1EF1A

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
294
structure length
294
Chain Sequence
b'TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOESIN
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 89
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ef1A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ef1A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef1A01
2COFA 1V5OA 1E8ZA 2DX5A 3PLUA 4GIVA 2A5UA 3AI5A 2W2XD 4W9LA 2LGYA 3K9OB 3ENEA 2RR9A 3V62A 3TL5A 2IFSA 3D8FA 3L0WB 2JY6A 3OJ3A 2V4LA 1WGGA 2WDTB 4A6KA 1H4RA 2KANA 5LONB 4W9GA 4N9F4 2KK8A 2KFJA 2QKMA 3UQBA 1AWEA 3ZNHB 3VTUA 2KO3A 3TW1A 4DDGD 2MBOA 2LKOA 4IWQA 2EMSA 4BKGA 5AZGA 1ZM0A 4NAWA 4GMVA 4FJZA 2BPSA 3W1YA 2FNJB 1UNQA 1P3RA 1J8CA 2KFKB 5DI9B 4H8SA 1XX0A 2MFQA 3HHMA 1FHOA 3OLMD 3IVFA 3KH0A 4ZRKA 2YLMA 1V6EA 2DHJA 2FJ9A 4GDLB 3DVGX 4A20A 2KFKA 2KX3A 5HE0A 3CSFA 2AYOB 3ODWA 3SD5A 4DXAB 2DZIA 5LXHA 3EFUA 2ASQA 4GDLA 2RGFA 2J59M 2LI5A 1MKEA 4MGKE 3UIPB 1NU2A 3LJ3A 5EFXA 3NHEB 1FAOA 3PZDA 3GZNI 2UZSA 4HDQA 2DENB 1NVLA 1V80A 1MK7B 4HXDA 1HBKA 1V49A 1UGMA 1GC6A 3ZVRA 4B6WA 3HK0A 3FLVA 1X1GA 1Q5WB 1QZEA 2ZPNA 4YL8A 5DPRA 3PRMB 3QA8A 1XR0B 4IAPA 4YONA 4A6HA 2JWZA 4IUMB 2L0TA 3DDCB 4NQKE 2EC1A 1E7VA 4K81A 4E71A 3PT2B 4FADA 1U5GA 4PS3A 4WWOA 2NS5A 2VSZA 4EUTA 5J17A 1Q67A 3UF8A 2DHIA 3NY5A 3DBHI 3KUCB 3GOEA 5J3QA 2HTHB 4B95A 2YS1A 1V5PA 1WX8A 3CF6E 2MLBA 2D3GA 4AUQC 2H7EA 4MJSB 5CX3A 4XC2A 2ELBA 3KVFB 4LDTB 1WE7A 4OVVA 5LLIA 5KHQA 4LJPB 1WF9A 4DK5A 3VUYA 4M8MA 2KDIA 1OTRB 1WH3A 2AEHA 2YT1A 3W1SA 2KHWB 4X57B 4HATB 4G50A 1WGHA 3UINB 1TTNA 1V88A 1T0YA 5C23A 3SO6A 4CHMA 3B08A 4ANXA 1PLSA 2KKCA 3MHSD 1DBHA 2E2XA 1EAZA 2P0FA 4DDID 2MBQA 2FIFA 1MPHA 2YF0A 3VIAA 2FCNA 3W1SC 3N32A 3PVWA 3ML4A 2C60A 4GXBA 1UBIA 1YJ1A 1IPGA 2RPQA 1WXMA 4I6LB 3GYPA 1ZGUB 2D9YA 5DPWA 3R66C 1Z87A 3QK0A 4ANUA 4KVGB 2YSZA 2W9NA 3QQ8B 3L13A 4BKSA 2KZRA 4LDTD 1DDWA 4BOSC 1KZ7A 2K00A 4MT7A 4ANVA 3BJIA 4IW0A 5BO4B 2DYNA 1WXSA 4W9FA 2GBKA 3SUZA 4FLHA 1Y5OA 1I2HA 2NPTB 2HE7A 4JL9A 2XQNM 5L83A 2KMAA 3ZDTA 5TR5A 2UZRA 3APFA 3SHQA 4DBGA 3T06A 3ECIA 2YRYA 2N9EB 1LFDA 2J0JA 1WJ1A 2MX2A 4IM0A 2FUHB 2NPTA 5CHFA 1UD7A 1V5MA 3TFMA 2LOXA 2KDEB 2KDBA 4MY6A 4GZUA 4JLCA 1VD2A 4CHJA 4ANWA 2AWTA 5DHFB 2IO2B 3H7PA 4BKSD 2NR2A 3ZNGC 4MSMB 1P0RA 3QJZA 4HAXB 1W1GA 1S3SG 5DH9B 4ASWC 4EKUA 5JHGA 2Z0OA 2C7HA 3L17A 1XODA 3ULCA 1RAXA 2K8CA 3A4RA 3NOBA 1QC6A 4GN1A 1FOEA 1WVHA 2M17A 2Z0PA 4EEWA 4XX5A 3R7QA 3A4SC 4W9IA 4RM8A 2GJYA 2M8SA 3U7DA 2KOXA 2BGFA 3QAQA 2M38A 1XT9B 2G45B 2LASA 2ZCCA 1BWNA 4NSWA 1HB8A 3PHWB 5D27A 3WAOA 1ISNA 3FM8C 2L00B 4TKNA 4W9CA 2MCNB 1WE6A 2LXAA 5HE3A 1GG3A 1U2BA 3KUZA 2EMTA 3PSCA 1YD8U 4EJNA 2PZ1A 1U5EA 1DDVA 4XWXA 1S1QB 1RJ2A 3ULBA 1KOTA 2KDFB 2V76A 2MW5A 3IHPC 2JRHA 1G6JA 4WJNA 1Q0WB 3NZUA 2KD0A 4I6NB 1X1MA 2COCA 3ZIMA 4CO7A 3WA0A 2N9XA 5EDSA 5C16A 4ZRJA 3DCGA 3T9LA 4WWPA 1WJNA 3FEHA 1WGQA 1E7UA 2DAFA 5HE2A 3QCAA 4FA6A 4PYUA 2CHXA 2RGNB 4G0NB 2Z0QA 3JSVB 3V61A 4GDKB 4HB3B 3QWZB 4TYZA 3PRPB 2DKPA 1V86A 3JSVA 3NS8A 4W9KA 4GDKA 3QC8B 1ST7A 2C9WB 1VCBA 4MH0E 3DOWA 2BWES 3DVNU 1OQYA 4B9KA 4G3XB 2EJ8A 3ZLZA 5IJMA 4W9EA 1TQZA 1P3QU 1W1DA 1TZ1A 2M0XA 1NTVA 1SHCA 3K9PB 5KQ1A 3ML9A 3ZUNA 3IFWB 1KJTA 3AULA 4WSFA 5JLJB 4AWJA 1NBFC 2BKRB 2KC2A 2NBVB 4KDLB 1U5FA 4IM2A 4IOYX 4PQ0A 1L7YA 3O65B 2XK5B 2KX0A 2PJHA 2GBJA 4PS7A 3M62B 5C1ZA 2YT0A 4IC7B 3Q3FA 1TXDA 4DWFA 2DTCA 2CRFA 2LBBA 4HB2B 2DKQA 2MP2B 3UQAA 1XQQA 3UGBB 4W9DA 2D07B 2LGDA 2IO3B 4GB9A 1D3ZA 2LVPA 5GMVA 4LCDE 3KY9A 5CHWA 5AZFA 2Y7BA 3ODXA 3KW5B 4KSKC 5LXIB 2XBBC 2LGXA 5D3XA 2DAJA 2KNBA 3H9DA 4M0WB 2O6VB 2KLGA 4AP4C 2LRWA 3TMPB 2WWZA 3PSEB 4CYEA 2D9WA 3P2BA 3APDA 3PV1A 3ZKJC 4M8NA 1WG7A 3WALA 2IYDB 2CHWA 4W9JA 2JF5A 2GOWA 2WX1A 4A6FB 3WANA 2ELAA 2YVCA 3VUWA 2KVRA 1W1HA 2MBBB 4HAUB 3JW0X 3VVWB 3IBEA 1WM2A 4F7HA 2BCJA 2ABDA 2KCJA 1UH6A 5J3TA 2N9PC 1OEYA 3AU4A 3VDZA 4HCNB 3TBLD 2JXXA 2MDXA 1NTYA 3VAWA 2G35A 3DQVA 3V60A 3TIXA 1WJMA 5JHBA 4TV3A 5AEKB 2FDQA 3CMMB 4TUUA 1CMXB 1RFAA 1DROA 2KQSA 5G2NA 5DCNA 1Z2MA 2REXA 4TQ1A 5JZEB 2LXCA 2P8VA 3R7RA 3KRWA 2O6VD 3U30A 1GNUA 1U4AA 4BKTA 1WZ3A 3X0WA 5D3WA 3V5WA 2DYOA 2IY1B 2RVBB 2LWPA 4NJ6A 1XKEA 1LXDA 3A1QB 5D94A 5D6JB 2HTHA 4MSQB 2VKIA 3BY4B 4ICUA 4B6HA 4K17A 3ZDMC 1UPQA 1L2NA 2G3QB 4KV2A 4MJSA 1AARA 1ZW7A 3A1QA 2D11A 3O96A 3N7CA 4NQLB 4HAWB 5L95C 2I5CA 2D4QA 2K2UA 1YX6B 2OTXA 4EZJA 1Q1OA 1WRDB 4HLEA 4KHOA 1BTKA 1I35A 2KXJA 1ACAA 2ROVA 1RRBA 1RRPB 4A3PA 1MG8A 1C3TA 2DYMA 4TQ0A 1MIXA 2KUPA 3WAPA 2RNRB 5D2MB 1C1YB 4KDIC 1OY2A 2D2QA 1WI0A 4HWIB 1TJ6A 3PPAA 1WJ4A 3TVVA 3MJWA 3A8QA 2CKHB 4HAVB 1YX5B 1V2YA 2L8JA 2UYZB 4LJOB 4EOYA 2MSED 1A5RA 2JVCA 3M3JA 1LB1A 3DXCA 2NBWB 4PNKA 4KZCA 1V5TA 2HJ8A 5KHOA 4WJOA 2RD0A 4MDKE 2N4FA 2PEAA 2M14A 4HDOA 4ZDVA 1WXAA 4EZKA 2YS5A 5IAAC 4FULA 1XD3B 3VXWA 2BYEA 3A9JB 3V6EB 2RQ1A 2CAYA 1WGUA 4IM3A 4FHKA 4E74A 3PGEA 2NCNA 4HHVA 4MM3A 2KWCA 2IZVB 3A9JA 1K5GB 2BWFA 4BVUC 4HPLB 3JYUA 1J0WA 1SE9A 5KQ4A 3PEGA 3ML8A 3L54A 5E6NA 1WXVA 4AJYB 1V5UA 3VHTC 4E3CA 4F7ZA 2CY4A 4KSLC 3ONSA 1F9JA 3SU8X 3PTFC 4K2OA 2KMCA 2JT4B 3M95A 4DHZB 4HJKA 4K7UA 3VUXA 3EPYA 2JP2A 3M63B 1WGRA 4Y94A 4RMAA 5E6OA 2L7RA 3VFKA 1EUVB 3R3MA 5KCVA 4GU2A 2CU1A 1WYWB 4WJ7A 5DPSA 3UZTA 1U5DA 2BYVE 1P9DU 3WIMA 2M4NA 2N1WA 2I1JA 3L10B 2RSGA 2N7DA 1U27A 4II2B 4MEMA 1EO6A 4EFOA 4Z2MB 3APCA 1E8YA 4HK2A 2L0FA 2LULA 3RCZA 4MGIE 1E90A 2PE6B 1M94A 2FCMA 2RUKB 1FB8A 3D32A 3PS6A 2KQ7A 5AZHA 4MK0A 3ZRFA 2K6DB 1BT0A 5E6PA 2IO1B 4WWNA 3KRXA 2KWUB 1OGWA 2ADZA 3SV1A 2HD5B 1PQSA 4C0AA 1WGDA 2XEWA 3RZFA 4K7SA 4FN2A 1XD4A 4KHAA 3CIKA 2X18A 3IG3A 1FXTB 2RSUA 3V6CB 2R09A 3RCPA 4HAYB 4W9HA 1ZSQA 1I42A 4BFRA 5DHAB 4NNJB 1WIAA 2D10A 3ZTCA 5CLLB 2KTFA 3ZW3A 1OQNA 2QHOA 1LW3A 2NVUI 1I7AA 5DPTA 4HCPB 4F7GA 3OJ4B 2ROZB 1GUAB 2J0KA 4EMOA 2I5FA 3ZRCA 1UNPA 4F7UP 4Z2NA 3RD2A 2DFKA 1Y19B 2LYDA 1SIFA 3B0AA 1FHWA 2KJHB 2NZ8B 3PG7A 4WVFB 4PYZA 3VOQA 3A9KB 1V9JA 2DYBA 4G11A 4RM9A 3X23A 2G4SA 1WX7A 2GBNA 3PREA 1ZC3B 1EGXA 1DYNA 1Z5SB 2Q13A 3HM6X 3P7ZA 3I3TB 1NTIA 2P0HA 2KJRA 1ZVRA 1MK9B 4GSWA 2J7QB 3F0WA 2MWNB 2LZ6A 5J3YA 2OJRA 1GC7A 1WR1A 3HQCA 5G55A 2ZJDA 2KC1A 3NSUA 3EECA 4I6PA 4D0NB 1E8XA 2RLOA 1M7EA 3RULA 3T8MA 5C5BB 2XK5A 3AXCA 4PS8A 3TO1A 2IBIB 4XZ4A 3MPXA 5J18A 2DN6A 1R4NI 2JUOA 1KLVA 1TGZB 3N3KB 5C5BA 2H7DA 3DVGY 2CB8A 2MP2A 3F5RA 3HW2B 4ZRIA 4WJQA 2MBEA 2CODA 1KM7A 4NAWB 2CQUA 4A3OA 1E8WA 2BF8B 5JH5C 2L2IA 4GPTB 5IA7A 3WAMA 1WZ0A 3NZSA 3DVNV 2Y5BB 2WYQA 1EF5A 1MIZB 3H6NA 5J2RA 1ZC4B 3PHXB 4DX8A 1ZKHA 2KJ6A 3Q3JA 3RZWC 4OVUA 2O6VA 3SNHA 2ZZPB 1UEFA 2VRWB 4K7WA 4DBBA 2K8BA 2LVQA 2FCSA 3LJUX 1SGHA 2EKEC 3KYDD 2COPA 1J19A 3MTNB 1K8RB 3PRZA 1OMWA 4A6FA 1XCGA 3CSTA 2DLWA 3SYXA 3DBLI 1H8CA 4WJPA 4F8CB 3QX1A 4GOCA 4DHJB 5HE1A 1N3HA 4HAZB 2J0MA 1P98A 2K39A 2I1KA 3VH3B 2MA9B 2MWSB 2P0DA 2MBHA 4P7IA 3LDZE 2WX0A 5GOWB 4J6IA 1UPRA 1U29A 4ICVA 4IG7B 2GMIC 4DHZE 2IO0B 5CTRC 1OEYJ 2ZVNA 1WR6E 2FCQA 3QARA 1EF1A 2IYBA 1IRSA 2MRPA 3ZTDA 1Y8RC 2L76A 3OAWA 2BKFA 2LD9A 4KIKB 2PE9A 2LUEA 1WFYA 2K6QA 2YS3A 3QHTA 2OQBA 4WAAA 2R0DA 1BTNA 2KTRB 2DX1A 4KIKA 2Z0DB 2D9XA 1UELA 3DPDA 1DDMA 2NBUA 2QKLA 2LRUA 4FBJB 4K1RB 4BOZB 2KTRA 1JRUA 3H1UA 3DXEA 2ZVOA 3TJPA 2KWVB 2GCJA 3QIJA 4DHJD 4AJWA 2JZZA 1X11A 4FJYA 1WMHB 2D9VA 2AL3A 2A4ZA 4JQWC 3KZ1A 2W2WA 2CS4A 4CHKA 1E5WA 3HIZA 2PPHA 3C0RB 3AJ4A 2CY5A 1X05A 1WMHA 2R2QA 3S2AA 2K8HA 2C5LC 2LJ5A 2N1VA 2GCLA 2DA0A 4GMXB 5C79A 4ZYNA 2AL6A 5JHAA 4MGYE 1RLFA 1NDDA 1WGYA 4DX90 3PP2A 3ZNZB 3VQIA 2JZ3B 5FR6A 1UNRA 4F1SA 5DIFB 1WI1A 1YQBA 3ODOA 3DXDA 4EZLA 2Y8GA 2GS0A 2DZKA 5FI0A 2L05A 2C7MB 4HPMB 1UZXB 3N30A 2N23A 1PMSA 3ZO5B 5FI1A 2GBRA 3G9WA 3VTVA 1M7RA 2FAZA 1GJZA 3JVZX 1IYFA 2IY0B 3A98B 2ZEQA 3M1IB 3RT3B 2CHZA 3EC8A 4BBNC 2L1CA 1EVHA 1FHXA 2ZNVB 3DBSA 3AU5A 1WJUA 4FJVB 5D3YA 2N7EA 2N0YA 2OOBB 4KHBB 4NJ7A 3ZVVA 3H7SA 4JIOU 3U8ZA 3ZNID 1FGYA 1X1FA 3PLVA 1KZGA 3SDLC 4L6EA 1HE8A 1KI1B 3VTWA 3H7PB 3QWMA 5CLQB 1V81A 3FSSA 4FHJA 2B3AA 2O2VB 2JRIB 4HB4B 2DHKA 4HVBA 1P5TA 1TBEA 3WYFB 2R2OA 2ZNVC 3L08A 5D7GA 5D3VA 2O2VA 2M1MA 4BBNF 2C7NB 3RYTA 4URKA 3L16A 5CHVC 1X86A 3P6AA 1MAIA 2K25A 4NPNA 2JPHA 5JHHA 3QBVB 3A33B 4IWOA 3OANA 4II3B 2Y8FA 3KYCD 4K2PA 5JP4A 1UBQA 2L3ZA 5HKHA 1WJ6A 2MKRA 2KLCA 2VRRB 2NMBA 2ZPYA 4BBKA 3BINA 1LQBA 2K2JA 4HB0B 2GBMA 2LOZA 2DZJA 4GGQA 2FJLA 2D9ZA 3TCAA 4NY0A 1WY8A 4WQOB 2KGXB 3UIOB 3KUDB 3VH4B 2Z0EB 1HB6A 1J0GA 1P1AA 3FP5A 1FGZA 4AOFA 1NI2A 3EHVA 2HRJA 3ALBA 2CR5A 2V1YA 5LOPB 2G4DB 2KN5A 2COAA 1P6SA 1R4MI 4MGZE 1BAKA 2UVMA 4IWPA 5C6RA 2LG1A 1AQCA 1K5DB 5L81A 4KAXB 1V89A 2MQJA 2FIDA 2Z59B 3D8DA 2ZCBA 2WH5A 1WM3A 2BYFA 1WX9A 3KSYA 2DZMA 1PFJA 1H10A 3HM3A 3D8EA 3DBRI 3PVUA 3RUIB 2DYQA 2LVOA 3GYOA 4KZ0A 2V3SA 3B1LX 1IP9A 1V61A 2UWQA 3MDBC 2W2XC 1LM8B 4IFSA 3PVLA 4MELA 3A9KA 1YIWA 4A5KA 1QQGA 2DX5B 3A8PA 2K1FA 1B55A 3CXBB 4JGHB 2DHZA
chains in the Genus database with same CATH superfamily
5EE0A 5BMIA 2LEKA 2COFA 1V5OA 1E8ZA 2JU6X 3GP7A 2JYEA 3W9CB 3ZXRA 3CWIA 2DX5A 3PLUA 4GIVA 2A5UA 3FILB 3AI5A 2W2XD 2IGDA 2KR0A 4W9LA 3PZ7A 2LGYA 2INPE 3R2IA 1HZ5A 3K9OB 3ENEA 2RR9A 3AE7B 3V62A 3TL5A 2M0AA 1T0QC 2IFSA 3D8FA 3L0WB 1YOVB 2JY6A 3OJ3A 2V4LA 5BYQA 5LNK1 1WGGA 3URYA 2WDTB 4A6KA 1H4RA 3FILA 2KANA 5LONB 4W9GA 2D5GA 2LJIA 4N9F4 2KK8A 2KFJA 2QKMA 3UQBA 1AWEA 5BMHA 3NZ3A 2WXFA 4WQMA 3ZNHB 2JZPA 1V97A 3VTUA 2KO3A 3TW1A 4DDGD 1YN5A 4IOIE 3Q14C 2MBOA 2V0GA 2LKOA 1VBHA 4IWQA 1V1PB 2WP9B 3FC4A 3N20C 2EMSA 1ENFA 4BKGA 5AZGA 1ZM0A 4FJZA 4GMVA 4NAWA 2BPSA 2L1AA 4MT5A 3W1YA 2FNJB 1UNQA 1P3RA 4ITKA 2WDVB 2KFKB 1J8CA 5DI9B 4H8SA 1XX0A 2MFQA 3HHMA 1FHOA 3AE9B 3OLMD 4JK8A 3IVFA 3NUHB 3ZXVA 3KH0A 1V1PA 5D3IB 4ZRKA 2YLMA 2KN4A 1JROA 3DHGC 1GB4A 1V6EA 2DHJA 2FJ9A 4GDLB 1C79A 3DVGX 4A20A 2KFKA 2KX3A 2G9HD 5HE0A 3UI3A 2Z4DA 5D3DA 4YWGG 2YT2A 3CSFA 2AYOB 5HHDG 3RNFC 3ODWA 3SD5A 2PVOD 4US8A 4A9AA 4DXAB 2DZIA 2CJOA 2ICIA 3EFUA 5LXHA 2ASQA 4GDLA 2RGFA 2J59M 2LI5A 1MKEA 4B0EA 4JK7A 4MGKE 3UIPB 1NU2A 3LJ3A 4D2KA 3FVCA 5EFXA 1V8CA 3NHEB 1FAOA 3PZDA 1T6BX 3GZNI 2UZSA 2X38A 4HDQA 1HZ6A 2DENB 1NVLA 1V80A 1MK7B 4HXDA 4LNNA 1HBKA 1V49A 1UGMA 1GC6A 3ZVRA 4B6WA 3HK0A 3I9V1 3FLVA 1X1GA 1Q5WB 1QZEA 2ZPNA 4YL8A 5DPRA 3PRMB 3QA8A 1XR0B 3AECB 4YXDB 4IAPA 4YONA 4A6HA 2JWZA 4IUMB 2L0TA 3DDCB 4NQKE 3MC9A 2EC1A 2KT7A 4JKFA 1E7VA 1JWBD 4LTUA 4K81A 4E71A 2BYTA 2WXRA 4ARCA 3PT2B 2FJUB 1U5GA 4PS3A 4WWOA 4FADA 2NS5A 2VSZA 4EUTA 4K3CA 5J17A 2BVCA 2UU7A 2N9KA 3TEZA 1Q67A 3UF8A 2DHIA 2ON8A 3NY5A 3DBHI 3KUCB 2AQ1B 3GOEA 3U52E 4YTNB 4C4VB 3BK2A 3HRDD 2H88B 3TEWA 5J3QA 2HTHB 4B95A 2WLBA 1PGAA 2YS1A 1V5PA 1WX8A 2QMTA 3CF6E 2MLBA 3I5JC 1MI0A 2D3GA 3RI7C 4JPSA 4AUQC 2H7EA 4MJSB 5CX3A 4XC2A 2ELBA 3KVFB 1N5WA 2DBYA 3E9LA 4LDTB 4C4VA 4L23A 4RH6A 1WE7A 4OVVA 5LLIA 2MEKA 2PW9A 5KHQA 2RRFA 3E9PA 3GE8C 4LJPB 4LLGM 1WF9A 4DK5A 2V9HA 2WQYB 3VUYA 4M8MA 2KDIA 1JDEA 1OTRB 1L5PA 1WH3A 2AEHA 2YT1A 3MJ5A 3W1SA 2KHWB 3OHMB 4X57B 4HATB 4G50A 1WGHA 3UINB 1TTNA 1JWMD 1V88A 4JWSC 1T0YA 1R4MB 5C23A 1WWTA 3SO6A 4CHMA 3B08A 4ANXA 1PLSA 2KKCA 3MHSD 1DBHA 2E2XA 3P63A 1EAZA 2P0FA 1J7BA 4DDID 1DIKA 2QEJC 2ZKMX 2RMMA 2MBQA 2FIFA 1MPHA 3AEDB 2YF0A 3VIAA 2FCNA 3W1SC 3N32A 2MJDA 2L83A 3PVWA 3ML4A 1TY0A 2C60A 2GI9A 1DOXA 1TY2A 4JK9A 1L0VB 3AH7A 1UGJA 4GXBA 1UBIA 5I2SA 1YJ1A 1IPGA 2RPQA 1WXMA 4I6LB 3GYPA 1ZGUB 3T3OA 4XYCA 1MI1A 2D9YA 5DPWA 3R66C 1Z87A 3QK0A 4ANUA 3DBRB 4KVGB 2YSZA 2AQ2B 2W9NA 3QQ8B 3L13A 4BKSA 2KZRA 5FKAC 2I2YA 4LDTD 1DDWA 4BOSC 1NVID 1KZ7A 2K00A 4MT7A 4ANVA 3BJIA 1P7EA 1YMHE 4IW0A 5BO4B 2DYNA 1WGKA 1WXSA 4W9FA 2GBKA 4AQ7A 3SUZA 4FLHA 2RPVA 2BB5A 1Y5OA 1I2HA 2NPTB 2HE7A 4JL9A 2XQNM 5L83A 2KMAA 4MM3B 3ZDTA 1C78A 5TR5A 2UZRA 1L6UA 3BYYB 3APFA 3SHQA 4DBGA 3T06A 3ECIA 2YRYA 2N9EB 1LFDA 2CJNA 4JKGA 2J0JA 2PVGC 1WJ1A 2MX2A 4IM0A 1UNSA 2FUHB 2NPTA 5CHFA 1UD7A 1V5MA 2IJ0A 3TFMA 2LOXA 2KDEB 1SE3A 3NVZA 2KDBA 4EE2A 4MY6A 3I63C 5EE3A 1TS4A 3KWVA 4GZUA 2K0PA 4A6QA 5LG4B 4HPPA 1VD2A 4JLCA 1FNVA 4CHJA 4KGRA 4ANWA 4OVZA 2AWTA 5DHFB 2IO2B 3H7PA 3AE8B 4BKSD 2NR2A 3ZNGC 4MSMB 1P0RA 1TYGB 4LNOA 3QJZA 4DXFA 4HAXB 1P7FA 1W1GA 1S3SG 5DH9B 3V3XA 3NVWA 1L4DB 4ASWC 4EKUA 3HSAA 5JHGA 2KWDA 2Z0OA 2C7HA 3L17A 1XODA 3ULCA 1RAXA 2K8CA 3A4RA 3NOBA 1QC6A 1D5ZC 4GN1A 1TS3A 4RF1A 1FOEA 2M17A 1WVHA 2Z0PA 4EEWA 1ZYIA 1XF5L 2M56B 4XX5A 2N9LA 3R7QA 3A4SC 2ONQA 4W9IA 3RNBC 4RM8A 3TEYA 2GJYA 2M8SA 3U7DA 2KOXA 1WSPA 2JYTA 3E56A 1XXGA 2BGFA 3QAQA 2M38A 1XT9B 3VRBB 2G45B 2LASA 2ZCCA 1BWNA 4O1NA 2KIGA 1I7HA 3AEGB 1FNWA 2FE8A 1FCCC 2SAKA 4NSWA 1HB8A 3PHWB 3BK1A 4K3BA 3C19A 5D27A 3WAOA 1ISNA 1HA5A 1L0XB 3FM8C 2L00B 4TKNA 4W9CA 2MCNB 1WE6A 1N63A 2J4XA 3OWEB 2LHDA 2LXAA 1ZPSA 5HE3A 3DBLB 1GG3A 1U2BA 3KUZA 2EMTA 3PSCA 1YD8U 4EJNA 2PZ1A 1U5EA 1DDVA 4XWXA 1S1QB 1RJ2A 1SF0A 3ULBA 1KOTA 2KDFB 2V76A 4C00A 1I4HA 2MW5A 2WXKA 1QKZA 3IHPC 4D6WA 1DOIA 4XWWA 2JRHA 2W55A 1G6JA 4WJNA 1C4CA 1Q0WB 3NZUA 1FFVA 2KD0A 2R61A 4JKDA 4HEA1 4I6NB 1X1MA 2COCA 2WU2B 3ZIMA 4CO7A 1N62A 5AUIA 3U2SC 3WA0A 2N9XA 3BWUD 3MHZA 5EDSA 5C16A 4ZRJA 3NS1A 3DCGA 2YEPB 1YQ4B 3T9LA 4WWPA 1WJNA 2Y5CA 3FEHA 1WGQA 1E7UA 2DAFA 2I38A 1BXTA 1AWDA 5HE2A 1CQVA 3SFDB 3QCAA 3IAM1 4FA6A 4PYUA 1ZP0B 2CHXA 2RGNB 4G0NB 2Z0QA 1ZDXA 3JSVB 3V61A 3AE1B 4GDKB 1D5XC 1FCLA 4HB3B 3QWZB 1QOBA 3DBHB 4TYZA 3LXFA 3PRPB 2DKPA 1LGRA 2ACZB 3C8YA 2BBCA 2LGIA 2B76B 1V86A 1DYQA 3JSVA 3NS8A 4W9KA 2V3PA 4GDKA 1HTQA 3QC8B 2BS2B 1ST7A 2KQ4X 2C9WB 1VCBA 4MH0E 3DOWA 2BWES 3DVNU 1OQYA 2Y5PA 4B9KA 4G3XB 2EJ8A 3ZLZA 5IJMA 3Q3NC 4W9EA 1TQZA 2ZW0A 1E10A 1P3QU 3ZQ4A 1W1DA 1TZ1A 2K3UA 1TKYA 4ZHOA 2M0XA 1NTVA 1SHCA 1TKEA 3K9PB 3A58A 5KQ1A 3ML9A 1C4PA 3IFWB 3ZUNA 1JWAD 1KJTA 2WDRB 3AEFB 4P16A 3AULA 4WSFA 5JLJB 4AWJA 1NBFC 2BKRB 2QCZA 2SEBD 2KC2A 1VDVA 4J3OD 4LNIA 1DGJA 1E6EB 2NBVB 4KDLB 1U5FA 4WAFA 4IM2A 4IOYX 4PQ0A 1L7YA 4LK0M 3O65B 1I4RA 2XK5B 2KX0A 2PJHA 2GBJA 4QAYA 2IDYA 4PS7A 1VZ7A 3MP9A 3M62B 5C1ZA 2NBVA 4XWTA 3W5VB 4JKCA 2YT0A 4IC7B 3Q3FA 1YN4A 1TXDA 1RFKA 4DWFA 2DTCA 1KLUD 3BIID 2CRFA 2LBBA 3ZGZA 4HB2B 2DKQA 1TS2A 2MP2B 3UQAA 1XQQA 2YEPF 3UGBB 4KGSA 4W9DA 2BS3B 4C7YA 4FXCA 2OJWA 2D07B 3RNAC 2LGDA 2IO3B 2NTTA 3ETRA 3ZJVA 4GB9A 4WWMA 2LVPA 5GMVA 1D3ZA 1I4GA 2W82A 4LCDE 4CQNA 3H8HA 3KY9A 5CHWA 5AZFA 2Y7BA 3ODXA 2X8XX 3AEAB 2CU3A 3KW5B 4KSKC 5LXIB 1FM0D 3VRAB 2XBBC 4RCOA 3B77A 3NWFA 5D3XA 2LGXA 2ZW1A 2DAJA 2KNBA 3H9DA 1E7PB 3LB8C 4M0WB 2O6VB 2KLGA 4AP4C 2LRWA 3B2FA 3TMPB 2WWZA 2VH1A 1N61A 5JXVA 2LFIA 4CYEA 1EU4A 3PSEB 2D9WA 2Z14A 1ZOYB 3P2BA 3APDA 3PV1A 3ZKJC 4M8NA 1FRRA 1WG7A 3WALA 2IYDB 2CHWA 2R82A 4W9JA 2JF5A 2GOWA 2WX1A 4A6FB 1QQRA 1FEHA 1NI3A 3WANA 2ELAA 2YVCA 2EKIA 3AEBB 3VUWA 2KVRA 1W1HA 3DHIC 2MBBB 4JE3B 4HAUB 1A70A 3JW0X 3VVWB 3TUOA 3Q2AC 3HVZA 3IBEA 2W3SA 1WM2A 4F7HA 2K5PA 5IO9A 2BCJA 2ABDA 2KCJA 1UH6A 5J3TA 2N9PC 1JCKB 2E6XA 1OEYA 3AU4A 3TSSA 3VDZA 4HCNB 3TBLD 2JXXA 2MDXA 1NTYA 3VAWA 5EE9A 3AV8A 2G35A 3DQVA 5AUKA 1F77A 4C56C 3V60A 1FPYA 3TIXA 1WJMA 5JHBA 4TV3A 5AEKB 1IGDA 1XCQL 2FDQA 3CMMB 4TUUA 1GAQB 2J52A 3NRZA 3Q3OC 1CMXB 1RFAA 1VR9A 1DROA 2KQSA 1C77A 4OSNA 5G2NA 5DCNA 2QDFA 1SJHD 2J42A 1ZUD2 4ILJA 3WCQA 2GUMA 1Z2MA 2REXA 4TQ1A 5JZEB 2LXCA 4DXGA 2P8VA 2MH7A 3R7RA 4ZHPA 2R2YA 3KRWA 2WHIA 2HJ1A 2O6VD 3IAS1 3Q8FA 2FUG1 3RFZB 3U30A 4M02A 5TSSA 1GNUA 1U4AA 1HQRD 4BKTA 1WZ3A 3ZYYX 3X0WA 5D3WA 3V5WA 2DYOA 4GNKB 2IY1B 1AN8A 2LWPA 2RVBB 1HEZE 4NJ6A 1V1OA 1XKEA 1LXDA 3N9YC 1JQ4A 3A1QB 3AE4B 4JX1C 3BVZA 4RGMA 4TMAB 5D94A 3HIEA 1SBBB 4NAMA 4C80A 5D6JB 2HTHA 4MSQB 2VKIA 3BY4B 2KUQA 4ICUA 4B6HA 2DIKA 4K17A 1SSNA 2VZKB 3ZDMC 1UPQA 1GB1A 1L2NA 4MACA 1FNUA 2G3QB 3NW8A 4M01A 4BAXA 4KV2A 4MJSA 1AARA 1ZW7A 2LGSA 3A1QA 2VH2A 2D11A 3O96A 4A55A 3N7CA 1OFFA 4NQLB 1MVKA 2GB1A 4RGNA 4HAWB 2M19A 5L95C 2I5CA 2D4QA 2K2UA 1YX6B 1FRDA 2OTXA 4EZJA 4DIXA 1Q1OA 1WRDB 1OQRA 4HLEA 4KHOA 1BTKA 1TIFA 3NG0A 1FMAD 1N6ZA 4NZLB 1I35A 1KRHA 2LHEA 1ZE3D 5HG2A 2KXJA 1ACAA 2ROVA 2WXQA 1RRBA 1QT9A 1RRPB 4A3PA 1MG8A 1C3TA 2IPKD 2DYMA 4TQ0A 1MIXA 2KUPA 3WAPA 2N7JA 2RNRB 1XO3A 1F2RI 5D2MB 1C1YB 4KDIC 1OY2A 2D2QA 1WI0A 4HWIB 1TJ6A 3VR8B 2KYWA 3LYYA 3PPAA 1SB3C 1WJ4A 3TVVA 1J7AA 3R8BA 2LUMA 4HKQA 3GE3C 3MJWA 3A8QA 1FIQA 3FKYA 2CKHB 4HAVB 1YX5B 1V2YA 2L8JA 3EA6A 1UF0A 2UYZB 4LJOB 5FR3A 4EOYA 1F0ZA 2MSED 1A5RA 2BB6A 2JVCA 3M3JA 5IP4D 1LB1A 2VZKD 3DXCA 2NBWB 4PNKA 4KZCA 1V5TA 2HJ8A 5KHOA 4WJOA 2RD0A 3DWGC 4MDKE 2N4FA 5IN7A 3Q3MC 4JKBA 2M14A 1K50A 2PEAA 4HDOA 4ZDVA 1WXAA 4DQOC 4ZOHC 4EZKA 3TEXA 2YS5A 5IAAC 4ACFA 4FULA 4XDDA 1XD3B 3VXWA 2BYEA 1T77A 1I4XA 1NYQA 3A9JB 2WXNA 3NWAA 2AQ3B 3P4RB 3V6EB 4B0MA 2X0SA 2RQ1A 4JKAA 2CAYA 1MFWA 1WGUA 2K22A 1PUTA 4IM3A 4FHKA 4E74A 1T0SC 3PGEA 5H8YE 2NCNA 4HHVA 3P42A 4MM3A 1JMLA 2KWCA 4H2AA 1L0YB 3O13A 3RNCC 3T3NA 2IZVB 3A9JA 1K5GB 2BWFA 5FK9C 4HPLB 3E9OA 4BVUC 3JYUA 1J0WA 1SE9A 1N60A 5KQ4A 2QSDA 3L4PA 3PEGA 2JX5A 3ML8A 1XLNA 3L54A 5E6NA 3IT4B 1WXVA 4AJYB 1V5UA 3VHTC 4E3CA 4F7ZA 2CY4A 4KSLC 3ONSA 1F9JA 3SU8X 3PTFC 4YTPB 4K2OA 2KMCA 2TSSA 2JT4B 3M95A 4DHZB 4HJKA 4K7UA 3GS2A 3VUXA 3EPYA 2JP2A 1F52A 3M63B 2WXPA 1WGRA 4Y94A 5IOIA 1I4PA 4RMAA 1ET6A 5E6OA 2L7RA 2E3TA 3VFKA 3BYTB 1EUVB 2DNFA 2WGSA 3R3MA 4RNAA 2WXGA 5KCVA 4GU2A 4A90A 1I4QA 3Q8EA 2CU1A 1WYWB 4WJ7A 2G1EA 5DPSA 3UZTA 3I57A 1U5DA 3Q8BA 2BYVE 4REZA 1HTOA 1P9DU 3WIMA 2M4NA 2N1WA 2GRIA 2I1JA 4OT1A 3L10B 2RSGA 1YJJA 2N7DA 1U27A 4II2B 4MEMA 2GLSA 3KWLA 1EO6A 4EFOA 4OW0A 4Z2MB 3APCA 1E8YA 4HK2A 2L0FA 3OG5A 2LULA 2K9XA 4MGIE 3RCZA 1E90A 2PE6B 2MJEA 1M94A 4ZYSA 2FCMA 2RUKB 1B9RA 3VR9B 1FB8A 3D32A 3PS6A 4S17A 2KQ7A 5AZHA 2J53A 4MK0A 3ZRFA 2K6DB 1BT0A 5E6PA 2IO1B 3B9JA 4WWNA 3RPFC 3KRXA 5HFYA 2KWUB 1EWYC 1OGWA 5EE1A 3GZNB 1YJIA 4JWUC 2ADZA 3BVMA 3SV1A 5BYSA 2HD5B 4RGOS 1PQSA 1TT5B 4C0AA 1GOZA 1ACCA 1WGDA 2XEWA 3RZFA 4K7SA 3SBGA 3PO0A 3CIRB 2Q5WD 2WXHA 4FN2A 4LNFA 1XD4A 4KHAA 1VBGA 3CIKA 2X18A 1PGBA 2NTSA 3IG3A 3BVGA 1RM6C 1UUPA 1FD6A 1FXTB 2RSUA 3V6CB 2R09A 3RCPA 4HAYB 2WDQB 4W9HA 3SEBA 1DOYA 1ZSQA 1I42A 4BFRA 5DHAB 4NNJB 5G5GA 1WIAA 2D10A 3ZTCA 1BMLC 2K49A 3AN1A 4PK1A 5CLLB 3J9CA 2KTFA 2D3BA 4A8XC 2Z13A 1LO5D 4XDCA 3RN9C 3AM9A 3N1ZC 1KF6B 3ZW3A 1CZPA 1OQNA 1SE4A 2QHOA 1LW3A 2NVUI 1I7AA 5DPTA 4HJGE 4HCPB 4F7GA 3OJ4B 2ROZB 4YSZB 1GUAB 2WXMA 2J0KA 4EMOA 2I5FA 1F1HA 3ZRCA 1UNPA 4F7UP 4Z2NA 3RD2A 3AE3B 4KKJA 2DFKA 1Y19B 2LYDA 1XLPA 3ENBA 1SIFA 5E6JA 3B0AA 1FHWA 2WXIA 2KJHB 2NZ8B 3PG7A 4WVFB 4PYZA 5C2TB 3VOQA 3A9KB 3W2DA 1V9JA 2DYBA 4G11A 4RM9A 3X23A 1T3QA 2G4SA 1WX7A 4US9A 3U7ZA 1PDXA 2GBNA 3PREA 1ZC3B 1MG4A 1Y56A 4IDIA 4P1BC 4IKGA 1EGXA 1XLQA 1DYNA 2WS3B 1Z5SB 2Q13A 3HM6X 2D3AA 3P7ZA 1L4ZB 3I3TB 2V3NA 2H89B 3DHHC 1NTIA 2P0HA 2KJRA 1ZVRA 1MK9B 3KQ4A 4GSWA 2J7QB 3F0WA 2MWNB 2LZ6A 2BQQA 5J3YA 2DLBA 2OJRA 1GC7A 1WR1A 3HQCA 5G55A 2ZJDA 2KC1A 2PMVA 3NSUA 3EECA 3MC8A 4TSSA 1AW7A 4I6PA 4D0NB 1E8XA 2RLOA 3HVDA 1M7EA 3Q69A 1ZXHA 3RULA 3P1MA 3T8MA 5C5BB 2XK5A 3AXCA 4PS8A 3TO1A 1NENB 4BZAA 2IBIB 4XZ4A 3MPXA 5J18A 3SR6A 2DN6A 1JWSD 1R4NI 2V4IB 4YSXB 1KTKA 3RMKC 2JUOA 1KLVA 2DWQA 2XNAC 1TGZB 3N3KB 5C5BA 2H7DA 3DVGY 3NVYA 4KX6B 2CB8A 2MP2A 1E0ZA 3RNEC 3F5RA 3HW2B 4ZRIA 4WJQA 4C7ZA 2MBEA 1SJED 1YN3A 2CODA 4MH8A 1KM7A 3Q8CA 4NAWB 2CQUA 1SE2A 4HSIA 3AEEB 4A3OA 4YTMB 1E8WA 2BF8B 5JH5C 2L2IA 4GPTB 5IA7A 3WAMA 3MC0B 1WZ0A 2OEDA 1NYRA 3NZSA 3DVNV 2Y5BB 2WYQA 1EF5A 1N5XA 3AE6B 1MIZB 2BT6A 3H6NA 4ZRQA 1F2RC 3KLSX 1D6EC 2Y3AA 5J2RA 1QF6A 1ZC4B 3FAHA 1C4AA 3PHXB 4DX8A 4N6EB 1ZKHA 3N1YC 2KJ6A 3Q3JA 3V05A 4M0WA 1XLOA 3RZWC 4QJ4B 4OVUA 2O6VA 5BMGA 3SNHA 2ZZPB 1UEFA 2VRWB 1QLBB 4K7WA 4DBBA 1KFYB 2K8BA 2LVQA 2FCSA 3LJUX 1SGHA 2EKEC 3E9SA 3KYDD 2COPA 1J19A 2QILA 3MTNB 1K8RB 3PRZA 1D5MC 1NEKB 1OMWA 4A6FA 4P6VF 1XCGA 3CSTA 5JVLA 2DLWA 3SYXA 3DBLI 2QIEB 1H8CA 4WJPA 1AYFA 1SIJA 4F8CB 3QX1A 4GOCA 4DHJB 3R2TA 1J7CA 1RWSA 4OZCA 5HE1A 1N3HA 2MHJA 4HAZB 2J0MA 1P98A 2K39A 2I1KA 3VH3B 2MA9B 1M4VA 2MWSB 2P0DA 2MBHA 4P7IA 3LDZE 2WX0A 5GOWB 2QC8A 4P1CC 4J6IA 1UPRA 2W54A 1U29A 4ICVA 1CK1A 4IG7B 1UWMA 2GMIC 4DHZE 2IO0B 4GOUA 5CTRC 1OEYJ 2XN9C 1VZ8A 2ZVNA 3AB5A 5I4DA 3GB1A 1WR6E 2FCQA 3QARA 1EF1A 2IYBA 1IRSA 1TZOA 2MRPA 1WRIA 3ZTDA 1Y8RC 2L76A 3OAWA 2BKFA 2LD9A 4KIKB 2PE9A 2LUEA 3BZDB 4HRSA 1WFYA 2K6QA 4JKEA 2YS3A 3QHTA 2OQBA 2JXTA 3ABVB 4WAAA 3AE2B 2R0DA 2WXLA 1BTNA 2KTRB 1EWCA 2JQRB 2EELA 2L52A 2DX1A 4KIKA 2Z0DB 2D9XA 1UELA 1WXQA 3DPDA 1DDMA 2WXJA 2NBUA 1JW9D 2QKLA 1SEBD 2LRUA 4FBJB 2KIEA 3DCXA 4K1RB 5MPOA 1ZXIA 4BOZB 2KTRA 5BYRA 1JRUA 3H1UA 3DXEA 2ZVOA 3TJPA 2KWVB 2GCJA 4KGTA 1D4BA 3QIJA 1E9MA 4DHJD 1VLBA 4AJWA 2JZZA 1X11A 4FJYA 1WMHB 1TKGA 2D9VA 1SXTA 2AL3A 2A4ZA 4JQWC 1JWUD 3P4QB 3EUB2 2MJ3A 3KZ1A 4UDUC 2W2WA 2CS4A 4QJ5B 4CHKA 1E5WA 3HIZA 1KC7A 4M00A 1K53A 2PPHA 3NJTA 3C0RB 3AJ4A 2CY5A 4HKZE 1X05A 1WMHA 2R2QA 3S2AA 2K8HA 1ZDVA 4HROA 1ROEA 2C5LC 2LJ5A 2N1VA 2GCLA 3N1XC 2KMMA 2DA0A 2PKOA 4GMXB 5C79A 4ZYNA 2AL6A 2BW2A 4N59A 5JHAA 4MGYE 2WU5B 1RLFA 1NDDA 1WGYA 4ILHA 4DX90 3PP2A 2RDGA 1UWXA 3ZNZB 1FO4A 3VQIA 2JZ3B 5FR6A 1UNRA 4F1SA 1JRPA 5DIFB 1WI1A 4XE0A 1YQBA 3ODOA 5GXGB 1XCTL 3DXDA 4EZLA 1OQQA 2Y8GA 2GS0A 2DZKA 3DWMA 4RFBA 5FI0A 2L05A 2C7MB 4YT0B 4HPMB 1UZXB 3N30A 2N23A 5H92C 1PMSA 2KACA 3ZO5B 5FI1A 2GBRA 3G9WA 1JALA 3VTVA 1M7RA 2FAZA 1GJZA 3P4PB 3JVZX 1IYFA 2IY0B 3A98B 2ZEQA 4LNKA 3M1IB 2IGHA 3RT3B 2WNMA 2CHZA 4QXAB 3EC8A 4BBNC 2L1CA 4OZBA 2NMQA 1EVHA 1FHXA 1IBXB 2ZNVB 2PLPA 1MHHE 3DBSA 4Q2JA 3AU5A 5T8IA 1WJUA 4JKGB 4FJVB 5D3YA 1PFDA 4RF0A 3Q6BA 2N7EA 2RDHA 2N0YA 2OOBB 1GGOA 4KHBB 4NJ7A 3ZVVA 3H7SA 2K8EA 3AMZA 4JIOU 3U8ZA 5HI1A 1IBXA 3P4SB 3ZNID 1FGYA 4QJ3B 3IXSA 1X1FA 3PLVA 1KZGA 3SDLC 5I2MA 4L6EA 1HE8A 1KI1B 3VTWA 2QJLA 3H7PB 3QWMA 5CLQB 4L1BA 1V81A 3FSSA 4FHJA 4KHBA 2B3AA 1IUEA 1TS5A 2O2VB 2JRIB 4HB4B 3ZJTA 2DHKA 3E66A 2HDEA 1KH0A 4HVBA 1P5TA 1TBEA 1ESFA 3WYFB 2R2OA 1R4NB 2ZNVC 1FFUA 1KLGD 1GPXA 3L08A 5D7GA 5D3VA 3ZJUA 1MPEA 2O2VA 2M1MA 4BBNF 2C7NB 1T5XD 5C3JB 4WIPA 3RYTA 4URKA 3L16A 2W3RA 4KKIA 1X86A 5CHVC 3P6AA 1Q10A 2BTEA 1MAIA 2K25A 3NVVA 4NPNA 2JPHA 4XGAB 1KBLA 1L6VA 1FXAA 3Q8AA 5JHHA 1VJKA 1MJDA 3B2GA 3QBVB 3A33B 4IWOA 3OANA 3EFCA 4II3B 5G5HA 2Y8FA 3KYCD 2N0SB 4K2PA 1YQ3B 5JP4A 1UBQA 1K51A 2L3ZA 2IGGA 4ILGB 4JKHA 5HKHA 1XEEA 1WJ6A 4AS1A 4GLSC 2MKRA 2KLCA 1ET9A 2VRRB 4L2YA 2NMBA 2ZPYA 4WH4A 1VRAB 4BBKA 3BINA 1LQBA 2OHFA 2WXOA 2K2JA 4HB0B 2GBMA 2PIAA 1C76A 1EU3A 2LOZA 2DZJA 4GGQA 2FJLA 2D9ZA 2AX5A 3TCAA 4NY0A 1CJEA 1WY8A 4WQOB 2KGXB 5M4YB 2KVZA 4OZAA 3IT6B 3UIOB 3KUDB 3VH4B 1MHXA 2Z0EB 1HB6A 3AE5B 4CSQA 1J0GA 3SBTA 1P1AA 2LMCA 3FP5A 1FGZA 4AOFA 1T0RC 2FBWB 1NI2A 2KAJA 3EHVA 2HRJA 2KDMA 2CR5A 1TJEA 5LOPB 2V1YA 3ALBA 4R3DA 4USAA 4RGTA 2G4DB 2KN5A 4NJCA 2COAA 1P6SA 1R4MI 4MGZE 2D3CA 2INNE 1BAKA 2UVMA 4IWPA 5C6RA 1EM7A 2LG1A 1AQCA 1K5DB 5L81A 3SFEB 4KAXB 1V89A 2MQJA 1QOAA 3MFGA 2INCC 2FIDA 2JWUA 4L1RA 4S0RA 2INDC 1PGXA 3RNGC 4ARIA 2Z59B 4YSYB 5IKCM 3D8DA 4ZRPA 2ZCBA 3HUIA 1STEA 2WH5A 1WM3A 3U12A 1BUIC 1PYWD 2HTME 4PT5A 1B1ZA 3NWDA 2BYFA 4WURA 4OHJA 1WX9A 3KSYA 2DZMA 1PFJA 2L32A 1H10A 3HM3A 3D8EA 3DBRI 2JSVX 2Z59A 5IRSA 3PVUA 4N58A 3U4EG 1R7SA 3RUIB 2DYQA 1VZ6A 1YNTE 2RDBC 2LVOA 3GYOA 1QOFA 4KZ0A 1WYGA 2V3SA 1K52A 3B1LX 1IP9A 1V61A 2UWQA 3MDBC 1HXYD 2W2XC 2PTLA 3PZ8A 1LM8B 4IFSA 2Z8LA 1QILA 1IGCA 3PVLA 4MELA 1FXIA 3A9KA 3EGRA 1YIWA 4A5KA 2BS4B 3W5UB 1QOGA 1RYJA 1QQGA 2DX5B 3A8PA 2K1FA 1B55A 3CXBB 4JGHB 2DHZA 1C9FA
chains in the Genus database with same CATH topology
2COFA 1V5OA 1E8ZA 2DX5A 3PLUA 4GIVA 2A5UA 3AI5A 2W2XD 4W9LA 2LGYA 3K9OB 3ENEA 2RR9A 3V62A 3TL5A 2IFSA 3D8FA 3L0WB 2JY6A 3OJ3A 2V4LA 1WGGA 2WDTB 4A6KA 1H4RA 2KANA 5LONB 4W9GA 4N9F4 2KK8A 2KFJA 2QKMA 3UQBA 1AWEA 3ZNHB 3VTUA 2KO3A 3TW1A 4DDGD 2MBOA 2LKOA 1VBHA 4IWQA 2EMSA 4BKGA 5AZGA 1ZM0A 4NAWA 4GMVA 4FJZA 2BPSA 3W1YA 2FNJB 1UNQA 1P3RA 1J8CA 2KFKB 5DI9B 4H8SA 1XX0A 2MFQA 3HHMA 1FHOA 3OLMD 4JK8A 3IVFA 3KH0A 4ZRKA 2YLMA 1V6EA 2DHJA 2FJ9A 4GDLB 3DVGX 4A20A 2KFKA 2KX3A 5HE0A 3CSFA 2AYOB 3ODWA 3SD5A 4DXAB 2DZIA 5LXHA 3EFUA 2ASQA 4GDLA 2RGFA 2J59M 2LI5A 1MKEA 4JK7A 4MGKE 3UIPB 1NU2A 3LJ3A 5EFXA 3NHEB 1FAOA 3PZDA 3GZNI 2UZSA 4HDQA 2DENB 1NVLA 1V80A 1MK7B 4HXDA 1HBKA 1V49A 1UGMA 1GC6A 3ZVRA 4B6WA 3HK0A 3FLVA 1X1GA 1Q5WB 1QZEA 2ZPNA 4YL8A 5DPRA 3PRMB 3QA8A 1XR0B 4IAPA 4YONA 4A6HA 2JWZA 4IUMB 2L0TA 3DDCB 4NQKE 2EC1A 4JKFA 1E7VA 4K81A 4E71A 3PT2B 4FADA 1U5GA 4PS3A 4WWOA 2NS5A 2VSZA 4EUTA 5J17A 1Q67A 3UF8A 2DHIA 3NY5A 3DBHI 3KUCB 3GOEA 5J3QA 2HTHB 4B95A 2YS1A 1V5PA 1WX8A 3CF6E 2MLBA 2D3GA 4AUQC 2H7EA 4MJSB 5CX3A 4XC2A 2ELBA 3KVFB 3E9LA 4LDTB 1WE7A 4OVVA 5LLIA 5KHQA 3E9PA 4LJPB 1WF9A 4DK5A 3VUYA 4M8MA 2KDIA 1JDEA 1OTRB 1WH3A 2AEHA 2YT1A 3W1SA 2KHWB 4X57B 4HATB 4G50A 1WGHA 3UINB 1TTNA 1V88A 1T0YA 5C23A 3SO6A 4CHMA 3B08A 4ANXA 1PLSA 2KKCA 3MHSD 1DBHA 2E2XA 1EAZA 2P0FA 4DDID 1DIKA 2MBQA 2FIFA 1MPHA 2YF0A 3VIAA 2FCNA 3W1SC 3N32A 3PVWA 3ML4A 2C60A 4JK9A 4GXBA 1UBIA 1YJ1A 1IPGA 2RPQA 1WXMA 4I6LB 3GYPA 1ZGUB 2D9YA 5DPWA 3R66C 1Z87A 3QK0A 4ANUA 4KVGB 2YSZA 2W9NA 3QQ8B 3L13A 4BKSA 2KZRA 4LDTD 1DDWA 4BOSC 1KZ7A 2K00A 4MT7A 4ANVA 3BJIA 4IW0A 5BO4B 2DYNA 1WXSA 4W9FA 2GBKA 3SUZA 4FLHA 1Y5OA 1I2HA 2NPTB 2HE7A 4JL9A 2XQNM 5L83A 2KMAA 3ZDTA 5TR5A 2UZRA 3APFA 3SHQA 4DBGA 3T06A 3ECIA 2YRYA 2N9EB 1LFDA 4JKGA 2J0JA 1WJ1A 2MX2A 4IM0A 2FUHB 2NPTA 5CHFA 1UD7A 1V5MA 3TFMA 2LOXA 2KDEB 2KDBA 4MY6A 4GZUA 4JLCA 1VD2A 4CHJA 4ANWA 2AWTA 5DHFB 2IO2B 3H7PA 4BKSD 2NR2A 3ZNGC 4MSMB 1P0RA 3QJZA 4HAXB 1W1GA 1S3SG 5DH9B 4ASWC 4EKUA 5JHGA 2Z0OA 2C7HA 3L17A 1XODA 3ULCA 1RAXA 2K8CA 3A4RA 3NOBA 1QC6A 4GN1A 1FOEA 1WVHA 2M17A 2Z0PA 4EEWA 4XX5A 3R7QA 3A4SC 4W9IA 4RM8A 2GJYA 2M8SA 3U7DA 2KOXA 2BGFA 3QAQA 2M38A 1XT9B 2G45B 2LASA 2ZCCA 1BWNA 4NSWA 1HB8A 3PHWB 5D27A 3WAOA 1ISNA 3FM8C 2L00B 4TKNA 4W9CA 2MCNB 1WE6A 2LXAA 5HE3A 1GG3A 1U2BA 3KUZA 2EMTA 3PSCA 1YD8U 4EJNA 2PZ1A 1U5EA 1DDVA 4XWXA 1S1QB 1RJ2A 3ULBA 1KOTA 2KDFB 2V76A 2MW5A 3IHPC 2JRHA 1G6JA 4WJNA 1Q0WB 3NZUA 2KD0A 4JKDA 4I6NB 1X1MA 2COCA 3ZIMA 4CO7A 3WA0A 2N9XA 5EDSA 5C16A 4ZRJA 3DCGA 3T9LA 4WWPA 1WJNA 3FEHA 1WGQA 1E7UA 2DAFA 5HE2A 3QCAA 4FA6A 4PYUA 2CHXA 2RGNB 4G0NB 2Z0QA 3JSVB 3V61A 4GDKB 4HB3B 3QWZB 4TYZA 3PRPB 2DKPA 1V86A 3JSVA 3NS8A 4W9KA 4GDKA 3QC8B 1ST7A 2C9WB 1VCBA 4MH0E 3DOWA 2BWES 3DVNU 1OQYA 4B9KA 4G3XB 2EJ8A 3ZLZA 5IJMA 4W9EA 1TQZA 1P3QU 1W1DA 1TZ1A 2M0XA 1NTVA 1SHCA 3K9PB 5KQ1A 3ML9A 3ZUNA 3IFWB 1KJTA 3AULA 4WSFA 5JLJB 4AWJA 1NBFC 2BKRB 2KC2A 2NBVB 4KDLB 1U5FA 4IM2A 4IOYX 4PQ0A 1L7YA 3O65B 2XK5B 2KX0A 2PJHA 2GBJA 4PS7A 3M62B 5C1ZA 4JKCA 2YT0A 4IC7B 3Q3FA 1TXDA 4DWFA 2DTCA 2CRFA 2LBBA 4HB2B 2DKQA 2MP2B 3UQAA 1XQQA 3UGBB 4W9DA 2D07B 2LGDA 2IO3B 4GB9A 1D3ZA 2LVPA 5GMVA 4LCDE 3KY9A 5CHWA 5AZFA 2Y7BA 3ODXA 3KW5B 4KSKC 5LXIB 2XBBC 2LGXA 5D3XA 2DAJA 2KNBA 3H9DA 4M0WB 2O6VB 2KLGA 4AP4C 2LRWA 3TMPB 2WWZA 3PSEB 4CYEA 2D9WA 3P2BA 3APDA 3PV1A 3ZKJC 4M8NA 1WG7A 3WALA 2IYDB 2CHWA 2R82A 4W9JA 2JF5A 2GOWA 2WX1A 4A6FB 3WANA 2ELAA 2YVCA 3VUWA 2KVRA 1W1HA 2MBBB 4HAUB 3JW0X 3VVWB 3IBEA 1WM2A 4F7HA 2BCJA 2ABDA 2KCJA 1UH6A 5J3TA 2N9PC 1OEYA 3AU4A 3VDZA 4HCNB 3TBLD 2JXXA 2MDXA 1NTYA 3VAWA 2G35A 3DQVA 3V60A 3TIXA 1WJMA 5JHBA 4TV3A 5AEKB 2FDQA 3CMMB 4TUUA 1CMXB 1RFAA 1DROA 2KQSA 5G2NA 5DCNA 4ILJA 1Z2MA 2REXA 4TQ1A 5JZEB 2LXCA 2P8VA 3R7RA 3KRWA 2O6VD 3U30A 1GNUA 1U4AA 4BKTA 1WZ3A 3X0WA 5D3WA 3V5WA 2DYOA 2IY1B 2RVBB 2LWPA 4NJ6A 1XKEA 1LXDA 3A1QB 5D94A 5D6JB 2HTHA 4MSQB 2VKIA 3BY4B 4ICUA 4B6HA 2DIKA 4K17A 3ZDMC 1UPQA 1L2NA 2G3QB 4KV2A 4MJSA 1AARA 1ZW7A 3A1QA 2D11A 3O96A 3N7CA 4NQLB 4HAWB 5L95C 2I5CA 2D4QA 2K2UA 1YX6B 2OTXA 4EZJA 1Q1OA 1WRDB 4HLEA 4KHOA 1BTKA 1I35A 2KXJA 1ACAA 2ROVA 1RRBA 1RRPB 4A3PA 1MG8A 1C3TA 2DYMA 4TQ0A 1MIXA 2KUPA 3WAPA 2RNRB 5D2MB 1C1YB 4KDIC 1OY2A 2D2QA 1WI0A 4HWIB 1TJ6A 3PPAA 1WJ4A 3TVVA 3MJWA 3A8QA 2CKHB 4HAVB 1YX5B 1V2YA 2L8JA 2UYZB 4LJOB 4EOYA 2MSED 1A5RA 2JVCA 3M3JA 1LB1A 3DXCA 2NBWB 4PNKA 4KZCA 1V5TA 2HJ8A 5KHOA 4WJOA 2RD0A 4MDKE 2N4FA 4JKBA 2M14A 2PEAA 4HDOA 4ZDVA 1WXAA 4EZKA 2YS5A 5IAAC 4FULA 1XD3B 3VXWA 2BYEA 3A9JB 3V6EB 2X0SA 2RQ1A 4JKAA 2CAYA 1WGUA 4IM3A 4FHKA 4E74A 3PGEA 2NCNA 4HHVA 4MM3A 2KWCA 2IZVB 3A9JA 1K5GB 2BWFA 4BVUC 4HPLB 3E9OA 3JYUA 1J0WA 1SE9A 5KQ4A 3PEGA 3ML8A 3L54A 5E6NA 1WXVA 4AJYB 1V5UA 3VHTC 4E3CA 4F7ZA 2CY4A 4KSLC 3ONSA 1F9JA 3SU8X 3PTFC 4K2OA 2KMCA 2JT4B 3M95A 4DHZB 4HJKA 4K7UA 3VUXA 3EPYA 2JP2A 3M63B 1WGRA 4Y94A 4RMAA 5E6OA 2L7RA 3VFKA 1EUVB 3R3MA 5KCVA 4GU2A 2CU1A 1WYWB 4WJ7A 5DPSA 3UZTA 1U5DA 2BYVE 1P9DU 3WIMA 2M4NA 2N1WA 2I1JA 3L10B 2RSGA 2N7DA 1U27A 4II2B 4MEMA 1EO6A 4EFOA 4Z2MB 3APCA 1E8YA 4HK2A 2L0FA 2LULA 3RCZA 4MGIE 1E90A 2PE6B 1M94A 2FCMA 2RUKB 1FB8A 3D32A 3PS6A 2KQ7A 5AZHA 4MK0A 3ZRFA 2K6DB 1BT0A 5E6PA 2IO1B 4WWNA 3KRXA 2KWUB 1OGWA 2ADZA 3SV1A 2HD5B 1PQSA 4C0AA 1WGDA 2XEWA 3RZFA 4K7SA 3SBGA 4FN2A 1XD4A 4KHAA 1VBGA 3CIKA 2X18A 3IG3A 1FXTB 2RSUA 3V6CB 2R09A 3RCPA 4HAYB 4W9HA 1ZSQA 1I42A 4BFRA 5DHAB 4NNJB 1WIAA 2D10A 3ZTCA 5CLLB 2KTFA 3ZW3A 1OQNA 2QHOA 1LW3A 2NVUI 1I7AA 5DPTA 4HCPB 4F7GA 3OJ4B 2ROZB 1GUAB 2J0KA 4EMOA 2I5FA 3ZRCA 1UNPA 4F7UP 4Z2NA 3RD2A 2DFKA 1Y19B 2LYDA 3ENBA 1SIFA 3B0AA 1FHWA 2KJHB 2NZ8B 3PG7A 4WVFB 4PYZA 3VOQA 3A9KB 1V9JA 2DYBA 4G11A 4RM9A 3X23A 2G4SA 1WX7A 2GBNA 3PREA 1ZC3B 1EGXA 1DYNA 1Z5SB 2Q13A 3HM6X 3P7ZA 3I3TB 1NTIA 2P0HA 2KJRA 1ZVRA 1MK9B 4GSWA 2J7QB 3F0WA 2MWNB 2LZ6A 5J3YA 2OJRA 1GC7A 1WR1A 3HQCA 5G55A 2ZJDA 2KC1A 3NSUA 3EECA 4I6PA 4D0NB 1E8XA 2RLOA 1M7EA 3RULA 3T8MA 5C5BB 2XK5A 3AXCA 4PS8A 3TO1A 2IBIB 4XZ4A 3MPXA 5J18A 2DN6A 1R4NI 2JUOA 1KLVA 1TGZB 3N3KB 5C5BA 2H7DA 3DVGY 2CB8A 2MP2A 3F5RA 3HW2B 4ZRIA 4WJQA 2MBEA 2CODA 1KM7A 4NAWB 2CQUA 4A3OA 1E8WA 2BF8B 5JH5C 2L2IA 4GPTB 5IA7A 3WAMA 1WZ0A 3NZSA 3DVNV 2Y5BB 2WYQA 1EF5A 1MIZB 3H6NA 5J2RA 1ZC4B 3PHXB 4DX8A 1ZKHA 2KJ6A 3Q3JA 3RZWC 4OVUA 2O6VA 3SNHA 2ZZPB 1UEFA 2VRWB 4K7WA 4DBBA 2K8BA 2LVQA 2FCSA 3LJUX 1SGHA 2EKEC 3KYDD 2COPA 1J19A 3MTNB 1K8RB 3PRZA 1OMWA 4A6FA 1XCGA 3CSTA 5JVLA 2DLWA 3SYXA 3DBLI 1H8CA 4WJPA 4F8CB 3QX1A 4GOCA 4DHJB 5HE1A 1N3HA 4HAZB 2J0MA 1P98A 2K39A 2I1KA 3VH3B 2MA9B 2MWSB 2P0DA 2MBHA 4P7IA 3LDZE 2WX0A 5GOWB 4J6IA 1UPRA 1U29A 4ICVA 4IG7B 2GMIC 4DHZE 2IO0B 5CTRC 1OEYJ 2ZVNA 1WR6E 2FCQA 3QARA 1EF1A 2IYBA 1IRSA 2MRPA 3ZTDA 1Y8RC 2L76A 3OAWA 2BKFA 2LD9A 4KIKB 2PE9A 2LUEA 1WFYA 2K6QA 4JKEA 2YS3A 3QHTA 2OQBA 4WAAA 2R0DA 1BTNA 2KTRB 2DX1A 4KIKA 2Z0DB 2D9XA 1UELA 3DPDA 1DDMA 2NBUA 2QKLA 2LRUA 4FBJB 4K1RB 4BOZB 2KTRA 1JRUA 3H1UA 3DXEA 2ZVOA 3TJPA 2KWVB 2GCJA 3QIJA 4DHJD 4AJWA 2JZZA 1X11A 4FJYA 1WMHB 2D9VA 2AL3A 2A4ZA 4JQWC 3KZ1A 2W2WA 2CS4A 4CHKA 1E5WA 3HIZA 1KC7A 2PPHA 3C0RB 3AJ4A 2CY5A 1X05A 1WMHA 2R2QA 3S2AA 2K8HA 2C5LC 2LJ5A 2N1VA 2GCLA 2DA0A 4GMXB 5C79A 4ZYNA 2AL6A 5JHAA 4MGYE 1RLFA 1NDDA 1WGYA 4ILHA 4DX90 3PP2A 3ZNZB 3VQIA 2JZ3B 5FR6A 1UNRA 4F1SA 5DIFB 1WI1A 1YQBA 3ODOA 3DXDA 4EZLA 2Y8GA 2GS0A 2DZKA 5FI0A 2L05A 2C7MB 4HPMB 1UZXB 3N30A 2N23A 1PMSA 3ZO5B 5FI1A 2GBRA 3G9WA 3VTVA 1M7RA 2FAZA 1GJZA 3JVZX 1IYFA 2IY0B 3A98B 2ZEQA 3M1IB 3RT3B 2CHZA 3EC8A 4BBNC 2L1CA 1EVHA 1FHXA 2ZNVB 3DBSA 3AU5A 1WJUA 4JKGB 4FJVB 5D3YA 2N7EA 2N0YA 2OOBB 1GGOA 4KHBB 4NJ7A 3ZVVA 3H7SA 4JIOU 3U8ZA 3ZNID 1FGYA 1X1FA 3PLVA 1KZGA 3SDLC 4L6EA 1HE8A 1KI1B 3VTWA 3H7PB 3QWMA 5CLQB 1V81A 3FSSA 4FHJA 2B3AA 2O2VB 2JRIB 4HB4B 2DHKA 3E66A 4HVBA 1P5TA 1TBEA 3WYFB 2R2OA 2ZNVC 3L08A 5D7GA 5D3VA 2O2VA 2M1MA 4BBNF 2C7NB 3RYTA 4URKA 3L16A 5CHVC 1X86A 3P6AA 1MAIA 2K25A 4NPNA 2JPHA 1KBLA 5JHHA 3QBVB 3A33B 4IWOA 3OANA 4II3B 2Y8FA 3KYCD 4K2PA 5JP4A 1UBQA 2L3ZA 4ILGB 4JKHA 5HKHA 1WJ6A 2MKRA 2KLCA 2VRRB 2NMBA 2ZPYA 4BBKA 3BINA 1LQBA 2K2JA 4HB0B 2GBMA 2LOZA 2DZJA 4GGQA 2FJLA 2D9ZA 3TCAA 4NY0A 1WY8A 4WQOB 2KGXB 3UIOB 3KUDB 3VH4B 2Z0EB 1HB6A 1J0GA 3SBTA 1P1AA 3FP5A 1FGZA 4AOFA 1NI2A 3EHVA 2HRJA 3ALBA 2CR5A 2V1YA 5LOPB 2G4DB 2KN5A 2COAA 1P6SA 1R4MI 4MGZE 1BAKA 2UVMA 4IWPA 5C6RA 2LG1A 1AQCA 1K5DB 5L81A 4KAXB 1V89A 2MQJA 2FIDA 2Z59B 3D8DA 2ZCBA 2WH5A 1WM3A 2BYFA 1WX9A 3KSYA 2DZMA 1PFJA 1H10A 3HM3A 3D8EA 3DBRI 3PVUA 3RUIB 2DYQA 2LVOA 3GYOA 4KZ0A 2V3SA 3B1LX 1IP9A 1V61A 2UWQA 3MDBC 2W2XC 1LM8B 4IFSA 3PVLA 4MELA 3A9KA 1YIWA 4A5KA 1QQGA 2DX5B 3A8PA 2K1FA 1B55A 3CXBB 4JGHB 2DHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COF A;  1V5O A;  1E8Z A;  2DX5 A;  3PLU A;  4GIV A;  2A5U A;  3AI5 A;  2W2X D;  4W9L A;  2LGY A;  3K9O B;  3ENE A;  2RR9 A;  3V62 A;  3TL5 A;  2IFS A;  3D8F A;  3L0W B;  2JY6 A;  3OJ3 A;  2V4L A;  1WGG A;  2WDT B;  4A6K A;  1H4R A;  2KAN A;  5LON B;  4W9G A;  4N9F 4;  2KK8 A;  2KFJ A;  2QKM A;  3UQB A;  1AWE A;  3ZNH B;  3VTU A;  2KO3 A;  3TW1 A;  4DDG D;  2MBO A;  2LKO A;  4IWQ A;  2EMS A;  4BKG A;  5AZG A;  1ZM0 A;  4NAW A;  4GMV A;  4FJZ A;  2BPS A;  3W1Y A;  2FNJ B;  1UNQ A;  1P3R A;  1J8C A;  2KFK B;  5DI9 B;  4H8S A;  1XX0 A;  2MFQ A;  3HHM A;  1FHO A;  3OLM D;  3IVF A;  3KH0 A;  4ZRK A;  2YLM A;  1V6E A;  2DHJ A;  2FJ9 A;  4GDL B;  3DVG X;  4A20 A;  2KFK A;  2KX3 A;  5HE0 A;  3CSF A;  2AYO B;  3ODW A;  3SD5 A;  4DXA B;  2DZI A;  5LXH A;  3EFU A;  2ASQ A;  4GDL A;  2RGF A;  2J59 M;  2LI5 A;  1MKE A;  4MGK E;  3UIP B;  1NU2 A;  3LJ3 A;  5EFX A;  3NHE B;  1FAO A;  3PZD A;  3GZN I;  2UZS A;  4HDQ A;  2DEN B;  1NVL A;  1V80 A;  1MK7 B;  4HXD A;  1HBK A;  1V49 A;  1UGM A;  1GC6 A;  3ZVR A;  4B6W A;  3HK0 A;  3FLV A;  1X1G A;  1Q5W B;  1QZE A;  2ZPN A;  4YL8 A;  5DPR A;  3PRM B;  3QA8 A;  1XR0 B;  4IAP A;  4YON A;  4A6H A;  2JWZ A;  4IUM B;  2L0T A;  3DDC B;  4NQK E;  2EC1 A;  1E7V A;  4K81 A;  4E71 A;  3PT2 B;  4FAD A;  1U5G A;  4PS3 A;  4WWO A;  2NS5 A;  2VSZ A;  4EUT A;  5J17 A;  1Q67 A;  3UF8 A;  2DHI A;  3NY5 A;  3DBH I;  3KUC B;  3GOE A;  5J3Q A;  2HTH B;  4B95 A;  2YS1 A;  1V5P A;  1WX8 A;  3CF6 E;  2MLB A;  2D3G A;  4AUQ C;  2H7E A;  4MJS B;  5CX3 A;  4XC2 A;  2ELB A;  3KVF B;  4LDT B;  1WE7 A;  4OVV A;  5LLI A;  5KHQ A;  4LJP B;  1WF9 A;  4DK5 A;  3VUY A;  4M8M A;  2KDI A;  1OTR B;  1WH3 A;  2AEH A;  2YT1 A;  3W1S A;  2KHW B;  4X57 B;  4HAT B;  4G50 A;  1WGH A;  3UIN B;  1TTN A;  1V88 A;  1T0Y A;  5C23 A;  3SO6 A;  4CHM A;  3B08 A;  4ANX A;  1PLS A;  2KKC A;  3MHS D;  1DBH A;  2E2X A;  1EAZ A;  2P0F A;  4DDI D;  2MBQ A;  2FIF A;  1MPH A;  2YF0 A;  3VIA A;  2FCN A;  3W1S C;  3N32 A;  3PVW A;  3ML4 A;  2C60 A;  4GXB A;  1UBI A;  1YJ1 A;  1IPG A;  2RPQ A;  1WXM A;  4I6L B;  3GYP A;  1ZGU B;  2D9Y A;  5DPW A;  3R66 C;  1Z87 A;  3QK0 A;  4ANU A;  4KVG B;  2YSZ A;  2W9N A;  3QQ8 B;  3L13 A;  4BKS A;  2KZR A;  4LDT D;  1DDW A;  4BOS C;  1KZ7 A;  2K00 A;  4MT7 A;  4ANV A;  3BJI A;  4IW0 A;  5BO4 B;  2DYN A;  1WXS A;  4W9F A;  2GBK A;  3SUZ A;  4FLH A;  1Y5O A;  1I2H A;  2NPT B;  2HE7 A;  4JL9 A;  2XQN M;  5L83 A;  2KMA A;  3ZDT A;  5TR5 A;  2UZR A;  3APF A;  3SHQ A;  4DBG A;  3T06 A;  3ECI A;  2YRY A;  2N9E B;  1LFD A;  2J0J A;  1WJ1 A;  2MX2 A;  4IM0 A;  2FUH B;  2NPT A;  5CHF A;  1UD7 A;  1V5M A;  3TFM A;  2LOX A;  2KDE B;  2KDB A;  4MY6 A;  4GZU A;  4JLC A;  1VD2 A;  4CHJ A;  4ANW A;  2AWT A;  5DHF B;  2IO2 B;  3H7P A;  4BKS D;  2NR2 A;  3ZNG C;  4MSM B;  1P0R A;  3QJZ A;  4HAX B;  1W1G A;  1S3S G;  5DH9 B;  4ASW C;  4EKU A;  5JHG A;  2Z0O A;  2C7H A;  3L17 A;  1XOD A;  3ULC A;  1RAX A;  2K8C A;  3A4R A;  3NOB A;  1QC6 A;  4GN1 A;  1FOE A;  1WVH A;  2M17 A;  2Z0P A;  4EEW A;  4XX5 A;  3R7Q A;  3A4S C;  4W9I A;  4RM8 A;  2GJY A;  2M8S A;  3U7D A;  2KOX A;  2BGF A;  3QAQ A;  2M38 A;  1XT9 B;  2G45 B;  2LAS A;  2ZCC A;  1BWN A;  4NSW A;  1HB8 A;  3PHW B;  5D27 A;  3WAO A;  1ISN A;  3FM8 C;  2L00 B;  4TKN A;  4W9C A;  2MCN B;  1WE6 A;  2LXA A;  5HE3 A;  1GG3 A;  1U2B A;  3KUZ A;  2EMT A;  3PSC A;  1YD8 U;  4EJN A;  2PZ1 A;  1U5E A;  1DDV A;  4XWX A;  1S1Q B;  1RJ2 A;  3ULB A;  1KOT A;  2KDF B;  2V76 A;  2MW5 A;  3IHP C;  2JRH A;  1G6J A;  4WJN A;  1Q0W B;  3NZU A;  2KD0 A;  4I6N B;  1X1M A;  2COC A;  3ZIM A;  4CO7 A;  3WA0 A;  2N9X A;  5EDS A;  5C16 A;  4ZRJ A;  3DCG A;  3T9L A;  4WWP A;  1WJN A;  3FEH A;  1WGQ A;  1E7U A;  2DAF A;  5HE2 A;  3QCA A;  4FA6 A;  4PYU A;  2CHX A;  2RGN B;  4G0N B;  2Z0Q A;  3JSV B;  3V61 A;  4GDK B;  4HB3 B;  3QWZ B;  4TYZ A;  3PRP B;  2DKP A;  1V86 A;  3JSV A;  3NS8 A;  4W9K A;  4GDK A;  3QC8 B;  1ST7 A;  2C9W B;  1VCB A;  4MH0 E;  3DOW A;  2BWE S;  3DVN U;  1OQY A;  4B9K A;  4G3X B;  2EJ8 A;  3ZLZ A;  5IJM A;  4W9E A;  1TQZ A;  1P3Q U;  1W1D A;  1TZ1 A;  2M0X A;  1NTV A;  1SHC A;  3K9P B;  5KQ1 A;  3ML9 A;  3ZUN A;  3IFW B;  1KJT A;  3AUL A;  4WSF A;  5JLJ B;  4AWJ A;  1NBF C;  2BKR B;  2KC2 A;  2NBV B;  4KDL B;  1U5F A;  4IM2 A;  4IOY X;  4PQ0 A;  1L7Y A;  3O65 B;  2XK5 B;  2KX0 A;  2PJH A;  2GBJ A;  4PS7 A;  3M62 B;  5C1Z A;  2YT0 A;  4IC7 B;  3Q3F A;  1TXD A;  4DWF A;  2DTC A;  2CRF A;  2LBB A;  4HB2 B;  2DKQ A;  2MP2 B;  3UQA A;  1XQQ A;  3UGB B;  4W9D A;  2D07 B;  2LGD A;  2IO3 B;  4GB9 A;  1D3Z A;  2LVP A;  5GMV A;  4LCD E;  3KY9 A;  5CHW A;  5AZF A;  2Y7B A;  3ODX A;  3KW5 B;  4KSK C;  5LXI B;  2XBB C;  2LGX A;  5D3X A;  2DAJ A;  2KNB A;  3H9D A;  4M0W B;  2O6V B;  2KLG A;  4AP4 C;  2LRW A;  3TMP B;  2WWZ A;  3PSE B;  4CYE A;  2D9W A;  3P2B A;  3APD A;  3PV1 A;  3ZKJ C;  4M8N A;  1WG7 A;  3WAL A;  2IYD B;  2CHW A;  4W9J A;  2JF5 A;  2GOW A;  2WX1 A;  4A6F B;  3WAN A;  2ELA A;  2YVC A;  3VUW A;  2KVR A;  1W1H A;  2MBB B;  4HAU B;  3JW0 X;  3VVW B;  3IBE A;  1WM2 A;  4F7H A;  2BCJ A;  2ABD A;  2KCJ A;  1UH6 A;  5J3T A;  2N9P C;  1OEY A;  3AU4 A;  3VDZ A;  4HCN B;  3TBL D;  2JXX A;  2MDX A;  1NTY A;  3VAW A;  2G35 A;  3DQV A;  3V60 A;  3TIX A;  1WJM A;  5JHB A;  4TV3 A;  5AEK B;  2FDQ A;  3CMM B;  4TUU A;  1CMX B;  1RFA A;  1DRO A;  2KQS A;  5G2N A;  5DCN A;  1Z2M A;  2REX A;  4TQ1 A;  5JZE B;  2LXC A;  2P8V A;  3R7R A;  3KRW A;  2O6V D;  3U30 A;  1GNU A;  1U4A A;  4BKT A;  1WZ3 A;  3X0W A;  5D3W A;  3V5W A;  2DYO A;  2IY1 B;  2RVB B;  2LWP A;  4NJ6 A;  1XKE A;  1LXD A;  3A1Q B;  5D94 A;  5D6J B;  2HTH A;  4MSQ B;  2VKI A;  3BY4 B;  4ICU A;  4B6H A;  4K17 A;  3ZDM C;  1UPQ A;  1L2N A;  2G3Q B;  4KV2 A;  4MJS A;  1AAR A;  1ZW7 A;  3A1Q A;  2D11 A;  3O96 A;  3N7C A;  4NQL B;  4HAW B;  5L95 C;  2I5C A;  2D4Q A;  2K2U A;  1YX6 B;  2OTX A;  4EZJ A;  1Q1O A;  1WRD B;  4HLE A;  4KHO A;  1BTK A;  1I35 A;  2KXJ A;  1ACA A;  2ROV A;  1RRB A;  1RRP B;  4A3P A;  1MG8 A;  1C3T A;  2DYM A;  4TQ0 A;  1MIX A;  2KUP A;  3WAP A;  2RNR B;  5D2M B;  1C1Y B;  4KDI C;  1OY2 A;  2D2Q A;  1WI0 A;  4HWI B;  1TJ6 A;  3PPA A;  1WJ4 A;  3TVV A;  3MJW A;  3A8Q A;  2CKH B;  4HAV B;  1YX5 B;  1V2Y A;  2L8J A;  2UYZ B;  4LJO B;  4EOY A;  2MSE D;  1A5R A;  2JVC A;  3M3J A;  1LB1 A;  3DXC A;  2NBW B;  4PNK A;  4KZC A;  1V5T A;  2HJ8 A;  5KHO A;  4WJO A;  2RD0 A;  4MDK E;  2N4F A;  2PEA A;  2M14 A;  4HDO A;  4ZDV A;  1WXA A;  4EZK A;  2YS5 A;  5IAA C;  4FUL A;  1XD3 B;  3VXW A;  2BYE A;  3A9J B;  3V6E B;  2RQ1 A;  2CAY A;  1WGU A;  4IM3 A;  4FHK A;  4E74 A;  3PGE A;  2NCN A;  4HHV A;  4MM3 A;  2KWC A;  2IZV B;  3A9J A;  1K5G B;  2BWF A;  4BVU C;  4HPL B;  3JYU A;  1J0W A;  1SE9 A;  5KQ4 A;  3PEG A;  3ML8 A;  3L54 A;  5E6N A;  1WXV A;  4AJY B;  1V5U A;  3VHT C;  4E3C A;  4F7Z A;  2CY4 A;  4KSL C;  3ONS A;  1F9J A;  3SU8 X;  3PTF C;  4K2O A;  2KMC A;  2JT4 B;  3M95 A;  4DHZ B;  4HJK A;  4K7U A;  3VUX A;  3EPY A;  2JP2 A;  3M63 B;  1WGR A;  4Y94 A;  4RMA A;  5E6O A;  2L7R A;  3VFK A;  1EUV B;  3R3M A;  5KCV A;  4GU2 A;  2CU1 A;  1WYW B;  4WJ7 A;  5DPS A;  3UZT A;  1U5D A;  2BYV E;  1P9D U;  3WIM A;  2M4N A;  2N1W A;  2I1J A;  3L10 B;  2RSG A;  2N7D A;  1U27 A;  4II2 B;  4MEM A;  1EO6 A;  4EFO A;  4Z2M B;  3APC A;  1E8Y A;  4HK2 A;  2L0F A;  2LUL A;  3RCZ A;  4MGI E;  1E90 A;  2PE6 B;  1M94 A;  2FCM A;  2RUK B;  1FB8 A;  3D32 A;  3PS6 A;  2KQ7 A;  5AZH A;  4MK0 A;  3ZRF A;  2K6D B;  1BT0 A;  5E6P A;  2IO1 B;  4WWN A;  3KRX A;  2KWU B;  1OGW A;  2ADZ A;  3SV1 A;  2HD5 B;  1PQS A;  4C0A A;  1WGD A;  2XEW A;  3RZF A;  4K7S A;  4FN2 A;  1XD4 A;  4KHA A;  3CIK A;  2X18 A;  3IG3 A;  1FXT B;  2RSU A;  3V6C B;  2R09 A;  3RCP A;  4HAY B;  4W9H A;  1ZSQ A;  1I42 A;  4BFR A;  5DHA B;  4NNJ B;  1WIA A;  2D10 A;  3ZTC A;  5CLL B;  2KTF A;  3ZW3 A;  1OQN A;  2QHO A;  1LW3 A;  2NVU I;  1I7A A;  5DPT A;  4HCP B;  4F7G A;  3OJ4 B;  2ROZ B;  1GUA B;  2J0K A;  4EMO A;  2I5F A;  3ZRC A;  1UNP A;  4F7U P;  4Z2N A;  3RD2 A;  2DFK A;  1Y19 B;  2LYD A;  1SIF A;  3B0A A;  1FHW A;  2KJH B;  2NZ8 B;  3PG7 A;  4WVF B;  4PYZ A;  3VOQ A;  3A9K B;  1V9J A;  2DYB A;  4G11 A;  4RM9 A;  3X23 A;  2G4S A;  1WX7 A;  2GBN A;  3PRE A;  1ZC3 B;  1EGX A;  1DYN A;  1Z5S B;  2Q13 A;  3HM6 X;  3P7Z A;  3I3T B;  1NTI A;  2P0H A;  2KJR A;  1ZVR A;  1MK9 B;  4GSW A;  2J7Q B;  3F0W A;  2MWN B;  2LZ6 A;  5J3Y A;  2OJR A;  1GC7 A;  1WR1 A;  3HQC A;  5G55 A;  2ZJD A;  2KC1 A;  3NSU A;  3EEC A;  4I6P A;  4D0N B;  1E8X A;  2RLO A;  1M7E A;  3RUL A;  3T8M A;  5C5B B;  2XK5 A;  3AXC A;  4PS8 A;  3TO1 A;  2IBI B;  4XZ4 A;  3MPX A;  5J18 A;  2DN6 A;  1R4N I;  2JUO A;  1KLV A;  1TGZ B;  3N3K B;  5C5B A;  2H7D A;  3DVG Y;  2CB8 A;  2MP2 A;  3F5R A;  3HW2 B;  4ZRI A;  4WJQ A;  2MBE A;  2COD A;  1KM7 A;  4NAW B;  2CQU A;  4A3O A;  1E8W A;  2BF8 B;  5JH5 C;  2L2I A;  4GPT B;  5IA7 A;  3WAM A;  1WZ0 A;  3NZS A;  3DVN V;  2Y5B B;  2WYQ A;  1EF5 A;  1MIZ B;  3H6N A;  5J2R A;  1ZC4 B;  3PHX B;  4DX8 A;  1ZKH A;  2KJ6 A;  3Q3J A;  3RZW C;  4OVU A;  2O6V A;  3SNH A;  2ZZP B;  1UEF A;  2VRW B;  4K7W A;  4DBB A;  2K8B A;  2LVQ A;  2FCS A;  3LJU X;  1SGH A;  2EKE C;  3KYD D;  2COP A;  1J19 A;  3MTN B;  1K8R B;  3PRZ A;  1OMW A;  4A6F A;  1XCG A;  3CST A;  2DLW A;  3SYX A;  3DBL I;  1H8C A;  4WJP A;  4F8C B;  3QX1 A;  4GOC A;  4DHJ B;  5HE1 A;  1N3H A;  4HAZ B;  2J0M A;  1P98 A;  2K39 A;  2I1K A;  3VH3 B;  2MA9 B;  2MWS B;  2P0D A;  2MBH A;  4P7I A;  3LDZ E;  2WX0 A;  5GOW B;  4J6I A;  1UPR A;  1U29 A;  4ICV A;  4IG7 B;  2GMI C;  4DHZ E;  2IO0 B;  5CTR C;  1OEY J;  2ZVN A;  1WR6 E;  2FCQ A;  3QAR A;  1EF1 A;  2IYB A;  1IRS A;  2MRP A;  3ZTD A;  1Y8R C;  2L76 A;  3OAW A;  2BKF A;  2LD9 A;  4KIK B;  2PE9 A;  2LUE A;  1WFY A;  2K6Q A;  2YS3 A;  3QHT A;  2OQB A;  4WAA A;  2R0D A;  1BTN A;  2KTR B;  2DX1 A;  4KIK A;  2Z0D B;  2D9X A;  1UEL A;  3DPD A;  1DDM A;  2NBU A;  2QKL A;  2LRU A;  4FBJ B;  4K1R B;  4BOZ B;  2KTR A;  1JRU A;  3H1U A;  3DXE A;  2ZVO A;  3TJP A;  2KWV B;  2GCJ A;  3QIJ A;  4DHJ D;  4AJW A;  2JZZ A;  1X11 A;  4FJY A;  1WMH B;  2D9V A;  2AL3 A;  2A4Z A;  4JQW C;  3KZ1 A;  2W2W A;  2CS4 A;  4CHK A;  1E5W A;  3HIZ A;  2PPH A;  3C0R B;  3AJ4 A;  2CY5 A;  1X05 A;  1WMH A;  2R2Q A;  3S2A A;  2K8H A;  2C5L C;  2LJ5 A;  2N1V A;  2GCL A;  2DA0 A;  4GMX B;  5C79 A;  4ZYN A;  2AL6 A;  5JHA A;  4MGY E;  1RLF A;  1NDD A;  1WGY A;  4DX9 0;  3PP2 A;  3ZNZ B;  3VQI A;  2JZ3 B;  5FR6 A;  1UNR A;  4F1S A;  5DIF B;  1WI1 A;  1YQB A;  3ODO A;  3DXD A;  4EZL A;  2Y8G A;  2GS0 A;  2DZK A;  5FI0 A;  2L05 A;  2C7M B;  4HPM B;  1UZX B;  3N30 A;  2N23 A;  1PMS A;  3ZO5 B;  5FI1 A;  2GBR A;  3G9W A;  3VTV A;  1M7R A;  2FAZ A;  1GJZ A;  3JVZ X;  1IYF A;  2IY0 B;  3A98 B;  2ZEQ A;  3M1I B;  3RT3 B;  2CHZ A;  3EC8 A;  4BBN C;  2L1C A;  1EVH A;  1FHX A;  2ZNV B;  3DBS A;  3AU5 A;  1WJU A;  4FJV B;  5D3Y A;  2N7E A;  2N0Y A;  2OOB B;  4KHB B;  4NJ7 A;  3ZVV A;  3H7S A;  4JIO U;  3U8Z A;  3ZNI D;  1FGY A;  1X1F A;  3PLV A;  1KZG A;  3SDL C;  4L6E A;  1HE8 A;  1KI1 B;  3VTW A;  3H7P B;  3QWM A;  5CLQ B;  1V81 A;  3FSS A;  4FHJ A;  2B3A A;  2O2V B;  2JRI B;  4HB4 B;  2DHK A;  4HVB A;  1P5T A;  1TBE A;  3WYF B;  2R2O A;  2ZNV C;  3L08 A;  5D7G A;  5D3V A;  2O2V A;  2M1M A;  4BBN F;  2C7N B;  3RYT A;  4URK A;  3L16 A;  5CHV C;  1X86 A;  3P6A A;  1MAI A;  2K25 A;  4NPN A;  2JPH A;  5JHH A;  3QBV B;  3A33 B;  4IWO A;  3OAN A;  4II3 B;  2Y8F A;  3KYC D;  4K2P A;  5JP4 A;  1UBQ A;  2L3Z A;  5HKH A;  1WJ6 A;  2MKR A;  2KLC A;  2VRR B;  2NMB A;  2ZPY A;  4BBK A;  3BIN A;  1LQB A;  2K2J A;  4HB0 B;  2GBM A;  2LOZ A;  2DZJ A;  4GGQ A;  2FJL A;  2D9Z A;  3TCA A;  4NY0 A;  1WY8 A;  4WQO B;  2KGX B;  3UIO B;  3KUD B;  3VH4 B;  2Z0E B;  1HB6 A;  1J0G A;  1P1A A;  3FP5 A;  1FGZ A;  4AOF A;  1NI2 A;  3EHV A;  2HRJ A;  3ALB A;  2CR5 A;  2V1Y A;  5LOP B;  2G4D B;  2KN5 A;  2COA A;  1P6S A;  1R4M I;  4MGZ E;  1BAK A;  2UVM A;  4IWP A;  5C6R A;  2LG1 A;  1AQC A;  1K5D B;  5L81 A;  4KAX B;  1V89 A;  2MQJ A;  2FID A;  2Z59 B;  3D8D A;  2ZCB A;  2WH5 A;  1WM3 A;  2BYF A;  1WX9 A;  3KSY A;  2DZM A;  1PFJ A;  1H10 A;  3HM3 A;  3D8E A;  3DBR I;  3PVU A;  3RUI B;  2DYQ A;  2LVO A;  3GYO A;  4KZ0 A;  2V3S A;  3B1L X;  1IP9 A;  1V61 A;  2UWQ A;  3MDB C;  2W2X C;  1LM8 B;  4IFS A;  3PVL A;  4MEL A;  3A9K A;  1YIW A;  4A5K A;  1QQG A;  2DX5 B;  3A8P A;  2K1F A;  1B55 A;  3CXB B;  4JGH B;  2DHZ A; 
#chains in the Genus database with same CATH topology
 5EE0 A;  5BMI A;  2LEK A;  2COF A;  1V5O A;  1E8Z A;  2JU6 X;  3GP7 A;  2JYE A;  3W9C B;  3ZXR A;  3CWI A;  2DX5 A;  3PLU A;  4GIV A;  2A5U A;  3FIL B;  3AI5 A;  2W2X D;  2IGD A;  2KR0 A;  4W9L A;  3PZ7 A;  2LGY A;  2INP E;  3R2I A;  1HZ5 A;  3K9O B;  3ENE A;  2RR9 A;  3AE7 B;  3V62 A;  3TL5 A;  2M0A A;  1T0Q C;  2IFS A;  3D8F A;  3L0W B;  1YOV B;  2JY6 A;  3OJ3 A;  2V4L A;  5BYQ A;  5LNK 1;  1WGG A;  3URY A;  2WDT B;  4A6K A;  1H4R A;  3FIL A;  2KAN A;  5LON B;  4W9G A;  2D5G A;  2LJI A;  4N9F 4;  2KK8 A;  2KFJ A;  2QKM A;  3UQB A;  1AWE A;  5BMH A;  3NZ3 A;  2WXF A;  4WQM A;  3ZNH B;  2JZP A;  1V97 A;  3VTU A;  2KO3 A;  3TW1 A;  4DDG D;  1YN5 A;  4IOI E;  3Q14 C;  2MBO A;  2V0G A;  2LKO A;  1VBH A;  4IWQ A;  1V1P B;  2WP9 B;  3FC4 A;  3N20 C;  2EMS A;  1ENF A;  4BKG A;  5AZG A;  1ZM0 A;  4FJZ A;  4GMV A;  4NAW A;  2BPS A;  2L1A A;  4MT5 A;  3W1Y A;  2FNJ B;  1UNQ A;  1P3R A;  4ITK A;  2WDV B;  2KFK B;  1J8C A;  5DI9 B;  4H8S A;  1XX0 A;  2MFQ A;  3HHM A;  1FHO A;  3AE9 B;  3OLM D;  4JK8 A;  3IVF A;  3NUH B;  3ZXV A;  3KH0 A;  1V1P A;  5D3I B;  4ZRK A;  2YLM A;  2KN4 A;  1JRO A;  3DHG C;  1GB4 A;  1V6E A;  2DHJ A;  2FJ9 A;  4GDL B;  1C79 A;  3DVG X;  4A20 A;  2KFK A;  2KX3 A;  2G9H D;  5HE0 A;  3UI3 A;  2Z4D A;  5D3D A;  4YWG G;  2YT2 A;  3CSF A;  2AYO B;  5HHD G;  3RNF C;  3ODW A;  3SD5 A;  2PVO D;  4US8 A;  4A9A A;  4DXA B;  2DZI A;  2CJO A;  2ICI A;  3EFU A;  5LXH A;  2ASQ A;  4GDL A;  2RGF A;  2J59 M;  2LI5 A;  1MKE A;  4B0E A;  4JK7 A;  4MGK E;  3UIP B;  1NU2 A;  3LJ3 A;  4D2K A;  3FVC A;  5EFX A;  1V8C A;  3NHE B;  1FAO A;  3PZD A;  1T6B X;  3GZN I;  2UZS A;  2X38 A;  4HDQ A;  1HZ6 A;  2DEN B;  1NVL A;  1V80 A;  1MK7 B;  4HXD A;  4LNN A;  1HBK A;  1V49 A;  1UGM A;  1GC6 A;  3ZVR A;  4B6W A;  3HK0 A;  3I9V 1;  3FLV A;  1X1G A;  1Q5W B;  1QZE A;  2ZPN A;  4YL8 A;  5DPR A;  3PRM B;  3QA8 A;  1XR0 B;  3AEC B;  4YXD B;  4IAP A;  4YON A;  4A6H A;  2JWZ A;  4IUM B;  2L0T A;  3DDC B;  4NQK E;  3MC9 A;  2EC1 A;  2KT7 A;  4JKF A;  1E7V A;  1JWB D;  4LTU A;  4K81 A;  4E71 A;  2BYT A;  2WXR A;  4ARC A;  3PT2 B;  2FJU B;  1U5G A;  4PS3 A;  4WWO A;  4FAD A;  2NS5 A;  2VSZ A;  4EUT A;  4K3C A;  5J17 A;  2BVC A;  2UU7 A;  2N9K A;  3TEZ A;  1Q67 A;  3UF8 A;  2DHI A;  2ON8 A;  3NY5 A;  3DBH I;  3KUC B;  2AQ1 B;  3GOE A;  3U52 E;  4YTN B;  4C4V B;  3BK2 A;  3HRD D;  2H88 B;  3TEW A;  5J3Q A;  2HTH B;  4B95 A;  2WLB A;  1PGA A;  2YS1 A;  1V5P A;  1WX8 A;  2QMT A;  3CF6 E;  2MLB A;  3I5J C;  1MI0 A;  2D3G A;  3RI7 C;  4JPS A;  4AUQ C;  2H7E A;  4MJS B;  5CX3 A;  4XC2 A;  2ELB A;  3KVF B;  1N5W A;  2DBY A;  3E9L A;  4LDT B;  4C4V A;  4L23 A;  4RH6 A;  1WE7 A;  4OVV A;  5LLI A;  2MEK A;  2PW9 A;  5KHQ A;  2RRF A;  3E9P A;  3GE8 C;  4LJP B;  4LLG M;  1WF9 A;  4DK5 A;  2V9H A;  2WQY B;  3VUY A;  4M8M A;  2KDI A;  1JDE A;  1OTR B;  1L5P A;  1WH3 A;  2AEH A;  2YT1 A;  3MJ5 A;  3W1S A;  2KHW B;  3OHM B;  4X57 B;  4HAT B;  4G50 A;  1WGH A;  3UIN B;  1TTN A;  1JWM D;  1V88 A;  4JWS C;  1T0Y A;  1R4M B;  5C23 A;  1WWT A;  3SO6 A;  4CHM A;  3B08 A;  4ANX A;  1PLS A;  2KKC A;  3MHS D;  1DBH A;  2E2X A;  3P63 A;  1EAZ A;  2P0F A;  1J7B A;  4DDI D;  1DIK A;  2QEJ C;  2ZKM X;  2RMM A;  2MBQ A;  2FIF A;  1MPH A;  3AED B;  2YF0 A;  3VIA A;  2FCN A;  3W1S C;  3N32 A;  2MJD A;  2L83 A;  3PVW A;  3ML4 A;  1TY0 A;  2C60 A;  2GI9 A;  1DOX A;  1TY2 A;  4JK9 A;  1L0V B;  3AH7 A;  1UGJ A;  4GXB A;  1UBI A;  5I2S A;  1YJ1 A;  1IPG A;  2RPQ A;  1WXM A;  4I6L B;  3GYP A;  1ZGU B;  3T3O A;  4XYC A;  1MI1 A;  2D9Y A;  5DPW A;  3R66 C;  1Z87 A;  3QK0 A;  4ANU A;  3DBR B;  4KVG B;  2YSZ A;  2AQ2 B;  2W9N A;  3QQ8 B;  3L13 A;  4BKS A;  2KZR A;  5FKA C;  2I2Y A;  4LDT D;  1DDW A;  4BOS C;  1NVI D;  1KZ7 A;  2K00 A;  4MT7 A;  4ANV A;  3BJI A;  1P7E A;  1YMH E;  4IW0 A;  5BO4 B;  2DYN A;  1WGK A;  1WXS A;  4W9F A;  2GBK A;  4AQ7 A;  3SUZ A;  4FLH A;  2RPV A;  2BB5 A;  1Y5O A;  1I2H A;  2NPT B;  2HE7 A;  4JL9 A;  2XQN M;  5L83 A;  2KMA A;  4MM3 B;  3ZDT A;  1C78 A;  5TR5 A;  2UZR A;  1L6U A;  3BYY B;  3APF A;  3SHQ A;  4DBG A;  3T06 A;  3ECI A;  2YRY A;  2N9E B;  1LFD A;  2CJN A;  4JKG A;  2J0J A;  2PVG C;  1WJ1 A;  2MX2 A;  4IM0 A;  1UNS A;  2FUH B;  2NPT A;  5CHF A;  1UD7 A;  1V5M A;  2IJ0 A;  3TFM A;  2LOX A;  2KDE B;  1SE3 A;  3NVZ A;  2KDB A;  4EE2 A;  4MY6 A;  3I63 C;  5EE3 A;  1TS4 A;  3KWV A;  4GZU A;  2K0P A;  4A6Q A;  5LG4 B;  4HPP A;  1VD2 A;  4JLC A;  1FNV A;  4CHJ A;  4KGR A;  4ANW A;  4OVZ A;  2AWT A;  5DHF B;  2IO2 B;  3H7P A;  3AE8 B;  4BKS D;  2NR2 A;  3ZNG C;  4MSM B;  1P0R A;  1TYG B;  4LNO A;  3QJZ A;  4DXF A;  4HAX B;  1P7F A;  1W1G A;  1S3S G;  5DH9 B;  3V3X A;  3NVW A;  1L4D B;  4ASW C;  4EKU A;  3HSA A;  5JHG A;  2KWD A;  2Z0O A;  2C7H A;  3L17 A;  1XOD A;  3ULC A;  1RAX A;  2K8C A;  3A4R A;  3NOB A;  1QC6 A;  1D5Z C;  4GN1 A;  1TS3 A;  4RF1 A;  1FOE A;  2M17 A;  1WVH A;  2Z0P A;  4EEW A;  1ZYI A;  1XF5 L;  2M56 B;  4XX5 A;  2N9L A;  3R7Q A;  3A4S C;  2ONQ A;  4W9I A;  3RNB C;  4RM8 A;  3TEY A;  2GJY A;  2M8S A;  3U7D A;  2KOX A;  1WSP A;  2JYT A;  3E56 A;  1XXG A;  2BGF A;  3QAQ A;  2M38 A;  1XT9 B;  3VRB B;  2G45 B;  2LAS A;  2ZCC A;  1BWN A;  4O1N A;  2KIG A;  1I7H A;  3AEG B;  1FNW A;  2FE8 A;  1FCC C;  2SAK A;  4NSW A;  1HB8 A;  3PHW B;  3BK1 A;  4K3B A;  3C19 A;  5D27 A;  3WAO A;  1ISN A;  1HA5 A;  1L0X B;  3FM8 C;  2L00 B;  4TKN A;  4W9C A;  2MCN B;  1WE6 A;  1N63 A;  2J4X A;  3OWE B;  2LHD A;  2LXA A;  1ZPS A;  5HE3 A;  3DBL B;  1GG3 A;  1U2B A;  3KUZ A;  2EMT A;  3PSC A;  1YD8 U;  4EJN A;  2PZ1 A;  1U5E A;  1DDV A;  4XWX A;  1S1Q B;  1RJ2 A;  1SF0 A;  3ULB A;  1KOT A;  2KDF B;  2V76 A;  4C00 A;  1I4H A;  2MW5 A;  2WXK A;  1QKZ A;  3IHP C;  4D6W A;  1DOI A;  4XWW A;  2JRH A;  2W55 A;  1G6J A;  4WJN A;  1C4C A;  1Q0W B;  3NZU A;  1FFV A;  2KD0 A;  2R61 A;  4JKD A;  4HEA 1;  4I6N B;  1X1M A;  2COC A;  2WU2 B;  3ZIM A;  4CO7 A;  1N62 A;  5AUI A;  3U2S C;  3WA0 A;  2N9X A;  3BWU D;  3MHZ A;  5EDS A;  5C16 A;  4ZRJ A;  3NS1 A;  3DCG A;  2YEP B;  1YQ4 B;  3T9L A;  4WWP A;  1WJN A;  2Y5C A;  3FEH A;  1WGQ A;  1E7U A;  2DAF A;  2I38 A;  1BXT A;  1AWD A;  5HE2 A;  1CQV A;  3SFD B;  3QCA A;  3IAM 1;  4FA6 A;  4PYU A;  1ZP0 B;  2CHX A;  2RGN B;  4G0N B;  2Z0Q A;  1ZDX A;  3JSV B;  3V61 A;  3AE1 B;  4GDK B;  1D5X C;  1FCL A;  4HB3 B;  3QWZ B;  1QOB A;  3DBH B;  4TYZ A;  3LXF A;  3PRP B;  2DKP A;  1LGR A;  2ACZ B;  3C8Y A;  2BBC A;  2LGI A;  2B76 B;  1V86 A;  1DYQ A;  3JSV A;  3NS8 A;  4W9K A;  2V3P A;  4GDK A;  1HTQ A;  3QC8 B;  2BS2 B;  1ST7 A;  2KQ4 X;  2C9W B;  1VCB A;  4MH0 E;  3DOW A;  2BWE S;  3DVN U;  1OQY A;  2Y5P A;  4B9K A;  4G3X B;  2EJ8 A;  3ZLZ A;  5IJM A;  3Q3N C;  4W9E A;  1TQZ A;  2ZW0 A;  1E10 A;  1P3Q U;  3ZQ4 A;  1W1D A;  1TZ1 A;  2K3U A;  1TKY A;  4ZHO A;  2M0X A;  1NTV A;  1SHC A;  1TKE A;  3K9P B;  3A58 A;  5KQ1 A;  3ML9 A;  1C4P A;  3IFW B;  3ZUN A;  1JWA D;  1KJT A;  2WDR B;  3AEF B;  4P16 A;  3AUL A;  4WSF A;  5JLJ B;  4AWJ A;  1NBF C;  2BKR B;  2QCZ A;  2SEB D;  2KC2 A;  1VDV A;  4J3O D;  4LNI A;  1DGJ A;  1E6E B;  2NBV B;  4KDL B;  1U5F A;  4WAF A;  4IM2 A;  4IOY X;  4PQ0 A;  1L7Y A;  4LK0 M;  3O65 B;  1I4R A;  2XK5 B;  2KX0 A;  2PJH A;  2GBJ A;  4QAY A;  2IDY A;  4PS7 A;  1VZ7 A;  3MP9 A;  3M62 B;  5C1Z A;  2NBV A;  4XWT A;  3W5V B;  4JKC A;  2YT0 A;  4IC7 B;  3Q3F A;  1YN4 A;  1TXD A;  1RFK A;  4DWF A;  2DTC A;  1KLU D;  3BII D;  2CRF A;  2LBB A;  3ZGZ A;  4HB2 B;  2DKQ A;  1TS2 A;  2MP2 B;  3UQA A;  1XQQ A;  2YEP F;  3UGB B;  4KGS A;  4W9D A;  2BS3 B;  4C7Y A;  4FXC A;  2OJW A;  2D07 B;  3RNA C;  2LGD A;  2IO3 B;  2NTT A;  3ETR A;  3ZJV A;  4GB9 A;  4WWM A;  2LVP A;  5GMV A;  1D3Z A;  1I4G A;  2W82 A;  4LCD E;  4CQN A;  3H8H A;  3KY9 A;  5CHW A;  5AZF A;  2Y7B A;  3ODX A;  2X8X X;  3AEA B;  2CU3 A;  3KW5 B;  4KSK C;  5LXI B;  1FM0 D;  3VRA B;  2XBB C;  4RCO A;  3B77 A;  3NWF A;  5D3X A;  2LGX A;  2ZW1 A;  2DAJ A;  2KNB A;  3H9D A;  1E7P B;  3LB8 C;  4M0W B;  2O6V B;  2KLG A;  4AP4 C;  2LRW A;  3B2F A;  3TMP B;  2WWZ A;  2VH1 A;  1N61 A;  5JXV A;  2LFI A;  4CYE A;  1EU4 A;  3PSE B;  2D9W A;  2Z14 A;  1ZOY B;  3P2B A;  3APD A;  3PV1 A;  3ZKJ C;  4M8N A;  1FRR A;  1WG7 A;  3WAL A;  2IYD B;  2CHW A;  2R82 A;  4W9J A;  2JF5 A;  2GOW A;  2WX1 A;  4A6F B;  1QQR A;  1FEH A;  1NI3 A;  3WAN A;  2ELA A;  2YVC A;  2EKI A;  3AEB B;  3VUW A;  2KVR A;  1W1H A;  3DHI C;  2MBB B;  4JE3 B;  4HAU B;  1A70 A;  3JW0 X;  3VVW B;  3TUO A;  3Q2A C;  3HVZ A;  3IBE A;  2W3S A;  1WM2 A;  4F7H A;  2K5P A;  5IO9 A;  2BCJ A;  2ABD A;  2KCJ A;  1UH6 A;  5J3T A;  2N9P C;  1JCK B;  2E6X A;  1OEY A;  3AU4 A;  3TSS A;  3VDZ A;  4HCN B;  3TBL D;  2JXX A;  2MDX A;  1NTY A;  3VAW A;  5EE9 A;  3AV8 A;  2G35 A;  3DQV A;  5AUK A;  1F77 A;  4C56 C;  3V60 A;  1FPY A;  3TIX A;  1WJM A;  5JHB A;  4TV3 A;  5AEK B;  1IGD A;  1XCQ L;  2FDQ A;  3CMM B;  4TUU A;  1GAQ B;  2J52 A;  3NRZ A;  3Q3O C;  1CMX B;  1RFA A;  1VR9 A;  1DRO A;  2KQS A;  1C77 A;  4OSN A;  5G2N A;  5DCN A;  2QDF A;  1SJH D;  2J42 A;  1ZUD 2;  4ILJ A;  3WCQ A;  2GUM A;  1Z2M A;  2REX A;  4TQ1 A;  5JZE B;  2LXC A;  4DXG A;  2P8V A;  2MH7 A;  3R7R A;  4ZHP A;  2R2Y A;  3KRW A;  2WHI A;  2HJ1 A;  2O6V D;  3IAS 1;  3Q8F A;  2FUG 1;  3RFZ B;  3U30 A;  4M02 A;  5TSS A;  1GNU A;  1U4A A;  1HQR D;  4BKT A;  1WZ3 A;  3ZYY X;  3X0W A;  5D3W A;  3V5W A;  2DYO A;  4GNK B;  2IY1 B;  1AN8 A;  2LWP A;  2RVB B;  1HEZ E;  4NJ6 A;  1V1O A;  1XKE A;  1LXD A;  3N9Y C;  1JQ4 A;  3A1Q B;  3AE4 B;  4JX1 C;  3BVZ A;  4RGM A;  4TMA B;  5D94 A;  3HIE A;  1SBB B;  4NAM A;  4C80 A;  5D6J B;  2HTH A;  4MSQ B;  2VKI A;  3BY4 B;  2KUQ A;  4ICU A;  4B6H A;  2DIK A;  4K17 A;  1SSN A;  2VZK B;  3ZDM C;  1UPQ A;  1GB1 A;  1L2N A;  4MAC A;  1FNU A;  2G3Q B;  3NW8 A;  4M01 A;  4BAX A;  4KV2 A;  4MJS A;  1AAR A;  1ZW7 A;  2LGS A;  3A1Q A;  2VH2 A;  2D11 A;  3O96 A;  4A55 A;  3N7C A;  1OFF A;  4NQL B;  1MVK A;  2GB1 A;  4RGN A;  4HAW B;  2M19 A;  5L95 C;  2I5C A;  2D4Q A;  2K2U A;  1YX6 B;  1FRD A;  2OTX A;  4EZJ A;  4DIX A;  1Q1O A;  1WRD B;  1OQR A;  4HLE A;  4KHO A;  1BTK A;  1TIF A;  3NG0 A;  1FMA D;  1N6Z A;  4NZL B;  1I35 A;  1KRH A;  2LHE A;  1ZE3 D;  5HG2 A;  2KXJ A;  1ACA A;  2ROV A;  2WXQ A;  1RRB A;  1QT9 A;  1RRP B;  4A3P A;  1MG8 A;  1C3T A;  2IPK D;  2DYM A;  4TQ0 A;  1MIX A;  2KUP A;  3WAP A;  2N7J A;  2RNR B;  1XO3 A;  1F2R I;  5D2M B;  1C1Y B;  4KDI C;  1OY2 A;  2D2Q A;  1WI0 A;  4HWI B;  1TJ6 A;  3VR8 B;  2KYW A;  3LYY A;  3PPA A;  1SB3 C;  1WJ4 A;  3TVV A;  1J7A A;  3R8B A;  2LUM A;  4HKQ A;  3GE3 C;  3MJW A;  3A8Q A;  1FIQ A;  3FKY A;  2CKH B;  4HAV B;  1YX5 B;  1V2Y A;  2L8J A;  3EA6 A;  1UF0 A;  2UYZ B;  4LJO B;  5FR3 A;  4EOY A;  1F0Z A;  2MSE D;  1A5R A;  2BB6 A;  2JVC A;  3M3J A;  5IP4 D;  1LB1 A;  2VZK D;  3DXC A;  2NBW B;  4PNK A;  4KZC A;  1V5T A;  2HJ8 A;  5KHO A;  4WJO A;  2RD0 A;  3DWG C;  4MDK E;  2N4F A;  5IN7 A;  3Q3M C;  4JKB A;  2M14 A;  1K50 A;  2PEA A;  4HDO A;  4ZDV A;  1WXA A;  4DQO C;  4ZOH C;  4EZK A;  3TEX A;  2YS5 A;  5IAA C;  4ACF A;  4FUL A;  4XDD A;  1XD3 B;  3VXW A;  2BYE A;  1T77 A;  1I4X A;  1NYQ A;  3A9J B;  2WXN A;  3NWA A;  2AQ3 B;  3P4R B;  3V6E B;  4B0M A;  2X0S A;  2RQ1 A;  4JKA A;  2CAY A;  1MFW A;  1WGU A;  2K22 A;  1PUT A;  4IM3 A;  4FHK A;  4E74 A;  1T0S C;  3PGE A;  5H8Y E;  2NCN A;  4HHV A;  3P42 A;  4MM3 A;  1JML A;  2KWC A;  4H2A A;  1L0Y B;  3O13 A;  3RNC C;  3T3N A;  2IZV B;  3A9J A;  1K5G B;  2BWF A;  5FK9 C;  4HPL B;  3E9O A;  4BVU C;  3JYU A;  1J0W A;  1SE9 A;  1N60 A;  5KQ4 A;  2QSD A;  3L4P A;  3PEG A;  2JX5 A;  3ML8 A;  1XLN A;  3L54 A;  5E6N A;  3IT4 B;  1WXV A;  4AJY B;  1V5U A;  3VHT C;  4E3C A;  4F7Z A;  2CY4 A;  4KSL C;  3ONS A;  1F9J A;  3SU8 X;  3PTF C;  4YTP B;  4K2O A;  2KMC A;  2TSS A;  2JT4 B;  3M95 A;  4DHZ B;  4HJK A;  4K7U A;  3GS2 A;  3VUX A;  3EPY A;  2JP2 A;  1F52 A;  3M63 B;  2WXP A;  1WGR A;  4Y94 A;  5IOI A;  1I4P A;  4RMA A;  1ET6 A;  5E6O A;  2L7R A;  2E3T A;  3VFK A;  3BYT B;  1EUV B;  2DNF A;  2WGS A;  3R3M A;  4RNA A;  2WXG A;  5KCV A;  4GU2 A;  4A90 A;  1I4Q A;  3Q8E A;  2CU1 A;  1WYW B;  4WJ7 A;  2G1E A;  5DPS A;  3UZT A;  3I57 A;  1U5D A;  3Q8B A;  2BYV E;  4REZ A;  1HTO A;  1P9D U;  3WIM A;  2M4N A;  2N1W A;  2GRI A;  2I1J A;  4OT1 A;  3L10 B;  2RSG A;  1YJJ A;  2N7D A;  1U27 A;  4II2 B;  4MEM A;  2GLS A;  3KWL A;  1EO6 A;  4EFO A;  4OW0 A;  4Z2M B;  3APC A;  1E8Y A;  4HK2 A;  2L0F A;  3OG5 A;  2LUL A;  2K9X A;  4MGI E;  3RCZ A;  1E90 A;  2PE6 B;  2MJE A;  1M94 A;  4ZYS A;  2FCM A;  2RUK B;  1B9R A;  3VR9 B;  1FB8 A;  3D32 A;  3PS6 A;  4S17 A;  2KQ7 A;  5AZH A;  2J53 A;  4MK0 A;  3ZRF A;  2K6D B;  1BT0 A;  5E6P A;  2IO1 B;  3B9J A;  4WWN A;  3RPF C;  3KRX A;  5HFY A;  2KWU B;  1EWY C;  1OGW A;  5EE1 A;  3GZN B;  1YJI A;  4JWU C;  2ADZ A;  3BVM A;  3SV1 A;  5BYS A;  2HD5 B;  4RGO S;  1PQS A;  1TT5 B;  4C0A A;  1GOZ A;  1ACC A;  1WGD A;  2XEW A;  3RZF A;  4K7S A;  3SBG A;  3PO0 A;  3CIR B;  2Q5W D;  2WXH A;  4FN2 A;  4LNF A;  1XD4 A;  4KHA A;  1VBG A;  3CIK A;  2X18 A;  1PGB A;  2NTS A;  3IG3 A;  3BVG A;  1RM6 C;  1UUP A;  1FD6 A;  1FXT B;  2RSU A;  3V6C B;  2R09 A;  3RCP A;  4HAY B;  2WDQ B;  4W9H A;  3SEB A;  1DOY A;  1ZSQ A;  1I42 A;  4BFR A;  5DHA B;  4NNJ B;  5G5G A;  1WIA A;  2D10 A;  3ZTC A;  1BML C;  2K49 A;  3AN1 A;  4PK1 A;  5CLL B;  3J9C A;  2KTF A;  2D3B A;  4A8X C;  2Z13 A;  1LO5 D;  4XDC A;  3RN9 C;  3AM9 A;  3N1Z C;  1KF6 B;  3ZW3 A;  1CZP A;  1OQN A;  1SE4 A;  2QHO A;  1LW3 A;  2NVU I;  1I7A A;  5DPT A;  4HJG E;  4HCP B;  4F7G A;  3OJ4 B;  2ROZ B;  4YSZ B;  1GUA B;  2WXM A;  2J0K A;  4EMO A;  2I5F A;  1F1H A;  3ZRC A;  1UNP A;  4F7U P;  4Z2N A;  3RD2 A;  3AE3 B;  4KKJ A;  2DFK A;  1Y19 B;  2LYD A;  1XLP A;  3ENB A;  1SIF A;  5E6J A;  3B0A A;  1FHW A;  2WXI A;  2KJH B;  2NZ8 B;  3PG7 A;  4WVF B;  4PYZ A;  5C2T B;  3VOQ A;  3A9K B;  3W2D A;  1V9J A;  2DYB A;  4G11 A;  4RM9 A;  3X23 A;  1T3Q A;  2G4S A;  1WX7 A;  4US9 A;  3U7Z A;  1PDX A;  2GBN A;  3PRE A;  1ZC3 B;  1MG4 A;  1Y56 A;  4IDI A;  4P1B C;  4IKG A;  1EGX A;  1XLQ A;  1DYN A;  2WS3 B;  1Z5S B;  2Q13 A;  3HM6 X;  2D3A A;  3P7Z A;  1L4Z B;  3I3T B;  2V3N A;  2H89 B;  3DHH C;  1NTI A;  2P0H A;  2KJR A;  1ZVR A;  1MK9 B;  3KQ4 A;  4GSW A;  2J7Q B;  3F0W A;  2MWN B;  2LZ6 A;  2BQQ A;  5J3Y A;  2DLB A;  2OJR A;  1GC7 A;  1WR1 A;  3HQC A;  5G55 A;  2ZJD A;  2KC1 A;  2PMV A;  3NSU A;  3EEC A;  3MC8 A;  4TSS A;  1AW7 A;  4I6P A;  4D0N B;  1E8X A;  2RLO A;  3HVD A;  1M7E A;  3Q69 A;  1ZXH A;  3RUL A;  3P1M A;  3T8M A;  5C5B B;  2XK5 A;  3AXC A;  4PS8 A;  3TO1 A;  1NEN B;  4BZA A;  2IBI B;  4XZ4 A;  3MPX A;  5J18 A;  3SR6 A;  2DN6 A;  1JWS D;  1R4N I;  2V4I B;  4YSX B;  1KTK A;  3RMK C;  2JUO A;  1KLV A;  2DWQ A;  2XNA C;  1TGZ B;  3N3K B;  5C5B A;  2H7D A;  3DVG Y;  3NVY A;  4KX6 B;  2CB8 A;  2MP2 A;  1E0Z A;  3RNE C;  3F5R A;  3HW2 B;  4ZRI A;  4WJQ A;  4C7Z A;  2MBE A;  1SJE D;  1YN3 A;  2COD A;  4MH8 A;  1KM7 A;  3Q8C A;  4NAW B;  2CQU A;  1SE2 A;  4HSI A;  3AEE B;  4A3O A;  4YTM B;  1E8W A;  2BF8 B;  5JH5 C;  2L2I A;  4GPT B;  5IA7 A;  3WAM A;  3MC0 B;  1WZ0 A;  2OED A;  1NYR A;  3NZS A;  3DVN V;  2Y5B B;  2WYQ A;  1EF5 A;  1N5X A;  3AE6 B;  1MIZ B;  2BT6 A;  3H6N A;  4ZRQ A;  1F2R C;  3KLS X;  1D6E C;  2Y3A A;  5J2R A;  1QF6 A;  1ZC4 B;  3FAH A;  1C4A A;  3PHX B;  4DX8 A;  4N6E B;  1ZKH A;  3N1Y C;  2KJ6 A;  3Q3J A;  3V05 A;  4M0W A;  1XLO A;  3RZW C;  4QJ4 B;  4OVU A;  2O6V A;  5BMG A;  3SNH A;  2ZZP B;  1UEF A;  2VRW B;  1QLB B;  4K7W A;  4DBB A;  1KFY B;  2K8B A;  2LVQ A;  2FCS A;  3LJU X;  1SGH A;  2EKE C;  3E9S A;  3KYD D;  2COP A;  1J19 A;  2QIL A;  3MTN B;  1K8R B;  3PRZ A;  1D5M C;  1NEK B;  1OMW A;  4A6F A;  4P6V F;  1XCG A;  3CST A;  5JVL A;  2DLW A;  3SYX A;  3DBL I;  2QIE B;  1H8C A;  4WJP A;  1AYF A;  1SIJ A;  4F8C B;  3QX1 A;  4GOC A;  4DHJ B;  3R2T A;  1J7C A;  1RWS A;  4OZC A;  5HE1 A;  1N3H A;  2MHJ A;  4HAZ B;  2J0M A;  1P98 A;  2K39 A;  2I1K A;  3VH3 B;  2MA9 B;  1M4V A;  2MWS B;  2P0D A;  2MBH A;  4P7I A;  3LDZ E;  2WX0 A;  5GOW B;  2QC8 A;  4P1C C;  4J6I A;  1UPR A;  2W54 A;  1U29 A;  4ICV A;  1CK1 A;  4IG7 B;  1UWM A;  2GMI C;  4DHZ E;  2IO0 B;  4GOU A;  5CTR C;  1OEY J;  2XN9 C;  1VZ8 A;  2ZVN A;  3AB5 A;  5I4D A;  3GB1 A;  1WR6 E;  2FCQ A;  3QAR A;  1EF1 A;  2IYB A;  1IRS A;  1TZO A;  2MRP A;  1WRI A;  3ZTD A;  1Y8R C;  2L76 A;  3OAW A;  2BKF A;  2LD9 A;  4KIK B;  2PE9 A;  2LUE A;  3BZD B;  4HRS A;  1WFY A;  2K6Q A;  4JKE A;  2YS3 A;  3QHT A;  2OQB A;  2JXT A;  3ABV B;  4WAA A;  3AE2 B;  2R0D A;  2WXL A;  1BTN A;  2KTR B;  1EWC A;  2JQR B;  2EEL A;  2L52 A;  2DX1 A;  4KIK A;  2Z0D B;  2D9X A;  1UEL A;  1WXQ A;  3DPD A;  1DDM A;  2WXJ A;  2NBU A;  1JW9 D;  2QKL A;  1SEB D;  2LRU A;  4FBJ B;  2KIE A;  3DCX A;  4K1R B;  5MPO A;  1ZXI A;  4BOZ B;  2KTR A;  5BYR A;  1JRU A;  3H1U A;  3DXE A;  2ZVO A;  3TJP A;  2KWV B;  2GCJ A;  4KGT A;  1D4B A;  3QIJ A;  1E9M A;  4DHJ D;  1VLB A;  4AJW A;  2JZZ A;  1X11 A;  4FJY A;  1WMH B;  1TKG A;  2D9V A;  1SXT A;  2AL3 A;  2A4Z A;  4JQW C;  1JWU D;  3P4Q B;  3EUB 2;  2MJ3 A;  3KZ1 A;  4UDU C;  2W2W A;  2CS4 A;  4QJ5 B;  4CHK A;  1E5W A;  3HIZ A;  1KC7 A;  4M00 A;  1K53 A;  2PPH A;  3NJT A;  3C0R B;  3AJ4 A;  2CY5 A;  4HKZ E;  1X05 A;  1WMH A;  2R2Q A;  3S2A A;  2K8H A;  1ZDV A;  4HRO A;  1ROE A;  2C5L C;  2LJ5 A;  2N1V A;  2GCL A;  3N1X C;  2KMM A;  2DA0 A;  2PKO A;  4GMX B;  5C79 A;  4ZYN A;  2AL6 A;  2BW2 A;  4N59 A;  5JHA A;  4MGY E;  2WU5 B;  1RLF A;  1NDD A;  1WGY A;  4ILH A;  4DX9 0;  3PP2 A;  2RDG A;  1UWX A;  3ZNZ B;  1FO4 A;  3VQI A;  2JZ3 B;  5FR6 A;  1UNR A;  4F1S A;  1JRP A;  5DIF B;  1WI1 A;  4XE0 A;  1YQB A;  3ODO A;  5GXG B;  1XCT L;  3DXD A;  4EZL A;  1OQQ A;  2Y8G A;  2GS0 A;  2DZK A;  3DWM A;  4RFB A;  5FI0 A;  2L05 A;  2C7M B;  4YT0 B;  4HPM B;  1UZX B;  3N30 A;  2N23 A;  5H92 C;  1PMS A;  2KAC A;  3ZO5 B;  5FI1 A;  2GBR A;  3G9W A;  1JAL A;  3VTV A;  1M7R A;  2FAZ A;  1GJZ A;  3P4P B;  3JVZ X;  1IYF A;  2IY0 B;  3A98 B;  2ZEQ A;  4LNK A;  3M1I B;  2IGH A;  3RT3 B;  2WNM A;  2CHZ A;  4QXA B;  3EC8 A;  4BBN C;  2L1C A;  4OZB A;  2NMQ A;  1EVH A;  1FHX A;  1IBX B;  2ZNV B;  2PLP A;  1MHH E;  3DBS A;  4Q2J A;  3AU5 A;  5T8I A;  1WJU A;  4JKG B;  4FJV B;  5D3Y A;  1PFD A;  4RF0 A;  3Q6B A;  2N7E A;  2RDH A;  2N0Y A;  2OOB B;  1GGO A;  4KHB B;  4NJ7 A;  3ZVV A;  3H7S A;  2K8E A;  3AMZ A;  4JIO U;  3U8Z A;  5HI1 A;  1IBX A;  3P4S B;  3ZNI D;  1FGY A;  4QJ3 B;  3IXS A;  1X1F A;  3PLV A;  1KZG A;  3SDL C;  5I2M A;  4L6E A;  1HE8 A;  1KI1 B;  3VTW A;  2QJL A;  3H7P B;  3QWM A;  5CLQ B;  4L1B A;  1V81 A;  3FSS A;  4FHJ A;  4KHB A;  2B3A A;  1IUE A;  1TS5 A;  2O2V B;  2JRI B;  4HB4 B;  3ZJT A;  2DHK A;  3E66 A;  2HDE A;  1KH0 A;  4HVB A;  1P5T A;  1TBE A;  1ESF A;  3WYF B;  2R2O A;  1R4N B;  2ZNV C;  1FFU A;  1KLG D;  1GPX A;  3L08 A;  5D7G A;  5D3V A;  3ZJU A;  1MPE A;  2O2V A;  2M1M A;  4BBN F;  2C7N B;  1T5X D;  5C3J B;  4WIP A;  3RYT A;  4URK A;  3L16 A;  2W3R A;  4KKI A;  1X86 A;  5CHV C;  3P6A A;  1Q10 A;  2BTE A;  1MAI A;  2K25 A;  3NVV A;  4NPN A;  2JPH A;  4XGA B;  1KBL A;  1L6V A;  1FXA A;  3Q8A A;  5JHH A;  1VJK A;  1MJD A;  3B2G A;  3QBV B;  3A33 B;  4IWO A;  3OAN A;  3EFC A;  4II3 B;  5G5H A;  2Y8F A;  3KYC D;  2N0S B;  4K2P A;  1YQ3 B;  5JP4 A;  1UBQ A;  1K51 A;  2L3Z A;  2IGG A;  4ILG B;  4JKH A;  5HKH A;  1XEE A;  1WJ6 A;  4AS1 A;  4GLS C;  2MKR A;  2KLC A;  1ET9 A;  2VRR B;  4L2Y A;  2NMB A;  2ZPY A;  4WH4 A;  1VRA B;  4BBK A;  3BIN A;  1LQB A;  2OHF A;  2WXO A;  2K2J A;  4HB0 B;  2GBM A;  2PIA A;  1C76 A;  1EU3 A;  2LOZ A;  2DZJ A;  4GGQ A;  2FJL A;  2D9Z A;  2AX5 A;  3TCA A;  4NY0 A;  1CJE A;  1WY8 A;  4WQO B;  2KGX B;  5M4Y B;  2KVZ A;  4OZA A;  3IT6 B;  3UIO B;  3KUD B;  3VH4 B;  1MHX A;  2Z0E B;  1HB6 A;  3AE5 B;  4CSQ A;  1J0G A;  3SBT A;  1P1A A;  2LMC A;  3FP5 A;  1FGZ A;  4AOF A;  1T0R C;  2FBW B;  1NI2 A;  2KAJ A;  3EHV A;  2HRJ A;  2KDM A;  2CR5 A;  1TJE A;  5LOP B;  2V1Y A;  3ALB A;  4R3D A;  4USA A;  4RGT A;  2G4D B;  2KN5 A;  4NJC A;  2COA A;  1P6S A;  1R4M I;  4MGZ E;  2D3C A;  2INN E;  1BAK A;  2UVM A;  4IWP A;  5C6R A;  1EM7 A;  2LG1 A;  1AQC A;  1K5D B;  5L81 A;  3SFE B;  4KAX B;  1V89 A;  2MQJ A;  1QOA A;  3MFG A;  2INC C;  2FID A;  2JWU A;  4L1R A;  4S0R A;  2IND C;  1PGX A;  3RNG C;  4ARI A;  2Z59 B;  4YSY B;  5IKC M;  3D8D A;  4ZRP A;  2ZCB A;  3HUI A;  1STE A;  2WH5 A;  1WM3 A;  3U12 A;  1BUI C;  1PYW D;  2HTM E;  4PT5 A;  1B1Z A;  3NWD A;  2BYF A;  4WUR A;  4OHJ A;  1WX9 A;  3KSY A;  2DZM A;  1PFJ A;  2L32 A;  1H10 A;  3HM3 A;  3D8E A;  3DBR I;  2JSV X;  2Z59 A;  5IRS A;  3PVU A;  4N58 A;  3U4E G;  1R7S A;  3RUI B;  2DYQ A;  1VZ6 A;  1YNT E;  2RDB C;  2LVO A;  3GYO A;  1QOF A;  4KZ0 A;  1WYG A;  2V3S A;  1K52 A;  3B1L X;  1IP9 A;  1V61 A;  2UWQ A;  3MDB C;  1HXY D;  2W2X C;  2PTL A;  3PZ8 A;  1LM8 B;  4IFS A;  2Z8L A;  1QIL A;  1IGC A;  3PVL A;  4MEL A;  1FXI A;  3A9K A;  3EGR A;  1YIW A;  4A5K A;  2BS4 B;  3W5U B;  1QOG A;  1RYJ A;  1QQG A;  2DX5 B;  3A8P A;  2K1F A;  1B55 A;  3CXB B;  4JGH B;  2DHZ A;  1C9F A; 
#chains in the Genus database with same CATH homology
 2COF A;  1V5O A;  1E8Z A;  2DX5 A;  3PLU A;  4GIV A;  2A5U A;  3AI5 A;  2W2X D;  4W9L A;  2LGY A;  3K9O B;  3ENE A;  2RR9 A;  3V62 A;  3TL5 A;  2IFS A;  3D8F A;  3L0W B;  2JY6 A;  3OJ3 A;  2V4L A;  1WGG A;  2WDT B;  4A6K A;  1H4R A;  2KAN A;  5LON B;  4W9G A;  4N9F 4;  2KK8 A;  2KFJ A;  2QKM A;  3UQB A;  1AWE A;  3ZNH B;  3VTU A;  2KO3 A;  3TW1 A;  4DDG D;  2MBO A;  2LKO A;  1VBH A;  4IWQ A;  2EMS A;  4BKG A;  5AZG A;  1ZM0 A;  4NAW A;  4GMV A;  4FJZ A;  2BPS A;  3W1Y A;  2FNJ B;  1UNQ A;  1P3R A;  1J8C A;  2KFK B;  5DI9 B;  4H8S A;  1XX0 A;  2MFQ A;  3HHM A;  1FHO A;  3OLM D;  4JK8 A;  3IVF A;  3KH0 A;  4ZRK A;  2YLM A;  1V6E A;  2DHJ A;  2FJ9 A;  4GDL B;  3DVG X;  4A20 A;  2KFK A;  2KX3 A;  5HE0 A;  3CSF A;  2AYO B;  3ODW A;  3SD5 A;  4DXA B;  2DZI A;  5LXH A;  3EFU A;  2ASQ A;  4GDL A;  2RGF A;  2J59 M;  2LI5 A;  1MKE A;  4JK7 A;  4MGK E;  3UIP B;  1NU2 A;  3LJ3 A;  5EFX A;  3NHE B;  1FAO A;  3PZD A;  3GZN I;  2UZS A;  4HDQ A;  2DEN B;  1NVL A;  1V80 A;  1MK7 B;  4HXD A;  1HBK A;  1V49 A;  1UGM A;  1GC6 A;  3ZVR A;  4B6W A;  3HK0 A;  3FLV A;  1X1G A;  1Q5W B;  1QZE A;  2ZPN A;  4YL8 A;  5DPR A;  3PRM B;  3QA8 A;  1XR0 B;  4IAP A;  4YON A;  4A6H A;  2JWZ A;  4IUM B;  2L0T A;  3DDC B;  4NQK E;  2EC1 A;  4JKF A;  1E7V A;  4K81 A;  4E71 A;  3PT2 B;  4FAD A;  1U5G A;  4PS3 A;  4WWO A;  2NS5 A;  2VSZ A;  4EUT A;  5J17 A;  1Q67 A;  3UF8 A;  2DHI A;  3NY5 A;  3DBH I;  3KUC B;  3GOE A;  5J3Q A;  2HTH B;  4B95 A;  2YS1 A;  1V5P A;  1WX8 A;  3CF6 E;  2MLB A;  2D3G A;  4AUQ C;  2H7E A;  4MJS B;  5CX3 A;  4XC2 A;  2ELB A;  3KVF B;  3E9L A;  4LDT B;  1WE7 A;  4OVV A;  5LLI A;  5KHQ A;  3E9P A;  4LJP B;  1WF9 A;  4DK5 A;  3VUY A;  4M8M A;  2KDI A;  1JDE A;  1OTR B;  1WH3 A;  2AEH A;  2YT1 A;  3W1S A;  2KHW B;  4X57 B;  4HAT B;  4G50 A;  1WGH A;  3UIN B;  1TTN A;  1V88 A;  1T0Y A;  5C23 A;  3SO6 A;  4CHM A;  3B08 A;  4ANX A;  1PLS A;  2KKC A;  3MHS D;  1DBH A;  2E2X A;  1EAZ A;  2P0F A;  4DDI D;  1DIK A;  2MBQ A;  2FIF A;  1MPH A;  2YF0 A;  3VIA A;  2FCN A;  3W1S C;  3N32 A;  3PVW A;  3ML4 A;  2C60 A;  4JK9 A;  4GXB A;  1UBI A;  1YJ1 A;  1IPG A;  2RPQ A;  1WXM A;  4I6L B;  3GYP A;  1ZGU B;  2D9Y A;  5DPW A;  3R66 C;  1Z87 A;  3QK0 A;  4ANU A;  4KVG B;  2YSZ A;  2W9N A;  3QQ8 B;  3L13 A;  4BKS A;  2KZR A;  4LDT D;  1DDW A;  4BOS C;  1KZ7 A;  2K00 A;  4MT7 A;  4ANV A;  3BJI A;  4IW0 A;  5BO4 B;  2DYN A;  1WXS A;  4W9F A;  2GBK A;  3SUZ A;  4FLH A;  1Y5O A;  1I2H A;  2NPT B;  2HE7 A;  4JL9 A;  2XQN M;  5L83 A;  2KMA A;  3ZDT A;  5TR5 A;  2UZR A;  3APF A;  3SHQ A;  4DBG A;  3T06 A;  3ECI A;  2YRY A;  2N9E B;  1LFD A;  4JKG A;  2J0J A;  1WJ1 A;  2MX2 A;  4IM0 A;  2FUH B;  2NPT A;  5CHF A;  1UD7 A;  1V5M A;  3TFM A;  2LOX A;  2KDE B;  2KDB A;  4MY6 A;  4GZU A;  4JLC A;  1VD2 A;  4CHJ A;  4ANW A;  2AWT A;  5DHF B;  2IO2 B;  3H7P A;  4BKS D;  2NR2 A;  3ZNG C;  4MSM B;  1P0R A;  3QJZ A;  4HAX B;  1W1G A;  1S3S G;  5DH9 B;  4ASW C;  4EKU A;  5JHG A;  2Z0O A;  2C7H A;  3L17 A;  1XOD A;  3ULC A;  1RAX A;  2K8C A;  3A4R A;  3NOB A;  1QC6 A;  4GN1 A;  1FOE A;  1WVH A;  2M17 A;  2Z0P A;  4EEW A;  4XX5 A;  3R7Q A;  3A4S C;  4W9I A;  4RM8 A;  2GJY A;  2M8S A;  3U7D A;  2KOX A;  2BGF A;  3QAQ A;  2M38 A;  1XT9 B;  2G45 B;  2LAS A;  2ZCC A;  1BWN A;  4NSW A;  1HB8 A;  3PHW B;  5D27 A;  3WAO A;  1ISN A;  3FM8 C;  2L00 B;  4TKN A;  4W9C A;  2MCN B;  1WE6 A;  2LXA A;  5HE3 A;  1GG3 A;  1U2B A;  3KUZ A;  2EMT A;  3PSC A;  1YD8 U;  4EJN A;  2PZ1 A;  1U5E A;  1DDV A;  4XWX A;  1S1Q B;  1RJ2 A;  3ULB A;  1KOT A;  2KDF B;  2V76 A;  2MW5 A;  3IHP C;  2JRH A;  1G6J A;  4WJN A;  1Q0W B;  3NZU A;  2KD0 A;  4JKD A;  4I6N B;  1X1M A;  2COC A;  3ZIM A;  4CO7 A;  3WA0 A;  2N9X A;  5EDS A;  5C16 A;  4ZRJ A;  3DCG A;  3T9L A;  4WWP A;  1WJN A;  3FEH A;  1WGQ A;  1E7U A;  2DAF A;  5HE2 A;  3QCA A;  4FA6 A;  4PYU A;  2CHX A;  2RGN B;  4G0N B;  2Z0Q A;  3JSV B;  3V61 A;  4GDK B;  4HB3 B;  3QWZ B;  4TYZ A;  3PRP B;  2DKP A;  1V86 A;  3JSV A;  3NS8 A;  4W9K A;  4GDK A;  3QC8 B;  1ST7 A;  2C9W B;  1VCB A;  4MH0 E;  3DOW A;  2BWE S;  3DVN U;  1OQY A;  4B9K A;  4G3X B;  2EJ8 A;  3ZLZ A;  5IJM A;  4W9E A;  1TQZ A;  1P3Q U;  1W1D A;  1TZ1 A;  2M0X A;  1NTV A;  1SHC A;  3K9P B;  5KQ1 A;  3ML9 A;  3ZUN A;  3IFW B;  1KJT A;  3AUL A;  4WSF A;  5JLJ B;  4AWJ A;  1NBF C;  2BKR B;  2KC2 A;  2NBV B;  4KDL B;  1U5F A;  4IM2 A;  4IOY X;  4PQ0 A;  1L7Y A;  3O65 B;  2XK5 B;  2KX0 A;  2PJH A;  2GBJ A;  4PS7 A;  3M62 B;  5C1Z A;  4JKC A;  2YT0 A;  4IC7 B;  3Q3F A;  1TXD A;  4DWF A;  2DTC A;  2CRF A;  2LBB A;  4HB2 B;  2DKQ A;  2MP2 B;  3UQA A;  1XQQ A;  3UGB B;  4W9D A;  2D07 B;  2LGD A;  2IO3 B;  4GB9 A;  1D3Z A;  2LVP A;  5GMV A;  4LCD E;  3KY9 A;  5CHW A;  5AZF A;  2Y7B A;  3ODX A;  3KW5 B;  4KSK C;  5LXI B;  2XBB C;  2LGX A;  5D3X A;  2DAJ A;  2KNB A;  3H9D A;  4M0W B;  2O6V B;  2KLG A;  4AP4 C;  2LRW A;  3TMP B;  2WWZ A;  3PSE B;  4CYE A;  2D9W A;  3P2B A;  3APD A;  3PV1 A;  3ZKJ C;  4M8N A;  1WG7 A;  3WAL A;  2IYD B;  2CHW A;  2R82 A;  4W9J A;  2JF5 A;  2GOW A;  2WX1 A;  4A6F B;  3WAN A;  2ELA A;  2YVC A;  3VUW A;  2KVR A;  1W1H A;  2MBB B;  4HAU B;  3JW0 X;  3VVW B;  3IBE A;  1WM2 A;  4F7H A;  2BCJ A;  2ABD A;  2KCJ A;  1UH6 A;  5J3T A;  2N9P C;  1OEY A;  3AU4 A;  3VDZ A;  4HCN B;  3TBL D;  2JXX A;  2MDX A;  1NTY A;  3VAW A;  2G35 A;  3DQV A;  3V60 A;  3TIX A;  1WJM A;  5JHB A;  4TV3 A;  5AEK B;  2FDQ A;  3CMM B;  4TUU A;  1CMX B;  1RFA A;  1DRO A;  2KQS A;  5G2N A;  5DCN A;  4ILJ A;  1Z2M A;  2REX A;  4TQ1 A;  5JZE B;  2LXC A;  2P8V A;  3R7R A;  3KRW A;  2O6V D;  3U30 A;  1GNU A;  1U4A A;  4BKT A;  1WZ3 A;  3X0W A;  5D3W A;  3V5W A;  2DYO A;  2IY1 B;  2RVB B;  2LWP A;  4NJ6 A;  1XKE A;  1LXD A;  3A1Q B;  5D94 A;  5D6J B;  2HTH A;  4MSQ B;  2VKI A;  3BY4 B;  4ICU A;  4B6H A;  2DIK A;  4K17 A;  3ZDM C;  1UPQ A;  1L2N A;  2G3Q B;  4KV2 A;  4MJS A;  1AAR A;  1ZW7 A;  3A1Q A;  2D11 A;  3O96 A;  3N7C A;  4NQL B;  4HAW B;  5L95 C;  2I5C A;  2D4Q A;  2K2U A;  1YX6 B;  2OTX A;  4EZJ A;  1Q1O A;  1WRD B;  4HLE A;  4KHO A;  1BTK A;  1I35 A;  2KXJ A;  1ACA A;  2ROV A;  1RRB A;  1RRP B;  4A3P A;  1MG8 A;  1C3T A;  2DYM A;  4TQ0 A;  1MIX A;  2KUP A;  3WAP A;  2RNR B;  5D2M B;  1C1Y B;  4KDI C;  1OY2 A;  2D2Q A;  1WI0 A;  4HWI B;  1TJ6 A;  3PPA A;  1WJ4 A;  3TVV A;  3MJW A;  3A8Q A;  2CKH B;  4HAV B;  1YX5 B;  1V2Y A;  2L8J A;  2UYZ B;  4LJO B;  4EOY A;  2MSE D;  1A5R A;  2JVC A;  3M3J A;  1LB1 A;  3DXC A;  2NBW B;  4PNK A;  4KZC A;  1V5T A;  2HJ8 A;  5KHO A;  4WJO A;  2RD0 A;  4MDK E;  2N4F A;  4JKB A;  2M14 A;  2PEA A;  4HDO A;  4ZDV A;  1WXA A;  4EZK A;  2YS5 A;  5IAA C;  4FUL A;  1XD3 B;  3VXW A;  2BYE A;  3A9J B;  3V6E B;  2X0S A;  2RQ1 A;  4JKA A;  2CAY A;  1WGU A;  4IM3 A;  4FHK A;  4E74 A;  3PGE A;  2NCN A;  4HHV A;  4MM3 A;  2KWC A;  2IZV B;  3A9J A;  1K5G B;  2BWF A;  4BVU C;  4HPL B;  3E9O A;  3JYU A;  1J0W A;  1SE9 A;  5KQ4 A;  3PEG A;  3ML8 A;  3L54 A;  5E6N A;  1WXV A;  4AJY B;  1V5U A;  3VHT C;  4E3C A;  4F7Z A;  2CY4 A;  4KSL C;  3ONS A;  1F9J A;  3SU8 X;  3PTF C;  4K2O A;  2KMC A;  2JT4 B;  3M95 A;  4DHZ B;  4HJK A;  4K7U A;  3VUX A;  3EPY A;  2JP2 A;  3M63 B;  1WGR A;  4Y94 A;  4RMA A;  5E6O A;  2L7R A;  3VFK A;  1EUV B;  3R3M A;  5KCV A;  4GU2 A;  2CU1 A;  1WYW B;  4WJ7 A;  5DPS A;  3UZT A;  1U5D A;  2BYV E;  1P9D U;  3WIM A;  2M4N A;  2N1W A;  2I1J A;  3L10 B;  2RSG A;  2N7D A;  1U27 A;  4II2 B;  4MEM A;  1EO6 A;  4EFO A;  4Z2M B;  3APC A;  1E8Y A;  4HK2 A;  2L0F A;  2LUL A;  3RCZ A;  4MGI E;  1E90 A;  2PE6 B;  1M94 A;  2FCM A;  2RUK B;  1FB8 A;  3D32 A;  3PS6 A;  2KQ7 A;  5AZH A;  4MK0 A;  3ZRF A;  2K6D B;  1BT0 A;  5E6P A;  2IO1 B;  4WWN A;  3KRX A;  2KWU B;  1OGW A;  2ADZ A;  3SV1 A;  2HD5 B;  1PQS A;  4C0A A;  1WGD A;  2XEW A;  3RZF A;  4K7S A;  3SBG A;  4FN2 A;  1XD4 A;  4KHA A;  1VBG A;  3CIK A;  2X18 A;  3IG3 A;  1FXT B;  2RSU A;  3V6C B;  2R09 A;  3RCP A;  4HAY B;  4W9H A;  1ZSQ A;  1I42 A;  4BFR A;  5DHA B;  4NNJ B;  1WIA A;  2D10 A;  3ZTC A;  5CLL B;  2KTF A;  3ZW3 A;  1OQN A;  2QHO A;  1LW3 A;  2NVU I;  1I7A A;  5DPT A;  4HCP B;  4F7G A;  3OJ4 B;  2ROZ B;  1GUA B;  2J0K A;  4EMO A;  2I5F A;  3ZRC A;  1UNP A;  4F7U P;  4Z2N A;  3RD2 A;  2DFK A;  1Y19 B;  2LYD A;  3ENB A;  1SIF A;  3B0A A;  1FHW A;  2KJH B;  2NZ8 B;  3PG7 A;  4WVF B;  4PYZ A;  3VOQ A;  3A9K B;  1V9J A;  2DYB A;  4G11 A;  4RM9 A;  3X23 A;  2G4S A;  1WX7 A;  2GBN A;  3PRE A;  1ZC3 B;  1EGX A;  1DYN A;  1Z5S B;  2Q13 A;  3HM6 X;  3P7Z A;  3I3T B;  1NTI A;  2P0H A;  2KJR A;  1ZVR A;  1MK9 B;  4GSW A;  2J7Q B;  3F0W A;  2MWN B;  2LZ6 A;  5J3Y A;  2OJR A;  1GC7 A;  1WR1 A;  3HQC A;  5G55 A;  2ZJD A;  2KC1 A;  3NSU A;  3EEC A;  4I6P A;  4D0N B;  1E8X A;  2RLO A;  1M7E A;  3RUL A;  3T8M A;  5C5B B;  2XK5 A;  3AXC A;  4PS8 A;  3TO1 A;  2IBI B;  4XZ4 A;  3MPX A;  5J18 A;  2DN6 A;  1R4N I;  2JUO A;  1KLV A;  1TGZ B;  3N3K B;  5C5B A;  2H7D A;  3DVG Y;  2CB8 A;  2MP2 A;  3F5R A;  3HW2 B;  4ZRI A;  4WJQ A;  2MBE A;  2COD A;  1KM7 A;  4NAW B;  2CQU A;  4A3O A;  1E8W A;  2BF8 B;  5JH5 C;  2L2I A;  4GPT B;  5IA7 A;  3WAM A;  1WZ0 A;  3NZS A;  3DVN V;  2Y5B B;  2WYQ A;  1EF5 A;  1MIZ B;  3H6N A;  5J2R A;  1ZC4 B;  3PHX B;  4DX8 A;  1ZKH A;  2KJ6 A;  3Q3J A;  3RZW C;  4OVU A;  2O6V A;  3SNH A;  2ZZP B;  1UEF A;  2VRW B;  4K7W A;  4DBB A;  2K8B A;  2LVQ A;  2FCS A;  3LJU X;  1SGH A;  2EKE C;  3KYD D;  2COP A;  1J19 A;  3MTN B;  1K8R B;  3PRZ A;  1OMW A;  4A6F A;  1XCG A;  3CST A;  5JVL A;  2DLW A;  3SYX A;  3DBL I;  1H8C A;  4WJP A;  4F8C B;  3QX1 A;  4GOC A;  4DHJ B;  5HE1 A;  1N3H A;  4HAZ B;  2J0M A;  1P98 A;  2K39 A;  2I1K A;  3VH3 B;  2MA9 B;  2MWS B;  2P0D A;  2MBH A;  4P7I A;  3LDZ E;  2WX0 A;  5GOW B;  4J6I A;  1UPR A;  1U29 A;  4ICV A;  4IG7 B;  2GMI C;  4DHZ E;  2IO0 B;  5CTR C;  1OEY J;  2ZVN A;  1WR6 E;  2FCQ A;  3QAR A;  1EF1 A;  2IYB A;  1IRS A;  2MRP A;  3ZTD A;  1Y8R C;  2L76 A;  3OAW A;  2BKF A;  2LD9 A;  4KIK B;  2PE9 A;  2LUE A;  1WFY A;  2K6Q A;  4JKE A;  2YS3 A;  3QHT A;  2OQB A;  4WAA A;  2R0D A;  1BTN A;  2KTR B;  2DX1 A;  4KIK A;  2Z0D B;  2D9X A;  1UEL A;  3DPD A;  1DDM A;  2NBU A;  2QKL A;  2LRU A;  4FBJ B;  4K1R B;  4BOZ B;  2KTR A;  1JRU A;  3H1U A;  3DXE A;  2ZVO A;  3TJP A;  2KWV B;  2GCJ A;  3QIJ A;  4DHJ D;  4AJW A;  2JZZ A;  1X11 A;  4FJY A;  1WMH B;  2D9V A;  2AL3 A;  2A4Z A;  4JQW C;  3KZ1 A;  2W2W A;  2CS4 A;  4CHK A;  1E5W A;  3HIZ A;  1KC7 A;  2PPH A;  3C0R B;  3AJ4 A;  2CY5 A;  1X05 A;  1WMH A;  2R2Q A;  3S2A A;  2K8H A;  2C5L C;  2LJ5 A;  2N1V A;  2GCL A;  2DA0 A;  4GMX B;  5C79 A;  4ZYN A;  2AL6 A;  5JHA A;  4MGY E;  1RLF A;  1NDD A;  1WGY A;  4ILH A;  4DX9 0;  3PP2 A;  3ZNZ B;  3VQI A;  2JZ3 B;  5FR6 A;  1UNR A;  4F1S A;  5DIF B;  1WI1 A;  1YQB A;  3ODO A;  3DXD A;  4EZL A;  2Y8G A;  2GS0 A;  2DZK A;  5FI0 A;  2L05 A;  2C7M B;  4HPM B;  1UZX B;  3N30 A;  2N23 A;  1PMS A;  3ZO5 B;  5FI1 A;  2GBR A;  3G9W A;  3VTV A;  1M7R A;  2FAZ A;  1GJZ A;  3JVZ X;  1IYF A;  2IY0 B;  3A98 B;  2ZEQ A;  3M1I B;  3RT3 B;  2CHZ A;  3EC8 A;  4BBN C;  2L1C A;  1EVH A;  1FHX A;  2ZNV B;  3DBS A;  3AU5 A;  1WJU A;  4JKG B;  4FJV B;  5D3Y A;  2N7E A;  2N0Y A;  2OOB B;  1GGO A;  4KHB B;  4NJ7 A;  3ZVV A;  3H7S A;  4JIO U;  3U8Z A;  3ZNI D;  1FGY A;  1X1F A;  3PLV A;  1KZG A;  3SDL C;  4L6E A;  1HE8 A;  1KI1 B;  3VTW A;  3H7P B;  3QWM A;  5CLQ B;  1V81 A;  3FSS A;  4FHJ A;  2B3A A;  2O2V B;  2JRI B;  4HB4 B;  2DHK A;  3E66 A;  4HVB A;  1P5T A;  1TBE A;  3WYF B;  2R2O A;  2ZNV C;  3L08 A;  5D7G A;  5D3V A;  2O2V A;  2M1M A;  4BBN F;  2C7N B;  3RYT A;  4URK A;  3L16 A;  5CHV C;  1X86 A;  3P6A A;  1MAI A;  2K25 A;  4NPN A;  2JPH A;  1KBL A;  5JHH A;  3QBV B;  3A33 B;  4IWO A;  3OAN A;  4II3 B;  2Y8F A;  3KYC D;  4K2P A;  5JP4 A;  1UBQ A;  2L3Z A;  4ILG B;  4JKH A;  5HKH A;  1WJ6 A;  2MKR A;  2KLC A;  2VRR B;  2NMB A;  2ZPY A;  4BBK A;  3BIN A;  1LQB A;  2K2J A;  4HB0 B;  2GBM A;  2LOZ A;  2DZJ A;  4GGQ A;  2FJL A;  2D9Z A;  3TCA A;  4NY0 A;  1WY8 A;  4WQO B;  2KGX B;  3UIO B;  3KUD B;  3VH4 B;  2Z0E B;  1HB6 A;  1J0G A;  3SBT A;  1P1A A;  3FP5 A;  1FGZ A;  4AOF A;  1NI2 A;  3EHV A;  2HRJ A;  3ALB A;  2CR5 A;  2V1Y A;  5LOP B;  2G4D B;  2KN5 A;  2COA A;  1P6S A;  1R4M I;  4MGZ E;  1BAK A;  2UVM A;  4IWP A;  5C6R A;  2LG1 A;  1AQC A;  1K5D B;  5L81 A;  4KAX B;  1V89 A;  2MQJ A;  2FID A;  2Z59 B;  3D8D A;  2ZCB A;  2WH5 A;  1WM3 A;  2BYF A;  1WX9 A;  3KSY A;  2DZM A;  1PFJ A;  1H10 A;  3HM3 A;  3D8E A;  3DBR I;  3PVU A;  3RUI B;  2DYQ A;  2LVO A;  3GYO A;  4KZ0 A;  2V3S A;  3B1L X;  1IP9 A;  1V61 A;  2UWQ A;  3MDB C;  2W2X C;  1LM8 B;  4IFS A;  3PVL A;  4MEL A;  3A9K A;  1YIW A;  4A5K A;  1QQG A;  2DX5 B;  3A8P A;  2K1F A;  1B55 A;  3CXB B;  4JGH B;  2DHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...