRKC 3QWNA 2QEJC 4FVMA 2K7VA 1AEXA 2F4IA 4NDXA 1D5ZC 2ICIA 4CKCA 4XQNA 1TS5A 1ZKOA 4IUVA 3BS1A 4HMJA 3BVMA 5LL6X 2OEOA 1MI2A 2DNEA 1I3QB 4QCLA 1JICA 1JORA 5C44B 1JWSD 2PW7A 4RH6A 2RQXA 4KI0A 1ESRA 3I91A 2PZTA 3EA6A 4B9WA 2WIIB 4KN7C 4J6HA 2R6GA 1LTTD 4QUCA 1VDZA 4Q5VA 1VMCA 4HCSA 1YNJC 5JVH3 3TZDA 1X3QA 2K33A 1CHQD 1DD2A 1F9QA 4CJ1B 2B2TA 4KK7A 1Z7TA 4K14A 2JSOA 4F87A 2O5IC 3BZDB 4G7ZC 1A2TA 1H9RA 3MXUA 4K8JA 3HGBA 5ISRA 2B2WC 3I73A 1EFID 3C2PA 4KTAA 3PUXA 5IT9L 4RFBA 1O7ZA 3PUWA 2O2LD 3QO2A 5HURA 2M9VA 5C4JB 5JPNC 4EGVA 4KKSA 2SNMA 3CHBD 4M1UB 2F0QA 4G7HC 1B1ZA 3SVMA 2A6ED 4U673 4QB4A 2NN6H 5DEHA 2EYJA 3NBIA 2PCFB 5EKIA 3QB3A 3GTKB 5J1ZA 1EIGA 4HEDA 2KCCA 2EYMA 1RDPD 4FXGC 1U4LA 3S2DB 3A7AB 1WTQA 3OW7A 4K5XA 3MWYW 3H6MA 3C1FA 1ENCA 3K6OA 4MHEA 1YNJD 3HOUB 3UI2A 2FINB 1NSNS 3VYUA 3NSWA 1PTOB 2VXWA 4C3HG 3BDOA 3KUPA 1C48A 1QILA 3WDNA 5IGGA 1S5BD 3HRZC 3DUZA 2ZT9C 1J9OA 5G3LD 3TP6A 4HSVA 3RZOB 1BCPD 4X3TA 1PYWD 4KKUA 2F0NA 2Q8IB 4OHJA 1V1PB 2EYPA 3KF8A 3HZXA 2EY5A 2M2LA 1D1IA 2R93B 2F0OA 1KDBA 3FPPA 3VYRA 4XIGS 1AN8A 4DU9A 1D5XC 3NWTA 5CYUA 1TY0A 2QCPX 4IUQA 3KLRA 5KRUA 1EU4A 2O4XA 4H0LC 4ZQ3A 3NQTA 1IW7C 1IYUA 1UAPA 3AB9A 4X3SA 1LTBD 1U9RA 2L1BA 1A6XA 3F2UA 1RF2D 2EVBA 2PZWA 3E6ZX 1S5FD 1EZ6A 3VYTA 3EVQA 3QOLA 2KUMA 5M5YB 2BCOA 2A73B 1I4RA 5FO8B 1GUNA 2L55A 4KY5A 3PO3B 1F2ZA 1HUMA 3FVQA 4PQXA 4ULLA 3NK9A 3DEOA 3SE0A 2MGSA 2PMZB 1F2MA 5I2XA 4NP5A 1XXGA 3JAML 1VF7A 1GUTA 1STYA 2NVXB 1K8MA 3OHXC 5KNDA 3OWEB 4BS9A 4ZKBB 4K2LA 5E1FA 4DAVA 3H3VC 1LTRD 2BA1A 2TSSA 1IKMA 1E2VA 4O42A 3DEPA 4Q0FA 4F88A 1FNUA 2XNAC 4C1NI 2L9HA 2R61A 5C6AA 5DNFA 1DOLA 3R2IA 2EXZA 1TWCB 3WOFA 5CBEE 3I4NB 4TQUS 4HR7B 2B2WA 3OSOA 2IT1A 4HCEA 2PPBC 2Y0SB 3LWUA 1Y8NB 3FKIB 2VUMB 4QIWB 1PFNA 3RD4A 5I9OA 1IW7D 4L8JA 3T4AC 1O7LA 2DNCA 3QOJA 4NMZA 2NN6I 1STBA 2R92B 1WTVA 1ZEQX 3OOCA 1CZWA 3K5OA 4XXEA 1QE6A 1PZKD 1MD2D 3KLSX 2F0JA 1JOOA 4DFAA 3T56B 2PQEA 3A8KE 4R8NA 1SAPA 1STNA 3R8BA 1K8OA 1I6VC 1PZID 5F2DA 1SE3A 3A7LA 2N55A 1Z6HA 1A3TA 2D9UA 3KBXA 1EY6A 1QB5D 1H9SA 3J7AV 3FDTA 2NVTB 4FXDA 1C4QA 3GTPB 4IN3A 3MXNA 2XIWA 3G7LA 4IFDJ 1ILPA 3I70A 3TMEA 4CKBA 3GP7A 1WD0A 3GV6A 3PV0A 3M3YB 3N52A 3VYSA 4DAYA 3I90A 3DWPA 1CT1D 2RVLA 4C56C 3SK4A 3L9AX 1WD1A 1EQTA 5EGTA 3PUVA 5JJZA 4L6TB 2NVQB 1SNMA 1PRTF 2JA5B 1RJTA 4FF4A 1O80A 1T5EA 4RKLA 2VB2X 1TT2A 1UUPA 4A93B 5KYIA 2IWHA 1D2BA 3SK5A 2NWGA 2V4DA 5I9PA 2ID0A 1JOQA 3S1RB 1QWYA 1BQQT 1ICWA 2WINB 1CHPD 1BNZA 4YIJA 1PTOH 5C0XJ 3S17B 2J7ZA 3MVVA 1SMYC 1ZXTA 2NBFA 2RSOA 4A3FB 5EQ0A 4ZUJA 4BA1I 1DOMA 2R7ZB 2MUYA 1SXTA 4M8AA 4AYBB 1UNSA 1TIID 5CV5A 5M3FB 1K83B 2EYOA 4FF1A 2MP1A 4HAEA 2EZVA 5DAUA 3S1MB 4KJOA 2EE1A 1I4XA 2JA7B 1HTPA 4WFN3 1H9JA 3M85A 5EPLA 1JCKB 2KQ3A 5DM63 4KHZA 4CBVA 5KGUA 3P1HA 1FNWA 3L3OC 1DCZA 1SE4A 4LJZC 4WJWA 3KK7A 1NR2A 1HFGA 1Y8OB 3GO5A 2WKCA 3M4YA 4HN7A 5IGFA 5BN3A 4DN4M 1BXTA 3HOZB 2A5HA 1OO9B 3SDZA 3MC0B 2BE5D 3PMFA 2QILA 3CU7A 1DZ1A 1F2YA 5D3IB 3CRLC 5K5PA 4FF3A 1KNEA 1SMYD 1CTMA 2F0FA 3A8JE 2K5DA 4EVOA 1HPCA 2M00A 2A6EC 3SR1A 3GQBA 2L11A 3OMCA 2CQAA 3HS0C 4ZUIA 1R4QB 1SNDA 2KJXA 2K05A 5CV9A 1F9SA 4TRDA 5AFWA 2EDGA 1DOKA 4BA2I 4B08A 1T5XD 3HOWB 2XVSA 5KEEA 4DNTB 5M9OA 1J8IA 2K1BA 1EY7A 1HHVA 2QF7A 1I6HB 4K5WA 3BVGA 3I8ZA 3WOEA 4FP5D 1AZPA 3TBIB 4RHSA 2L0CA 5CV4A 2F0EA 1H9SB 5T1GA 2B2YC 4FNFA 2E2IB 4ZRZA 1B53A 2F0KA 2XWBB 5A2QE 3E0JA 1ESFA 1BCPC 1HCZA 5EJWA 1STAA 2FMMA 3SHLA 3HEJA 1R9TB 2EY6A 1DM0B 3OWFA 4O1NA 2H4OA 2PYKA 3EROA 3Q22A 1HQRD 1B44D 1MBYA 3P20A 1W6KA 1F2LA 3DM1A 2Z8LA 1CZGA 2FMCA 3QIAA 3NUCA 3OIQA 1U4PA 2CVRA 3PUYA 1Q3LA 1O78A 2L5TA 1JOKA 1EEFD 2CW0D 5LL6S 2HUGA 1CA5A 5C4HA 2KEEA 3VR2A 2B2UC 1ILQA 3S2HB 3GTQB 3J7YW 1LV9A 1QJOA 4FYDA 4OGQC 2IL8A 3NPPA 3A8IE 3X3MA 1RTOA 3W3AA 4C3IB 1BOSA 2N88A 3L7ZC 4S3SA 2OF1A 3R3OA 2Q8TA 1EU3A 2A74C 2EYLA 1EY9A 5KIXA 1SYGA 5FK9C 2F1MA 3S1QB 1SEBD 4EQPA 2PO4A 1PTOF 5CV7A 1DJRD 4IUUA 4QMGA 3TN2A 1SBBB 1OXTA 2BDNA 2NTTA 4XTCS 4GZYC 1I4HA 3DMUA 1L0YB 3AMUA 3N6RA 4WRDA 1JC7A 3HOVB 2JE6I 4RCOA 1AW7A 1VMPA 1EY5A 1W6JA 1HQMC 3J80E 4F8MA 2IW3A 1HRJA 1Y8PB 5I4DA 1ENAA 1II3A 1QCBD 4XQQA 3CQZB 5LHY1 1M4VA 1KNAA 2SOBA 2JEAI 3BDCA 4A3KB 1L0XB 5I2YA 3OIPA 1TWFB 4G7OC 2KECA 4BY7B 1TWAB 3E5SA 1SNPA 1KDCA 3W2DA 4RHRA 2WB1B 1TR5A 4FO2A 3K7AB 1PLFA 4ME5A 2KEDA 1JE4A 3EFXD 2B8GA 2EJFC 2IJ0A 4RCNA 1A2UA 4NW2A 1VF5C 2KCNA 5TSSA 4QUFA 4ZK9B 5BN5A 5ELFA 4IFDH 2KVMA 3D4DA 1B2TA 2EYHA 3NTHA 4I7ZC 1JWUD 1F9PA 2OT2A 4K6LA 2F03A 1STGA 5ELEA 3K5MA 1V43A 1LT5D 2BDOA 1U4MA 2B2YA 1SDFA 3OMGA 1G8ZD 4ILWA 2ICEC 1TY2A 1EWHA 2EJMA 3H09A 3I4MB 2Q8RE 2E2JB 1PXUA 1S5ED 4CHTB 3MEHA 3S16B 2ENBA 1FD7D 3NHHA 1EYAA 1GUWA 4MIUA 3MTSA 2A69C 3SEBA 3S9WA 1SNCA 2PW5A 1SFOB 1F77A 2CHBD 4KJNA 2E2DC 3RZDB 2X69A 5C0XH 4N9TA 1LTGD 2TMPA 1G2SA 3MFYA 1Q12A 2EOTA 4C3JB 2O5JC 2AQ1B 4IUTA 4OO1H 1STHA 2B2VC 2HCCA 3DWQA 5I6YA 1LABA 2AUKA 4OIJA 3MAQA 5FOBB 2B2UA 5EKLA 1UEAB 3DXJC 1D6EC 1PFMA 4P2CB 3G6JB 1Y1VB 4DXFA 1O7YA 1G2TA 3U9SA 1KLUD 4ZKCB 1B9MA 4RWSC 4K2KA 3J81L 5C3XA 3GD7A 1E0BA 4ODGA 1X32A 2F0HA 1PTOD 1SNOA 2SDFA 5EPKA 1KABA 2YU9B 4KHVA 1IYVA 3D31A 2NB0A 1I4QA 1GUOA 1PMRA 3BG3A 1ONLA 5CV6A 4KD3A 4IZ8A 3V96A 1EY4A 4IFDG 1TU2B 3D6CA 3D4WA 4JK1C 3HG9A 1SSOA 2RDFA 4LAAA 2A69D 1WVLA 1HA5A 3IFDA 1CA6A 5JOBA 1EY0A 1BBXC 3ND8A 4XYOA 4XYQA 2LS01 5IGBA 4KV6A 4K5VA 3K59A 2EY2A 1D5MC 5JAVA 3GTMB 1FR3A 1IL8A 3R2TA 5FLXE 3AU7A 2WKDA 1Y1WB 4MN3A 5IIFA 1BUVT 4E6IA 4R8IA 2F0VA 2MJ8A 5D3DA 2BE5C 3SK6A 2XRSD 5FO7B 5A2QL 2E75C 3GTLB 1ET6A 3FPUB 4NKLA 1QNUA 5M5WB 1Q1EA 2AQ3B 2I07B 4IURA 4EQOA 4OIKA 2HDLA 5C0XG 5CC4A 5D65A 3P75A 4R9WA 3D8GA 5C3EB 1GXDC 2F3VA 1KDAA 1EYDA 2KOLA 2L12A 1S4ZA 4OO1G 5JEAJ 2ZXOA 2KHSA 1XYIA 4RGOS 1FNVA 1Q90A 4BBSB 5J22A 3HOYB 3GTGB 1EZ8A 2HDMA 1BO0A 2F0IA 3PIP3 3I3CA 3TDQA 4KY6A 4DNRB 2XSCA 2SNSA 1CI3M 1XWEA 2A6HD 3HP3A 3KBGA 3IFTA 3K5LA 3J7AF 2G9DA 4DK1A 1PRTC 5J39A 2X6GA 1WTWA 3MHBA 1IHZA 3J81E 4ZYSA 3D6WA 2BOSA 2LY7A 1BCPB 2XWJB 2XRQD 4CJ0B 1TQOA 2RSNA 3A54A 3EJIA 1A3UA 4K8IA 1NAPA 5I6WA 4UAIA 1LT6D 1HUNA 3T16A 2JEBI 4A3IB 2NZ1D 5E4XA 3M7NA 4ZLTF 4BY1B 1SYCA 2ZXRA 2OXPA 1U4RA 2B2VA 1QOHA 4RGMA 4U68A 3D3RA 1WTPA 1HTLD 3IKJA 4HTHA 5BN4A 2JA8B 4IQZA 1ENFA 2F0MA 3DHQA 1LACA 4C3IG 2CW0C 2K28A 5T1IA 1NCVA 1CM9A 2G9HD 3MA2B 1BDOA 2I46A 2D2CC 2JXMB 4FXKC 1H9KA 1V8QA 3NTKA 4G4KA 3J80L 2QKIC 3RUZA 2YYZA 2PNRC 4C1NK 1MGSA 2K01A 5IGEA 5CV8A 4DAPA 4C2MB 1AZQA 2C5CA 1SNQA 3NE5B 5C5LA 3HOXB 5ELBA 1B3AA 1VCIA 3RLFA 3T13A 1PRTD 2K5QA 3M7GA 3H91A 1OXXK 2LMCB 1WTRA 3LX0A 2ZXPA 2K04A 1QG7A 1QNKA 3M4OB 1OXVA 2GA4B 3GV3A 4Z9CB 2D5DA 4OL7A 1V1OA 2B8FA 1TWHB 2DY7A 1ZYRD 4B9XA 4HMIA 1LT3D 1LO5D 3MZ5A 2F3WA 3GTJB 3A56A 5CORA 3X3NA 3RMHA 3K0YA 2Z4HA 2AUJD 5NUCA 3ONAB 4A3JB 1MSHA 2SEBD 1I4GA 4CKEA 4Y7NB 3VR4A 3C46A 4DXGA 2DN8A 4LMQD 5C4XB 1ET9A 3BYYB 3VR3A 2K5WA 3NP8A 2F0TA 4KD4A 4CJ2C 1PZJD 3VA7A 4PNYA 3BYTB 5KNBA 3U9OA 4KY7A 5A35A 3BDLA 5IODA 1G6ZA 1Z47A 3D4RA 5E4WC 1NR4A 1BF4A 1E2ZA 1A3VA 3Q24A 1EWCA 2F0UA 2X6LA 3O13A 5C5MA 4F7XA 2FFKB 5CGKA 2FHTA 3K58A 1RD9D 3ITPA 1OXUA 4XDXA 4J8QA 4UDUC 3BVZA 1RTNA 5EBCA 5E3FA 4V0BA 1XTCD 3QJYA 3H0GB 1DYQA 3C1EA 1EY8A 1D1KA 5C3WA 2LFNA 1Q8IA 4IUNA 5C4ZA 4TSSA 3NXWA 5CBAE 1TS3A 4C3JG 4RGTA 3TP5A 2PZUA 4A3EB 1HA6A 4FF2A 3PUZA 3NTIA 2IX3A 1WTXA 2Z1CA 3FEWX 5IOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2L D;  1FNW A;  1JQY D;  3BYT B;  1GOZ A;  3DWA A;  2G9H D;  4BWG B;  1AN8 A;  1SE4 A;  1JWU D;  1SEB D;  4K6L A;  5ELC A;  1D5X C;  1EEI D;  5ELE A;  1JR0 D;  1PTO F;  1LT5 D;  1TY0 A;  1I4P A;  3CHB D;  1DJR D;  4L6T B;  4RGO S;  1FNV A;  1G8Z D;  1ESF A;  1BCP C;  1CK1 A;  1TY2 A;  1I4Q A;  1EU4 A;  1SBB B;  1PRT F;  1B1Z A;  2NTT A;  2WV6 D;  2J4X A;  2QEJ C;  1I4H A;  1L0Y B;  1EWC A;  1D5Z C;  2ICI A;  3URY A;  1LTB D;  1SJH D;  1S5E D;  1FGB D;  2NTS A;  3O13 A;  1TS5 A;  1RF2 D;  1PTO C;  1UUP A;  1FD7 D;  5ELB A;  1BXT A;  4O1N A;  3BVM A;  2XN9 C;  1STE A;  1HA5 A;  1PRT D;  1AW7 A;  1S5F D;  4RCO A;  3SEB A;  1RD9 D;  4L63 B;  1PRT C;  3MC0 B;  1I4R A;  2QIL A;  1HQR D;  1CHP D;  1B44 D;  1LTA D;  1PZK D;  4UDU C;  5D3I B;  1MD2 D;  3KLS X;  4Z9C B;  1JWS D;  1PTO H;  1RDP D;  4RH6 A;  1KTK A;  1V1O A;  3BVZ A;  4ZYS A;  1JWM D;  1F77 A;  2CHB D;  1KLG D;  5I4D A;  1BCP B;  3EA6 A;  3R8B A;  1TS2 A;  1LTS D;  2XRQ D;  1LT3 D;  5FKA C;  2IPK D;  1LO5 D;  1M4V A;  1D5M C;  1PZI D;  1XTC D;  2Z8L A;  2RDH A;  1LTT D;  1LTI D;  1L0X B;  3R2T A;  1SE3 A;  3TSS A;  1V1P A;  1XXG A;  1DYQ A;  1S5D D;  1LTG D;  1SXT A;  1EEF D;  1PTO B;  1UNS A;  4C56 C;  5D3D A;  1QIL A;  1CHQ D;  1LT6 D;  1RCV D;  3W2D A;  4RHR A;  1S5B D;  1I4G A;  2SEB D;  3OWE B;  2AQ1 B;  3DWQ A;  1LTR D;  1PRT B;  2XRS D;  2TSS A;  4TSS A;  1T5X D;  3EFX D;  1TS3 A;  1ET6 A;  1D6E C;  1BCP D;  1SE2 A;  2IJ0 A;  4DXG A;  4RGT A;  4DXF A;  1I4X A;  1PYW D;  3BZD B;  4RGM A;  1TS4 A;  4RGN A;  1ET9 A;  3V05 A;  1FNU A;  1KLU D;  1LLR D;  3BYY B;  1HTL D;  2AQ3 B;  4OHJ A;  2XNA C;  3BVG A;  1V1P B;  5TSS A;  5ELD A;  3GP7 A;  1BCP F;  1EU3 A;  2R61 A;  1ENF A;  2AQ2 B;  3MFG A;  1JCK B;  1SJE D;  1EFI D;  4RHS A;  5ELF A;  2RDG A;  1HXY D;  3DWP A;  1PZJ D;  3R2I A;  1PTO D;  1CT1 D;  1CQV A;  1S5C D;  4RFB A;  5FK9 C;  1LT4 D; 
#chains in the Genus database with same CATH topology
 1JQY D;  4JI7 Q;  3DWA A;  4CGY B;  4O2D A;  3IRB A;  2B39 A;  1JR0 D;  4IAL A;  3G6E A;  1B3Q A;  3PGZ A;  4L5R C;  4DV7 Q;  1Z9F A;  3NWS A;  1SMX A;  5M3M G;  3HKZ E;  3HKZ B;  1OTC A;  1KXL A;  4GN5 A;  1E1T A;  4DK6 C;  2I5H A;  1FYC A;  2D62 A;  4JC0 A;  1SJH D;  5IT9 E;  1FGB D;  4XT1 B;  2F0L A;  1EFW A;  1PTO C;  2EJG C;  1DON A;  5FO9 B;  4H7B A;  5FLX L;  2UUB Q;  1MSG A;  2XN9 C;  2B29 A;  1UE6 A;  2ATW A;  2N78 A;  2NN6 G;  3RLO A;  4GKJ L;  4N9P A;  4A3D G;  2RHQ B;  3KF6 B;  4GN3 B;  3K5N A;  4A4I A;  3LWE A;  3ULP A;  4I65 A;  2WP8 J;  2K03 A;  3IAY A;  1GHK A;  5FLM G;  1VQ5 A;  1ML0 D;  4LWC A;  1C0A A;  1TS2 A;  5D14 A;  4A3I H;  1C9O A;  4XT3 B;  1YNN C;  4C3H B;  1GJX A;  2MHV A;  3RLN A;  3AEV A;  3TSS A;  4BY1 H;  1S72 A;  2MO0 A;  1PDQ A;  1UWV A;  1S5D D;  1HFN A;  4QF4 A;  5GAH C;  4H44 C;  3A55 A;  1SYD A;  4KHP L;  2QDL A;  1X3P A;  4WOR A;  2JA8 H;  3F8T A;  4NB3 A;  2EY1 A;  2BH2 A;  2WAQ E;  2WAQ B;  4R4O A;  4DGZ A;  3ICE A;  1XX8 A;  5HGT A;  1EL0 A;  1M8A A;  1L1O C;  3ND9 A;  3P7J A;  1IKL A;  4B3S Q;  1WCM G;  1SYF A;  1JB3 A;  4BBR B;  4KMU C;  1LLR D;  4PMB A;  1IBM L;  1OXS C;  4A3G B;  5ELD A;  3SK8 A;  1EYG A;  1MHW C;  2KEN A;  2UXD Q;  3MFG A;  3VR5 A;  2B63 B;  2F0D A;  1CQV A;  4RAU C;  5IGC A;  2AWO A;  1G29 1;  4KN4 C;  3SXH A;  1KD1 C;  2AWN A;  2HQE A;  3B6Y A;  4C2M H;  4LK1 C;  3Q0A A;  4DR4 Q;  1G91 A;  4BWG B;  3PIO 3;  2NVY B;  4DPG A;  2F0W A;  3NBH A;  1A15 A;  4ID6 A;  1MIU A;  3HOX H;  2VZA A;  2Z4I A;  4HID A;  1SYE A;  1CKO A;  2A68 C;  3T53 B;  3A5U A;  3H15 A;  1F9R A;  3W5O A;  2FXQ A;  2K32 A;  2JA9 A;  2G5D A;  4ZAI A;  3CP0 A;  4GS3 A;  5K36 H;  3OPO A;  5JEA H;  4A3M B;  1B50 A;  2MPM A;  1UE1 A;  3ERS X;  4GLA C;  2JQO A;  4LUZ A;  1B4O A;  3RN2 A;  3M4O H;  1EYC A;  2F0G A;  3URY A;  4J1M A;  5M3M B;  2NTS A;  4PV1 C;  4IUP A;  1TWH H;  4B3M L;  1CUK A;  1STE A;  1N8R C;  4EQN A;  4DR6 L;  2CWP A;  1H9M A;  4DA2 A;  1SYB A;  5BR8 Q;  4LF6 L;  5EKK A;  3GTJ H;  4PMC A;  3NQI A;  5LMU L;  4XQJ A;  3PIP A;  1LTA D;  2PNH A;  3TZU A;  3FMC A;  3S1N B;  2F0P A;  3PSI A;  1XMQ Q;  1KTK A;  4X3U A;  4A3J H;  1KLG D;  3J80 c;  3VA5 A;  1YNN D;  2E2H B;  2VNU D;  1LTS D;  5FKA C;  4A3D B;  2IPK D;  1PH6 A;  4Y7N H;  3GTO B;  2RDH A;  2KCT A;  2BA0 A;  1LTI D;  5CMD A;  2A6H C;  4A3B B;  5JVG 3;  4L5Q A;  3TP7 A;  1Y69 U;  2NUC A;  1QUQ A;  5C4X H;  2J0T D;  1WTO A;  4IJL A;  4JBM A;  5JPM C;  3KOJ A;  2DY8 A;  2B2T C;  2FJ2 A;  4I7A A;  3VR6 A;  4O0A A;  1PHJ A;  3J7A 5;  3Q6S A;  3CD6 A;  1PRT B;  2ZM6 L;  4YHH Q;  1CKM A;  4RA8 A;  1NMF A;  1SE2 A;  2D0O A;  2VB3 X;  3NEN A;  4DK0 A;  2EPB A;  4HJA A;  1TS4 A;  4JBW A;  3V05 A;  4N8X 1;  3V2T A;  1TKW B;  1RHP A;  3JAM E;  3GTK H;  2IX1 A;  3QG1 A;  1NUC A;  2PQA B;  1AFP A;  5KYL A;  2AQ2 B;  2RDG A;  1PFB A;  1I50 B;  1E2W A;  1WCM B;  2C9O A;  1SLJ A;  1LT4 D;  3CAM A;  4V19 0;  1GOZ A;  3MXP A;  1A8V A;  5ELC A;  5EPJ A;  2JA6 B;  3S15 B;  4JI2 L;  3S2D H;  2A68 D;  1I4P A;  2EYF A;  3KLS A;  1YZ6 A;  2E74 C;  1PFS A;  3PF5 A;  1CK1 A;  3DM3 A;  3I4L A;  4JCV E;  2LKV A;  1WTH A;  4IFD I;  3TRZ A;  1AP0 A;  2WV6 D;  2J4X A;  3T1Y Q;  1EQV A;  1QVG A;  2EIF A;  3A5Z B;  3H94 A;  1TWG B;  5DM7 3;  1PH9 A;  2K6A A;  1ROD A;  4X3K A;  2R3Z A;  4KKT A;  5EBD A;  2E76 C;  4KHP Q;  3LNN A;  4L63 B;  3R93 A;  1XPR A;  1Q1B A;  4IPH A;  4MTN A;  2JK8 A;  3HOX G;  3H0G H;  3T51 B;  4TKO B;  3BU2 A;  4JI6 Q;  4JI3 Q;  1CFM A;  1JWM D;  5K36 G;  4LF5 L;  5JEA G;  3PO2 B;  4BXX G;  2F0S A;  4G57 A;  3CCV A;  4LFA L;  4DR3 Q;  1GUG A;  2IX0 A;  1IBM Q;  2H1E A;  2JP1 A;  3ZYY X;  1V1P A;  4DF7 A;  1GUS A;  2QDB A;  1BR9 A;  1C8C A;  1XTD A;  2KA7 A;  5LMN Q;  1VQ9 A;  2RA4 A;  4JV5 L;  5COY A;  3AFQ A;  1RCV D;  4A3E H;  3IL8 A;  1VQ7 A;  1RKN A;  1CQF A;  5KNC A;  4HSP A;  1GHJ A;  3TP8 A;  2WAC A;  4JI8 L;  3CKI B;  3F2D A;  5M5X B;  1EIH A;  5C0X I;  2DJF C;  1PYS B;  1ZYR C;  5G3L F;  2JYO A;  4IPG A;  4PMW A;  4RGN A;  4H13 C;  3FRP B;  4X6A H;  1L1O A;  3MXG A;  3ERQ A;  3Q23 A;  1BCP F;  1TVX A;  4HIK A;  1SJE D;  4K6D A;  2Q2U A;  1HXY D;  1KAA A;  4OO1 I;  3K57 A;  1YIT A;  1S5C D;  1R4P B;  4RKB A;  4B3M Q;  1JJ2 A;  1D8L A;  3CW2 C;  1DXM A;  1AH9 A;  3C3L A;  2LXK A;  2RBM A;  2NYZ D;  2RKS A;  1WJJ A;  3CCS A;  1EEI D;  4LF6 Q;  2L4N A;  1B9N A;  5IGD A;  3I72 A;  5CR3 A;  3EQL C;  5LMU Q;  5IP7 G;  1EOT A;  3S14 B;  2HCI A;  4ABN A;  3CRK C;  1IXR A;  1LUZ A;  3QWN A;  2QEJ C;  4FVM A;  2K7V A;  1AEX A;  2F4I A;  4NDX A;  1D5Z C;  2ICI A;  2Q2H A;  4CKC A;  4XQN A;  1TS5 A;  3CCU A;  1ZKO A;  4IUV A;  3BS1 A;  4HMJ A;  3BVM A;  5LL6 X;  4C3H H;  2OEO A;  1MI2 A;  2DNE A;  1I3Q B;  3CF5 A;  1JIC A;  4LUV A;  4QCL A;  5IY0 A;  1JOR A;  3I4O A;  5C44 B;  2L15 A;  3L2P A;  1JWS D;  3HOU G;  2PW7 A;  4RH6 A;  2RQX A;  4KI0 A;  1N33 L;  1ESR A;  1VQ8 A;  3I91 A;  2PZT A;  3EA6 A;  4B9W A;  2WII B;  4KN7 C;  4J6H A;  2R6G A;  1LTT D;  4QUC A;  1VDZ A;  4JI7 L;  4Q5V A;  2OQK A;  4OWT B;  1VMC A;  4HCS A;  1YNJ C;  5FLX c;  5JVH 3;  3TZD A;  3M9B A;  1X3Q A;  2K33 A;  1VQ4 A;  1CHQ D;  4A3G H;  1DD2 A;  5IYB H;  3H0G G;  4PG3 A;  4YCU A;  1F9Q A;  4CJ1 B;  2B63 H;  2B2T A;  1VQE A;  4KK7 A;  1Z7T A;  2GVB A;  2JSO A;  4K14 A;  1K73 C;  4F87 A;  2O5I C;  2R93 G;  1MKH A;  3BZD B;  2NVY H;  1VS0 A;  4G7Z C;  1A2T A;  1H9R A;  3CCQ A;  2K14 A;  3MXU A;  4K8J A;  3HGB A;  1QUQ B;  5ISR A;  2B2W C;  3I73 A;  5J3B A;  1EFI D;  3C2P A;  4KTA A;  4AH6 A;  3PUX A;  4A3M H;  5IT9 L;  5JJI A;  4RFB A;  2E5L L;  1O7Z A;  3PUW A;  2O2L D;  1ASY A;  3QO2 A;  1HZA A;  5HUR A;  2M9V A;  5C4J B;  5JPN C;  1E3P A;  1NMG A;  4EGV A;  4KKS A;  2SNM A;  3CHB D;  2UXB L;  4M1U B;  2F0Q A;  4G7H C;  1P8L A;  3J81 i;  1B1Z A;  4LF5 Q;  2QA4 A;  3SVM A;  4LFA Q;  1RL2 A;  2A6E D;  2BH8 A;  3S1N H;  1O7I A;  2DJG C;  3FP9 A;  4U67 3;  3PO3 G;  1NY4 A;  4R1J A;  2CFM A;  4DAM A;  2E2H H;  1VQG A;  4QB4 A;  2NN6 H;  5DEH A;  2EYJ A;  3NBI A;  4A3D H;  2LSS A;  2PCF B;  5EKI A;  3QB3 A;  3KJP A;  3U4Z A;  3GTO H;  3GTK B;  5J1Z A;  4A3B H;  1TXY A;  1PH8 A;  1BBW A;  4B3S L;  4JBJ A;  1D7Q A;  1EIG A;  4HED A;  3OW2 A;  5FLM H;  1HNZ Q;  2KCC A;  2K5V A;  2EYM A;  4JI8 Q;  1RDP D;  5FJ8 H;  4FXG C;  4A3L G;  4JVZ A;  2UXD L;  1U4L A;  3S2D B;  3J81 c;  3A7A B;  1WTQ A;  3OW7 A;  4K5X A;  3MWY W;  3H6M A;  3C1F A;  1ENC A;  3K6O A;  4DUY Q;  4MHE A;  1YNJ D;  4CDD C;  4JPB W;  3HOU B;  3UI2 A;  2FIN B;  1NSN S;  3VYU A;  3NSW A;  1PTO B;  2VXW A;  4C3H G;  3BDO A;  4LF8 Q;  3KUP A;  1C48 A;  1QIL A;  3WDN A;  1SE8 A;  1S5B D;  5IGG A;  3HRZ C;  4R4Q A;  3DUZ A;  2ZT9 C;  1J9O A;  5G3L D;  1I50 H;  3TP6 A;  2EXD A;  4HSV A;  3RZO B;  1BCP D;  4X3T A;  1V9P A;  3I4N G;  1WFQ A;  1JJG A;  1PYW D;  2JA6 H;  1N36 L;  4KKU A;  2F0N A;  2Q8I B;  4P75 A;  4P71 A;  4OHJ A;  1V1P B;  2EYP A;  3CME A;  3KF8 A;  3HZX A;  2EY5 A;  2M2L A;  1KL9 A;  1D1I A;  5JJL A;  5BR8 L;  2R93 B;  4UHV A;  3FKI G;  2F0O A;  1KDB A;  2VUM G;  1QVF A;  3FPP A;  5IYC G;  2YTV A;  3CCE A;  3VYR A;  1G6P A;  3K81 C;  4XIG S;  1AN8 A;  4DU9 A;  5IYB G;  1TWG H;  1D5X C;  2MO1 A;  2Z0S A;  3NWT A;  4WJ3 M;  5CYU A;  1TY0 A;  2Z6K C;  2AHO B;  2B63 G;  2QCP X;  4IUQ A;  1EUJ A;  3KLR A;  1M90 C;  4DKA C;  5KRU A;  4JYA L;  1EU4 A;  1L1O B;  5H1S E;  2O4X A;  4H0L C;  4ZQ3 A;  3NQT A;  1IW7 C;  1IYU A;  1UAP A;  3AB9 A;  4X3S A;  1LTB D;  1U9R A;  2L1B A;  4JBK A;  1A6X A;  3F2U A;  5LMN W;  1RF2 D;  2EVB A;  4A3M G;  3PO2 H;  3STB C;  2PZW A;  3S1M H;  3E6Z X;  1S5F D;  1EZ6 A;  4YHH L;  3VYT A;  3EVQ A;  3QOL A;  2KUM A;  5M5Y B;  5GAE C;  2BCO A;  2A73 B;  1I4R A;  5FO8 B;  1GUN A;  2L55 A;  4KY5 A;  3PO3 B;  1F2Z A;  1HUM A;  4A3C H;  3FVQ A;  4PQX A;  4ULL A;  3NK9 A;  3DEO A;  3SE0 A;  1E22 A;  2MGS A;  2PMZ E;  2PMZ B;  1F2M A;  2CH4 A;  5I2X A;  4NP5 A;  1XXG A;  5M5X H;  3JAM L;  1VF7 A;  1GUT A;  1STY A;  2ZTD A;  2NVX B;  1K8M A;  1Q7Y C;  4X66 L;  3OHX C;  4HJ9 A;  2E5L Q;  5KND A;  4LFB Q;  4A3B G;  3OWE B;  4BS9 A;  4LNQ A;  4ZKB B;  4K2L A;  5E1F A;  4DAV A;  3H3V C;  1LTR D;  2BA1 A;  3M4P A;  3T1Y L;  1GD7 A;  2TSS A;  1IKM A;  2UXB Q;  1E2V A;  1VQD A;  3PCO B;  4O42 A;  4PZ7 A;  4JI5 L;  5FJ8 G;  4LFC Q;  3DEP A;  3G48 A;  4Q0F A;  2OWO A;  1QZH A;  4CDC C;  1RIP A;  4F88 A;  1FNU A;  5DLQ E;  5ELO A;  2XNA C;  4C1N I;  2L9H A;  4IOC A;  5E7N A;  3S14 H;  2R61 A;  2DUD A;  1B7Y B;  5C6A A;  5DNF A;  1DOL A;  3R2I A;  2EXZ A;  1TWC B;  2ALY B;  3WOF A;  5CBE E;  3I4N B;  1NNX A;  4TQU S;  4HR7 B;  2B2W A;  3OSO A;  2IT1 A;  4HCE A;  2PPB C;  4JI3 L;  4JI6 L;  2Y0S E;  2Y0S B;  2QGQ A;  3LWU A;  1Y8N B;  1A63 A;  3FKI B;  4DR3 L;  4QIW E;  2VUM B;  4QIW B;  1PFN A;  2RHS B;  3RD4 A;  2JA6 G;  5I9O A;  1IW7 D;  4L8J A;  3T4A C;  1I3Q H;  1O7L A;  2DNC A;  4OEM B;  5LMN L;  5C44 H;  3QOJ A;  3STB D;  4NMZ A;  4JI4 L;  2NN6 I;  1T9H A;  2R7D A;  1STB A;  3TQY A;  2R92 B;  1WTV A;  3HOW H;  4GNX C;  1ZEQ X;  2LXJ A;  3OOC A;  1CZW A;  3K5O A;  4XXE A;  3KJO A;  4A3F G;  1QE6 A;  3J80 i;  2E8G A;  4GKK L;  1PZK D;  2UXC Q;  1MD2 D;  3KLS X;  2F0J A;  4BXX H;  1JOO A;  4DFA A;  3T56 B;  2PQE A;  3A8K E;  1A62 A;  1X55 A;  4R8N A;  1SAP A;  1STN A;  3R8B A;  1K8O A;  1I6V C;  4LF9 Q;  1N36 Q;  1PZI D;  5F2D A;  1SE3 A;  3A7L A;  2N55 A;  1Z6H A;  3HKS A;  1A3T A;  3PO2 G;  2D9U A;  3KBX A;  1EY6 A;  1QB5 D;  1H9S A;  2JA7 G;  3J7A V;  4GN4 B;  3FDT A;  1M1K C;  1HR0 Q;  2NVT B;  4FXD A;  1C4Q A;  3GTP B;  4A3C G;  4IN3 A;  3MXN A;  2XIW A;  3G7L A;  4NXN L;  4GOP C;  2ES2 A;  1MJC A;  4IFD J;  4HJ8 A;  4DV1 Q;  4JYA Q;  1ILP A;  1YHA A;  5C4J H;  3I70 A;  4X64 L;  3TME A;  4AQY L;  3CCJ A;  4CKB A;  3GP7 A;  1WD0 A;  3GV6 A;  2YV5 A;  3PV0 A;  2MQH A;  3M3Y B;  3N52 A;  3VYS A;  4DAY A;  3I90 A;  3DWP A;  2UUC L;  2K5H A;  1XNQ L;  1CT1 D;  1HJP A;  2RVL A;  1Y14 B;  4C56 C;  5GQO A;  4JI1 Q;  3SK4 A;  3L9A X;  5IP7 H;  1WD1 A;  1EQT A;  5EGT A;  1JE5 A;  3PUV A;  5JJZ A;  1HZC A;  4L6T B;  2NVQ B;  3CPF A;  5AJ3 Q;  4J15 A;  4R4T A;  1IBL L;  4YY3 Q;  3RNU A;  1SNM A;  2Z6K A;  3UDF A;  3HOZ G;  1PRT F;  2JA5 B;  1RJT A;  4R4C A;  1FJG L;  4FF4 A;  2ZTC A;  3KF8 B;  1O80 A;  1T5E A;  4RKL A;  5IE8 A;  2VB2 X;  3D0F A;  4K0K Q;  1TT2 A;  1UUP A;  4A93 B;  2OQ0 A;  5KYI A;  1Q86 C;  2IWH A;  3UDI A;  5IT9 c;  1HNX Q;  1D2B A;  3SK5 A;  2NWG A;  4X66 Q;  2V4D A;  4YWM A;  5I9P A;  3CXC A;  2CCZ A;  4P74 A;  3HOU H;  2ID0 A;  1JOQ A;  3S1R B;  1QWY A;  1BQQ T;  1ICW A;  2WIN B;  1CHP D;  1BNZ A;  1K0S A;  2NZH A;  4YIJ A;  1E24 A;  1PTO H;  5C0X J;  4JI5 Q;  3S17 B;  1YI2 A;  4LW1 A;  2J7Z A;  3MVV A;  1SMY C;  1ZXT A;  2NBF A;  2RSO A;  4A3F B;  3FHW A;  5C44 G;  5EQ0 A;  4ZUJ A;  4BA1 I;  1DOM A;  3RZO H;  3CCR A;  1XNR L;  2R7Z B;  4X62 L;  2MUY A;  1SXT A;  3HOW G;  4AYB E;  4M8A A;  4AYB B;  1UNS A;  1TII D;  5CV5 A;  5M3F B;  1K83 B;  2EYO A;  4AIM A;  3NEM A;  4FF1 A;  4OWX B;  1P16 A;  2MP1 A;  4HAE A;  2EZV A;  4UPA A;  2R93 H;  2F4V L;  5DAU A;  4OWW B;  3S1M B;  1Q46 A;  4IPD A;  4KJO A;  2EE1 A;  1I4X A;  2JA7 B;  1K8G A;  2GN5 A;  1HTP A;  4WFN 3;  1H9J A;  3M85 A;  1VQ6 A;  3EIV A;  4OXP A;  5EPL A;  1JCK B;  2KQ3 A;  5DM6 3;  4KHZ A;  4JI4 Q;  4CBV A;  4LF4 L;  4DNI A;  5KGU A;  1BVS A;  3CCM A;  1ICF B;  1FNW A;  3P1H A;  3L3O C;  1HNZ L;  1DCZ A;  1SE4 A;  4LJZ C;  2H5X A;  4WJW A;  3KK7 A;  2RF4 A;  3CMA A;  2DGY A;  1NR2 A;  4GKK Q;  1SR3 A;  1HFG A;  1LYL A;  3JC6 6;  4YCV A;  2VQE L;  4HJ7 A;  4UY8 C;  1Y8O B;  3GO5 A;  4DUY L;  2ZTE A;  4RMF A;  5M5Y H;  2WKC A;  3M4Y A;  4HN7 A;  3PO3 H;  5IGF A;  4LF8 L;  5BN3 A;  1Q81 C;  3E3X A;  4DN4 M;  2HD3 A;  1V1Q A;  4H02 A;  2NZO A;  1BXT A;  3HOZ B;  3G4S A;  2A5H A;  1EIF A;  1QVC A;  5IWA Q;  1OO9 B;  3SDZ A;  3UDG A;  3PF4 A;  1X3F A;  3MC0 B;  4GNX A;  2BE5 D;  3PMF A;  2QIL A;  3CU7 A;  1DZ1 A;  5HY6 A;  1F2Y A;  2NVX H;  5D3I B;  4A3L H;  4POF A;  3CRL C;  4R4I A;  5K5P A;  2N3S A;  4FF3 A;  1KNE A;  1VQP A;  1SMY D;  4NXN Q;  1I94 L;  1YVC A;  3VDY A;  1CTM A;  2F0F A;  2CWA A;  4X65 Q;  3A8J E;  4ZCK A;  4YCW A;  2K5D A;  2HIV A;  4EVO A;  1HPC A;  2M00 A;  1H95 A;  2A6E C;  4X64 Q;  3SR1 A;  4AQY Q;  3GQB A;  4JW0 A;  2L11 A;  3OMC A;  1FL0 A;  2CQA A;  3M4Q A;  3HS0 C;  4ZUI A;  3EBE A;  1R4Q B;  3I55 A;  2UUC Q;  1PH3 A;  1SND A;  1VQH A;  1XNQ Q;  2KJX A;  2K05 A;  3F1Z A;  5CV9 A;  1F9S A;  1Q82 C;  4TRD A;  4NXM Q;  5AFW A;  1C7Y A;  2EDG A;  2I5M X;  1DOK A;  4BA2 I;  4B08 A;  1TWC H;  3I4N H;  1T5X D;  3HOW B;  2XVS A;  5KEE A;  2F52 A;  4DNT B;  5M9O A;  3G71 A;  1J8I A;  2K1B A;  1EY7 A;  1IBL Q;  1K0R A;  1HHV A;  2QF7 A;  3TS0 A;  1FJG Q;  1I6H B;  4K5W A;  4GOP A;  3BVG A;  3I8Z A;  2VS1 A;  2VY3 A;  4IJH A;  3WOE A;  3FKI H;  4FP5 D;  2WFW A;  2VUM H;  1AZP A;  3TBI B;  4RHS A;  5IYC H;  4DUZ L;  2L0C A;  5CV4 A;  2F0E A;  1H9S B;  5T1G A;  1SFO H;  2B2Y C;  1NJI C;  4FNF A;  2E2I B;  4ZRZ A;  2JJQ A;  3HFZ B;  1B53 A;  4DR2 Q;  2F0K A;  1HZB A;  2XWB B;  5A2Q E;  3MXN B;  3E0J A;  2R92 H;  3UE1 A;  1ESF A;  2N8N A;  5JJK A;  1BCP C;  4DR7 L;  2A1A A;  5GAD C;  3GDE A;  1HCZ A;  5EJW A;  3OTO Q;  1STA A;  4DAY B;  3T1H Q;  2FMM A;  3SHL A;  3HEJ A;  3CC4 A;  1R9T B;  4LFB L;  2EY6 A;  1DM0 B;  3AYH B;  1WYD A;  1CKN A;  3OWF A;  4O1N A;  1XNR Q;  2KHI A;  4X62 Q;  2H4O A;  1XMO Q;  2PYK A;  1HR0 W;  4LFC L;  3ERO A;  3Q22 A;  1HQR D;  1B44 D;  1MBY A;  3SGI A;  1X54 A;  4N8F A;  1KQS A;  2F4V Q;  3P20 A;  1W6K A;  4BY7 G;  1F2L A;  1PYB A;  3DM1 A;  2Z8L A;  2NVT H;  1CZG A;  2FMC A;  2WB1 G;  3QIA A;  3GTP H;  3NUC A;  3OIQ A;  1U4P A;  1CSQ A;  2CVR A;  3PUY A;  1Q3L A;  1O78 A;  2L5T A;  1JOK A;  1EEF D;  2CW0 D;  5LL6 S;  2HUG A;  3K7U C;  5C4H A;  1CA5 A;  2KEE A;  2OCE A;  3VR2 A;  4LF4 Q;  1FGU A;  1PH1 A;  2B2U C;  1ILQ A;  3S2H B;  2K50 A;  3GTQ B;  3J7Y W;  3M3Y H;  1LV9 A;  4ME3 A;  4PZ8 A;  1QJO A;  4FYD A;  4OGQ C;  2IL8 A;  1VQJ A;  3NPP A;  3UDX A;  3A8I E;  3X3M A;  2VQE Q;  1SRU A;  1RTO A;  3W3A A;  4C3I B;  1BOS A;  2N88 A;  3PQI A;  3L7Z C;  1EQQ A;  4S3S A;  2OF1 A;  3R3O A;  2Q8T A;  2HT1 A;  2NVQ H;  1EU3 A;  2A74 C;  1X56 A;  2EYL A;  1E7Z A;  1EY9 A;  5KIX A;  2JA5 H;  4LF7 L;  1SYG A;  5FK9 C;  2KCM A;  4IOA A;  2UXC L;  2F1M A;  4A75 A;  3S1Q B;  1X9N A;  1SEB D;  4EQP A;  4HIM A;  3TEH B;  1I5F A;  2ZJR A;  2PO4 A;  1KIX A;  2OTL A;  1PTO F;  4UP9 A;  3I4M G;  5CV7 A;  1DJR D;  4IUU A;  4LF9 L;  4A93 H;  1YHB A;  4QMG A;  2IHF A;  1UE7 A;  3TN2 A;  1SBB B;  1I94 Q;  2R7F A;  1OXT A;  2BDN A;  2NTT A;  2Y0S G;  4XTC S;  1KC8 C;  1GM5 A;  4GZY C;  1KRS A;  1I4H A;  3DMU A;  1L0Y B;  3S1R H;  3AMU A;  3N6R A;  4WRD A;  1PH4 A;  3J7Z C;  3S17 H;  1JC7 A;  1PA6 A;  3HOV B;  4A3F H;  1HR0 L;  2JE6 I;  4RCO A;  4CDF C;  1AW7 A;  1VMP A;  3KDF A;  3OYY A;  1YEZ A;  1EY5 A;  4DV1 L;  1W6J A;  2R7Z H;  2R92 G;  1HQM C;  3J80 E;  4F8M A;  2IW3 A;  1HRJ A;  1IL2 A;  5M3F H;  1Y8P B;  4QY7 A;  1ENA A;  1HZ9 A;  1II3 A;  1QCB D;  1K83 H;  5I4D A;  5C3E H;  3PIO A;  3Q8D A;  4XQQ A;  3CQZ B;  1PH5 A;  5LHY 1;  1M4V A;  1KNA A;  4GLV B;  2SOB A;  2JEA I;  3BDC A;  4B3T L;  4A3K B;  2CH4 W;  1L0X B;  3CC7 A;  5I2Y A;  3OIP A;  4ALP A;  4MTK A;  3BZK A;  3K8A A;  4JI1 L;  1TWF B;  2F3I A;  5GAG C;  4G7O C;  4DUZ Q;  1N34 Q;  2JA7 H;  1VQB A;  2KEC A;  1J5E L;  4BY7 B;  1TWA B;  3E5S A;  1Y1V G;  1KDC A;  1SNP A;  2QW7 A;  3W2D A;  5AJ3 L;  4GNX B;  5IYD G;  2WB1 E;  4RHR A;  2WB1 B;  1TR5 A;  4FO2 A;  1L2F A;  3K7A B;  4YY3 L;  1PLF A;  4ME5 A;  5EAY A;  2KED A;  1JE4 A;  4POG A;  3EFX D;  2B8G A;  2EJF C;  2IJ0 A;  4DR7 Q;  4RCN A;  1YHQ A;  1SN8 A;  1A2U A;  4K0K L;  4NW2 A;  1VF5 C;  2KCN A;  2Z6B A;  4DV5 Q;  5TSS A;  4QUF A;  1HNX L;  4ZK9 B;  4JG2 A;  5BN5 A;  5ELF A;  4IFD H;  3ZJY C;  2KVM A;  4LUO A;  1QZG A;  3D4D A;  1B2T A;  1PVO A;  4DK3 C;  2EYH A;  3NTH A;  4IPC A;  4I7Z C;  4QL5 A;  1JWU D;  1F9P A;  2OT2 A;  3I2Z A;  4K6L A;  1STG A;  2F03 A;  5ELE A;  3K5M A;  1V43 A;  1LT5 D;  2BDO A;  1U4M A;  2B2Y A;  1BBU A;  1K3B C;  4Y52 H;  1SDF A;  3OMG A;  3HOZ H;  1G8Z D;  1VQO A;  3A0J A;  4ILW A;  2ICE C;  1TY2 A;  1EWH A;  4GOP B;  4L5T A;  1VQI A;  2EJM A;  2CQO A;  1X3G A;  2HHH L;  3I56 A;  3H09 A;  3I4M B;  2Q8R E;  4B3R L;  3AFP A;  2E2J B;  1PXU A;  1S5E D;  2UUA L;  4CHT B;  3MEH A;  3S16 B;  2ENB A;  2JA5 G;  1FD7 D;  4DR1 Q;  3NHH A;  1EYA A;  1YIJ A;  4MIU A;  1GUW A;  3MTS A;  1DGS A;  2A69 C;  1KRT A;  3SEB A;  1J6Q A;  3S9W A;  1L0W A;  1SNC A;  4P73 A;  2IY5 B;  4A93 G;  1GKH A;  3S24 A;  2PW5 A;  1Y1W G;  1SFO B;  1F77 A;  2CHB D;  1LTL A;  4KJN A;  2E2D C;  3RZD B;  1K8A C;  2X69 A;  1S40 A;  4L5S A;  4OEL B;  1CKN B;  5C0X H;  1N32 Q;  4MNO A;  4N9T A;  1LTG D;  2TMP A;  1G2S A;  3MFY A;  1Q12 A;  2EOT A;  4LF7 Q;  4UP7 A;  1I6H H;  2VQF L;  4C3J B;  2O5J C;  4JI0 Q;  2AQ1 B;  4IUT A;  2R7Z G;  4OO1 H;  2CKZ B;  1STH A;  2B2V C;  2HCC A;  3DWQ A;  5I6Y A;  1LAB A;  1PV4 A;  1X65 A;  2AUK A;  4RG1 A;  1YJN A;  4AYB G;  4OIJ A;  3MAQ A;  5FOB B;  4DV6 Q;  1EIY B;  2B2U A;  5M3F G;  5EKL A;  1YJ9 A;  1UEA B;  3DXJ C;  1D6E C;  1PFM A;  2RCF A;  4P2C B;  3G6J B;  1Y1V B;  4DXF A;  5C3E G;  1O7Y A;  2E2I H;  1G2T A;  3U9S A;  2YTY A;  1KLU D;  4ZKC B;  1B9M A;  4RWS C;  4K2K A;  3J81 L;  5C3X A;  5IWA L;  3GD7 A;  1KAW A;  1E0B A;  4ODG A;  1X32 A;  2F0H A;  1PTO D;  4BBS G;  1SNO A;  2SDF A;  5EPK A;  1KAB A;  2YU9 B;  4KHV A;  3HOY G;  1IYV A;  4DR5 Q;  1R9T H;  1UEB A;  4X65 L;  3D31 A;  1PH2 A;  1X3E A;  2NB0 A;  1G51 A;  1I4Q A;  1GUO A;  4DV3 L;  1E1O A;  1PMR A;  2KBN A;  3BG3 A;  1ONL A;  3F2C A;  1W2B A;  5CV6 A;  1U0L A;  4KD3 A;  4IZ8 A;  4B3T Q;  3V96 A;  1EY4 A;  2MNA A;  4IFD G;  1CSP A;  1TU2 B;  4TVA B;  3D6C A;  4NXM L;  3D4W A;  2Q2I A;  1N9W A;  3A74 A;  4JK1 C;  3HG9 A;  4DV0 Q;  1SRO A;  1SSO A;  2PI2 E;  2A69 D;  2RDF A;  4LAA A;  1WVL A;  2ZJQ A;  1J5E Q;  1HA5 A;  3U4V A;  3IFD A;  1CA6 A;  5JOB A;  1EY0 A;  1NBW A;  4DV4 Q;  1BBX C;  3ND8 A;  4XYO A;  1EOV A;  4XYQ A;  4QQB X;  1K3R A;  2LS0 1;  5IGB A;  4KV6 A;  4K5V A;  3K59 A;  3S2H H;  2EY2 A;  3GTQ H;  1B8A A;  1D5M C;  4OX9 L;  5JAV A;  3GTM B;  1FR3 A;  1IL8 A;  1LM0 A;  3R2T A;  4A3I G;  5FLX E;  3AU7 A;  2WKD A;  4KLK A;  1Y1W B;  4MN3 A;  4C3I H;  4DR2 L;  1NTG A;  4BY1 G;  5IIF A;  1BUV T;  3KDF B;  4E6I A;  1VQK A;  4R8I A;  1UE5 A;  2F0V A;  2KHJ A;  2MJ8 A;  5D3D A;  2BE5 C;  2AMC B;  3SK6 A;  2JA8 G;  2XRS D;  5FO7 B;  3OTO L;  5A2Q L;  2E75 C;  3GTL B;  1ET6 A;  4GKJ Q;  3FPU B;  1B70 B;  1IZ6 A;  1EQR A;  3T1H L;  3S1Q H;  4NKL A;  1QNU A;  5M5W B;  1Q1E A;  1HNW L;  1VQM A;  2AQ3 B;  2I07 B;  2HHH Q;  4IUR A;  2UU9 L;  2A8V A;  4EQO A;  4OIK A;  2HDL A;  5C0X G;  4QJF A;  3H3V H;  5CC4 A;  1AE3 A;  2K4K A;  5D65 A;  3P75 A;  1IBK L;  4B3R Q;  4R9W A;  1XMO L;  2UUA Q;  3D8G A;  5C3E B;  1GXD C;  2GVA A;  2F3V A;  1KDA A;  1EYD A;  2KOL A;  2L12 A;  2VW9 A;  1S4Z A;  4OO1 G;  5JEA J;  2ZXO A;  2C35 B;  2KHS A;  1Q8K A;  1XYI A;  4RGO S;  1FNV A;  1Q90 A;  4JOI C;  1KHI A;  3HOV H;  4BBS B;  3K0X A;  3W1G A;  3E9I A;  5J22 A;  3HOY B;  3GTG B;  1EZ8 A;  2HDM A;  1BO0 A;  2F0I A;  3PIP 3;  1FVI A;  3I3C A;  3TDQ A;  4KY6 A;  5IP9 H;  3CCL A;  3BZC A;  1HH2 P;  2SNS A;  2XSC A;  1CI3 M;  4DNR B;  1XWE A;  2RCN A;  2A6H D;  3HP3 A;  2K75 A;  2Z9H A;  2HIX A;  3KBG A;  3CQZ H;  3IFT A;  3K5L A;  2B3G A;  3NEL A;  3J7A F;  2G9D A;  2VQF Q;  4DK1 A;  4A3K H;  1XPU A;  3TS2 A;  1PRT C;  5J39 A;  2X6G A;  3ULL A;  1WTW A;  3MHB A;  1IHZ A;  1TWF H;  1JB7 A;  4BY7 H;  3J81 E;  1TWA H;  4ZYS A;  4EX5 A;  3D6W A;  2BOS A;  2LY7 A;  1BCP B;  2XWJ B;  2A19 A;  2XRQ D;  3K7A H;  4A3J G;  4CJ0 B;  1TQO A;  1ASZ A;  2RSN A;  1VQL A;  3A54 A;  3EJI A;  1A3U A;  4K8I A;  1W3S A;  1NAP A;  3AQQ A;  5I6W A;  4UAI A;  3CC2 A;  4YWL A;  1LT6 D;  5GRO A;  3T16 A;  5C4X G;  1HUN A;  2JEB I;  1U5K A;  4A3I B;  2NZ1 D;  4DR6 Q;  5E4X A;  3M7N A;  4ZLT F;  4BY1 B;  3MEF A;  1SYC A;  2ZXR A;  2OXP A;  1U4R A;  2MFI A;  2B2V A;  5ELN A;  4DV3 Q;  1QOH A;  4RGM A;  2P5Z X;  2ASB A;  4U68 A;  3JAM i;  3D3R A;  1WTP A;  1HTL D;  3IKJ A;  4HTH A;  4YWK A;  5BN4 A;  2K52 A;  3RN5 A;  2JA8 B;  4IQZ A;  1ENF A;  3TRE A;  2F0M A;  3DHQ A;  1LAC A;  4C3I G;  2CW0 C;  1VQF A;  2K28 A;  5T1I A;  2QEX A;  1NCV A;  1WOC A;  3LGJ A;  1CM9 A;  2G9H D;  3I4M H;  1BKB A;  2E2J H;  2I0Q A;  3MA2 B;  1BDO A;  3S16 H;  3WWV A;  2I46 A;  3NBH B;  2D2C C;  3KF6 A;  5L37 A;  4DV2 L;  2JXM B;  4FXK C;  1H9K A;  4OON A;  1V8Q A;  1X6O A;  4MZ9 A;  3NTK A;  4G4K A;  3J80 L;  2QKI C;  3RUZ A;  2YYZ A;  2PNR C;  4C1N K;  1MGS A;  2K01 A;  5IGE A;  5CV8 A;  4DAP A;  2ZM6 Q;  3U50 C;  3JAM c;  4C2M B;  1N34 L;  1AZQ A;  2C5C A;  4HJ5 A;  4OX9 Q;  1SNQ A;  3J81 j;  3NE5 B;  1VQC A;  3KLW A;  5C5L A;  3HOX B;  5ELB A;  1B3A A;  1A0I A;  5HGQ A;  1VCI A;  3RLF A;  3RR5 A;  3RZD H;  3T13 A;  1PRT D;  2V1C C;  2K5Q A;  3M7G A;  1MJE A;  3H91 A;  1OXX K;  2LMC B;  1WTR A;  4BBR H;  2ZJP A;  3LX0 A;  2ZXP A;  4DV7 L;  1GO3 E;  4WJ4 A;  2K04 A;  1QG7 A;  4PZ6 A;  1QNK A;  3HOV G;  3M4O B;  1EWI A;  1OXV A;  2GA4 B;  3GV3 A;  2D5D A;  4Z9C B;  4OL7 A;  1V1O A;  4DV5 L;  4JI2 Q;  4C3J H;  2B8F A;  1TWH B;  2HQL A;  2DY7 A;  1ZYR D;  4B9X A;  3BJU A;  3QR8 A;  4HMI A;  4NPS A;  1LT3 D;  1LO5 D;  2VL6 A;  3MZ5 A;  4IO9 A;  5IP9 G;  1HNW Q;  1IYJ B;  2F3W A;  1XPO A;  1PH7 A;  2UU9 Q;  3GTJ B;  3A56 A;  5COR A;  3X3N A;  3ULJ A;  1IBK Q;  2UUB L;  1Y1V H;  3RMH A;  5IYD H;  3K0Y A;  2Z4H A;  2AUJ D;  5NUC A;  3ONA B;  4A3J B;  4GLX A;  4A3K G;  1MSH A;  3E0E A;  2SEB D;  1I4G A;  4CKE A;  4Y7N B;  3I7F A;  4QGU A;  4A3E G;  3CPW A;  3ER0 A;  3E9H A;  2Q2T A;  3VR4 A;  3C46 A;  2AKW B;  5M3M H;  2YU9 H;  4DXG A;  1K9M C;  2DN8 A;  4LMQ D;  5C4X B;  1ET9 A;  3H3V I;  3BYY B;  3VR3 A;  2K5W A;  4DR1 L;  3NP8 A;  2F0T A;  4KD4 A;  4CJ2 C;  3L0O A;  1PZJ D;  1WI5 A;  3VA7 A;  3HKZ G;  4PNY A;  3BYT B;  5KNB A;  3F2B A;  2OTJ A;  3U9O A;  4A76 A;  4HIO A;  2EQS A;  4KY7 A;  5A35 A;  4JV5 Q;  1JJC B;  3BDL A;  4FDB A;  3K80 C;  5IOD A;  1G6Z A;  1Z47 A;  3D4R A;  5E4W C;  1NR4 A;  1BF4 A;  1N32 L;  1E2Z A;  4JOI A;  1A3V A;  3Q24 A;  1EWC A;  1GVP A;  2YTX A;  2F0U A;  2X6L A;  2JN4 A;  3O13 A;  4JI0 L;  5C5M A;  2PI2 A;  4F7X A;  2FFK B;  2N49 A;  5CGK A;  4DR4 L;  3EN2 A;  2FHT A;  3K58 A;  4DV6 L;  3GTM H;  1JT8 A;  1VQA A;  1RD9 D;  3ITP A;  1OXU A;  3UE0 A;  1Y1W H;  4XDX A;  4J8Q A;  4UDU C;  2IHE A;  1YNX A;  1NE3 A;  3BVZ A;  1RTN A;  2I5L X;  5EBC A;  2K5N A;  1WCM H;  3DLL A;  4CDE C;  5E3F A;  4V0B A;  1XTC D;  3KYH C;  3QJY A;  3S15 H;  2WAQ G;  1JMC A;  3GTL H;  3H0G B;  1DYQ A;  2PQA A;  4DR5 L;  2XTI A;  3C1E A;  4EQ5 A;  4UP8 A;  1EY8 A;  5M5W H;  1AE2 A;  1D1K A;  5C3W A;  4BBR G;  3U58 A;  4APV A;  4A3G G;  2LFN A;  1Q8I A;  2XGT A;  4IUN A;  5C4Z A;  1XMQ L;  4TSS A;  2D0P A;  3NXW A;  5CBA E;  1TS3 A;  4DV2 Q;  4C3J G;  1YBY A;  4RGT A;  1S3O A;  1XJV A;  3KFU A;  3TP5 A;  2PZU A;  4DV0 L;  1YJW A;  4A3E B;  1K28 A;  1HA6 A;  1N33 Q;  1VQN A;  4FF2 A;  4BBS H;  3PUZ A;  3NTI A;  4P72 A;  4DV4 L;  3GTG H;  3HOY H;  2IX3 A;  3W1B A;  1WTX A;  2Z1C A;  3FEW X;  5IOC A; 
#chains in the Genus database with same CATH homology
 1JQY D;  3DWA A;  4CGY B;  2B39 A;  1JR0 D;  4IAL A;  3NWS A;  3HKZ B;  1FYC A;  2D62 A;  1SJH D;  5IT9 E;  1FGB D;  4XT1 B;  2F0L A;  1PTO C;  2EJG C;  1DON A;  5FO9 B;  4H7B A;  5FLX L;  1MSG A;  2XN9 C;  2NN6 G;  4N9P A;  3K5N A;  3LWE A;  4I65 A;  2WP8 J;  2K03 A;  3IAY A;  1GHK A;  1ML0 D;  1TS2 A;  5D14 A;  4XT3 B;  1YNN C;  4C3H B;  1GJX A;  2MHV A;  3TSS A;  1PDQ A;  1S5D D;  1HFN A;  4QF4 A;  4H44 C;  3A55 A;  1SYD A;  1X3P A;  4WOR A;  2EY1 A;  2WAQ B;  4DGZ A;  1XX8 A;  5HGT A;  1EL0 A;  1M8A A;  3ND9 A;  3P7J A;  1IKL A;  1SYF A;  1JB3 A;  4BBR B;  4KMU C;  1LLR D;  4PMB A;  1OXS C;  4A3G B;  5ELD A;  3SK8 A;  3MFG A;  3VR5 A;  2B63 B;  2F0D A;  1CQV A;  4RAU C;  5IGC A;  2AWO A;  1G29 1;  4KN4 C;  3SXH A;  2AWN A;  2HQE A;  1G91 A;  4LK1 C;  3Q0A A;  4BWG B;  3PIO 3;  2NVY B;  2F0W A;  3NBH A;  1A15 A;  4ID6 A;  2Z4I A;  1SYE A;  2A68 C;  3T53 B;  1F9R A;  2K32 A;  4ZAI A;  5K36 H;  3OPO A;  5JEA H;  4A3M B;  1B50 A;  2MPM A;  1B4O A;  1EYC A;  2F0G A;  3URY A;  4J1M A;  5M3M B;  2NTS A;  4PV1 C;  4IUP A;  1STE A;  4EQN A;  1H9M A;  4DA2 A;  1SYB A;  5EKK A;  4PMC A;  3NQI A;  4XQJ A;  1LTA D;  3TZU A;  3FMC A;  3S1N B;  2F0P A;  1KTK A;  4X3U A;  1KLG D;  3VA5 A;  1YNN D;  2E2H B;  2VNU D;  1LTS D;  5FKA C;  4A3D B;  2IPK D;  3GTO B;  2RDH A;  2BA0 A;  1LTI D;  5CMD A;  2A6H C;  4A3B B;  5JVG 3;  3TP7 A;  1Y69 U;  2NUC A;  2J0T D;  1WTO A;  5JPM C;  2DY8 A;  2B2T C;  2FJ2 A;  3VR6 A;  3Q6S A;  1PRT B;  4RA8 A;  1SE2 A;  2VB3 X;  4DK0 A;  2EPB A;  1TS4 A;  4JBW A;  3V05 A;  3V2T A;  1TKW B;  1RHP A;  3JAM E;  2IX1 A;  3QG1 A;  1NUC A;  1AFP A;  5KYL A;  2AQ2 B;  2RDG A;  1PFB A;  1I50 B;  1E2W A;  1WCM B;  2C9O A;  1LT4 D;  4V19 0;  1GOZ A;  3MXP A;  5ELC A;  5EPJ A;  2JA6 B;  3S15 B;  2A68 D;  1I4P A;  2EYF A;  3KLS A;  2E74 C;  1CK1 A;  3I4L A;  2LKV A;  4IFD I;  1AP0 A;  2WV6 D;  2J4X A;  1EQV A;  3H94 A;  1TWG B;  5DM7 3;  2K6A A;  1ROD A;  4X3K A;  2R3Z A;  4KKT A;  5EBD A;  2E76 C;  3LNN A;  4L63 B;  3R93 A;  1Q1B A;  3T51 B;  4TKO B;  1CFM A;  1JWM D;  5K36 G;  5JEA G;  3PO2 B;  2F0S A;  4G57 A;  1GUG A;  2IX0 A;  2H1E A;  2JP1 A;  3ZYY X;  1V1P A;  4DF7 A;  1GUS A;  2QDB A;  1BR9 A;  1C8C A;  2KA7 A;  2RA4 A;  5COY A;  1RCV D;  3IL8 A;  1RKN A;  1CQF A;  5KNC A;  4HSP A;  1GHJ A;  3TP8 A;  2WAC A;  3CKI B;  5M5X B;  1EIH A;  5C0X I;  1ZYR C;  5G3L F;  2JYO A;  4PMW A;  4RGN A;  4H13 C;  3FRP B;  3MXG A;  3ERQ A;  3Q23 A;  1BCP F;  1TVX A;  1SJE D;  4K6D A;  1HXY D;  1KAA A;  4OO1 I;  3K57 A;  1S5C D;  1R4P B;  4RKB A;  1DXM A;  3C3L A;  2RBM A;  2NYZ D;  2RKS A;  1EEI D;  2L4N A;  1B9N A;  5IGD A;  3I72 A;  5CR3 A;  3EQL C;  1EOT A;  3S14 B;  2HCI A;  4ABN A;  3CRK C;  3QWN A;  2QEJ C;  4FVM A;  2K7V A;  1AEX A;  2F4I A;  4NDX A;  1D5Z C;  2ICI A;  4CKC A;  4XQN A;  1TS5 A;  1ZKO A;  4IUV A;  3BS1 A;  4HMJ A;  3BVM A;  5LL6 X;  2OEO A;  1MI2 A;  2DNE A;  1I3Q B;  4QCL A;  1JIC A;  1JOR A;  5C44 B;  1JWS D;  2PW7 A;  4RH6 A;  2RQX A;  4KI0 A;  1ESR A;  3I91 A;  2PZT A;  3EA6 A;  4B9W A;  2WII B;  4KN7 C;  4J6H A;  2R6G A;  1LTT D;  4QUC A;  1VDZ A;  4Q5V A;  1VMC A;  4HCS A;  1YNJ C;  5JVH 3;  3TZD A;  1X3Q A;  2K33 A;  1CHQ D;  1DD2 A;  1F9Q A;  4CJ1 B;  2B2T A;  4KK7 A;  1Z7T A;  4K14 A;  2JSO A;  4F87 A;  2O5I C;  3BZD B;  4G7Z C;  1A2T A;  1H9R A;  3MXU A;  4K8J A;  3HGB A;  5ISR A;  2B2W C;  3I73 A;  1EFI D;  3C2P A;  4KTA A;  3PUX A;  5IT9 L;  4RFB A;  1O7Z A;  3PUW A;  2O2L D;  3QO2 A;  5HUR A;  2M9V A;  5C4J B;  5JPN C;  4EGV A;  4KKS A;  2SNM A;  3CHB D;  4M1U B;  2F0Q A;  4G7H C;  1B1Z A;  3SVM A;  2A6E D;  4U67 3;  4QB4 A;  2NN6 H;  5DEH A;  2EYJ A;  3NBI A;  2PCF B;  5EKI A;  3QB3 A;  3GTK B;  5J1Z A;  1EIG A;  4HED A;  2KCC A;  2EYM A;  1RDP D;  4FXG C;  1U4L A;  3S2D B;  3A7A B;  1WTQ A;  3OW7 A;  4K5X A;  3MWY W;  3H6M A;  3C1F A;  1ENC A;  3K6O A;  4MHE A;  1YNJ D;  3HOU B;  3UI2 A;  2FIN B;  1NSN S;  3VYU A;  3NSW A;  1PTO B;  2VXW A;  4C3H G;  3BDO A;  3KUP A;  1C48 A;  1QIL A;  3WDN A;  5IGG A;  1S5B D;  3HRZ C;  3DUZ A;  2ZT9 C;  1J9O A;  5G3L D;  3TP6 A;  4HSV A;  3RZO B;  1BCP D;  4X3T A;  1PYW D;  4KKU A;  2F0N A;  2Q8I B;  4OHJ A;  1V1P B;  2EYP A;  3KF8 A;  3HZX A;  2EY5 A;  2M2L A;  1D1I A;  2R93 B;  2F0O A;  1KDB A;  3FPP A;  3VYR A;  4XIG S;  1AN8 A;  4DU9 A;  1D5X C;  3NWT A;  5CYU A;  1TY0 A;  2QCP X;  4IUQ A;  3KLR A;  5KRU A;  1EU4 A;  2O4X A;  4H0L C;  4ZQ3 A;  3NQT A;  1IW7 C;  1IYU A;  1UAP A;  3AB9 A;  4X3S A;  1LTB D;  1U9R A;  2L1B A;  1A6X A;  3F2U A;  1RF2 D;  2EVB A;  2PZW A;  3E6Z X;  1S5F D;  1EZ6 A;  3VYT A;  3EVQ A;  3QOL A;  2KUM A;  5M5Y B;  2BCO A;  2A73 B;  1I4R A;  5FO8 B;  1GUN A;  2L55 A;  4KY5 A;  3PO3 B;  1F2Z A;  1HUM A;  3FVQ A;  4PQX A;  4ULL A;  3NK9 A;  3DEO A;  3SE0 A;  2MGS A;  2PMZ B;  1F2M A;  5I2X A;  4NP5 A;  1XXG A;  3JAM L;  1VF7 A;  1GUT A;  1STY A;  2NVX B;  1K8M A;  3OHX C;  5KND A;  3OWE B;  4BS9 A;  4ZKB B;  4K2L A;  5E1F A;  4DAV A;  3H3V C;  1LTR D;  2BA1 A;  2TSS A;  1IKM A;  1E2V A;  4O42 A;  3DEP A;  4Q0F A;  4F88 A;  1FNU A;  2XNA C;  4C1N I;  2L9H A;  2R61 A;  5C6A A;  5DNF A;  1DOL A;  3R2I A;  2EXZ A;  1TWC B;  3WOF A;  5CBE E;  3I4N B;  4TQU S;  4HR7 B;  2B2W A;  3OSO A;  2IT1 A;  4HCE A;  2PPB C;  2Y0S B;  3LWU A;  1Y8N B;  3FKI B;  2VUM B;  4QIW B;  1PFN A;  3RD4 A;  5I9O A;  1IW7 D;  4L8J A;  3T4A C;  1O7L A;  2DNC A;  3QOJ A;  4NMZ A;  2NN6 I;  1STB A;  2R92 B;  1WTV A;  1ZEQ X;  3OOC A;  1CZW A;  3K5O A;  4XXE A;  1QE6 A;  1PZK D;  1MD2 D;  3KLS X;  2F0J A;  1JOO A;  4DFA A;  3T56 B;  2PQE A;  3A8K E;  4R8N A;  1SAP A;  1STN A;  3R8B A;  1K8O A;  1I6V C;  1PZI D;  5F2D A;  1SE3 A;  3A7L A;  2N55 A;  1Z6H A;  1A3T A;  2D9U A;  3KBX A;  1EY6 A;  1QB5 D;  1H9S A;  3J7A V;  3FDT A;  2NVT B;  4FXD A;  1C4Q A;  3GTP B;  4IN3 A;  3MXN A;  2XIW A;  3G7L A;  4IFD J;  1ILP A;  3I70 A;  3TME A;  4CKB A;  3GP7 A;  1WD0 A;  3GV6 A;  3PV0 A;  3M3Y B;  3N52 A;  3VYS A;  4DAY A;  3I90 A;  3DWP A;  1CT1 D;  2RVL A;  4C56 C;  3SK4 A;  3L9A X;  1WD1 A;  1EQT A;  5EGT A;  3PUV A;  5JJZ A;  4L6T B;  2NVQ B;  1SNM A;  1PRT F;  2JA5 B;  1RJT A;  4FF4 A;  1O80 A;  1T5E A;  4RKL A;  2VB2 X;  1TT2 A;  1UUP A;  4A93 B;  5KYI A;  2IWH A;  1D2B A;  3SK5 A;  2NWG A;  2V4D A;  5I9P A;  2ID0 A;  1JOQ A;  3S1R B;  1QWY A;  1BQQ T;  1ICW A;  2WIN B;  1CHP D;  1BNZ A;  4YIJ A;  1PTO H;  5C0X J;  3S17 B;  2J7Z A;  3MVV A;  1SMY C;  1ZXT A;  2NBF A;  2RSO A;  4A3F B;  5EQ0 A;  4ZUJ A;  4BA1 I;  1DOM A;  2R7Z B;  2MUY A;  1SXT A;  4M8A A;  4AYB B;  1UNS A;  1TII D;  5CV5 A;  5M3F B;  1K83 B;  2EYO A;  4FF1 A;  2MP1 A;  4HAE A;  2EZV A;  5DAU A;  3S1M B;  4KJO A;  2EE1 A;  1I4X A;  2JA7 B;  1HTP A;  4WFN 3;  1H9J A;  3M85 A;  5EPL A;  1JCK B;  2KQ3 A;  5DM6 3;  4KHZ A;  4CBV A;  5KGU A;  3P1H A;  1FNW A;  3L3O C;  1DCZ A;  1SE4 A;  4LJZ C;  4WJW A;  3KK7 A;  1NR2 A;  1HFG A;  1Y8O B;  3GO5 A;  2WKC A;  3M4Y A;  4HN7 A;  5IGF A;  5BN3 A;  4DN4 M;  1BXT A;  3HOZ B;  2A5H A;  1OO9 B;  3SDZ A;  3MC0 B;  2BE5 D;  3PMF A;  2QIL A;  3CU7 A;  1DZ1 A;  1F2Y A;  5D3I B;  3CRL C;  5K5P A;  4FF3 A;  1KNE A;  1SMY D;  1CTM A;  2F0F A;  3A8J E;  2K5D A;  4EVO A;  1HPC A;  2M00 A;  2A6E C;  3SR1 A;  3GQB A;  2L11 A;  3OMC A;  2CQA A;  3HS0 C;  4ZUI A;  1R4Q B;  1SND A;  2KJX A;  2K05 A;  5CV9 A;  1F9S A;  4TRD A;  5AFW A;  2EDG A;  1DOK A;  4BA2 I;  4B08 A;  1T5X D;  3HOW B;  2XVS A;  5KEE A;  4DNT B;  5M9O A;  1J8I A;  2K1B A;  1EY7 A;  1HHV A;  2QF7 A;  1I6H B;  4K5W A;  3BVG A;  3I8Z A;  3WOE A;  4FP5 D;  1AZP A;  3TBI B;  4RHS A;  2L0C A;  5CV4 A;  2F0E A;  1H9S B;  5T1G A;  2B2Y C;  4FNF A;  2E2I B;  4ZRZ A;  1B53 A;  2F0K A;  2XWB B;  5A2Q E;  3E0J A;  1ESF A;  1BCP C;  1HCZ A;  5EJW A;  1STA A;  2FMM A;  3SHL A;  3HEJ A;  1R9T B;  2EY6 A;  1DM0 B;  3OWF A;  4O1N A;  2H4O A;  2PYK A;  3ERO A;  3Q22 A;  1HQR D;  1B44 D;  1MBY A;  3P20 A;  1W6K A;  1F2L A;  3DM1 A;  2Z8L A;  1CZG A;  2FMC A;  3QIA A;  3NUC A;  3OIQ A;  1U4P A;  2CVR A;  3PUY A;  1Q3L A;  1O78 A;  2L5T A;  1JOK A;  1EEF D;  2CW0 D;  5LL6 S;  2HUG A;  1CA5 A;  5C4H A;  2KEE A;  3VR2 A;  2B2U C;  1ILQ A;  3S2H B;  3GTQ B;  3J7Y W;  1LV9 A;  1QJO A;  4FYD A;  4OGQ C;  2IL8 A;  3NPP A;  3A8I E;  3X3M A;  1RTO A;  3W3A A;  4C3I B;  1BOS A;  2N88 A;  3L7Z C;  4S3S A;  2OF1 A;  3R3O A;  2Q8T A;  1EU3 A;  2A74 C;  2EYL A;  1EY9 A;  5KIX A;  1SYG A;  5FK9 C;  2F1M A;  3S1Q B;  1SEB D;  4EQP A;  2PO4 A;  1PTO F;  5CV7 A;  1DJR D;  4IUU A;  4QMG A;  3TN2 A;  1SBB B;  1OXT A;  2BDN A;  2NTT A;  4XTC S;  4GZY C;  1I4H A;  3DMU A;  1L0Y B;  3AMU A;  3N6R A;  4WRD A;  1JC7 A;  3HOV B;  2JE6 I;  4RCO A;  1AW7 A;  1VMP A;  1EY5 A;  1W6J A;  1HQM C;  3J80 E;  4F8M A;  2IW3 A;  1HRJ A;  1Y8P B;  5I4D A;  1ENA A;  1II3 A;  1QCB D;  4XQQ A;  3CQZ B;  5LHY 1;  1M4V A;  1KNA A;  2SOB A;  2JEA I;  3BDC A;  4A3K B;  1L0X B;  5I2Y A;  3OIP A;  1TWF B;  4G7O C;  2KEC A;  4BY7 B;  1TWA B;  3E5S A;  1SNP A;  1KDC A;  3W2D A;  4RHR A;  2WB1 B;  1TR5 A;  4FO2 A;  3K7A B;  1PLF A;  4ME5 A;  2KED A;  1JE4 A;  3EFX D;  2B8G A;  2EJF C;  2IJ0 A;  4RCN A;  1A2U A;  4NW2 A;  1VF5 C;  2KCN A;  5TSS A;  4QUF A;  4ZK9 B;  5BN5 A;  5ELF A;  4IFD H;  2KVM A;  3D4D A;  1B2T A;  2EYH A;  3NTH A;  4I7Z C;  1JWU D;  1F9P A;  2OT2 A;  4K6L A;  2F03 A;  1STG A;  5ELE A;  3K5M A;  1V43 A;  1LT5 D;  2BDO A;  1U4M A;  2B2Y A;  1SDF A;  3OMG A;  1G8Z D;  4ILW A;  2ICE C;  1TY2 A;  1EWH A;  2EJM A;  3H09 A;  3I4M B;  2Q8R E;  2E2J B;  1PXU A;  1S5E D;  4CHT B;  3MEH A;  3S16 B;  2ENB A;  1FD7 D;  3NHH A;  1EYA A;  1GUW A;  4MIU A;  3MTS A;  2A69 C;  3SEB A;  3S9W A;  1SNC A;  2PW5 A;  1SFO B;  1F77 A;  2CHB D;  4KJN A;  2E2D C;  3RZD B;  2X69 A;  5C0X H;  4N9T A;  1LTG D;  2TMP A;  1G2S A;  3MFY A;  1Q12 A;  2EOT A;  4C3J B;  2O5J C;  2AQ1 B;  4IUT A;  4OO1 H;  1STH A;  2B2V C;  2HCC A;  3DWQ A;  5I6Y A;  1LAB A;  2AUK A;  4OIJ A;  3MAQ A;  5FOB B;  2B2U A;  5EKL A;  1UEA B;  3DXJ C;  1D6E C;  1PFM A;  4P2C B;  3G6J B;  1Y1V B;  4DXF A;  1O7Y A;  1G2T A;  3U9S A;  1KLU D;  4ZKC B;  1B9M A;  4RWS C;  4K2K A;  3J81 L;  5C3X A;  3GD7 A;  1E0B A;  4ODG A;  1X32 A;  2F0H A;  1PTO D;  1SNO A;  2SDF A;  5EPK A;  1KAB A;  2YU9 B;  4KHV A;  1IYV A;  3D31 A;  2NB0 A;  1I4Q A;  1GUO A;  1PMR A;  3BG3 A;  1ONL A;  5CV6 A;  4KD3 A;  4IZ8 A;  3V96 A;  1EY4 A;  4IFD G;  1TU2 B;  3D6C A;  3D4W A;  4JK1 C;  3HG9 A;  1SSO A;  2RDF A;  4LAA A;  2A69 D;  1WVL A;  1HA5 A;  3IFD A;  1CA6 A;  5JOB A;  1EY0 A;  1BBX C;  3ND8 A;  4XYO A;  4XYQ A;  2LS0 1;  5IGB A;  4KV6 A;  4K5V A;  3K59 A;  2EY2 A;  1D5M C;  5JAV A;  3GTM B;  1FR3 A;  1IL8 A;  3R2T A;  5FLX E;  3AU7 A;  2WKD A;  1Y1W B;  4MN3 A;  5IIF A;  1BUV T;  4E6I A;  4R8I A;  2F0V A;  2MJ8 A;  5D3D A;  2BE5 C;  3SK6 A;  2XRS D;  5FO7 B;  5A2Q L;  2E75 C;  3GTL B;  1ET6 A;  3FPU B;  4NKL A;  1QNU A;  5M5W B;  1Q1E A;  2AQ3 B;  2I07 B;  4IUR A;  4EQO A;  4OIK A;  2HDL A;  5C0X G;  5CC4 A;  5D65 A;  3P75 A;  4R9W A;  3D8G A;  5C3E B;  1GXD C;  2F3V A;  1KDA A;  1EYD A;  2KOL A;  2L12 A;  1S4Z A;  4OO1 G;  5JEA J;  2ZXO A;  2KHS A;  1XYI A;  4RGO S;  1FNV A;  1Q90 A;  4BBS B;  5J22 A;  3HOY B;  3GTG B;  1EZ8 A;  2HDM A;  1BO0 A;  2F0I A;  3PIP 3;  3I3C A;  3TDQ A;  4KY6 A;  4DNR B;  2XSC A;  2SNS A;  1CI3 M;  1XWE A;  2A6H D;  3HP3 A;  3KBG A;  3IFT A;  3K5L A;  3J7A F;  2G9D A;  4DK1 A;  1PRT C;  5J39 A;  2X6G A;  1WTW A;  3MHB A;  1IHZ A;  3J81 E;  4ZYS A;  3D6W A;  2BOS A;  2LY7 A;  1BCP B;  2XWJ B;  2XRQ D;  4CJ0 B;  1TQO A;  2RSN A;  3A54 A;  3EJI A;  1A3U A;  4K8I A;  1NAP A;  5I6W A;  4UAI A;  1LT6 D;  1HUN A;  3T16 A;  2JEB I;  4A3I B;  2NZ1 D;  5E4X A;  3M7N A;  4ZLT F;  4BY1 B;  1SYC A;  2ZXR A;  2OXP A;  1U4R A;  2B2V A;  1QOH A;  4RGM A;  4U68 A;  3D3R A;  1WTP A;  1HTL D;  3IKJ A;  4HTH A;  5BN4 A;  2JA8 B;  4IQZ A;  1ENF A;  2F0M A;  3DHQ A;  1LAC A;  4C3I G;  2CW0 C;  2K28 A;  5T1I A;  1NCV A;  1CM9 A;  2G9H D;  3MA2 B;  1BDO A;  2I46 A;  2D2C C;  2JXM B;  4FXK C;  1H9K A;  1V8Q A;  3NTK A;  4G4K A;  3J80 L;  2QKI C;  3RUZ A;  2YYZ A;  2PNR C;  4C1N K;  1MGS A;  2K01 A;  5IGE A;  5CV8 A;  4DAP A;  4C2M B;  1AZQ A;  2C5C A;  1SNQ A;  3NE5 B;  5C5L A;  3HOX B;  5ELB A;  1B3A A;  1VCI A;  3RLF A;  3T13 A;  1PRT D;  2K5Q A;  3M7G A;  3H91 A;  1OXX K;  2LMC B;  1WTR A;  3LX0 A;  2ZXP A;  2K04 A;  1QG7 A;  1QNK A;  3M4O B;  1OXV A;  2GA4 B;  3GV3 A;  4Z9C B;  2D5D A;  4OL7 A;  1V1O A;  2B8F A;  1TWH B;  2DY7 A;  1ZYR D;  4B9X A;  4HMI A;  1LT3 D;  1LO5 D;  3MZ5 A;  2F3W A;  3GTJ B;  3A56 A;  5COR A;  3X3N A;  3RMH A;  3K0Y A;  2Z4H A;  2AUJ D;  5NUC A;  3ONA B;  4A3J B;  1MSH A;  2SEB D;  1I4G A;  4CKE A;  4Y7N B;  3VR4 A;  3C46 A;  4DXG A;  2DN8 A;  4LMQ D;  5C4X B;  1ET9 A;  3BYY B;  3VR3 A;  2K5W A;  3NP8 A;  2F0T A;  4KD4 A;  4CJ2 C;  1PZJ D;  3VA7 A;  4PNY A;  3BYT B;  5KNB A;  3U9O A;  4KY7 A;  5A35 A;  3BDL A;  5IOD A;  1G6Z A;  1Z47 A;  3D4R A;  5E4W C;  1NR4 A;  1BF4 A;  1E2Z A;  1A3V A;  3Q24 A;  1EWC A;  2F0U A;  2X6L A;  3O13 A;  5C5M A;  4F7X A;  2FFK B;  5CGK A;  2FHT A;  3K58 A;  1RD9 D;  3ITP A;  1OXU A;  4XDX A;  4J8Q A;  4UDU C;  3BVZ A;  1RTN A;  5EBC A;  5E3F A;  4V0B A;  1XTC D;  3QJY A;  3H0G B;  1DYQ A;  3C1E A;  1EY8 A;  1D1K A;  5C3W A;  2LFN A;  1Q8I A;  4IUN A;  5C4Z A;  4TSS A;  3NXW A;  5CBA E;  1TS3 A;  4C3J G;  4RGT A;  3TP5 A;  2PZU A;  4A3E B;  1HA6 A;  4FF2 A;  3PUZ A;  3NTI A;  2IX3 A;  1WTX A;  2Z1C A;  3FEW X;  5IOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...