1EESA

Solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of Cdc42Hs with a peptide derived from P-21 activated kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords GTP-BINDING PROTEIN
total genus 14
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1eesA00
3KXLA 4J0QA 2PLRA 2RH5A 2W0SA 4B43A 1SVKA 1KI6B 2OBNA 3BERA 3FYHA 1MRNA 3WNCA 2IL1A 1L7VC 4DCNA 1EGAA 4EQ6A 2WJIA 2B8TA 2EU8A 4TLBA 2OT3B 1NBMA 1JPNA 3V9PA 1X1RA 1P72A 2QRZA 5DGXA 2WKRA 3MUFA 1HE8B 4GRAA 2XJ4A 3BH7A 1DE0A 1ONBA 1XTJA 1XZQA 3FKQA 2BMFA 4U00A 2ZPTX 2RGAA 3MAAC 1VCNA 2CNWA 5FUVA 3WYGA 5L3VA 4TN1A 4NYMR 4WXPA 4EIWA 1ANKA 2HLDD 1JBKA 2XAUA 1E0AA 5CLLA 1JR3A 2VSFA 4A4DA 1T9HA 1NN5A 2YOHA 1COWA 2VTKA 1CR1A 2OBLA 2FSFA 1G8GA 4QHTA 1NVWQ 4I1OA 2QI9C 1MABA 2ZRFA 4B47A 3TW8B 3DMDA 3QF4A 4ZDWA 4D26A 3EWSA 2GHIA 1JXOA 2J41A 3CRMA 5B30A 2QU8A 2RKOA 2PCLA 3GQBA 3A37A 3P20A 4Z51A 4NDZA 2YC4C 4DVGA 3NWJA 1BS1A 2VHTA 4V0ME 1EK0A 1R5BA 3UMFA 5DSZA 4G5GA 1C9KA 1I4DD 3TUJC 3KKMA 1Q12A 2A5JA 1BH2A 1ZYUA 4TL9A 2IXFA 2V6JA 3LH5A 2DFTA 4II7A 3PENA 1Z22A 1RC8A 3RC3A 5IDVA 3QXXA 5KTYA 3OF5A 4DLRA 2MSDB 2OE2A 4C3ZA 1OXTA 4DEYA 2H7VA 2JEOA 1SULA 1VG8A 2BBWA 3TSZA 3SHWA 3H2YA 5FR2A 1CLUA 5SZKB 5FFMA 1Z6GA 2EWVA 8OHMA 1JR6A 1XTSA 1G5TA 2X77A 3IPXA 3NBFA 3B1ZA 2L0XA 4EKDA 2XXAB 2BBSA 2ZUBA 2GNOA 4LDJA 2BEJA 3PUWA 1G41A 1YVDA 3W6OA 1Y63A 3B6EA 1U2RA 3WNDA 2PX3A 3MLEA 3OIYA 4IOLA 4M8NE 4C0LA 4YDSA 3WY9A 2PEYA 3THXA 5FOXA 3A58B 3TE6A 2VH5R 3LXRA 4DLXA 3IHWA 2WPDD 5TXGA 2V1UA 1ZCAA 2ORVA 3OESA 3RSOA 3KKPA 3CR8A 5KOYA 5D3MA 3K53A 2C04A 3FHCB 5FL7A 3OEEA 2UKDA 2AXNA 2IYZA 3HR8A 4WA7A 3ZVLA 1BMFA 5P21A 3LX5A 4G5RA 4OQMA 4CYMA 2UZ3A 3TKLA 1GAJA 2A30A 3G82C 2BMEA 1XMSA 4X8LA 5KU1A 2ERXA 3I4LA 4TL7A 4E03A 5HPYB 4XOIA 4OK6A 5JWRA 1IJFA 2FGKA 3TVDA 2D4HA 4BFZA 4LYAA 4Z1MA 3NC1C 3B82A 4MKIA 2IEYA 3M0EA 4B3DA 2IYXA 3L2OB 5JSZA 5CK4A 2H1LA 5H68A 1XJ0A 2ODEA 3AVPA 1E2IA 2QY9A 4HAZA 5CDFE 4F4CA 4Q47A 2BMJA 2OFXA 2YKGA 2AD5A 3KKNA 1ZUIA 3QUSA 4LHXA 3NIBA 2ZYTX 3CX6A 4ZIRA 4DZZA 3K9HA 1P4SA 1OFTA 1KDRA 3GJ6A 1XDBA 2ZI3A 1OSNA 4NMMA 2IUSA 4QG7A 3QIAA 1G18A 4RZ3A 2BVNA 3LA6A 4Q9IA 2AHOA 3QKTA 4V0MA 3NEJA 1VPLA 2FPLA 1W48A 3BB3A 4WZAE 5F2EA 2ZU0C 1D2MA 5ANRB 2ZR9A 4N0DA 3FHOA 1AGPA 4JT2A 4JIMA 1JQJC 1N6HA 4ZCIA 4MRRA 2ZAOA 5DISB 3BIFA 2PMKA 3C15C 3CONA 4ASUD 3KJIA 3GLFA 1CJKC 2C9CA 3BBPA 3MG9A 1ODFA 1M34E 4DDUA 1OIVA 1YRBA 4A8JB 1PLJA 1W4CA 2XTNA 4PAQA 1ZINA 3WRXC 5ELXA 2AXPA 4GP6A 4TYWA 1G6HA 4DCTA 5LBIA 1U94A 2HXYA 2YWGA 4ZO4A 3KKOA 5J4HA 4L9WA 4FIDA 1OXVA 5FR1A 2IUUA 3A1WA 1OXSC 1Z0DA 3DZ8A 2NTYC 2BIFA 1KI2A 3HU3A 3UMSA 5CITA 5AUOB 1NVUQ 1U0JA 5EE5B 1Q22A 1F2TA 3CPEA 1LB1B 2ZJBA 2FSIA 3LVRE 3IDQA 3B1YA 4R98A 1E9SA 2DR3A 1EFHA 2J3EA 2QT0A 4PSAA 4Q7MB 4QNRA 5C1BA 4A36A 5JJKA 1DAMA 2PT5A 2EFCB 4HAWA 3KJEA 5E7MA 4PZLA 4A0RA 3WMEA 4IHQA 4C0KA 3KB2A 4OHWA 4AURA 1VIAA 4RD2A 2QMUA 1ELOA 3FFAA 3TVTA 1ZMXA 5L3QA 3RC8A 2NGRA 1AZTA 4HAXA 4ESHA 2O8EB 3JVVA 4BLRA 4TQ9A 3QQ5A 4HLUC 2HCJB 4DT1B 3ZD7A 5L3RA 4BLTA 1XTRA 1VIYA 4M22A 2ZE6A 5BQ5A 1OIXA 3E2IA 2YYZA 2ZE5A 1EFUA 1KO7A 4D0GA 3U3RA 4C7OB 3VNVA 2PBRA 1Z0FA 4XVRA 2CL7X 1NKSA 1UKVY 2DFKB 1R6BX 1RRCA 2GETA 1JEDA 4QM7A 3DO6A 1GVNB 1WE2A 2WBLC 2ZSBA 2OG2A 3CF0A 3CPJB 4Y0VA 4Q4JB 3D31A 1F2UB 5GADl 3BD9A 1GTVA 1LVGA 821PA 1MO6A 3OIWA 4DHEA 2JJ1D 2ZSEA 3OZXA 2IW3A 3H84A 2E87A 2DY1A 3FKSA 1E2DA 1KJWA 4URVR 4QFMA 1RFLA 2FEOA 1G6OA 2QE7D 4CT4B 1UDXA 1TF5A 2BKEA 1A7JA 3W9YA 5CB8A 5DYIA 2VHUA 1NRJB 3H86A 4A1FA 3NH6A 1NMZA 5AJXA 4ON9A 1AK2A 4LHYA 1D2NA 1S96A 3P26A 1AQUA 2CEAA 3QY0A 2V8OA 2ZIAA 2C98A 3TSOA 2BBTA 2WICA 3HP1A 2WWFA 3CM0A 2RHDA 2YOGA 3NKVA 1OFUX 2VA8A 1UBCA 2XOKA 4Q19A 3CX7A 4QNMA 2XX3A 5TB5A 1U8YA 4L5BA 4IW3B 3GLGE 1EFTA 1JECA 2B7BA 5JFGA 2QM8A 3NC0C 1OJLA 2QMHA 1HUQA 3PUYA 4LJYA 3FMPB 1G8PA 5EE9A 1HT2E 3AP3A 4X8OA 1N5KA 1ZVQA 2ZYUX 1M74A 4QBHA 4KSCA 2RGBA 1V43A 5BN3A 3B7GA 4IXNA 2DCUA 5EXXA 2QBYA 2A3RA 3U44B 3NG1A 3A36A 1X8KA 4LJAA 5C4MA 3ZH9B 2F1IA 1K6MA 4C0BA 3U7HB 4TMXA 4D4LA 2OCAA 4B35A 4FMDB 2ZR0A 3R9XA 4QKQA 1JAHA 3B9QA 3NXSA 4M1YA 4XVQA 4Y0AA 1IBRA 3QNUA 2R44A 4DLTA 1IN8A 2ODBA 4Q4AA 3O8BA 5DI9A 1YHNA 1COWD 2ZI9A 1KK1A 4QGGA 2FA9A 2FFAA 2X2FA 2O8BB 3B8HA 3T12A 4U02A 3P27A 2O8CB 4FWTA 2YWFA 1E2FA 2IYQA 3DKVA 4IEIA 1X3SA 1DVRA 4EQ6B 2QSZA 2J0QA 3T15A 1GITA 1PVOA 3QG5A 5FOVA 1XEFA 2HT6A 3PVSA 4TLCA 2ZRKA 3ZVNA 4GP7A 3W8NA 4RFVA 1TU3A 5EP2A 3CF6R 4BFUA 1NIPA 4HSEA 1ZRHA 4M1WA 3GJ5A 2W6JD 2ATXA 2YZ2A 3X1XA 1CF4A 3HU2A 4XD7D 4A2PA 4G5OA 2OFOA 2PJRA 2IA5A 4PANA 4TT3D 2G9NA 2CE2X 1NSFA 2QTFA 2XTMA 5H8WA 2IS2A 5JLJA 4WBSA 4P4UA 1JR3D 4JL6A 2Y8EA 1ZNYA 1T3HA 1GNQA 1G7RA 2OESA 1G64A 4ACAA 4H1UA 2Z6VA 2ZSDA 4HB4A 5EXSA 1T0JB 5KNCA 2CCKA 2F3TA 2V6IA 2X2EA 4RD3A 3BORA 3T5DA 4CEJA 2R6DA 4LBZA 4Q01A 4ITRC 2I3BA 3TK1A 5BW8A 3RWMB 2ZYWX 3EIEA 4MRSA 1XD9A 1II9A 3LBHA 2Q6TA 5KDDA 3KXKA 4KAXA 1W0JA 4I1VA 4HDCA 3GEIA 4OBEA 4R2HA 1KHTA 3GMTA 4B3CA 3U44A 3QBVA 3DM5A 2ZETA 4LY6A 5JI3E 4E09A 1X1SA 1GDDA 4RKFA 2BDTA 4BRWA 4QJ3A 5EQTA 4PC3A 2EVWX 1OH5A 1II8A 2FWRA 3GLIA 5DI3B 2J5XA 3THYA 4Q1CA 5L3QB 1S9DA 2CL0X 2XITA 2WJGA 3CWZA 2D74A 4OKSA 2A5YB 2F1RA 2QZ4A 2YV5A 1SGWA 2XZOA 2F1JA 2QPAA 2GF9A 2O5VA 3AF0A 2JLVA 3AVYA 3CNOA 1YZNA 3OE7A 2NQ2C 1E9RA 4TTRA 2QORA 2VP6A 3ZIAA 4UJ3A 2V9PA 2HJVA 2NO1A 1Q3HA 4RZ2A 1IN6A 4TLDA 4MUAA 5DYGA 1J7KA 3K70C 1TUEA 3THOA 3GJ3A 3SBDA 1YZQA 2OLJA 5FBQB 4XWAA 4QXAA 4DDWA 3I72A 2UVQA 1G9XA 5FL7D 3EZ2A 4GOJA 4M21A 5LPNA 3QPUA 4A0GA 1TF7A 5KYKA 4OHXA 4GOXA 1P73A 4GL2A 4P3YA 2Q3HA 2QBYB 1CTQA 4BLQA 4W5HA 1HQYE 3JZAA 5DE3A 1P2VA 3OEED 2FJUA 4IFEA 4HAVA 2CBZA 4MKGA 2PX0A 3R9IA 1FPMA 1WCV1 3LQRA 1ZM3A 3C7KA 4MGYR 1L4UA 2MSCB 4BZQA 3ADCA 3K70D 2EWWA 4PHGA 2F1HA 4B3BA 3ZIAD 2QTHA 2OUKA 1XZPA 1GILA 3MSXA 1G17A 3QEOA 3B1VA 4GZLA 3UWKA 4EPVA 5F9FA 3K0CA 3GP8A 3EPJA 3U7FB 2ZQ5A 1E2KA 1G1MA 3DMNA 3N70A 1Q21A 2ZROA 2JLXA 1ZD1A 4TLAA 4DSOA 1ZD9A 5CM9C 4M53A 4FW9A 4G01B 4Q1DA 2J7PA 3B78A 3FHTA 2C03A 4BE7B 3WP0A 3KX2A 4NE2A 4DIDA 3X2SA 4F91B 2XSZA 1U98A 1LY1A 1Z2CA 2GJ8A 2IF2A 2GJKA 3SJAA 2W2XA 5JHGB 5JRJA 1FNMA 2WOJA 4HYYA 4B3GA 2CVHA 5KPJA 3F5FA 1DADA 3LW7A 3TSWA 5AUPB 2HUPA 1A1VA 4LRWA 1R5NA 1W4RA 2WWWA 1Q44A 1SHKA 1QZXA 1T91A 4LJ5A 1J8YF 1N6RA 2RGEA 2YJTD 1P75A 2JLZA 4WOPA 4QM6A 1N0VC 3U7GA 3ZJYA 3PXGA 4JL8A 4ILEA 4IOKA 2R6FA 4D6PA 1NBME 4JLPA 4NZYA 1VHLA 2G0NA 1ZP6A 3SJZA 1IHUA 3MWJA 3TR5A 1QHSA 3MCAA 2Q3MA 3O47A 3W6PA 4B2PA 2JJ2A 3IBYA 1W0JD 3QKSA 5FTNA 4YC7A 3DZDA 3EZ7A 2D06A 4QBFA 2ZRIA 5FTKA 3OEHD 2CNWD 2JDIA 3IIKA 2GXUA 1N5LA 3KTAA 4QGHA 5DHFA 4DBLC 4H9GA 3GEHA 1SVIA 1JPJA 1W0KA 3BGWA 1DELA 1JQLB 3SJCA 3QPWA 4A15A 1XTKA 1WDTA 1LFDB 2IK8A 4NYJR 2V4ZA 2BHRA 1HE1C 2AWOA 1DG1G 3K0SA 1SVSA 3FPAA 2V3CC 2G88A 1E94E 2GCOA 3HDTA 3IHLA 3RRMA 4ZCMA 1FMJA 1IY1A 2H57A 3U3OA 2QQEA 4HDOB 2WWGA 2IYWA 3WBJA 4C2TA 1J99A 3AKYA 1Z08A 3GLFB 3WHKA 4F93B 1NJGA 4BLOA 1U0HC 5FUXA 1DOAA 3BE4A 1P3JA 1U0LA 4K81B 1OH8A 3NDPA 2N42A 3I92A 3AVWA 3OIVA 2QM7A 3GJ0A 1A2KC 1S8FA 5JI2E 4IDNA 3WBKA 3U2QA 5AUNB 4B48A 4HAYA 4MYUA 2ZRPA 1XJQA 621PA 1ZUHA 3QE0A 5A5GA 4I1SA 1W47A 3RVBA 4WZBE 3PUZA 4OYHA 1AN0A 3SDZA 2QT1A 2ODNA 3RNLA 5TY0A 1CKEA 3BS4A 4CVNA 1Z0IA 1XD8A 4Q1FA 4QHSA 4ACBA 1CIPA 1XD2A 1SXJB 2ZRJA 4TYNA 4MYCA 3EZ6A 3DL0A 4FMCB 4V02A 2ZJAA 5JCZA 4LPSA 4TYQA 4G5SA 3PQCA 1WRBA 1AKYA 1UM8A 5H70A 5C46F 1Z3IX 3K8YA 1HA3A 4XSHA 5BWMA 3ETLA 5HZKA 2IYTA 4C0HA 1I2MA 2RGNA 3ZZUA 5KPDA 5DLQC 1GRQA 3SR0A 2R6AA 1M6NA 4FI3C 3RS7A 2CHQA 4LK2A 4ESVA 3F0TA 2GXSA 2O0JA 1VCIA 2GCNA 2HCBA 1R8SA 3SHFA 1EFRD 4FXPA 3I5XA 5B2ZA 1CRQA 1PUIA 2RGNC 2XXAA 1RRGA 3JZMA 2W83A 4S35A 1VHTA 2AFHE 2XOKD 2ZXUA 3IILA 1TNDA 1NI3A 4Q9HA 3GCGA 1G21E 1JEEA 2QP4A 1F48A 4NCNA 1HT1E 2FDCA 1NN0A 5EE3A 3L82B 1KO8A 1QG2A 4MKHA 5SZHB 4Q4LA 4YLGA 4BZXA 5UKDA 1Q1BA 2FG5A 2EQBA 3AGQA 2ZRHA 1OF1A 1UKYA 3GJXC 3TJZA 4BEBA 1OHHD 3FWYA 3LO5A 1H65A 3BOSA 2JJ2D 3IGFA 3Q8XB 4BFYA 3RAPR 3WYFA 2VSXA 1G20E 4B3FX 2OM2A 1M8PA 1NIJA 4FMDF 4D25A 1AS2A 1W2HA 3B9PA 4ERNA 1XWIA 3OAAA 1N0WA 4FMBB 4GDFA 1W5TA 121PA 3Q9LA 4BFXA 2Z83A 5KNDA 3WRYC 1HURA 4TL6A 2JLYA 4O3MA 1K5DA 1UF9A 2GA8A 2ZS8A 1TEXA 1NN3A 2QRNA 3HPQA 4GMDA 4P0TA 4BLPA 5CDFA 2QPOA 4A8JA 1ZW6A 2QAGC 4ZKDA 5CIWA 2BJVA 3QF4B 1SVWA 1LS6A 1NN1A 2JLRA 3UIEA 2VHCA 3PV0A 2B7CA 4BFVA 2Z4RA 5L8VA 4JJKA 3GLGA 4C9BA 4M1OA 1NMYA 4LV6A 4TWZA 3B85A 1LNZA 1OPXA 3QBTA 5EXPA 4C0SA 4IDOA 2UZIR 1GM5A 3EA0A 4MGZR 1O3YA 3I73A 2XNDA 1M7BA 1FP6A 3QXSA 1X6VA 3AF1A 3BH0A 4OJKA 4QJ5A 2C77A 1NF3A 2WJJA 2OFWA 2C9OA 4CEHA 4IDQA 521PA 4F4JA 4B6FA 3DHWC 1CP2A 1CULC 4EJSB 2ATVA 4FD2A 1KDOA 4NBSA 1E2LA 4PQRA 5CB6A 2DYKA 1Q1ZA 4LYFA 3GLHE 1KMQA 1DARA 4P32A 3AUXA 3W8RA 2GK6A 2ODWA 4HATA 4DLSA 2HEIA 3MGCA 2WWHA 4DLYA 1TL7C 1ZNWA 5GJBA 2O8FA 3MJHA 3VFDA 1KI6A 1MRSA 3R20A 4EAQA 3CW2A 3M6AA 4LZZA 1YRAA 3B2EA 4L15A 4XWKA 2BBOA 3VAAA 1N6LA 1YZKA 4ZIRB 1CBUA 4DSUA 1G4UR 3AKEA 2JDID 2ERYA 3CZPA 4MH0R 1GWNA 2SHKA 3SU8A 2JLSA 2KSQA 1QHXA 2H8KA 1UBGA 3CR7A 2BCJQ 1EWRA 1RYHA 4JS0A 1XB2A 2IYUA 4XTRA 2CDNA 3RRYA 1XD2B 3H1TA 3L0SA 2G1KA 4PX9A 1P9RA 2QMOA 1OHHA 3GD7A 3CNNA 1HEIA 3PJRA 1IN5A 4AD8A 1YZUA 2ZVPX 4M0LA 1ZBDA 2VQSA 3FGNA 1E79D 2OCBA 4EPRA 3X1WA 4JVNA 2X1VA 3GFPA 2ZRMA 3AVOA 4O2RA 2ZYVX 1K5GA 2ZI7A 1YZLA 4U5XA 5FBWB 1D9XA 3QSYA 1X8JA 2BWJA 1ZC3A 1GSIA 2FSHA 1NNEA 3U6KA 1P61B 2RGGA 2VRWA 3AUYA 2OAP1 3L0PA 2GESA 5D3MB 2EFGA 4KLNA 5JHHB 4N0EA 1AS3A 1N5JA 3BWDD 3PR1A 3DOFA 4CRWB 4TTPA 5EUQB 1KY2A 1TMKA 1ZD8A 3ZYCA 1K8RA 5HCNA 1GP2A 5C2JB 1MR3F 2RMKA 4C4PA 3OFND 2QUZA 5K8TA 1PLLA 3HYTA 2KB0A 4IJMA 3DDCA 1W7AA 1F2UA 1FX0B 2HXSA 2RAPA 1A5TA 2Q0HA 1WQ1R 3FMFA 1MT0A 5GVSA 3AF3A 4S2EA 1M2OB 2CLCX 2WHXA 3LNCA 4LYHA 4XH9B 4PTLA 1W36D 3GJ4A 1YU9A 4HB2A 1RVDA 2VHQA 4UQOA 3GJ7A 4TSFD 3U61B 1D2EA 5FBRB 2WM9B 4KHZA 5M04A 5KNBA 2C99A 2IEZA 1R8QA 4DCUA 2PEZA 4IEEA 5J4YA 1CJMA 2DFLA 3EC2A 3NHAA 2ZRAA 1T8TA 2DWPA 3HPRA 3PUVA 3NBYC 1KY3A 3LD9A 1HQCA 4EPTA 1UFQA 4OHZA 3WMFA 3ZVMA 2NO7A 3HJNA 3HU1A 4NHOA 4AKEA 4OQLA 3I1FA 1FW6A 4RFSA 3FVQA 3VKWA 3MFYA 1E2QA 1US8A 2NZ8A 2VP5A 2FF7A 2WSSA 1M7HA 3BFKA 1F5NA 3CKLA 3P32A 2IYVA 2JCSA 4RD6A 1H8ED 4NCIA 5KHOC 4G3XA 3VR2A 4WW0A 1W1WA 4O25A 4PAMA 3LV8A 2AD1A 4TZ0A 3TRFA 1VCOA 1RZ3A 2PH1A 3N2IA 2Z5FA 3PUXA 4KU4A 1QRAA 3CH5A 4KFSA 5DN6A 4MDEA 4TZ6A 4KI0A 1O87A 2G6BA 4B71A 3U6BA 5JJLA 2ZSFA 2ZE8A 3X1YA 3GLFE 1IOZA 4AKGA 4CF7A 1E2MA 1E99A 4Q1BA 4RY2A 3NH9A 4UNPA 2ZS9A 1Q1EA 2VSOA 2WSMA 5CK5A 3ZS9A 3QKSB 2EW1A 2GAAA 3VTKA 1TU4A 4JKYA 1GOTA 4Q4HA 1N0UA 2WTUA 2X19A 3HYRA 1UEIA 1QG4A 3SC3A 4B6EA 1T3LA 1L8QA 3ZGXA 4XJXA 4GPTA 4DJTA 4WVFA 4Q1AA 3I5YA 1E4VA 2O8DB 1OFIA 1UBFA 3VKHA 2W6IA 3L8YA 4KJZA 3AGPA 5EP4A 4V0NA 3THYB 2VP0A 1G8FA 1NY5A 5AR1A 5JS8A 3BK7A 3K0CC 1P2UA 4WZ6A 3T61A 4QOSA 3K0FB 3X1ZA 2QPTA 4I4LA 1KK2A 1W5SA 2VF8A 5HE8A 4D2IA 2GVZC 1XBTA 4H1VA 5EE0A 4OQFA 1YKSA 5JEEA 3G5UA 2CLDX 4IDHA 3PEUA 1NMXA 1OYWA 3C14C 3D6TB 1PJRA 1XF9A 5L3SB 2GJSA 3GJ8A 2IF0A 3ND9A 4D0NA 4AG5A 1HH4A 4LBVA 4HUQB 1U8ZA 2BCGY 4MYTA 1FFHA 5FUYA 4OI1A 1RIFA 4JYBA 3T06B 4LV8B 3A1VA 3GLIE 1E2HA 1YE8A 4DXAA 4JT4A 4BQSA 2F55A 1SXJD 5J47A 4EDHA 1N6IA 1BMFD 1TPZA 4QJ4A 4Q66C 3EPHA 2C2HA 1E98A 4GOKA 4PPFA 2GEDA 1QHGA 2ORIA 3TIFA 2GZHA 3KDSE 3VNUA 2R9VA 1PUJA 1OLOA 2WV9A 4LX0A 2B21A 3REGA 5EP3A 2P2LA 2V7QA 1UBEA 3ICQB 1Z83A 2BEKA 4TYPA 1WBDA 2Z4SA 4Q1EA 2GWHA 5DIFA 4BLSA 5TMPA 4PHTA 2YNMA 1CEEA 4OK3A 3V4RA 4AG6A 1P5ZB 2D7CA 4DWJA 4PHHA 1MV5A 4JKIA 5GJWC 1FMLA 2P0EA 2IYLD 2KBEA 2KE5A 4RD0A 3KQLA 2D7DA 1EFRA 2QMEA 2F43A 1EWQA 3BRWD 2P6NA 3A4MA 1E0KA 3O8DA 2IUTA 4KODA 1EFCA 4BZPA 1JB1A 1DS6A 2WAYA 2MMCA 2YWHA 3AV0B 2A5GA 1Z5ZA 4L16A 5G41A 1GIAA 2J0UA 4NYIR 2XTZA 2N46A 4HLCA 4IVPA 1D6JA 1GG2A 2P65A 4Q5IA 3OFNA 5B64A 3ICEA 4BFTA 1G3IA 1GRNA 2MSEB 3IKJA 2AX4A 1G4AE 1W44A 1DAHA 1P62B 1XFAA 2WIAA 2WMNB 4IVRA 1HTWA 4CGZA 4XSGA 2Q21A 4Q48A 1KI9A 3K9NA 4B75A 1IONA 3O8CA 4XTCS 3K9GA 3QXJA 4JSTA 2JA1A 2HF9A 1L2TA 4DC9A 4P4TA 4W9MC 2IXEA 1EXMA 2QA5A 2QQ0A 3BJIC 3CWQA 3IEUA 1J90A 1I2DA 3CRRA 4PPGA 4QC2A 3UKDA 4EPWA 3ZQJA 1ZIOA 4TSFA 1M1YE 1N6KA 4ZPXA 3ZQ6A 1A82A 4Q7LA 4NU0A 3GLHA 1E4YA 3J81k 3WP1B 3PEVA 1MO3A 5J40A 3R7WA 1MOZA 2OZEA 2R62A 4DSTA 3WNBA 1EESA 5HKKD 3KUCA 1KO5A 2ZUDA 3AVUA 1NLYA 3ZD6A 4JLVA 4M9ZA 1E9CA 1IM2A 1A2BA 1R5OA 4HEJA 2Z0MA 4LSGA 1VECA 4DDVA 1YJ5A 5LDDC 3FMOB 1US8B 3MWLA 1N6PA 4LJ9A 3IO5A 3TUZC 1UAAA 3CB4A 4O0MA 5DO9A 4XD7A 2QP9X 1VCMA 1MKYA 4JLAA 1E3MA 4IVQA 1E9FA 4YXWA 3M4YA 2YOFA 4IDPA 2DB3A 1XCGB 3GLIB 3NDBB 3LXXA 4JSYA 1BYIA 2NO0A 4PQFA 1QVAA 4LGMA 1XPUA 1KI1A 1DTSA 1Q1QA 1WF3A 4HUTA 5AJVB 2GF0A 3VHLB 5A0FA 1XEXA 2ZU6A 2R2AA 2WKPA 5FPYA 4B3XA 2W2VA 3QEJA 1VMAA 3N5CA 4Z8YA 3B13B 3ZDQA 5KUTA 3RSLA 1WA5A 1FP7A 5J4KA 4F38A 1RW4A 3KQNA 5JECA 1T5IA 4GNKA 4RJLA 3OEHA 2Z43A 1RKBA 2ZE7A 3VHXA 4C0AC 2NO6A 2X8AA 4B32A 3SNHA 5HZHA 4FCWA 3T1TA 3A6PC 4NONA 2AR7A 2ZRDA 1SXJC 1II8B 2JIZA 4ZDKA 2ANCA 2ZRLA 5F9HA 4JLOA 5JZVA 2WWXA 4TMTA 1EG7A 1ZM9A 1E69A 3ZZ0A 3GFTA 4Z8XA 1U9IA 4PSKA 2EYUA 1KIMA 3EAQA 3DEFA 2DFNA 4JZKA 2OILA 1PZNA 4M1TA 4PZZA 4KITB 2R8RA 1OIWA 3ECCA 3C5CA 4DB4A 5K8UA 3AVTA 3V4FA 2QSYA 2NIPA 1PV4A 2FN4A 3TR0A 3KQUA 1FTNA 5K8IA 1J2JA 1Z29A 2OXCA 2CLSA 2ZRBA 3AF2A 5LD2C 3IQXA 3TNFA 4Q7JB 4URYR 4JLNA 1KNQA 4US2R 2J9RA 3T1OA 4FWIB 2HF8A 2YINC 2QEQA 2WOOA 1CR4A 4XWOA 2Q3FA 1GKUB 3LY5A 1DBSA 1T0HB 4MQBA 4D81A 4BRUA 2A5DA 3EZFA 1SKQA 2WVJA 3QKRB 3AVVA 3CIOA 4RSGA 3FB4A 1SXJE 1OV4A 2C9YA 2CHGA 2GRJA 4CT5A 2ZREA 2GEUA 2GKSA 3FKSD 1L4YA 5E4FA 3LBIA 5KDOA 2F7SA 4JMPA 3RWOA 1TQ6A 3IUYA 2W6JA 4C30A 2O8DA 3JVUA 1ZUNB 4JBXA 4Q9LA 4BPBA 3UG7A 2JGNA 1FQKA 1JXMA 3A1UA 1OXXK 1RJ9B 1Z6XA 2ZITA 3T1QA 3C4JA 1U99A 2ONKA 3CRQA 5JRZA 1I4LD 2VL7A 1FL9A 2GCOB 4LJ6A 3QOFA 3SEAA 3WMGA 2QGNA 2OBMA 4M9SA 2NO9A 4Z54A 4HLUA 4K46A 3BH6A 4PO1A 4GMXA 3UANA 4I99A 3CUEF 1DAEA 1XU4A 2C5LA 3MRSA 1SVOA 4IKEA 3GLHB 5G3YA 2CJWB 3RS5A 2XNSA 5EE1A 1CU1A 4A92A 1KO4A 1G3QA 1ZNXA 4LHWA 2ZAMA 2ZJ2A 2HT1A 2CMKA 5CJ2A 5BXQC 4Q18A 4BFSA 5C4GB 1AM4D 1FTSA 3AEZA 4R7ZA 1OB2A 1C1YA 2J87A 4E07A 4AI6A 4RFSB 1S3GA 1U8AA 3KKQA 2PJZA 2F9LA 4B73A 1T6NA 2WJVA 2H17A 3T35A 3UK6A 3UWOA 2VP4A 4EJSC 4YONB 4PSVA 2ZVQX 3TW4A 2F6RA 4CEHB 1AGRA 2ZJZA 4YMWA 4EFNA 2W0MA 4LUCA 3EA5A 2WZQA 1T8UA 3F3YA 3SZRA 3M1IA 1OXUA 2O8EA 5JS7A 2G1JA 4JVMA 5JMTA 1TEVA 3R7WB 4HLQB 4EFLA 4MKFA 4UNQA 5H1YA 1GUAA 4TMWA 1OKKD 3BB1A 4OJQA 1W36C 2ZEJA 4DEXA 1UKZA 2DPXA 1V5WA 2CHVA 2NOAA 4W7SA 3ADKA 1WB9A 5JJIA 2W00A 4M1SA 3HWSA 2FZ4A 1KAGA 1AS0A 1W4AA 2OHFA 4RD4A 4GFDA 4AYXA 1QVRA 3I61A 3U3KA 3SQWA 2J0SA 3B1WA 2QROA 3CPHA 4Q7KA 2GJ9A 4NCHA 4LV5B 1KI4A 5FOUA 4P33A 1YR9A 1KAOA 1SHZA 3ADBA 3C41J 1G8YA 1CJUC 1T3SA 3AB3A 2VO1A 4JVLA 4PC7A 4LJ8A 2OXRA 4L9SA 2QAJA 1MO5A 3ASZA 4V03A 4WXRA 2KJQA 5FBVB 4JBWA 1SQ5A 3Q5DA 1E2PA 4NKRA 3P4XA 2YC2C 2BKUA 5SZJA 1IQPA 3KB1A 5KSOA 3THWA 3UATA 3PEYA 2MMGA 2IYSA 1KJYA 3A8TA 3KJGA 4LOAA 3SYKA 4DKXA 3RLFA 4LC1A 4PO9A 4KSBA 2IWRA 3DKPA 4LHVA 1Z8FA 3S1AA 1FNNA 1IY0A 2NG1A 4UJ5A 2GJAA 2PZFA 1KGDA 5G53C 1UKEA 5DNYB 4Z1MD 3FE2A 2H16A 2P5SA 1YZTA 1CXZA 3P1JA 3EXAA 5IT5A 4D82A 1Z0JA 1SXJA 1LTQA 4P4SA 2WWIA 5K8LA 4MRPA 4Q00A 1XNJA 3I8XA 3QKUA 2P6RA 4B76A 4KVGA 1F2TB 3K0AB 5HE9A 1NVVQ 4URUR 4C0QC 5HTKA 5FOWA 3VKGA 2OAQ1 2QE7A 1XMVA 1UJ2A 3SBEA 2HV8A 4POAA 2BJWA 4PAOA 2PMDA 3V00A 3SQXA 421PA 4CW7A 1ZNZA 2FFBA 2ONJA 1IAQA 4CEIB 1E9EA 2FSGA 3U4QA 3EIHA 3MWYW 1Y3AA 4CEJB 4EFMA 1KTVA 3VX4A 3DVLA 4I81A 1G8HA 2FPKA 4HAUA 4L8GA 2D2FA 3K0FA 3VR5A 1FQJA 3QXHA 1RPZA 2DWQA 2VYFA 1QF9A 4LBWA 2A5FA 3BFXA 5FI1B 3BC1A 3QVVA 1OYYA 721PA 5IK2A 2RHMA 4Q9KA 1NY6A 1P60A 1WMSA 4KV9A 4LC0A 1EX6A 4Q03A 1CJTC 5DHAA 5EXTA 5HCIA 2ORWA 2EFDB 4BGDA 1GKIA 2REBA 3TAUA 1N6OA 4NH0A 2XB4A 3GPLA 5B57C 3W5JA 4NYIQ 4DLWA 3LW8A 1SZPA 4UXIA 2IWHA 4D4JA 1GL9B 5FH9A 1Z2AA 4A82A 3RS2A 3LVQE 5KSYA 1KDTA 3K09A 1XRJA 1VDZA 4M4SA 4NP6A 4CZ2A 1JNYA 2KBFA 1E1QD 3CBQA 2FE4A 1IN4A 1UPTA 5AK0A 2AK3A 2HLDA 1XEWX 4MRNA 2AKAB 2ECKA 5C18A 2WSSD 3WYAA 3IIJA 2B8WA 4HZUB 5BN4A 4QBIA 1R0WA 2GAOA 5FTMA 1SVMA 3VMFA 4ZV4A 5AJZA 5CJPA 4AC9A 2QTVB 1GRRA 4ZI2A 1R0ZA 2IS4A 1E0JA 5J4LA 4MGKR 1DPFA 1P9NA 1FUUA 3D7MA 2VLIA 1F3OA 2HYIC 5IF9A 4PHFA 2PL3A 3AH8A 3FDIA 1IXZA 1KZ7B 4PFSA 3W90A 3CX8A 4KO8A 3AP2A 2LKDA 5BYJA 3RABA 1NG9A 3MJRA 3PCRB 4Q4HB 2YVUA 2RB4A 2ZJOA 3RANA 1A4RA 2C96A 2ZRCA 1XXHE 3GEEA 3OIUA 4TQAA 1Z0KA 1II0A 3CF2A 2JLUA 1TQ4A 2V54A 5CIQA 1P6XA 2WJHA 2XJ9A 3EARA 4OI0A 1E32A 1OB5A 2FV8A 2ZJ5A 2QL6A 4FINA 4KBGA 1GNPA 5DI3A 1KNXA 2C8VA 4I1UA 3TUIC 3UXMA 2KI5A 4B2LA 1E79A 3QXCA 4Q4AB 4DSNA 3CH4B 2RGDA 3LRPA 5HR5A 2C95A 2EYQA 1DG3A 1RYFA 4LBYA 3IPYA 5KSZA 1NLFA 2A78A 1P7CA 2C78A 5EZ6B 1ZAKA 3U3JA 4KXFB 5LD2B 3WHLA 2HJGA 2ZRGA 3THXB 2GBLA 1TX4B 2FH5B 1ZC4A 2D62A 1N6NA 1RRFA 3FMIA 3R8FA 3PITA 2GTPA 2G83A 4A9AA 1G16A 1E6CA 2ZI5A 4MUBA 4HI0E 4PXAA 4WIAA 4A6XA 2TMKA 4JL5A 2BMDA 2FX3A 3DM9B 3EG5A 1NVXQ 5JWHA 5E7JA 3B60A 2JJ1A 1G3RA 2F3RA 2CL6X 4IFBA 3AP1A 2JASA 2ZI6A 3U3MA 2GEVA 1QHHA 4EPYA 2ZR7A 1DAKA 2OLKA 1W2GA 2REOA 4IXMA 5JEDA 2V55B 4OI2A 2J0VA 5FTJA 3U60B 3EASA 3GFOA 3L8ZA 3EWAA 3THWB 6Q21A 2JJ8A 2VP2A 3TGPA 2QNRA 1R7RA 2OEPA 4QGAA 1XTQA 5FOTA 1E9DA 2AL7A 1CRPA 3DOEA 2O0HA 3ZLJA 3LLMA 5EZ5A 5FOSA 3O8RA 2O8FB 1KYIA 4GBMA 4X8MA 4YDHB 4BUJA 3G0HA 4JYCA 3EC1A 4KVAA 2ZSAA 1Z47A 3QVUA 1AKEA 3QKRA 1D9ZA 2PZEA 4MGIR 2IYRA 1TTTA 1TQDA 1ZM4A 3AVXA 3TLXA 1MO4A 2HYDA 3OHMA 4A8JC 1G7CA 1E2JA 4Q4JA 3QENA 2CCGA 3W6NA 1UADA 3VR6A 1FX0A 4V0LA 1T4GA 2J7KA 4RZUA 4MYHA 3EIQA 2RCNA 4N1AA 1E1QA 3SI7A 5E3HA 4FN5A 5DH9A 4AY2A 2WAXA 3AVQA 4PC6A 4R71A 5CYOA 4TMKA 2FZLA 4NPHA 2P3SA 2H5EA 2IT1A 4IOMA 2WKQA 1KK3A 2WIBA 5G3ZA 1OW3B 2KWIA 4TMVA 4EUNA 2ANBA 2RGXA 2H92A 3RS4A 1LV7A 2FGJA 3LFUA 3QPVA 1OH7A 4G0NA 4LJ4A 4X8HA 2FEMA 1QHIA 5EUMA 4XVUA 4DB2A 5AJWA 1DO2A 1VG0B 2IC5A 1SKYE 3BB4A 4B74A 2CJWA 2P67A 2JLWA 2ZTSA 5IK2D 3KXIA 1G3MA 1BIFA 4FCTA 1G7SA 2QG6A 4OI4A 3K0EA 3ZZTA 3A4LA 4QBGB 4JVSB 3Q5EA 1AJEA 2AKYA 2IX3A 1Q20A 2FOLA 2GILA 2OO7A 4AIIA 2OV2A 5FPHA 3QJYA 3MD0A 2R6CA 5FTLA 3B5JA 2FMXA 1E2EA 3MWKA 1U81A 4ZI3A 3QG1A 2FPMA 1Z6YA 5TV2A 4LHZA 1J8MF 1N25A 3SJBA 1SVLA 1Z07A 4RD1A 3RS0A 1OH6A 3CNLA 3T34A 1XX6A 2GDJA 2JIZD 1Z28A 4TMZA 3TQCA 4DUGD 1MH1A 2WJYA 2LKCA 2CK3A 3I32A 4A2QA 1I4TD 2IXGA 3VR3A 1CR2A 5BYKA 5EJEA 5LB4A 1TADA 4PC1A 2BM0A 4URWR 3PFIA 1Z6AA 3L43A 2O8BA 1F6BA 4V0OA 1Z06A 3BFVA 1CJVC 5JCPA 1XXHA 2NPIA 5FBLB 3AM1A 5JSZB 3UMRA 3IO3A 1AQYA 5G40A 1Z6TA 3BAFA 4V0KA 1VTKA 1YR6A 1ZU4A 4BASA 3HR7A 4F7WA 2RGCA 4L4UA 2DWOA 2JLQA 2IS1A 3K09C 1KDPA 2ZM5A 2I4IA 1E1RD 4LPKA 3EPLA 3IEVA 4P31A 3R8CA 3WXMA 3U5ZB 2CE7A 1R0YA 3A1TA 3NTUA 2G3YA 1JJVA 1B0UA 2FFQA 4OL0A 4WAUA 4XIGS 4TYYA 3QI2A 4IOJA 4NCJA 3KZ1E 1G7TA 1DAFA 1X86B 4FCVA 3DPUA 4YXWD 3LBNA 4PO8A 1KI3A 1QHHB 5JBQA 4DLVA 3TMKA 5AUQA 5A4JA 1GFIA 4JLBA 3R9WA 4AKIA 2VPPA 1QBKC 3X1DA 4KBFA 1H8HA 4AYTA 1WBBA 4KFTA 4JBYA 3IBGA 2V7QD 1C4OA 1P9WA 2NZJA 1S4QA 2FU5C 4C2UA 2PT7A 1KK0A 3KFXA 4RKEA 5TDHA 4DCSA 5F98A 4E22A 1T5LA 3OE7D 1X8LA 2I1QA 1W4BA 1YR8A 4QGFA 1BOFA 4HZIA 4DT1A 1XEXB 1LS1A 4PPNA 2ZJYA 1D5CA 3Q72A 3SOPA 2J59A 4AYWA 4TL8A 1N3BA 1B23P 1XMIA 2OSBA 1E96A 2XEXA 4F4IA 3CZQA 1OT3A 1IXSB 2HDNB 1NBMD 3I3SR 4ZKEA 4PQYA 2JATA 3D8BA 3L0OA 4B34A 2QENA 2JAQA 4OHVA 1JR3E 3N2EA 4R9UC 2AN9A 2V1XA 4HB0A 5F3WB 4CDGA 1XPOA 4DLUA 3RYTC 4YMUA 5FUWA 2OCPA 3EX7C 1RJ9A 4NYJQ 1TQ2A 1PLKA 1ZM2A 1LW7A 2BC9A 1QHNA 3K70B 3ZS8A 3EZ9A 1F60A 1NJFA 5CYPA 3W3ZB 1NKTA 1W0KD 1ZCBA 2QGZA 1XXHB 2GZAA 2H18A 2GVDC 2B92A 4UNSA 1OFHA 2PCJA 1TUIA 2GK7A 2VF7A 2Q9CA 2WMOB 4US0R 1AIPA 1KJZA 2F43B 3REFA 4DUGA 4AKHA 1KMHA 1GL6A 4G5QA 4ASUA 5DN6D 1ZU5A 1S2MA 4OK5A 3K1JA 4LWZA 5GJVC 3SN6A 1VG1A 4AK9A 5EP1A 2XSZD 2J7PD 2OCYC 4HUQA 2R65A 4TQUS 1CR0A 4E5UA 3KQKA 3EPKA 3NVAA 4DIEA 1ETUA 2J1LA 3FFBA 5CLQA 4U7DA 4LCBA 3LAWA 4YMVA 2XGJA 5FI0B 1EX7A 1KZGB 4RCYA 3VU9B 3VQTA 1XP8A 2DBYA 1W46A 1HV8A 2AWNA 3ASYA 5FPTA 1VYTA 3W34A 4B44A 4LI0A 4QRHA 4RVCA 2QP3A 3KFVA 5LB2A 1XMJA 1XPRA 2IYYA 1H8EA 3NBXX 4PZYA 3T5GA 1IJEA 2ZANA 3I8SA 4JLDA 5B58C 4UKDA 5FPKA 1KOFA 4D4KA 3RRNA 3FTQA 1G291 3LX8A 4HLDA 2AFIE 3RS3A 2IS6A 3U7EB 3SYLA 4YQFA 2GZDA 2EFEB 3Q7PA 4D4MA 1E9BA 2O8CA 2XZPA 4ABYA 1TAGA 3SS8A 3A4NA 3E1SA 4Q9JA 3D3QA 3VX3A 4B33A 1WXQA 4K8OA 4C0JA 2FNAA 2W58A 3RRZA 3GLGB 4GZMA 1AA9A 3LLUA 1VG9B 1S1CA 5IHPA 1DAIA 4G1UC 3SYNA 2PLFA 4AWXA 2W6ID 1U9IC 4JLMA 4Q21A 2EFHB 4W5WA 4OQXA 4US1R 2WWYA 1P2SA 4A0FA 3LQQA 2VIIA 4NTZA 1Z63A 4URXR 3AKCA 1R2QA 4NCKA 5KSPA 4KFUA 1R0XA 1OKKA 2A2ZA 1KKLA 4F92B 3TH5A 4IRUB 2B6HA 4ARZB 3C8UA 2IHYA 5AJYA 3LWNA 1E0SA 2XB2A 221PA 2BOVA 5TARA 1JJ7A 4CIDA 2IHBA 2ZS7A 3SE0A 3CLVA 3E5HA 3K9LA 3UG6A 3KQHA 3A1SA 1KO1A 1KSGA 2AK2A 1E1RA 4DDTA 1S0UA 2N1BA 2QAGB 2LWIA 2ASEA 1P2TA 3C5HA 3VU9A 2XZLA 2R6GA 1FZQA 1S1MA 3CRVA 3K0AA 1G19A 4NL4H 3PIRA 4GT1A 3KL4A 1BKDR 2CVFA 4A0HA 2QN6A 1NVVR 1UEJA 4FMCF 3Q85A 4M1KA 4JLKA 1M7GA 3Q7QA 4OHYA 1GKYA 4MRVA 1BYUA 2YHSA 3AKDA 5CM8B 1WP9A 1W36B 2GBLC 2P6UA 2XNDD 4EPXA 1CS4C 3U4QB 3KUDA 1OE0A 2BV3A 3QF7A 4KYUA 1ESNA 1S3SA 4QL3A 1E2NA 2A7QA 4BEJA 5TVKA 1E2GA 4UXHA 5AWFC 1U90A 3CO5A 2PZGA 1XJCA 2DHRA 4LJ7A 1KMHB 1MABB 1SKYB 1YQTA 3H4MA 1LF0A 4N3NA 3LDAA 5J5CA 3TAHA 4BECA 2ZI4A 1IY2A 2BM1A 4GSYA 1JALA 4D80A 1LF5A 1FUKA 4ZDIA 3VR4A 1N2CE 5FL3A 4OQNA 4YMSA 3B1XA 2Q9AA 3P4YA 4KCGA 4URZR 3SFVA 4BFWA 1HY3A 1BO6A 1G5RA 3BXZA 4TLEA 1NG1A 2GXQA 2W2TA 2CCJA 3CRW1 3OAAD 1IN7A 2K5UA 1RE0A 4PPQA 1S9HA 3VR1A 3TQFA 5FPSA 3IQWA 3T1VA 3UPUA 4KYIB 2P5TB 4TT3A 1RRPA 2VBCA 3PG5A 1DAGA 1KSJA 1FOEB 2D2EA 3FOZA 2G0TA 1ZJ6A 3MMPA 5KDLA 1VYUA 4D0LB 4JJZA 2E1RA 1XEWY 5BN5A 1DEKA 2O0KA 3I62A 4A6PA 3NBZC 1NLZA 1Q3TA 1W49A 2LCFA 4Q02A 1XCPA 4ZDJA 3IIMA 1ESMA 5E7IA 5E95A 3ADDA 1ZIPA 1GL7A 4MITA 4C7OA 3W5IA 3E70C 4GI7A 2G77B 4LYJA 1R4AA 2ZRNA 5HKKA 1J70A 1G5PA 1D8TA 4MA4A 4DCVA 1JI0A 1QHYA 1DO0A 4PC2A 4QHYA 1ZM7A 2J0UB 3ONWA 4PR0A 3H0KA 4TTQA 5GJCA 1Q57A 4M1MA 2ZJ8A 3ND8A 1NSTA 2Q9BA 4RZXA 4HB3A 4BWYA 1E9AA 1VYVA 3SFZA 2J46A 2GXAA 1NP6A 1GNRA 1XTIA 3L0IB 4W5JA 5SZIA 1UDWA 2CK3D 3AQ4A 3ZVRA 3PEWA 1Z0AA 3W3AA 1GZSA 3EW9A 4ZCLA 2ZUCA 3C16C 3KJHA 3RHFA 4RCZA 1NL3A 2F9MA 2NMVA 4KLZA 2VHJA 4HDQB 4DLZA 4ARZA 1XCMA 2O52A 4HZUA 4JLJA 4M9XA 2FFHA 1AZSC 2NPFA 1G3UA 2D3WA 5JWOA 2WPDA 5L3SA 4MDFA 1KI7A 2VP9A 1Q0UA 1QDEA 2REXB 2J45A 2A9KA 3Q3JB 5D3QA 1IXRC 1R10A 3TBKA 4NYMQ 1HYQA 2GCPA 3AF4A 5J4VA 4UNNA 3RDPA 2QAGA 1YZGA 1YR7A 2I1VB 4UNRA 5GVRA 4YMTA 4P4SB 1VKJA 2IBMA 2CXXA 4O2LA 1TF2A 2E9SA 3F8TA 3KTAB 1KI8A 1H8HD 1KKMA 2VEDA 4DRZA 4M2LA 5KO2A 2YWEA 4KFRA 3NHBA 5IRCD 1N5IA 4EJSA 4UXJA 4R2IA 1KSFX 4CEIA 3NEYA 4A2WA 4B2IA 1JAIA 3S1AB 1KSHA 4M9QA
chains in the Genus database with same CATH superfamily
2RH5A 4L5JA 2VDUE 4RTSA 4IJUA 3LZCA 1J1IA 5KJ1A 2HM7A 4REQA 3WNCA 4E4TA 2ZIXB 3NOOA 4UEKA 1AMNA 1EGAA 4ND4A 3GFBA 1IFXA 2WJIA 5AW3A 5ITZB 4U4AA 2EU8A 1X38A 2MYTA 5IS2A 3VHXB 2QRZA 1ZI8A 2ZJ1A 3NHUA 3LDHA 2BGUA 5DGXA 3ORFA 5FLEX 2VDJA 1H2HA 1X7ZA 2ZJ7A 2O2HA 4QYIB 5KINB 4JC5A 4LXQA 3EVAA 2A1TR 3NAQA 4XUEA 3EAGA 3OZIA 4LCEA 5IXYA 1E3SA 1AUXA 1LRLA 2XJ4A 1DE0A 1ONBA 1XK7A 2ZBGA 1XZQA 3FKQA 4M38A 4WLEA 5TQ0A 3TM4A 4Q93A 1QORA 1GV1A 2BMFA 3H9CA 2PGXA 4TVKA 1VCNA 2CNWA 4C2BA 1VLJA 3PCXA 1E7MA 4MR8A 2WG0A 4NYMR 4WXPA 3INGA 4RNDB 4UAUA 3TZBA 4ATNA 4V39A 3PKZA 2WWRA 4YUZA 1NJ6A 1JR3A 1T9ZA 3DAPA 4A4DA 2OXFA 3IIEA 5H81A 3R7AA 1Q0RA 3EXHA 1COWA 1DIGA 1FX1A 5KWVA 4DC1A 4QHTA 3UTCA 1MABA 4MGEA 4UTNA 4B47A 1D07A 3QA3E 5FHRA 3DXZA 3ENQA 3EWSA 2GHIA 1JXOA 3KEQA 3CRMA 1NBHA 3WYNA 2PCLA 5BSRA 2XVAA 3M5CA 3HJUA 2R96A 4LF7B 1ILWA 2PZMA 1PGNA 2VHTA 2XGMA 3KVVA 1T25A 2Y99A 5IAJA 4AJNA 4JV5B 1MIOA 4ESEA 1I4DD 4KQXA 4X1YA 3S7TA 4D41A 1Q12A 1YRQA 2V6JA 3LH5A 1WL8A 2DX7A 3JU3A 3BEDA 4R3NA 3WYCA 5JD4A 2P79A 1RC8A 1P3Y1 5IDVA 3QXXA 2Y1OA 3OF5A 5KQMA 3A9RA 3CKYA 1TKBA 2GO1A 2OE2A 3VU1A 3W8FA 4D9MA 1OXTA 3K9QO 3ZWYA 4FB5A 4F5DA 4DEYA 5FDFA 5I4KA 1AUOA 1QE5A 1XRNA 3TSZA 3SHWA 2FPPB 3A9CA 3H2YA 3OWHA 4KPUA 3OCVA 4P9NA 1XQVA 1LH0A 2Q5JA 2GUWA 4JFAA 3ROMA 4AULA 4C6TB 8OHMA 3B3FA 3WQSB 3DNFA 3A1FA 1O94A 3B1ZA 5AXCA 5JYEA 1VIDA 4OUKX 1QTQA 2BEJA 5DW3A 1YJXA 1HDYA 2COEA 2XZDA 4S04A 1IRIA 4RETA 4AY3A 3SVTA 3NMUF 2FYTA 2X1MA 2PX3A 4W1PA 4C0LA 2VAMA 4M8NE 1BVRA 1XYYA 1KVUA 3PL5A 4FQ8A 4K1LA 4OGLA 2UUAB 1XZCA 5E6UB 3HVIA 4BP9A 1FJXA 1XZAA 3A58B 2ZVDA 4RJTA 3LVBA 3ZYZA 1DQSA 3IMKA 4PCVA 1N0IA 4ZVLA 4OP3A 5AI9A 4ND7A 3RSOA 1CQWA 5D3MA 5AJHA 2C04A 4MARA 4AMVA 4CN9A 5JY1A 3PFKA 4KR6A 2HREA 3OEEA 2AXNA 1G21A 2IYZA 3SEQA 3V1TC 2PZAA 2WAOA 3BMNB 2DOKA 3EHEA 5IBCA 4HRVA 1MC8A 2EDCA 3LF1A 1PYGA 2I1LA 1QH0A 1HL7A 4ZOLF 2PE5A 2JIRA 3G2HA 1Q17A 3CEHA 3B8EA 3DTTA 5B4VA 4IKPA 4YNBA 2AG0A 4RK4A 3C45A 1NNI1 3EWNA 3HJGA 5FWYB 3TVDA 4V2IA 3HSYA 4K6FA 2ZBFA 5JPIA 1BFDA 1VL2A 3ZGZA 5AFSA 2PGJA 4H60A 3V34A 1Z2OX 2AOWA 5LYJF 4KMRA 2EJWA 3OMXA 3D3WA 4YX9A 3MMSA 3PWSA 3KOZA 3T9EA 3HCNA 3D8HA 1HKUA 3RHTA 1NF8A 3MB8A 4U2CA 4X3PA 1H2BA 1KR2A 1FMTA 2BGJA 2Y1FA 3E35A 2BH9A 1D03A 3LKZA 3ZV5A 1ZUIA 3LK7A 2HDOA 4A8HA 4G1EB 4LHXA 5CLIA 2I87A 2WG2A 2EQ5A 4DZZA 2V98A 3F7TA 1UPBA 3JAWB 4UM9D 3PJEA 4Q9AA 2X0EA 4JLUA 3GJQA 1CUXA 1RXEA 1OSNA 4JEIA 1P0PA 1U5AA 3AB8A 3OC0A 4ISCA 5TT0A 3PDIA 1GO2A 1JU9A 4XIYA 4XPZA 2O8VA 3QYAA 5FWDA 2PBFA 4BQIA 3NV9A 2AHOA 1JQKA 3NEJA 4WZAE 4X92A 1W48A 1PN3A 1QB7A 2NSLA 2OY0A 4LF4B 2QYSA 2FLWA 2F9FA 3FHOA 5DGTA 5F52A 3WIUA 1JDBC 3N39C 4MRRA 5LCXA 5DISB 4W8HA 2GS9A 5DCWA 3IURA 4QFDA 2C9CA 2MSKA 2DLNA 1E1NA 1U2TA 2VYNA 1EVYA 1ODFA 3RB8A 5CIYA 4I6GA 5H9VA 4Y6SA 2PYDA 5GZ3A 4ZVUA 1FXWF 1OIVA 1XAHA 1TVCA 4MVCA 5EIOA 3L0DA 4W8GA 4LMRA 3WRXC 4GP6A 5HKLA 5FNZA 5LBIA 4LFAB 1FP2A 4Q1VA 5C1IA 5ESDA 3EGDA 4L9WA 5ALYA 4TSRA 2PUCA 4DOMA 3A1WA 1N2CA 3DZ8A 2JG3A 3W04A 2BIFA 3PX7A 4EABA 5DIZA 2YWRA 2BR3A 1NTRA 2VK4A 3EIXA 1ZUD1 4GQBA 4OHFA 3CPEA 6REQB 5LOVF 1LB1B 5LA6A 4XD2A 1GYPA 2CXHA 1C41A 2G8LA 2FSIA 3LF2A 4QICA 4ZEMA 5KYVA 5F64A 4MV1A 1R6VA 2V96A 4PZDA 5CHEA 4HN2A 5TPZD 4I66A 2B1QA 3MERA 3WNVA 4AO7A 3CVJA 1H05A 4YRDA 1TVEA 2A9QA 3PDUA 4HDAA 1EKXA 4A10A 3PHBE 4A0RA 3KB2A 4OHWA 1M72A 4NMWA 3I6MA 3E9EA 3NONA 4RD2A 4J1TA 4TXJA 3TO5A 3AEKA 3NXKA 1QKIA 4H7EA 1ZMXA 5I9IA 1RI1A 1AZTA 2NGRA 2O8EB 2HHHB 1SBHA 4CPDA 1EXWA 5DHTA 3PHHA 1VSBA 3NP7A 4D6XA 1VIYA 4BPRA 1ZQ1A 1JZSA 4M22A 1D6SA 2RIRA 3JPWA 2H0RA 2E4VA 2ZE6A 1QGDA 3O0TA 4MV4A 1MQAA 5BQ5A 3E2IA 2ZE5A 3TYXA 2I7XA 1EFUA 1KO7A 4D0GA 3WMWA 2XCRB 3U3RA 1WEHA 4XVRA 4PYRA 1A9ZA 1R6BX 1YQUA 3OQ1A 2NV2B 3DOHA 3O8OA 5TLSA 3CUUA 3DO6A 3NHMA 3SQLA 1BE8A 1CY8A 1WE2A 2WBLC 3UM9A 3VZDA 3W4KA 3W7BA 4MO9A 1E4OA 3ANLA 2OG2A 4Q4JB 3DA8A 1C9DB 2G7MC 3IP7A 2XUFA 5GADl 1GTVA 1UJMA 4PLCA 3IUBA 3VC2A 5JSQA 5HUJA 2BGNA 4DHEA 2C92A 4ZYUA 3MPOA 2Q6OA 3QLVA 3P9QA 1ZIXA 2IW3A 3W2EA 3V1YA 2YZNA 3FYTA 4O4LA 5LDGA 4C08A 1EBFA 4HDKB 2EL9A 1DQPA 1KBOA 3OUUA 3SS7X 2IXDA 1E2DA 1WLYA 4AQ7A 1BHO1 2PUFA 5BQOA 4B4OA 1XTVA 4MV6A 1SB8A 3BIOA 2RC6A 5DYIA 2VHUA 2YJGA 3WLQA 4A1FA 2VXOA 1NMZA 4ON9A 3AOGA 4MV8A 3CLKA 4FOTA 1D2NA 1S96A 2W6ZA 2IQIA 3EDMA 4L74A 4JI3B 3RUPA 3TSOA 4OTZA 1YU6A 1ZCFA 1RM4A 2VDRB 1M2NA 1NDQA 1MC4A 1U2QA 2YOGA 2AVNA 2XOKA 1AVTA 2G4CA 4R68A 3CX7A 5EZQA 3T94A 1XEAA 1JH8A 4IJKA 4M1EA 2QD3A 4NAVA 5ECGC 4AM8A 1ZFNA 4PLWA 1ZMRA 4JI0B 1JECA 3CZ9A 3M5PA 3NC0C 1F4VA 1QFMA 2FHPA 5KWIA 1G8KA 5EE9A 3GUYA 1E59A 3BA1A 4K6GA 3NOQA 4X0EA 4ZT7A 4OAOA 5IH3A 2YFQA 5FYQA 5BN3A 3V4OA 2VWPA 4KXYA 2YXPX 4FU0A 5EXXA 4CHGA 3U44B 2E89A 3V8NA 4LJAA 2ZUFA 1ZRMA 3DLPX 2F1IA 1OFGA 5CCDA 3U7HB 4L22A 2GFHA 1ZJ4A 4TMXA 4E1VA 5AVKA 3TXAA 4B35A 3GRFA 5HF6A 3W9UA 3R9XA 3VPHA 1JAHA 2YV1A 3NXSA 2W90A 4MIOA 2L2QA 3QNUA 4NJOA 4CMEA 1IN8A 4Q4AA 4E33A 5DI9A 2BFMA 1COWD 2ZI9A 1KK1A 1NHGA 1SCJA 4ZO7A 2VHVA 1SIWA 2D1RA 4KE6A 4U6SA 1Q15A 1UBUS 2C7GA 2ZIUB 4PN3A 4NDNE 5TX7A 4R2LA 3RRJA 1E2FA 3RBXA 1FDOA 1DVRA 4MGHA 3TLKA 3UXHA 2OQ2A 2QSZA 1EIZA 1TIKA 1TKRA 1YC2A 2G0AA 3K5WA 3T15A 1Y3DE 2OZLA 4TXNA 1QX3A 1VRVA 4HNAB 1HFKA 3UFXA 1WZNA 3M3DA 3ZVNA 2J4DA 4MTCA 5ILOA 3FPEA 4EB0A 2JJYA 3IB6A 2H1SA 4CL0A 3E3LA 1ZRHA 2QR5A 3QTTA 2W6JD 3EVDA 2QJFA 2CXNA 3RT7A 4A2PA 1A9XA 4AP9A 4G5OA 4XE5A 2OFOA 2IA5A 2XEDA 4PANA 4TT3D 2G9NA 4FR0A 5JS6A 3G2NA 3HZRA 4LJLA 1NSFA 2QTFA 1WW8A 2C0PA 2YS6A 1Q83A 3QV2A 2XTMA 2OWEA 2IYFA 1H94A 1F12A 4RIFA 2IS2A 3L79A 3ROTA 4JL6A 4NU8X 1AHPA 1B8OA 4GEGA 1PO7A 1A95A 3OFVA 1JW9B 3ETCA 4G1BA 1DEAA 3NATA 4YRMA 1RWKA 3FCOA 4YQEA 4H1UA 1WU7A 4HXFB 3K4QA 3T7JA 1WETA 2NUAA 2C4TA 2V6IA 4CEJA 1L4EA 4MV7A 5KKCA 4K3VA 3I52A 3F1KA 3CLHA 3ITEA 2E18A 4ITRC 2JBAA 3RKSA 3GBPA 1WZUA 2QPLA 4B7UA 3ESYA 1NC1A 4DTCA 3SICE 1DI0A 1W0JA 2XB6A 1JHRA 2WUWE 3C7DB 1KE1A 3KSAC 2P7IA 3REQA 3ONEA 3HKEA 5D2CA 5DTRA 4B3CA 1K92A 1WMDA 6PFKA 3DM5A 5LUBA 4JUFA 4LY6A 1QIKA 2RIPA 3FHLA 4E09A 2IE0A 2EKPA 3TFQA 1T1GA 4WXEA 4G25A 1HZZA 4HGYA 4JITA 13PKA 4G5FA 5ELMA 2BMWA 4NNOA 3VPXA 1RJFA 1II8A 2FWRA 3RTBA 4AZ0B 3GLIA 1CZLA 2I2DA 1ACMA 2J5XA 4WN3A 4EVRA 1IDN1 2WJGA 4DJAA 1XALA 1K98A 1CQZA 2F1RA 4NY1A 3QTBA 1WUYA 3HCRA 3O4HA 3GFGA 4UHJA 3VR3D 2BFPA 2ZZKA 3DMRA 4AF7A 2QVXX 1RWPA 2D54A 5D8DA 1L5HB 1E9RA 1YTLA 2C83A 1JZTA 4KC0A 1FFAA 4LTNA 2EJTA 4KOEC 3STXA 2BDEA 3I9V1 1D4FA 3ZIAA 2VP6A 2Q1WA 2A1TS 4TLDA 1Q3HA 5AKXA 7MDHA 3DYVA 5E4JA 1KVQA 1TUEA 3V1KA 3K70C 1NMQA 3ZIUA 1IEXA 1VQ1A 3FXAA 3K96A 1YZQA 2Z56A 3C3KA 3WLMA 5CFQA 5AVQA 2DHEA 1J0BA 4DDWA 2PUEA 5HGJA 3SYTA 2QTBA 4MI3A 3IXLA 4G0OA 3D2LA 3EZ2A 2HA4A 5LPNA 4JN6B 4HS4A 3DE6X 2YIMA 3HA3A 3KWMA 4OHXA 4GOXA 4K2HA 1P73A 1VL6A 4W5RA 5MGNA 3KYDA 4X1KA 1KDVA 3COPA 2XCLA 1RHRA 1B4DA 2QLJA 3ICWA 1QNFA 1IZZA 3ZDFA 1QAMA 4FLMA 3JZAA 5B53A 2YHIA 4FS8A 3UJ6A 2CBZA 2XB8A 4LRTB 4DY6A 5HDBB 4QYWA 3LSYA 3LQRA 3T7TA 2I2CA 1J2UA 1Q3KA 5AXBA 4RDHA 4DGQA 4X7RA 2A57A 3QELB 5A9TA 3R1IA 2EWWA 4FOPA 4JI4B 4I4IA 4BVLA 2FKAA 4Y2XA 1IZYA 4Y2YA 3QEOA 5BQPA 2OFFA 3JQ9A 3B1VA 1JLHA 1VE5A 1JLRA 5E9QA 4KQIA 1AXGA 2G5CA 1SWVA 1WUKS 4HN9A 4OIFA 1PQWA 2CFOA 4GMGA 2WIFA 1USWA 3A6EA 3C3AA 3HDQA 4GPIB 3STYA 3DV0A 5DGHA 3KYIB 5CG1A 1Y3BE 2WYUA 3FJOA 1CF2O 2XW6A 1WDLA 3VSCA 4DSOA 4CT0A 3LSTA 5CM9C 5AHWA 2FR8A 4G01B 4Q1DA 1C1DA 2AF3C 2GSWA 3B78A 4I2NA 3B5IA 4K7JA 3FHTA 1VSVA 2C03A 2P3LA 4BZWA 3WP0A 3KX2A 4NE2A 4U7FA 4IIXA 1SA0A 3D4PA 2WT9A 2XDYA 5LBUA 4BO8A 4FFBA 4RPKA 1S2NA 2IF2A 4YRQA 4BP1A 4IUCS 4L6IA 4BWVA 5CFPA 1LPAB 1OQAA 1MO2A 2QN1A 3SJAA 3HB9A 2W22A 1N5MA 1DLJA 2AF4C 3HBLA 4BMZA 1DCTA 3FUTA 4DA8A 2FN8A 2KS6A 1FNMA 1UM9B 2PJUA 4HYYA 4CMIB 4XB2A 1M2JA 2NNLD 2CVHA 1UWKA 4YJFB 3F5FA 3Q41A 1KXZA 4HGRA 2DFPA 2XWBF 3OHSX 3Q2OA 4P3KA 2JI7A 3V1MA 1W4RA 3WJ7A 1C50A 3S2GA 4DBLE 3AI3A 4D96A 2A0XA 2A9JA 4AX4A 1T91A 4WD3A 1J8YF 1YIDA 2NXWA 1W30A 4K9MA 2CDBA 2JLZA 3KHTA 1A1SA 3O3CA 3HFSA 1RE1A 4YGXB 1KFEB 5HRCA 4JL8A 1YRLA 2WYHA 3KEMA 3O8LA 4ITUA 1NBME 1QJ4A 2CWWA 3LXUX 4RJKA 1ZP6A 1IHUA 2H52A 1DBQA 1PU2A 2YYAA 5CT5A 3O47A 1B0AA 1RBMA 2G1AA 2QIOA 3A6DA 3GG2A 5CDGA 1D7AA 4URFA 4Q05A 3DZDA 4XLTA 4JQZA 1XHFA 3PRJA 4G65A 2ZRIA 4Z6KA 1L6RA 2GERA 1DV2A 1A9QA 2PGIA 1N9ZA 1Y7IA 3FNIA 4RV5A 3T5PA 1HPLA 1ZVJA 4QULA 1NW4A 4UE2A 2I4LA 5ELLA 4DBLC 4Q12A 3GEHA 3S2YA 1YQQA 1E92A 4NESA 1NW9B 4P86A 1W0KA 4ENPA 4EW1A 1DELA 4WPGA 2R1VA 4IRMA 1I6LA 1VHQA 1X70A 1JIQA 3QE4A 3OCUA 2HL6A 2IEDA 5AHOA 5K4AA 1PWEA 2V4ZA 4KRXA 5M29A 2PGLA 5BV8A 3PA8A 2XVZA 1YK0A 4R8MA 4CLXA 2I4OA 4WSOA 4F2WA 3ME5A 1JLLA 2G88A 1QC5B 3H11A 3IHLA 4QYSA 4ZCMA 1DIAA 1EINA 4MQEB 1DZIA 4HDOB 1BOOA 1N92A 2WWGA 3I4FA 1EXNA 4C2TA 4G5HA 4KTVE 2IV3A 3WHKA 2WTAA 1AKNA 3RC9A 3WZMA 5IABA 2B8EA 1U0HC 4KLRA 5FUXA 4BLOA 1P3JA 1U0LA 3DKIA 1OH8A 1ONSA 1C30A 2DHQA 2P3OA 5SICE 2N42A 2GAJA 2FMTA 2RGRA 1DKQA 3MELA 3RTAA 3OQBA 1EFVA 1DJLA 3GJ0A 1A2KC 2HV9A 3HABA 4IDNA 4V0RA 3WBKA 4MCAA 4P6VF 2XMCA 4L4YA 2FZWA 2A67A 2CNBA 2JIBA 1QKKA 1WCYA 2WJ3A 2B1IA 2ZRPA 3QE0A 4JBNA 3UXEA 4F12A 1E7SA 2QL5A 1W47A 4I2VA 1PGQA 1ZL2A 3PUZA 4WZBE 4BJ6A 3VR6H 1JG4A 1M3SA 1OMOA 1YS4A 3RNLA 5TY0A 2YHUA 1Z0IA 3OLZA 4OGKA 2P4UA 5CVTA 3JR7A 2FY8A 4ACBA 1CIPA 2NQTA 1SBCA 4YUWA 4DZTA 2ZRJA 4MYCA 1W93A 2W9XA 2C61A 3LKDA 3EZ6A 5ABPA 5BP7A 2AW5A 2IHUA 3LHIA 1QSGA 5IBRA 1N57A 4AQDA 4EO4A 2PWPA 3PWTA 5KWSA 2J3IA 5C46F 5EEGA 1Z3IX 2CMHA 2ILTA 5EZSA 3R7LA 4DA6A 2VDWB 4ER6A 4RIGA 4J3NA 5EHGA 1E5TA 1G5IA 2RGNA 3L8CA 3NW9A 3PCTA 3C4QA 4C0HA 3JRXA 5C5DA 5DLQC 1FP4B 2IZ7A 2I9PA 3IP9A 2CUTA 4DLBA 8ADHA 4FI3C 2CHQA 1BWPA 1P1IA 4LK2A 3QMPA 4XPIA 4OQ4A 2FFJA 2O0JA 2B0CA 2GCNA 3RKRA 5KNDD 4R84A 1RLOA 4WNAA 4ARIA 1P1CA 4ZV9A 2CW5A 2YS7A 3IIIA 4R1OA 3I5MA 3SHFA 2VAVA 5B2ZA 2WFZA 2W83A 4M8LA 3IUQA 3RU7A 2XOKD 4JQSA 4CNBA 5C9ZA 4FZVA 3QVOA 1JDVA 2AG6A 5BWBA 1NI3A 3TOZA 1JEJA 3GCGA 3LQKA 1SKUA 4FFDA 4N6OA 4Q9HA 5ADHA 2FDCA 4JYAB 3A6ZA 1KO8A 4N82A 2BR5A 3HCPA 4BZXA 3OI7A 1Q1BA 2FG5A 2P2NA 4MUKA 5BR1A 4B4WA 2QHXA 4HTFB 2IUFA 2G5PA 3R0VA 3TJZA 3D5EA 3BF7A 5BWLA 1J5PA 3O3OB 4J4HA 4JI1B 4A73A 2BEWB 1G6Q1 3LO5A 2C4HA 1H65A 2AA3A 4BFYA 2XQIA 4P82A 2VSXA 3NWPA 2OKGA 1KP2A 2HU5A 4AXBA 1AS2A 1HG1A 5KMGA 3KEGA 1DB3A 2MJLA 4P7BA 2D5IA 1YBHA 3ENVA 4FMBB 2HEGA 1M2OA 2GBFA 1W5TA 2A5LA 2IEBA 4G4GA 2Z83A 3ICCA 4Y6RA 10MHA 1QH8A 2PMCA 2ADFA 2B1RA 2EZ4A 4GW3A 5A3VA 1K5DA 2HN9A 1IUOA 1MT3A 1VHWA 4GMDA 4OGFA 4RF3A 4XWKA 4CN8A 1AG9A 2QPOA 2HQOA 5A62A 1VMDA 3PDCA 1ZW6A 4IJ5A 2Z9DA 3RBAA 4D79A 1J5EB 1GPLA 1C7FA 1U5BA 3QF4B 4CG3A 4A0SA 1FSGA 3PV0A 4DF3A 2PX8A 4LOHA 3OKFA 5L8VA 1H2ZA 4HQRA 4BMSA 4C9BA 1D6MA 2WFLA 1QQ7A 2CMFA 1NMYA 3IBTA 3LC7O 2ZUTA 3X3HA 2PVPA 2O7NA 3IJPA 3JW8A 5AVJA 3PRYA 1LNZA 2P9QA 4K28A 4W1SA 5TQ0B 5EXPA 5CT4A 4IDOA 1U0GA 1G20A 1RXWA 2E85A 3SSOA 3EA0A 1JQ5A 4OGGA 3FGOA 1BDIA 4HN4B 1UPUA 1JJIA 2IPOA 3ZQ4A 3CUSA 2IPXA 4DILA 4EG4A 4OJKA 1AE1A 3KVYA 3IPAA 5DSTA 3TB6A 2VDWA 4AMBA 3ZUPA 2VPWA 3B1FA 5ALDA 2JZOA 3AYXB 521PA 5IVDA 3R6GA 4AS2A 4UQLA 5TF4A 4WINA 5TQJA 1CULC 2X5JO 1Z4JA 1Q0QA 2ATVA 1LNSA 5HJEA 1KDOA 3AEKB 4NBSA 5CA1A 4MIEA 3S3TA 3GMSA 1VI6A 3QI7A 1KMQA 2ZIVB 1CE8A 1RLMA 2GK6A 1PYDA 4PG7A 4HATA 3W8RA 3ZWDA 2VUIB 4F3RA 2HEIA 1O94D 3TG8A 1OX5A 1Z13A 1ADJA 1ZNWA 2DUJA 3FUCA 5DMXA 4BNIA 5LLTA 1ESDA 4CWAA 1LPSA 1GPAA 1UXGA 2CVPA 5JNRA 4OLFA 1QGUB 4S0ZA 3T3EA 1N7GA 3UC9A 2B83A 4L15A 1QO7A 2VRCA 2BBOA 1O5TA 3QFRA 3VC7A 1Q0TA 1YAJA 4FC6A 2FW7A 4ZIRB 3E0QA 3JQQA 4F46A 3CLSD 2JDID 2ERYA 2TMYA 3KOOA 4MH0R 5BVHA 1JQEA 2YBDA 2FUEA 2QN7A 3HNPA 1U2DC 3KLOA 4AO6A 3EXEB 3S2SA 4NBUA 4TRNA 5FCDA 3N3AC 4MVJF 4X00A 3D6NB 1WXDA 3SF8A 1ZQ9A 2BCJQ 3D4BA 3FBWA 1A8PA 4WE3A 3WK9A 4RTRA 4XTRA 1RVV1 1G21B 2NXJA 1W4ZA 1XD2B 3L0SA 4PX9A 2ZBDA 3JQAB 5KX5F 1P9RA 2QMOA 1UC8A 1VGQA 4Y67A 9GPBA 4C89A 4E5VA 3CNNA 1HEIA 2CLLB 1J2YA 3ES9A 3UQYS 1JWAB 3PJRA 1IN5A 1J8QA 1WQ4A 4GYYA 2NT4A 4IWYA 2VQSA 3TVYA 2PPVA 1AN9A 3U0VA 2PKCA 1OI3A 2VHZA 4CNQA 4YJ2A 2Q1YA 3IOEA 1J8DA 4EA8A 3STUA 3T54A 5AM2A 2K7ZA 4JP5A 5BQXA 4JVNA 4R4JA 3C3WA 4GQAA 5GZ1A 2ZRMA 1DEXA 1KRWA 4RH1A 4RKRA 2J3QA 3CZ4A 2ZYVX 4EB6B 1YZLA 3H2JA 5FBWB 1J7JA 3QSYA 4PCAA 1X8JA 3H2KA 2J0EA 2X4GA 2FSHA 3D64A 4R83A 3R3YA 1E9VA 5BSUA 3AUYA 3JYPA 4LIPD 3SDBA 1CB0A 1BFUA 1U0NA 2HA3A 4LI3X 4N0EA 3JYOA 1KARA 4M54A 5KYXA 4KXLA 4YAOA 1S7GA 3U37A 3VXKA 3PNVA 4NENA 1HZZC 1KY2A 1MJFA 2GPSA 1TMKA 1ZD8A 4FBGA 4HTFA 4F0JA 5JROA 4ZALA 4UTZA 4OATA 1JFFB 3OPYB 1DRJA 2FW9A 5FEMA 3EEQA 4I1RA 5K8TA 1V7ZA 3OFND 3GU3A 3FOFC 1INLA 3HYTA 4BV3A 1Q19A 3PBKA 1M2GA 1X39A 1F2UA 3OE1A 3LI2A 4X85A 2ECOA 1NULA 4DQDA 4D4HA 2RAPA 3F3SA 1WQ1R 2ZWIA 4KQ9A 5KQPA 1S5PA 4N12A 4N7BA 5CA0B 2RBEA 3Q3VA 3ZBUA 4W7IA 3MW8A 2B1JA 3IVAA 1QVWA 4LYHA 4KREA 1MN6A 1V3UA 1MJGM 4PTLA 1W36D 2GBCA 4IDEA 4HB2A 4B8YA 2LUOA 4RDXA 2QKYA 4I1PA 4B46A 4B1FA 2NN3C 3DWIA 3LJKA 4IIJB 1JRLA 4TSFD 4E14A 621PA 3GH3A 3GO4A 3INRA 1UOOA 2IRWA 1R6UA 4MUHA 4BC1A 5KNBA 4N7MA 3UB2A 2J31A 5A4AA 3EFEA 3K5HA 4R40A 3O3MB 4ALMA 1KDYA 3TD9A 3EC2A 4JWKA 3R2JA 1WV0A 4UHKA 1C8KA 4JQYA 1T8TA 5EQDA 1DV1A 2BAGA 4C20A 4QDJA 2A9OA 1LFAA 5CXXA 1M2HA 8GPBA 4OHZA 2FW8A 2FN3A 3WZLA 3BD8A 4UOZA 3CZ5A 5FWNA 5LNK1 1T24A 1PIWA 4F9GA 2Z2KA 2OECA 2K7FA 1U7XA 3PIIA 4Z4HA 1UZNA 2Z4TA 3DNPA 3FVQA 3VKWA 1FW6A 5GQSA 4IIBA 2XYQA 2DPMA 3WGYA 4ZCTA 3NIGB 4BO4A 2IVZA 3MJVA 1GFWA 1F5NA 1P9LA 3BFKA 3CKLA 3WOHA 2J67A 4F6CA 2VAPA 4RD6A 1L5NA 1QRSA 4G3XA 5KAPA 4WW0A 3HMQA 1I30A 3K2BA 3LV8A 2AD1A 3LZ6A 4CL3A 2PH1A 1RQLA 4L0MA 4LRYA 3CH5A 1DC5A 3MVEA 1DRUA 4UEJA 2AG8A 4B71A 4L7VA 4X1OA 1GCIA 3UEOA 3NRBA 2PAAA 4OQDA 3MUOA 2BELA 1E2MA 4KRGA 3HHEA 4HD8A 3R75A 4DIFA 3KL2A 3N6XA 2ZIZA 3DMPA 2XT6A 3PFFA 2DEUA 1S8AA 1JKFA 5GIPE 3LTNC 3QKSB 4LE0A 2GAAA 4WZAA 3REQB 1TU4A 4QJ3A 1GOTA 3NIWA 3AETA 1UEIA 1JFFA 3PPWA 5GY7A 4FFSA 3SC3A 1T3LA 1Y4SA 2F8MA 1LSSA 4WVFA 1TMOA 3DDUA 3L7DA 3OQVA 2WT8A 3M6LA 4WK6A 5EKUA 1FS5A 1OFIA 5JZ9A 3VKHA 3G2JA 4OQQA 3D2CA 1XDGA 3VR2D 3PNSA 3TPCA 2Y2UA 3TTVA 3T7AA 2GGSA 3L92A 5GGXA 4GXRA 5C8VA 4IKOA 5AP9A 1NAHA 1NY5A 2RJOA 4H7HA 4ZVMA 5JS8A 2XRZA 2EF0A 1J00A 2NO4A 2VSNA 3I6ZA 4IZIA 2UXBB 2QXTA 3BGOS 3LHSA 1ZGZA 3K0FB 3DBLB 2H06A 4QOSA 3KJXA 3LT1A 3PUIA 3X1ZA 3ER9A 2EGGA 2Q1TA 3FTFA 3JALA 4F8JA 5LQRA 4D2IA 2GVZC 2NYRA 1WTAA 2VQ6A 4MR9B 4XWWA 2CT8A 2NVWA 3VISA 2L17A 3SBXA 1YKSA 2CLDX 1X7DA 3IAUA 2VRCD 2Z1MA 3WTCA 3DWGA 2YQ5A 4QXQA 2O2DA 4PICA 4X90A 2I80A 3ND9A 4CV1A 4D0NA 2VHYA 1HH4A 4HUQB 2DU8A 1PFGA 1FFHA 4A7PA 1RIFA 2JCBA 1RMQA 2OO5A 2AS0A 4RENA 4LV8B 4P4GA 1E3JA 3QM1A 2XUIA 3A1VA 4BVGA 1SEPA 2IEGA 3ECAA 1OC4A 3V55A 5THXA 5BN3B 1QUEA 4DXAA 4S1OA 1P5JA 4J1TC 2FUKA 2WM2A 3WRYA 4EDHA 1N6IA 3H2IA 3FAZA 4ITVA 1YIAA 1N9GA 5CFNA 4GOKA 3CEPB 2ORIA 3EUEA 3QBDA 2GZHA 3BCRA 3TIFA 4W8OA 3RAGA 5ICSA 1KEUA 3L6CA 1YFJA 3VNUA 2NZWA 1VC2A 4ZGWA 2B21A 3REGA 3VOBA 4FEYA 4KK4A 3I9NA 1PGJA 5EP3A 2V7QA 1UBEA 3HS3A 4I5DA 3UMGA 5IWCA 3ICQB 2C9MA 1Z83A 4PBSA 4MAAA 2BEKA 5EJ7A 5HDQA 2BL4A 1S2LA 5I9NA 3IP3A 2GWHA 1QYWA 3ODPA 4NNJA 1QCYA 4KUEA 4RK1A 1M0EA 1WKVA 4OK3A 1L1QA 1H0RA 2GNAA 3OKCA 3OM8A 4BX2A 4IHJF 1V8OA 4JKIA 5GJWC 4NHEA 3KQLA 4QECA 4FW8A 1FCJA 4RD0A 1P19A 1P18A 1NT4A 3QVGA 4MHSA 2VUHB 1JVBA 1GV0A 2F43A 2QMEA 2K4MA 4LY9A 3DW1X 3O91A 3RODA 1PR3A 2P6NA 1CK4A 3A4MA 2DH6A 3BQNB 1JA1A 1E0KA 3N2NA 3O8DA 1QLHA 2VC2B 4KODA 3FW1A 1AF7A 1JB1A 1DS6A 3E5NA 3GR6A 1T2UA 3QX8A 4JH0A 2WAYA 4H7KA 2IX9A 3HLKA 2YWHA 1Z5ZA 4N6GA 1U2GA 1SPBS 1P0CA 3S8MA 1NATA 3BT7A 1D6JA 1Y4UA 2WLTA 3OFNA 4GGMX 4J0DA 3ICEA 1T4MA 3KB6A 1XFAA 1TCAA 3F7NA 1YZHA 1XTTA 1Z39A 1HTWA 1QGYA 2IPAB 4GE0A 2Q21A 4WDRA 1AZWA 5EHIA 4RSHA 4B75A 1IONA 2JLAA 3K9GA 1EHIA 2Z08A 1SFRA 3QXJA 2HF9A 4J03A 5JCOA 1KFKB 2IXEA 1DAPA 2H0AA 4KL8S 4QC2A 1DKRA 3CRRA 5EFOA 3UKDA 3N05A 1DX9A 2VDKB 4KO4S 4E12A 1BZYA 2PH3A 4TSFA 3UT6A 2R1ZA 4RYLA 1RSZA 3EZYA 1V3VA 1XO1A 1A82A 4N8DA 2D3TA 3GLHA 2WR8A 5BUZA 2IH2A 1BROA 3ZY6A 1SUAA 2O3UA 4DGSA 1Q74A 4ZGBA 2RDMA 1DHRA 5J40A 3SKXA 1K6EA 2ZJ4A 2AR0A 2P2ZA 5THKA 1T0BA 2MU1A 3GLRA 1YACA 3Q6MA 1EESA 4AJ1A 3KTFA 5L53A 3UJ9A 1Z3CA 4X44A 5K45A 1V26A 3ZD6A 4N7RA 1RAHA 1E9CA 1N7JA 2IW1A 4PE5B 4WZAB 5BMVA 5C5IA 4Y6LA 5F33A 5B3AA 3ZG6A 4ENRA 2FTKE 1ISSA 1ENPA 1YJ5A 4DDVA 1QQ6A 3EYAA 3MWLA 2E48A 2OYRA 1V16A 1QH9A 2OQVA 3ZE1B 1RC0A 1B16A 2RC5A 4MIYA 4NWIA 3Q0EA 2J5BA 2ACKA 3ZHTA 1E9FA 4RNCA 5CXQA 3M4YA 1ZVMA 4IDGA 4OBWA 3VDNB 2DB3A 1XCGB 4JSYA 1UAGA 1BYIA 4KR3A 3VSAA 4R2MA 2UYOA 4N76A 2E4AA 2YWJA 3FD8A 1ZEMA 5AM4A 2HK6A 5NLLA 1XPUA 1KI1A 4BKMA 2GM3A 2A9VA 1EU1A 2Y93A 3EXIA 1T1EA 4JASB 3K0KA 4G1FA 5AJVB 3KSUA 5EJMA 3WIDA 1RBZA 3ZHVA 4D3ZA 1XEXA 2XDAA 3EXHB 4FSXA 3KQVA 3T0IA 3BWXA 5FPYA 1EFPA 2R2AA 2VYQA 4M0EA 1KP9A 3QEJA 1BE0A 2P2YA 3N5CA 4WLVA 3HGMA 3INNA 5IKPA 4RLFA 5CRIA 5KUTA 3S8EA 3ER6A 4YAEA 1UZMA 1RW4A 3LPAA 4KIFA 5JC8A 3AM5A 2R5FA 5CW1A 1J0AA 2PSHA 4FGUA 4UU1A 3HCEA 1QYVA 5ALSA 3G79A 5KTTA 2WM3A 1V9CA 1Z56C 1AKRA 2ATCA 1U9JA 3ZKWA 4MVJA 4RAOA 1P2GA 2XUDA 1MA0A 1M2VB 2OV1A 4D8XA 4UU7A 1II8B 1QHEA 2JIZA 5JPCA 3RPEA 2ANCA 2PS9A 1A8IA 3NWBA 3VO9A 2WWXA 3TOVA 4E46A 1UQUA 2CFSA 1ZM9A 2CJFA 5D51S 2RHJA 3QEMB 1T3TA 1ZH6A 4TKMA 3DEFA 4BN0A 4KMMA 4F06A 3IDAA 3IE1A 2Y3IA 3OTIA 1KL7A 1KY5A 3C3XA 3ZW9A 1ND5A 1OIWA 2ILVA 2W4IA 3ECCA 3V4FA 2QSYA 1LDGA 1FA9A 3HB1A 3TR0A 1IPEA 1PNVA 2E6KA 4MCJA 3KE8A 1FTNA 1KAEA 2BFEB 3AF2A 2RJ3A 4QJBA 4DV0B 4Q7JB 1IM5A 1K08A 4US2R 4H6XA 3SSNA 3LKBA 3C1AA 2Y0EA 2HF8A 2YINC 2PU7A 3UGTA 1CR4A 2Q3FA 4RC9A 1M8KA 2RONA 3NNNA 1QIHA 5C80A 4D81A 4OP1A 2A5DA 4H27A 5IJWA 2I6SA 3BBLA 3BWEA 2NUTB 3QKRB 1PTKA 1FS4A 2WFAA 5IM4F 2QTTA 4X8OA 4DIMA 4NJEA 5LXTA 2C9YA 4H1TA 4E5KA 2CHGA 1UXOA 2GRJA 3G2KA 1A7KA 3RJZA 3H5AA 4EYOA 1QV6A 1S02A 4M76B 2ZYGA 5E4FA 3LBIA 4EKYA 2P2GA 2F7SA 2XV1A 1O9BA 1NUPA 4ZVVA 2YMLA 3NS7A 3OCZA 3RWOA 2J6CA 5IYZB 1DTEA 4C30A 2HO4A 3JVUA 2FVXA 4ZHSA 1L0BA 4JBXA 1GD1O