1EEXB

Crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
b'GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPANEDIOL DEHYDRATASE
molecule tags Lyase
source organism Klebsiella oxytoca
publication title How a protein generates a catalytic radical from coenzyme B(12): X-ray structure of a diol-dehydratase-adeninylpentylcobalamin complex.
pubmed doi rcsb
total genus 63
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1eexB00
1NBWB 1MMFB 5D5PA 3WB2A 2D0PB 1EEXB 1IWPB 1DIOB 3AUJB 1UC5B 3BRCA 2D0OB 5D5QA 3WB0A 3WB1A 1UC4B 1EGVB 1IWBB 1EGMB
chains in the Genus database with same CATH superfamily
3BGSA 1AKYA 4KQFA 7REQA 2Z9CA 3N8KA 2W2TA 5DHTA 2Q1XA 4XXHA 1B14A 4A6XA 3N70A 4DAOA 1Y4ZA 3BIWA 4JC0A 1VXOA 4S1TA 5ADWA 5LZ2A 3HSYA 5AP9A 4KBYA 3BB3A 1EFDN 3E18A 2WAMA 1MQSA 3V8VA 2IODA 2I6TA 3KV3O 1CNEA 4ZQBA 2HWUA 3B52X 1NSYA 1B26A 1F06A 1C9EA 4F4FA 2NMVA 1ZNYA 2WYIA 4MIKA 2ZYDA 1P39A 4C4RA 4D4KA 1A8SA 4H6XA 1BMFD 3JYOA 4H6VA 4IDEA 1E1NA 1E1QA 1OX5A 3LWNA 1XCGB 1V4VA 2JG3A 4PX9A 1B73A 3EEOA 1R16A 2BL4A 1U0HC 2IBMA 2XWJI 4HQKA 4M46A 4TVKA 4DLBA 1KYQA 3NBKA 2FPGA 3SQOA 3KQOA 1L3IA 1EVJA 3AG5A 3SC3A 1R4NA 2PHZA 1FW6A 3ITNA 5C8ZA 4R6XA 1H8ED 1KJQA 1SQ5A 1GV0A 4QPDA 3E6AA 4ZEXA 5BMVF 3UW1A 4EP1A 4QOIA 5BRNA 4CLOA 1P80A 2NNLD 2OM6A 4KJZA 3C7CB 4J4HA 3MA0A 2IZ6A 4RWEA 2CL6X 1N2HA 3RC3A 3ZCRA 2G0TA 4ZMRA 4HEA1 4QTYA 5FLYA 3AESA 1EGVB 1FPMA 2XF8A 3DNMA 3H7AA 1I36A 3QU2A 4PPNA 3HM9A 5E3JA 5IDYA 1G7TA 4ARZB 1HDRA 5JTUA 1EK1A 3ADPA 2YVQA 2VRWA 3AVQA 1NURA 5A06A 5CIYA 1CKEA 1NUAA 1Z83A 2CNNA 2ISQA 3K0AB 2B92A 3AF2A 5H4HA 3S55A 1LBTA 5IEJA 2IFTA 1E2FA 1XA4A 1PQ4A 2Y92A 3R5SA 4MGYR 3TBFA 5E8JA 3IBFA 3M7IA 4F0JA 3THRA 3BQMB 3FSGD 2LGJA 2J6IA 2WP8J 3MJDA 4UFNA 2ZFUA 5AT1A 4HY3A 5KTTA 2IPXA 4YRNA 3F7NA 2XGOA 3X1JA 3L82B 5ESDA 2D2XA 1MO5A 1AU9A 2P41A 3SJBA 5FD8A 3NVMB 3VDQA 2IRWA 3PHLA 3IEMA 3Q0TA 1RXSA 1U8TA 3L7KA 4EOGA 1MAWA 1XU9A 4QLBA 1YBHA 1ND6A 1KBOA 2BKEA 4JL6A 3BF8A 4RYLA 4YT2A 3DQQA 3M3HA 5TMDA 2NQ2C 1ZW6A 2YXDA 3NYQA 5HJ7A 5T7BA 2M1XA 1RYYA 1GQFA 4Z7JA 5AVWA 5KVQA 4K9LA 3N8HA 1XYGA 1ZH2A 1JP7A 1PAUA 2GAJA 3PUZA 2BWJA 2BHNA 4CT5A 1UJ6A 4YIHA 3FX2A 4ZVRA 3OJOA 1GU1A 3DW3X 4Q4CA 2YVLA 1POWA 2DR3A 3HGMA 2X1VA 3L7MA 1G66A 1VSTA 4BFLA 2VUUA 2X1HA 3ERCA 2WWTA 3K4HA 1JDZA 1JKIA 2WJIA 4UDXX 1II8B 4YEDA 5H81A 2QUIA 3LFUA 2AR7A 3FWZA 2F67A 4MSUA 3O9MA 4PSUA 5LZ9A 1JHAA 4O5OA 3TG2A 4AY6A 3LX6A 1YJAA 2PUHA 4TPKA 5EXEA 1E2DA 2H1FA 2P1DA 3S0JA 3HMQA 4I5GA 2HYDA 4PSVA 1BX0A 1BS2A 3HPRA 4RVDA 2XT0A 2P9TA 5K0CA 3IODA 1KKMA 2OCLA 2Z04A 3KT6A 4F04A 5FEMA 4QDKA 1B15A 3RTGA 3SQXA 4RH3A 1G8PA 3PBKA 3PXAA 4ERNA 5FL7D 4UARA 2BKUA 2NU8A 4HN2A 2QI9C 4DR2B 1AO0A 1EINA 2CVQA 4M3NA 2VDOB 3CJQA 3IA7A 1OLOA 3IP3A 1PS9A 1VHTA 1E0KA 2B69A 4GXQA 1CIVA 1U6IA 3MMNA 4PSAA 3OJWA 1FLDA 3RUDA 2ZVQX 3EWAA 1UWKA 3IERA 2Q3MA 5EINA 5CITA 4Y2RA 4RGBA 1M3SA 5DLEA 3ZUGA 5CDFE 1WETA 1AQIA 4HWOA 1ZD4A 2J5XA 5H68A 5C34B 1UPBA 4QM6A 2FP4B 3A0UA 1F5SA 4I5IA 4RTOA 2G8LA 5SZJA 2NZUG 3LI2A 3GLSA 1TF7A 2HWKA 2ZQ5A 5B1HA 2WHYA 3RSGA 1N34B 1E62A 2YV2A 4QWWA 1RRCA 2GAIA 3ZDBA 4O2AB 1E2JA 3B7PA 1MHPA 3HLKA 4RK1A 5AKGA 4MI1A 3OA0A 2ZJAA 4AKTA 2P7IA 3EGDB 1JIXA 2EDAA 2B4YA 2BLLA 4JA0A 4HK4A 5FUWA 3JQRA 1QQ5A 4Y67A 4F5ZA 2FV8A 2CVZA 3KL2A 4S0XA 1K8ZB 3QWBA 1I6KA 3HUTA 3PC8C 4D3YA 2J3HA 3N2LA 1AG9A 2MSEB 4JENA 1VPEA 1J7JA 4IUDS 4Q1VA 4NQZA 4LHWA 4Y2QA 5HRUA 3P9ZA 4DCSA 1E60A 3GJQA 1NX6A 4PGHA 2B8EA 5JMPA 3KNZA 3HU5A 3MQ2A 4HLUC 2XZPA 4KP7A 2VWHA 4CU5A 2ZSAA 2WVGA 5HFAA 3LS2A 4X61A 4M21A 4EG5A 5C7YA 5ALKA 3WL3A 4KR9A 3PR2B 1L0BA 1ISRA 5TXGA 2WJWA 3DYIA 2QZ9A 3MIIA 3IUBA 1GCOA 4N76A 3K8QA 4TL9A 3IILA 2C0QA 3ROZA 3UH0A 5CP8A 3BBLA 4B44A 1TU3A 3RC9A 3ZYCA 3T52A 3JQFA 5FPHA 4M0FA 3N5CA 3IFSA 1FSGA 3L05A 3PS9A 5FBWB 3C1TA 4ANFA 1TAQA 4OA5A 4U7WA 3BH7A 4JSTA 3REFA 3CVWA 4YRLA 4M0DA 1MENA 1EM8A 1NPTO 4WDQA 4P58A 2G6BA 4UVGA 3RLFA 1G60A 1ZK3A 5K8VA 1XQ6A 2RBGA 1XEAA 4RTQA 3AL3A 1PG0A 5A2QA 4QREA 3TQHA 4EFMA 3B2QA 4DLNA 2WMDA 2JHGA 2JKVA 1SXIA 5GIPE 2VATA 1I2AA 1Z37A 1A27A 3WLNA 2O3SA 4AB1A 2QQ0A 1G5HA 3BMCA 3CUSA 2YRFA 1GQRA 1FU8A 2GK4A 1ZK0A 2QBYB 1G0OA 1T10A 4OBXA 1XZCA 1VM6A 3KZOA 2KBEA 5BORA 2G9QA 3JQPA 4K3VA 3LXRA 5TR9A 4QOHA 4S2EA 5B12A 3FIUA 1DPGA 4DR7B 2AMYA 4RDCA 1X1EA 2ERXA 3PVZA 4L50A 5ALDA 5CXQA 4FGZA 1G42A 4JSYA 3KJHA 2VK8A 3M0EA 1SY7A 2GBFA 3K9HA 4EWLA 3HWX1 4ZYYA 5TMBA 3DJFA 5M34A 4NJEB 1YSCA 4X41A 2IXGA 3HL4A 1ONSA 2PZLA 4HX9A 3UPUA 1UPTA 3QI2A 1XTIA 5BQ5A 2H59A 2FSIA 3RS0A 4R7TA 3W7VA 4ZZ3A 3EGCA 3IP8A 3W7BA 1HQKA 2YVKA 4IWNA 1R4AA 3R8CA 1QE3A 3BH0A 3ON5A 5J23A 2WUFA 2EGGA 4OB8A 3GIDA 4MP6A 4DRZA 1TB4A 2QE7D 3L7LA 4WZAA 2IA5A 4FMDB 3UV6A 3WRYA 1ZM3A 3Q7RA 1OWOA 3O9VA 4FHDA 4IZ6A 3OJFA 1YDFA 4MRVA 4HADA 2ZJ8A 4YFVA 2WR8A 3ZDFA 1DRVA 3K9LA 1T5DX 3VU8A 3TW6A 2O8BA 1PT9A 3CE6A 3RYIA 2A35A 1QNFA 2IOFA 2JC3A 3F6PA 1U7ZA 5ICMA 4MW9A 5JYEA 5KO2A 3DMGA 3ELWA 4YPVA 1NBWB 721PA 1MO6A 2ATCA 1YAHA 4H18A 3E15A 3N0WA 4DXHA 1QH8A 3TEMA 2ZTVA 4A16A 4G65A 5K51A 2PA3A 3V8NA 4O2AA 4HLDA 2Q4OA 3EX7C 3LCCA 2A0YA 1RQLA 2J33A 2I4OA 3R2JA 3VYVA 4URXR 1P8AA 4UNQA 4TMYA 3DULA 5EUMA 4ZCRA 4UVEA 3ZEIA 2JIQA 2ODNA 1QO0A 3UAVA 4QXRA 4EJ6A 1U90A 1GXSA 4L8FA 3THWB 4UKDA 3A9WA 4KGDA 4RTJA 2EYUA 1Q0TA 1DQRA 2ZBEA 5EIXA 4X85A 3VKHA 4NATA 4PVCA 4DUGD 4K87A 1M54A 3IAS1 5EWMB 1Y6GA 5KYYA 4S1WA 4MV6A 3GP8A 5HVNA 2NUTA 3O2QB 2CW5A 2JGRA 1SD5A 3FDZB 2CVHA 3GA7A 2XAAA 2B5WA 4JZYA 1V37A 5BSMA 2YOHA 3R6LA 3WZ2A 4E4TA 1OYVA 2B8TA 4LNHA 1OQAA 3PNVA 1S4QA 4KN5A 4KQEA 3T5BA 3W6ZA 4BUCA 3PLNA 1XDGA 1PEYA 3DLIA 3M1IA 3PQ3A 4EKDA 3PUWA 2DTXA 1QQBA 3GRKA 2AI1A 5AXCA 5HF6A 2I4IA 2L19A 2HK9A 3CUTA 3R9WA 4B43A 3TVDA 2FMTA 2DY0A 4PO1A 3WGGA 2C4UA 5JANA 2BH2A 3P27A 3HGTA 3RM3A 2OPBA 3OQHA 4RGQA 5EPOA 1UK6A 5AM2A 1OLSB 2Q7XA 2VYCA 1E4EA 2FWJA 5KQSA 1FJHA 3Q3CA 1HRKA 3N2KA 4GVLA 4DA6A 4JV5B 1GTJ1 3FE2A 4P9NA 3NH6A 1CK4A 2QQFA 5IARA 2GBLC 4NU6A 5HE8A 5M3BA 5BW4A 4AJ1A 1UJBA 3UJ3X 4ND7A 3RS4A 3E22B 5F4ZA 2QLFA 3QPWA 2E5LB 2R85A 3X44A 3BD8A 3DUFA 5GPBA 2UDPA 3QE2A 3RS8A 3OZAA 1M1YB 1PDVA 4KX5A 4NE7A 2YNMC 2ZYSA 4IHQA 3DTTA 5HX7A 1YIAA 2ETXA 1JIUA 4BLTA 1EU1A 3VI3B 3I5YA 1N3YA 3O3CA 4R4JA 4XYLA 2D1FA 1SB9A 3IUPA 5ER6A 1PJRA 4IZIA 1B2RA 1R0SA 2QX7A 4FYYA 4ND5A 4TVBA 3QLVA 1SUDA 5SYMA 2H92A 2D8MA 4MYUA 4FN4A 4TUYA 4YX9A 4ZQFA 3S1AA 2HQOA 5AM5A 1RKBA 1HOTA 5ALFA 4JZKA 1O1YA 3BHJA 4AJ4A 5LJLA 2O8NA 3LDUA 4HYYA 4WCDA 5REQB 1JIKA 4DJFC 1KRXA 1TM7E 4FILA 3HCFA 4H6WA 4QUKA 1SIUA 2Q4BA 4BCBA 1FSPA 2RH5A 2CC2A 1QYIA 3QMMA 3K2IA 1XTTA 3FD8A 5EERA 3EGDA 4XPIA 4LNUB 3MYRA 5AUNB 3HB9A 5HKOA 4AT1A 3EXFA 1EX7A 2AFVA 1L4BA 1SOWA 2D0IA 1BJRE 3HBFA 3ZQKA 1Q7TA 1QDUA 3GFBA 3DOFA 3EPRA 1U9IC 2X4GA 4R05A 3FCOA 3UUWA 2AZTA 1KYVA 5LA6A 4LBYA 2OQVA 4ZCIA 4ER3A 2IH5A 1SWVA 1WNFA 3HUFA 3FKJA 3NPMA 2FETA 3NT4A 2C98A 4DLRA 1JAIA 3OKCA 2RGCA 3G2KA 2D62A 2O2HA 3WNCA 4KACA 3I2HA 5G41A 4QXAA 4YLYA 3L8HA 2ZJ5A 2HR1A 1M0EA 1IBKB 1ESZA 2VWQA 1NUTA 1Z2OX 1CUXA 3OIYA 5JT1A 1XMOB 1JSCA 1LQUA 2Y68A 1RYHA 1HG0A 3QWFA 2ERCA 4K5QA 4V2IA 4HPXB 5CK5A 2BE7A 2QAGB 4ZVLA 5LKAA 5KIAA 2JNWA 3TLJA 3ADOA 3WYFA 1AXGA 2GJSA 3BH6A 5EE5B 4ZAWA 3WTBA 5JYDA 3ORFA 4KNVA 1ZMTA 4QNNA 3KEOA 3LXXA 3MZ0A 1FNDA 4OJTA 1PEAA 2CD7A 1I80A 2JRLA 1K3TA 2ZUWA 1S2LA 2DRIA 3M6XA 3O8QB 4MK4A 5IJXA 1NR1A 3I61A 4JJZA 1LSSA 1U81A 1QGDA 4N7BA 5KOHA 2HQRA 2X7JA 4JLAA 3RT1A 1JQLB 1WG8A 3OTHA 4TL6A 5JDCA 4H60A 1F3OA 4BN5A 5B7NA 3D4LA 1HL7A 3AYXB 5A4JA 4MDFA 2Y76A 4KO3S 5KKAA 5EUBA 3SYKA 5EHQA 1VPDA 4BZZA 3FUCA 1UQTA 2G63A 1R3UA 3AY7A 3CIFA 1U8UA 3GGDA 3OE5A 1NWCA 2J48A 3ZIAD 2H1CA 5TT1A 3WS7A 4ZI7A 3AM1A 3GNSA 3BEOA 1XJ5A 5A4MS 2Y71A 1RQXA 3KQYA 2O20A 2HLHA 4NH4A 1N2BA 3OAAA 1V2HE 4NK4A 4UHKA 2PZFA 4G1UC 5FFNA 4D8XA 3W90A 2AI3A 3H1PA 1GCAA 4EHDA 4GC9A 1SZDA 5DYNA 3PHHA 3SR3A 1K86A 1UP4A 5L40A 4BRZA 1UXIA 1ZZEA 4RPHA 1E1QD 4RJLA 4H77A 5GMOA 2FWRA 3JZDA 4D3DA 2VJDA 5F73A 5THQA 1V3TA 3PEYA 1J9EA 1CY4A 3WNZA 1CY6A 3N3AC 1E59A 1QS0B 2GN4A 4ND3A 3AMVA 2WICA 4NMHA 3W3ZB 5IULC 4EI8A 3IHWA 4HXGA 1P5HA 3CTMA 3FRJA 4IX9A 1IU9A 2J1LA 4B6OA 1K7XB 1IPHA 3MQFA 3VPAA 1DE0A 2PWBA 2YQ4A 2JGDA 4Y2SA 3DDHA 2PYDA 1DIRA 1R88A 1XDSA 1R00A 2V0NA 4XQ0A 3ZCUA 2H8GA 3I30X 2IIBA 4HLCA 4BGEA 4LTMA 3MLBA 4GI2A 4UXHA 2IW1A 4OBBA 5DE3A 4AMVA 2DERA 4MYTA 4DMRA 2EKBA 1Y98A 1Y1SA 2R66A 4OVKA 4QT0A 1XHLA 3OLZA 1NXPA 1V47A 1ADJA 1T4BA 5L7TA 2BT4A 2J9FB 2ZRGA 2YY6A 1RAIA 3E4CA 4HS4A 3FNGA 4XFKA 4CCYB 1TDJA 1MD9A 4DF3A 2XCSB 3BYZA 4H0CA 2FE1A 4L3WA 1EEXB 1I1OA 2PWZA 2YUTA 1UJCA 4F45A 5FWAA 4TZ6A 4NG5A 3PQEA 1TMKA 1SXHA 3CH7A 3D54D 3Q7IA 3HDJA 3UQYS 4GECA 1R0RE 2SECE 4ZAZA 4F9GA 4RV9A 4QQNA 5D2CA 5JH7A 3SCZA 2JBHA 2JFNA 3ZQ6A 2R1VA 3EASA 2JJMA 3VHRA 2F00A 3QPDA 3HDGA 2C7VA 1TQ2A 2WJ3A 3A36A 4JT8A 3V2UA 5M29A 3I0MA 1S2NA 1F1BA 3IJPA 1J20A 1F0KA 3I6YA 4NZZA 3KVRA 3RRYA 1ISIA 1A5BB 4JR2A 2FFBA 1JAZA 3FVTA 5HR5A 4DDMA 1DCFA 1GRNA 3TMKA 2H2FA 1V7ZA 1P74A 2WNHA 4HEHA 4XX0A 3RUIA 1RIIA 1QWOA 4DVJA 2JGIA 3BAFA 3FWHA 2C1ZA 4K86A 3K9FC 2DR0A 2JK0A 2QLLA 2H5EA 1M6YA 4S1OA 3WQRA 5AHRA 1GPH1 1GQOA 3HZHA 3KG2A 4AK9A 1Z0IA 4TRJA 3R3HA 3ZWYA 1TGVA 3DE7X 3FOFC 3T3GA 3N59A 3GEPA 5I6DA 4BVHA 1N0WA 1XAHA 3O4FA 4LGVA 1SC6A 1R5BA 2JFWA 2WKSA 3QXCA 4PHGA 5EXSA 1IM2A 3DO8A 3SM3A 3RVNA 4NI5A 5LD2B 3PEUA 4HDKB 3P9IA 3EY9A 1GCGA 2GHRA 3BEDA 3G1UA 3IPYA 4BVKA 4YTEA 5A1JA 4RULA 3TH5A 4W5QA 2MSWA 3SG0A 4KO2S 1NJ5A 3R0QA 5EG5A 2QD3A 1WB4A 1AS3A 2ATIA 2CGEA 4MUGA 1G8KA 4XOIA 2OV4A 4MNTA 3HCDA 2R7KA 4KYTA 2OYCA 3RVMA 4BEBA 3M6IA 4F1WA 5E4JA 2VQDA 5TEVA 3ZZUA 2G80A 5F9HA 4CIXA 3RE1A 5AKHA 2QORA 1TRKA 4XLZA 2RMKA 1VE9A 4YMHA 1ZCFA 3PF9A 3LC2O 3PL1A 4RV5A 1BQEA 4TYPA 3M83A 3DKKA 5K3BA 3DLTA 5F64A 3ZKAA 5LDDC 4DR5B 1E1CB 4KE7A 1U0OC 2XAUA 3IXQA 1XP5A 2O23A 3DMTC 1Z8HA 4EPWA 5IPFA 5A7FA 3L84A 2ONCA 5AOVA 1ZGBA 3K70D 5IH7A 3K5PA 3E9ZA 1XB2A 1NMSA 4OI4A 1J2RA 3TTXA 5A71A 1IQRA 1VLLA 3FNHA 5JD4A 3TQRA 1CQPA 4PRKA 2O1EA 1ZK2A 4X60A 1N2EA 3WLRA 3NUGA 2B9VA 1XLTA 4GDMA 5JCOC 3TL2A 4WKPA 2EKZA 4FFPA 4V03A 3RIMA 4BNKA 4B3MB 2WFZA 2PL3A 4FE3A 4L95C 4A0RA 3DE2X 2QVCA 1SHZA 1VBKA 5D5HA 4YAIA 1W96A 2F59A 3LK6A 1EUQA 4KYUA 4L74A 2QVZX 2C77A 1SVNA 4ZODA 3AUYA 4YMUA 1QS0A 1F8FA 2HSJA 4QWMA 4MV8A 1Z8DA 2ZQYA 3E3NA 3IE1A 1YA8A 3OEYA 2Q5EA 3H86A 3GMDA 4JFRA 2BMWA 1NQXA 1LK0A 1AXRA 1KEUA 1SZCA 1VA4A 1YQWA 2V7GA 3NHUA 3K1ZA 3OT1A 4NPHA 4UU7A 4X8HA 1JS1X 4EQ6B 3TZEA 1TK2A 4GR4A 1UH5A 4NYJR 3JY6A 1CERA 1LC3A 4C6RA 5JXGA 1X6VA 1G5TA 5J4KA 3MB8A 4HWTA 3EZFA 2WUVA 3BSSA 1P0IA 2YZ2A 4GMKA 1V9SA 1LFAA 1BG6A 3JAWB 2AC4A 2GZHA 3MJCA 3H4VA 1Q1ZA 3PD1A 3R40A 5DGIA 3TWOA 2QR2A 5F5LA 3BGVA 2ZQZA 4C0XA 4E5NA 1UJNA 4MO9A 5B6IA 2NOAA 3TJZA 3UMSA 4BFXA 5EQJB 5LQAA 5J2TF 4XWAA 3A2MA 2O7QA 2GN9A 2I7VA 1YU6A 2WWYA 3L79A 1Q95A 1J06A 5D6OA 4J3JA 2IXAA 3EWIA 3ZV5A 3TNLA 2JZOA 4F11A 2Z1DA 2XXAA 3JQ9C 2VUIB 1N7JA 5LBUA 4PAMA 1X7XA 3D6NB 2DE0X 1RQGA 4MB2A 4XRGA 5L6LB 1SURA 3CZRA 4FFWA 1OZFA 3S27A 2O2DA 4ITVA 4PV7A 4XARA 1RKQA 3WFZA 1XZIA 3HYSA 2CY0A 1D09A 1ZCBA 3W9SA 4F5EA 5CFPA 3FKQA 4AJOA 1GG9A 3GN1A 4NS4A 1GKYA 4FXPA 3VZCA 3R7SA 2R1UA 3IQHX 1QV6A 2H9AA 1NXOA 1G5RA 1H0KA 1Q6YA 2DCMA 2O2XA 2YFQA 4ISBA 3RC7A 3TIIA 4V1CB 4NYIR 2ZUBA 1KZGB 1JJ7A 1RXIA 4GLOA 3T94A 3KZVA 4KCGA 4HJRA 3HXTA 2JFOA 3I23A 1B43A 3DH0A 2WRZA 4XEUA 3SQDA 3GJ3A 2GFIA 1RAGA 4W5JA 3A14A 3AQ4A 1JNXX 3AHDA 3MMPA 3QM1A 3CF0A 2QROA 4HVCA 5LMCA 2F1RA 1N5OX 3AF1A 4I4TB 3QU5A 4JWTA 2P79A 1DDIA 2YV1A 3DPIA 2HSGA 4X93A 5L3RA 3C7TA 3X1KA 4D5GA 4GZMA 5CPBA 2ID9A 1QE5A 2WMNB 4O4HF 2VZ8A 2BFMA 2H2GA 1OV4A 3BCHA 2XUGA 4N18A 3SS7X 1V5GA 2F1HA 1JHXA 1UM9B 4M0UA 4D92A 4DARA 4W99A 3RAGA 1QNLA 1WW2A 2TYSB 3UQZA 1W6UA 4WLUA 1JTEA 4U5XA 4MV0A 4MR8B 3T9BA 2V55B 1LV7A 2QT9A 1HETA 3LT0A 2NTNA 2N1MA 5P8WA 4CI9A 4X24A 1QOPB 5JC8A 2JARA 1GLGA 2FGJA 2VHTA 3CPSA 1Y5NA 4GKBA 4OO3A 3T3OA 3HKEB 3GG2A 3IDOA 3O21A 4NJMA 5E2BA 3V2GA 3V48A 2WU0A 1IHYA 2QM8A 1E4VA 2B8NA 5BN4A 3Q8MA 1ZS9A 2OXTA 3C41J 4QHSA 2DSTA 4WNIA 2ONYA 1VE3A 4MKZA 2A7QA 1HA3A 4OFWA 3VNUA 3TR6A 2W2OA 1ITZA 1FZQA 3NC0C 3L4KA 5LQSA 5T64A 1L4KA 5KNDH 3TX2A 1H8HA 1YZHA 1WULS 2Q62A 2ONJA 3UFXA 5CDHA 1XN1A 2GXSA 4WTOA 3V5NA 2ZM6B 3PHCA 4FNMA 5DHRA 3RHTA 3VISA 2RARA 3OQMA 1PL0A 1KQPA 4JCCA 4YQZA 1GLNA 1D8TA 4MR7B 3WRVA 3QOYA 2ZROA 2ZG6A 3ZVNA 1ND5A 2Q1UA 4BMSA 4WK4B 5GM2A 1TPYA 4WOKA 1UAGA 4QJ5A 1JXOA 4H1UA 4UAJA 1L5NA 1TF2A 5LQJA 4LYEA 1KC3A 3N8DA 1E1DA 4UTXA 4TS1A 2XVAA 5LP6C 2NG1A 1Z5UA 4TQUS 1N7HA 2QXUA 5CVCA 4JS0A 5AIAA 1E20A 4LWZA 1MOQA 3LLVA 3O8OB 4DLUA 2J41A 3JALA 3G8DA 4JNKA 5F23A 2ZKLA 5AHXA 1UZUA 3WVNA 3L43A 3QPUA 2ZYWX 2D0DA 1U9JA 4HLUA 3R7LA 1Y1RA 3CCBA 1LSJA 3GJ4A 3I6BA 4QKQA 2H1RA 3LQYA 3ZHOA 2D2IA 2DFNA 3CNHA 3I42A 4DLXA 1EG2A 3L1JA 3ZKWB 4F1KA 1PIWA 1Y4UA 3V80A 2ZIUB 1KQOA 4MHSA 4J94A 2CBXA 1I6MA 3OF5A 1NVUQ 1I2DA 1O97D 4HL6A 3VPDA 3OPMA 4X6XA 5CG2A 4P81A 4R01A 2O05A 3LGSA 3TTSA 1W1WA 2Y1CA 1J2JA 3KDSE 4CHTA 1Y8CA 2BELA 3GAMA 3JQFC 4OD0A 2ZRDA 4YBRA 2J08A 3AY3A 4AN1A 4L1KA 1A8QA 5JFTA 5E3HA 4NU8X 4CZ2A 4OG2A 2X8BA 1QKKA 1C9KA 5G0VA 5TSDA 4REMA 3HDYA 3NAZA 4M1KA 4OJMX 3H4TA 3ZHXA 2GYWA 5F2KA 4XWTA 3G82C 5I9TA 4PYKA 4HDMA 3PD0A 2WOOA 2XVZA 1A9RA 3MGCA 1DBSA 3G8CA 4X6UA 3WGIA 3WE7A 2DPMA 2PRIA 1HDCA 2X6QA 4BDTA 4TQGA 1XXLA 2NSHA 4W9NA 4N9WA 2V0GA 1ZFNA 3RS7A 1HORA 4OM7A 4JR0A 1DQNA 5D7NA 3E9NA 3OO0A 1L5RA 2VYQA 2W2NA 5EKXA 4AG5A 1RPJA 5CGZA 5C0OE 1T4CA 4YUZA 1Z4IA 4DQVA 1AB5A 1CY2A 2BF7A 2IYXA 3GZTB 5KSYA 1ZRNA 3RVOA 1M6WA 2V58A 3AU8A 1FDSA 1TA9A 3GEIA 2BJHA 5FBKA 1RJDA 4GPZA 3OY2A 1J8VA 3ZGXA 2WIDA 3K9GA 4DA8A 3H1EA 3IV6A 1US8A 3GEBA 5AHWA 5CAEA 5GZ3A 4IYJA 1HL3A 1FFCA 3KRTA 3LY7A 2OQ2A 2VBGA 1X1AA 3FPFA 5EQTA 1NPDA 3D8TA 5FWYA 2P67A 3CEPB 2XDYA 4KPUB 4MUNA 3U17A 4Z6KA 3LX4A 4EYKA 2B3DA 2XB6A 1LJ8A 3G2IA 4GRAA 4W1RA 1H1TA 1Z8NA 3KAKA 4EKGA 2WAAA 4CM4B 4DC0A 1ZMRA 3EZGA 4RSGA 1VZ3A 1PJBA 1UKBA 1W0JD 4GMGA 1PVDA 1K8YB 1BH2A 2JFFA 1P9NA 4NBLA 3C3MA 3KOUA 4DWWA 4F46A 1SVWA 1Z4MA 2IPOA 1SBHA 3O2SB 3B6ZA 1B6SA 2ARKA 5CFQA 4I4CA 4Y18A 3ZHRA 2OZLB 1K7YA 1CJVC 3I37X 4REOA 4HDAA 1GKKA 5DASA 5BUSA 2NZ2A 2RDMA 3PWZA 3HKDA 1C9YA 3WK9A 1MF7A 1TTQB 2GTIA 4QASA 1PV4A 5JSYA 1EJBA 1J8YF 1A7UA 3FGNA 4IZHA 1C3OB 3CCFA 3LZ6A 2FMIA 4G1MB 3ZV6A 2ZSUA 3ABSB 4AN4A 3DTNA 1QAOA 3FOAA 5CDYA 4M9ZA 1JLRA 2ZI5A 4P5DA 5B37A 4DSUA 3RS3A 3H83A 4PR3A 2WNIA 5DM0A 3A27A 2FQ1A 3SQNA 1HLPA 1W8DA 3RBVA 5AIBA 5H9WA 3SSMA 1D9XA 5C80A 2QJFA 5FLXA 1NYQA 1TYZA 5EXPA 4BPBA 1QB8A 3BHMA 3GRAA 5E7MA 1RWNA 5DFAA 3ZN2A 1OH8A 1G9TA 2YY7A 3T5DA 3ZHQA 1HDXA 1S8AA 4I19A 3JR3A 1XQWA 1O54A 4PC2A 3VMFA 4BWFB 1K5GA 2X2OA 3TXYA 5DTMA 1NDQA 1U8CB 2WKQA 3PNMA 4WCFB 3V4LA 3RVDA 1X74A 1GM5A 5AOAA 2ODPA 3GLFB 1F6DA 4OJNA 3LRTA 4UJ5A 2QYOA 2NUAB 5BXQC 4AY2A 4Y9UA 3RQIA 2RHCA 3ZC3A 5GIOE 3OEED 1YQXA 1E5TA 4YI3A 4ZT5A 1TYAE 4UTVA 2X9VA 2X77A 4HVAA 2XODA 2XKBA 3R0IA 2VJMA 2C57A 1RWBA 4PPQA 1XDBA 4WJLA 5FBLB 4TYWA 1FDWA 3G8BA 1SKQA 3EUWA 5GJCA 2ADFA 1COZA 1XALA 3B48A 5GONB 3UNXA 2NXNA 1XZLA 4KXLA 4DDWA 4YXWD 5EHXA 1RI1A 2CCGA 4IJMA 1RXVA 3N53A 1KDYA 2E2WA 4FGJA 4I50A 4ALIA 3HJTA 3DAOA 4JAVC 4WXEA 4B9EA 2JIOA 5IWAB 3USES 2WAYA 3GA5A 4TS4A 2VF7A 4U7DA 3K0HA 3BMOB 2Z8YA 3RRXA 3DQPA 2C5BA 3MCVA 2O07A 2YOFA 4QFDA 4RADA 1YTLA 1UMBA 4UCFA 3E7XA 1RC0A 3R77A 4N5IX 2VPIA 4H3SA 4YBZA 5B2EA 4NYMR 1AB6A 3OT5A 3OLVA 5BV8A 3F6SA 3NB0A 1FFEA 3KJQA 4O4HA 3K70C 3ZQJA 3DHEA 3NKFA 1UMDB 2OCXA 2QUJA 4IV8A 1J70A 1Y4SA 4L07A 1Q21A 2BP7B 5BN1A 4LVUA 4JB0A 3ZWXA 221PA 1GR0A 1Y8RA 1JIJA 2OA0A 1J39A 4BECA 2C2HA 4P4LA 3ZU4A 3BRCA 3PQ6A 5FWNA 1P29A 2GPYA 2A9FA 2RC5A 1QQ6A 3K5WA 3H6HA 1E6LA 2WD8A 1TLLA 4MI9A 2QQGA 2ZZKA 3WTCA 2ZB2A 5C8YF 4R6WA 4U02A 4LC0A 4O4JB 3P97A 4CV2A 2Z09A 4RQAA 5AK3A 2OFFA 5I7HA 2YDXA 1HR0B 2TSYB 2WDZA 4OXNA 1J0CA 4LCEA 4ND8A 4U2GA 2R11A 2CB9A 3DR3A 3LG2A 4MEBA 2VPQA 4BCCA 2OCBA 3JYHA 4Z5XA 4RE6A 1RLIA 1RJ9A 3WP1B 2CXHA 3EFOB 4ZAVA 5IAGA 2QTLA 2ID4A 3UPDA 4EVRA 5DTIA 3BE4A 3EVGA 2EF1A 3DO6A 4DBLE 2BI8A 4RVUA 3U4CA 1RYZA 2QTVA 1IJBA 3EUEA 4RJIA 2XUQA 1UINA 2JHFA 2XTJA 1AVTA 5MF6A 3AVPA 3ZJYA 1DINA 1H9CA 2QTTA 3D8BA 1F2DA 1VE6A 1DFHA 1DC6A 1MJGM 3VR2A 1ENZA 1OBHA 4L4YA 1WZUA 2IV3A 3LQKA 2C7PA 3UOWA 4DC9A 4L6IA 4YGYA 2XIJA 1GR1A 3CZMA 1NR5A 2Q5FA 2VHJA 1AKWA 3I05A 3CZPA 3MRTA 4KWTA 4CM9D 4DA0A 4DN6A 4FD2A 4L16A 4E0BA 5KTPA 5KOYA 1OAOA 1W5SA 3L1HA 1O9HA 2MSCB 3NEAA 5E9WA 1KIMA 1USIA 2Z4SA 3E61A 1P1IA 3VH4A 3WIEA 4CMAA 2IC5A 4IHAA 2QX9A 3ZJ5A 3PGMA 2JCVA 2RBEA 4UOEA 2WTMA 2QQ5A 3CNLA 4H6PA 2C9DA 4GHWA 1YT5A 1VL0A 2DFLA 1SXJC 1DIHA 3I2YX 1IIRA 2RHTA 3UH1A 2XQJA 4JLVA 1AUXA 4S24A 1QYXA 5DP2A 4E5UA 3ZQ4A 5MDHA 2W42A 2WJJA 3BZUA 2FMXA 2V6BA 2Y6VA 4EFDA 4GVXA 4YUWA 3CN7A 1CQIB 2BGMA 4Y2XA 4F7DA 2GZMA 4G0XA 1E2NA 3UJNA 2PQ0A 1PZGA 1UM9A 2A5YB 2VLBA 3GROA 4OMUA 4CM1A 5JZOA 3ESRA 3ZZTA 1G2QA 3LOPA 4E15A 3TCNA 5HIKA 3TAXA 3UGTA 4ZC8A 1T0UA 4RJJA 3X43A 3F5QA 5CLJA 2JLSA 1JEQA 1L5QA 1XLTC 3CR3C 3JARA 3STYA 4Y1RB 5BSEA 1TUGA 1R8XA 1NSFA 1H0RA 4K0RA 2NP6A 4CLEA 6REQA 1DJPA 1QBKC 3RYFA 3WQHA 1A69A 3U16A 2Y0CA 1UKEA 1NAIA 3HRIA 1IEQA 1GNPA 1C7ZA 4XUCA 5JJKA 1M0TA 3OQNA 4LY3A 2N3ZA 2R68A 1MZVA 5ECGC 1MJ5A 4OQNA 3VTKA 2HMTA 5JC1A 1QXSA 1ZBQA 3BKWA 4ZREA 3JQGB 1J8QA 3HO8A 4L3OA 3MCZA 2ZCJA 2HBQA 4W8GA 5JNTA 2H2DA 3PHIA 4YMIA 1C3XA 3GJRA 1G17A 4FCVA 5FTMA 5KWSA 1ZN2A 5B7QA 3BT7A 3IUMA 4UEOA 3G9QA 1MR3F 1VL6A 2JLAA 2HCJB 3K1AA 3ZE7A 4AZ3A 4C04A 5EIBD 9GPBA 3CEMA 4GRDA 3VYTB 1Z45A 2KQUA 2G1JA 4FWTA 4KGVA 2VFAA 2WMYA 1QRTA 2E3JA 2F7SA 1WM1A 4B09A 2EGHA 1A77A 2OXCA 1L5OA 3M2PA 5JRZA 1ZYUA 2R6FA 2BCEA 3TLEA 2HIMA 2IIQA 4D56A 4KMOA 1G5IA 2R7AA 3C6MA 4I36A 3GGSA 3DEJA 3KKNA 2H2AA 1TIPA 2BFCA 4MB0A 2ZGVA 4LDZA 4MVJE 3NU1A 1NP6A 4NCJA 3THXB 1JRLA 3L6CA 1S8NA 3HM2A 1MJGA 1KYTA 1MFZA 3LT2A 2IXEA 1PGNA 4Q9LA 1N33B 1ZD9A 2F8LA 2PH7A 2GJ9A 5EC8A 3DV0A 2B61A 3BRWA 4YAEA 3ILHA 1FBTA 3DLPX 3HXKA 1GUYA 2DWQA 4B3GA 4J0CA 2FSVA 2OP1A 3WK8A 2J0VA 5KVVA 4QM7A 1DPFA 1WUYA 1Z74A 1WSWA 4CCAA 5KCZA 1A9YA 3DLBA 3KYCB 4AJLA 1GZ5A 2DFPA 2Z3VA 4JEUA 5FCDA 5C1OA 1TIKA 1O6GA 2W0MA 3UXEA 1H69A 4F60A 4WY5A 5ITWA 2FPOA 3FTNA 4MUHA 2PZEA 2I6UA 1XVTA 1SU4A 5FULA 3LLCA 1QZXA 2HM7A 3P71T 1NW9B 4DR6B 3DBRA 3VYSB 4HUTA 1CY8A 1GZ6A 2BY4A 2NU7A 2V7BA 3AUJB 4CODB 4QIHA 1ORIA 4IXWA 1X1SA 1JLSA 1GITA 5JSQA 1E5VA 5LWQA 4I2VA 1PBTA 1WDTA 1SA0B 2ODQA 3CLSD 4YJGA 5JVDB 2YWGA 1LA2A 4IOMA 1XKXA 2HMAA 5DTRA 3WYAA 5JI2E 4Y1GA 4LRYA 1ISHA 4B3SB 5DN9A 4EHLA 4M76B 2C4KA 1YL5A 4I9UA 2R86A 3A4LA 4TN5A 5KKCA 1ZGGA 1DEHA 3REOA 4C3ZA 2VJQA 3DL2A 1VMKA 1IJFA 3FDIA 1TKRA 4AJEA 1U2SA 3DYVA 3ESDA 4P4SB 3PXCX 4G67A 3OHMA 4K6GA 4Z1MA 4EY3A 3QTBA 1P75A 2QRNA 3UUFA 2HTEA 3E8XA 4C03A 5DYTA 2DT5A 2P9ZA 4OP2A 4QNRA 2QUAA 1Q2XA 1DAHA 3TSAA 1RBMA 3PX2A 5ALUA 2JGKA 2ZYHA 1EVLA 2OAGA 2YWBA 1THMA 4C2AA 1X92A 4UULA 3BMOA 2FG7C 3AK4A 4KZPA 3L8ZA 3VOAA 1YR1A 5ER9A 3TPCA 3ZWVA 3OZCA 3FLMA 5KNCD 3UM9A 4COOA 1EFRA 5AVTA 2ZE7A 2P6NA 1PZNA 3LWZA 1N2JA 4NCBA 1YQUA 1XF1A 4GPTA 4Q24A 4TUYF 1ZGZA 2ETVA 3NHYA 1RQ2A 2PUVA 3WYCA 4IIGA 3VVBA 4ZOBA 2VHUA 1OYOA 3M1AA 3FVVA 3O8OA 4BGVA 3U09A 1ZGHA 3WAGA 1ZISA 3A3OA 4B0PA 2OCYC 3GLTA 1Z62A 2C04A 4Q21A 1I0ZA 1W48A 1NOJA 3BXOA 3IP5A 1C8VB 3U0BA 3AF0A 2XTNA 1OFTA 3GFSA 2PMDA 4IMIB 2VI5A 1QGOA 1PS8A 2FEXA 2GGSA 3H11B 3F49S 4DNPA 4DIKA 4DLYA 1F4VA 1T2FA 4M37A 4NCXA 2G88A 4US0R 3C7KA 4C3OB 1VJ0A 5L3QA 3I34X 2FWPA 2VK4A 1GL6A 1RJFA 2UAGA 4F93B 1KGSA 1XI2A 3K30A 5FP0A 5IFKA 2PX3A 3A70A 4ZD6A 1E58A 4UHBA 1NW5A 1GNVA 2MINB 2FI1A 3UMFA 2ZJBA 1WR8A 4L5JA 5CLHA 2N0SA 1VCNA 1WSDA 3PRHA 4MQ6A 4TLAA 5EY5B 4MVJM 4X20A 3CLUC 4FT2A 1QRAA 5CTAA 1R4MA 4MP3A 4U7HA 3ROGA 2DF8A 4J0FA 1M74A 1R8SA 4BP9A 4ZDIA 2V7EA 3PFWO 3T1TA 3GLIB 3GVXA 5F1PA 4O4IF 2E4XA 3EIEA 1LCIA 1HFEL 3KVOA 2J5QA 2I2AA 1P1CA 1JDVA 3IBGA 3SHWA 3TTYA 3VGJA 1NN1A 3W9YA 3DEKA 1BNCA 1J9ZA 3D5EA 5E95A 1A9TA 4QFCA 4MLCA 2H4WA 3WWYA 3F96A 5IVIA 4YAKA 3B3JA 4TVSA 2ONZA 3KEGA 1Y1PA 1X9GA 3EXHC 4EL0A 1ABBA 5HIJA 3RBXA 3SF8A 4C21A 1ILWA 2WBLC 2OLKA 1YE5A 3PR1A 1P4HA 1JEJA 2ANBA 3H9JA 4I1IA 5A3SA 5IP5A 1D4OA 5KYXA 2VTDA 4I3GA 4J9VA 3MIZA 1EK0A 2Q1WA 3D8HA 2DHQA 3FPHA 4PGFA 1MPTA 4ZJUA 3LBYA 2IZZA 3AW9A 5HGXA 1ZH8A 2DVMA 3UO8B 2EVWX 4L5CA 1C0PA 1DI0A 1YOVB 3QV2A 2BDTA 5F77A 4PXYA 1QVWA 3IEXA 4CJXA 1LK5A 4ZI7F 2X0FA 1D2NA 1GPJA 1PUJA 2PRSA 5D3MB 3GUHA 3MTIA 2EJTA 4CRWB 4RZ3A 5C7LO 4EHJA 5JQGB 1C30B 1NM5A 2X8LA 4N49A 6GPBA 2CZCA 1TZKA 4B3RB 1VFPA 2HJWA 2MDTA 1CR2A 4BVAA 5CD1A 1YBAA 2WB2A 5LA6B 4FYVA 5DSZA 5C37A 1NI4B 1FYXA 2V5AA 4M89A 4PWZA 3STWA 2RE8A 3GJXC 3SLKA 4KO8A 1KEZA 1B1CA 4XDGA 1C1DA 1V43A 4DUGA 4F9FA 4ZCQA 1EESA 4Q1DA 4RAOA 3ADBA 2PCJA 4CL0A 2P6OA 1MX5A 3FTPA 4JLDA 1UBKS 1D0IA 2W6MA 2WIBA 4TTRA 5D5PA 4YRZA 4Z0TA 1QG6A 1RR6A 1XZQA 2BGIA 4LJAA 4RKFA 1ISSA 1NVEA 1JQ5A 1U3VA 4S2UA 3QYAA 5D3ZA 1ECBA 2WPNA 4JLWA 1C9MA 2HREA 3UVEA 5AK0A 1OF1A 2P5UA 4CIYA 3P2JA 4ER0A 1NRJB 1FXSA 1R9GA 4GQIA 4XDHA 4PPFA 3FOBA 5COAA 1DEOA 8ATCA 5DIZA 5LQKA 1AV7A 1PSDA 1ZKDA 3I5MA 2PUCA 1LFDB 2E82A 4LF5B 1TCVA 5EE9A 2Q8QA 1I24A 1A9OA 3MS4A 4WE3A 5IX8A 3MJHA 1TVKA 2C03A 1GZSA 4FOLA 1QTRA 4EMUA 1NQUA 3B9QA 2IZOA 1CIPA 4K28A 4D79A 5F98A 3EPHA 1WCIA 2CLMB 4IH1A 3UYKA 3JZAA 1T5HX 2ZM5A 2X40A 5JYCA 2PS0A 3HDQA 4OLFA 5EA2A 2PXCA 1V96A 2CHFA 3U6BA 4DUYB 1IJKA 4O63O 5FI5A 3T7AA 2WKRA 5GWXA 3CW9A 3OU6A 3N6RA 1MT0A 2HRCA 3B82A 1E9BA 4P93A 5LUBA 4R1TA 1UT5A 2O2GA 3JR7A 3KLBA 1YV9A 2VSXA 3IRUA 4HAUA 4LQCA 4I1PA 2YZNA 5JZMA 1KOJA 3WGOA 5CDTA 4OI0A 3A58B 1PL8A 3CO0S 4QECA 4YCAA 5D1NA 3VH2A 4F8JA 1ZAKA 4G5OA 4HH4A 1QK4A 3W6PA 4BVJA 1GT91 3OZGA 4I4NA 4R8MA 3ZEAA 4A8JB 1JMYA 2IHKA 4G0YA 4UDOA 1BQ4A 2CE2X 2FW9A 8ADHA 8GPBA 3CG0A 1KDVA 2VHCA 4Q12A 3RRZA 3OEWA 5AVZA 1JXMA 5DW3A 2G0AA 3GYGA 1JHVA 1KI1A 3E9RA 3G8AA 5TQVA 4BX3A 1L5FA 2QX8A 1PZHA 3VTAA 5IYZA 1U4NA 2H06A 3H5WA 3NI2A 4ZAYA 1L4HA 3ZDEA 1XO1A 2FUG1 1XZEA 2HL6A 1BGXT 1L9KA 2JKYA 5BNFA 3PFFA 1TKBA 3OT4A 3OE1A 2YN4A 5TT0A 3FYUC 3H5NA 1EUDB 4N5MA 4U3JA 3SHQA 5JZSA 1ZI9A 1S9DA 1UP6A 1HEUA 1DP4A 3VZPA 1I7PA 3C24A 4DG5A 5CXXA 4DSAA 3CZ5A 2A1UB 4EHBA 1P0QA 4F7WA 3WA7A 1E77A 5FKJA 3RYTC 3OBIA 3RH0A 4DDHA 4IP0A 3T3MB 1FMCA 1G7SA 3KC2A 4BASA 4A92A 3EW7A 3KR9A 1HZZC 4MITA 1EDDA 1H1LB 2GMWA 2JGLA 2F2TA 2H9YA 1WV0A 4IIJB 3K1JA 4J75A 1O94A 1Y9JA 4OA8A 3WL4A 1HQCA 2DBRA 3P9CA 5ESXA 2EHDA 1QP4A 1VMAA 3DCYA 1NDUA 3GUCA 5D87A 3JAWA 2Q9CA 3VYUB 1KI9A 3D3WA 3R0JA 2JRCA 1DJNA 3HDTA 4DWJA 3I8OA 5TMEA 2I87A 1U3GA 4FLMA 1XWWA 2CJXA 3FZNA 3N1UA 5K1ZA 5K8JB 4V2UA 1IC6A 4M7PA 3VM6A 4OOEA 4RZXA 2YHIA 4MIOA 1F1JA 4DMFA 1A8UA 1R9NA 5IEBA 4Q01A 2BGLA 5B4TA 4MMZB 4N4AA 1N32B 3AX6A 3JS5A 2UYHA 3PJGA 4Q6WA 3R5TA 1RM5A 5LQMA 3S28A 1JQAA 2APJA 4NU0A 1N75A 2BKVA 2GKOA 3IV7A 4QSHA 1ADCA 1LDGA 3RVQA 4BBZA 4F38A 4CN8A 5A5EA 4RPJA 3OQIA 1WPRA 1BROA 9ATCA 1K4KA 1BFUA 3KAPA 1HEIA 4ZAFA 4OL0A 1O95C 3PQFA 1AQYA 2XMGA 2AD5A 4O2RA 4CUJA 1PT7A 5ITZB 2BBWA 1GKLA 2PZMA 3BOSA 2BFFB 1BSVA 4CIDA 3EJWA 3OCWA 5TQ0A 3BRSA 2ODBA 3KUCA 2X9QA 2I78A 4KI7A 3MGBA 5K8TA 4RM3A 2Y1XA 1CJSA 3IA2A 3LXUX 5CX4A 1GG5A 3LM8A 3MRSA 5K5EA 4MULA 1M1ZA 1SCBA 3QJYA 2WHQA 3GJTA 3P2MA 4KNWA 5AW9A 4WADA 2IV2X 5DBOA 1D6SA 1P2UA 1ECLA 4Z49A 5EL0A 3LYAA 5EWLA 3N5KA 3C5CA 2J7PD 2NLOA 3GZNA 1ULZA 4O25A 2ICAA 1PYOA 2RGNA 3UGQA 4DCUA 1I5RA 2H9IA 1GILA 4AN0A 3CEAA 3NUZA 3TSYA 3MERA 1NVAA 4J1TC 2ZKIA 1YDMA 1SB8A 4MS1A 4WK2B 4UFPA 1I9CA 2VJYA 1VIVA 3EIFA 3AHIA 4MW4A 1DG9A 2JLRA 3W8EA 5CB8A 4EO4A 1EP3B 3M3PA 3A1UA 4P1ZA 5AM1A 2JJ2D 5DBIA 5JH7F 2GAAA 4G25A 1PLKA 3DKIA 4IFBA 2OXIA 3TR5A 3LA8A 3WX0A 1JE1A 2J6HA 4FGKA 3ZI0A 5ABPA 3EGXB 1DGQA 5B3JA 1VHQA 4GICA 4RMNA 3IQWA 1SQ6A 2CLOB 2Q6OA 2Q2QA 3D0QA 4LQDA 4AZ3B 3KQUA 3R3SA 4AJ9A 4AQDA 3UWDA 2VN8A 5ETJA 3KPYA 3QWAA 1K7FB 1U1CA 1PNOA 2O7SA 4MGIR 2X3FA 1F8GA 1SCQA 3WKCA 3C8MA 3H1AA 2AWOA 3DE4X 1VC2A 1ORDA 3WRWA 2RH4A 2P3SA 4Q3AA 2POCA 3EZ6A 4ME6A 4TMWA 2VAXA 4INOA 4TN1A 5I45A 1G2OA 1U8AA 4JOCA 1G8HA 1N6PA 3VZDA 3NBAA 3NH9A 4TKMA 4DJEC 1PE0A 3RTDA 3ZLJA 2PT7A 4CL2A 4NOJA 4ZV7A 5K8LA 3K6JA 1UDCA 3FGZA 3BXPA 2VZ9A 2F8TA 4K6MA 1C41A 4QDZA 5AVQA 3P7MA 1F51E 4ZO8A 5BRJA 1HNWB 4AM8A 2AZDA 1RKXA 3KP1A 5H5JA 2A0FA 4YQYA 5HTKA 4EIWA 1N9ZA 1CQZA 1OZGA 3KWLA 3FFBA 3LLUA 1CDOA 2FSVC 1RXUA 3N2EA 4WKNA 3HKBA 4BUZA 3C3YA 3CZCA 3RJZA 2D8AA 4DJJA 5ILOA 1R64A 1XCJA 5AMXA 4BNDA 3NVDA 3PEWA 3IHTA 2XRZA 4LJRA 3EF1A 3CF6R 2D5BA 1Z36A 2VXYA 2X5JO 4FYJA 3ILVA 4J0GA 4LCBA 4LWPA 1V11A 4XH9B 3F73A 4ZICA 4BMXA 4X3OA 4ZT7A 4B73A 4F4JA 4RF2A 1Y3FE 3JX9A 4AX4A 5KQMA 4QXQA 5HRAA 4XGIA 2ZRJA 1NI5A 4DC1A 3A9UA 3UJAA 2GUWA 2O0MA 2XMRA 4EEZA 1IZYA 3OTGA 5FR2A 3PX3A 4TXMA 3QKSB 1RSZA 1C7EA 1BFDA 3H8JA 5FL7A 3RKUA 2WM2A 2XSZD 3PUXA 1NI3A 1UT6A 3RFTA 3O93A 4L9RA 3V1NA 2VK2A 4ZU1X 4NE2A 4O3FA 1RRGA 2WJYA 4BU0A 4D82A 4ZT6A 1SG0A 1GZDA 2Q9UA 3KOYA 1WU8A 1XJWA 3U3RA 1EUCB 3E7WA 2D00A 3R3ZA 2QGNA 3R6TA 1NF2A 3WO1A 5I7UA 2MYPA 1O95A 1NLUA 1CQWA 1X7ZB 3H42B 3W3AD 1WXWA 2RAPA 1UKYA 3H5VA 1YQQA 2C1XA 4M2LA 5KHOC 1QVVA 1UPCA 1THGA 3GFQA 3KSDO 4WKCA 1WUJS 1BMFA 1SXJD 3DZIA 2W8BB 5GJWC 1CBUA 1H1LA 1MT3A 2C00A 2H4ZA 2IHZA 3FDJA 4E5SA 5C7OO 5JW6A 3GB9A 2IWRA 2FP4A 1UZMA 3K15A 3V42A 3MPUA 1W1UA 1W19A 4B2PA 3W0LB 4NENA 2B8JA 4UBMA 2HPZA 3QEOA 2WU8A 3MJSA 4IFTA 4QDJA 1QDEA 3IOBA 4YYEA 1U0GA 2V59A 3SE7A 3AF6A 3HXLA 1FE8A 4X1KA 2HPVA 1K2VN 1MTZA 3SSAA 3UMGA 3V1MA 5FL3A 4B4WA 5A2GA 4IILA 3FNBA 3DBIA 4LHYA 4ENVA 4GW3A 2OM2A 4ZOQI 5HW0A 1NTRA 4BJ5A 3DLHA 1QGZA 1RFGE 2GCNA 4MDHA 1XAGA 1D3AA 3A1TA 4Y30A 2Z30A 4TV9A 2WJHA 4OHUA 4YJ2A 4IIYA 2VRCD 1PTJC 5HKAA 1JR3A 4ENTA 5KSOA 1W4RA 1RLTA 5GONF 3WHIA 2GQ0A 3HPQA 3U40A 1Z5OA 4F84A 2OO7A 2KS6A 1FU7A 4G0PA 4C0LA 3IVRA 1JTFA 3V8EA 4BNWA 4DRXA 1IQ0A 3BE8A 5B3JC 5JY6A 2OSBA 3SIPA 3T15A 4BOYA 3JATA 2PX2A 4QFBA 1ECJA 1Z9BA 2ZWOA 4NCIA 3X1DA 1Q0RA 4DMGA 4J0EA 1E3IA 1MB9A 1VA5A 3ZD7A 2AEMA 3V4SA 3GXOA 1U2PA 1JDJA 4CDMA 3P26A 3W04A 3EF0A 4RDXA 1UMBB 4P86A 1KQ3A 1KS2A 1W88A 1P4SA 1XRRA 1WUKS 1UBJS 4MRAA 1GG8A 1BEZA 4TKVB 4YRDA 1KFJB 1XRLA 3HCWA 5B1DA 1FK8A 3OD5A 2X6TA 3EOZA 2ZIWB 2ZJZA 5ALTA 3RASA 1WU7A 4K03A 3KCQA 4D97A 2VHZA 2WTUA 4CM9A 2JAHA 3HGQA 2ZT7A 4B74A 2PUBA 2XXAB 1AA9A 1P73A 1QHIA 1W29A 3KWFA 4YRCA 4I9GA 3CH5A 4F92B 3E0XA 4MVJI 4UM5A 5DN6D 4IGKA 1DUVG 2OO3A 3WRXC 1I7QB 1JYSA 4U7TB 1SOMA 4Q1FA 3D0OA 1RAAA 5I7FA 3MCUA 3OCJA 1JR2A 3SFTA 4MEAA 1G5PA 2HSEA 4FFNA 2GKGA 5F33A 2DJIA 5DHPA 1NY6A 4MUAA 2GF0A 4AP9A 3SHFA 1FNMA 1MG5A 2XCQA 1E8DA 5H3HA 3S70A 4MGKR 3HUEA 3TW8B 4CKBB 4DQXA 3PRYA 3T1QA 5CFZA 4CXMA 1NBMA 3KU1A 3LKBA 1CF4A 1JBQA 4ZOAA 4IWYA 4FEGA 4RVFA 5NLLA 3CLVA 1DC8A 3VDMA 2L42A 3D4IA 2C9OA 2QRKA 4W5WA 3TZLA 1RS0A 4DZRA 5LQDA 4Y0AA 3C8DA 3DMPA 1HXHA 3OM8A 4OBWA 2F3RA 4RVOA 3NJ8A 3H84A 2VJNA 3L02A 1VSBA 3JQ6A 4UTNA 4E51A 2P9CA 2CV1A 1E5LA 2OV8A 4WBXC 2JGNA 1JDBB 3ER6A 3WNBA 2OZVA 3EXIB 3V46A 3QLVC 5ECYA 5FPPA 3THYB 3AESB 3U1TA 1NYTA 3GRRA 2FVXA 2JH8A 1SO8A 1WHSA 2QTNA 3PYXA 4OLHA 521PA 5LA6F 1UMCB 4WKBA 3PUHA 4KSCA 1NMZA 4N5HX 1T9DA 4PQRA 1AN0A 1VDMA 3T61A 4B4UA 2FW6A 3AJEA 1KY3A 1BHJA 1OPRA 3BWMA 3JQQA 4BVEA 4BWYA 4DLTA 4MDEA 1JZTA 3QG1A 3NOVA 3AF3A 2K5UA 3FIJA 3HVUA 4W5TA 4M0LA 4R9VA 1ZJZA 5DIFA 4YHBA 5I9NA 3HR8A 2Z98A 4W7SA 5H16A 1QK5A 3GRCA 5BSUA 1VKRA 3RAPR 1TADA 2AH5A 3PJFA 3SFZA 2O8EB 4NEGA 2MSDB 3TYXA 3HJFA 3AP1A 1M1NB 3Q8WA 1P2VA 1SMKA 1L7BA 4CNQA 4C7JA 3LRXA 1QCZA 1H6BA 2AQHA 1VI6A 1QHSA 1X7DA 2P2DA 3DC7A 3I39X 3K4PA 3PTLA 4J6FA 3ORHA 4OXYA 2J5RA 3RFFA 3L01A 4B79A 2PRJA 1U2ZA 2VS1A 1JR4A 3NLLA 4AUEA 5KYYB 3AKDA 4WNAB 3ACBA 1NWHA 1XKLA 3AEUA 3WGNA 3HZOA 3F3MA 3WGMA 4D99A 1QKJA 4K46A 4XYBA 4YO8A 6AT1A 2JIDA 1E8MA 2QUBA 1A96A 1RCTE 1EDZA 5F5XA 2AKYA 1UDRA 4FLFA 4OHMA 1C3OA 1QORA 2C8JA 1SIOA 1Y34E 2J9RA 2B20A 3ZU2A 1SHKA 4BP1A 1LI4A 1UJ5A 3QF4B 4KOAA 1FMFA 3B9BA 4QU8A 3AUAA 1OI2A 1ORVA 3C74A 1AZTA 1T9BA 1YJQA 2RHBA 2W6NA 3Q4GA 1JHQA 1BE8A 1GTG1 1MJFA 2OBXA 3GCZA 3CCCA 2PH1A 4RQUA 5C52B 1CUIA 4LGYA 1H05A 2MTBA 2R7MA 3L0OA 4URUR 4LVCA 3DGFC 1TCAA 4BLWA 5JBIA 4MQEA 3N6VA 1HG1A 3QJGA 1BYIA 3JXEA 1NQWA 3I76A 1K27A 3HVHA 1IK6A 4N3NA 5DM70 2EQAA 2HY7A 1U2RA 4Q03A 2Y8EA 1YR2A 1FS4A 1NE2A 4BB5A 2PL5A 3PQ8A 4YP7A 1Z6XA 1T9GS 2VR1A 3AM5A 3K8ZA 2VA8A 4RF4A 4LY0A 3OX2A 3T34A 3O4HA 1EK6A 2EFGA 2HPAA 1BCRA 4AMUA 2NUTB 3BAZA 1IY8A 4WRRA 5IBRA 2EU8A 2D7JA 1XQVA 4MKFA 1RBQA 3V4ZA 1P9LA 3ZCXA 3Q72A 2FRXA 2H1HA 2E37A 3OU7A 5C5EA 5CVDA 4CF5A 2C3MA 1LNQA 1IE3A 3NHBA 2AOVA 3NTRA 3QY0A 4MJLA 5FPQA 3ETNA 4ZYWA 2WILA 1KK2A 1OD6A 2OUIA 4O2AF 3I9NA 4ZVUA 5HKKD 2X5XA 3WQQA 2PUDA 1UDXA 2KBFA 4OI2A 4BKOA 5CFRA 4GAEA 5I9IA 2GSWA 2YHBA 1DUSA 2OFPA 3U3KA 4EB0A 1VP3A 1O0BA 3PP8A 2BTQA 5DDIP 1VTKA 1E2HA 1MMFB 2IEZA 3ANNA 3PFKA 4MUJA 4N8EA 2AJDA 1NT4A 3BWYA 3F9RA 4A8JC 1DC4A 1W5TA 3IAS6 4EG8A 2JGDB 5TV2A 3U3XA 3VXKA 1WDKA 3CBQA 1EXMA 2OAP1 3FUWA 1SM4A 3JRNA 5ALQA 3SS8A 3W2HA 3ESQA 1I4DD 1NHWA 2D0PB 3L49A 2P30A 4WMLA 5C51B 3S2EA 5EJ2A 2O8BB 1FX0A 3ZLTA 5H4GA 2QL7A 4X0EA 3K0CA 3RU3A 2O3UA 2CKDA 2YJGA 3K09A 1T3TA 4Z4QA 4YCNA 5KJCA 3M9WA 3UFXB 4AMZA 6LDHA 4O29A 2EFHB 4S3MA 2D3TA 4P54A 4JP3A 3Q5DA 1H5NA 1NLZA 2IIVA 2PKXA 2Z8ZA 3KUDA 3NHSA 4GXRA 1PG5A 1JHMA 4MLDA 5F35A 4YRMA 1DCTA 1COWA 1Z3CA 4QQKA 1E2BA 1BWSA 1PDWA 2YXPX 5I8ZA 2GTHA 4UVIA 5IJ9A 5FF9A 2QJOA 3TD9A 1BE0A 3TOXA 3U1BA 2YV3A 1RRPA 1CCWA 2P1RA 3O4RA 3ZE8A 4B7XA 1SBNE 3MWFA 1OBFO 2P3QA 1RC8A 2ZE8A 4YO7A 5A4AA 13PKA 1Q7CA 4ONEA 1BQ3A 1T5SA 1NXWA 1KEEB 1Y81A 2JCXA 1KFEB 4ASUA 2CXQA 2JFHA 1C2YA 2YNMD 1NW4A 1AT1A 4UZFA 5G0WA 3C5VA 5BSFA 1Z13A 1OIWA 2C4TA 5LD2C 2GBCA 3EODA 3FDXA 4CM3A 2GSDA 4TMKA 3RAEC 1B4DA 3Q2KA 4LVNA 1WBJB 4RC9A 4BB9A 5ES4B 1YZ3A 2FXIA 2CLKB 2CXNA 2GESA 3F5DA 5ALJA 1DVRA 2X5OA 3B20A 5LYJF 1IVYA 4KE6A 4N3CA 5IYZB 3JWJA 3SQWA 1XRJA 4QJIA 5EWJB 2FMHA 1YC2A 1YIDA 3KS9A 3N7TA 1KDOA 2QN9A 3V7UA 1MO4A 2QAJA 4AMGA 4D3XA 2GYYA 1WX1A 3QU9A 4JQZA 1NXVA 3GJSA 2J6CA 4M99A 5FOWA 1W0KA 4C43A 2Y1EA 3DEZA 3E4DA 1TA4A 3P96A 4JL5A 4GOND 4H15A 1FX1A 3EXAA 3O74A 3TQIA 3K6SB 1SELA 2OD9A 4AS2A 2FQXA 4JI0B 2WT4A 4PZ9A 5A4IS 1QGUA 5M7EA 2FH5B 1Z8FA 5AXBA 4CM6A 4OQ4A 4RORA 1VHDA 1OYYA 2FPUA 2ACKA 3ML1A 1A9QA 1VJRA 3F5MA 2PK3A 2D6FA 4X3CA 1T8WA 2CJYA 2HAEA 2UZ1B 3IAEA 1HT3A 5EJFA 3JRWA 3UGJA 5C2JB 1Z4OA 1O96A 4B3BA 4P0QB 4OHCA 1CQIA 2E6KA 4BNLA 5JAHA 1UL1X 2VO1A 5IW8A 2R1ZA 5E1MA 1AUOA 2Q0HA 1QMGA 2GYUA 1KQFA 3DHNA 2HLDD 4NL4H 5KINB 4F2HA 3OTOB 4UHJA 3IIKA 4Y6PA 1EE9A 1QGUB 3MBIA 4RL6A 2JKZA 1PKEA 1XEXA 3FAKA 4Q9JA 1T13A 5EQDA 3WB0A 4Z4IA 1Z29A 4R71A 1EMDA 1OVMA 4MV3A 1Y48E 2Y0DA 1V3VA 1XKTA 3L7IA 1A76A 2XBUA 4MAFA 3ZWNA 5B30A 5JFGA 1WCYA 4LN1A 4W1QA 4RO0A 3KQKA 1JDNA 1D04A 4NR0A 4PEVA 4RQTA 4KXXA 3C43A 3W77A 1PS0A 2PR2A 4H3KB 3AEXA 4EFKA 3ACCA 4PAQA 4FN5A 4ED9A 1M6NA 3ECSA 3SP1A 1CEQA 2DHDA 4P34A 1JILA 1KO1A 1ZR2A 1L6RA 3I1FA 1U2DA 3KQQA 1LPOA 4I1OA 4FMBB 5JXJA 4S04A 3KQNA 1WXQA 2AV6A 1G8FA 1NG1A 1LB1B 4GSLA 3TNJA 4Z7NB 3OPNA 2Z5VA 2BBOA 2PG3A 4RA9B 1NOIA 1EFHA 4UBIA 3QTTA 3A05A 4MHOA 4ITUA 4C4ZA 3MPOA 4OSPA 2DBQA 4LBZA 3QXSA 2XUIA 1TZCA 3HKBB 3HVKA 1OGJA 3BWXA 4G85A 3Q2IA 2F8MA 3UENA 1KEVA 1ACLA 3L04A 3MAGA 2WTEA 4OJKA 3MYYA 1PNVA 3UXMA 4EPVA 3PUKA 1NMEA 2WJGA 4IHKA 1YK1A 1Z5NA 2JVIA 3LX8A 4RW0A 1J6UA 4H1TA 3V1YA 2LDXA 4R2IA 2C0PA 4A8TA 5CVJA 5CYGA 4X62B 3AKCA 4HEQA 3SX2A 2Q6LA 5EMHA 2PKQO 4B6FA 2YMPA 4Y9TA 1LH0A 2E5WA 2ZI3A 2WY2D 2OHXA 4P5PA 3OFSA 3RYCA 1HUQA 1P4AA 1R5NA 2AC2A 1CW2B 3RROA 1XVVA 1FJXA 3TNDA 3DZBA 5CVEA 5J59A 4YCSA 1AZWA 1UKZA 5KYTA 2Z08A 2XOKA 4CUKA 1BC5A 3D81A 5BSTA 5C7IO 3OKFA 1V16B 5JY1A 4X90A 2QLNA 3COZA 4LWQA 1MXHA 2ZSBA 1UJMA 2IUUA 3A4NA 2PVPA 3T3HA 4RCVA 4UTPA 1JFVA 2DKFA 3H1FA 2UZ3A 4D44A 3WHKA 1WMDA 3SZMA 3F6YA 4QOJA 2OWEA 4Q18A 1SOVA 3F3KA 1BRTA 2G9ZA 4G5QA 5DP1A 5BV2P 2V3CC 3AVYA 1ZSYA 3CUUA 1W0CA 3E3AA 3SR4A 2XNCA 2XE4A 3DVLA 5CRIA 3CNBA 2HCRA 1VYVA 2V7XA 3I5UA 1WKBA 1DLIA 1U2QA 1PQYA 4K9SA 2QNRA 3PXXA 2O5EA 3SOPA 4UQLA 1L7RA 1SKYB 1PX0A 4G5HA 5BYAA 1HKUA 2JAWA 3ILXA 3AONB 1NRXA 1RRVA 1CJTC 3R5JA 4GZLA 4EAAA 1Y6RA 3BL5A 3BJZA 3MTGA 3RRFA 1BTOA 1R4NB 2Y1GA 5D85A 4DM3A 3FKSA 1QGAA 3PNBA 4Q6BA 1JLHA 4HAOA 2B7CA 1K7EB 4PRLA 2J3QA 2Q49A 2QMOA 2W70A 4YV7A 2Y93A 4HWRA 1M6HA 3DVQX 3Q7QA 4P4SA 2NZXA 4UW9A 1DAGA 4AUMA 2WFAA 4R54A 4YMTA 5IKMA 4C6SA 3AFHA 1H2FA 2AQIA 3P0JA 1W34A 3ASYA 1H2XA 1VMIA 2BZGA 2EZUA 3AIOA 3C0KA 4FDTA 4IXDA 4L85A 4RK7A 2OKCA 2OC9A 5E6SA 1D5CA 1KPGA 4XIYA 5B5SA 4S1NA 1N1GA 3CPHA 2CDAA 3G02A 3P9SA 2QG6A 4PQEA 2DQSA 1P0CA 1X70A 1TF5A 3MJ4A 4GOJA 3I3SR 4L9SA 4CMEA 3FAZA 3L0CA 5TARA 3AETB 5JXWA 3L7YA 4GI5A 5B64A 3WAJA 3L0ZA 2XGGA 4QUEA 4KR3A 1DFGA 2AKEA 5BSWA 5HP4A 2ZBPA 2WYHA 4MI6A 4S12A 1YONA 1EVKA 2X13A 1NZFA 3RIHA 4CETA 4C22A 1X1QA 3FR8A 1AHNA 1NQAO 2GBIA 2WUWE 4TM8A 5K4HA 4QPCA 4PM4A 1JWAB 2PEYA 2R4TA 1VG1A 3H13A 1VJDA 2PBLA 4MKRA 3RGGA 3FCCA 5BW5A 4CKCB 3DVRX 1UWCA 1L5ZA 1G20E 1RBYA 2FQWA 3EULA 1KH3A 4DR4B 1CLUA 5CLLA 4BRSA 1GGMA 5ALYA 4JJAA 1N1EA 4J0QA 1YB4A 1AKQA 2BV3A 4L76A 4N9QA 5H83A 1SPXA 5K0JA 4H1HA 3BQ9A 5TS2A 4CM4A 3CSDA 4OK3A 2EIHA 3W4KA 4UMDA 1HFJA 4JB2A 1EVIA 1R6BX 3FHOA 2E1RA 3VR6D 5ARBA 1ORHA 4XWWA 1Z0ZA 5DYGA 4DY6A 2WB4A 3PJEA 3I28A 2CFIA 4XUGB 4WFIA 2X2EA 3O9ZA 4FOSA 2RGBA 3O8NA 4LHZA 1MEOA 3C3KA 2ZSIA 1R0KA 2GN8A 1N77A 4I55A 3C3WA 4WIAA 4YROA 2I4MA 4JP2A 1KU0A 3UXYA 3A4VA 1P4RA 3ZK7A 5K03A 4OHYA 3GAZA 3NTXA 2XYHA 4LYJA 1X2BA 2WF8A 5JYBA 1TQHA 2QRHA 2GYVA 1ZWLA 3N8GA 1EPUA 4CKEB 2JI9A 5FPTA 2XDQA 4ID3A 3ULKA 5K0ZA 3C15C 4XRRA 4FBGA 4BNNA 5EKTA 1GA6A 4L5BA 1ONPA 1FP1D 2AA3A 3LNCA 3WKEA 1U2EA 4DUPA 2V9PA 4FK8A 2FE4A 3V9AA 3OX4A 5IUNC 3NGLA 1YOBA 4Y2VA 4B34A 2AB0A 1JZQA 1RD4A 3ITDA 3THOA 5KEIA 1H4TA 2QDKA 3O5AA 2AOXA 3QVVA 1YL6A 1PJSA 1TVKB 2E87A 4JD5A 4NYMQ 4P0TA 3I2GA 4GD3Q 3TLMA 4JGBA 3T9CA 2HDOA 1SRRA 4L2IA 5KYVA 5K0GA 1CIJA 2BM1A 3N0VA 4OHVA 3ZOZA 5I51A 3ZWMA 1MDFA 2FDRA 3EEQA 1BVHA 3G9XA 3H1GA 2FPRA 2H0QA 2XCIA 1LDBA 4RH1A 2YZKA 3PQDA 2DPXA 4RJTA 3OIWA 3DR5A 3AIKA 4JOQA 3L7CA 2FCRA 3PCRB 4EHFA 5GM1A 5K7SA 5KU7A 4UD2A 1DJLA 3U4HA 1Y1QA 3PKZA 2QD5A 3KKEA 2BGUA 1U1EA 2XQVA 3JQAA 1HWYA 3S29A 1JSZA 4JVOA 4LK2A 5K6TA 3QEMA 1R0BA 4KXMA 1ZZGA 1O08A 1MOPA 3WGKA 5EI5A 2H7YA 2GLXA 3R23A 4QEDA 1N0UA 2VQEB 3VFDA 2IHBA 2CXTA 3ZWBA 5AVKA 2BJVA 3EYAA 1CNMA 1QZTA 2EATA 5AUQA 2VZLA 3VU1A 4FEYA 3RVPA 4C7MA 2O54A 3KOWA 1UPAA 5ALHA 2JD0A 5FTNA 3ZDAA 2PMBA 5JD5A 4KMMA 4YJKA 5DNEA 3D6JA 3D6UA 1REQB 3OQPA 1VPLA 4I6GA 5F2OA 5C8YA 4OUDB 3R75A 4LECA 2YIJA 4YPOA 1HLGA 1PLLA 4XQCA 5JASA 5IKXA 1OXUA 1QZUA 2BI7A 3QMWA 3RNOA 5HZHA 1Z6AA 4C0WA 1B0ZA 5J9FA 2ATVA 3C48A 1FRNA 1AQLA 1DX4A 1QH1A 2A84A 1UOQA 2XADA 2WAXA 1F3LA 2Z3ZA 3PTZA 2NXJA 4EFNA 4YRQA 5C3MA 3SIRA 1KVRA 3ME5A 1PTKA 4UMEA 1QQ7A 3STXA 2V03A 1XSEA 2VBCA 2P27A 3LW7A 3GVPA 1MEJA 1SXGA 1R6DA 4AI6A 1IBRA 5EHNA 3GJ7A 4XWGA 3H5TA 4RK4A 1VL5A 3KEFA 4DEVA 3VH3A 4DIOA 4UJ3A 2QMQA 2BSXA 4W5RA 2IHYA 2WM9B 3O83A 1KI7A 2C20A 2RGEA 4BO0A 4JIGA 4XIJA 4F56A 1A7JA 1T24A 2FZ5A 1NDHA 1M2KA 2EGUA 4V0NA 2VH2A 2OV2A 5B36A 5E1OA 5K6RA 5IK2A 1OWNA 5IZCC 2HOQA 3NDIA 3PPIA 3B70A 1P9WA 1RIFA 4I1YA 3EJ6A 4QUDA 3RJ9A 3Q3IA 3IIIA 4L8WB 5CHYA 3UV3A 5LU9A 3VR6H 3DKVA 1TFRA 2A0WA 2CZQA 3RSFA 2DBZA 2W0SA 1LLFA 1GPWB 3GMSA 1IFXA 1M2FA 2ZRNA 3CRVA 3IP1A 3BBPA 3TM5A 3UY4A 1GGHA 3WSTA 1A1SA 5K20A 5IXYA 3MWEB 1Z07A 4B7CA 3LGXA 4LZNA 2VDWB 1GPDG 3OURA 1M73E 3ONWA 4L0QA 4PYIA 4HFJA 1UFQA 2VIIA 3QXJA 1A2KC 5DYWA 3JATB 5JSZA 4BQFA 3G68A 5FH9A 3KZKA 4G4GA 3U7JA 3JAMA 3EIXA 5TX7A 5CX1A 4AF8A 2BMAA 4AJNA 5ADUS 3AU9A 2V4ZA 4TUYB 4O4LA 2H4HA 5EMJA 3FYSA 1P2FA 1T26A 1Q0SA 3BJIC 4JBWA 4ZEMA 1F20A 1B6TA 1Q3HA 3I8XA 4NOKA 3TUZC 1D7AA 4W5NA 4C20A 1U3UA 1GYRA 2CXOA 2JL1A 4W5HA 1JNYA 4L9WA 5EJGA 3T3DA 1BHSA 1ECPA 3ZI4A 3PJDA 4UUNA 3S2ZA 2R44A 3KQSA 2V98A 3VPHA 4CFSA 3J81A 4U2KA 2VDWA 3DVSX 4YV0A 3LC1O 1CQXA 1U4SA 8MHTA 3VKFA 2GCIA 5F1KA 1WPQA 3I1YA 2H18A 1BWPA 4MV1A 4ARBA 3ZYZA 4YJFB 4P22A 3T0GA 1SCIA 1J8FA 1G6HA 4I9FA 3CLTC 2OCKA 3N58A 3UV7A 4TWIA 5IANA 4RTSA 4TZ0A 2FRDC 2TMKA 3CXUA 3EXEB 1XL1A 3IDFA 2ZREA 3U48A 2EYQA 4XIFA 3TGWA 1FDVA 1FUIA 1J22A 2AFIA 3KR1A 4OHOA 3BN3A 1GNLA 3N2KB 4YHHB 4DS3A 4N7MA 4CEJB 1FTQA 2I9KA 3S40A 1Q7BA 4YCJA 4MZXA 1QRUA 1O4WA 3HCEA 3VDRA 3U9TA 1Z4NA 3ANSA 3ETJA 1LZKA 1KAQA 1NC3A 3DV2A 2QXTA 3L9XA 2ZBUA 2GPSA 4L15A 3TRFA 3UPTA 2O06A 2Q2OA 1JLKA 3FPJA 5KAMA 3A31A 1SIBE 1YS6A 1IATA 2FPGB 2JCGA 3B53X 1T1RA 1UC5B 1QCCA 3DL0A 3HCNA 4ZJZA 4DILA 4YMLA 2I55A 3NQ41 3BIFA 4C2TA 1KOFA 2PIDA 2HXYA 4JYAB 3CX3A 2ZYVX 1N8NA 1JFFA 1ZNWA 2BLNA 2P2SA 1DUIA 1I0IA 4KSBA 2GDZA 1KYZA 3B5EA 3WIBA 3ZE2B 2WF9A 4M83A 3SBXA 4PGAA 1Z16A 3ITKA 3OCZA 3QVSA 3BTUA 4JI6B 4Q9AA 3IJ5A 2H11A 2A0KA 4M54A 1JU4A 2A9OA 3WGHA 4FS3A 1KAEA 4DT1B 1RDFA 3LQRA 4L78A 5WRFA 1RJEA 1IB0A 2G04A 2HZ7A 5KTMA 1ACMA 1BW9A 2I3GA 2Q2WA 2WEKA 2WP0A 4HB0A 4IOKA 4KXUA 4LJ7A 4MX8A 3RARA 4W82A 4WXRA 3WWPA 5JADA 2HRDA 3S7ZA 1QONA 1QHHA 2GPWA 2CJWA 3AHFA 3TRHA 5IWCA 2ZCUA 1UBLS 2VT6A 4YRRA 2YWJA 4CMIB 1AN9A 1UKAA 3IPLA 3DZFA 4Q93A 2AOTB 3MBKA 1ZNQO 3ONVA 4I1SA 3SGLA 4DTCA 4D25A 2J0EA 2JEZA 4CGZA 3QVGB 1V5FA 1EEHA 4PYLA 4J03A 3LYLA 1GSHA 1PG2A 1PJTA 4KSYA 5GP1A 4DB4A 3RFCA 1U63A 1Z26A 2UXBB 2HGZA 2VAWA 3NGMA 5JNRA 1D1TA 2OGSA 4NBNA 3ZU6A 4CF4A 1BDIA 3RS9A 4R2XA 5JHHB 3EAFA 3G2MA 1OKKA 1KI4A 5CYPA 4RESA 1CUEA 3VVCA 1PJ3A 1PFQA 2PT9A 3AFMA 5JPIA 3KT3A 3NXKA 5LWHA 3DBHB 5J2TB 4LYHA 3MWJA 5DNUA 5T4EA 3VMMA 3BE5A 2EIXA 3ELUA 4FHCA 3W5SA 2VYFA 1TO1E 1R12A 2CNDA 3F7TA 1XU4A 2H5JA 3HZRA 4NQRA 1CXZA 1ZOSA 1Q3KA 2VJOA 2YZMA 3C6ZA 2XDQB 3WOHA 4F4UA 5F76A 1JG7A 1Q0UA 3GT0A 3RAFC 4MJXA 4INAA 2BYTA 3NBFA 3HCCA 3J81k 4LXQA 4CKXA 2OILA 3K1AB 4IFIA 2IY7A 2I7DA 3IHKA 1X8KA 1TI7A 4PF1A 2AFIE 3PQ7A 4YK7A 4DCGA 4HXFB 3CA8A 3P0FA 3O3MB 4DLAA 1VJCA 1I7DA 3L6OO 1G98A 3MM4A 1CS0B 5IKPA 1WMAA 4EB3A 1Y6QA 5F21A 1EFLA 4GU5A 3LIIA 1OWMA 3DOJA 1YFLA 3CC8A 4ZVVA 4BTVA 2VTBA 1XEWY 4RMHA 1U7WA 1NVTA 4KN6A 2LD4A 2FWIA 2P9JA 3PTAA 1RJWA 1FNBA 4F6CA 1PWYE 3JQBC 2F3TA 3EEFA 2AI2A 4DCCA 4R83A 1U5AA 2I03A 5AYVA 1FY2A 1KK1A 2BKLA 5L45A 4HGRA 3ICVA 4QOGA 3WKDA 1H9BA 1IZ0A 1L7DA 3WWDA 2LCIA 1XZMA 1FVHA 2C2YA 1Z6TA 3B38A 4HDQB 3JYPA 2LPMA 3W2IA 1KI6B 4HTAA 3ZWWA 2DKNA 3LE8A 2FZGA 3E9MA 3LSYA 4A0SA 1KOGA 3INNA 4IBOA 2JPDA 5DTEA 3PZRA 4WLFA 4B3IA 1CY1A 1EBBA 3KFXA 4LRSB 3ZWPA 3AOEC 2XNDA 3B7WA 5LMUB 4GIBA 3ZIUA 2MOKA 2IEIA 4W9MC 2A9PA 3CIOA 1C7FA 2Q28A 2FSHA 3NWPA 3TD6A 4X65B 3BCRA 2PZAA 1NNSA 3ZVMA 1P44A 2ZBVA 4DV1B 3DSRA 2C9MA 1TU4A 1Q50A 3P9XA 3CF2A 2R47A 5SICE 4F4HA 1AM4D 1IN8A 4DCPA 4FR5A 3JQDA 4L7VA 4PGGA 5GGYA 1OXBB 3CJTA 2XOKD 2VNKA 3I9FA 4OMFG 1PWXA 1NE7A 3AR9A 1JFFB 4ZALA 1Z2AA 3H9BA 3TIFA 3WJ7A 1IIBA 4OHPA 2IS1A 1JHDA 4M22A 2RB5A 3F7OA 4LOJA 2I66A 2XUAA 4ND4A 3GCXA 3SVZA 2K7ZA 4OBEA 4ZO9A 3UWSA 3PSAA 4EKIA 3FMOB 4WQMA 1G8JA 2ZRAA 3LZCA 5K0EA 2D5IA 2ZPUA 1A4XA 4IG4A 3W79A 1CB7A 1CFJA 2WI8A 4R3UC 4ZK6A 1XMSA 1YGPA 2MYUA 3TNFA 4JFAA 3DE3X 3FHTA 1H4SA 4ES6A 3EG5A 1JPJA 4P3XA 2C92A 1XD8A 5GOTA 3T54A 3DGEC 3HEMA 3HEAA 4OSEA 2DT8A 2A67A 1E89A 2W90A 3VSDA 1ZP6A 1AUPA 3EWNA 4X8OA 3JSXA 1T91A 4JLNA 2D1SA 5AW0A 3ESBA 1OAKA 1DB3A 4PBRA 5DLPA 5AW1A 3ETLA 2WG2A 3WYDA 4A15A 1ATZA 1WY5A 4HZGA 5JNLA 1BFKA 3HY4A 3D8SA 1XGKA 2GHTA 2BFDB 2IZ0A 3GGJA 2IU0A 3W2FA 4DV4B 2W6ZA 1T6NA 4JVNA 1VJ5A 3LL4A 1P6QA 4LE2A 2GZ3A 3ZHZA 4G0QA 1JEDA 2I4RA 2VPYA 1WCIB 3CURA 4V0MA 3RABA 1G41A 3ZS9A 4EJSB 2CB0A 2FEKA 4J6EA 3TRKA 5HUHA 1A71A 2GA8A 4CLRA 4CQNA 2JFVA 5KDLA 3ANTA 5CYOA 2RK6A 2OBMA 4HAXA 2ILVA 1QTQA 5CNIA 1TXGA 4UXIA 2AG8A 4C0AC 3D1JA 5NULA 2FN4A 3V8PA 1S01A 4E46A 5DYIA 3NETA 4LHXA 1BCSA 1KIFA 2B78A 2ZTUA 2AMJA 4WX2B 1F6WA 2B0JA 3KE9A 2TMDA 3T7CA 3V33A 4LJYA 4QC2A 3FN4A 4KQIA 1Z38A 4PYMA 3ZBQA 5HA5A 4UNNA 1QKIA 2QIPA 4I6JA 3AERB 3IALA 4TT3D 1E63A 1MORA 4J7UA 4MUYA 3IURA 4A82A 5JDIC 1RMYA 5H3CA 4JKOA 1W5EA 4Y2YA 2H07A 3QU4A 1X14A 4GQBA 3OZUA 1XAIA 4NENB 4XA8A 1ULHA 2H7CA 4BO5A 1HQYE 1V11B 2D5LA 1EA7A 2X8WA 3G1TA 4PQGA 3RC1A 1HPLA 3FUUA 4NMXB 4LW8A 2FG5A 4M88A 3RKRA 1UBHS 2BEUB 1AQNA 2GZDA 1Z5ZA 4OHBA 4WD3A 3KKMA 5FA5A 1S1CA 2GBPA 1B8OA 1MP0A 2UYQA 1ZR4A 4D42A 1KS9A 1MPXA 2C2MA 3LP8A 1OKKD 2B1IA 2FY8A 2WAOA 3Q9LA 1FDIA 1FP2A 2C4WA 1QWSA 4JUIA 2IXDA 2ZVPX 1PWEA 4WK0B 3PFBA 4QEZA 3K05A 4YJ3B 4LFBB 4D0NA 4LGCA 3T35A 1W4BA 3AKEA 3VDNB 4EY6A 4MW5A 1MHTA 1WQ3A 2C7QA 1J21A 1YRBA 5TGZA 4DPLA 4GWLA 4M1EA 1V3UA 1W9MA 4IM7A 2W4IA 3K16A 3V3TA 1ODIA 1QHGA 1ONBA 1G59A 2HBZA 2BH9A 5KX5B 3QENA 4CF6A 1K6IA 4MCHA 5KDOA 3LWBA 1L7NA 4C6TB 5HZMA 2IZ7A 1D0SA 2I2CA 3ZGNA 4D4GA 2R4UA 3AIIA 2CBZA 2I8LA 2IYYA 4E94A 4MUFA 5AKXA 3QVXA 1T9GR 3I32A 4FONA 3FJOA 4FYXA 4YT8A 5KYNA 1GFIA 1BJKA 2A1TR 5IYZF 5IAAA 1OGYA 4RFLA 4V0ME 1XTZA 5K3SA 3LCMA 7REQB 1NU8A 3FYUB 2WG0A 4X71A 3TDMA 5A0FA 2YWDA 2Z1NA 1GUZA 2XOEA 3BSYA 3PE3A 3KOXA 4XVQA<