1EESA

Solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
178
structure length
178
Chain Sequence
b'MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN
molecule tags Structural protein
source organism Homo sapiens
publication title Structure of the complex of Cdc42Hs with a peptide derived from P-21 activated kinase.
pubmed doi rcsb
total genus 14
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1eesA00
2DYKA 2R62A 5FPTA 5AUPB 3IQWA 4RVCA 3E1SA 3DKPA 2QM8A 4L5BA 1NY5A 1XBTA 1VG1A 3H86A 2CL6X 2AD5A 1Z0DA 2ZRHA 3AUXA 3U3KA 3OAAD 3TAHA 1X8LA 2FN4A 2Y8EA 3NBYC 2X19A 1CF4A 1D8TA 1IY2A 1E4VA 2JGNA 2ZRAA 1T5IA 1EG7A 5D3MB 3C4JA 1ZU4A 1P2TA 2CLCX 3VFDA 1G4AE 4QXAA 4XWOA 1ZNWA 3U7FB 2REOA 4GBMA 2PMDA 2YWHA 2OE2A 2JIZD 2KB0A 2NO6A 1P72A 2QMHA 2EW1A 4WZBE 2GJ9A 4OL0A 2C96A 5LD2B 4FCTA 4B2IA 2GJSA 4M1SA 1G6HA 621PA 1BO6A 2ZYTX 4RKFA 1BOFA 1LNZA 1XTSA 2ZI3A 4OQMA 4C0HA 1I2DA 4YONB 4QBFA 3ADCA 5KPDA 1BKDR 4B2PA 1QZXA 5FBRB 2QL6A 3MSXA 4TZ6A 4IDHA 4CEJA 2C04A 5AJXA 1W0KA 2MMGA 3O8DA 3LVRE 2IYUA 3HYRA 4POAA 1P7CA 2QGNA 1US8A 3AVPA 5CLQA 1KJZA 1Z22A 4JKYA 4UQOA 4W9MC 3RWMB 5KUTA 2UKDA 1EWRA 3DOFA 3X2SA 3Q3JB 1Q22A 3MJRA 4Q5IA 1F2TA 3K09C 3U2QA 1QG2A 2AX4A 2NPIA 4Y0VA 3ZZ0A 2AKYA 4U02A 3L0PA 4BFUA 3KQHA 1OXTA 1AKEA 1G7RA 1R2QA 3D3QA 4MYCA 2OLJA 3GLFB 3MMPA 1CRPA 3QPWA 1E2FA 2H18A 1NLZA 2H8KA 2OILA 4B44A 4OK6A 1DAIA 1G8YA 4BEBA 4BASA 1G8FA 1VG0B 1ZUIA 4LK2A 2YC2C 2IEYA 3GFPA 4QNRA 5EQTA 5FTLA 2CCGA 2D4HA 2HCJB 5B58C 2ZAMA 4NMMA 4NE2A 3WY9A 4A0HA 3BH6A 3X1ZA 5E3HA 1X86B 1NVVQ 2OBNA 1NKSA 1E99A 2R9VA 3PV0A 1BMFD 2BJWA 1W4CA 3AEZA 1BIFA 5KHOC 1TF7A 1KO8A 3LX8A 3LVQE 1E2DA 3BRWD 4NYMR 2FU5C 5CIQA 3OEEA 4TMXA 5UKDA 3CNOA 1CR0A 3O8RA 1TQDA 3AKYA 3U3JA 5KNDA 4M9ZA 4C0JA 1E1QD 4LBVA 4D26A 1TQ4A 1Q12A 4Q02A 4TMZA 3ZVMA 4P4TA 3VQTA 3D8BA 3PUYA 4HB3A 4OJQA 3TUIC 2BBTA 1OYYA 3NTUA 5CDFA 1VCOA 2O8DB 1N6IA 1GKUB 4IOLA 5DYGA 3BB1A 3DKVA 4C0KA 2XNDD 4R7ZA 3QKSB 1F2TB 2YOHA 4NPHA 1GILA 3N70A 1KSGA 5E7JA 1QHGA 3MG9A 4CT4B 2XITA 2DFNA 2CCKA 1OH5A 1J2JA 1S9DA 3T12A 2P65A 3H0KA 4ZV4A 1HTWA 1U99A 4RD6A 4B48A 3V4RA 2A5GA 3NG1A 1H8ED 2ZJZA 3NKVA 5AR1A 4DHEA 5HE9A 1NVXQ 1H8EA 4WZAE 2CLDX 3CF0A 3GQBA 4A2PA 2CBZA 2BBWA 1W0JA 4FIDA 3C41J 2OESA 4ZI2A 2XTMA 1YZLA 2QORA 1N5LA 3BERA 5A0FA 3GLHE 4KXFB 2DWPA 2P67A 2VHCA 3SBDA 5M04A 1L2TA 5JI3E 3B8HA 3OF5A 4DCUA 1G4UR 4MH0R 5JRJA 4HAZA 1F2UA 2ZR0A 5DH9A 1KMHA 2QPTA 2ANCA 4M8NE 2GNOA 1CR2A 1AK2A 4NDZA 3BS4A 4M9SA 1EFTA 1XXHA 1YKSA 2A5JA 4A0GA 3GLIA 1E2JA 2GJAA 3KJEA 3REGA 4IVRA 3CWZA 4L9SA 1HT1E 5TDHA 2GHIA 1P73A 2ODBA 1RC8A 1CP2A 1UADA 3D7MA 1CJUC 1BYIA 3KXIA 1GWNA 2C77A 2AWNA 4TQUS 1QHHA 1N25A 4A82A 2W6JA 4JL6A 2ERXA 3DL0A 4CVNA 3QE0A 1NP6A 1Z07A 5ANRB 1UDWA 5LPNA 1N6HA 1GDDA 4KLZA 1UKVY 3BD9A 5J4YA 3EIEA 1U81A 2AKAB 1W1WA 4GZLA 2WOOA 1LS1A 3FTQA 1EX7A 5HZHA 2FEMA 1XTIA 4C0LA 1D2EA 4DLXA 1W2GA 4FD2A 1CKEA 4XOIA 2IYYA 4BFWA 1R0WA 5JCZA 3LW7A 4FWIB 4EIWA 1V5WA 1P62B 1VYTA 3P26A 4OI1A 3RANA 4HSEA 3UG7A 4B47A 4A36A 3QENA 4JMPA 2GESA 1A4RA 1T4GA 5G53C 1AS0A 2WWWA 4DCTA 4ZIRA 1K8RA 3AV0B 1CEEA 1D5CA 4Q4AB 4HLDA 4HDOB 3GEHA 2WJHA 2QZ4A 4ILEA 4QJ5A 4DSUA 3MRSA 2DHRA 3WMEA 5E7IA 1UEIA 1XMIA 2KSQA 2CE7A 2QU8A 2OM2A 4PO8A 2WKPA 4QJ4A 4IDQA 4AK9A 4QBGB 4YXWD 4LZZA 2F3TA 4EPXA 2O8FA 4EAQA 1YR6A 2O0KA 5JWOA 3KJGA 1HQCA 2YKGA 1MO4A 3K0AB 2IS2A 1P9RA 4PHGA 4RZXA 1UBGA 1OYWA 2EWVA 3OIVA 3ND9A 5FOVA 1N6RA 3AP3A 1KDOA 2VO1A 1YVDA 1KY3A 4WA7A 2ZIAA 3CIOA 4LDJA 2W83A 3EPHA 2IYLD 1P60A 2IK8A 2Q9CA 121PA 4GPTA 4V0NA 1CRQA 1T0HB 4OI0A 3ONWA 1F2UB 3LD9A 4OI4A 2GXQA 1W5TA 1RRGA 2YWFA 1SVIA 3B85A 2BBSA 2WZQA 3ZYCA 1OFUX 4AG6A 1TADA 1SVOA 1E94E 3CH4B 1P6XA 4I4LA 4XTRA 4C9BA 4I1UA 1EK0A 3JVVA 1JBKA 1AS3A 3RVBA 3ZS9A 3DHWC 3GCGA 2QGZA 2ZJBA 3QKTA 4OQFA 4OHZA 2YZ2A 4QKQA 1IONA 2BDTA 1M2OB 3GJ0A 2ZSAA 3THOA 3ZJYA 3R7WA 421PA 2ZE7A 2IBMA 2ZI5A 3CPHA 4ON9A 5JEDA 1CR4A 5G3YA 3LX5A 3UIEA 2EYUA 4P31A 1XZPA 4YDHB 3EIHA 2JJ2A 4NCHA 2RGEA 3BB4A 3THXA 4D4MA 2JJ8A 2IXFA 3VR3A 3QUSA 3K70B 4A0RA 4MGYR 2PT7A 2CCJA 1Z28A 2G0TA 2H17A 3FKQA 2EFCB 4LJ8A 2V7QD 2LWIA 4NCIA 4GOXA 2FSGA 1DARA 2Z43A 1K5GA 4QOSA 1RE0A 1HA3A 5GADl 3FOZA 1Z0IA 2ZEJA 4Q9JA 2KBEA 1XB2A 1SVWA 3K0FA 2G9NA 5J4LA 1RIFA 3Q7PA 4ZIRB 2FMXA 4MYUA 1FMJA 2IS1A 2PL3A 2FFBA 2BV3A 2FA9A 1NN1A 1N6KA 1IY0A 2XEXA 1WRBA 1GZSA 4QG7A 3AVXA 3MCAA 4ESVA 1OFIA 3L43A 3QJYA 1N6LA 3NH9A 1YZGA 3KUDA 4HB0A 4HI0E 4DUGA 4LX0A 1H8HA 1TU4A 2ZAOA 5C4MA 1AA9A 3M1IA 3N2IA 3A8TA 1YRBA 1QVRA 4TYNA 2JDIA 4MDFA 4CEHB 2DFLA 5E4FA 2QROA 2GETA 2F1JA 3E5HA 4TL8A 1TX4B 4AKHA 2E87A 1DAGA 4TLAA 5GVRA 4IXNA 1VG8A 3LXXA 2D74A 4PC2A 1FUUA 4LJ6A 5L3QB 1G64A 3LFUA 1LF0A 2Q3FA 3EASA 2ZRFA 1W36B 1GITA 2QM7A 1NJGA 1GRNA 5EE9A 4F91B 4LUCA 2CHVA 3EWSA 4FWTA 4DUGD 2GCOA 4JLOA 4BQSA 3U6BA 4Q7MB 4Q47A 3KKOA 4PHTA 1XD2A 1DPFA 2JLYA 1NI3A 1KK2A 4DCSA 2R6DA 2NG1A 1II0A 3LH5A 1SVLA 2FZ4A 2GJ8A 3R9IA 4AI6A 3EPLA 2ZRLA 1O3YA 2V6IA 1RYFA 3X1XA 1Q1QA 4H9GA 1S1CA 1XCGB 3FKSD 2D2EA 3MAAC 1K6MA 3LQRA 3GJ7A 1Q1BA 4A92A 5BWMA 4JS0A 4RD0A 1WBBA 1XP8A 3MWLA 4Q48A 1BMFA 3PEYA 1LTQA 4Q7KA 3U4QA 1E2NA 2QG6A 1HEIA 1M34E 1RRPA 1Q1EA 2OXCA 1DAFA 3AGQA 5CLLA 3HPRA 2QY9A 1WMSA 3T1OA 1IXRC 2JCSA 1T8UA 1ZM2A 5JJKA 3S1AB 1C4OA 4M1WA 2ZRIA 4D80A 2CLSA 4L4UA 1E79A 2OAQ1 3NVAA 4C2TA 5AUOB 3TJZA 3TNFA 4YLGA 2CMKA 3AH8A 2RGAA 2OSBA 3FGNA 4UXHA 1XNJA 1OB5A 4OHXA 1GL6A 4GFDA 1VDZA 4RKEA 221PA 1G7SA 4HUQA 4DVGA 1NBMD 4FINA 2NMVA 4Q4JB 3QXHA 2KJQA 3VR1A 5JI2E 2ZI7A 4UXJA 4TL7A 1Z3IX 2H92A 2YVUA 4QM7A 2CL0X 3MWJA 3B1YA 3AKDA 3O8CA 4DLSA 3QXXA 5P21A 3B1ZA 1YZNA 1Q3TA 2CE2X 4PFSA 3TGPA 4CEIA 2FGJA 1MO6A 1XXHB 1XEXB 2IYQA 4NTZA 5KO2A 4PSKA 3HJNA 4QNMA 2L0XA 3RAPR 4BFSA 3K0FB 1KI4A 4K8OA 3H84A 4JLBA 5BXQC 3A1WA 1WBDA 1CTQA 4C7OB 4Z1MA 4YMWA 4HAYA 1Z5ZA 4PPNA 2WKQA 1R7RA 1KDRA 1XFAA 3QY0A 4IVPA 1J99A 2C8VA 2PEZA 4EJSB 1HV8A 2QQEA 4C3ZA 4FN5A 2WV9A 4X8LA 4DSOA 5JFGA 2VYFA 3S1AA 3AF3A 4DJTA 1R10A 1IN6A 1NN5A 5L3VA 3LA6A 1L4YA 3GJ6A 2WWFA 4KITB 3O47A 4C0BA 3BFVA 2EYQA 3L0IB 1FPMA 3CLVA 3I92A 5G40A 4EKDA 3KX2A 3QG5A 2MMCA 4O2RA 1VCNA 3VX3A 4JSTA 5B2ZA 4GP7A 3CZPA 1TQ6A 4G5QA 4Q18A 2D62A 3CRVA 1U2RA 3E70C 3CPJB 2WICA 4AYWA 4QRHA 2FZLA 5G41A 1XTQA 2RGGA 2A78A 5FUXA 4PPFA 1U94A 4US1R 5HTKA 4BFYA 3EZ9A 4R2IA 4KLNA 4BZPA 5KSOA 3B78A 721PA 1QDEA 5TXGA 4OK3A 4KCGA 4LBZA 3GLFE 1EFHA 2OFXA 4MA4A 1PV4A 1KY2A 2FDCA 4EFLA 1OV4A 4RFSB 1JPJA 3A37A 1AZSC 2HF8A 3QXCA 3THYB 2MSCB 1SKYB 2OBLA 2C78A 1JR3E 4CDGA 5HKKA 2IYWA 3CBQA 1E96A 1KNQA 2IUSA 3IUYA 5JS7A 4Z8XA 2EQBA 2VRWA 3ZDQA 4XTCS 3KJHA 1OHHD 1QHSA 4B35A 4IJMA 4LJ5A 3ASZA 5FTKA 3SS8A 3GLFA 3SC3A 3PFIA 3FB4A 3RRYA 4LCBA 3GLHA 2ONJA 3ZZTA 5F98A 3KKMA 5CB8A 4W5WA 2W6JD 1CULC 3WBJA 2FSIA 4A6PA 1EESA 2A5DA 3GMTA 4A8JC 3SZRA 3GLGA 5JRZA 1JR3A 2VP9A 1VCIA 4M9QA 2WWXA 1M1YE 4CGZA 2AXNA 1OKKD 4BLPA 2ZS7A 3FHOA 2W00A 5LB4A 1XDBA 2VP4A 4DEXA 2A5FA 1WDTA 3CUEF 3E2IA 3SN6A 5JJLA 2OUKA 3QPUA 3VKHA 2IW3A 4CT5A 4JLKA 4CEJB 1NRJB 1NLYA 4K81B 1G16A 2GCNA 4LPKA 3ICEA 1S3SA 2VP6A 4P4SB 2BMJA 1A7JA 1WE2A 3CRW1 1GTVA 4M2LA 3TMKA 2I1QA 5JECA 5JWHA 2BKUA 2QI9C 3EG5A 1NVWQ 1M7BA 4MUBA 4XJXA 4A8JA 1VYUA 4RZ3A 5FPSA 4CEHA 1DE0A 3U3OA 2O8FB 1P2SA 4UKDA 5L8VA 1Z6AA 3B1XA 3EX7C 2QPAA 2JEOA 2H57A 1E9FA 3PXGA 1W36C 3ND8A 4BLRA 2BEKA 3SQXA 1V43A 4HB4A 4B33A 1N0UA 4B3BA 2W0MA 4PHFA 2NZJA 4Q4LA 1XPRA 4AY2A 5IK2D 1N5KA 2ODNA 4UJ5A 3ZQJA 1NMXA 5TB5A 1UKZA 3IPYA 5FOSA 1E0JA 3SJBA 4G5SA 3PIRA 1NBME 2WWYA 4DB2A 1M6NA 3HP1A 1LY1A 2BHRA 1N6PA 3GLGE 4QHTA 4UNQA 2BEJA 4MGZR 3TSZA 3SJAA 4DLTA 1EFRA 5CDFE 1XEFA 1N2CE 3PENA 3A6PC 3OZXA 1M8PA 4KVAA 2AN9A 4X8OA 1E3MA 3P20A 2LCFA 1GM5A 5H68A 4H1UA 4DLRA 1PZNA 1YE8A 3AVUA 3TLXA 3VAAA 2O8EB 1VIAA 3PEUA 4ACAA 1G21E 1ZVQA 1NIPA 2HXSA 4A2WA 4Q1BA 4ZCMA 2XNSA 4PQRA 3KTAA 1QHHB 2HT1A 1VHLA 2QMUA 2VSFA 3PR1A 3CNNA 2NOAA 1VCMA 4TYQA 1OIXA 1WXQA 4YC7A 5FBQB 1E9DA 2FEOA 5KSPA 4DZZA 3U6KA 4LYAA 3TW4A 2HCBA 2K5UA 2OCBA 2QAGC 3SBEA 4PQYA 2DFTA 1TEVA 5H8WA 2HUPA 4M4SA 3PJRA 2J1LA 3QG1A 3U44A 1CLUA 3LO5A 3W90A 2JLZA 4Q1DA 4EPRA 3IO3A 1RJ9A 2VHTA 5HZKA 1G7TA 2BBOA 2NZ8A 1E0KA 4NHOA 5BQ5A 1IXSB 4PX9A 2ZYVX 5EXXA 4I1OA 2FPMA 2FWRA 2JLWA 2ZE6A 2PLFA 4TTRA 2ZSEA 5DE3A 1OLOA 1E9CA 4ITRC 2QMOA 3QF4B 3SDZA 2KI5A 3EXAA 1Q3HA 1NY6A 5C4GB 4DCVA 1GOTA 2BMDA 1ANKA 1FUKA 1E9RA 1YR7A 2AK2A 2FPKA 2WHXA 3BOSA 3IO5A 4MKGA 4U5XA 4LGMA 4Z8YA 1DELA 4YMVA 1JEDA 2RAPA 3W6NA 3A4MA 4JLAA 2W2VA 3C5HA 5J5CA 5IK2A 3W6PA 4QGGA 4TMWA 4OQNA 2PZEA 4FMCB 1TMKA 4DIEA 2RH5A 3RDPA 2EFGA 4M9XA 1R5OA 4E22A 1WB9A 3QKUA 3NEJA 2FV8A 4JVMA 3AQ4A 5DI9A 3W3ZB 5EE1A 2V1XA 1KI6B 1K5DA 5J40A 1Z83A 3JVUA 4Q66C 4BFXA 4Q01A 1E2LA 4WVFA 3FMOB 2O52A 2ZJ2A 3U7EB 4RJLA 1OB2A 3QXSA 4KFTA 1Z2AA 4LC1A 1XTRA 3ASYA 1NVVR 4IOJA 1T3HA 2KBFA 4KO8A 2CVFA 3HU3A 2ZSBA 2BWJA 5B57C 4G5RA 4TLDA 4TMKA 3SR0A 2SHKA 1R8SA 4KYUA 4BGDA 1XEXA 2JLVA 2OCPA 4B32A 4WAUA 2QSYA 3A1SA 3OE7D 1XRJA 2O8BA 3CO5A 2XJ4A 2VH5R 1CJKC 1LFDB 5HKKD 5GJWC 4Z54A 1W2HA 1XZQA 4B3CA 2IXEA 521PA 2CDNA 3Q5EA 5EP4A 3I4LA 2DB3A 3ADKA 1OH8A 4L8GA 4DDTA 1U0JA 1M7GA 4G0NA 4L15A 4TL9A 2GXUA 4PPQA 4EFNA 4R98A 1NN0A 2F3RA 1E98A 1XCMA 5H70A 1NVUQ 3LY5A 2WM9B 1O87A 3Q85A 4W5JA 2QNRA 1KO1A 1UBFA 4TQ9A 2QA5A 5TV2A 3U7GA 4TYWA 1IN5A 4A2QA 4A4DA 4LC0A 4GDFA 3UMSA 5ELXA 3K09A 4B75A 4BFVA 2R6CA 2ZJAA 4OKSA 4D4LA 3KQKA 1ZU5A 2W6IA 4BE7B 2LKDA 5KPJA 2IF2A 4BPBA 1S2MA 1QRAA 2ODWA 5EJEA 2C9OA 3FE2A 4PO9A 4PHHA 1RKBA 5CYOA 4EPVA 1M74A 2J5XA 5FL3A 3RNLA 5AUNB 1ZNZA 4XSHA 3SHFA 3IQXA 2QE7A 1IOZA 3QOFA 4Z1MD 1UF9A 1YZQA 4PQFA 1ZCBA 2E9SA 3V00A 2GZHA 1X1SA 1VMAA 2R65A 3W3AA 2RKOA 3KZ1E 1IQPA 4TSFA 1XPUA 4D0NA 4JYCA 5EUQB 1OH7A 3P4YA 1E69A 3PUWA 4CYMA 2C99A 4D2IA 4C2UA 4TLEA 4KI0A 5F9HA 4BUJA 4ERNA 1G1MA 3K9HA 4NH0A 1KGDA 4QC2A 4ZKDA 3GJ5A 2ANBA 5CM9C 3LDAA 1G291 2VPPA 4JVSB 4XVQA 2FPLA 3CZQA 3DZ8A 1IN7A 2ZUDA 1QHNA 1KI7A 1HE8B 1GL9B 4WXRA 2JLQA 1NMYA 2C95A 3IILA 4GOKA 2XOKD 3C7KA 4Q1AA 1MV5A 3PITA 3TR0A 1KZ7B 4DRZA 1P61B 1SHKA 3NDPA 1XMVA 2WJYA 3I72A 3VR6A 3R8CA 2G88A 4IDPA 4B6FA 1KNXA 4NYIQ 3NWJA 4HAXA 2GKSA 3IEUA 4W7SA 1GRQA 1MO3A 4HLUA 1S8FA 4PAOA 3RS4A 4E09A 3ZZUA 1ZM9A 2ZRDA 5FOUA 2XSZD 5FFMA 1BYUA 2BM0A 1A5TA 4NYJR 4LJYA 1KO5A 2Q9BA 3DPUA 1DOAA 4BZQA 5KYKA 1PVOA 2HEIA 2FX3A 4M0LA 3B7GA 1T6NA 4DT1A 2XZLA 2GXSA 3UATA 2G3YA 4B73A 1T3LA 2ZANA 3I73A 3DVLA 2DPXA 4V0KA 4EQ6A 2H7VA 3KQLA 1C9KA 4OHVA 2GXAA 2YV5A 4RSGA 1JAIA 1QVAA 1S1MA 4MRVA 2QENA 4MYTA 4YXWA 2Q3MA 5JJIA 3K0EA 2J7PD 2XNDA 3A4NA 3TQCA 1FL9A 4XWAA 2XGJA 4DDUA 1Z6YA 3T1QA 4PR0A 1SXJE 2FOLA 3UXMA 3KDSE 2VF7A 3GD7A 1ZP6A 4F4IA 1ONBA 1XPOA 3G82C 2J45A 4Q03A 3WNBA 5LD2C 2GAAA 2GF9A 2RGNA 3KL4A 3NH6A 1YZKA 4ACBA 2QQ0A 4Z51A 5JSZB 1TL7C 4QGFA 2ZI4A 3W34A 5K8LA 2ZI6A 3OFND 4MYHA 1GFIA 3WYAA 2QSZA 3OIUA 4B71A 1DTSA 5FI0B 2GK6A 1ZRHA 1Q20A 1ZUHA 4Q1FA 4Q9LA 3ETLA 5AJVB 3I5YA 3ADDA 4PC3A 2F55A 4M1KA 1YQTA 4JLMA 4JJZA 5AUQA 4JLNA 2J59A 4IW3B 3CH5A 1VG9B 5HPYB 1KI1A 3I61A 2XSZA 2FE4A 4NP6A 2MSDB 4Q1EA 3FHCB 4KFUA 3JZAA 3QQ5A 3FHTA 2QPOA 4DT1B 1JB1A 4FMBB 3IIMA 3TE6A 5JWRA 4NYIR 2XZPA 5CITA 5FBVB 1Q1ZA 2FFQA 1B0UA 2F6RA 2GEVA 3ZIAA 3ZVNA 5KDDA 2IWHA 1G5RA 4QBIA 3NDBB 2WWIA 1SXJA 2ZE5A 1CJVC 1KOFA 3HR7A 4U00A 5LBIA 2RB4A 1KI3A 3OIYA 1Q44A 2W58A 5BN4A 4CZ2A 3SU8A 5BYKA 4P4SA 1JR6A 1X1RA 3GFTA 3GJ4A 3IIJA 4V0MA 2F7SA 2QTHA 3VU9A 3VX4A 3K1JA 3U3MA 4K46A 4C30A 2XTZA 5DHAA 2ZS9A 1XMJA 5FOTA 4DB4A 5GVSA 5AK0A 2G83A 1MKYA 2IWRA 3THYA 1SQ5A 2QMEA 1ZJ6A 2YYZA 4IKEA 4GP6A 2PEYA 3Q5DA 5EP2A 2GDJA 2NPFA 3VU9B 1A2KC 2W0SA 3EZFA 1ODFA 2D3WA 2IEZA 1D2MA 2HYDA 3UPUA 4KBGA 2ZRNA 1UEJA 4G5GA 3QEOA 3MWYW 3QIAA 4OHYA 1FQKA 4KJZA 4LHZA 4D0LB 1KI6A 5JCPA 3QVUA 1Q57A 4LJAA 5BN5A 2NTYC 3VHLB 4KAXA 4Q9HA 1JEEA 4ZPXA 3BFKA 1MRNA 1QHXA 1R5BA 2ZETA 4QJ3A 1S96A 4US0R 2OEPA 4BLQA 4DSTA 3I8XA 3I5XA 3EARA 1KO4A 1OXSC 3ZVRA 4BLTA 3AP1A 4OHWA 1E2IA 2J0QA 3J81k 3T61A 3I3SR 1W7AA 5IRCD 1KIMA 3IGFA 4UNRA 3RABA 3B1WA 2J0UA 1OIWA 3RLFA 2OBMA 2UZ3A 4JYBA 4V0ME 4EDHA 2D7DA 4FMCF 2QRNA 2F9MA 3SHWA 3TRFA 1MO5A 3L2OB 1NG1A 4M21A 4LV8B 1R0XA 1KMHB 1NN3A 2O8EA 3PUXA 4MDEA 2ZU0C 4AYTA 1KSJA 1QBKC 3OIWA 2ZTSA 5EXPA 3LWNA 5J4KA 1HT2E 4FMDB 2ERYA 3B9PA 2D7CA 3PQCA 2QP4A 3LNCA 2J0SA 3F0TA 1W4AA 4IVQA 4Q9KA 3VR5A 2BCGY 1FNNA 2C03A 1NBMA 2O8CA 1JXMA 5FOXA 1OXXK 1S9HA 3SI7A 2CJWB 4IRUB 4A15A 3ICQB 4E03A 3A4LA 1N6NA 1F5NA 2X77A 2HLDD 1YR8A 3QSYA 4GNKA 3LLMA 3K0CA 4DLYA 2ZYWX 2FGKA 3UWKA 4MQBA 1OH6A 4R9UC 3U5ZB 3SJZA 3NEYA 4F7WA 5JHGB 4OBEA 1XMSA 2RHDA 2PT5A 1F3OA 1NSTA 3WMFA 1UAAA 2WIBA 4GZMA 1WF3A 2HJGA 2OG2A 3PG5A 1GNRA 1RVDA 2RMKA 4GMXA 4TLBA 4XWKA 1N0VC 5E7MA 3HYTA 3KUCA 1JNYA 2IYSA 5SZKB 1Z0FA 1G5PA 4C0SA 2FJUA 4G1UC 3AB3A 1XCPA 1ZD8A 3D31A 4AC9A 1R8QA 2ZVPX 1FTNA 1KTVA 5KOYA 3R9WA 4OI2A 1P9WA 1G20E 2DR3A 4AG5A 3BH7A 3C5CA 4Q7JB 1KK1A 1ZYUA 2G6BA 3CR7A 4II7A 2LKCA 1COWD 2ZJ8A 3B1VA 3KB2A 1AN0A 4ZCLA 1U90A 3K0CC 1E0SA 4IDOA 2RCNA 2BVNA 3AP2A 1R0ZA 2YOGA 4XVUA 2WMOB 3GPLA 3Q7QA 4TMTA 5FL7A 1QHYA 3R20A 2ZRJA 1WCV1 2YC4C 2X1VA 4I99A 5LB2A 1SXJC 1LVGA 2VTKA 2NQ2C 3K0AA 4QHSA 4O3MA 2OXRA 2R2AA 1IJFA 1KI8A 1TQ2A 3FPAA 3D6TB 2WJGA 1XX6A 3IBGA 3MFYA 1P4SA 4NU0A 4TT3A 1E9SA 1MABA 3AKEA 4HZUA 4LBYA 3VKWA 4B3GA 2CK3A 1Z0KA 3EPJA 3GLHB 4O2LA 3SEAA 3HDTA 1DO0A 2F1RA 3IEVA 3WRXC 1ZW6A 2YWGA 1D9ZA 4NCNA 1NNEA 1IY1A 3QPVA 4IFBA 3Q9LA 1NSFA 2X2FA 2WSSA 1ZIPA 3K9NA 4KVGA 4I1VA 5EP3A 2H16A 2V9PA 4B3FX 2NO1A 5F9FA 1X8JA 2RGNC 3BWDD 1ZC4A 2CL7X 5EE3A 3DMDA 1IAQA 3WXMA 2IYTA 1ZC3A 4GI7A 5DHFA 3B5JA 4CF7A 5K8TA 1N3BA 3T34A 1E1RA 4CIDA 1SZPA 4LBWA 1NJFA 1TUIA 1TUEA 5CYPA 4OYHA 1Z63A 1KSFX 2REBA 2YINC 4DC9A 3WBKA 2YNMA 1UM8A 4G01B 1HQYE 1PUIA 1AZTA 2BCJQ 3CF6R 1Z06A 2JLUA 4HZIA 1UFQA 4P0TA 3RC8A 3U7HB 5IF9A 1ZM3A 1OW3B 1E2HA 3VTKA 1G41A 5CK5A 1P9NA 4IXMA 3TKLA 2PZGA 4MRRA 3V9PA 5CIWA 2ZJOA 4ASUA 1W5SA 1VYVA 3I8SA 3RS2A 3I32A 2YJTD 1Q21A 2YOFA 1UKYA 3B6EA 4NBSA 1AJEA 4M1OA 1YJ5A 1ZM7A 1EX6A 3HPQA 2P0EA 4P33A 1SKYE 4LOAA 4EQ6B 2JJ2D 1P2UA 4NYJQ 3AM1A 4XD7D 3M4YA 2ZM5A 3THWB 2B92A 2YHSA 2ZSFA 3G0HA 4RD3A 4D25A 3C8UA 3NC1C 1QF9A 2ZRMA 1IM2A 5KU1A 3I1FA 2VL7A 1AGPA 4RZ2A 4S35A 3K70C 1OSNA 3F3YA 2ZU6A 4KODA 2GA8A 2GK7A 4PZLA 3RHFA 3W9YA 4DLWA 1W4RA 3HR8A 5EZ5A 3SQWA 4I81A 1DS6A 4ZDIA 5KSZA 2OCYC 3A36A 5FH9A 2XZOA 2HYIC 2J41A 5DSZA 4MRSA 2VQSA 2ATXA 4EJSC 4Q4AA 3DDCA 4JZKA 3NC0C 2P3SA 4PTLA 2Q9AA 4D6PA 1E4YA 2IL1A 2GBLA 2P5SA 3G5UA 3FKSA 3F8TA 3LBNA 1JR3D 1S0UA 2XJ9A 4URUR 3P4XA 2VHJA 5H1YA 4A0FA 3CM0A 4DWJA 1FOEB 4U7DA 2A3RA 4URZR 2GRJA 4DSNA 3FMIA 2JJ1A 3EZ7A 4DDWA 4DLZA 4TWZA 3VR4A 1MR3F 2QT0A 1R6BX 3W8RA 2JDID 2WVJA 2UZIR 3EA5A 3OHMA 4B3XA 4WBSA 1JXOA 1WQ1R 1E9BA 1XWIA 1E2MA 1D9XA 3EA0A 3IHLA 1DAEA 1G3MA 4M1MA 2OAP1 2ZSDA 1LS6A 3RS5A 1R0YA 1OPXA 2I1VB 4YDSA 3CRRA 2E1RA 1JQLB 1GL7A 1YZUA 2J7PA 2V55B 3HWSA 2ZR7A 4XH9B 3AVYA 3AUYA 1IN8A 5HE8A 2WPDA 1RZ3A 2PJZA 2ORIA 2Q3HA 3FFAA 2WPDD 5DI3A 1J8MF 1FFHA 1JJ7A 4HEJA 4B74A 1AS2A 2MSEB 3TVDA 4UNPA 3QXJA 3TBKA 2EFEB 1NF3A 3FFBA 5SZIA 5TMPA 4EPTA 2G0NA 1KDTA 4GT1A 5JSZA 3PEVA 5JEEA 5EXTA 2Z0MA 1W0KD 4Q7LA 4PAMA 4M53A 1WP9A 4KBFA 3T5GA 1QHIA 2P2LA 2BJVA 3QKRB 1J70A 3RSOA 3IDQA 3W6OA 4XSGA 2OCAA 3BB3A 3C16C 4HLUC 2VF8A 2QE7D 5FUYA 1ZIOA 3IHWA 3LXRA 5D3MA 3RWOA 1T3SA 3DOEA 4AIIA 1DG1G 5JHHB 2NO0A 3THXB 1ZNXA 3WP0A 3TUJC 4HB2A 4MKHA 4D4KA 1GAJA 4F38A 1B23P 2EFHB 2V8OA 4RD4A 1OHHA 5C46F 2IYZA 1HUQA 5FL7D 1T8TA 1UKEA 3LBHA 3QF7A 3R8FA 2WSMA 4TYPA 3RS7A 2VHQA 3DM5A 3CNLA 5EE5B 1LF5A 3U3RA 4AKIA 1NIJA 3MUFA 3OAAA 4PO1A 3IKJA 4KFRA 1MOZA 5JLJA 2IHBA 3V4FA 5CJPA 4XIGS 4IOMA 2JA1A 1EFRD 1D6JA 2WWGA 2ORVA 5FPHA 5JBQA 4LJ9A 2N1BA 1MH1A 2BMFA 2QTVB 5DYIA 3UMFA 2EWWA 1E1RD 1Y63A 1ZM4A 3KXLA 3SNHA 1Z6GA 2BC9A 4IOKA 1SULA 3BORA 1TTTA 1RRFA 3CW2A 4JBWA 2JASA 2P6RA 2VIIA 3R7WB 5FBWB 2QEQA 3BFXA 1T91A 2FSFA 1DADA 3H1TA 2ZJYA 3TSWA 4ZCIA 2A30A 2P6NA 1G3RA 4NZYA 2R6GA 2ZRBA 1KK0A 4Q4HA 1NL3A 1XD2B 3DO6A 5GJCA 2W2XA 4QGHA 2ZUBA 5DO9A 2VSOA 1A2BA 3K9GA 4X8MA 4B3DA 1AQYA 2NO9A 3FVQA 5BW8A 5EXSA 1NKTA 1T9HA 3KKQA 4WIAA 1KAGA 4PC6A 2JLRA 1TF2A 4UXIA 1ETUA 2D06A 4LY6A 3T1VA 3TW8B 1GUAA 2DCUA 2BMEA 3LV8A 1G8PA 5GJVC 3WNCA 1KI9A 2RGXA 1RPZA 2JAQA 2O0JA 1G17A 3WYFA 2Z5FA 3LAWA 2YWEA 3GJXC 4P3YA 3VNVA 3QKSA 3GLIB 4LV5B 1G9XA 1FZQA 1FMLA 1LW7A 3ZQ6A 4AWXA 1KMQA 3QF4A 2G1KA 3AF1A 2DBYA 2P6UA 2CJWA 1VIYA 1IN4A 4PSAA 2CEAA 4LHYA 1JI0A 3T15A 2ZE8A 3B9QA 4F4CA 3B82A 4YMSA 5TVKA 2D2FA 3CRQA 4TT3D 4AD8A 8OHMA 1DEKA 2ZS8A 1HH4A 5IT5A 4CW7A 1U9IA 4LHXA 5A4JA 4F92B 2V4ZA 1E2PA 2XB2A 2GCOB 3L0SA 4XVRA 2JJ1D 4P32A 2QP3A 3OESA 5FTNA 1SKQA 4KHZA 4RCYA 1PJRA 1Z6TA 3RRNA 4RY2A 3WMGA 5CB6A 4CEIB 4DXAA 5EZ6B 2OFWA 1IXZA 4G5OA 2DWOA 1W44A 4KSBA 3VMFA 2Q6TA 1U0HC 1ZUNB 1COWA 1TEXA 2UVQA 3GLGB 2ASEA 3MWKA 1RJ9B 4AYXA 5L3SA 1E0AA 4NYMQ 5F2EA 4WZ6A 4H1VA 4L16A 1SGWA 2GEDA 2O8DA 1XJCA 3GEIA 4MKFA 4YQFA 2QRZA 1G3UA 3KB1A 1G8HA 5DGXA 1UDXA 1ZNYA 4URXR 1UBCA 1KJWA 4RFVA 3DMNA 3HU2A 5FI1B 4V03A 3TSOA 3SOPA 1N5IA 1KAOA 4YMTA 2VP0A 5HR5A 4TSFD 3EW9A 4OJKA 4RD2A 4JLDA 1JQJC 1CU1A 2HV8A 2KE5A 2WTUA 2PCJA 2GTPA 3WYGA 4TMVA 3VHXA 2ZREA 1L8QA 1NLFA 2QP9X 1G7CA 4GSYA 3WHKA 2A7QA 5FPYA 2Z4RA 1G3IA 2FFAA 5L3QA 1RRCA 2RGDA 2ZXUA 4FCVA 5KDOA 2JLSA 5IHPA 5E95A 4DIDA 1ESMA 2CNWA 2ZQ5A 4HUQB 1G3QA 2J87A 3X1YA 3ZLJA 4GRAA 3IIKA 4TTPA 2AL7A 2OV2A 4PC1A 2HJVA 5DIFA 1U9IC 1KDPA 1TAGA 1Z29A 3DZDA 4Q9IA 3VR2A 5JMTA 2O8BB 3CB4A 4F93B 2GF0A 2HT6A 3WHLA 1Z0AA 1DAKA 4J0QA 4X8HA 2QAGA 1GRRA 4IHQA 1Z6XA 2DWQA 5HCIA 3TK1A 1II8B 3RS0A 3GLIE 2EFDB 3Q8XB 3T5DA 3C15C 1E32A 1W47A 1XD8A 3LRPA 5AJYA 1W36D 4LYHA 1MT0A 4Q19A 3UG6A 3ZH9B 1CR1A 1J7KA 2Z6VA 1IJEA 1XJQA 3NHBA 4AKGA 2WSSD 2R6FA 2I4IA 1AM4D 3F5FA 4KYIB 1OKKA 1XTJA 5J47A 2H5EA 1UJ2A 4MKIA 2B6HA 3GP8A 2HXYA 3NIBA 2IYRA 2A9KA 1I4LD 4E5UA 3NBZC 3TIFA 1Y3AA 4DLVA 4OK5A 2OLKA 4PC7A 1ZD1A 4QFMA 2X8AA 5FPKA 4TYYA 4QL3A 2EVWX 4JSYA 1ZAKA 1SVKA 1ESNA 2XTNA 4BFZA 1E79D 1ZBDA 2OHFA 2FSHA 5KSYA 4OQLA 3GFOA 3EZ6A 4IEIA 5BYJA 2PBRA 3SFZA 3BE4A 1OE0A 5AJWA 4M1TA 1U8YA 3CX6A 3K0SA 5KNBA 3Q72A 1FP6A 1R5NA 5KTYA 2WAYA 2AFIE 3SFVA 2C5LA 2ZRPA 4JT4A 4ZO4A 4QHYA 4UNNA 4LHWA 2R8RA 3CWQA 4MUAA 3SJCA 1EWQA 2ZR9A 4MGKR 1KSHA 4Q00A 1SXJD 2Z83A 3SYNA 1Z47A 4BWYA 4RFSA 1MRSA 3A1UA 3C14C 5FUWA 4EPYA 2N42A 4LWZA 1LV7A 2ZRCA 2JIZA 4B6EA 4WW0A 3EPKA 4DLUA 2PJRA 4C7OA 3REFA 3P1JA 2FFHA 4HAVA 3MLEA 2OO7A 5FOWA 3BIFA 1CXZA 2GJKA 1GNPA 4HDQB 3BAFA 4LSGA 5FUVA 3L8ZA 2VEDA 3QBTA 4FMDF 5B30A 4RCZA 1Z2CA 2WOJA 2QBYB 1X8KA 1KKMA 4JT2A 1E6CA 2HLDA 1TF5A 2ZJ5A 3KFXA 4P4UA 3TAUA 4V0LA 3UANA 2HF9A 4FCWA 4DDVA 1L7VC 2HDNB 4KU4A 2ZYUX 2AR7A 3K8YA 1OFTA 1OF1A 1CJMA 2F1IA 4A6XA 2IT1A 1F6BA 2R44A 3RRZA 2V1UA 1E2GA 2IA5A 2DFKB 2PH1A 5FTJA 3B13B 4FI3C 4ZKEA 4G3XA 2H1LA 4PANA 1CBUA 2CHGA 3VNUA 1TNDA 3L82B 1GIAA 5DLQC 1EGAA 1P75A 5L3SB 2WMNB 1OIVA 4KSCA 4FXPA 1GKYA 3B2EA 3W8NA 4NL4H 4F4JA 2GEUA 3FDIA 4UJ3A 4FW9A 3IPXA 3TQFA 3KKNA 2IX3A 1XD9A 1FQJA 3NBFA 4LYJA 2J0VA 2VP2A 3N5CA 2NO7A 4C4PA 4R2HA 4LRWA 1AGRA 2TMKA 2VA8A 3W5JA 1M7HA 1UBEA 4WOPA 1JPNA 3U4QB 1XEWY 3CONA 4XD7A 2FG5A 5FR1A 2O0HA 2RHMA 2GBLC 1CIPA 3T06B 3X1DA 6Q21A 2PX0A 3PUZA 1U8ZA 2B8TA 2B7CA 1GVNB 2IUTA 4JL5A 4BLSA 3FMPB 3TVTA 3SE0A 2WJJA 5DN6A 1OJLA 4IDNA 2V7QA 2IUUA 1E2KA 1F48A 2C9YA 4M22A 3PEWA 3VKGA 2J3EA 1J8YF 2IS4A 5LDDC 2WKRA 3ZGXA 2QTFA 1W48A 3CKLA 1G18A 4URVR 2GVDC 2C9CA 3AVWA 1YZTA 5SZJA 4TN1A 3RC3A 3HU1A 1HYQA 1YHNA 5F3WB 4QM6A 3DEFA 4A1FA 1F60A 3EWAA 5FBLB 4C0AC 5IDVA 4D4JA 4GOJA 4TLCA 2W6ID 2GAOA 1EXMA 4BRUA 1PLLA 4EUNA 2V3CC 3GEEA 3QVVA 2ZVQX 2F43A 2VLIA 1I4TD 3BXZA 1W0JD 1E2QA 4IEEA 3OEHD 2DY1A 4A8JB 2PZFA 1I4DD 1YR9A 4HATA 1G6OA 5B64A 3LBIA 2AWOA 4LJ4A 5C1BA 2QN6A 1C1YA 2VBCA 3AF2A 4RD1A 5FTMA 1OFHA 3K9LA 5C18A 4LYFA 1XF9A 3ECCA 1VKJA 1E9EA 2V6JA 3SYLA 4WXPA 3K70D 2KWIA 4TL6A 3QEJA 2RGBA 3PVSA 1SVSA 5KNCA 2J0UB 2W2TA 2VHUA 1OXUA 2REXB 1FX0B 1U8AA 3OFNA 1X6VA 4UNSA 3WRYC 4A9AA 3AVTA 3ZS8A 1Q0UA 2BOVA 4Q4JA 2XB4A 3CX7A 1KI2A 2FNAA 4O25A 5AJZA 2WIAA 821PA 5CK4A 5EUMA 3RS3A 4M1YA 2WJVA 1UPTA 1GP2A 3P27A 1JALA 3RYTC 2WJIA 4N0EA 3NBXX 3A58B 4NCKA 1G8GA 4HDCA 1X3SA 1N0WA 2XX3A 3MGCA 3UWOA 1DG3A 4PAQA 1E1QA 4JKIA 4D81A 3GJ3A 4N1AA 3MD0A 3KKPA 3UMRA 3U61B 4JLPA 1P3JA 3AVVA 1N5JA 2NGRA 4KFSA 1DO2A 1HURA 3LLUA 2C98A 2GZDA 4PZYA 4ZDJA 3I62A 3ADBA 4HLCA 4KV9A 4DCNA 4ARZB 1CJTC 1N6OA 1KHTA 5DISB 3UK6A 4NONA 1XU4A 2GVZC 2FF7A 3N2EA 3SYKA 1BS1A 1W46A 2GZAA 1DBSA 2EU8A 2QT1A 1RYHA 2N46A 4C0QC 3KXKA 3EC1A 3ZVLA 5AWFC 2OT3B 4GL2A 4L9WA 4N3NA 1FW6A 1KJYA 4ASUD 2GCPA 1BH2A 2G1JA 2OFOA 5D3QA 4JIMA 2ZRKA 1HE1C 3DM9B 3P32A 3U44B 3CRMA 4JBYA 4BRWA 3X1WA 3WNDA 3L8YA 4BLOA 1P2VA 4ZDWA 4N0DA 2X2EA 4QGAA 1HY3A 4IFEA 2B7BA 2IHYA 4TQAA 2F43B 5JZVA 3KJIA 1L4UA 3OEHA 3W5IA 4B34A 3M0EA 2CXXA 4AURA 2XXAB 4HAUA 3BC1A 1YRAA 1OXVA 2IC5A 3AVQA 1A1VA 3H2YA 3K53A 3QBVA 4Y0AA 1D2NA 3KQNA 2BM1A 2PCLA 2QUZA 1EFCA 5K8UA 2XXAA 4JJKA 3CX8A 1XEWX 1FTSA 1CS4C 1IHUA 4V02A 4B43A 1JECA 1AQUA 1VHTA 2O5VA 2CNWD 4JL8A 1SHZA 2IXGA 2ONKA 4JBXA 2ZROA 2AK3A 2A2ZA 2Z4SA 1U0LA 4HYYA 3AGPA 2XAUA 1MABB 1VECA 4HZUB 4HUTA 2FH5B 1A82A 2ZRGA 4MRPA 4RZUA 4JVLA 5A5GA 4S2EA 5K8IA 4Q4HB 3AKCA 1W4BA 2BIFA 5J4HA 4Q21A 1Z8FA 1XXHE 2PX3A 3AVOA 4ABYA 1W49A 4MGIR 1FX0A 3TUZC 5CM8B 3PCRB 2V54A 4HAWA 2AHOA 1G5TA 5DN6D 3BK7A 3UKDA 4DBLC 1KYIA 2AXPA 4YMUA 4B2LA 2WBLC 1R4AA 1NMZA 4NCJA 4DKXA 4TTQA 1II9A 1T5LA 3ZD6A 4PZZA 2ZITA 3BJIC 2QAJA 1RW4A 2ZI9A 5CJ2A 4BFTA 3QNUA 4JLJA 2QAGB 4JVNA 1EFUA 2ODEA 1IBRA 2ZUCA 3EC2A 4LI0A 4URWR 4QBHA 4BEJA 4EFMA 1PUJA 4TZ0A 3BBPA 3LW8A 2G77B 3EZ2A 1KK3A 4ZI3A 3ZD7A 2NIPA 3A1VA 1JJVA 1SVMA 4PSVA 2J9RA 5HCNA 3MJHA 4PXAA 1TPZA 3OEED 4ARZA 3OE7A 4E07A 4LHVA 2J7KA 3H4MA 2ZPTX 3ZIAD 2IF0A 3R9XA 2WAXA 4EPWA 1RFLA 5BN3A 1ZCAA 1US8B 3CPEA 4V0OA 2ECKA 3EIQA 4MITA 1H65A 1VPLA 5SZHB 3U60B 1FNMA 1AIPA 3AF4A 3M6AA 2J46A 2GWHA 2WWHA 3FWYA 2B21A 5DNYB 4Q1CA 2CK3D 2RGCA 1OT3A 3FYHA 3NHAA 5G3ZA 2ATVA 4AKEA 1S3GA 2JATA 1DAMA 1DVRA 2CVHA 1J90A 1Z08A 3FMFA 5TARA 3RRMA 2VSXA 1GNQA 4W5HA 5FR2A 1TU3A 3T35A 4R71A 1FP7A 3CR8A 5KDLA 1Z0JA 1KKLA 2OZEA 3AF0A 1GSIA 1G19A 2P5TB 1ZMXA 2Q21A 1E2EA 3L0OA 3THWA 5TY0A 5DI3B 3KFVA 1ZINA 3A1TA 5J4VA 4PPGA 1S4QA 1ELOA 2ORWA 2PMKA 4D0GA 4I1SA 2C2HA 2R6AA 1NG9A 4ZDKA 4US2R 1II8A 1QG4A 5EP1A 1GKIA 1P5ZB 1SXJB 4BECA 2GILA 2CHQA 4NKRA 5C2JB 3QI2A 5JS8A 1PLJA 1XTKA 2VP5A 1LB1B 3RSLA 4EJSA 3TH5A 2AD1A 2IS6A 2B8WA 4OQXA 2O8CB 1E9AA 3EAQA 4B76A 4MRNA 3QKRA 3B60A 3PUVA 2F9LA 1GG2A 2F1HA 3KQUA 4URYR 2IYVA 4LJ7A 2JLXA 2Q0HA 3TR5A 3WP1B 3JZMA 2PLRA 4HLQB 1DAHA 4BZXA 1U98A 2AFHE 4ESHA 4O0MA 3NXSA 3KTAB 1WA5A 4GMDA 4DEYA 2QBYA 5GJBA 2A5YB 5L3RA 4JLVA 4CRWB 3T1TA 1JAHA 1KZGB 3BGWA 4D82A 1ZD9A 3O8BA 1I2MA 1H8HD 1T0JB 3BH0A 4LPSA 2I3BA 5EE0A 1AKYA 2IYXA 1KO7A 2BKEA 3GJ8A 1XJ0A 1YU9A 2XOKA 3LQQA 4LV6A 1PLKA 1VTKA 3IBYA 3CF2A
chains in the Genus database with same CATH superfamily
1TYZA 1C8LA 2EP5A 1JDSA 1L7BA 2GM5A 2GRAA 2XR1A 3JY6A 3LI2A 3MJ4A 3PR3A 1GKLA 4MPDA 1FU7A 3SZLA 3CEMA 5KC8A 1XA0A 3JWHA 3NZEA 3E1SA 5JS6A 4M99A 2ZIVB 2DTEA 5DGTA 1RADA 2QM8A 3QMPA 1XBTA 1ZI9A 4L5BA 4P7JA 4EB6A 1BRMA 1VG1A 5DM0A 1L9XA 1Z0DA 3BREA 1UDCA 1KR2A 2Z8YA 3AUXA 3IR6A 4WV3A 3RIEA 3U3KA 1UK7A 3OAAD 1XNQB 2XNJA 4D8YA 1E2BA 1X8LA 2FN4A 5B53A 3EMKA 3IAAA 1DDOA 3PD7A 3UN1A 2XUIA 3ZNPA 3HGMA 1CF4A 4NPCA 2G8NA 5IJ0A 3I9NA 4NAVA 1SBIA 1YK0A 2ON6A 2DEUA 2JCXA 4NI5A 2CLCX 1U1GA 1TDJA 4KDEA 4N76A 4JLSA 1ZNWA 4G63A 3U7FB 1A2OA 3X0DA 4DV7B 3ZJVA 2REOA 3HU5A 4XFJA 16PKA 4XQCA 2W2LA 5GQSA 5LD2B 2I7TA 4KMSA 5EVJA 4B2IA 3FRHA 2VVTA 1CSEE 1ABEA 1FPQA 3DVAB 4TPKA 4RKFA 4JX8A 4H0FA 2VYCA 1LNZA 3D4IA 5KZMB 4LWPA 1E1YA 3ROEA 1I2DA 4YONB 2J30A 5BT8A 3BFJA 1GV0A 3E4DA 3TB4A 1L5HB 2I6UA 2AYXA 4G2NA 4IDHA 4CEJA 3OQ1A 1TVEA 2GK3A 2JGIA 1DRJA 3GJRA 3O8DA 4UMVA 3BZWA 3C43A 2AMVA 3HYRA 3I1IA 4QELA 5JYEA 3GGCA 4QXOA 1FP2A 4S04A 5KKCA 1ZJWA 1FDVA 1Z22A 3PWTA 4UQOA 5BSEA 1XQVA 2RB5A 1R74A 1QGED 4R9SA 5PGMA 1BCRA 3QLTA 2CD7A 2BFPA 4FFBB 5E2BA 2FKAA 3BJEA 3DFFA 1NJ1A 2AX4A 4TTAA 4BJ5A 2AKYA 5TF0A 1W88A 1YR2A 2XQJA 4ECEA 3KSRA 2G0AA 4G0OA 1OXTA 3JYQA 4IIEA 4LEIA 3D3QA 3FCSB 4ZU1X 4LA4A 2C94A 2C3UA 2OLJA 3UJCA 3AR8A 3GLFB 2WVAA 3K2IA 1JHYA 2H18A 2YZKA 2WJ6A 2J3QA 3MB5A 4YRLA 4H7EA 1ZJ5A 5LZ5A 4OK6A 1GXSA 4UASA 4DJDC 2IKQA 4BEBA 1JU3A 4XW2A 1RQRA 4F97A 3IODA 4LK2A 1BN7A 1SZJG 3O4FA 2OYCA 2CCGA 2IEIA 3NFRA 2D4HA 2HCJB 4Q3LA 1TW2A 1ZCZA 2ZAMA 1EGMB 4A0HA 3BH6A 4B81A 3HCWA 4PLCA 4BB9A 5E3HA 1IXYA 4N48A 1WSBA 5KYUA 3C6MA 1I32A 2DG2A 4ARBA 1BMFD 3FLAA 2BJWA 4FCCA 4E5VA 1J07A 4DZTA 1HC7A 2PSJA 1NJ5A 5KHLB 1KO8A 2CLMB 1MJGM 2FPXA 3CINA 3BRWD 3QLVA 1AKQA 4IV5A 4NYMR 3OEEA 3T8YA 3EULA 5UKDA 4Y9TA 2HLHA 4M86A 1EXDA 3AKYA 1OBCA 4GM0A 4TXLA 2EERA 1MQSA 4M9ZA 4WINA 2B2XA 5JG7A 4DE5A 3K9BA 4EKGA 2WA2A 1KQNA 2C4TA 1EH5A 4WWHA 3NHRA 1PK7A 2LGJA 3D8BA 2WE8A 2AJLI 4O4IF 4OJQA 5F76A 4YPVA 3NTUA 4LQ4A 4WLNA 1VCOA 1FIUA 1ZDMA 1KBZA 1SCDA 2AR9A 4QBKA 3KYBA 4NOLA 4E46A 3TTUA 4P4NA 3SDBA 4BQFA 3BXHA 3DE0X 1U0BB 1XDGA 4YUWA 1GILA 3GQVA 2ZOSA 1QHGA 3MG9A 3PX3A 4CQLA 1FRVA 2BCEA 3R9KA 4Q34A 3DEYX 2FX2A 3KCQA 2O07A 3T12A 3G2MA 3Q8LA 2J4DA 3GRPA 4LWQA 1RTTA 3LUPA 4YJ3A 2CDCA 4CUKA 3DOOA 3P9SA 3G1TA 5ECWA 3B53X 4P35A 3M82A 1NVXQ 1UJNA 1H8EA 4WZAE 3GQBA 3KVYA 2XV1A 2FZGA 1RC0A 3V8VA 4B9AA 4EKYA 4RENA 3OTOB 4MTCA 1UAGA 3JQ9C 1KDVA 2XTMA 2GZSA 3AM4A 1YZLA 2QORA 3DZCA 1N5LA 3PVZA 3R0IA 2DBZA 3WNQA 3TFOA 4MR9B 4PWYA 3GLHE 3O92A 3D8TA 4LFCB 4DR3B 3E05A 3C39A 4G0QA 2PJDA 3LU1A 1L9KA 2VHYA 3EGXB 3PTZA 3GCZA 4RHYA 1S2GA 2C2XA 1F2UA 5JRJA 5JJ5A 1C4KA 4P92A 2O7QA 1QIMA 2R1VB 4G84A 4LXQA 3D6FA 2OCLA 3GW8A 3S2ZA 2GNOA 3JARB 3NYWA 1AK2A 3O2JA 3BS4A 4NDZA 2G4CA 3OOHA 4A0GA 4KPUA 4YJGA 4KN9S 4CDRA 3FCUB 2RK6A 2PA3A 3LQ2A 3FBWA 4NMXB 1QF6A 4X20B 1JYFA 3MYRA 1RC8A 4C4SA 5L95A 1CJUC 2BISA 4WZZA 1OUMA 1PFGA 2W6JA 2YJ5A 4JL6A 3RTBA 1JH8A 3LRXA 4UU0A 5A06A 3MWEA 4FDTA 4MZXA 3B20A 3EG9A 3CLSC 2G08A 1Z07A 1UDWA 5HS6A 1EE9A 1DOHA 3BD9A 2ODPA 4EMSA 2VDLB 4RKRA 3OPYB 1LS1A 3G8BA 4RV9A 4PQEA 5E7QA 2G4LA 3Q3CA 5HZHA 1IEVA 4EHHA 4ZJZA 1ZVMA 1XTIA 4C0LA 2DH6A 4DLXA 4XWTA 4YRFA 4TS9A 3ND5A 1B2LA 1R0WA 2EJCA 3LW7A 4IHKA 4IUCS 4A5OA 1NI5A 2OV1A 1Y8ZA 4IZHA 1V5WA 2OECA 1P62B 1U3GA 4FFPA 3QUTA 3RANA 1GVHA 4A36A 1JAYA 2IELA 2PU7A 3DH0A 1A4RA 1CUHA 1T4GA 4R69A 4LMBA 5E0KB 4CQJA 4CPDA 3JVDA 1XWWA 4DCTA 4ZIRA 1K8RA 2IU6A 3GCWA 3PZRA 3ZWCA 1H6AA 3AFIA 1RPTA 5U4XA 2DH5A 3LT2A 5I4IA 1D5CA 1AGNA 1VE6A 1OGIA 4XFKA 5BSUA 3OEWA 4UBLA 1QZ3A 2O48X 1TQ8A 3TDMA 3WMEA 5E7IA 2V5AA 1XMIA 3T7JA 2CE7A 1PT7A 2FEPA 4PO8A 1UL1X 3R74A 1Z4IA 2WB2A 4IDQA 4OHUA 4YXWD 3EDYA 2VPZA 4RVOA 1UK9A 1UMCA 2NVUA 2PXHA 3ESCA 4G8BA 3FSGA 4XCXA 4BMOB 1GQRA 2VT7A 3M5CA 4H59A 3X44A 1YR6A 5JWOA 3KK0A 4YDQA 2X9NA 1HQCA 4HEQA 2JHFA 5HK9A 3PT9A 4ZQFA 4MQFB 3K0AB 2IS2A 1OFUA 1HBJA 2O4UX 3T3EA 3GD5A 1OYWA 4MW9A 1NAHA 2EWVA 5BYBA 2ZTLA 1SEVA 1N6RA 3AP3A 1KDOA 2M98A 3ELBA 1P80A 2VO1A 1JQ5A 1FNCA 4ITUA 4ZT2A 1PVDA 1B3RA 1Y1RA 1YVDA 2B3DA 4HNTA 3H5TA 3R23A 4DYHA 3SSMA 3VPBA 5I51A 1KMNA 1P60A 3GPDG 2H07A 2Q9CA 4V0NA 5GAJA 3O6VA 1KMCA 1IWPB 1T0HB 1BEEA 2I29A 3ZBUA 4EITA 1RQLA 3LD9A 3GBSA 2GXQA 3BTVA 3Q5GA 3PCTA 3LGAA 1QF7A 3OTGA 4WNAA 4PTZA 3BULA 4UBIA 3BBLA 4FDVA 3BK2A 2QUKA 3CH4B 3AUAA 1ADYA 3C8ZA 4H60A 4I1UA 2C58A 4CMCA 4BO5A 3T7KA 1EK0A 1EWYA 2RG1A 1OTYA 3N53A 1JBKA 3CVVA 3MTQA 4IIJF 1E66A 3WLIA 1E3QA 3ECAA 4M6WA 1UFVA 3VYRB 1M2VB 3ZXXA 3M6LA 2IZ5A 3GJ0A 4NQZA 3ZJYA 421PA 3G3EA 4J2OA 2ZI5A 2Q49A 3CPHA 1ZGJA 1MENA 5CA1A 1CR4A 2JH8A 2JLCA 2CFTA 5CG1A 1Z4JA 2MSNA 2P4SA 4GLBA 2V98A 4LC9A 2E5LB 3PTAA 1XTUA 4E13A 4M0KA 1N2SA 1PEDA 1WNTA 3GJQA 3BB4A 1HX7A 3OFVA 1EK6A 3WRXA 5IKMA 5HMMA 1ZVVA 1TZMA 5LZ7A 1D7OA 2LDXA 4DQ0A 1PL6A 3IJ5A 2F8MA 3HVJA 1ZSYA 4GDMA 4TKZA 5P8WA 3PYLA 3G02A 5JQGB 1Z28A 3ILSA 4RA9B 3I9OA 2C7RA 1DV1A 2B35A 3CVOA 4KRYA 4LK3A 3P2MA 2VXCA 1CE8B 3FLEA 2EFCB 1Y8AA 3E8SA 2V7QD 4GOXA 2E5FA 1Z2OX 2FSGA 3BWEA 2QTRA 2VJLA 3IIIA 4QOSA 1IN1A 2CWWA 4NABA 4J7XA 3E9QA 4AX4A 1Z0IA 2ZEJA 4Q9JA 1DBRA 2ST1A 1SVWA 1Z4MA 3ROPA 1ICIA 3RUCA 3UXHA 4OH7A 5FKJA 4LMPA 4O5OA 4YJ2F 1KR5A 3IQFA 2VTEA 2FMXA 5DP1A 4AUEA 5EZQA 1JPVA 4ZZIA 1YBAA 5ADWA 4R8MA 3DMHA 2BV3A 1UJCA 5FUMA 1PFWA 3H2GA 4HHEA 4L28A 3ZZMA 4MVJM 3WJ2A 2V4UA 4CU2A 2KHZA 3PE4A 2CMDA 3I6ZA 1MCZA 3SBXA 3QJYA 2H06A 1GGMA 4ND2A 4G26A 1IWBB 4Y1FA 1GTJ1 3UHJA 1YZGA 3TW8A 1G2QA 3V32A 4FFSA 1H8HA 4RDHA 5CCXA 4O4LA 3GDGA 3T38A 2CMFA 1SKUA 3MXOA 1QVRA 4KRFA 2JDIA 1M2HA 4CEHB 3CFYA 3RR2A 1FRFS 5E4FA 2PXXA 2QROA 1CRZA 1YZ3A 2PZ8A 1TX4B 3OZRA 5MHTA 2I7DA 2JK1A 5FPQA 2A0UA 2L42A 4AJJA 4AKHA 4S1OA 3QKIA 2CGEA 3PGMA 2VNHA 2D74A 1T4MA 1FUUA 1W96A 1V8FA 3I9V1 3KKKA 4DV6B 3KUUA 3L7IA 1JFFB 1K9VF 2PX4A 3H13A 3LFUA 1R0LA 2V45A 1SBNE 2WF6A 1HG0A 1L8AA 3KWLA 1ZIXA 2QMQA 4MVJI 5J5VA 1QV7A 2QM7A 3ROQA 4X90A 4ZEOA 4F91B 4P3OA 2RHLA 3EWSA 1Y9ZA 2YHBA 3D8UA 2LCQA 3EDCA 3WDMA 4CM7A 4DUGD 2XGSA 2R8ZA 3K16A 4RZIA 3D3KA 4FYVA 1P8AA 1RHQA 2IHTA 1Z34A 3D3JA 4FGLA 4M8SA 1GZ3A 4QSHA 4C06A 3L0ZA 5BR8B 4RK7A 3AB7A 5A9SA 2JLYA 1NI3A 1VJRA 2QF7A 4CDMA 2R6DA 1T2FA 3IQZA 4JI3B 2GJ8A 2JH3A 1VIDA 4JFRA 2GD1O 2HDHA 3TLBA 3F74A 1IDOA 3X1XA 1YQ9A 1HFEL 4UAGA 1S1CA 2GEFA 1XCGB 1K2VN 5CR9A 3LQRA 3P9XA 3GJ7A 1KH2A 3OX2A 4MI6A 2XYRA 1EUDB 5BWNA 4Q48A 5CGQB 4JI1B 1LTQA 2MOKA 4J0HA 1E2NA 3H0CA 3DLAA 4RPKA 1Z5OA 1X3LA 1YUBA 2J3IA 1HDIA 4N18A 1NP3A 1RPNA 4RK6A 3VDRA 2EKZA 2OXCA 3LBFA 3HGTA 2IU0A 2QY9A 3OPVA 3PICA 2BFFA 5JISA 2P9TA 3LUDA 5CNJA 4NZMA 1ZRSA 2VS1A 3AUJB 3MWDB 4E2ZA 2I78A 4GEGA 1ZM2A 3JTEA 5CA1B 4OVKA 2I55A 3QFFA 1DDGA 4RF2A 1UT5A 3S1AB 5JJKA 1C4OA 4M1WA 2CLSA 2XE7A 4EEXA 2OAQ1 2QLLA 3NVAA 4BKMA 4E4RA 1YFKA 2FCRA 3TNFA 3H1FA 4XGKA 2RGAA 1YI8A 3FGNA 4BDSA 3HB4X 4L4ZA 3AY0A 4WBNF 2AOVA 1JHZA 1OB5A 1TM3E 4OGKA 4GKKB 1QQTA 1JDJA 1SIWA 2O3TA 5DPMA 1VDZA 1KJIA 5JO9A 2FWAA 3ANLA 4C6TB 4PYNA 2OV8A 1EFLA 5DM4A 3OZEA 4OATA 1L5WA 1N57A 2YVUA 2Q9UA 1CS0A 3STUA 3A32A 4U7GA 4XJSA 1D2GA 3KT6A 1GSHA 2OO3A 3H2ZA 1VBKA 5CLJA 1SQ0A 1RMYA 4NTZA 2VQ3A 4PSKA 4JQYA 3UYKA 5KO2A 2V7UA 4X61A 3HJNA 4QNMA 5ITWA 1WDLA 2XRFA 1C7JA 1AKUA 1FFGA 3GARA 1YO6A 3K92A 3ZCPA 5GP1A 4JLBA 4O4IA 3OCYA 1WBDA 3A06A 4RMHA 3VOBA 4MUNA 4RMGA 3SS7X 2PZBA 3HY6A 5JZOA 2YIMA 3RVJA 1Y6ZA 4YMWA 4KR2A 1KDRA 3E5MA 3QVSA 4EJMA 4WK6A 5BVHB 1GT91 4PZEA 4NJMB 5JZMA 1J99A 4AAYA 2CXSA 3FR7A 4DREA 2PKWA 4X91A 1CYEA 3HZOA 4P1ZA 4WJZA 3TZQA 5FOQA 2ETXA 4EYEA 3DLHA 3S1AA 2JIQA 3AF3A 4PGFA 2FUG1 3OJEA 1PZEA 3ZBQA 3IRUA 5JATA 3GRZA 4KITB 1MAUA 1U04A 2BEWA 1R18A 2WWFA 3GJ6A 3DCIA 3OWOA 2PR7A 3ZCSA 4D3YA 4YRKA 2HX1A 4YAUA 2B20A 1PEAA 3CLVA 3I92A 2MSWA 2MMCA 3PLNA 4O2RA 3ZW7A 1L1EA 4JSTA 2CFSA 3SP1A 4LVNA 4BCCA 1DKNA 1TQ6A 1DAOA 4C04A 4OREX 4Q18A 2DWUA 4PSDA 3E70C 4ZQHA 2R6HA 4U1RA 4IM7A 2WICA 3WFJA 6PFKA 4ZZ3A 5LP6A 3ZR4B 2D2VA 2X0DA 5KYYB 2N3ZA 5G41A 3CEPB 7YASA 3UCFA 1C7FA 4KLNA 1RM5A 2VJNA 5DNAA 3B78A 1QR6A 3O7MA 1QDEA 1T34A 2FOIA 3RFTA 3O4VA 3KOUA 1GYRA 3WYNA 1WL8A 2ISSD 1EFHA 1ST3A 3HN2A 1Q7TA 1KY2A 4YRGA 4EFLA 4UHCA 3TECE 3BK1A 5JBNA 3STXA 2G4VA 1Y6QA 3HXMA 3QLUA 1YB7A 3HGQA 1SKYB 3DZGA 3IVRA 2OHOA 1PYOA 1DT5A 2R751 3F98A 4FOTA 4O2BA 4RJ2A 3R7DA 3U37A 3WHIA 2Y6UA 2WD8A 3FVTA 2GFHA 2YQ4A 1ZXBA 4C22A 3P2IA 5HKKA 3UG7A 4ZMBA 5B3LA 3KS9A 1WQ4A 1ATZA 1IVYA 2C5EA 1ZGAA 4BUZA 4EF6A 3L7MA 4PV7A 2OR3A 3DBRA 3HA5A 1NWCA 4XTCS 1HO3A 1Y80A 3AB8A 3K1ZA 2QWXA 1WZCA 4W6QA 4IJMA 4J0JA 5FTKA 4J16A 3SS8A 1RS0A 3FUUA 3AOEA 3O82A 3FB4A 3PFIA 3QI7A 4YQZA 4LCBA 2WU0A 3LF2A 4XQ9A 2ONJA 1EG2A 3AHEA 4MVJA 3GMTA 1I9GA 2C2WA 2XODA 4EGJA 4BNJA 2XD4A 2V03A 4O2AB 4A8JC 2PPVA 1XR3A 2YXBA 4OQDA 4F6CA 1UXGA 2G06A 5JRZA 1H05A 4JXXA 2PT6A 1M1YE 1OJ7A 3A6KA 3OQNA 4M0FA 2FMUA 4BLPA 5K4HA 4CGZA 1L7EA 4UZEA 3TJMA 1UXOA 2ZS7A 2W00A 3FHOA 3LQYA 1XDBA 2VP4A 4I50B 1BHSA 3I12A 4Q6WA 3CUEF 4YBZA 2HLPA 3TOSA 3SN6A 4DEXA 5LOVF 3QPUA 1MX9A 4IDDA 4D9IA 3HBAA 2YJ4A 1BAPA 3GH1A 1C9DB 3N1UA 4LWOA 1KOLA 4LAFA 4K81B 2AQHA 3OUTA 4RXTA 3SM3A 3VGPA 4XDZA 1G16A 3B1FA 1ESEA 3MRXA 1Q0LA 3QY9A 3A2LA 4H6WA 4IZOA 4LPKA 4D5EA 2H1RA 2BMJA 3LC7O 3KZMA 4GGOA 2X4LA 2A0WA 3PI7A 5SICE 2JFPA 4XM2A 2IOQA 3KZKA 2V65A 4MQFA 3WL6A 4WXHA 2WPNA 1M7BA 4KBYA 4L4XA 4XJXA 4OAQA 4A8JA 1F2VA 1DXHA 4EW2A 1DE0A 4PU0A 3U3OA 2QTBA 1P2SA 1T1EA 4MV5A 1LDYA 1Z56C 3REQA 5L8VA 1XO1A 5FA5A 3W1EA 2QN9A 3OUUA 1A4XA 2EEPA 1E9FA 1DCKA 3WGYA 1W36C 4FR2A 1AMUA 4KXUA 1OASA 1LEHA 1I1NA 2ADFA 4B33A 4PHFA 1MT3A 5F7ZA 2MSLA 2XHEA 3MOIA 1KU6A 1RXYA 3HM2A 4AY2A 3W9UA 2FXVA 1JLRA 5DT2A 3ZQJA 5AKHA 1HDEA 2J09A 3AXSA 4QUEA 1H3NA 1E0JA 1P0PA 3IDFA 1H23A 2IZ1A 3H18A 1LY1A 5BV2P 5AKYA 5JSKA 2H51A 5HDBB 5FULA 2HSJA 3NRJA 3ILYA 2JGJA 1MIOB 4MGZR 4MIEA 1V9LA 4NZ9A 3SJAA 4DLTA 4EYOA 2XIQA 4QAQA 4GOMD 1VGVA 3LPNA 5KNDH 1XEFA 2F3QA 3OQJA 1N2CE 3PENA 4O63O 1S02A 3L7AA 2I4MA 1ZN8A 2WNHA 1GT6A 3ANMA 5A7HA 4R3UC 3W5AA 2AZMA 3LY7A 1D2HA 1NOIA 3OFSA 3WKDA 2AN9A 4X8OA 4MW6A 3NKFA 4Y3UA 3P20A 3CKMA 5EJIA 1AD2A 4H1UA 3UAGA 1GM5A 1JQAA 5E6UA 4JY7A 2O8EB 1R27A 1K86A 2QR2A 4ACAA 1V47A 1ZVQA 2ZUEA 1NIPA 1NJ6A 1LSUA 2HXSA 3E2MA 1EWVA 3IVXA 4RACA 4RVUA 3LSTA 3CISA 1XZBA 3TCKA 3WAKA 3VR3D 1R6UA 4EVSA 3VOAA 1QHHB 2R5WA 2HT1A 3BCHA 1XYVA 3CNNA 5BSKA 4N12A 4TYQA 4IV8A 1WXQA 2QIOA 4ETMA 2IE8A 4GLFA 2OHVA 4TXMA 1DC6A 4LYAA 1EDEA 4KRGA 4AY5A 2XQIA 3FHJA 1XZFA 2VYND 5K51A 4EHBA 3VR4H 4ISBA 3CF4A 4PQYA 2QYTA 4XLZA 1TEVA 5HWSA 1K1EA 3DMGA 2HUPA 5LQJA 3Q1LA 5JCJA 2B9EA 1QJ4A 5CXSA 4DNOA 3M9LA 3U44A 4W9NC 3LO5A 2VDQB 3M1YA 3JRWA 3IO3A 2E49A 2VHTA 5GONF 2VF4X 1G7TA 3C3EA 1E0KA 4NHOA 3O3OB 3LT0A 5IBQA 4G1BA 3N2ZB 4PX9A 2QQ5A 3H87A 2ZZMA 4XSVA 4LECA 3MT0A 4HVAA 5ALTA 1CT9A 1CDEA 3GK3A 3QX7A 2GPSA 1PQUA 3WGNA 4F3KA 1DDIA 3SDZA 2F3SA 3VR5H 4H16A 4J0KA 4BV2A 1Q3HA 3GV0A 3S40A 1ANKA 2AK2A 3I5AA 2WHXA 1IWOA 4MKGA 2P9QA 3KT3A 4U5XA 2ZT5A 1DELA 4YH1A 5LYJA 4F1JA 3W6NA 2WD9A 2CXRA 3B89A 1FVXA 1FXWA 3WB2A 1AA6A 1FZTA 1BOOA 1E58A 2VH2A 4D9BA 2VBGA 4CLDA 1DJMA 4TMWA 1EUZA 1IOLA 2QY6A 2VHXA 3FNHA 3KR0A 1F0PA 4FZVA 2P9EA 2P3LA 4E22A 3PFFA 1WB9A 4LJLA 3BD6A 3H2SA 4QXRA 4RLSA 2HHJA 3ETGA 5JVDB 1IFXA 1QLWA 4PG4A 1Y9EA 1SVNA 4DVJA 2QR3A 3H1PA 2BH2A 3JVUA 4Q66C 1E2LA 2PSDA 4UVGA 4WVFA 3HC7A 4B85A 3TX2A 3QXSA 2PL5A 4KFTA 3WLQA 4QAJA 3JQBC 3IMCA 4IY1A 4LC1A 1TOAA 3ASYA 5KNCD 1NVVR 1T3HA 2Y77A 1USIA 1PR9A 1AZWA 1T5DX 1W1UA 2FEKA 3NNNA 3MB8A 3JWPA 1HE3A 3EVFA 4AMUA 3RO7A 1HEYA 2IYAA 3OM0A 3SR0A 4J0CA 2RBEA 4WT7A 1F0KA 4D97A 5DM70 3ANYB 4DBZA 1WLSA 3MCWA 3M4NA 3L7DA 4ZQIA 2VH5R 2HQOA 1QGDA 1WV1A 5E6SB 3W04A 5ESWA 1WZ2A 1RXEA 4NLLA 521PA 1RMQA 4P22A 7AT1A 3Q5EA 1JV2B 2QS9A 4QU9A 1LBTA 5EP4A 1WMAA 3MCVA 1T0IA 1TYEB 3MTJA 5DGIA 3G5AA 1FBNA 1GNVA 4H3SA 4FVTA 1M7GA 4TL9A 4AJPA 4EFNA 4PPQA 4OPMA 4HG2A 1NN0A 1YJAA 4UOQA 5C1IA 3IUEA 4PYLA 1NVUQ 1VI6A 3LY5A 4PN3A 2WM9B 5CD1A 3KEQA 1FTWA 1GG5A 4MWDA 2C31A 1EK1A 1KF0A 1IN5A 2IX9A 2X9QA 3SX4A 1N32B 3M34A 4KQFA 4PIPA 3UMSA 2QUBA 3EW7A 2ODQA 4RZSA 1U2DC 4D4LA 3TR6A 4P7KA 3QH4A 2IF2A 1SOWA 1AUVA 2BY4A 2C9OA 3FE2A 1ES9A 3GF4A 4PHHA 1W76A 4NJOA 4JKOA 4EPVA 4WBNA 1M74A 3SFTA 5EJ7A 5JOQA 4F3RA 4FS8A 2QE7A 4RSRA 1WNFA 1X7WA 3P9IA 3IAM1 1YZQA 2ZDGA 3EBOA 2E9SA 1PHRA 2C5BA 2VOEA 3IUMA 4JWTA 4KO3S 5G0WA 5THQA 1REQA 3MGGA 4RW0A 4D0NA 1GDHA 2YZNA 3ZGNA 1I30A 3PUWA 1E69A 1K7SN 3KV1A 1NTRA 4CYMA 1OH7A 1G66A 1NV8A 4KI0A 4EP1A 4ERNA 1FYDA 3K9HA 4AZ3A 3PYXA 2V59A 3KKEA 3U26A 1ORHA 2OYRA 2CYBA 3F6SA 5FEMA 4TS4A 2WNSA 2Q4RA 4LHSA 4WACA 2EX0A 5AHOA 5A4FS 1QHNA 2CXNA 1EVEA 1Q1AA 1LCIA 1NMYA 2C95A 3FNIA 1BDMA 1JA9A 2XOKD 2GYVA 3C7KA 1FU4A 1VSBA 4TWJA 2VPXA 1MV5A 4MDYA 4G25A 4WLVA 3U40A 5D3KA 2NV2B 4BDTA 2K2WA 4IIJA 3AEQA 3CV3A 1DBIA 1GY8A 2WJ4A 3D8NA 3IFSA 2GFQA 3IP3A 2OA0A 3GRRA 4N3CA 4B6FA 4RVDA 3NWJA 4CMJA 4LZPA 1J0DA 3PQ7A 2W11A 3U7IA 4L8YA 1DU4A 1IZZA 4LF4B 1UZAA 6LDHA 1ZD2P 3Q6NA 2ILTA 4FHFA 2ZRDA 1T0UA 1BYUA 4NBUA 1A5TA 2BHNA 4NYJR 5BN5B 1KO5A 5LP6C 1A9SA 1DOAA 3I76A 1NQAO 2XKAA 3OM8A 1QC5A 2OMKA 2P1RA 4RJIA 2HM7A 3WGZA 2FX3A 1R9JA 3LLSA 3B7GA 3EOAI 4CIBA 4DT1A 2G5TA 4BVKA 4MQ4A 1G8JA 5C3MA 1WEHA 2QVGA 2RD2A 1KIFA 3OE4A 4XM1A 5ENVA 4Z3KA 1QB7A 3DVLA 1KE1A 3T3IA 4D8XA 4V0KA 3RVPA 2QD2A 1LC3A 4AJ2A 1VHJA 4OHVA 2GXAA 4K28A 2D1YA 2O2DA 1EAYA 2VXOA 1ZHHA 1JAIA 4KQMA 1SPXA 4X60A 1JTEA 4WK2B 4GKVA 5DLYA 2GHQA 4MEAA 7MDHA 1DT3A 2B2NA 4YXWA 5AIBA 2PSFA 4FQ8A 1RHKA 3A4NA 4GBED 1O54A 4TWAA 1E7MA 1HMYA 1L5OA 4ZRMA 3ZCRA 1Z5UA 5JD6A 2XGJA 2CLHB 4BQOA 4DDUA 3T1QA 1U6IA 3KDSE 2QTVA 4TKLA 5CCDA 4R1MA 1C81A 3JQGA 2AF4C 3PLRA 3WGQA 2GHTA 2FLKA 3VI4B 4Z7QB 4Q03A 4WFQA 3RBXA 1YUMA 4UU1A 2GAAA 3PRKE 4EAAA 5C51B 2WFMA 1SKMA 4CM4B 1YJ8A 2RGNA 2O7SA 2WHPB 2D5BA 5KYNA 4A2CA 4KIJA 2P8SA 4KN8A 3W78A 2XMZA 5L6MB 5SYAA 1KMIY 3HTXA 2AFRA 2ZI4A 4OP3A 2ZI6A 3W34A 1Z4PX 5CT6A 2GSDA 2PV0A 4MYHA 3GGDA 3RYHA 1Q19A 1K2WA 3WYAA 4QYMA 3ZHXA 3CEHA 4B71A 1DTSA 4XIFA 5FI0B 1FDWA 1N75A 2GK6A 1ZUHA 3JQ7A 4FBLA 4WESB 5BSRA 3WSTA 3UCXA 4PC3A 3I5YA 3HXQA 4DOMA 2F8TA 4LZNA 2WUWE 4IW3B 2WJ3A 2W71A 4UCQA 4GU5A 5DEIA 4JVOA 2XSZA 2HCFA 4Q1EA 4QODA 3OOWA 1VZ2A 3JZAA 2WUFA 2IXAA 3OCZA 4DT1B 4I6JA 5ALOA 3D6JA 3IIMA 1RYYA 2F4VB 3H5LA 3AY6A 1V1JA 4DRYA 4B87A 1JTVA 2GEVA 1ZXXA 2BMAA 3ZXYA 3NORA 1M66A 3OQOA 5AKLA 1G9SA 3KJFA 1JFRA 2QYOA 4GSKA 1KJNA 3HR7A 5CX1A 5FWDA 3BN3A 3H4TA 5HQ3A 1PSZA 2H2DA 2W58A 1VHDA 4YCJA 1B15A 1FYXA 3BRCA 4HDNA 2IDJA 5BYKA 4IINA 3U62A 4DV1B 3FFXA 1D6MA 1HZZA 3ZHRA 1K8ZB 3IIJA 4C2BA 4CLRA 1W73A 4NARA 4NEHB 3MMSA 2Y0DA 1TCCA 3K1JA 1WW3A 2Q4DA 1P17A 2IVFA 2ZS9A 2ZWIA 2NTJA 3FSRA 2B69A 1EFDN 4MVCA 4CGYA 1D3AA 1KPGA 4R2JA 2QMEA 3N28A 4IKEA 2VDPB 2ALJA 2PEYA 2DTXA 2PSEA 1A2KC 3W06A 1CETA 3LHFA 1MXHA 3EZFA 3N8GA 3UA3A 5KCZA 4L74A 3EY4A 4J9VA 4B5LA 1D6NA 4WA8A 2LUOA 4C7BA 1DIRA 5EYPB 2D0PB 3CZ5A 4HJXA 3TCXB 3QIAA 3A6FA 4E32A 4DV2B 3EDOA 4F7DA 1KI6A 3HO8A 1PL0A 2RHGB 1WU8A 4UHEA 3RUIA 4F71A 2NTYC 3IKVA 1J0BA 5EUBA 1JKIA 4Q9HA 1YQWA 1OFGA 1D0SA 5AH0A 3ENWA 4YMIA 2ZETA 1QHXA 4QJ3A 4ZI7B 2HZBA 3GUZA 1ULSA 4ZQEA 2OEPA 1TA0A 4K6CA 4BLQA 2FJPA 4EUSA 1CY6A 4GI1A 4P84A 1PQPA 5G4KA 3EZXA 1OXSC 4XWGA 5B55A 3OKAA 3I5XA 4H7DA 4J0DA 4RIHA 1U4SA 2PX5A 3HKEB 5COQA 3J81k 1H6BA 5AIAA 1QX3A 5IC6A 4OXYA 1NQUA 3CZAA 1KXJA 3GUCA 1O0SA 1HNZB 2Z95A 3B1WA 4A27A 1SXPA 4G5XA 1OIWA 5DTJA 4L08A 1V1RB 1XE3A 5IFLA 2D7DA 1UKAA 3IBCA 3OX4A 1XTVA 2QRNA 2ADOA 4XUGB 1MO5A 4BWVA 1MAVA 5DM60 1JI3A 4M21A 4D99A 5F7JA 1KMHB 1NN3A 4HOYA 4KQEA 4LS3A 4F2DA 3KQPA 2OWEA 5J4HA 2ZKIA 4MDEA 3C5VA 3MRTA 1NI4A 3NLLA 2Y1DA 1B26A 5HJ7A 4F86A 2EATA 3GNSA 3RF7A 5EXPA 2WIDA 4ZAWA 2QTWB 4LZJA 4RVGA 2ERYA 3B9PA 3EGDA 5CFZA 2VAXA 4O6VA 1NTOA 4J29A 3VR5A 3ZI7A 3FYTA 4AW9A 1NBMA 2PO7A 2UAGA 4AN1A 4CMGA 4KXVA 1H4QA 1OXXK 1S9HA 4A15A 3HXKA 4YECA 1M1YB 4CQNA 1BDJA 4MP3A 1N6NA 1T0PA 2X77A 4IX9A 4DADA 1YR8A 1SPBS 1PO7A 5IXSA 1MGPA 3LLMA 1U02A 2ZYWX 2IUYA 2FGKA 3J7AC 1KVTA 3EZYA 4R9UC 4RU1A 5JHGB 2ZBUA 3QPCA 1QV9A 1GHTA 1MN6A 2B25A 1MB3A 3HB0A 1CY2A 4UMEA 1KHHA 4RIFA 3R0QA 4BAGA 1WF3A 2HJGA 3HZHA 4EKEA 5H9WA 4LFAB 1LLCA 1RVDA 4GMXA 3SOZA 7MHTA 1USGA 1E3TA 2GEKA 2YXPX 3QWAA 3OQHA 4RPIA 1TLFA 3DC2A 4TS1A 1CUFA 1RLTA 5JBIA 1JNYA 3CRNA 4OMCA 2IPAB 5SZKB 1UBMS 2Q2OA 2V3WA 4FHCA 5G1NA 4CU5A 4C0SA 2JKYA 2O59A 5K0EA 1M75A 4ND5A 3AB3A 1JR4A 4OF4A 4AC9A 1BROA 1U2TA 3LP8A 4IYJA 4B45A 1FTNA 4C21A 4F6LA 3QU7A 1G20E 3OJLA 1NJ8A 3N39C 3ABOB 4LSMA 5K4AA 4DLPA 5CAEA 3QFCA 2HHLA 3L4BC 3CR7A 1K8XB 5DRTA 1X9GA 4BRSA 4GVLA 2V97A 4ZCLA 2ET6A 4IDOA 3RVOA 3PJDA 3O3NB 3QOXA 2VPIA 3RGWS 5HVNA 4IMPA 1JEYB 1IPEA 2BVNA 4MQEA 1R0ZA 2VDWA 4X0EA 1IIBA 3OECA 2WMOB 3GPLA 4YPFA 1MB0A 4X64B 1Y3IA 4KRXA 4CLRB 1VE5A 1VLMA 3F4BA 4IG4A 1ZJJA 5T64A 2LZ0A 3ZIUA 2YQ5A 1Y7LA 4RE5A 4ALNA 1SXJC 3H99A 2VR1A 4X00A 2OCKA 3M89A 3D6TB 2WJGA 1ONSA 3V8BA 4TUYA 3AKEA 4LBYA 1F9EA 3ZCVA 2P5YA 4B3GA 2OZVA 2P62A 5JQGA 1O89A 1Z0KA 2YCLA 3LPLA 3QUQA 4GLJA 3SEAA 1LFAA 4LOKA 3U17A 2AMYA 1DO0A 3GJYA 4CQMB 1O58A 2Q99A 1ZW6A 3WRXC 1D9ZA 1SY7A 4N5LA 1IY1A 4G9GA 1LZKA 4OKIA 3QPVA 3A10A 2NU7B 4IFBA 1NSFA 3I2YX 4R16A 4RY8A 1D2RA 4DNFA 2PUCA 3SS9X 4KVGA 2WJWA 5K1ZA 4B3FX 3AL3A 1N8KA 4CR7A 1JIXA 1EVLA 3OT5A 3R6WA 5BOSB 4ENVA 2NWQA 2C1XA 2QKYA 3CLRD 3GCXA 4RQUA 5EE3A 4MAMA 1IK6A 2Q1UA 4ZVQA 1IAQA 4ENSA 3MT7A 4H7JA 4GSLA 3TX6A 3WXMA 5C32A 4GI7A 1EUDA 1U2DA 3B5JA 3PT5A 1SZPA 2AQIA 4AFNA 3O0DA 2MWMA 3T0GA 3T4EA 1PBNA 3Q3GE 4F5EA 5GZ3A 4QE3A 3DE6X 1U0EA 1LXCA 3JD3A 4A0QA 1HQYE 1PUIA 4EA6A 3LBYA 2R8OA 2YTZA 3ZK8A 1Z06A 3RCBA 2P41A 1UFQA 1FNSA 2DTDA 4P0TA 1IUNA 5IF9A 1ZM3A 1U2EA 2E55A 1AV7A 4CIVA 1NI4B 2I4RA 3I6YA 5AW1A 1OWLA 1PQWA 1G41A 1GARA 3WB1A 4IXMA 4HF7A 2ZCJA 1VL8A 3KR1A 4K9SA 5BRNA 4E5NA 2C7BA 3C6ZA 3V9PA 3N7AA 3GMSA 1MPTA 1ADCA 3RS2A 2J67A 3F6CA 3E15A 3FTNA 3WLMA 3ZY2A 4AMGA 5LVAA 4NSNA 3GZNB 1U8CB 1UKYA 4NBSA 4DUPA 1XV5A 2Y4NA 1AJEA 4V1CI 4BGIA 4FJ1A