1EESA

Solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords GTP-BINDING PROTEIN
publication title Structure of the complex of Cdc42Hs with a peptide derived from P-21 activated kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1eesA00
5DI9A 2C03A 3FMFA 3V9PA 1SVLA 2VEDA 4CDGA 4NZYA 2BKEA 2GRJA 2ZETA 3LRPA 3ND9A 3DPUA 5TMPA 1TF5A 4A2QA 1UM8A 1S96A 5DI3A 2ZJBA 2PZEA 1KI8A 1YZGA 5L3SA 1VG0B 2IYXA 1GAJA 1BYUA 2Y8EA 2C77A 2GF9A 4B47A 1CKEA 1E1RA 4RFSA 3SDZA 3F8TA 3GFOA 4XWAA 3TIFA 1TU4A 2W2TA 4ZDWA 1OXXK 3TW8B 3RSOA 3ADCA 3AF0A 3LX5A 4LZZA 4X8HA 4CEJA 1WMSA 2ZI7A 1G8PA 2GILA 1EX7A 4MYTA 1HURA 3QJYA 4PPQA 3ZVRA 3OIYA 2J45A 2WBLC 4GL2A 3UG6A 4RZXA 1A4RA 2GDJA 3CB4A 1NBME 4DRZA 1E2GA 2WWWA 2FSFA 2FU5C 4I81A 1P5ZB 5AJZA 3OESA 3T12A 1T5LA 3I8SA 1E9BA 1XXHB 1S8FA 4NMMA 4B2IA 3KQLA 4DDTA 1KKLA 4DHEA 5KNCA 2H8KA 4LX0A 3SJCA 1TEXA 1QHSA 4MDFA 5FTKA 4B3BA 1KK3A 1HA3A 2BV3A 2J87A 2REBA 5GVRA 3RWMB 4PQRA 4DB4A 4C7OA 4LJ5A 5CITA 2CEAA 4TL6A 3EXAA 3IEVA 4JVNA 1ZD1A 5E7IA 4A36A 4AI6A 4RD2A 4B3CA 2PMKA 4DEYA 3THWB 4PAMA 4B34A 4X8MA 4ASUA 1HT1E 2YINC 2ZPTX 3L8ZA 3PIRA 4FXPA 3ICQB 1WCV1 1SULA 2YV5A 1IONA 4YDHB 4LBYA 3X1DA 2OLJA 4KV9A 3A4MA 2ZJZA 1W36D 4KLZA 4URVR 2PEZA 3Q7PA 2ATVA 4II7A 1W36B 1A2KC 3FMIA 2JAQA 1DBSA 2F1JA 5FTJA 1JPJA 2JATA 3ZD6A 4URZR 4I1SA 3BXZA 2P67A 1VG9B 1N6PA 1GRNA 4PC7A 4HI0E 2GBLC 2PEYA 1U2RA 2XAUA 1PUJA 4N0EA 2BMFA 1PLKA 2WOOA 3TVDA 5J4VA 2SHKA 3QKSA 2Z0MA 2NO7A 4PC2A 3QG5A 1EFRD 2IXEA 1II9A 2VP5A 2NIPA 1XJCA 4BFZA 1EX6A 5HTKA 4DVGA 1ZVQA 5FUWA 5CDFA 1ODFA 4OQXA 4GRAA 1U8AA 3KJHA 4B33A 3ETLA 2G0TA 5DE3A 5JRZA 2J0UA 2ZS9A 1L4YA 2ZRLA 2O8CB 4BFVA 5K8UA 4RKEA 4A2WA 3ICEA 1HQYE 4AG5A 4XVUA 4PPGA 2ZE6A 1E9DA 4QBGB 3P32A 3WXMA 6Q21A 1AZTA 3U3JA 1X3SA 3ZIAA 3C4JA 1E2FA 1UPTA 4LOAA 1XD8A 4ZIRA 5LB4A 1J99A 1AZSC 1KOFA 4OBEA 1R8SA 3O8DA 5TVKA 1JNYA 4JT2A 1F60A 1Z2CA 3VR6A 2FSGA 2J5XA 2PCJA 2KBFA 2YWEA 4PC6A 4A0GA 3MD0A 1RW4A 3E1SA 3MCAA 2HF9A 1ZIPA 5AUQA 2ZXUA 1IBRA 2DFTA 3AGQA 5KOYA 3W90A 4YLGA 1ZMXA 4L8GA 3RRZA 2RKOA 3U4QA 3DEFA 3CRMA 4P31A 1G5RA 1NIJA 2CMKA 4LYHA 3RDPA 1UKEA 3OEHA 4IEIA 4OQMA 1RC8A 5HKKA 5KTYA 2O8FA 2XZPA 5J4KA 2FH5B 3M1IA 3NEJA 3FFBA 3P4XA 4M1WA 4M1MA 4YMSA 5DH9A 2OAP1 4Q5IA 3SOPA 2ZI6A 1CJUC 4ACAA 1YU9A 2ATXA 1R4AA 5GJCA 3HU2A 2YWGA 4ZKDA 3AUXA 3RANA 1TEVA 2HV8A 4A1FA 4L5BA 2H1LA 1XMIA 1LY1A 3WYFA 4DDUA 2YOGA 1A82A 2ZJ5A 2N1BA 1RE0A 1TQDA 1OYYA 2P6UA 4EPRA 3AGPA 3DMDA 1G8YA 3N2EA 1VECA 2ERXA 3KQHA 1MOZA 1JALA 4TT3D 1TF7A 3CIOA 2XB2A 2IF2A 3VAAA 1GNPA 4RFVA 1T6NA 4ABYA 2Q0HA 3QKUA 1CR0A 3JVVA 2AKAB 3IHLA 3GLIB 1YR9A 2A7QA 4M1TA 5DN6D 1Z3IX 5LPNA 3SR0A 3UKDA 1FNNA 2IA5A 1NBMD 3B1ZA 4UNSA 2ZI9A 1QHYA 2YOHA 2ZE5A 2JLWA 1KZGB 3K53A 3LDAA 2LWIA 2WWGA 3U61B 2AFHE 3AF1A 1S0UA 2IT1A 5DHFA 4K81B 1CR2A 4G5OA 3KTAB 1A7JA 3PXGA 1MABA 4QHYA 5KSZA 3TSZA 4KJZA 2VSXA 5GVSA 3CUEF 3X1XA 1UKYA 1W49A 2I4IA 2VRWA 2YC2C 1G8FA 3IIMA 1US8B 3W34A 1D2EA 3OEEA 2VSOA 5EUQB 4DLXA 2IXGA 5FL3A 1DAFA 4LJ7A 1ZD9A 2IS4A 5BN4A 3T1OA 1RJ9A 2GEDA 4Q9LA 1RFLA 3VKHA 2FZLA 2GCOB 2AL7A 3Q72A 1FX0A 1VG1A 3D6TB 3K09C 1N3BA 1P6XA 4LCBA 1NG9A 4JLKA 1T3SA 4QJ4A 1N5JA 3SJAA 4D81A 1IN5A 4G5QA 4NE2A 4E5UA 1U0HC 4HZIA 4BGDA 4M9XA 4Q7LA 1FQKA 1D2NA 2OG2A 4O0MA 3CNOA 3LBNA 2PBRA 3CO5A 4JKIA 1GKIA 3CNNA 1ANKA 4RSGA 2MMGA 3BB1A 4KBGA 3FHTA 1QF9A 3MJHA 1E2IA 4B2LA 3RC8A 2IHYA 3T35A 2GZHA 3PJRA 4B3XA 3GPLA 4D82A 1W48A 1Z0JA 2CVHA 2DHRA 1S2MA 2QSYA 3ADKA 3NTUA 4AWXA 2J59A 5JEEA 5KU1A 4D25A 2H17A 3R7WA 1NSTA 1EFHA 4NTZA 2BOVA 1B0UA 3KQUA 1F6BA 3LV8A 1WE2A 1XEXB 2VBCA 4C0BA 1OKKD 3CF6R 4JVSB 1QHHB 4LHWA 2CHVA 1EGAA 2A5JA 4DCUA 3NIBA 4GNKA 1NY5A 4CT5A 4ACBA 1AA9A 3ZZUA 2BVNA 2ANCA 2Z4SA 1XMVA 4JVLA 4R7ZA 2OCPA 2ERYA 3W6PA 1Q1BA 2Q9AA 1CRPA 4RZ2A 4A8JB 1MRNA 2EYUA 1E6CA 2XTMA 2FE4A 4BLSA 4MGIR 4MQBA 2KE5A 4DLRA 1II0A 1LVGA 3GEIA 3U44A 2QM8A 3QUSA 5CB8A 2DWQA 3DVLA 1E1QA 3KKPA 4GOKA 1L8QA 1RVDA 4IDPA 4JMPA 2FF7A 3BFKA 3TQFA 5JWRA 2PH1A 2IEZA 4WAUA 4DIEA 5B64A 2QGZA 3RRYA 2AKYA 4HB3A 4JVMA 3BD9A 3H4MA 3IHWA 1VYVA 4BZXA 2WJIA 2IK8A 2C96A 3LNCA 3PUZA 2N42A 3BERA 2XTNA 3OAAA 3A8TA 3PUXA 1QHGA 3QSYA 3LVRE 4JLAA 4JYCA 1Z22A 3QXJA 2GZDA 3D3QA 2WMNB 3KFVA 1W0JA 2LCFA 5J4HA 2UVQA 4M21A 1Z0DA 1KMQA 2O52A 4CW7A 4BLTA 1W36C 1IN7A 1XNJA 2VPPA 1TQ4A 4TZ6A 1P62B 2OHFA 2PZGA 3KUCA 1K6MA 2HCJB 4WXPA 1TADA 3FFAA 1P61B 2Q6TA 4OI1A 2XTZA 4JL5A 3TNFA 4QOSA 4Q7KA 1BO6A 2NTYC 4AYWA 1KDTA 3WNDA 3KB1A 3CPEA 2A30A 2Q21A 3CKLA 3I32A 4XWKA 3RNLA 1JR3A 2IX3A 1OFTA 3OF5A 1KNXA 2W0SA 2E87A 2XEXA 4Q21A 1RRPA 1E79A 4EFLA 3NEYA 4ZV4A 2ZSDA 4LUCA 1KSFX 3B1WA 3C5HA 1E79D 5G40A 2OAQ1 5JI2E 5KHOC 2IC5A 3QKRA 1NMZA 3KDSE 3FB4A 1R7RA 2CVFA 1GITA 2CCGA 3PUWA 1BYIA 4DLWA 4W5JA 3TUZC 2TMKA 1YZTA 2AK3A 3RABA 4O2RA 1GKUB 2OUKA 3F5FA 1LF0A 5FL7A 2XZLA 3BIFA 2QTHA 1G18A 1E69A 4D80A 4YONB 3QNUA 3A37A 4B6FA 5DSZA 1XMSA 4JJZA 2ZRFA 3U3OA 1QBKC 1OJLA 2AWOA 2FPKA 2QRNA 4TMWA 2ZSEA 2QE7D 4Y0VA 2QBYB 2R9VA 1YR8A 2WAYA 4RCZA 4LJYA 3AUYA 2XJ4A 4Q01A 2JCSA 1G3QA 1Q3TA 5FPYA 3WNCA 3TR5A 3JVUA 1KSHA 1E0KA 4EQ6B 2HUPA 3RWOA 3ZS8A 2JJ8A 4HLCA 2XNDD 1GRQA 3B1VA 1U8YA 4I1UA 2JASA 3AP3A 2D4HA 1XCGB 1YR6A 2IW3A 4GP7A 2W6JD 2GXSA 1G64A 5C2JB 2JDID 2OXRA 1W47A 2H57A 3IQWA 1WP9A 4NCIA 4Q18A 3CX8A 4F38A 2WWXA 1OB2A 1Z0IA 2VP4A 2ZRGA 3KJGA 4BFTA 2FDCA 2EU8A 3VR1A 2VO1A 4EPYA 1R10A 2NGRA 2PX3A 3GLGA 1UAAA 3CRW1 1SHZA 4DSNA 3AP1A 3EARA 1CXZA 2V7QA 1P2UA 3C7KA 2DB3A 4PPNA 2ODWA 3Q85A 2ZUDA 2PX0A 1Z28A 3IIKA 3ECCA 1S9HA 2V7QD 3CWZA 1RIFA 2EWVA 4CYMA 3BOSA 4FD2A 4US0R 3T1VA 2GAAA 4GMXA 4KSBA 1DE0A 2JLRA 1CR1A 4UKDA 1GKYA 3W6OA 1NMYA 3H2YA 4BQSA 5FPKA 5HE8A 1RYHA 4LJ8A 3AF3A 4IEEA 4ZDKA 2RHDA 2YC4C 4MRVA 5FBRB 3QXCA 4TL7A 4IFBA 4V0LA 3KUDA 4V0OA 1OYWA 5DNYB 1FW6A 1J8MF 1ZCAA 3TUIC 1IXRC 4ZPXA 2ZANA 3OFND 4HAVA 3TBKA 2ODBA 2QRZA 3IDQA 2B8TA 2BKUA 4RVCA 4BUJA 2J0VA 3TUJC 4D0GA 2RGNA 1E9CA 3GJ7A 4TLBA 3QXHA 3SYLA 4AYTA 3OIUA 4CIDA 3AKDA 1IAQA 3AH8A 3DL0A 1NP6A 4XSGA 3RC3A 1T0JB 3TMKA 1Y63A 3VU9B 2QMEA 5EE1A 3O8RA 1DS6A 4C2UA 3QY0A 2OBMA 4V02A 3M4YA 4NYJR 2HLDA 2EW1A 4PHFA 3AKCA 4JL8A 2YWFA 1W5TA 4DCNA 3A6PC 1DO0A 3HDTA 4LHYA 5JHGB 2AD1A 3T61A 1OW3B 2F43A 4US1R 4G5RA 3A1SA 1RZ3A 1OE0A 4C0JA 1MO6A 4UNPA 1GNRA 1ELOA 2ODEA 2P0EA 5FBQB 1CTQA 3BE4A 4UJ3A 5EE5B 2ZI4A 5EP1A 3S1AB 4CEIB 1K5DA 4V0KA 1CULC 2HJGA 1IY1A 1UBCA 3K0AA 1NN3A 3PUVA 3OIVA 2V4ZA 2FGKA 1QVAA 4QNRA 3ADBA 4YXWD 1ZD8A 1GM5A 3T15A 3UATA 3TH5A 5H1YA 4Q4HA 2GHIA 3AKYA 1H8EA 1LB1B 2JIZD 4WZ6A 5G53C 1A1VA 1D9XA 3TSWA 4I99A 4JJKA 1SKYE 1H8ED 3I92A 1YZQA 1DAEA 2F55A 4JSYA 4U02A 5FI1B 3WNBA 4C30A 1E2EA 3HJNA 4AD8A 4BEBA 2ORVA 3GLFE 2ZVPX 4A8JC 4IDQA 4N1AA 4PZYA 5CIWA 4O2LA 2JEOA 3B1YA 4U5XA 1OB5A 3LY5A 2D62A 4Z1MD 1R5BA 2VP9A 4DCSA 3L8YA 1GUAA 4V03A 4MRPA 4M4SA 1LTQA 3WRYC 2W2XA 1P4SA 2REXB 4H1VA 4TMXA 5EXXA 1ZRHA 3K0FB 1G3IA 2QL6A 4DSUA 1EK0A 4JZKA 5J5CA 1TL7C 2QAGB 3GFPA 3PVSA 1Q1EA 4D0NA 3R8FA 1GDDA 3RHFA 3VR5A 4DWJA 2Z4RA 2V1XA 1GIAA 2GXQA 4MUAA 4US2R 2HDNB 3UPUA 4PR0A 3U3MA 1XD2A 5JRJA 2VP2A 3QI2A 4DT1A 3K09A 3UWOA 1VHLA 1FMLA 2DFKB 1JJVA 2OXCA 3OE7D 1UDWA 5JWOA 3AVQA 4Q7JB 4EPXA 4GBMA 1VIYA 2F7SA 4LRWA 4D4JA 3HP1A 4DLZA 1M74A 2FMXA 2PLFA 3TRFA 2GK7A 4U7DA 2O8DB 1ONBA 3HPQA 1W0KA 1BOFA 1UEJA 2QPOA 1IN6A 4NDZA 3B1XA 3GJ8A 2IUTA 1XTSA 3KKOA 2ZRNA 3LLMA 2FA9A 5F2EA 5G3YA 2EWWA 4V0MA 1CR4A 2K5UA 2A5YB 1OSNA 4LWZA 4NYMQ 5L3RA 1YRAA 5C46F 3FE2A 4RD4A 3W5IA 3T1TA 5FPHA 4TTRA 2AFIE 4DDVA 2IBMA 5A5GA 1DAIA 2J7KA 4OL0A 4YMTA 1SQ5A 1XTRA 1F2TA 5K8IA 1XDBA 2X19A 1P3JA 521PA 4M9ZA 2HF8A 2VLIA 2WICA 4PC3A 2G1JA 3EWSA 1KY3A 2IYZA 4TTQA 2WPDD 3KB2A 2HT1A 1IHUA 2CLCX 5BYJA 2A2ZA 3REFA 1T9HA 1QDEA 1TUEA 5JMTA 1N0UA 3B7GA 4POAA 4L9WA 4EJSB 3NBFA 5H70A 5AJVB 3ZVNA 1KMHA 1Q21A 1XXHA 5CIQA 1G17A 3BJIC 4M0LA 2BBWA 2BEKA 5SZJA 4QJ3A 4P33A 2X2FA 4JLPA 5J4LA 4NCHA 1HTWA 1U99A 4KVGA 2H18A 1XBTA 5E95A 2WAXA 3H1TA 3R8CA 1KI1A 4IOMA 4YDSA 1Z29A 5AK0A 4BFWA 3SZRA 1NNEA 4P32A 1KI6B 4AKIA 1VCIA 3E70C 3WHLA 3MUFA 4PPFA 4ZCLA 3X1ZA 3P4YA 3UANA 1JI0A 3QE0A 4PO9A 4BRUA 4W5HA 2ZM5A 4QC2A 1N0VC 4BZPA 3IBYA 1R0XA 5FUYA 2ZR7A 3RRMA 1WA5A 1JB1A 2FFHA 2OFXA 4TTPA 4BFYA 3PEUA 3T5DA 5LDDC 1DAKA 5F3WB 2W58A 1KYIA 3SC3A 2J41A 2BJVA 3HYTA 3N5CA 4ZDJA 4L15A 1NKSA 2IWRA 2QP3A 1NL3A 4C9BA 2ZEJA 4NU0A 2J0SA 2DFLA 3FVQA 2OESA 3LAWA 3MFYA 2IWHA 3UMSA 3I1FA 1NN1A 3QQ5A 3U7FB 3CM0A 2C99A 5JHHB 1J7KA 3EZ9A 2JJ1D 1QHXA 4WZBE 2JLXA 4LK2A 1Z07A 3EC1A 4HDCA 2VL7A 3SYNA 5C4MA 1D6JA 1ZW6A 1I2DA 4MGZR 2VTKA 5C1BA 2IYTA 1P9NA 1S4QA 1DTSA 2VSFA 5BWMA 3FHCB 4P4SB 1M2OB 2G0NA 721PA 1UJ2A 4PZLA 1EFRA 4URXR 3VKGA 1G7SA 4MKIA 1OIXA 1VCNA 2BJWA 3BC1A 4NBSA 3PCRB 4LBZA 3SEAA 1W2HA 4NCJA 5H68A 1G6HA 4UNNA 1J90A 5IDVA 3CW2A 2VF8A 3EA5A 3AM1A 2NPFA 1O3YA 3RYTC 4UXJA 4DSOA 4D4MA 2FZ4A 1ZIOA 2O8CA 1XEWX 1AKEA 2C9OA 2BM0A 4OK3A 5EZ5A 4D0LB 5AUNB 3GLFB 5B57C 1LW7A 2WJJA 4KFUA 5EXPA 4RZ3A 2IS2A 4HB4A 1AKYA 3C41J 3TQCA 421PA 4OJKA 5IRCD 2D74A 1SVSA 3MLEA 4FN5A 5JWHA 1OIVA 1SZPA 2AD5A 1L4UA 1OXTA 3V00A 2OILA 4V0NA 1G3MA 2BMJA 3NXSA 4F91B 4MA4A 4P3YA 5FFMA 121PA 1G4AE 2ZRJA 1AM4D 4JLMA 4TYPA 2VP6A 3EZFA 1AS0A 5J4YA 1DG3A 2AXNA 1CIPA 1FL9A 4PHTA 1AGRA 3KJEA 1U0LA 1Y3AA 1OXSC 1BS1A 4IDNA 1VTKA 1Z6TA 1M1YE 1LFDB 4DKXA 2RGNC 2IUSA 2RGBA 1IQPA 2NZJA 2ONKA 4FWTA 2XXAB 5JLJA 4JBWA 4YC7A 1CJMA 2YYZA 1SGWA 1RRGA 5EZ6B 3THOA 1I4TD 1Z0KA 3GCGA 3RVBA 4ESHA 5DLQC 2W2VA 3WMGA 1GP2A 3K8YA 3CR7A 4Q4AB 2R62A 3AEZA 5JSZB 3B60A 1P9RA 1IOZA 3K0CC 2C98A 2FN4A 5CK5A 4IDHA 4IW3B 1BH2A 1Q3HA 1KO5A 4AKEA 4RZUA 3NDPA 2IYSA 4KVAA 3MRSA 4Q1DA 5K8TA 3AP2A 1G8HA 3DM5A 2JA1A 3NBXX 1N5KA 3V4RA 1MT0A 1S3SA 1C9KA 1A2BA 3GP8A 3AV0B 4QRHA 1NSFA 2FX3A 1KDOA 2GA8A 2XJ9A 2ZYTX 3B13B 4IFEA 5GJVC 2UKDA 3FKSD 4RD0A 3NC0C 4JLVA 4BFXA 3LW7A 1E9RA 3PFIA 4TT3A 2NZ8A 4QGGA 4H9GA 3NG1A 5P21A 1WB9A 2O8FB 4HAWA 3GLIA 1E2PA 4FIDA 4QHSA 1HQCA 3SYKA 2X8AA 2HXYA 1F3OA 5C4GB 2I1QA 5DN6A 621PA 3M0EA 2ZUCA 3LFUA 1DOAA 3HR8A 1NBMA 2WTUA 4AKHA 4XD7D 2J46A 2WIBA 2A5DA 4PANA 5F98A 1SXJE 3QEJA 3ADDA 3NH9A 3IQXA 5JCZA 3UMFA 4D26A 3BB4A 4QBFA 4XTRA 2R6GA 4U00A 3TKLA 4UQOA 1EFUA 5FOTA 5FUXA 5HZKA 3CH5A 3KTAA 3KX2A 1XRJA 1LV7A 5HR5A 1CLUA 4AURA 4HUTA 4KBFA 3JZMA 4LC1A 1KZ7B 4A4DA 1KI9A 4HAYA 1DELA 2QAGC 4LDJA 1R5OA 1ZU5A 2A3RA 3D7MA 3GJ4A 3VR4A 1JR3E 3BAFA 3MWYW 1N6KA 1ZP6A 3AVYA 4Q4JB 1KHTA 2Z6VA 5LD2C 1X1SA 1OH6A 2ZI3A 2C9YA 3RSLA 5CJPA 3IBGA 1Z0FA 2DBYA 4D4LA 2ZAMA 1T91A 2ZYVX 3NWJA 4FWIB 5FR1A 4HAZA 3H86A 3C15C 3P27A 3AKEA 3ZZ0A 1XZQA 1U9IC 2PL3A 5CK4A 2GWHA 3UXMA 1XCMA 1K5GA 3EC2A 3LX8A 5AJWA 2J3EA 4ARZB 2GJ9A 4EFNA 1JR6A 4Q66C 3UMRA 5ELXA 2PJZA 1KDPA 4EDHA 2WMOB 1HH4A 2FGJA 5AWFC 1MABB 4TLEA 4KCGA 4KITB 1I2MA 2QI9C 4Z8YA 2A5GA 1ZINA 1U98A 2KI5A 4BEJA 4LV6A 2FFAA 1QZXA 4Q9KA 3CBQA 1JAHA 3LBHA 3PR1A 4Q1EA 5G3ZA 3N2IA 2RH5A 1XEXA 4IOLA 1FP7A 1E96A 4E22A 4WBSA 5FUVA 1QHHA 3ZVLA 4AIIA 3AVTA 1OKKA 4LI0A 4Q03A 3IGFA 5FR2A 2ZJOA 3QG1A 4F4IA 1WRBA 1E4YA 5CLQA 2MSDB 3SU8A 3CZPA 4OHZA 2V9PA 4NL4H 4Y0AA 4B3GA 1KI3A 1QRAA 1BMFD 3VQTA 1Z83A 1N5LA 2REOA 2Q3HA 2JLVA 5HCNA 1KIMA 4EJSC 1JAIA 4A8JA 2A9KA 3A4LA 3ZQ6A 2VQSA 4NP6A 1E2NA 3KXIA 2XITA 1CP2A 3KXKA 4PQFA 5IK2D 3EASA 3VNUA 2DPXA 3W9YA 4LJ6A 2OT3B 3CLVA 3IO3A 1V5WA 3MWLA 5AJYA 1L7VC 3DHWC 2XOKD 4ON9A 2NO6A 4O25A 4TL9A 1TU3A 2YZ2A 4B6EA 2XSZD 2Z5FA 4JLBA 4Q1FA 5SZKB 4A15A 3EAQA 2IUUA 2QA5A 4DDWA 1E94E 3TR0A 2OCYC 3E5HA 1OFUX 4CRWB 1C4OA 3F3YA 3B82A 5AUPB 1GVNB 1N6LA 4YMUA 4PZZA 2CLDX 3NKVA 1G7CA 4L16A 1KTVA 1UADA 1N6HA 3EA0A 2GJSA 2B7CA 1WBDA 2ZIAA 3K9HA 1E2LA 1ZCBA 2FPMA 5KPJA 1PV4A 1G6OA 3GJ0A 2FG5A 2KB0A 2D7CA 4HZUB 3CRRA 4I1VA 1VG8A 1M7GA 1P2SA 1N25A 3H0KA 4W7SA 3I8XA 3ZJYA 4XVQA 3PUYA 1XEWY 4A2PA 4DIDA 1Z5ZA 1AGPA 2ZJ8A 3HPRA 3ZQJA 2D3WA 4EFMA 1OFIA 3K70D 1CBUA 1UBEA 3SHFA 5L3QB 4FCWA 2F1RA 4NCKA 3K70B 4M1OA 2CJWB 1QG2A 1KO8A 1SXJD 1JQJC 1JXOA 3BWDD 3QEOA 1ZM4A 1GTVA 1GL9B 1SXJB 4DCTA 4AY2A 3SHWA 2LKCA 3VNVA 1R8QA 4LPKA 4OK5A 1GOTA 1RKBA 4URUR 2ZR0A 2D7DA 4K46A 2Q9BA 4PXAA 4BRWA 3GFTA 1KO4A 4M9SA 1QHIA 3PEYA 4CEHB 2ZITA 1S1CA 4ZO4A 3THYB 3BB3A 3LD9A 1RYFA 1TX4B 2RMKA 2QN6A 4TLDA 4B75A 2F9LA 2WSMA 4AG6A 1NVVQ 2XB4A 3GLHE 5E3HA 4N3NA 5FTMA 3QF7A 1ZC4A 5L3VA 4CGZA 1MO3A 3Q5EA 1UKZA 4QHTA 1W2GA 1AIPA 4B44A 5JI3E 3A1UA 3SN6A 1EFTA 2QUZA 2QBYA 3THXB 2QE7A 1W5SA 2FJUA 2ZAOA 4DLSA 4GFDA 2P65A 2O8EB 1ZC3A 2E9SA 5FPSA 1M7BA 5EJEA 4EUNA 4OI4A 1ESNA 2H5EA 2GJAA 4YMWA 3ZH9B 4DC9A 1GWNA 1NVWQ 2XNDA 3C8UA 3U7EB 3B5JA 2QPAA 3CPJB 4GOXA 4PHGA 2P6RA 2YVUA 1T8TA 2CE7A 4KO8A 4UXIA 1AQYA 3G5UA 2NPIA 2W6JA 2CBZA 3A1VA 4C0AC 5EE3A 5TV2A 2JDIA 3A4NA 1UKVY 2GEVA 2OO7A 4ILEA 4S35A 2QP4A 3GEEA 2WWYA 3IKJA 2WJVA 3U7GA 3EZ6A 3ZGXA 3QBTA 4MRSA 1DADA 3KQNA 1TQ2A 2ZJYA 3EIHA 3U3RA 1JEEA 5EQTA 4MKFA 3CF0A 2RB4A 3CPHA 4JLDA 4XOIA 4QNMA 3UG7A 3GJXC 3L0IB 1X1RA 5FPTA 4LJAA 5KDOA 3FHOA 1G4UR 4BFUA 2RGAA 1W4CA 3MJRA 1YQTA 3BK7A 1JJ7A 1KDRA 2KWIA 3DZDA 3QF4B 1XTJA 1FPMA 1AQUA 3R9XA 4IKEA 1R5NA 2RHMA 1UBGA 3AF2A 3DKVA 2G83A 3SBDA 1X86B 2GJ8A 2MMCA 3TW4A 3EX7C 2GJKA 1AS2A 1E2KA 1HUQA 1LS6A 4GP6A 1G20E 2NG1A 2VA8A 5FTLA 3IPXA 4B74A 1KI2A 4KLNA 1NN5A 3B85A 2V54A 1G16A 1CU1A 1GFIA 2WOJA 4OQLA 3V4FA 1W4RA 1H65A 1XFAA 3OFNA 4GZMA 3X1WA 2ZQ5A 3MMPA 3HU1A 2DWOA 3QENA 2WIAA 2F3TA 1DARA 2I1VB 2GXUA 2AN9A 4NYIQ 1P75A 3AF4A 8OHMA 3C14C 2R65A 4V0ME 5BXQC 2G1KA 4EPWA 2O0KA 3EPHA 1UFQA 1OT3A 5F9HA 2H7VA 3TK1A 4WZAE 3L0PA 2ZRHA 5KPDA 4DSTA 3CNLA 3TAUA 5TY0A 2BMDA 5D3QA 3T34A 2OZEA 4Z8XA 1MO5A 2GESA 3CWQA 3IILA 4HLUC 1K8RA 2OCBA 5JJIA 1JQLB 4HLDA 2QU8A 1OXUA 2YHSA 3K0CA 3AVOA 3QPWA 1VMAA 4HUQB 4JLNA 4QG7A 5UKDA 5KDLA 1WF3A 2ZSBA 2ZRDA 3P1JA 3EIQA 4HB0A 1G7RA 1YZKA 4LHZA 3L0OA 1XPRA 1GL7A 1EG7A 5E7MA 4D2IA 3CONA 3RLFA 2OBLA 2OFWA 3I4LA 4MUBA 3KQKA 1XEFA 4TWZA 3S1AA 2IS6A 1UF9A 1E2MA 3CZQA 2FOLA 4FMCB 1AJEA 4A9AA 4GMDA 3PEWA 2ZE8A 2FWRA 2V6JA 4EPTA 3B8HA 4M2LA 1S3GA 3KFXA 2XGJA 2ASEA 3DDCA 3DKPA 1HV8A 5AUOB 3WY9A 4YXWA 2R2AA 2ZRKA 2X2EA 2PJRA 2WM9B 4FW9A 1RPZA 1TF2A 2JIZA 3SE0A 2HXSA 5EXTA 4DUGA 4ERNA 2LKDA 4BLOA 1XTQA 1ZM9A 1DEKA 4NONA 2V3CC 1GL6A 4NYMR 4DUGD 2GKSA 2O5VA 2WWHA 2CK3D 4PHHA 4RJLA 1E9EA 4HAUA 3SJBA 5F9FA 2GCPA 1COWD 4XJXA 1IN8A 2Q3MA 2L0XA 4K8OA 4MKGA 3GLHB 4Z1MA 3IUYA 5EE9A 4W5WA 2F9MA 4G5GA 4PSAA 2W6ID 2ORIA 5L8VA 1YZUA 4IOKA 5FOSA 1Q0UA 1F2UB 1TAGA 2QPTA 3K0FA 4DBLC 4A6XA 2QAGA 5HZHA 5D3MA 4L4UA 1ESMA 1TPZA 2NO9A 1C1YA 3SBEA 1CJKC 2EFGA 4Q48A 4Q4HB 3BH6A 1CRQA 3KKNA 1HEIA 5HCIA 4M9QA 3CX6A 4FCTA 5JECA 2CLSA 4UXHA 3DZ8A 4Q9JA 1WDTA 3I73A 2ZS7A 1YJ5A 3KKQA 5FOUA 2ZRPA 3LXRA 5CDFE 3MAAC 5A0FA 3OE7A 1VKJA 2JLSA 1OHHA 4TMVA 4JLOA 4KAXA 3VR3A 4BWYA 3TGPA 1RRCA 1NLZA 1EWQA 2ZR9A 1U9IA 4IVPA 1U81A 1OHHD 2X77A 5HE9A 5JBQA 1ZM7A 4DLYA 4URWR 2QEQA 2O8DA 5FOVA 4A0HA 1KSGA 4KFSA 5IF9A 2VHCA 2YWHA 2QT0A 1XZPA 4KXFB 3ONWA 1E2JA 1QVRA 1XP8A 1HE1C 3EG5A 3FDIA 3NHBA 1IJFA 1G9XA 2F1IA 1W4BA 2QP9X 5TB5A 4DLTA 2BC9A 4X8OA 2CNWD 1LS1A 3C16C 1W44A 2PT7A 3WHKA 3IIJA 3TJZA 2WVJA 2R6FA 3FWYA 2O8BB 1CS4C 1E4VA 4G01B 2OSBA 2AR7A 3K70C 1D9ZA 2GAOA 2FSIA 4LBWA 5EP2A 1D8TA 3MWJA 3B9QA 3N70A 4HYYA 4IXMA 3B2EA 1SXJC 4FMBB 2D06A 3L2OB 2B6HA 3I5YA 1PVOA 4OI2A 1GNQA 4JLJA 3K9NA 2QTVB 2NQ2C 1E0AA 2WPDA 1MO4A 2WWIA 1II8B 1E9FA 2EFHB 4EJSA 5JCPA 1ZNZA 4JBXA 4LJ9A 4AKGA 4EPVA 1VDZA 2J0QA 5G41A 3T1QA 5BW8A 3LLUA 3DMNA 4ZCMA 4Q1AA 5CYOA 3MGCA 1KI6A 4C0SA 5FBWB 3U60B 5DI3B 1LNZA 2HT6A 4HLQB 4NCNA 5SZHB 2YKGA 5L3SB 1E1RD 1X8KA 2EYQA 2OM2A 1NY6A 2XNSA 3G82C 4BZQA 2V6IA 4RFSB 4TMZA 1F2TB 2BIFA 5IHPA 3R9WA 3AVVA 4PX9A 4QFMA 3GD7A 3W8RA 3B6EA 3GLIE 1U0JA 3THWA 1NLYA 4CEJB 4F93B 4WOPA 3UWKA 5KDDA 1Z6YA 3LO5A 2IL1A 3W5JA 3C5CA 2PLRA 2XX3A 3LQQA 3T5GA 2ZS8A 4QBHA 3FKQA 3F0TA 2P3SA 1W1WA 4M1YA 4RD6A 1E98A 1FP6A 1KMHB 1FQJA 1W4AA 1SVKA 4O3MA 5JS7A 2F6RA 4A0FA 1UDXA 1OH7A 1IXZA 1NI3A 1YZLA 3KJIA 2JJ1A 1KJZA 2BBTA 2CDNA 821PA 5E7JA 2B92A 2IEYA 4A82A 1CF4A 1S1MA 3BGWA 4GZLA 1JXMA 4YQFA 3PV0A 2OCAA 3Q3JB 3FYHA 3NHAA 4P4SA 3A1TA 3HU3A 3AVUA 1MRSA 3CH4B 3B9PA 1GSIA 4PSVA 2EQBA 2QM7A 4LBVA 4TLCA 5KNDA 4C7OB 2CCJA 5B2ZA 2FNAA 2QT1A 2GVDC 4G0NA 1KO7A 1T0HB 5AJXA 5BYKA 1IY0A 1NF3A 3QOFA 2WKPA 3M6AA 3NH6A 2CHGA 4D6PA 2C95A 1Z6AA 3DOEA 4ASUD 5K8LA 3HYRA 3BS4A 5B58C 1YKSA 2HJVA 2RGEA 2FPLA 3ZD7A 3CRVA 4KU4A 1SKYB 3GLFA 1OXVA 4DCVA 1OV4A 1P9WA 1N2CE 2RCNA 2VH5R 2PCLA 1YVDA 3I3SR 4BPBA 4DLVA 1ZU4A 4B71A 2CE2X 3LH5A 1E2HA 1Z0AA 3P20A 2IYYA 1Z47A 4B3FX 3WBJA 4TYWA 2GK6A 2AXPA 1E0JA 1XWIA 2OFOA 4MITA 1ZNXA 5C18A 3VX4A 2BMEA 4IJMA 3O47A 1TUIA 1DAGA 4MGKR 2IXFA 4G1UC 4L9SA 5CM8B 4FMCF 4MGYR 1G3RA 4QL3A 4TMTA 3PG5A 3T06B 3BFXA 3QKSB 4OHVA 2P5SA 4XVRA 5FBVB 2JLUA 2XXAA 2ZRCA 4Z51A 4HDOB 2C8VA 2GVZC 3PENA 1FNMA 2QORA 4LJ4A 2IYLD 4Q1BA 5AR1A 4ZKEA 1R0ZA 2PT5A 1FUUA 2J0UB 4Q4AA 2D2FA 2DYKA 4G5SA 4B73A 3EPLA 2A78A 4KI0A 4M22A 5JSZA 2GTPA 4G3XA 4XTCS 3L0SA 2ZREA 1MR3F 3RS0A 1KK0A 3VR2A 1EWRA 3ZIAD 1QHNA 4M1KA 4AK9A 2DWPA 2ZI5A 4A92A 1GZSA 4X8LA 5B30A 2GNOA 3K1JA 1HYQA 2O0JA 4ZIRB 2ZRAA 4F7WA 3LW8A 3AVWA 1G3UA 3L82B 3U3KA 2WZQA 1HE8B 3R20A 3QXSA 5JJKA 4QM6A 4C0LA 2F1HA 4IVRA 1WXQA 3JZAA 2AK2A 1VYTA 4IVQA 2W83A 4R2IA 4DJTA 3FKSA 4P4TA 2ZUBA 4QJ5A 2R44A 4XWOA 3O8CA 3U2QA 2QG6A 2O0HA 2G77B 4IDOA 3I62A 1KSJA 4F92B 3KL4A 4TSFA 2VIIA 3WBKA 2BHRA 4GOJA 2OBNA 1X8LA 1XB2A 4JBYA 2ZRBA 3U4QB 1IM2A 4TSFD 4GI7A 1X6VA 3OEHD 5DYIA 1YRBA 1KK1A 2B21A 3BH0A 5FOXA 2VHUA 2C5LA 5HKKD 3RS7A 4QGAA 2QNRA 2VP0A 1NJFA 3QBVA 5SZIA 4XD7A 4DLUA 3BRWD 1J8YF 3RS3A 3TSOA 3RS2A 4TQUS 1SKQA 1I4LD 2G6BA 2XZOA 5H8WA 1GRRA 1KJYA 5EUMA 3TVTA 2A5FA 2ZSAA 3WYAA 4B48A 4P4UA 5KSPA 2E1RA 4GT1A 2NO1A 3AVPA 3O8BA 1OF1A 1WBBA 1XU4A 5FBLB 4QGHA 1KI4A 4DXAA 1IN4A 1KK2A 1XMJA 4WVFA 4XIGS 2B8WA 4Q9HA 4Q47A 2NMVA 3OIWA 2GCNA 4PC1A 5GJBA 5EE0A 2CHQA 1SVOA 1YE8A 3K9LA 4AC9A 1KY2A 4CZ2A 4BLRA 5CYPA 4Q4JA 1US8A 2ZYWX 4Q19A 4TYQA 3NDBB 2YNMA 4JKYA 2X1VA 1Z2AA 5IT5A 2CL6X 3LQRA 1NN0A 1PZNA 4KFRA 3I5XA 2GCOA 4C3ZA 3KZ1E 1R0YA 1Q20A 4HLUA 2P6NA 3DO6A 4UJ5A 1ZNYA 2RGGA 3MWKA 1YZNA 1B23P 3AVXA 2VHTA 2QMUA 1ZJ6A 2BCGY 1E99A 5FOWA 2HCBA 4ARZA 3GQBA 3RAPR 4UNRA 5M04A 4XH9B 5CJ2A 3VMFA 2ZVQX 1J2JA 1XPOA 4OHWA 3X1YA 4OYHA 5JEDA 2RGCA 5FH9A 3LWNA 1PJRA 221PA 2J9RA 3H84A 3D31A 3P26A 4WW0A 4WXRA 1XF9A 2FFQA 3FPAA 1Z06A 3ZZTA 3NVAA 4HDQB 2ONJA 4B43A 1YHNA 3SFZA 1XD9A 3OEED 4IRUB 2ZJ2A 2QROA 3WRXC 2Z43A 1ZBDA 4JS0A 3WP0A 3WMEA 4EAQA 3NBZC 4KYUA 2QMHA 3WP1B 1G5TA 1KI7A 1RJ9B 4LHXA 4PQYA 3U5ZB 4CT4B 4PFSA 2V8OA 1FX0B 5EXSA 2J7PA 2DCUA 4P0TA 4OK6A 1BMFA 4UNQA 1Q44A 1DPFA 2J7PD 4GSYA 5DGXA 4FINA 3LVQE 3X2SA 3HR7A 2JGNA 2ZYUX 1FUKA 1ZM3A 1Q22A 1TMKA 1OLOA 4Q7MB 5IK2A 1J70A 3B78A 1N6RA 1T3LA 4RCYA 2QTFA 3BBPA 2FEOA 2CXXA 2OV2A 5CM9C 2I3BA 4B76A 3D8BA 5JFGA 2XOKA 5JZVA 1XCPA 3BORA 1XJ0A 1GG2A 4FCVA 1P2TA 4CVNA 4OHYA 4M53A 1NVVR 2OLKA 1PLLA 3R7WB 2DR3A 2KJQA 2G9NA 1ETUA 2XSZA 2VYFA 4C4PA 3GLGE 1S9DA 4TYNA 3CRQA 1MV5A 3DOFA 4OJQA 4Z54A 2RGXA 1KO1A 2GEUA 4Q1CA 2UZIR 4MRNA 3I61A 4MYCA 4I4LA 4KFTA 2ZE7A 4C0QC 1NMXA 2BCJQ 1SHKA 1PUIA 1Z08A 1EXMA 1FZQA 2G88A 1TTTA 4F4CA 4QBIA 1OPXA 4E03A 3VKWA 1EESA 4BASA 1IJEA 1P73A 2CCKA 4ITRC 4E07A 1SVIA 4M8NE 4HZUA 1SVMA 5BN3A 4H1UA 3W8NA 3U44B 1E1QD 4C0KA 5DO9A 1FOEB 4JSTA 1E9AA 1G19A 1M8PA 2VHQA 2HYDA 4LV5B 1BIFA 3BH7A 5HPYB 3FOZA 2NO0A 2YOFA 1XJQA 5ANRB 2FFBA 5KSYA 2QZ4A 4NHOA 4A0RA 2CL0X 5L3QA 4Q00A 1TQ6A 2BEJA 1F48A 2CJWA 2W0MA 1VHTA 1DAHA 2IYRA 1DO2A 3OAAD 4HATA 1SXJA 2C9CA 1R2QA 4TMKA 3EZ7A 2Q9CA 4B3DA 2WJHA 4CF7A 1W0JD 2CL7X 4N0DA 4PAOA 4DEXA 4FMDB 1QG4A 3VFDA 2JLYA 4MH0R 2R6DA 1JECA 2HYIC 3EIEA 3A36A 4FI3C 2AHOA 3QPUA 5EP4A 5E4FA 4CEHA 2R6CA 1FFHA 4TQ9A 3THYA 4HEJA 1NVUQ 5EP3A 1FTSA 1G1MA 3EWAA 3SJZA 2VF7A 1R0WA 1IY2A 3SI7A 3QKTA 4QGFA 4OKSA 1EFCA 3OZXA 1PLJA 1AK2A 4TQAA 4JYBA 1T5IA 2IF0A 3Q5DA 2JLQA 2BM1A 3THXA 1JR3D 1XX6A 2ANBA 4OQFA 2QQEA 2ZSFA 4LYAA 1Z8FA 3A1WA 4HAXA 4BLQA 2O8EA 2ZRMA 1VCMA 4F4JA 2QSZA 1M6NA 4PTLA 1D2MA 3NBYC 1KAOA 3MG9A 2KBEA 3AB3A 1E32A 4NYIR 3TAHA 2UZ3A 4MYUA 2QQ0A 4LYFA 4BE7B 2ECKA 3EW9A 4EQ6A 1G21E 1CJTC 4YMVA 3FGNA 4IXNA 3IEUA 3J81k 1H8HA 4R2HA 1Z63A 1P7CA 4LC0A 4B35A 4KSCA 3QKRB 2HEIA 4NKRA 1H8HD 4EIWA 2WJYA 5BQ5A 1G7TA 3ZVMA 3KXLA 4Q9IA 4RD3A 3VX3A 3R9IA 1R6BX 5FL7D 2AX4A 4LY6A 4Q4LA 5FI0B 1P72A 1AS3A 4D4KA 1X8JA 3PITA 1G41A 1RRFA 2G3YA 4KYIB 2C04A 1KNQA 1NLFA 4C2TA 1HY3A 4PO8A 3ZDQA 1KKMA 1A5TA 1FMJA 1ZM2A 3LBIA 3QF4A 3LA6A 1ZUIA 3KKMA 2ODNA 4BECA 2PMDA 3RS5A 2ORWA 1G8GA 3CX7A 4R98A 3VHLB 1T4GA 2EFDB 3SFVA 4C0HA 5DYGA 3TE6A 3BFVA 4LPSA 2FSHA 4LYJA 4E09A 2BDTA 1HT2E 3RRNA 2JLZA 3RS4A 2EVWX 1M34E 4S2EA 2WKRA 1GILA 4WIAA 1N0WA 1O87A 1XTIA 2YJTD 1KGDA 5TARA 3Q9LA 2GBLA 2QENA 4JL6A 4LGMA 1D5CA 5TDHA 2ZRIA 1XPUA 2P5TB 4QKQA 3G0HA 4DB2A 3U6BA 1V43A 3SNHA 4ZCIA 3GEHA 1G5PA 2WJGA 3QPVA 1P60A 1OFHA 4QXAA 2IYWA 1E2DA 2Z83A 4ESVA 1U90A 1BKDR 5KYKA 3ZYCA 1OIWA 3GLGB 3E2IA 5DIFA 2D2EA 1TNDA 2MSCB 3L43A 4MRRA 4EKDA 4GPTA 3GJ6A 3TLXA 4R9UC 3SS8A 4W9MC 1NG1A 1AN0A 3VU9A 2BBOA 4HSEA 1N6NA 4AYXA 4LV8B 2IS1A 1ZNWA 4HB2A 1VIAA 2ZJAA 1T8UA 1NVXQ 3QVUA 4TL8A 3U7HB 5KUTA 4HUQA 2R6AA 1IXSB 4KHZA 5GJWC 2QGNA 1U94A 2IYQA 3GJ5A 3U6KA 4TLAA 3DM9B 2J1LA 3ASYA 5BN5A 4RD1A 4NH0A 5JJLA 1W46A 2BWJA 1WQ1R 2OEPA 3A58B 3QIAA 5J47A 1XXHE 1OH5A 4TZ0A 2B7BA 4IOJA 1E9SA 4WA7A 4CEIA 1ZUNB 2ZTSA 3EPJA 3K0SA 2WSSA 1U8ZA 1E0SA 1L2TA 1N5IA 1Z6XA 1DAMA 4OHXA 1DVRA 2WSSD 3REGA 4OI0A 5LBIA 1ZYUA 2OE2A 2RAPA 1Q12A 2IYUA 3EPKA 1OH8A 3FMPB 2QY9A 3IPYA 2N46A 4PO1A 5KNBA 2HLDD 3WMFA 3FMOB 5DHAA 2CK3A 1MKYA 3OHMA 3PEVA 5CLLA 1ZAKA 2F3RA 1DG1G 3K9GA 4B32A 2AWNA 1ZUHA 2EFEB 4M1SA 1NRJB 2EFCB 1P2VA 5KO2A 1SVWA 5DISB 2WWFA 1COWA 2WHXA 4TYYA 2F43B 3GLHA 1Q57A 3I72A 4MYHA 4ZI2A 3IO5A 1M7HA 5FTNA 3GMTA 2W00A 3MSXA 2W6IA 4LSGA 1F2UA 4B2PA 2KSQA 1W7AA 2C2HA 4PSKA 4BFSA 5J40A 2H92A 5LB2A 1VPLA 2FEMA 3QXXA 5CB6A 1Z6GA 1N6OA 3K0AB 4JT4A 2GZAA 2WKQA 4OQNA 3ZS9A 2ZU6A 2QMOA 4LHVA 2P2LA 1VCOA 2BBSA 3UK6A 2R8RA 4MDEA 3Q7QA 2GXAA 2JJ2A 3QVVA 5GADl 3W3ZB 3NC1C 3ZLJA 3W6NA 3WYGA 1E3MA 3K0EA 2JJ2D 1F5NA 4PAQA 1NIPA 2IHBA 2NOAA 1CEEA 4FMDF 4RKFA 2C78A 3SQXA 4KODA 3VTKA 1MH1A 3SQWA 3VHXA 4DZZA 4RY2A 1CJVC 5JS8A 1FTNA 3AQ4A 1XTKA 3Q8XB 1JBKA 2RGDA 1VYUA 1UEIA 2Q3FA 2WV9A 4TN1A 4A6PA 5A4JA 4QM7A 3GJ3A 3CR8A 4MKHA 1Q1QA 2PZFA 5D3MB 1NKTA 4GDFA 1JEDA 5KSOA 1LF5A 2CNWA 4R71A 2V1UA 2ZROA 2O8BA 1UBFA 1Q1ZA 2IYVA 4NYJQ 1I4DD 3CF2A 2DY1A 4XSHA 1JPNA 2ZU0C 3ND8A 3PQCA 4BLPA 5LD2B 2MSEB 3FTQA 4I1OA 4NPHA 5TXGA 2QAJA 4IHQA 2GETA 2V55B 1G291 1XD2B 2H16A 3LXXA 4Q02A 4DT1B 4J0QA 1KAGA 1II8A 1T3HA 2VHJA 4URYR 3EZ2A 3W3AA 3HWSA 4ZDIA 1E2QA 2DFNA 2FV8A 4JIMA 4ZI3A 1YR7A 3UIEA 1N6IA 1KJWA 3ASZA 2GF0A 1W0KD 1NJGA
chains in the Genus database with same CATH superfamily
1JLRA 1ZOSA 1L7XA 2CB0A 2DUJA 2Y1EA 5DI9A 2DXIA 1SVLA 3ONEA 3AYZB 5IPFA 1LVUA 3OPMA 4NZYA 2ZSIA 1JIKA 3A9VA 2BE9A 2BKEA 2JEYA 2W90A 4X5OA 5SICE 2ZVDA 1UM8A 1S96A 4N3BA 1Z6PA 1ORHA 4W7HA 3ZLUA 1YS6A 3I5MA 2RARA 5CXUA 1BJKA 2FP4A 4WZAA 4EHLA 2PTHA 1KFJB 2Y8EA 3R44A 2GF9A 4LFBB 1WSAA 1EFPB 1TPYA 2PT9A 4RFSA 4C6SA 3F7MA 5AKLA 5DLPA 2E2WA 4EGAA 1EB8A 2NO4A 2PGOA 3TW8B 1RYDA 3N8NA 1XTPA 3F96A 2E6KA 4X8HA 3HJBA 3T3IA 3SX2A 5IVDA 1WMSA 1ZVJA 2ZI7A 1TVKB 3LQ2A 2GILA 5EJAA 2PX4A 1IWPB 1SCUA 1ZR2A 4F72A 5TQJA 3Q3HA 3ZVRA 4IHKA 1GTMA 3N7UA 2IPNA 5REQB 2WBLC 3RROA 5CVUA 1D4ZA 2F8MA 2RGYA 3OTWA 1A4RA 2GDJA 5F1YA 1NBME 4DRZA 1GTSA 1WCWA 1RWPA 3OBIA 4I81A 1S4MA 1EUZA 1NDQA 3BXOA 3RVSA 5IJ0B 2WU3A 3KD2A 3I8SA 4W8HA 4PYQA 1E9BA 3RJTA 2VQEB 1XXHB 4NMMA 4YJ3B 3JQQA 3N05A 3UMVA 3KQLA 2C7RA 3JD3A 5THQA 1H23A 5KNCA 1KZ1A 2YZGA 2H8KA 1HQDA 3MJSA 4LX0A 3C1UA 4RL6A 2OCXA 2XMZA 5CH5A 4TWBA 1OCEA 5DCYA 4B3BA 1JILA 3L3BA 1HA3A 2REBA 4FOSA 3H6KA 1BS9A 1NSYA 1YONA 1W94A 2FWIA 2CMHA 4P7KA 2PXCA 2YIMA 3U0BA 2W70A 2VQ6A 5CITA 4TL6A 3USCS 2AN5A 3LZDA 1UXJA 4JVNA 4JR2A 1SY7A 3THWB 3DMGA 4GZ3A 3RKRA 1YQXA 1PS0A 1YR2A 1RXEA 2XDQA 2YXPX 1ECLA 2FSSA 1HT1E 2YINC 3CGWA 3N28A 1JKXA 3E7DA 3PIRA 4X8MA 1NVAA 3NYQA 4HNHA 3V2GA 4LBYA 4EELA 5L53A 4GBJA 3R0IA 3RREA 1K7SN 3IA2A 3T5TA 3R24A 2ZM6B 5FIUA 1Q95A 2C4HA 2JH3A 1EUDB 4DRXB 5JZMA 1DRWA 3GGOA 2CDBA 3LPLA 3UMMA 2FW1A 1ZOOA 4QQRA 1NW9B 2YCBA 4MLDA 1LDMA 4R16A 4KKVA 2G70A 4ALJA 1N6PA 4RJIA 4G85A 2ZBEA 3WB9A 4PYIA 2PEYA 2F3QA 2XE4A 4N0EA 1LSSA 2HA2A 2RC5A 5J4VA 1YL7A 2XQKA 4Y2TA 4XQ9A 4EBFA 1KZHA 4PG7A 2ETVA 3NANA 3V8NA 3KPYA 4E32A 2IXEA 1II9A 3EZYA 4MR7A 3RK4A 2NIPA 3TIXB 3I9NA 5EYPB 4ZRNA 4MICA 1NAIA 1ZD3A 2HPAA 2JFHA 1ZCJA 5FUWA 4Z5XA 1JEYB 4NOJA 5GAJA 5CDFA 4WN9B 1V3VA 2Y1KA 3OKCA 4GRAA 3TJMA 3KJHA 1B6GA 2LD4A 5EOVA 3QELB 3WIEA 2J0UA 1OFVA 3E2MA 1O6FA 2ZWMA 2EEPA 2WR8A 5GY7A 1TKRA 2ZRLA 4ISBA 4A2WA 4LJSA 4TTSA 1N3IA 4KKXB 1HQYE 5LA6F 2FYTA 1JBEA 4GLBA 2ZE6A 2PK3A 3S55A 3P32A 2P2CA 1Y9JA 1X3SA 3URMA 1FNBA 3C4JA 1BEUB 1NVDA 3HNPA 3G8YA 1UPTA 4BGVA 4BNNA 4RVOA 1JWBB 5LB4A 4PCUA 4G5FA 3QPAA 1UJNA 5DP1A 1KOFA 1IH8A 4J91A 4ENRA 3TXYA 5CYFA 1OFUA 2EW2A 3AJ8A 1FYXA 4JYAB 4DGSA 5JLAA 3AEKB 2VLBA 1C1XA 5JCXA 2J09A 4FFRA 4FFLA 3I2JA 3VR6A 3LGXA 4ND1A 4XGRA 3DFUA 4C05A 4DBLE 2YWEA 2KBFA 3O91A 1DEHA 3ETEA 3LX6A 4GM1A 5A6SB 2CF5A 3E1SA 3MCAA 5C8VA 3ZDDA 2PH3A 3FKJA 5CA0A 2BFDA 3T99A 4LQCA 3JQAD 4QUJA 2P1RA 2JFOA 3AGQA 3U31A 3IDZA 2QQ5A 4MQ6A 4YLGA 2AFIA 3IOMA 1GZ4A 2RKOA 4MULA 3DEFA 4KZKA 1SCIA 3DC2A 3KT6A 1NIJA 5K0LA 3IKTA 4LYHA 1UJ5A 4FKMA 4OQMA 4CF3A 3G02A 2O8FA 4BBJA 1PJCA 1ZGZA 2I67A 3LC0A 2XZPA 2ZCVA 3MC1A 1GPAA 2Z56A 3WAKA 3BILA 2F9FA 2AIRA 1D4AA 2NUPA 2Y1CA 3NEJA 1WMDA 4M1WA 4PAWA 4S1OA 1W52X 4YMSA 4Q5IA 5DH9A 3SBXA 2ZI6A 2DTDA 2ATXA 3IUQA 1M6VA 5HF5A 3LF1A 3DLCA 3HU2A 3K0KA 1WJGA 2O3JA 3EGVA 4MS3B 3ZH2A 3HLKA 1QU2A 1XRMA 1NXSA 1ZH6A 3BQ9A 4L85A 1YJXA 3DV0B 2HV8A 3A0UA 2BUCA 4A1FA 2X42A 5LSAA 4MSUA 4EQZA 2PJUA 2XCRB 2YZMA 4JGBA 1XGKA 4E88A 5C5IA 4G4SP 2VJYA 2PY6A 1C2YA 2YOGA 4YUAA 3AOEC 4Q6WA 3A2KA 1LPSA 2N1BA 5FAKA 4P3XA 1KBOA 1YVRA 2P6UA 4Y98A 1E6KA 1RZVA 4DMMA 1WV1A 5DX1A 4C0XA 2UZ1A 2EJCA 3LY7A 2ZIGA 5D7BA 4M36A 2E48A 3FOEC 2Q5CA 2AS0A 2G5TA 3RSGA 1WW3A 2AYXA 2H0AA 3CIOA 4GKVA 3QE2A 1R0RE 2B98A 2C8KA 5H3CA 4LNUB 4YV2A 3EPPA 2B83A 1T6NA 2XDYA 4BAGA 4ABYA 3KYBA 5IC6A 3HU5A 3BD6A 4IYRA 3IHLA 5ALPA 1R64A 1YR9A 4M1TA 5DN6D 3UKDA 3PGA1 1FNNA 4BNYA 1PFYA 3B1ZA 3CJQA 1WVIA 2I4OA 1TUBB 5AM1A 5EMKA 3VU8A 1QHYA 2IQIA 2GN8A 4XVCA 1JR6A 1QLJA 1IEWA 4RABA 2WHEA 4Q4DA 3C43A 2QYTA 1CC1S 2LWIA 1C50A 1SCDA 2YWBA 4IX1A 5ILOA 1CQJB 5F3DA 5ITZA 2A67A 2UYOA 4IWNA 2D0OB 1CR2A 3LP6A 4G5OA 3WWYA 3UTCA 4BKQA 2IEDA 3I28A 4QYXA 3ES9A 3K6RA 4XLTA 1OJ7A 2H1SA 3LY8A 1V6AA 1RMYA 2YV4A 1I7SB 1NAHA 3FVVA 3R6DA 2CZGA 4JEMA 4X66B 3UKJA 4ERXA 5EUQB 3CUVA 1UDAA 2IXGA 3H9CA 1T5TA 1DAFA 1V4VA 2ZB3A 3D0KA 1RFLA 1AF4A 3JR7A 3P2OA 4Q9LA 5KJ6A 1VPTA 4L76A 1DZIA 1FX0A 1V25A 1VG1A 3BF7A 3D6TB 1NG9A 1VLHA 2FMIA 2WT4A 3GB9A 2ENWA 1NJ1A 3TI9A 1IN5A 3RYIA 4NESA 4G5QA 4K0RA 4NE2A 4E5UA 4OHYA 1WMBA 1SCBA 1M8KA 4M9XA 4Q7LA 1NF2A 3BDVA 3S99A 4YR7A 3WGNA 2AX3A 1ACMA 2PUAA 3CVOA 1D2NA 4O0MA 3UQZA 1W5AA 2DUUA 3DMRA 3IIIA 3QPBA 3VKFA 3ZHTA 3A9RA 2OGTA 4C7VA 3NGLA 3UGQA 5K3EA 2EGGA 5C7IO 1IHPA 3FHTA 4QASA 3MJHA 1BXGB 3HV2A 5DBOA 3CB2A 4B09A 2XCQA 1ATZA 1UMCA 2I2CA 3BHNA 1JYSA 3B7PA 1S2LA 3F49S 2Z2IA 4JYZA 1W48A 1Z0ZA 1HE4A 3F8SA 2CVHA 2ZJ4A 3PX2A 1E61A 3SIXA 4FWBA 1S2MA 4JNKA 5ENDA 4AWXA 3GMDA 1ZIXA 3ZU6A 2OC4A 4D25A 4UCFA 5EEGA 4HEHA 2BOVA 1B0UA 3PA8A 1WE2A 2D5AA 2XQIA 2VBCA 4MJ7A 3I9V1 1OC2A 1OKKD 2I6GA 3LC2O 4C0BA 3TLKA 4LHWA 4OX9Y 4MW2A 5EIEA 1KKUA 5BW5A 4PGAA 2V8BA 1ODTC 3AUKA 5JSFA 3C3BA 3H75A 4DCUA 3NIBA 1NY5A 2GRAA 1AA9A 4RL4A 3T4UA 4JVLA 4R7ZA 3OOJA 3SM9A 4CM9A 1V8DA 2EFJA 3SICE 1SBQA 2DJ5A 2Q9AA 4E3WA 5L9AA 1UAGA 2AFVA 3LKDA 4IBOA 4MPJA 4OKNA 4RZ2A 3LUKA 1E6CA 3VYTB 4ZOCA 4A8JB 4CMGA 5K3DA 3OG9A 3U44A 2DFDA 1Q7BA 3QUSA 5EWJA 1N34B 2H2GA 3KKPA 5ALKA 3V6LA 5FJJA 3IA7A 5KTRA 1GYQA 2VQDA 2EHJA 2RDMA 3LK6A 3LU1A 5JWRA 3M49A 1ZD5A 2PH1A 1TGYA 1TGVA 5EIBD 2PIAA 2IEZA 4WAUA 4DIEA 5B64A 5CDGA 3RRYA 2JGKA 4JVMA 3QEMA 4IXWA 4RACA 3IHWA 3PGVA 4AZ0B 2B0JA 3NI2A 2FQ1A 3J80A 2VS1A 2C1EA 1ODLA 1ZL0A 2N42A 3LGSA 3LNCA 3HXPA 3PUZA 4HX5A 3BERA 3N87A 4J6EA 4D8WA 3A8TA 1P1IA 2NVOA 3LVRE 1BCSB 2BFPA 3LCJA 3I45A 5J1SB 2D1FA 2AKEA 3O9VA 3D3QA 4B4WA 5BP7A 1W0JA 4I3HA 4YP1A 1XZFA 4OGKA 1V37A 3A0RB 3SF8B 4B3RB 2UVQA 4HH0A 4M21A 3WX0A 1KMQA 3ANMA 3C6BA 3I4CA 4U6SA 4BLTA 1XNJA 5DWVA 2VPPA 5HYVA 1TQ4A 1W6UA 1IHYA 2ATCA 5KAMA 4MV8A 3KUCA 3ENQA 1K6MA 1FBNA 1H05A 1QE3A 1TJ5A 2FPXA 1ZHOA 4V0SA 2B1RA 3HQ4O 3RVKA 2GJ4A 3KQYA 3DTTA 1P61B 1LQ2A 1RABA 4JL5A 4XX0A 4YA6A 1U5AA 4R51A 1I4WA 2XIQA 4QOSA 1DIGA 4I8XA 5DHUA 1RHRA 1NW6A 3I39X 3PL1A 1RHJA 1X0VA 1LKZA 1REQA 1ZISA 3CKLA 4NG5A 1R9NA 2BFWA 1UXGA 2OKCA 1JR3A 2IX3A 3DVAB 2GFHA 2PBFA 1CRZA 1SUPA 1WTAA 4QGBA 4REQB 3OF5A 3V9AA 1H2RS 2V03A 2G5CA 2XEXA 2VR1A 1C29B 3PNKA 4RY0A 4EVIA 1F2DA 3BTOA 3A9TA 3G1WA 3H13A 2ZSDA 3KBBA 3KEOA 3UJPA 3B1WA 4BO4A 5AKGA 5EJ4A 1UPCA 3F9IA 5ALUA 4QU0A 1C0PA 3W78A 3R0JA 4B1FA 3KPVA 3BEDA 1G63A 1ZS9A 3IR6A 5G40A 3HA2A 4D56A 5DHSA 1AUVA 2X1LA 5KHOC 3I9LA 2IC5A 5CX1B 3T7DA 3DP7A 2WA1A 2FRXA 2AFHB 2CCGA 5HTOA 3QRWA 3PUWA 1AQLA 1BYIA 5HHTA 3TUZC 2NADA 5C7YA 3IVRA 3GLKA 3DWEX 2OUKA 1PWHA 3F5FA 3LT1A 4KMOA 4PS1A 4V3CA 2R5NA 3DG9A 5EKSA 4KR3A 3FGPA 2QTHA 2I03A 4CIYA 4B6FA 4PNEA 4KR2A 4R1TA 2GSWA 2Z8XA 1E2UA 2IRWA 1OX5A 1M54A 1JLLB 3U3OA 5K0ZA 4QWMA 2QRNA 3D7KA 4TMWA 1IN1A 4RV4A 1C1DA 2PZAA 1RVV1 4Y0VA 5HSGA 3GP3A 1CDEA 1KPIA 1OD6A 4EEXA 3IXLA 2WK1A 2JCSA 3WNCA 1QCZA 3A26A 3NZEA 1YJQA 2I6XA 4H35A 4OOFA 4EQ6B 1UJ4A 3VMMA 2ZIFA 3TLYA 2CN1A 3KP1A 4ZHQA 3FOBA 1FXUA 1H69A 4FYWA 4OQDA 2OXTA 3WQBA 5CHYA 3Q0IA 4MQFA 4I1UA 3G2IA 4FHCA 1AUXA 2FCRA 2J3JA 3A06A 3JALB 3TSYA 5BMVA 2EF1A 3DA8A 1U7XA 4ZVLA 1O96A 3JASB 4U3JA 4R40A 4UM7A 2WYVA 1WCXA 4GP7A 3BQNB 3C6QA 4IIGA 3TL3A 2GXSA 1RM3A 1HDXA 1IHDA 2FWAA 2JRLA 3JYPA 1GZ7A 4KV7A 5C2JB 1HPLA 4MDYA 3L01A 1ZK2A 4Q9NA 4LN1A 2AEFA 2C2KA 2POCA 2NU7B 3GCDA 2P4HX 3RWBA 3IMGA 3MIZA 3CG0A 4DYDA 4GBGA 1T25A 1OOEA 2GM3A 4WOCA 5J2UF 2ZRGA 1DBIA 2XUOA 4XLLA 3UT0A 5CFOA 5MDHA 4G0PA 4F2GA 1LLFA 2FPWA 4NZMA 5JD5A 2NGRA 3W4JA 2G9RA 2O7NA 3JQ7B 1UAAA 9ABPA 1SHZA 4HWSA 3IERA 4DSNA 4RTOA 4IO1A 4C87A 1BFDA 1GPBA 2DB3A 3P9KA 1PI3A 4MVJF 1UIMA 3EFBA 1Z2EA 1S2OA 1S9HA 2V7QD 1OLSA 3KEGA 2X4DA 3C6YA 4IDCA 1A71A 4UFNA 3V4PB 5BSWA 3R9XB 1EM6A 1RQRA 3JQGB 4X97A 4E33A 4EA6A 1HQKA 4QPCA 2DTEA 5BSHA 3TD2A 2IZ0A 1GKYA 2BKLA 1A88A 3FZGA 4K6GA 1AUQA 1C3JA 2VYCA 1HE5A 1WEKA 1Z0UA 2GN0A 2MJLA 2Y9PB 4TLMB 4TWAA 4I2VA 4OXXA 4EDFA 2YHAA 2QAIA 2YC4C 3COZA 5G4KA 3USES 5T67A 4V0LA 2O8EA 2XBLA 4JJ7A 1JHXA 1OYWA 2GARA 1UC4B 1J8MF 5HIAA 4CG0A 1TA9A 2ZANA 1N32B 2FKAA 3ZU3A 2VC2B 3TBKA 3MJEA 2ODBA 5H02A 1ZUNA 1GVHA 1VL0A 2B8TA 4G8DA 4K1LA 3ZNNA 2GHTA 2AW3A 4AZVA 4BNZA 4BUJA 1U8UA 2Q62A 1VJTA 2RGNA 3EZNA 3R5SA 4JQCA 1LTHR 4Y2PA 1E9CA 3A2NA 3GJ7A 1ADCA 1TRHA 1YD7A 3L6EA 1A7KA 4Y1RB 4V0RA 1QOQB 1C7EA 2Q5QA 1OWNA 1KQPA 2QRVA 4MMZB 2IJGX 4RE5A 3TMKA 3FGZA 4BMXA 3IBTA 5ULLA 5ALHA 3UFXA 3Q7EA 4J7AA 4JB2A 1DBVO 1B41A 5L51A 3IDFA 4CIXA 3LS2A 2WMYA 3NLLA 3S7ZA 3DNFA 1MDFA 3KUUA 3A6PC 1DO0A 1OWOA 2VOJA 4LHYA 5JZOA 4IKOA 2P6OA 4LOKA 1M1NB 1YBFA 3UC5A 2F43A 3D0OA 3TLMA 3BGIA 4E1BA 5K01A 2HRBA 1CUEA 4KAAA 3E9RA 1ELOA 2FPPB 4KXUA 4WNAA 1DOHA 5EWMB 3VI3B 1CTQA 3BE4A 3TE7A 3WL7A 2IUEA 1ZGBA 4FZJA 3ZHXA 2ZUFA 2Z95A 1K5DA 6ABPA 3BMNA 1O6ZA 2O7SA 1AKUA 3RAFC 2X9QA 2YHBA 3O6VA 1CULC 5CMLA 1E8MA 1UBCA 1RHUA 3KT0A 4J75A 1HZZA 3NBMA 5B1DA 1VMIA 2CNDA 4QNRA 1B0ZA 3ME5A 2OWDA 1UJCA 4GKKB 2QTBA 4JA0A 1JA1A 1V4BA 3KYIB 1ZD8A 1C5KA 3LIPA 4NF2A 4ZVSA 3COSA 4UDOA 4O4JF 5H1YA 1GM5A 1B8UA 1CVIA 5CYGA 6ADHA 1PGQA 4YJHA 1H8EA 1G21A 1QBGA 1U2QA 3DFIA 3EQ7A 1G0NA 3KZMA 5G53C 1JZTA 2FZWA 1HKUA 1I2ZA 2CUKA 2P9HA 1YZQA 1P4HA 3E8MA 4JI2B 1DAEA 2XYVA 4MV9A 3MILA 1DL5A 1ZG3A 2GKGA 2ON6A 4WLVA 4C30A 3RUIA 3WNBA 4GNRA 1N4DA 3ZY4A 5BWLA 1Y6GA 4X3PA 3AF6A 1JKJA 2AC4A 2CVOA 2H29A 2YQ4A 3L9XA 2C4TA 4I5FA 4WLEA 3IBCA 5JZ9A 3QX3A 3W05A 4DPLA 5KKCA 4BMDA 2JEOA 2R8EA 3PR2B 2C4VA 4U5XA 5JSYA 4Z1MD 2D62A 2ZTLA 3L8YA 4BIMA 1CZLA 1ID8A 2DHQA 3GYGA 5K0BA 4R9VA 1U7TA 3DEAA 4MRPA 3T41A 1HO3A 2HTEA 2ID8A 4ZD6A 3BGVA 3WRYC 2W2XA 4MUYA 2REXB 4PZPA 2AJDA 5NULA 4ED9A 2XGGA 6NULA 2V7EA 2DERA 1PZXA 4JZKA 3E35A 1TL7C 4I55B 7MDHA 3AYXB 3PVSA 3R8FA 4RZQA 1XVIA 2NX2A 1T2EA 4C76A 3RHFA 1ZKDA 4BDTA 1I7NA 4JQZA 2Z4RA 4WK4B 2J8ZA 4RBNA 4LCJA 1TW2A 2JFFA 5IYZB 1GIAA 4A5OA 5IM4A 3SVLA 3VR5D 4PRYA 1Q2UA 1AO0A 3H5AA 3U3MA 3VBCA 1XD2A 4UPVA 1XQ6A 1PFVA 2YS6A 4O2BF 2DFKB 1FMLA 3UWOA 2OXCA 3OE7D 9ATCA 1UDWA 3VR3D 1QGED 2Q7XA 4JFRA 1TIPA 4ZI7B 4EPXA 3RVPA 2M6RA 3H5IA 4Y2HA 3OH8A 3UJBA 1RXIA 2X9LA 4HMOA 4DPMA 2F7SA 5F2NA 1JT2A 5EHZA 1EUYA 2PLFA 1F9EA 5LJLA 4OM7A 2JJYA 3SS9X 4TS9A 4R8RA 5L7TA 1W0KA 1L7NA 2V97A 2ZSKA 1UEJA 3WL3A 4XUCA 5DX0A 4Q05A 5CEJA 4CU2A 4NDZA 3G88A 4N3GA 2HEGA 4DAOA 2M9MA 3B1XA 2IUTA 1E1LA 1V48A 4X6LA 1ISRA 2BDEA 3Q0TA 5HFAA 3L4SO 4D0SA 2ZRNA 4E6EA 1JEJA 3O84A 3QBEA 5E6UB 1PIWA 3D2BA 2GD6A 1TVEA 1EFPA 4V0MA 3CNHA 3SQMA 4YT5A 2K5UA 4NYMQ 1OSNA 4WY5A 4Q4CA 2JK1A 5C46F 4RD4A 5TC4A 3TW8A 4TTRA 4U2EA 3U0VA 1M1XB 2IBMA 3CFYA 3A9SA 1DAIA 3PFKA 1TVKA 5H80A 1XDBA 1UP4A 4LOLA 1CIJA 4G07A 4MO2A 2WICA 1LDNA 1PBTA 5REQA 1P74A 2G1JA 1F5SA 2K7FA 4D9GA 1TZMA 1Z4JA 2IYZA 4MB2A 2AGVA 3KB2A 1IHUA 1DDOA 2CLCX 4KWTA 5BYJA 2V65A 3LL7A 4BQIA 3IYLW 3B7GA 2DQZA 1J0EA 5IJ0A 4L9WA 5ICSA 3KWLA 1C9JA 2R97A 3GRKA 1XVLA 1KMHA 1XXHA 1ZJZA 3CUYA 2FWPA 2W7TA 2O1XA 4YJ3A 2R7LA 2IV3A 2ECOA 3C3KA 3DC7A 1QIDA 1E6EA 4R9RA 3S2GA 2X2FA 3HACA 5I48A 5GINE 3BXFA 3AJEA 1AUPA 4JLPA 4YK7A 1VJRA 1EXDA 2HGSA 5E95A 1ZOIA 4QTXA 2EATA 1AK1A 1B8NA 3DTNA 1MB3A 1PD1A 2RBKA 3I52A 3IESA 3TCNA 2J9ZB 4UTPA 1KI6B 1GGFA 1T29A 4UTRA 2Z6UA 2W5UA 1ADBA 1DIAA 3Q2OA 3X1ZA 3C98A 3DYIA 3P4YA 4V38A 3SC6A 3ZWNA 4HNAB 4BRUA 4FYMA 3BREA 4O4LB 4CM7A 1OWMA 4QQNA 4DR3B 1QDUA 2O19A 4G5HA 2ZR7A 3RRMA 4TTPA 2OFXA 1R9MA 1J24A 1U11A 3DV2A 3H83A 4LW8A 3TOXA 4DN6A 5F3WB 1U2GC 2A4MA 4WK0B 1RBYA 2UVPB 1UT5A 4UE6A 2C5SA 5DF1A 1LJUA 4YQEA 1IUNA 1EG2A 4Q7QA 4IH1A 1EUDA 5JD4A 4DRXA 3ETHA 1O6BA 3PX3A 4PBRA 4C9BA 1ZH0A 2DFLA 3E82A 4BPRA 3MFYA 4RNCA 2HCFA 3TFWA 3KYDB 2C99A 3QOWA 1DG9A 1J7KA 1FLDA 2O2DA 2JJ1D 3EZ9A 3KZXA 4JWTA 2HGZA 2JLXA 1JP7A 4D3SA 1Z07A 2L17A 3H11B 2QD2A 1VKHA 3NO4A 4BNVA 3NNDA 4IQGA 1D6JA 1ZW6A 4MGZR 2IYTA 4L8VA 1YKFA 5ER9A 2LV8A 721PA 1A3CA 1BNCA 1UJ2A 2O2YA 1R4MB 2OHOA 1LXCA 3G2JA 4MGHA 4MKIA 4J7CA 2HHAA 7AT1A 5KKAA 4NBSA 1PUXA 1L5RA 4LBZA 4JB3A 3UMGA 5H68A 1JEYA 1DRVA 4YWHA 3EA5A 4JKOA 3SDSA 3VYRB 3QELA 4DLBA 2RK6A 4RM3A 1P5HA 2B36A 5CAEB 2RCYA 3KTOA 4TTJA 4ZAXA 5B37A 1J0BA 2Q7OE 3F5MA 2NVWA 2BM0A 2LCQA 1QNFA 5JTUA 3HZOA 1OU4A 3FIUA 3EYWA 4N5DA 2DHEA 4D0LB 3ZWAA 3X1KA 3NTQA 5AUNB 5LQRA 1N8NA 2BKXA 3UB2A 3L6DA 1UJ6A 3U4DA 1EHIA 2IS2A 1EDZA 4HB4A 2H59A 3C41J 4J0FA 2WINI 4OJKA 4HDMB 1H0KA 2OG1A 2QLTA 1KJ9A 3DZGA 4PSUA 4QATA 3IP9A 5CH3A 4FN5A 1JG6A 1SMKA 1RR6A 1SZPA 1PR1A 1L4UA 2BH9A 3AEKA 3PJFA 3BZWA 5DNCA 4W5OA 4NY1A 5DGIA 5I7VA 3TQRA 4AXBA 3ORFA 4MQ4A 4D6XA 5FFMA 3E61A 5CA1B 4N5NA 1AM4D 2ZDGA 1FFGA 1LU9A 4CLEA 3IE2A 5J4YA 2QUJA 3D8NA 5J2TF 5A6SA 2AH5A 2HHLA 2Y6UA 4CKXA 4URFA 1SQSA 2JFNA 1I33A 4EF5A 3NMUF 3JWPA 1VTKA 1Z6TA 4Z7OB 4PZDA 1PKEA 4DKXA 4JR1A 5BR7A 2RGNC 2YMPA 1QJ4A 2IUSA 4B8ZA 5JYEA 1CZRA 4K40A 5JVDB 3QKIA 1HYEA 2E5LB 3PUKA 1RRGA 3MIIA 5EZ6B 3C48A 3GCGA 3SQOA 4PBTA 1JQKA 3GJRA 5IKEA 1ML4A 1DGQA 3JVIA 1SZJG 1KXZA 1WXHA 3G17A 4KGDA 3V4ZA 2V7UA 1UR5A 4Q4AB 3WMGA 1OZFA 1PKXA 2AEMA 2AN4A 4AG3A 1D2RA 4JHXA 1F51E 1OASA 1D7OA 4B3MB 3B60A 3VR2D 1IOZA 3K0CC 1E5VA 2FR1A 1WF6A 3O1JC 4TVKA 4MS3A 3AHCA 1C9DB 4RNDB 3ZZNA 4ECEA 4AKEA 1Q3HA 5FYQA 1KS2A 4RZUA 2FWBA 2PE5A 1TYZA 4QTUB 7REQB 2IYSA 3C6MA 1ZGCA 2BEUB 3MRSA 3VOTA 1G8HA 2V45A 4CR7A 4F3KA 2JA1A 2WVGA 3NYWA 2O2XA 4QQFA 3WGVA 3NBXX 5A5VA 4ZEWA 4PIMA 2FX2A 1MT0A 4OMFG 4JUFA 4UHHA 1VQ1A 3A6FA 2AMYA 3AV0B 3GPCA 2FX3A 4IFEA 1TAHA 1CNFA 3EGEA 3M6MD 3M81A 4R0NA 3RS8A 3TRKA 3CVYA 3FKSD 1N78A 1FXWF 1IBMB 3PFIA 2PO5A 3VM6A 4LNUA 1PP4A 2F67A 4I3FA 5DMHA 1F12A 1DRUA 1V11B 2GPYA 2R5WA 2OZVA 4HPWA 2TS1A 1O7JA 1G8MA 1E2PA 2FN8A 3GBVA 3ROFA 2R1UA 4HX9A 4NEGA 2CXHA 2X8AA 4D1YA 3ZVKA 1F3OA 5KVCA 5DN6A 621PA 2XLBA 3OLZA 1L7EA 2XMCA 1TUBA 3NB0A 5KCZA 3BSSA 3HR8A 4AKHA 3U4IA 1R0KA 1XZNA 1ZLYA 4PANA 4UEJA 3ADDA 5JD3A 2PXHA 1H4QA 5JCZA 1GCOA 4ZTUB 4D26A 3ZY3A 3BB4A 2R6GA 3REQB 2QF7A 1MG0A 4H7DA 4XOUA 2XUZA 3LWDA 1CQJA 4FC6A 3LMKA 5FOTA 3TKLA 3WVNA 1ONNA 4P3KA 1QZTA 3D3WB 3KX2A 1XRJA 2HRRA 5ABPA 1EXVA 2ZIUB 1JIUA 3GF4A 3GOHA 4R69A 1PTJA 2JKYA 1JMKC 3PNSA 5HMLA 3ZR4B 1KZ7B 4A4DA 3MS2A 1KI9A 3OZVA 4CPDA 3OI7A 1X1EA 4TRMA 1QZUA 3STYA 5ITWA 2H1WA 1BHO1 2VHXA 3D7MA 5BNIA 5IVPA 3R5XA 3RSCA 5KCMA 3W4KA 4EH1A 2FN9A 2FEXA 2K2QB 1NTRA 2D54A 4BVAA 3ONNA 2E5WA 3SYTA 2Z6VA 2O8NA 4DV4B 1KZ9A 1OXBB 4KREA 1JDBC 1I2AA 3H87A 1RJWA 4ZALA 3VISA 5BW4A 1KRWA 2WB2A 4XKJA 2C9YA 2BLLA 3PT9A 4GMKA 3RSLA 3ZWXA 4DV1B 5CJPA 1GZ3A 2C5EA 3DZFA 4LJLA 3LBFA 4ZU6X 3RVJA 1P1JA 2PQ6A 3H86A 3AHIA 1TO6A 3ZZ0A 4JVOA 6LDHA 4F3TA 1DOZA 2JLAA 2QSUA 3DBHB 1U9IC 1ZRMA 2GWHA 1XCMA 1SHUX 2IIVA 2XUFA 1K5GA 1CETA 3EC2A 4ARZB 1ZJ4A 2J3EA 1YZ3A 1BXGA 4AJ9A 1HM5A 1N5RA 2EZTA 1B8VA 2DM6A 4D99A 2IBSA 1KDPA 2B8JA 5BO5A 5LOVF 1HH4A 4Q93A 2FGJA 4LWPA 2Z8YM 4B6OA 1JQ3A 1QH8B 4BGEA 4Z8YA 5IKPA 2G82A 1X7XB 1U98A 4NDAA 5ESXA 3VPXA 4O2AB 2QG4A 1W5FA 5EJ2A 2J32A 2CYBA 5EIFA 4FFVA 1MNAA 1QZXA 1YDEA 2E21A 3HCEA 4TKUB 1WOMA 3FH0A 3H3JA 2PS0A 1ZH8A 1WKVA 2C4KA 4PR3A 1EUCA 1VIMA 2JNWA 1KL7A 2HWUA 4GRIA 1OKKA 4LI0A 5FR2A 8GPBA 3RC9A 1DC7A 2ZJOA 4IHJA 1XCJA 3V2HA 5AI6A 3IQEA 3U3DA 1PT5A 4A8TA 4NL4H 2FEAA 3V8EA 2EIXA 1QRAA 2HRZA 1KMIY 1PR4A 3L18A 3I2HA 4KQIA 3HUEA 4BEVA 4IP0A 5T7BA 1I7LA 4A8JA 2VA9A 4CQJA 5BSRA 2GAFA 4LY3A 4TKLA 3UO8B 3N59A 3A6KA 4YI5A 1E2NA 1MUUA 3AONB 1NXWA 4DUPA 2ZXEA 4IJUA 3ENNA 5E9WA 5THKA 1UPXA 3B1KA 5IK2D 4N0QA 5KNDH 1E8NA 1KH1A 2O8VA 2RHTA 2B7LA 4LJ6A 4PICA 4BAUA 2R3SA 4TXJA 5AOBA 3RBAA 3MRVA 1AC5A 1M1YB 4KDCA 3FVWA 3FRHA 4Z7NB 3BWYA 4ZCQA 1KAQA 5BXQC 3O3MB 2NO6A 4QSMA 3FCSB 3EXG2 3L02A 1E77A 4AZ0A 3NS7A 2R79A 4H17A 4CM1A 4TL9A 3I9MA 4WWHA 4B6EA 3S6JA 4RKWA 1TVCA 2AJ8A 1BCSA 2G6TA 3HHPA 3G0IA 5SZKB 2IUUA 4TSRA 4DQDA 3U80A 1QYWA 3TR0A 1XZBA 1ZXLA 2OCYC 2PMBA 3E5HA 3SF8A 4CRWB 5H9WA 4HRVA 2KS6A 4BVEA 4MWCA 2PKQP 2ZWOA 3BTSA 3TRHA 2FR8A 3A1CA 3I9OA 1G7CA 4L16A 2HB6A 1N6HA 2HJ9A 4C0WA 2GJSA 3FPJA 4C04A 1XHFA 4O4IB 1WBDA 1Y3FE 4Z4IA 3K9HA 4IYJA 3OA2A 1ZCBA 4OH1A 4WN3A 4F9TA 3NJ8A 3OLQA 1L5GB 5C52B 4J76A 3H4VA 4KXLA 2FG5A 1BQEA 2O0LA 1J22A 3W77A 3R7BA 3U61B 3RJ9A 1MZVA 4C2BA 4XE5A 3DH0A 1N25A 1T0IA 5F1OA 4AMBA 4W7SA 3I8XA 3T5MA 1U4SA 3O4RA 4NZNA 3DOHA 3DVAA 4XB1A 4XVQA 5SY9A 1IG3A 4REQA 1ID1A 2E1PA 4NK4A 3ZNPA 1Z5ZA 4RDHA 2DQYA 4O5OA 4EUEA 3ZQJA 4V39A 4P83A 3LI2A 5A1TA 2HADA 1CBUA 1KHHA 4FLFA 2ZBGA 4G0ZA 3SHFA 3WWZA 4HADA 4RADA 4HGNA 4UPDA 5K0SA 5L3QB 2CJWB 2WT9A 1SD5A 1INLA 3WL8A 1SXJD 5DTRA 1GZHB 1QO0A 4BQFA 2Q6VA 4DCTA 1SXJB 4KWCA 1R18A 4AY2A 1R0LA 1V9LA 1R8QA 2PL1A 2Q5LA 5CX1A 1WXWA 3HCNA 5FHQA 5KNDD 2Y4OA 3TKAA 1RDFA 4ZWNA 5GP1A 2AFHA 3TM5A 3UA4A 3RSQA 3AJDA 4EVQA 3ZK7A 2D7DA 1I5RA 1KO4A 4M9SA 2PA3A 4HCJA 3CXRA 1QHIA 5CVVA 3TECE 1N7JA 3FUUA 2ZITA 4UBNA 2ZK7A 1GUBA 3VSEA 4U2CA 5DBHX 1P39A 5J59A 4ND6A 3ZLTA 4B75A 2XB4A 3DEKA 4LMRA 2FUEA 3FM9A 4EY5A 3HCRA 4WNYA 5JO9A 1Y3BE 1ZC4A 2RGWA 2HMVA 3D5TA 3PB3A 4CGZA 1JLLA 3HUFA 4NENB 3OZBA 1Y9EA 5BV0A 4B44A 5JI3E 3O1IC 1JJFA 4M0MA 4K6HA 4R41A 4UAJA 1T15A 3THXB 5AXBA 4AO8A 1W5SA 3BJRA 2ZAOA 1YT5A 3TLJA 3IPRA 1SJ9A 1I7QB 4QT0A 4UC0A 3TAXA 1R50A 2O8EB 1E5DA 2IY8A 3V6MA 3ZWDA 4O3FA 2AF3C 1ADFA 4YAFA 4X45A 4BS9A 2VZ9A 1I4OA 2GJAA 3ZH9B 4DC9A 3KR1A 1BJRE 4JP2A 1A98A 2GLUA 2BFEB 3L7DA 2CMDA 3U7EB 4DLNA 4ARIA 2WUEA 3JALA 3COWA 1UK8A 5FI1B 1J8DA 1JKMA 2P6RA 2C5HA 1BJTA 1OTXA 4LF6B 4QDJA 1SKMA 1T8TA 1Z45A 4KO8A 2FF5A 4R6WA 4GO1A 5SYNA 3HZZA 4CHTA 2NPIA 3QU7A 2RGRA 4YWJA 3FNFA 2CBZA 1T43A 4UUPA 3TCXB 3RHZA 3DMTC 5EE3A 1K8ZB 4L0DA 1KP2A 4H3HB 4D9CA 1YV9A 2NU7A 1UKVY 4CGYA 3L49A 2YWDA 4GQIA 4ILEA 1MN6A 2LNDA 4R3NA 3GEEA 3BG5A 3ZHSA 2IEIA 3IKJA 2WWYA 3U7GA 5HUQA 4E11A 4LZOA 4OG2A 3QBTA 4KIJA 4P7BA 4B4OA 1T2AA 1TQ2A 2ZJYA 3KQNA 1R1DA 3U3RA 5HZGA 2ORYA 3CF0A 3CPHA 3JQ7A 1H4VB 2PAAA 3CN7A 2JRCA 4ICIA 4L1KA 3AMVA 4QNMA 4Y1FA 3ZK9A 4LJAA 1X1CA 2X3FA 3FHOA 5WRFA 5KDOA 1HOXA 2ZGVA 3MJRA 1YQTA 3CU5A 1JJ7A 2ID7A 3DZDA 3QF4B 5JH7B 1JLMA 1DP4A 5D8DA 4I2NA 4E31A 1RXSA 3R9XA 4D42A 3CX4A 2PWZA 4WNIA 1UBGA 3JQGA 1NMEA 3C1AA 3VZBA 4ZYTA 2UYYA 5BR8B 4PWYA 1QQAA 4F5YA 1FFXB 2WFAA 3KFLA 1JH8A 1D07A 2XB9A