1EESA

Solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN
publication title Structure of the complex of Cdc42Hs with a peptide derived from P-21 activated kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 14
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1eesA00
5CJ2A 3WMEA 4D0NA 3Q5DA 1PVOA 2YWHA 1Z28A 2QQEA 1E69A 3EIEA 3T06B 1BYUA 2DFLA 2A5DA 2C9YA 4PO8A 4Q9JA 4BFYA 1UF9A 5JI2E 1IY0A 1Q1QA 1T0JB 4ASUA 4MITA 2R2AA 3B1YA 3EPKA 3N2EA 1KSHA 2NMVA 3HWSA 3RRYA 1MR3F 4NL4H 1NL3A 1KDRA 4YDSA 1SVWA 4BLPA 5GJCA 3QXXA 4D6PA 3PEVA 1WE2A 5LD2B 4IDNA 2DR3A 3E2IA 4C7OA 4PQFA 1Q21A 5FTJA 1JR3A 1OXVA 1DS6A 5EP3A 1IXRC 4E03A 1GUAA 4CVNA 2CL7X 5BXQC 4Q1CA 4Q7KA 5BN4A 3B1XA 3AVOA 5FBQB 2W6ID 5CK4A 1RE0A 3WP0A 5JSZA 4KU4A 221PA 4I1OA 4GI7A 4FWTA 3EW9A 2DWPA 2ONKA 5KNDA 3V00A 5AUOB 1UKYA 4JYBA 2VP2A 5JLJA 3EA0A 3Q85A 4TQAA 4BASA 2JCSA 3BRWD 3U6BA 3H2YA 2FDCA 4JMPA 1I2DA 2GCPA 1PZNA 2AL7A 3EXAA 1JJ7A 2QP9X 2KSQA 2ZE8A 3PFIA 1XF9A 3MLEA 1A1VA 3KKMA 3VR2A 5FFMA 4A8JC 1E94E 4FMDB 3TR0A 2XGJA 1N5LA 1J99A 4HLQB 4LHWA 4X8LA 3E70C 5HCNA 2ZRIA 4Q7LA 4B76A 1SHZA 1G17A 3UANA 4Q4JA 4CZ2A 2A7QA 2C95A 2GJ8A 5KNCA 3C5HA 4ERNA 1FQJA 4TMTA 2G1JA 4C30A 5L3QA 1G8GA 2YJTD 2ZJYA 4CGZA 2XJ9A 2RB4A 3EX7C 3AKDA 3PCRB 2ORVA 5A0FA 1W0JD 2EQBA 2REBA 3DOFA 4Y0AA 2GCOB 5J4KA 4PAMA 2MSEB 4ITRC 2QGNA 5JJKA 4HDOB 4MUAA 2I1QA 3AB3A 4V0NA 1HA3A 4DEXA 1ZM3A 2WJYA 5JFGA 4QXAA 3X1XA 4AY2A 4JS0A 2AXPA 3O8RA 3GD7A 2HYDA 1W2HA 3THXA 3RC8A 1H65A 2BBOA 3HP1A 1EWQA 1XP8A 1T0HB 1OW3B 1NIJA 5FPHA 4UNPA 3GFPA 3DL0A 2ZVPX 4JLNA 1OH8A 1RZ3A 4BFSA 2NO1A 3AH8A 4WZBE 1G8HA 1N0UA 1F48A 4NPHA 3SU8A 1Z0KA 2P0EA 2ZETA 2QM8A 1E2PA 1TU4A 2ZROA 2XTMA 2HXSA 4Q1EA 1XU4A 2ZI9A 4P0TA 3GLIA 3H0KA 1XD9A 3ZH9B 3SJBA 5GVRA 5EXXA 4ZDKA 1YR7A 1JAIA 1LF0A 1X1RA 4N0EA 5C46F 1QHIA 4M1OA 3C7KA 1BH2A 5JBQA 2OAP1 1N6NA 1WDTA 2YNMA 2H5EA 4MRNA 3AVXA 4XWKA 2FSGA 4Q1FA 4PO9A 1XCGB 3RRMA 2JLRA 3A4NA 1DAMA 3RHFA 3X1DA 3U44B 1Z3IX 2ODEA 2O0KA 4QBHA 3THWB 1X8JA 1RW4A 5A4JA 1S3SA 2VHUA 4JL5A 4QC2A 2R62A 3ZZ0A 1XTIA 2PCJA 4NCNA 3T1OA 4LV8B 1LV7A 1ZM2A 3P4YA 3CW2A 4CT5A 4L9WA 1W47A 4RD3A 4F4JA 1LVGA 4MKHA 1QHHA 2ANBA 5J5CA 2ZJ5A 2QBYB 2R6DA 2ECKA 1ZUNB 1CRPA 4LBVA 2RGNA 1F5NA 3OIWA 4KVGA 3CZQA 4Q4HA 2VIIA 1M7BA 3OFNA 4YMVA 1X3SA 4DSTA 5EE3A 2FPMA 3O8CA 4G0NA 4UXIA 4TL8A 2FFHA 2QQ0A 1DPFA 2PH1A 4JLVA 4DLSA 1IN8A 3GJ6A 4TMKA 2JLWA 1U98A 1ZU5A 1GRQA 2LWIA 2BCJQ 1E0SA 2VP6A 1DAGA 1OXSC 4D0LB 1KZGB 4UNNA 3U7FB 3LY5A 2PMDA 2XOKA 4MQBA 3QPWA 2NO0A 3TKLA 4FMBB 1GNRA 2HYIC 4A82A 1I4LD 1YU9A 4CEIA 4TSFA 5IDVA 1JPNA 2ORWA 5J40A 4BGDA 1XD2A 3DKPA 3QKUA 1G7SA 4LC0A 5JRJA 2J9RA 4LRWA 1XXHE 2WM9B 2ZU0C 3KTAA 1KKLA 2W0MA 3M0EA 3FFBA 5JS8A 3GLFE 3VR4A 1IY2A 5FR2A 4BQSA 2ZYWX 4Q1BA 3MWYW 1S1CA 4DRZA 2XZOA 2QP3A 4URZR 4YXWA 1Z0JA 1M2OB 1MABA 1NF3A 3C15C 8OHMA 2EFHB 3REGA 4M1WA 1P75A 2MSCB 4EFMA 3VTKA 4G5GA 4DKXA 3BGWA 1Z83A 4LJ9A 5FBVB 2QN6A 3GJ4A 1PUIA 1Q3HA 2BBSA 4MRSA 3FDIA 3N5CA 2JIZA 3K9LA 4ABYA 2DHRA 1QHNA 1UBGA 2F6RA 2AR7A 2JJ1D 4ASUD 3QPUA 2BDTA 4OQFA 2C8VA 5FOUA 5FUXA 2AN9A 1JR3E 4C0BA 3EZ7A 2D62A 4US0R 1E2JA 1NVUQ 1XJQA 5AUQA 3CRRA 3TSOA 2VQSA 2JLZA 3CONA 1N6HA 4W7SA 1H8HA 1KJWA 4NHOA 2C98A 4POAA 3TQCA 4A0GA 1QHGA 1GOTA 1Z0FA 3KJHA 1ZM9A 3KKQA 2GDJA 3QEOA 4V0KA 2JLXA 3SOPA 2IYLD 4UNRA 4F38A 4QGHA 2WVJA 2PZEA 1I4TD 2ZYTX 2RGEA 5IK2D 2VF7A 1OYWA 2AD5A 1Z22A 3R8FA 2G88A 3CWZA 2VO1A 4DVGA 3CF0A 2NTYC 3QBTA 4B6FA 2R6AA 4LJ6A 1GL9B 1PLJA 3A1TA 3CO5A 3UK6A 5HE8A 3W34A 4KO8A 4PSVA 4PZYA 3PJRA 4C0QC 4P4SB 2G83A 4PHHA 2OFXA 4M22A 4URVR 1ESNA 4RKFA 1KSGA 1Z6TA 3LO5A 3RABA 3PV0A 4H1UA 2AFHE 4Q66C 5LDDC 4GPTA 4I99A 1NY5A 1CXZA 2P3SA 2ZYUX 1WP9A 5J4VA 1RRFA 3MRSA 5HE9A 3VQTA 3DO6A 3N70A 2ZRJA 3DKVA 1U0JA 1E2QA 3WRYC 2J46A 1T5IA 2GESA 1FP6A 1KI9A 1SVKA 3HR7A 2D3WA 2OCPA 2RGNC 4IDOA 3NBZC 2Z0MA 4URWR 4HLDA 3TE6A 2J59A 2IYYA 4GDFA 3R9IA 3OF5A 1VPLA 4GL2A 4HB0A 5FOVA 2WSMA 1NVVR 3B9QA 1G3RA 1TQDA 4RJLA 3CRW1 4LJ5A 1XJ0A 2EW1A 4LBWA 1CJUC 2GBLA 3UWKA 3CLVA 3KJGA 3VR6A 5TB5A 2QMHA 1HE1C 4BECA 2BM1A 4KODA 1LNZA 2LKDA 3P26A 2O8EA 2CHGA 3HDTA 3LVQE 1TF5A 4NZYA 4W5JA 3Q3JB 3WRXC 2W2TA 4ZKEA 3EC1A 3GLIE 2ZS7A 2CHQA 2LKCA 4PC3A 3K0FA 2NG1A 1NSTA 2QPOA 4ZDJA 1ZIPA 5FR1A 1ETUA 5KPJA 3CPEA 3FYHA 1KIMA 2PBRA 1VYTA 3BBPA 1KDTA 1VG0B 3TVTA 4UKDA 3AF4A 2GNOA 2REXB 3CR8A 5EP2A 3WMFA 1EX6A 3DHWC 5FUVA 1TNDA 4FN5A 2IHYA 1Z6GA 1IQPA 4AC9A 3IGFA 1EG7A 1P9RA 3RWOA 4QM7A 4W5HA 5FH9A 3ADCA 2J0SA 4TTRA 1AZSC 4GP7A 4JLJA 1D6JA 2IUTA 4M9ZA 1KYIA 1E2LA 4Q9KA 2E1RA 3PXGA 1IHUA 2W58A 2XX3A 1RRPA 2JGNA 4A0RA 3GLFB 2ASEA 5AUPB 1VMAA 2G3YA 2IL1A 2RGXA 5HKKA 1ZVQA 4JT4A 5LB2A 4TQUS 3AV0B 2IYWA 5L3RA 2X8AA 3HPQA 3B1ZA 1X1SA 3U61B 4GBMA 2QEQA 3GJ3A 4BE7B 4AYXA 1OJLA 2UVQA 3SS8A 4LJAA 3JZMA 4L16A 4LHYA 3EARA 1HYQA 1OHHA 3U7EB 4RKEA 4AI6A 1W36B 4TMZA 2IYZA 4MA4A 1DG3A 3H1TA 1KK0A 4A36A 3DDCA 2AK2A 1BMFA 4B2LA 4N3NA 2GCNA 3CKLA 2V1XA 4M2LA 2FGJA 3U4QA 2C9OA 1L7VC 3VAAA 4C7OB 4Q02A 3OFND 3V9PA 1YR9A 4CEJA 5DI9A 2ORIA 2P6NA 3C5CA 1YR6A 3AVQA 1R0ZA 3PUYA 4HUQA 4R98A 5KUTA 2XNSA 2JJ2A 5JSZB 2C99A 3CH5A 2GEVA 2ZVQX 3PG5A 5E7IA 2JAQA 2REOA 2ZJ8A 3I32A 4MYHA 1R2QA 4JLBA 2F3TA 1FW6A 3KZ1E 2CXXA 2W0SA 2XOKD 4NBSA 4XTRA 5E3HA 4DLUA 2ZYVX 3GJ7A 2AKYA 2ZRGA 2ZTSA 1UDWA 1KK1A 3KXKA 3QPVA 4P3YA 3WBJA 4GP6A 4U00A 5EJEA 4DLTA 5JWOA 5IT5A 4IEIA 1C1YA 1J8YF 1QVAA 821PA 4HDQB 2ZI4A 4BZXA 3ZVLA 3I5YA 4ON9A 2CBZA 3HR8A 4RY2A 1GKIA 2J3EA 2IWRA 2ANCA 3QKTA 4A9AA 5JCPA 4YXWD 5H68A 2O8DA 4I4LA 4M4SA 3Q7PA 3GLGB 4E07A 1XPOA 3U6KA 4OI2A 4TYQA 3CRMA 3M6AA 4HB4A 2O8FB 2WJIA 3DEFA 1RYHA 2JLSA 4QFMA 5L3QB 3EASA 2JIZD 3QQ5A 4JJZA 3MFYA 3WMGA 4B74A 5C18A 1NVVQ 1ZD9A 3BORA 3TBKA 2FZ4A 1HY3A 3U3RA 4ESHA 3VR3A 3K70C 5FTMA 4ZV4A 3SJAA 2CNWA 3QKRB 3ZYCA 4TYWA 3X2SA 3F3YA 4OI1A 2PJRA 4NP6A 3SNHA 1OT3A 2I1VB 3O8DA 4P4UA 3QJYA 4CT4B 1ANKA 2QTHA 2GEDA 2X1VA 2Z43A 3W5IA 3THXB 1JALA 4P4TA 1H8HD 4ILEA 3MD0A 1R10A 1RYFA 3B5JA 3OIUA 4RCZA 1BIFA 4HLUA 4BLQA 4DB4A 4V0LA 3U7GA 1M6NA 2O8BA 2R6FA 5FTKA 3FMIA 2ZRKA 2PEYA 4QNRA 3B1VA 3CNOA 1XPUA 4IHQA 3BJIC 4Q9HA 5FOTA 1MKYA 1QDEA 3GLIB 2JLYA 3A36A 1SZPA 2OCYC 3B78A 2ZANA 3A4MA 5FTLA 3RWMB 3AKEA 2VHJA 1R8QA 1B23P 4JKIA 1GTVA 1HTWA 1KGDA 4RZ2A 5K8TA 3PR1A 5EUQB 1E9FA 1ZP6A 3SEAA 1GNQA 4DSOA 4GFDA 2AD1A 2GHIA 1N6KA 2QRNA 3NIBA 4KITB 4K81B 3BOSA 3U3KA 2FA9A 2QE7A 4MGYR 3FVQA 5EXSA 4MYTA 4PX9A 2CLDX 4RVCA 2R6GA 1GG2A 1D2NA 1LFDB 2FPKA 3A1SA 3FHOA 2H18A 4DZZA 3VNUA 1M7GA 3NVAA 1IXZA 1G18A 2VBCA 3K09A 1TU3A 4IRUB 1S9DA 1XMSA 1Q22A 1T4GA 2VRWA 3K9HA 5G53C 4CYMA 5EE9A 2RGDA 2O8CB 3BFXA 1ZIOA 1UADA 2OILA 1I4DD 2ODNA 4LV5B 2YV5A 3ICEA 4JBYA 1E96A 4PZLA 4Q4HB 2IYSA 3DVLA 2XB2A 1KHTA 1EFUA 1AQYA 1FL9A 2CLCX 2GJKA 4OL0A 1SKQA 4LY6A 2WKQA 4PFSA 4Z1MA 1FMJA 4Q5IA 3K70D 3BC1A 5KDOA 3MGCA 1Z0DA 5B64A 5HZKA 1YZUA 2E9SA 3AP2A 4DDUA 1TUIA 1KO5A 5EE0A 4OK5A 1YKSA 4ZCMA 2J0UA 4HB2A 5KNBA 2ZREA 2A5JA 3ND8A 5CJPA 1CJKC 3VKWA 4DHEA 4PC7A 4WXPA 3IEVA 1XWIA 4CEIB 1Z8FA 1IAQA 1P2TA 1T6NA 1CJTC 1SKYB 1UM8A 2CVFA 3MMPA 4OQMA 1HT1E 2GETA 5CB8A 4F93B 4P31A 3IO3A 4LJ7A 1XD2B 2FGKA 1PUJA 2W2XA 2GJAA 2A2ZA 3IBGA 3IPYA 1LS1A 2WZQA 5L3SA 4BFXA 3BIFA 1VHLA 2ZEJA 5SZIA 5DN6A 2AK3A 3JVVA 3QOFA 1OFTA 1FQKA 3BB1A 4M9QA 2WWGA 2GILA 4EJSC 2C9CA 1XX6A 5FUYA 1YZKA 1D9ZA 2ATXA 1KMHA 2QAGA 4ARZA 1OXTA 5BYJA 3SDZA 3HU3A 2XXAB 4FW9A 2P67A 1LTQA 1XCMA 4XD7A 1AGRA 1P62B 1VG8A 4OI0A 4N1AA 5DGXA 4BEBA 2RKOA 1NSFA 2WKRA 1KI8A 2HF8A 1U0HC 2QMEA 4II7A 1OHHD 3QXSA 3QVUA 3T5GA 4GOXA 1AK2A 3TJZA 3CRQA 3ZIAA 1BMFD 4HLUC 4PQYA 4UJ3A 3NXSA 4JLOA 2XTZA 2R6CA 1H8ED 2GZDA 5J47A 3L82B 1G8PA 3QENA 2QNRA 3A1UA 3QY0A 4GMDA 4NE2A 1E0KA 3S1AB 2JJ1A 3LRPA 3CUEF 3WHLA 4DLYA 3KQHA 2WAXA 4C3ZA 3ASYA 2CK3A 1TAGA 4M1TA 2Q3MA 2FSFA 1OIXA 1G7CA 2JJ2D 2KWIA 2YOFA 2WV9A 3TUJC 2G0NA 1ZU4A 5IRCD 3I1FA 2J87A 5AWFC 3T12A 2NZ8A 4M1MA 1R0XA 2VP5A 3MUFA 1W49A 4DUGA 4EKDA 2JLVA 2P6UA 4JKYA 4C0AC 4OYHA 1BO6A 2MMGA 5CYPA 2P65A 3O8BA 3AVTA 4NYMQ 5FBRB 3BXZA 1GAJA 4ZIRA 2HLDA 3B60A 3UWOA 2Q9CA 2VSFA 4UXJA 2FFAA 1GP2A 4YC7A 3TR5A 4A0HA 4X8OA 3WNCA 3B1WA 4ZCLA 5IK2A 2YYZA 3K09C 1MO6A 1ZINA 2A30A 4LJ4A 3PUXA 3UMSA 3RNLA 1NLFA 2P6RA 1FNNA 4C2UA 1KK2A 3OESA 2GF9A 1RIFA 4KJZA 2BJWA 1SXJB 4TZ0A 1BYIA 2ZRLA 3QUSA 5EE1A 3W5JA 1EESA 3T35A 1TL7C 1E79D 3VFDA 4BRUA 1G6HA 1UKZA 2DFNA 3IPXA 3EIQA 1MO5A 4WXRA 2CE7A 2X77A 1G4UR 4BFVA 2FG5A 5JJLA 2W6JA 4CEHA 1F2UB 1TQ6A 2CNWD 2OXRA 3TMKA 3AVVA 5DO9A 4CDGA 2DFTA 3G5UA 3W3AA 1AA9A 5LBIA 4LPSA 5KOYA 1XZQA 3NHBA 2D4HA 2IHBA 5JI3E 2BOVA 1MV5A 2H8KA 2I3BA 2KB0A 2OM2A 3AF2A 2CL0X 2RHMA 2JLUA 4C0HA 3SFVA 3L0PA 1Z29A 5JWHA 3LDAA 3FWYA 2NO6A 2O8EB 2IYXA 1P73A 2GA8A 2GWHA 4GZMA 4E5UA 1TQ2A 3K70B 1Q12A 1Z2AA 2J1LA 2ZI3A 4NDZA 4RCYA 1II9A 1P6XA 3W8RA 1OSNA 4NCHA 5KSOA 4MRPA 4WZ6A 4HAZA 2Z83A 4HAXA 3R7WA 3NH9A 2XB4A 2ZJAA 1P60A 2CL6X 2IXEA 1KDOA 1ZNYA 2IYVA 1NJGA 1U8YA 4XSHA 1KY2A 1N5KA 2WHXA 2IA5A 3PQCA 4X8HA 2WJHA 3LX5A 3TQFA 4US2R 3EPLA 5KO2A 5DH9A 4B32A 2LCFA 3FMPB 4E22A 4DT1A 2QAGC 5KSYA 2JATA 2ZR9A 4Q1DA 2GK7A 4JVNA 4OHYA 3SQWA 4OHVA 3QF7A 3QXJA 1S4QA 5BN3A 1V43A 2N42A 1G3QA 4DLRA 1IY1A 1G8YA 2YOGA 1U8ZA 4V0OA 1N2CE 2QE7D 1DG1G 1MT0A 1OE0A 1YRAA 3NBYC 3W6PA 2FE4A 1TF2A 2IW3A 4B3CA 4QJ3A 4JSTA 5HCIA 1E0AA 3AVWA 2V4ZA 5B2ZA 3U2QA 3W8NA 3I4LA 2VSOA 3GFTA 4IDPA 3RVBA 1T3LA 1JQJC 3D8BA 5EP1A 2GKSA 4JBXA 1ZCBA 4XVQA 3W9YA 3KDSE 1G5PA 1NN0A 5JEDA 2OESA 1LW7A 3QKSA 4Q48A 5HZHA 1GNPA 5CIQA 3U4QB 1UKEA 5FL3A 4O2RA 3NKVA 4ZDWA 4EQ6B 4TYPA 5EUMA 3VU9A 1G5TA 1XEXA 4CEJB 1VG9B 3LXXA 2EFEB 5JHGB 2D06A 2WKPA 4PPNA 2ZRFA 5CDFA 2ZJBA 4WA7A 4Z1MD 1XTSA 4LHZA 4JVMA 1CLUA 1DE0A 1UBFA 3KUCA 2V54A 3NG1A 4W5WA 3T15A 2FMXA 3VMFA 3WNDA 3FE2A 4B6EA 4I1VA 4TL6A 4PPGA 3D31A 3VR1A 1EX7A 3TUZC 1EWRA 2ZQ5A 1E4YA 4DCVA 4G5QA 5JRZA 5EZ6B 2G9NA 1VCMA 4AYTA 2Z4RA 4IXMA 5DISB 1OPXA 4QJ5A 1T5LA 2I4IA 4GT1A 1XB2A 2QM7A 4RZUA 2NPIA 3GJ5A 1E1QA 3ZZUA 4C0LA 4R7ZA 1LY1A 4PPQA 4EPVA 3QF4A 1O87A 5DN6D 1G19A 2X2FA 3AF3A 2Y8EA 2O0JA 2QGZA 2ERXA 2O0HA 4FMDF 4C9BA 4Q19A 4DCTA 2O8DB 1C9KA 2NGRA 4HYYA 3BB3A 2FF7A 1WA5A 1F2TA 4JLAA 1NRJB 4TTQA 1N0WA 2OCAA 1ZUIA 4XD7D 1OXXK 2GZAA 5ANRB 4IVRA 5E7JA 1D2MA 4PSAA 1NMZA 1E2HA 2ZRAA 1M1YE 3ND9A 3AVPA 4TMVA 1DAIA 3Q8XB 4NYIR 2ZE7A 1G4AE 1OH5A 1E9DA 1YZQA 2RCNA 2ZE6A 3PVSA 4IVQA 4QHTA 1JB1A 3LAWA 5AR1A 3PUWA 1CP2A 3KL4A 4OHZA 3ZIAD 4HATA 4A2PA 4D26A 2RAPA 1SVMA 3EC2A 1ZRHA 2XSZA 2TMKA 2IS2A 3FFAA 5CIWA 3RLFA 4FCVA 4LSGA 4PAQA 4B35A 4HAYA 2FJUA 1AKEA 3SYNA 1QVRA 2CK3D 4BZPA 5BYKA 1UEJA 2O8BB 1W4RA 2FWRA 3REFA 3MCAA 2QI9C 5CK5A 2HF9A 1G7TA 4MRRA 3W3ZB 3SN6A 3KXLA 3LBHA 2CHVA 1DAFA 4BFWA 4DUGD 1E2MA 1OKKA 1Q44A 1N5IA 4K46A 2PEZA 4QNMA 1N6IA 1NJFA 3L43A 5EQTA 1E2FA 2CCGA 4AKGA 3KUDA 4XJXA 2HLDD 2VP4A 4IJMA 2F7SA 1UBEA 2ZIAA 1E9RA 1Z47A 5AK0A 5H70A 1ZC4A 1SHKA 2FEOA 4JT2A 5DYGA 4QGFA 3RS4A 1R8SA 5B30A 1NN1A 4Q47A 4H1VA 3Q7QA 1GKUB 3MWLA 1S96A 2BM0A 1KZ7B 3I62A 1E9AA 4EIWA 3MJHA 4O2LA 3L0IB 3TSZA 1Z5ZA 3AKCA 4LYHA 5DHAA 3EA5A 3L0OA 2W00A 2P5SA 2VHTA 3SE0A 3MSXA 1KO7A 1N6LA 5F2EA 3FB4A 2CJWA 2GEUA 2ZSDA 3LQRA 4FWIB 4HDCA 1ZAKA 3C16C 5K8LA 2BWJA 2A78A 2W6JD 3I3SR 4F92B 4JYCA 1SVIA 4ZI2A 2SHKA 2JEOA 3GJ0A 3A4LA 4RD6A 3M1IA 3SZRA 4A8JB 1UKVY 4G5SA 3KQKA 1ELOA 3ZJYA 1P2UA 1N5JA 3M4YA 4TT3D 1UBCA 1PLLA 3ZVMA 1ZD1A 1JPJA 2F43B 2OLKA 2O5VA 1CS4C 1W48A 4Q7JB 3RS0A 1G3IA 3WBKA 4BFZA 4HI0E 1JJVA 3C8UA 1NBMA 5CB6A 1EFHA 2HXYA 4D2IA 2CLSA 1KSJA 1NKTA 1FTSA 2CDNA 2MMCA 2J0UB 1YZNA 5SZHB 4EPTA 5J4HA 1WBDA 2VEDA 1DO2A 1ZBDA 1N6PA 4WZAE 4EFLA 3BB4A 4XSGA 1G1MA 5FPYA 3TK1A 2WIAA 2IXFA 3LBIA 5C4GB 3THYB 5KHOC 3CNLA 3K8YA 1XTRA 3LX8A 3CZPA 1YR8A 2QMUA 3JZAA 3D3QA 3QEJA 3T1VA 4DSNA 2HT1A 2BEKA 1G3UA 2GVZC 5D3MA 1OB2A 3T61A 1TMKA 2IYTA 3A6PC 5TARA 1N3BA 2OSBA 3F8TA 2A9KA 1IN5A 2QROA 4B2IA 1E32A 4B33A 1K8RA 1T8TA 3J81k 1FUKA 1KMHB 3H84A 2QUZA 1AGPA 4ARZB 1AKYA 2GF0A 4MGKR 4LYFA 1GZSA 4BWYA 2EFDB 4CF7A 1QBKC 1ZNWA 2ZSBA 4NCJA 1Q57A 5BQ5A 5KYKA 1GL7A 4NYIQ 1P4SA 1E4VA 4TLEA 4ZCIA 1XXHB 4JLMA 1LF5A 1BS1A 1T9HA 2VA8A 1W5SA 2R9VA 4M8NE 4KV9A 1EK0A 5IF9A 521PA 5AJVB 2ZUDA 1KK3A 3SJZA 4LI0A 4GNKA 4GZLA 1CJVC 3X1WA 3FPAA 3PENA 5FPSA 2UZ3A 2IEZA 1SGWA 2D2EA 3SI7A 5CDFE 4QL3A 3PIRA 4DLZA 1V5WA 3E5HA 5GJWC 4OHWA 4AD8A 4WW0A 5EE5B 1WQ1R 3QI2A 4AKIA 3I73A 4B73A 1GFIA 1A7JA 1GM5A 5F9HA 1DADA 4YONB 3K0EA 4A6PA 1QHXA 3V4RA 1MO3A 2G1KA 1GITA 3A1VA 1XDBA 2ZI7A 1OLOA 2VSXA 1H8EA 1HQYE 2YZ2A 4FMCB 4G5RA 4PAOA 1TADA 4U02A 2XNDA 1R5BA 4Z8YA 2QT1A 4IKEA 3U44A 3CRVA 4I1SA 1DTSA 1R0YA 1Z2CA 3FKQA 4DLXA 1QRAA 1NG9A 4C0KA 5KSZA 4ZIRB 1US8A 1OIVA 2AWOA 2DBYA 4LWZA 4QKQA 2DCUA 4HSEA 3LH5A 1E1QD 4UNSA 3I8XA 1E2EA 2CEAA 3LNCA 2CVHA 3BH7A 4BLSA 3CF2A 4KSBA 2ZR7A 5LD2C 1ZM4A 1FZQA 1ZNXA 4TLBA 1D5CA 2DYKA 3FTQA 3RS2A 5FBWB 1II8A 4TZ6A 1E9SA 4PPFA 2AHOA 1WMSA 4HUTA 4RZ3A 4IFEA 3WYGA 4BUJA 5JMTA 3RDPA 5DLQC 721PA 4R2IA 1RRCA 3UPUA 1E2IA 1NLZA 1CIPA 1G7RA 3A37A 1IN6A 2B92A 3IQXA 3OIVA 5KSPA 3HPRA 1IBRA 4IOKA 5CLLA 2YVUA 1N0VC 2NZJA 1X86B 2OEPA 4Q4JB 3WYAA 3ADDA 3LLMA 3K0SA 2JA1A 2GJ9A 2WOOA 2YOHA 4BRWA 3Q5EA 3TH5A 1XTQA 4ZKDA 3ZVRA 1YZTA 2F55A 1E79A 1S3GA 4WVFA 4UJ5A 3ONWA 3ETLA 4MGZR 1W46A 2F9LA 2XSZD 3B6EA 1VYUA 4PSKA 1G41A 1MRSA 4EJSA 1JBKA 1R6BX 4B44A 1FNMA 4PR0A 3RSLA 1Q0UA 4XWAA 4WAUA 2JLQA 3ZD6A 1EFRA 1S8FA 3IIJA 3RRZA 3QIAA 1XEWY 4PHGA 3VKGA 1R0WA 3R7WB 4NYJR 4MYUA 2GXSA 3GPLA 1AJEA 2EFGA 2QRZA 4O0MA 2YINC 4F4CA 1OKKD 2VPPA 4GRAA 3MWKA 4A15A 3L2OB 2E87A 3CPHA 4XIGS 2CE2X 4D4MA 4CIDA 4BLTA 1M8PA 2IYUA 4O3MA 2XEXA 1JXMA 3EZFA 2VTKA 2ZJZA 1S1MA 5KU1A 2FOLA 4IOJA 4TYNA 2KE5A 3EWAA 2WIBA 1Z6AA 4PXAA 4X8MA 4BFTA 2FFQA 2A5GA 3P20A 2KBFA 1ZCAA 4YMWA 4TYYA 5ELXA 5FL7A 1IJFA 2FPLA 3KKOA 3CB4A 4NYMR 4BLOA 4DCSA 6Q21A 2DY1A 4OQNA 4M9SA 5TV2A 4L4UA 1SQ5A 2EWWA 3SBDA 3QNUA 2X19A 2Q3HA 3A8TA 4DDWA 1E1RD 2VP9A 2IS1A 3T1QA 3NC0C 1OFHA 5E95A 2HT6A 2GXQA 2HCBA 3UG7A 4ZO4A 3CF6R 1VKJA 1S9HA 3I8SA 2P2LA 1E98A 4HAWA 3IQWA 3A58B 2ZJ2A 4OKSA 1DVRA 3RANA 2BMEA 3W90A 1R4AA 2N1BA 1U0LA 1XEWX 1WB9A 3LXRA 1XEXB 1CTQA 2ZRMA 4FMCF 4EUNA 4P33A 1QHHB 5AJWA 2KI5A 4US1R 1NBME 1OXUA 1NI3A 2OG2A 2V9PA 3HYTA 1U8AA 3P4XA 1R7RA 4NH0A 3OEHA 5CLQA 2WMOB 1OF1A 2BIFA 3LFUA 1FX0A 5C2JB 2OZEA 5K8IA 1NBMD 3U3JA 4Q9LA 3SBEA 4LDJA 1E0JA 3N2IA 4OK3A 2RHDA 1GDDA 2QG6A 3HJNA 2AFIE 3K1JA 3LW7A 2EWVA 3T34A 5DHFA 3THOA 1VCIA 1VTKA 4IDHA 1A2BA 1OB5A 2L0XA 2VL7A 4AK9A 1JEEA 1YJ5A 1N25A 1EFCA 1W4CA 1Y3AA 1YZGA 2F9MA 1XMJA 4RD2A 2YHSA 3I5XA 4PC2A 4AKHA 1A5TA 2HDNB 2IWHA 4M1KA 4MDFA 3QF4B 3CX8A 1EXMA 4FXPA 3QG1A 5CYOA 4JVSB 1E3MA 3ZS8A 4I1UA 4EPWA 3I72A 2IX3A 1SVOA 4RFSA 4LHVA 4IXNA 3DMNA 2ZRPA 3KXIA 2HV8A 3U7HB 5KDLA 4O25A 2FH5B 1UDXA 2GK6A 3KTAB 3NC1C 1JAHA 4EPYA 1J2JA 4L9SA 3A1WA 1EFTA 1P9WA 1HEIA 4C4PA 4OQLA 4TTPA 1Z6XA 4B47A 5JWRA 2ZRNA 1A2KC 2KBEA 2NPFA 3PUVA 1U99A 5C1BA 1E2GA 4EPXA 3ADKA 4LJYA 1MABB 2GXAA 2IYRA 1G3MA 1IM2A 2ONJA 3ZS9A 3TGPA 1UEIA 3OIYA 1T91A 2FX3A 5FPKA 1C4OA 3KX2A 3GCGA 1A4RA 3VHXA 4UQOA 1B0UA 1RFLA 2FZLA 3BAFA 5LPNA 1QHYA 4MGIR 2GTPA 4JZKA 3W6NA 3ZZTA 4EDHA 2YC4C 3CR7A 2H92A 2ZPTX 2DFKB 2IC5A 3IILA 4TN1A 4ZDIA 4NYJQ 5TDHA 3BE4A 2C78A 4Y0VA 4YLGA 3ZQ6A 1DBSA 1NVWQ 4OK6A 4AG6A 4Z51A 621PA 1NNEA 2H16A 2NIPA 3WXMA 3GLHA 1CKEA 3CWQA 5AJZA 3QSYA 2XNDD 4XTCS 5FOWA 1JI0A 4IVPA 2ZRCA 1O3YA 3AUYA 3K0AA 2J5XA 2NQ2C 3ECCA 2ATVA 1N6RA 4RD1A 2G6BA 1YRBA 3DM5A 4QGGA 4DCNA 1JQLB 1UPTA 3FMOB 4B2PA 5HPYB 3ZDQA 3TRFA 3WNBA 2IK8A 5IHPA 2VYFA 3R20A 1XTJA 3SJCA 4KFSA 4CW7A 2QPTA 4K8OA 4MRVA 4H9GA 5DI3A 1NLYA 2B21A 2CCKA 1RC8A 5F9FA 5L3VA 3ZQJA 4QJ4A 2GAAA 3OEEA 2FNAA 1NMXA 1N6OA 1MRNA 5FPTA 5H1YA 1JXOA 1GWNA 1Q1ZA 3CNNA 2FFBA 3SYLA 4AG5A 4KFRA 3SYKA 421PA 4LUCA 1FTNA 2WWFA 4AYWA 4DXAA 2Q0HA 3AGQA 1OH6A 3GFOA 2CJWB 3IKJA 3LBNA 3Q72A 2UZIR 4QBFA 2CCJA 4DLWA 1KOFA 2HJGA 3K9GA 5GJVC 1K5DA 4F91B 4XVRA 3U3MA 4QHYA 4A0FA 2V6IA 4Q4LA 5EZ5A 4I81A 3KQUA 3PITA 3B2EA 4MYCA 4J0QA 4U7DA 4XH9B 4R71A 5AJXA 1KAOA 4OHXA 3NBFA 2BKUA 3EIHA 2OFWA 1AS3A 3SHWA 2ZXUA 3K53A 1EFRD 1SULA 1TPZA 4G1UC 4D4LA 2JDID 4JVLA 4A2WA 2WPDA 2ODWA 3KFVA 3R8CA 1XMIA 5CITA 1QG2A 5G40A 4FCWA 4TT3A 2ZJOA 3JVUA 4V0MA 1KTVA 4PZZA 1XJCA 3NEYA 4QHSA 1RJ9A 5DYIA 2ZS8A 2WMNB 2OUKA 2R44A 1G20E 1JECA 1Q20A 3KB1A 4LJ8A 4JLPA 3SHFA 3BFVA 1KO1A 3OZXA 2V7QD 4XOIA 5JECA 3WHKA 4Z8XA 2F1RA 3GLGA 3K0FB 5D3MB 4B75A 1HH4A 2J0QA 4OJKA 2O8FA 5BN5A 2ZM5A 1CR0A 4B3DA 5LB4A 1M7HA 1G9XA 3ZGXA 3TW8B 4IDQA 2JASA 5JJIA 2QSYA 2YWFA 4BFUA 2IBMA 2RGBA 3CX7A 2EVWX 1IXSB 5FI1B 3RS7A 1M74A 1GVNB 1TX4B 5FL7D 4KFUA 4Z54A 1RPZA 4G5OA 3LA6A 3MWJA 2FN4A 5EP4A 3R9XA 1HT2E 1AQUA 1XRJA 4KLNA 3QKRA 5DIFA 1KMQA 3U3OA 2OBLA 3VKHA 1U81A 2QL6A 1VCNA 5EXPA 1FFHA 3EZ6A 1IOZA 1E2DA 1KI6A 2IUSA 3DOEA 4OQXA 4C0JA 2ZAOA 4DJTA 1HE8B 2GAOA 1ZM7A 1Y63A 3Q9LA 2A5YB 3RC3A 3UXMA 1FMLA 5J4LA 1II0A 1AS0A 4Q18A 4JJKA 5FI0B 4KYIB 5FUWA 4B3FX 2H57A 1VDZA 4MKFA 1D8TA 4IW3B 2ZI6A 1XD8A 2WJJA 3ADBA 1QZXA 4IFBA 4IOMA 2ZU6A 3BH6A 4TL7A 3P1JA 2Z4SA 1K5GA 3OEHD 1BKDR 3KQLA 2ZI5A 1G64A 1CJMA 1CBUA 2P5TB 4Q4AA 1KO4A 5F98A 5FOXA 3KB2A 4A6XA 1Z0AA 2WAYA 3OHMA 2F3RA 4PO1A 1XFAA 3OAAA 1Z08A 3G82C 5G41A 3UIEA 1U94A 3C41J 3NTUA 1GIAA 2AKAB 1US8B 2QENA 4HUQB 1T3SA 4D0GA 3WP1B 1OH7A 1KI1A 3C14C 1GL6A 5DSZA 1NN3A 1W36C 3UMRA 4Q9IA 1IJEA 1HUQA 1LB1B 1VHTA 5JS7A 3VNVA 3AP1A 3X1ZA 4LK2A 2PJZA 3L8YA 1NG1A 2YKGA 3EWSA 1W4BA 3OE7A 4PQRA 4OI4A 2B8WA 5FOSA 2O8CA 3I92A 4TMXA 3B13B 1II8B 4L15A 1HQCA 4RSGA 3VX4A 5KTYA 2J7PD 4C0SA 1KJZA 1E6CA 2WOJA 5CM8B 2VF8A 3P32A 4NKRA 2D74A 1KSFX 3QG5A 3LW8A 2ZE5A 5G3YA 3IIMA 1E2NA 1F3OA 3NBXX 1YHNA 5A5GA 2ZSEA 3CX6A 4NU0A 2HCJB 1QHSA 4P32A 2EYQA 1TEVA 1VG1A 3BH0A 2ERYA 2OT3B 2VHQA 5HTKA 1P2VA 5BWMA 3HYRA 5JZVA 1P5ZB 3NDPA 4Q1AA 2FSHA 1ZYUA 4PHFA 3WYFA 1SVSA 5SZKB 2FEMA 2XJ4A 1FPMA 3DZ8A 4HAUA 1QG4A 4D80A 5TVKA 5BW8A 4ACAA 4DDTA 4EJSB 2OV2A 2IT1A 3VX3A 2B7CA 5D3QA 4KXFB 2Q21A 3BK7A 3QXHA 1CEEA 3GLHE 4DB2A 2RGGA 1KNQA 2UKDA 2WWWA 3FKSA 1E9BA 3EPJA 1MOZA 2KJQA 3NDBB 2DWOA 3UG6A 4Q7MB 2ZSFA 4M21A 1W7AA 4D25A 1GRNA 3HU2A 1VIAA 1G291 3SFZA 1GSIA 3B82A 3QVVA 1U9IA 3BERA 4WOPA 2Q6TA 3KKPA 1DO0A 1TQ4A 3MG9A 3U5ZB 4HZUA 4GOKA 1DOAA 1KY3A 1Z0IA 3WY9A 4BPBA 4QGAA 1COWA 2XXAA 2QY9A 4DBLC 2DB3A 3FHTA 1KDPA 2HUPA 1L4YA 5HR5A 1WBBA 4KI0A 3PEWA 1NP6A 1DEKA 1XPRA 1CR4A 3OEED 3IO5A 3LLUA 4G3XA 4YMTA 3U60B 1W36D 4LYAA 4MUBA 4NCIA 3B8HA 3DPUA 4M0LA 4BLRA 4E09A 2WWIA 2QZ4A 4KYUA 2BBWA 1FOEB 3AVUA 3LD9A 1JR3D 4HZIA 3CH4B 3S1AA 1Q3TA 1AN0A 3NEJA 4GMXA 2F1JA 3AQ4A 5KDDA 4V02A 1ZMXA 3QXCA 1WRBA 2O52A 4DCUA 1D9XA 1E1RA 4AURA 4KVAA 3VHLB 2GVDC 3B7GA 5C4MA 3B85A 1X8KA 3FHCB 4LCBA 3AKYA 4ZPXA 2AWNA 2Q9AA 3LWNA 4EAQA 2PLRA 3D6TB 1FX0B 2IYQA 4TLCA 4QOSA 4V0ME 1FUUA 2R65A 1D2EA 1ODFA 1W4AA 4F4IA 1RKBA 2WPDD 2VP0A 4FCTA 3GJXC 3FGNA 3TIFA 4D81A 5DNYB 3AF0A 2FSIA 3RAPR 2PZFA 3GEIA 5TMPA 3EG5A 4ESVA 3TAHA 2NO9A 1OYYA 4JBWA 1U90A 4QG7A 3GLGE 2B6HA 3AM1A 1GKYA 1IN4A 1GRRA 1KAGA 2IS4A 4KBFA 2QAJA 2WSSA 1SXJA 4S35A 2QSZA 4RD0A 3KQNA 2C5LA 1E9EA 2FV8A 4Q01A 5F3WB 3TLXA 4L8GA 2PT7A 1X6VA 2QPAA 3RS5A 4B48A 4RFSB 1NKSA 2W2VA 3RS3A 4IOLA 3IIKA 1AZTA 2PCLA 1MO4A 3LQQA 4M9XA 1OIWA 3T1TA 2A3RA 2OBNA 4LGMA 5E7MA 1XEFA 2PX3A 2ZUBA 4UXHA 3ZD7A 3W6OA 5L3SB 1KNXA 1F2UA 2WJVA 3K9NA 3L8ZA 4Q00A 2B8TA 3H86A 4RD4A 4MH0R 3GQBA 5G3ZA 5GADl 3AEZA 4D4JA 4UNQA 1U2RA 3VR5A 1R5NA 1P2SA 2QAGB 4M53A 3MAAC 4TLDA 1PV4A 3R9WA 1L2TA 2GCOA 4URYR 2WWYA 1VECA 1YZLA 4PC1A 2ZRBA 3GEEA 1SVLA 2G77B 2BMJA 2PMKA 3F5FA 4HAVA 4HB3A 1DAKA 3IDQA 2H7VA 4DIEA 4C2TA 5GVSA 3EZ9A 1TF7A 1W44A 1KO8A 2XTNA 5DE3A 1Z06A 4EFNA 2AX4A 1M34E 1CR1A 1YQTA 3B9PA 1A82A 1XTKA 3G0HA 121PA 1U9IC 1IN7A 1WF3A 3CBQA 1XMVA 2QTVB 3GP8A 1PJRA 4URXR 3C4JA 1OFIA 4R9UC 3GLHB 2GRJA 2X2EA 1AIPA 5EXTA 2QT0A 1ONBA 3IEUA 4QBIA 4URUR 3KKNA 1KI2A 4KCGA 3K0AB 4LOAA 3OAAD 3K0CA 2J41A 4PANA 3P27A 4JIMA 2HJVA 2WWXA 2XITA 2OXCA 4QBGB 2A5FA 2VH5R 2F1HA 3FMFA 2H17A 4DWJA 4B3GA 3BFKA 4A92A 2YWGA 2V8OA 5J4YA 4U5XA 5DI3B 4HLCA 3OE7D 1RVDA 1W0KA 3THWA 2VHCA 2IS6A 1F6BA 4IEEA 1W1WA 4AKEA 1JR6A 4FD2A 2ODBA 4JLKA 1E9CA 4LZZA 3F0TA 1ESMA 1J8MF 2Q9BA 2OLJA 5TXGA 3KFXA 4DSUA 2XAUA 4D82A 4MDEA 1E99A 1VYVA 4MKGA 4YMSA 1E2KA 4KHZA 5FBLB 1ZJ6A 4RZXA 4EQ6A 2OO7A 4A2QA 3H4MA 3FOZA 2BC9A 3DMDA 3IBYA 4KBGA 4JSYA 2D7DA 2C04A 3DZDA 2QBYA 3BWDD 2V6JA 5JEEA 4JL8A 1XCPA 4PHTA 1EGAA 1R5OA 2C2HA 4WBSA 4LC1A 1ZNZA 5P21A 1SKYE 1K6MA 2V55B 1UAAA 1WCV1 2Z6VA 1F60A 4FI3C 5UKDA 1G5RA 3TNFA 2WTUA 3SQXA 1DAHA 3CPJB 1Z63A 4CEHB 4NTZA 4TSFD 1Q1BA 4D4KA 3FKSD 2W83A 4L5BA 2V1UA 2PZGA 4FINA 4ZI3A 2W6IA 1P72A 1SXJC 5TY0A 4PTLA 4WIAA 5H8WA 2YWEA 2V3CC 4AWXA 4MKIA 5E4FA 2BV3A 4KAXA 3PEYA 2OE2A 3TAUA 2BVNA 2ZAMA 1AS2A 1RJ9B 3AGPA 4JL6A 2IEYA 1CULC 3UMFA 3GEHA 2C03A 2ZRHA 2QMOA 1G6OA 1TEXA 1Z07A 3BD9A 2JDIA 2Z5FA 3TVDA 2PL3A 2B7BA 4DEYA 4Q21A 4TQ9A 1COWD 2OFOA 2VLIA 3TSWA 4NMMA 1LS6A 2XZPA 4DLVA 2QORA 3CIOA 2PT5A 3AP3A 2OBMA 1DARA 4N0DA 2ZITA 1T3HA 2GBLC 3LV8A 5FTNA 4DIDA 1S2MA 3ZLJA 2V7QA 3DM9B 1X8LA 2RH5A 1VCOA 2MSDB 1CU1A 4DT1B 1AM4D 3NH6A 2QA5A 1YE8A 1NVXQ 4OJQA 1XZPA 1RRGA 1KI4A 1G16A 3LVRE 1KI6B 1W0JA 2C96A 2DPXA 2NOAA 1J90A 2PLFA 2R8RA 4B34A 2RGAA 2RMKA 2DWQA 3BS4A 2NO7A 1P61B 4B3BA 2AXNA 3PEUA 2GZHA 1TTTA 1XNJA 4DC9A 1UJ2A 3ASZA 2BKEA 1DELA 1ZC3A 4XWOA 1P3JA 5JCZA 3HU1A 4M1YA 1G21E 3V4FA 4DDVA 4YQFA 4FIDA 4BZQA 4TLAA 2N46A 1P9NA 1JEDA 3K0CC 1HV8A 3QKSB 4LPKA 3T5DA 4R2HA 4Q4AB 4TL9A 3KJEA 3X1YA 2OAQ1 3CM0A 2IF2A 3QE0A 3EAQA 3VU9B 5GJBA 3NHAA 1WXQA 1ZD8A 2ZUCA 1G8FA 3GMTA 1SXJE 2QTFA 2ZR0A 2K5UA 2HEIA 2CMKA 3TUIC 5B57C 2J7KA 5CM9C 2WSSD 1SXJD 2Q3FA 4ACBA 3ZVNA 3UKDA 1W2GA 3KJIA 3L0SA 2OCBA 3AUXA 4P4SA 4KSCA 2F1IA 4V03A 2EFCB 2GJSA 4Q03A 1HURA 3NWJA 3UATA 4B3XA 3ICQB 1J7KA 2ZSAA 3AF1A 5SZJA 4NONA 1ZUHA 1T8UA 2GXUA 3SC3A 4LHXA 4A1FA 3GJ8A 1KJYA 3PUZA 2WJGA 4YMUA 2J45A 2PX0A 3SR0A 5JHHB 4PC6A 4A8JA 1FP7A 2BMDA 2IXGA 1KI3A 3AVYA 3IHWA 1YVDA 1ZW6A 4LV6A 5KPDA 4CRWB 1F2TB 2F43A 2BCGY 2OHFA 1Q1EA 2EYUA 2ZS9A 5L8VA 2J7PA 1GILA 4B71A 2C77A 2ZRDA 3D7MA 2BEJA 4TMWA 3TW4A 4M1SA 1TUEA 2BJVA 4W9MC 3RRNA 2FU5C 3IUYA 4JLDA 2BBTA 3IHLA 1UFQA 1OV4A 1JNYA 1BOFA 1J70A 4LYJA 4HEJA 2D2FA 2BHRA 1PLKA 2IUUA 2EU8A 3THYA 2QP4A 1NN5A 3EZ2A 1NY6A 4B43A 1CRQA 1VIYA 4GSYA 4F7WA 1CF4A 4LBZA 4A4DA 1IONA 1NIPA 3MJRA 4EPRA 1L8QA 1S0UA 1KKMA 4TWZA 3RSOA 2BMFA 4NCKA 3RYTC 2WWHA 4RFVA 2IF0A 2WICA 1OFUX 3QBVA 2RGCA 5B58C 5M04A 1NMYA 4LX0A 1P7CA 1I2MA 2G0TA 4QRHA 4AIIA 1MH1A 4HZUB 5HKKD 2QU8A 5AJYA 4XVUA 3I61A 1W5TA 4LBYA 2JJ8A 2WBLC 2YC2C 4BEJA 4QM6A 1KI7A 1L4UA 1DAEA 1Z6YA 3EPHA 1XXHA 2J0VA 2D7CA 4YDHB 5AUNB 2H1LA 1W0KD 1XBTA 4KFTA 4S2EA 3E1SA 4KLZA 3O47A 5K8UA 1CR2A 3GLFA 4GOJA 4G01B 1QF9A 2XZLA 4OBEA
chains in the Genus database with same CATH superfamily
5CJ2A 2ZQZA 3N8DA 1BN6A 3AEQA 4YJGB 3Q5DA 4UHFA 3RF7A 1Z28A 1E69A 4EFKA 2ZYSA 5C31A 5KYXB 2RE8A 4PZCA 4C7VA 1E5TA 2WF9A 1VJ5A 2A1TR 2A5DA 2C9YA 3F49S 3CEPB 3G2HA 5HHTA 3FH0A 4U2CA 4C1BA 4GXTA 2V74B 1SO8A 2DQSA 4ASUA 2HNKA 3JVEA 4YQYA 3DAPA 1J5PA 4XOUA 4IH1A 3PX2A 5EQFA 5M2QA 1Y1TA 2NMVA 2DBRA 1MR3F 4NL4H 3S2ZA 1SVWA 4JVOA 2PL9A 4RACA 3PEVA 1WE2A 3SQMA 1QG6A 4IDNA 4WCVA 2CJYA 4ZI7F 1XPUA 2Q9UA 4C7KA 4UPVA 5HP4A 4D0RA 1JR3A 4N40A 2QOEA 1QUFA 5ALXA 5EJMA 4PGHA 1EU1A 1NF2A 1PS0A 1DS6A 4OGLA 1T9KA 5DZSA 1IXRC 1Q74A 2CL7X 3EIFA 4EITA 3ZXIA 5BN4A 4YCSA 1YQXA 2RH9B 2Y6VA 4O5OA 3UKJA 1KQNA 1RE0A 3WP0A 4F04A 3Q2IA 1A8SA 2XF2A 2YY5A 5JSZA 4FWTA 5JLAA 5LU9A 1A72A 4ZO9A 3V00A 4BN5A 2G9ZA 4JYBA 1YIAA 5JLJA 2D5IA 3Q85A 3OU6A 1G2OA 1EA7A 4IQ0A 3BXFA 4KIJA 4LNUB 4BASA 1QX3A 4HDSB 3BRWD 1T0IA 2PANA 1FYEA 3GJSA 1LC0A 1VB3A 2EC5A 4OXNA 2SCUA 2AL7A 4J75A 2QJOA 3SJUA 1TTPB 1JJ7A 4O4HF 3KYCB 4ZT5A 4KN6A 2M6LA 1YAHA 1PFWA 1GPNA 2DBZA 2HXGA 4RMJA 5DBGA 3VR2A 2F48A 5FFMA 1IZ0A 1ZGAA 1E58A 1X1DA 4FMDB 4MPJA 5B3KA 2GPNA 4FYMA 3WLIA 1J99A 2BELA 1UMBB 2DJ5A 5HCNA 3S2EA 2NVBA 2CSUA 2V6MA 1Q7TA 2N47A 4WLVA 1WUTA 1P45A 1G17A 2CNNA 3WLPA 4H7HA 2QV7A 2A7QA 3OKCA 2V7UA 4IP0A 4UARA 2AFHA 3C5HA 2AOXA 3G7UA 1FQJA 3HUFA 1G5HA 4TMTA 1Z36A 1XZLA 4ESOA 1KAQA 1G8GA 4WNCA 4Y2YA 4B6PA 4WLUA 2IH2A 2AG6A 1CDZA 2HNAA 1ECJA 3ECAA 3O95A 3PXDA 3WWOA 2YIVX 4POOA 4CGZA 4N7RA 4UHHA 1N3YA 2REBA 4UEQA 3ZLUA 1O7JA 4O08A 3Q2OA 3AJAA 3PDWA 1JIXA 2R60A 4N0PA 3REQA 2WIFA 3FYUC 4J7CA 2YX1A 3H9BA 5BN1A 5J4KA 3QRWA 2NYVA 2WTNA 1VE7A 2I1QA 1MAAA 1QC5B 3IVAA 2AJDA 4EO4A 2DU8A 1SOUA 4MV6A 1T35A 3DF7A 1VMIA 3GB9A 4AY2A 1NA5A 4ERXA 4JS0A 3RT7A 1OZGA 3RASA 3AFIA 3JQ6A 3T7JA 1H65A 2BBOA 3HP1A 4CU5A 4HBZA 3E9CA 1OW3B 5DASA 1NIJA 2C4WA 5HQ3A 1R88A 1SG6A 3DL0A 5JNWA 3BYZA 4JLNA 2JRLA 4BFSA 2NO1A 3AH8A 2VXCA 1MQSA 3HADA 4L73A 2A0YA 2PS9A 2ORED 3DAHA 1AUOA 1E2PA 5DTEA 3BWYA 3DLHA 2V7XA 1JHPA 1XU4A 1YBHA 2H4YA 2ZI9A 3LUBA 3QLVA 3HCDA 4HAOA 5ALZA 4IV8A 3L6UA 5JJCA 3PUIA 1X1RA 3OX2A 4RSHA 3C7KA 2CXTA 5A9SA 1N6NA 2YNMA 3OCVA 2QGFA 1HOTA 4A2CA 2FSGA 1F8YA 3L8FA 1NM5A 4MW7A 5AICA 4EUHA 1XCGB 3LP8A 3A4NA 4P93A 3UHFA 4D56A 4RVOA 3HB1A 2O0KA 3QBDA 3RCBA 4DRYA 4WCFA 1B8NA 4M83A 5B1SA 1S3SA 5A4JA 1U2TA 1FMFA 3WLRA 3GH1A 4YV1A 4IMIB 4CF4A 2HBYA 4NLLA 3IP5A 4NCNA 1UK9A 2UZ0A 1LV7A 3PX3A 4E2ZA 4NJOA 3P4YA 3TB6A 1PW7A 3CW2A 3ZGLA 3G68A 4B32A 3FRHA 3EYAA 3TZKA 2PJDA 3R7BA 4L9WA 1UDCA 5FD8A 5I8PA 4RD3A 4CL3A 1HQKA 3O8OA 2WF8A 2CF6A 1QHHA 4XVHA 1CHNA 2H11A 2UZ1B 2XB6A 1EDDA 5EQJB 1M8KA 5AOCA 2ECKA 3D3KA 4URHA 1CRPA 2JCYA 4LBVA 2R8YA 2B25A 1BRMA 1S2LA 2RGNA 1D6SA 4IIDA 4KVGA 3TWOA 3PD7A 3UCEA 3VTZA 4Q4HA 2WHEA 3L7LA 3NETA 4YMVA 1BDBA 4JXJA 4DSTA 1NC3A 3KT0A 4FR0A 4GM1A 2A88A 3CVXA 3DV0B 3KEFA 2QQ0A 2ZTVA 3QEMA 1IUPA 5ALWA 1JG3A 3NKFA 3ZGOA 2VRCA 4ZP1A 1IN8A 3FYTA 3OU2A 2YFYA 2BFCA 2QW0X 3WXBA 1CFJA 4OEHA 2IV2X 1GRQA 4H15A 3QVJA 4BBZA 1L5WA 1ZQ9A 4EM6A 2B0CA 3RTDA 4DRXB 5JROA 1E0SA 2JEZA 2VP6A 3U7JA 1DAGA 3ROPA 1G0NA 1L5YA 3A3PA 1CRWG 1K3UB 3QV2A 3LC2O 1ZCFA 4L8WB 4X9XA 1UAYA 4XWTA 3ZTWA 4I9GA 2PMDA 1G6Q1 1E60A 2XOKA 1HFJA 1FSZA 3GFQA 4PTZA 3UJ9A 3RVOA 1I4LD 1I4EB 4YRZA 2DERA 1R4MA 1V25A 5IDVA 5D84A 1SG0A 2V9CA 2QLBA 5J40A 5KYUB 1G7SA 1T2UA 2OQRA 5JRJA 5DTRA 2FJ0A 1D4ZA 1CY8A 4LQDA 5I7SA 1X7DA 2XQJA 4LRWA 2ZU0C 1LD3A 4CV0A 1EJBA 3GOQA 2I2FA 5JS8A 5LZ9A 3IAHA 3ZOZA 1ZSVA 5FR2A 2GZMA 1S1CA 1R4NB 2VDVE 2PDAA 4YXWA 1FQOA 2X8BA 3DUWA 1CUIA 2VJKA 3FSGD 1M2OB 4L27A 2VBGA 5EGSA 1SCBA 1UWVA 2P4UA 3REGA 2BGGA 4M8KA 4C78A 2MSCB 8AT1A 1EWVA 4FUTA 3F6PA 5C8YF 4DR1B 1GQYA 3GYBA 1PUIA 5JYCA 4MRSA 1ULBA 1N8KA 1BDJA 3EISA 3HO8A 2G04A 2VXOA 2H59A 4ABYA 5L53A 2R00A 3F9IA 4LA4A 2W2NA 4YAUA 2WU8A 3GN1A 1UBGA 1HMYA 4IIGA 3EE6A 3F2VA 3OJEA 3QPUA 2BDTA 5IVHA 1DJNA 3DHVA 3NC4A 2AVNA 2R7AA 2PO5A 1W59A 4NOMA 5B5SA 4C0BA 2OVBA 1JIJA 3AJDA 4US0R 1XVTA 1UR5A 5JCJD 3E48A 3ILXA 4M7OA 3WR5A 4DWOA 4BO1A 1TM5E 3C87A 1WSBA 4JK3A 1H9AA 2NTJA 1FXWF 4Z9YA 3JYPA 3DAOA 3TQCA 5CA1B 1QHGA 1R6UA 3IBCA 3L0DA 1E3TA 3PXUA 3QEOA 2WJPA 4Q24A 4MKZA 3HNRA 4EKGA 2HU5A 2QWXA 2JLXA 4OX9Y 3I2JA 2IYLD 3D2BA 3WGOA 3NPAA 2HCFA 2WVJA 4X92A 4EL5A 1H5QA 2E1PA 1I4TD 3L8DA 3ZU4A 4Y9SA 4ETWA 5KNDD 3O8LA 4JWTA 2BPOA 1OYWA 4UU7A 4J8PA 3CWZA 1ITZA 2W8BB 2YJ3A 2D4AA 3CF0A 3QBTA 2I33A 2MJLA 1Y7IA 5ERGB 2R6AA 1J1ZA 4LJ6A 2EERA 1GL9B 1SBCA 2DGDA 3TCNA 5HE8A 2EJWA 4KO8A 4NQRA 1FDIA 4PSVA 4PZYA 3PJRA 1DBIA 4NPAA 2AXEA 3SF8A 4FDAA 2OP1A 3AY3A 3TRDA 4URVR 4N6NA 3GA0A 1KSGA 1EGHA 3VPFA 3LO5A 3QE9Y 1T4MA 5AIAA 1M2GA 1DJMA 1UMCB 4J9VA 2RDMA 4QLAA 1CPYA 5T6MA 2C58A 1EM8B 2W2LD 4H35A 5AESA 5KB3A 3DDOA 1O4VA 4RL6A 1U5BB 1U0JA 5HJ2A 1ECFA 2PD6A 4MIEA 4YUZA 1NW9B 1T5IA 2GESA 5KNCD 4DIKA 2Z2ZA 3W3AD 2OCPA 3MJSA 3V2IA 1FNDA 1XELA 1OAKA 2Z0MA 4IDOA 2CLEB 5A9RA 3RFFA 3E0XA 3HL0A 3IERA 2IYYA 1O6BA 3C7AA 4HLDA 4H6WA 4J0KA 4PLYA 5F1OA 3OF5A 4GL2A 4JT9A 5CW1A 2JL1A 2LPMA 4FFBA 4AUNA 3BSWA 1TM2A 3D6FA 3FBGA 4CKCA 3HJFA 2WSMA 1NVVR 4QODA 4XLTA 1G3RA 5KTKA 4M1QA 1TQDA 5B1IA 3VTAA 2ZVDA 1I5OA 2VF2A 4RJLA 3VOTA 4XUCA 2BRUC 2NUAA 2X7XA 2I7DA 2XR1A 4KQIA 4LBWA 4HV4A 5B2FA 4AUMA 4G0MA 4MAAA 2YMPA 5EKXA 1LLCA 5EWJB 2BM1A 2HA5A 3JPWA 2LKDA 3P26A 1S02A 4EBBA 4EGJA 5HF5A 1TVMA 1D4OA 1ZKMA 3USES 4KXYA 4J0HA 1Z7BA 2E37A 2NSJA 1QIFA 2VAWA 3G5TA 3EXHA 2CW5A 1P2DA 2B94A 1LGYA 2ZS7A 1DXHA 1XLUA 1QIGA 1Z5PA 2P40A 3KIPA 4UM8B 4YRRA 5FWYA 1SBHA 521PA 1ZKDA 1AXRA 4JHXA 3OQIB 3SVTA 5KPJA 3FYHA 1KIMA 1PAUA 1VYTA 2D59A 2ZWOA 3BBPA 3RBZA 4NJEA 3AF4A 2GNOA 3CR8A 4KQKA 4L2IA 5EP2A 5JNUA 1QH9A 5D5HA 3RYIA 2IHYA 4PG5A 1EK5A 3WKEA 3S40A 2VWQA 1IQPA 1NQUA 1YJXA 3IGFA 4AC9A 1CCWA 2FSUA 2J3HA 2D5AA 4W5HA 4W5TA 3ADCA 1P81A 3E03A 2YJNA 3OZIA 1N75A 1ADGA 4TTAA 4S04A 2OC4A 3EVCA 4RHFA 1U9JA 3PNQA 4JLJA 1T0BA 2VR1A 4LWPA 1D6JA 1A77A 1U7ZA 2IUTA 3I5UA 3NFYA 1KYIA 3IQFA 2XEDA 1E2LA 2Q1XA 1R37A 3C3XA 2G5PA 5JMOA 4TTVA 1CQJB 5J1TB 3H16A 2UXBB 3AINA 1N2GA 3GLFB 3UFXA 2PRYA 2BN4A 3HJUA 4N41A 5LB2A 1EP2B 3AV0B 3ITNA 4FYJA 4TQUS 2NT4A 2X8AA 3P97A 2Y0PA 3ZHTA 4RJJA 5EUBA 2OP0A 1GDHA 5F3DA 4ARUA 2C3PA 1LK5A 2QEQA 1NW4A 3F9CA 2VK4A 3DFUA 1K2VN 1JTFA 3C48A 3COPA 3GJ3A 3K6RA 1OJLA 1Q2XA 4AZVA 3NIDB 2IYEA 3MERA 3OECA 2R8XA 2Q5FA 1XQYA 1YZHA 3PBKA 5IKEA 1A4UA 1SKUA 4RIFA 3PFNA 4WZZA 3D1JA 1XF1A 3I64A 4MA4A 1P44A 1DG3A 2WIKA 4HNSA 1P19A 2PMEA 3HUTA 3BWEA 4YRDA 4A36A 3OQJA 5IKPA 2GCNA 3CKLA 2YXEA 1A5ZA 4YO8A 2C1EA 3DBHA 1H85A 2Q3BA 3WSTA 2QTBA 2PZMA 4C7OB 2DHDA 4Q02A 3JQ7A 1TUBA 3ELUA 4DMFA 3QVWA 4N3AA 3L4JA 1YR9A 3EYWA 4ZXPA 5TT0A 4QYIB 2P6NA 5EJ8A 3C5CA 3AVQA 4PQGA 1QG0A 2CJPA 1GJRA 2V3WA 3F74A 4P22A 5ALYA 3SYTA 1Z25A 1P9LA 1QMGA 1WL8A 4I9UA 4OVKA 1XQ6A 1TK3A 2XIQA 3PEFA 4EY8A 1ZLYA 2C99A 1YZYA 2O2DA 2O3SA 3D4PA 3CH5A 3GNSA 1QFZA 2ZVQX 3PG5A 2GN4A 2IP1A 3H6GA 2ZJ8A 2FB9A 3R77A 5T3YA 4JLBA 1QOQB 4BNGA 1AKNA 2H1OA 2PKCA 2OG1A 1M54A 3AR4A 5FKJA 2IW1A 3GJ7A 2PQ2A 2AKYA 3L49A 1KK1A 4P3YA 5ALOA 1OXMA 3CISA 3A32A 1A9TA 2HN9A 1RQ7A 1FFAA 2A1UB 3M9XA 4IEIA 1J8YF 5D01A 5FI5A 5IT5A 2QDKA 4R2XA 4UM9B 3EXIB 4P98A 2Y05A 1JSLA 3JV7A 3NNSA 1V26A 1BW9B 3GZNB 4X7RA 4V2IA 2GDZA 5KKAA 4C5CA 2CBZA 4BXOA 2VI5A 1XC7A 3DLBA 3ZXUB 4A9AA 1I6KA 2BSAA 4P82A 2NVUA 3COSA 5GONB 4QOFA 4LF9B 1YQUA 3LHKA 1QVWA 2HJWA 3HG7A 3RJ9A 3RK1A 1XPOA 4MPDA 2GBCA 3OE5A 3E8SA 4OI2A 1AO0A 3M6AA 4HB4A 1E3SA 4ZQCB 5I3ZA 3D3NA 4Q4DA 2XNCA 4WEQA 1RYHA 2JLSA 3O84A 3EASA 5I4BA 2JIZD 3P9CA 1H22A 4JJZA 3WMGA 3IAM6 2ZIFA 4BNVA 5BVGA 5C18A 1NVVQ 1XAHA 1ZD9A 4ZAFA 4ZAXA 1LBSA 1ZJJA 5FYDA 3ZJTA 5DX0A 1WDKA 5K4AA 4ESHA 1S3IA 4BPRA 1U7HA 4UHDA 4XIJA 1QBGA 3K70C 5FTMA 3K8QA 2LTAA 4ZV4A 4JCCA 5EZYF 1JEOA 2I3DA 5AOVA 2WD7B 3F97A 3QKRB 3IODA 4TYWA 2QU7A 3S44A 1K68A 4NP6A 2X8LA 1OT3A 2PBZA 2HMSA 3O8DA 4DLNA 3QJYA 4BWGA 1ANKA 2GEDA 3ZN2A 4O4JB 1PR9A 5CXUA 3VNBA 3D6AA 2E4YA 5EG5A 5JD4A 3NWPA 1B7GO 5IJAA 3OZDA 3MD0A 2GO7A 2Y1CA 5K3CA 3B5JA 3PGA1 3O2SB 4HLUA 1MC5A 4HLNA 3AV3A 4V0LA 3U7GA 1C1XB 1RI1A 4HXEB 2R6FA 5JNRA 3HXQA 4OAOA 4HN4B 1RI4A 3CNOA 2HQBA 4MCHA 4NBNA 4C21A 1NBEA 4Q9HA 5JE8A 5FOTA 1IPEA 1JT9A 3GOHA 2BEUA 4YGYA 4EG7A 2JLYA 1UPUA 2V7WA 4I0WB 4ZZIA 3A4MA 1Z39A 5FTLA 4EATA 4FOOA 7REQA 4ZTBA 3OTGA 2WTMA 2VYVA 4ZC8A 3TB4A 2XQVA 1B23P 1V7QA 1S2NA 2PV7A 3K0BA 4O6VA 1IVNA 2R8PA 2GEKA 3GRPA 3MJEA 1RPNA 2VJMA 4MWDA 3LYUA 5DBEX 2PNFA 1YOBA 1V7ZA 2H51A 2Z2YA 1E92A 4GFDA 4DSOA 1YZ3A 2CXPA 1W5FA 3NWOA 1N5RA 2YDXA 3NS7A 4TXHA 3UJCA 3BOSA 4KITB 1A8IA 4OIFA 1TW2A 5HIIA 1PT5A 3JWJA 3X2FA 1UBLS 1WXFA 3CN9A 3NBQA 4CM1A 5AQEA 2B1IA 2OKCA 4QASA 3M5CA 4DM3A 2GN8A 2WSYB 3W6UA 3I83A 1QH8B 1ZY2A 3O3MB 4ZOQI 4LTNA 3T3DA 1M7GA 1W93A 2VDMB 1JWAB 3P0JA 1XJWA 3NVAA 1G18A 2VBCA 4N3GA 5EKSA 2G17A 3RGGA 1XMSA 4L3VA 3TLGB 2TYSB 2PNJA 5G53C 1E3WA 1YIOA 1TMGE 4HAIA 3AHJA 4X61A 2YQ4A 1AV7A 1ZIOA 4NWIA 4LWOA 1TVKA 4HEA6 3STWA 1UADA 3Q98A 5FWNA 1TRHA 2VUUA 2YWDA 4JBGA 3FPEA 3LE8A 4NPCA 3ICEA 3WLLA 4IQFA 4JBYA 3U4HA 2NTNA 2YRXA 5K0BA 1FDTA 4PZLA 1U7TA 1EUDB 1RMYA 2IYSA 4HP8A 5FUMA 3PC8A 2F3PA 2XB2A 4ZRMA 3G1TA 4AULA 2QJRA 2CLCX 3TSAA 4R8VA 3GGCA 1KJJA 3F4LA 1FMJA 3CVJA 4GOLD 2J67A 1BJRE 4ZHQF 5KDOA 1ZG3A 3V7NA 2GI4A 2ON6A 5IVPA 4HUJA 4FB5A 5JSUA 1K5HA 1G2IA 4JI1B 4N3BA 3ESCA 1FFCA 3C8DA 2XVMA 2J0UA 4WOKA 3DLIA 4HB2A 5FP0A 5CAEB 4EY3A 4O2AF 2ESRA 2HFJA 3VKWA 3DULA 4C20A 1P39A 5FWXA 1WDLA 4RA9A 1P2TA 1T6NA 1R66A 1U7UA 1SKYB 2F67A 2XHZA 1HT1E 2AMVA 2P1DA 1X8XA 2X8JB 2FHSA 2ZWVA 3EOAI 4UPDA 1SCIA 4C14A 5JD6A 1KTIA 3LCRA 1UDBA 2FKNA 4BTEA 4XYBA 2CFCA 1XIVA 2GJAA 2PMCA 3B2NA 3GUHA 1L7PA 3IPYA 1T2EA 3KWLA 4RV4A 5KCZA 1Q0TA 4QXPA 2M6RA 2YASA 3GNLA 1FP1D 3ILSA 1LH0A 1QIKA 2GR9A 3JRWA 1OLUA 1T9DA 4LVCA 1PFYA 2P69A 3JVVA 3RS9A 3VRHA 2QHXA 3QOFA 5GOTA 5K0JA 1OFTA 1FQKA 3DUFB 4F0JA 3T0GA 4D46A 3RBXA 2GILA 1XX6A 1YZKA 4L3WA 1WU7A 1ZRMA 2BSXA 3RSGA 3NVKI 4FW9A 3RU2A 2P5UA 3H9EO 3HA5A 2E18A 2ZT7A 4L8YA 4BE9A 1AGRA 5BP7A 1VG8A 2OGTA 1YF3A 3ZDCA 4OI0A 3PVCA 4YP1A 4GAEA 5BUSA 1EE1A 1UBTS 4LZNA 1WQ4A 2I29A 4MUFA 4BBAA 3GK3A 3QVSA 4BEBA 2YBEA 2G7ZA 3DONA 1KI8A 3IP3A 3MAGA 4FGSA 4CKBA 3BMOA 5IJWA 2QMEA 4II7A 2DLNA 5BMOA 3HH8A 2EW8A 3PDUA 4YAEA 1N2XA 2HJRA 2HIHA 4MVWA 4RDHA 3TJZA 1BMFD 4RJ2A 4ROTA 3NXSA 2QTVA 2XTZA 4A10A 3VC2A 2GZDA 5J47A 1G8PA 5DBOA 3NHLA 1RFGE 3A1UA 2O1XA 4X00A 4HQNA 3S1AB 1E0KA 2I6GA 3GAAA 2YN4A 3QMPA 1R0BA 1WTCA 3P9IA 3LRPA 4L8LA 4MHSA 3AY6A 5FF9A 4P6VF 4DLYA 5LIPA 3KQHA 3N6RA 3K1AA 2NU9B 3ASYA 3VYRB 3K9BA 5K8CA 4PZUA 1YJ8A 1RMTA 4KK3A 1HDIA 1BKSB 2WSIA 1OIXA 3I9OA 2YOFA 3PL5A 2WV9A 2HKIA 3LQKA 1NDQA 3TUJC 3GHYA 5F78A 4FE3A 2ZR8A 4RKWA 3NRJA 4RHCA 3EZLA 1E4EB 4YJ3B 3T12A 4ENRA 3AWIA 4M1MA 3MUFA 3QNWA 4DUGA 5JAPA 2EKDA 3PKZA 1BGWA 4JKYA 4C0AC 4OYHA 2A1TS 1BO6A 3HVKA 1UPCA 4FQ5A 1CUHA 5HZGA 2EKLA 4NYMQ 1O97C 3VJKA 1HNNA 4XCXA 4PYNA 2H3HA 2ODQA 3GC6A 2IBSA 3CHYA 1MQAA 2RK4A 4X1KA 2POCA 4YC7A 5EWMB 3WNCA 3B1WA 3P0FA 4IBOA 4KPEC 4L4ZA 4JUCA 1H4TA 1A2OA 3IAXA 4J0IA 4BNDA 3ET4A 1AUXA 1YB4A 3IEXA 3U09A 1QGZA 1K8QA 2I6SA 1FNNA 1KK2A 2GF9A 4BMDA 2RGRA 1Y3DE 2PYDA 4KJZA 3ZE9A 3RIXA 4DLBA 4QLOA 2G5GX 5JTUA 4BO6A 3QUSA 4HGNA 3GGDA 1XLTC 1S8AA 1OWMA 4FEEA 1EESA 3MW8A 4YRAA 3FDXA 4BMZA 1E79D 3AI1A 2WJ6A 3QW2A 4XARA 3KXPA 3I9MA 1VHJA 4RK7A 2X77A 1G4UR 3NTLA 1PT6A 3I76A 4BFVA 5EJ9A 3OEWA 2JH3A 3OWHA 3FIJA 3S2UA 2C7GA 1F2UB 1FU7A 4YRMA 2CWDA 2CMHA 3A0UA 4YIKA 2CNOA 1SXQA 1NBAA 5KQLA 5KOYA 1XZQA 3G0IA 5JI3E 1D03A 3H04A 1UKCA 2FZ5A 4J91A 2PUHA 2H8KA 4MCAA 1JSCA 2FUG1 1AY0A 2JCVA 3VO1A 3CWCA 1U8XX 2CLFB 4MR8B 3L0PA 1Z29A 1H2BA 5COBA 3FWYA 1PJ8A 2NO6A 2GA8A 2IYXA 2Q99A 2GWHA 3KSRA 3LO8A 3NBUA 4OY3A 1E62A 1Q12A 4B85A 4NDZA 3CH6A 3MXTA 1II9A 2Q6IA 4RCYA 5JAHA 5LJLA 3FOAA 3ITDA 1FFXB 4RPHA 4WZ6A 4JI3B 2XYQA 3VUEA 3L8MA 5C1DA 2JFFA 3IKTA 1YGYA 4QDTA 3NH9A 1NQAO 3NV9A 2UAGA 2IXEA 4MR7B 4PHCA 1T10A 1ZNYA 2IYVA 3G7NA 5DW0A 5H3HA 2WHXA 3ZZ1A 4F2HA 1KAEA 4TV9A 1KY5A 1MFPA 3H8JA 3FPKA 3O92A 3W05A 2WZBA 5CCBA 2R8OA 5AVRA 3O1JC 3EPLA 4RMIA 3NDJA 5DH9A 3FPGA 5LLSA 3ZCPA 1K06A 3EQ2A 3HNOA 3FMPB 3KU1A 4GRIA 3NIGB 2QAGC 4J7AA 4X1IA 2JATA 1DV1A 1L4KA 5KAPA 1PF7E 1QANA 2FN8A 1SELA 2KLBA 3W8FA 3CR3C 1V41E 3QXJA 2X9GA 1J39A 1ES9A 3VPHA 4Y2UA 3MB5A 1U8ZA 3TLYA 4D9IA 1EM6A 3G5MA 3GVIA 4FHGA 1YRAA 1EMDA 1IMJA 2JK1A 2WT8A 4IIUA 2I9KA 3KOUA 4XJSA 4Y2XA 5HEKA 3W6PA 2FWBA 1TF2A 4WINA 4ADSG 4R2LA 1U4OA 2GUWA 2V4ZA 3DHNA 5T64A 3IMCA 2JW5A 4HFNA 2C97A 3W8NA 1C4WA 2OQVA 3V1UA 4UUOA 3GFTA 4Y1EA 5JO9A 1B8VA 1DFIA 1JQJC 4UTZA 1Y1RA 3F3MA 3VBCA 3HVJA 5AVWA 1KP9A 4GUAA 3TBHA 2JK0A 2FPIB 3MRTA 3W9YA 3STTA 1KRHA 2Q46A 4JGBA 3UWDA 4DA4A 3MS2A 2OESA 4WV3A 1LW7A 3OIFA 5HZHA 1IJBA 1GNPA 3CVVA 4ES6A 1A04A 2BL4A 3NBAA 1KEVA 4FSDA 5AVOA 1NQXA 1DIGA 1NFFA 4P0PB 3NKVA 3R8XA 4EQ6B 1XXLA 3E58A 3VU9A 1G5TA 1UWCA 1QYCA 2Q5JA 4CEJB 3LXXA 1SHJA 5DHSA 1DKRA 1E64A 2WFMA 3KSUA 3W7AA 2BLLA 4G97A 2JFOA 4LK3A 5F73A 5A4KA 3K1YA 1T29A 3UXEA 3K5IA 4LHZA 3FR7A 3KVRA 2RHWA 3WRYA 4REOA 4BVJA 1CLUA 1DE0A 1MO2A 4EYQA 3GA5A 4LRSB 4O2BB 4OH1A 2JLVA 4R5MA 3KUCA 5F21A 4C6RA 2HIMA 4B6EA 3H5LA 4K03A 3RVMA 5BVHB 4H59A 4TL6A 2P9TA 4FI3F 4PPGA 4FFRA 2AJCA 1W35A 2ZQ5A 1L7OA 2BFEB 1NXPA 3F98A 4DCVA 5IYZB 5JRZA 4N8DA 4KQMA 3M6XA 4X63A 2H8GA 1CV2A 3JVIA 4F2WA 1LCIA 4F93B 1VCMA 2AZ4A 5CFRA 3FLMA 3PXGA 3E05A 2WAOA 3LT0A 5DISB 1OPXA 4UD2A 3EZYA 1G5FA 1JWBB 2FR0A 4P3KA 3HDHA 1XB2A 5KMGB 3ZZUA 3DS8A 3JWPA 1LY1A 4PN3A 1G4HA 2GARA 2MSWA 3R3HA 3ZDFA 3MPOA 4E5NA 4DANA 1FP4B 5LYJF 5BOSA 1H4VB 4HL6A 2FPGA 2O0JA 4NOKA 2ERXA 2Z2IA 2L42A 1M8FA 3GLSA 4J1TC 4DCTA 4RA6A 4MR9B 1C1DA 4YUXA 1BA3A 3SHOA 2PSJA 2YFKA 3TXYA 1F2TA 2H7CA 3GVCA 2XGOA 2VBFA 3FCOA 3U7QB 1FDWA 4NABA 1HE4A 4N9QA 1WXGA 2OCAA 4Y2SA 4Z4HA 4XD7D 2H7XA 2QS9A 4R2WA 1E1KA 1JQDA 5CCXA 3MMNA 1XA3A 4ZEMA 1XO1A 2H1WA 1FNCA 3A05A 1VLHA 1UWLA 1NMZA 3ZDAA 1E5QA 5AFSA 1GG9A 1M1YE 2QSJA 3BRQA 4TMVA 1DAIA 1QAMA 2ZE7A 1U7DA 3PVSA 4NCBA 2BGTA 3FBWA 4DWVA 3A3OA 4EY7A 2E55A 2JFGA 3R0ZA 4QHTA 1WHSB 1JB1A 4PCUA 4U2BA 2JHPA 1P4AA 4MVJA 3CLSD 4D26A 3BTSA 1SVMA 2IIBA 3DOHA 1LQ2A 4Z0TA 2TMKA 4KFCA 3DB1A 1C5KA 4DHWA 3IVRA 5TF4A 2WD9A 4JC4A 5ER6A 4PLTA 3ZX5A 1I7LA 3GAFA 2X8WA 4U7TB 4DDMA 1TZ2A 2CK3D 1EHYA 4TSKA 3GRUA 3IYLW 1QQTA 2QZJA 3J7TA 3KB6A 2FWRA 1C29B 1JE0A 5G0TA 4LHEA 3AERB 2HF9A 2PKQO 1WP4A 1NJ2A 1EGMB 2COUA 2FP4B 4TROA 2EL9A 4P54A 1GEGA 1E2MA 1N5IA 4C87A 4CLEA 2PEZA 3SHQA 1Q7BA 3LQ1A 2FMTA 1NJFA 1JW9B 1U28A 5EQTA 3OOHA 2EARA 1H0HA 3IAUA 3KUDA 3WIUA 2IU6A 1T8SA 4QEKA 4XJXA 5JASA 2I3GA 2Q2QA 5HF9A 2WWVD 1HFKA 2QRMA 4IJMA 4ARIA 1MJGM 1OC2A 1Z47A 3INNA 5GZ6A 2CHFA 5BURA 2SKEA 3PGKA 3UAXA 3HUUA 1JRLA 4JT2A 1CWUA 3RS4A 2H0RA 3NAGA 4Q47A 2R8ZA 3QVTA 1MA0A 5LA6B 2P7HA 2BUAA 1CNEA 4IHKA 5KTSA 1S96A 1J8VA 2NUTB 1KZ7B 4N8SA 3VH4A 2FZKA 1L7BA 1UZAA 3MS7A 1NASA 3MJHA 2OMKA 1GPJA 4O2LA 3L0IB 4Z49A 3WI7A 1YIDA 3IR6A 3V8RA 5A3VA 2HA0A 2L69A 3BGOS 3ZBUA 1V6SA 4B6OA 1BVRA 5MDHA 2ACWA 2P5SA 4FFSA 3NBKA 1XQXA 1I3CA 1E7MA 5JOQA 4ZARA 3I3OA 5FT9A 3KQTA 1A8UA 2YXLA 1FK8A 1SUWA 2GEUA 3LQRA 4LRTB 1CDDA 2FOIA 3C16C 5K8LA 1F4PA 2A78A 2HA2A 3I3SR 1MP0A 2IPLA 3H9CA 2XCTB 1UPXA 2OOSA 2SHKA 3IDAA 3GJ0A 2HK7A 4CLHA 4F84A 5KKCA 1PK7A 2IELA 4Q3AA 1MXFA 2GYUA 3AUKA 3I28A 1P2UA 3T7RA 1N5JA 1Y7HA 4Z9BA 3AILA 3DXZA 4QSHA 3EH2A 3JQBA 1ZD1A 3ZVMA 1JPJA 2OLKA 4KR0A 2O19A 4IUCS 2Z1MA 1E5XA 1JTEA 4H0CA 1EUCB 2M6KA 3WBKA 2VFAA 4HDSA 3PPIA 5LKRA 1RXIA 3PXAA 3AR2A 1NMSA 3AEKB 2MMCA 1FTSA 1RAHA 3C2QA 5E1DA 5SZHB 3V7UA 5DHPA 5ALGA 1ZGCA 4FHCA 4WZAE 2QRJA 1X94A 4XSGA 5FULA 1PQ4A 5FPYA 5DGTA 2GCGA 3LBIA 1QK3A 3T3NA 2EKBA 4QVIA 4ZYZA 2Z08A 3FYUB 5BO5A 2I3AA 3S8MA 4ENVA 1WWKA 2P9HA 5T4BA 5KHOC 1S4MA 1RHQA 4KNYA 1UMBA 3JZAA 1A9OA 4RADA 5INTA 1YC2A 3O1HB 1CG6A 5KJ1A 1JYSA 2GVZC 3OETA 3OJWA 3GRAA 4J16C 5D3MA 5FNVB 1NR5A 2NADA 5DNYB 3A6PC 4B3JA 4ZCTA 1JBQA 1WEHA 2BGRA 1Y48E 2ZWPA 3TLZA 4YRIA 1MZPA 2QROA 2XUDA 3KOXA 1TECE 4AZSA 4B33A 3GFGA 1DC5A 1J2YA 3B6JA 1K8RA 1T8TA 2OHJA 1IB6A 4HADA 3OM1A 5CVUA 3OOYA 3T5PA 1UC4B 4UDYX 1B8UA 4MGKR 3EVFA 1PNVA 4LYFA 1L9KA 1GZSA 4ARCA 1WQ3A 4JC5A 4CF7A 3GY0A 1QBKC 3KJNA 3SYMA 3ZJ4A 2IKQA 1SXPA 3KSBC 3TXXA 1NJ5A 4BX8A 1PUXA 4Z3DA 5AYVA 3ZKAA 1ZAYA 2JI9A 2YS7A 1T9HA 4IIBA 4RCVA 1M6YA 1TAHA 1ZXBA 3NHZA 4O1IA 4W8OA 5BSUA 2IXDA 5IF9A 5IZCC 5BR8B 3CT6A 3FY4A 2GD1O 3SJZA 2CFIA 2I4OA 3GRFA 4N54A 3G13A 2REQA 3X1WA 3RK4A 3PENA 2UZ3A 4MVJG 1K89A 1NOKA 1SGWA 1YCGA 1YZFA 2IEZA 2JAHA 3SI7A 4MLPA 1AMNA 4WJZA 1ZW1A 2Z2KA 2J5RA 3S8EA 4ZU1X 2QUHA 4AD8A 3T4UA 3UOGA 4IGFA 3RIMA 1WQ1R 1ZIDA 3QI2A 1TMYA 4F71A 2CY0A 3HCWA 1D2HA 3HDQA 3L84A 5D3ZA 3TZLA 2EKZA 2FRXA 2QN1A 2Z5GA 4G6ZA 3I2HA 2PS3A 5EMLA 4CR6A 1I3NA 3WC4A 4EI9A 1M1NA 1QHXA 1G63A 3RM3A 4NE9A 1DINA 1H2WA 3PHCA 3UAZA 4B9EA 1H8EA 1HQYE 2WIGA 1ULAA 2H5LA 4LISA 2V0GA 4G5RA 4PAOA 4U02A 4UBLA 2CLMB 5GOZA 4JUIA 4Z8YA 1BXRB 3VSCA 2EGUA 3CNEA 4AMYA 2PKQP 4KRFA 4W5NA 1DTSA 1TTHA 1RBYA 2C7VA 3GZ4A 3UB4A 4D9EA 4FKBA 4ITUA 4E3WA 3TW6A 4ZYTA 4C0KA 4ZIRB 1XDWA 3BGVA 3V42A 2DCUA 3LH5A 5F2OA 2DFDA 1NF9A 1E2EA 4A8TA 2BCEA 4ZO7A 3ROXA 3BH7A 2IRWA 1K9VF 3CF2A 4RHUA 2XMRA 4KSBA 3I5AA 4Z2AA 1FZQA 1JU4A 2Y66A 3MCTA 3EEQA 5JC8A 3SBOA 2A14A 3L4EA 2ID9A 4K0KB 1NHGA 4HXYA 4C0XA 4NRDA 1NBIA 2UZ1A 3DPIA 4L6AA 3RRXA 4KE7A 3ZY5A 4PPFA 4S1TA 2AHOA 4G1BA 5T4HA 4Q16A 4RZ3A 4IFEA 4BUJA 3M6MD 3RDPA 5DLQC 3C6BA 4D4GA 721PA 4XUEA 3OJLA 3HP4A 1K7EB 4CQMD 3MQFA 1UZNA 2QTMA 3FDFA 4C3ZA 1CIPA 5KSPA 1QZTA 4DF3A 3G9ZA 2OBBA 4A03A 4OQYA 4Z4FA 1K9SA 3DV0A 2AN3A 2ISQA 1W9HA 2GT1A 4LJKA 5T41A 2OEPA 4AO8A 3DEKA 3WYAA 2B6NA 1N4DA 1H9BA 3HB7A 3RTAA 4IICA 2P11A 2B1JA 2XOXA 4OMDA 1X9GA 3TH5A 3ZVRA 1YZTA 4KUHA 1V8BA 4YT2A 3D2AA 2VEOA 5BV2P 3M2PA 3BD7A 4A73A 2F9LA 3B6EA 2INGX 3R09A 4GX5A 4PSKA 4EJSA 1SQSA 1Z26A 2IDKA 1GTL1 1X7XA 2J6IA 3AHIA 5CIYA 3RSLA 1Y42X 1YRWA 3QFCA 5EC8A 5EKDA 4WAUA 3ZD6A 3PT9A 3QFHA 1OFVA 1S8FA 3PDCA 4GZ3A 4GE0A 4FLMA 3TMYA 1T3TA 3TNLA 5BQFA 2QF7A 1WCYA