1EF1A

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOESIN
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 89
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ef1A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ef1A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef1A01
1SE9A 5JLJB 2P0FA 4GMVA 1RLFA 2JPHA 3JSVB 2Z0EB 4C0AA 4WVFB 3RCPA 2VRWB 1VD2A 2LD9A 3ZTCA 4YL8A 2WYQA 4MJSB 4LJOB 5J3QA 3PRPB 1WX8A 2LUEA 3PSEB 4KZ0A 3H6NA 1ZM0A 1GJZA 1XKEA 2YF0A 1PFJA 4CHKA 5DI9B 3RUIB 2MCNB 1DDVA 4CO7A 3TVVA 3CSFA 1FHXA 1UNPA 2LRWA 2H7DA 2LULA 1QZEA 4W9IA 5E6PA 2JVCA 3BJIA 2Y7BA 4P7IA 1OTRB 1NTYA 2GCJA 1Y8RC 4K1RB 3ZVVA 4K7WA 4LDTD 3NHEB 2N7EA 2BWFA 3KY9A 2D2QA 2J0KA 1Q67A 1B55A 4HB3B 4F7HA 2KWCA 5EFXA 1FGYA 4AJWA 1UBIA 4FJVB 4ASWC 2D10A 5DPTA 4EZJA 3T8MA 2IO0B 2YVCA 2R2OA 2COCA 3A9JB 2ROVA 4FULA 2OTXA 4ZRIA 1NI2A 4E74A 1QQGA 2JP2A 2L3ZA 4NAWA 4TKNA 4JL9A 2P0DA 3JW0X 3PLVA 3GYPA 1WR6E 1PLSA 3HM3A 4DK5A 2ZVNA 1X1MA 3CF6E 2KWUB 2MLBA 4FLHA 2QHOA 2JZ3B 2LVOA 2R0DA 4XX5A 4HAWB 3QQ8B 1WMHB 2JRHA 1SIFA 2KNBA 4MGYE 4HDOA 2BWES 3PGEA 3UINB 2WDTB 5L95C 3U7DA 3PP2A 1K5GB 4JQWC 2I5CA 2HRJA 3KH0A 2D9XA 2IYBA 4W9GA 3QC8B 3A9KA 3NS8A 2KFKA 5JHAA 2V1YA 3WIMA 3TBLD 3DXDA 3ZTDA 3UF8A 3DBHI 3NZUA 1E8YA 1FAOA 3U30A 2ZCCA 2B3AA 2LXAA 2LRUA 3F0WA 2K2JA 1M94A 5E6NA 3L13A 4ANUA 3KZ1A 4GIVA 2DZMA 5KHOA 4FADA 2L0FA 1WG7A 2M17A 2Z0PA 1XCGA 3NZSA 1H8CA 1DDMA 2Y8GA 2FNJB 4K7SA 4W9LA 4IWQA 1X1FA 2I1JA 2DAJA 4GN1A 2L0TA 4GU2A 2ADZA 4HB0B 4A5KA 2DHJA 2N1VA 1MK9B 2KOXA 3ML8A 1WY8A 2ZZPB 2J0MA 2LOZA 4TQ0A 1PMSA 4BKSA 3JSVA 2WH5A 1GC7A 4HAVB 4HWIB 2LG1A 4KHOA 4HCPB 3HW2B 2FAZA 2GOWA 4GMXB 3L0WB 4JLCA 2KJHB 1FB8A 2GBJA 2MRPA 2ZEQA 2X18A 4HPMB 2MWNB 1BTNA 3UZTA 4NPNA 3PSCA 2FUHB 2WX1A 3PVLA 2L00B 3ZRFA 2ABDA 4AJYB 1TXDA 3V6CB 3BINA 4KHAA 1JRUA 5DIFB 2OQBA 3ZIMA 3KW5B 4ANWA 4DX8A 1KM7A 3PHXB 5L83A 5KCVA 3QIJA 2K2UA 2KDEB 3H7PB 4GGQA 3MPXA 4ZRJA 2YS1A 3VQIA 4W9HA 3DVGY 5KQ4A 4JGHB 3PRMB 4ZYNA 2YT0A 3HQCA 2DHKA 1RJ2A 2N23A 2KTRA 1WXSA 1Q0WB 2MWSB 1CMXB 3CIKA 1NDDA 2M14A 1U4AA 3V62A 3P6AA 3ZO5B 3A4SC 4DDGD 3WAMA 3SO6A 5J18A 4EKUA 3VTVA 2NZ8B 2CB8A 3OLMD 2KO3A 3ENEA 4MM3A 4NJ6A 2GCLA 2LGDA 4RMAA 1J0WA 4II2B 3DPDA 2AL6A 1KZ7A 3ZVRA 2A5UA 3W1SA 4WQOB 2Q13A 1DDWA 1KI1B 2DYBA 2D9VA 1MG8A 3NSUA 4FJZA 3R3MA 1F9JA 4HHVA 4MK0A 1V88A 1AWEA 1V5PA 2BYEA 1RAXA 4KIKA 5DH9B 3H9DA 5HE2A 1I2HA 2K8BA 2KWVB 3B0AA 1ACAA 2R09A 5J17A 2K8HA 3ODWA 4W9DA 3OJ4B 2IO2B 3ZRCA 2ROZB 4TYZA 3JVZX 4W9JA 2W9NA 3FEHA 1WVHA 2CODA 2A4ZA 2COFA 4A6FA 2RPQA 2NVUI 2RGFA 1YX6B 2C60A 1R4MI 2AL3A 2LZ6A 2ZJDA 3SUZA 2YS3A 1OGWA 2MP2A 4EJNA 2LBBA 2D9WA 3N32A 3K9PB 3AXCA 2UZRA 4KAXB 1E5WA 3ZKJC 1TTNA 4H8SA 2UWQA 4RM8A 1H4RA 2G35A 3SV1A 1WRDB 1M7EA 3IFWB 3HHMA 5FI0A 2UZSA 3N3KB 2G4SA 4HLEA 4CHJA 2PJHA 4URKA 2IO3B 1EF5A 3L16A 4BKGA 2FDQA 2J7QB 3M62B 1LB1A 1K8RB 2LOXA 2KDBA 3APFA 3L10B 2CRFA 2NR2A 1YQBA 1WGHA 2ZNVB 5CHWA 4PQ0A 3EFUA 4NQLB 4G0NB 2D07B 2DZIA 3ML4A 2P8VA 2XQNM 2DN6A 5LONB 2N1WA 2FIDA 2MW5A 4TV3A 4BBNC 4IW0A 1WZ0A 4KHBB 3N30A 4RM9A 3S2AA 3V61A 3CSTA 4KSKC 4XZ4A 2Y8FA 4HAUB 2M38A 2D9ZA 3DVNV 1U27A 2DYNA 1MKEA 4HB4B 4N9F4 3UGBB 1WM2A 4AWJA 1S3SG 2DYQA 5C5BB 2E2XA 2GMIC 3RZFA 1Y19B 5CLQB 2HTHB 3FLVA 2O6VD 4WJ7A 4F7GA 2RSUA 4WJQA 3H7PA 2O6VB 2D9YA 3ONSA 1OMWA 3LJUX 2FCMA 4GDLB 2REXA 3AU5A 2KDFB 2NPTB 2K6DB 2KFJA 2AEHA 3SYXA 3WA0A 3TFMA 5JZEB 5D3XA 2GBRA 2RLOA 2MBHA 1V61A 4GPTB 2BKFA 5DPWA 4IG7B 2KXJA 4AOFA 3UQBA 4IC7B 1FGZA 1V86A 2GBNA 4LDTB 4YONA 2CAYA 2YRYA 2AYOB 1WX9A 4BOSC 2EJ8A 5D27A 2K6QA 2KLCA 1WXAA 3TCAA 3W1SC 1X11A 1WI0A 1UZXB 3D8EA 2C7HA 2MQJA 1WGGA 4K17A 2MBEA 1XT9B 1M7RA 3TMPB 4LJPB 5IJMA 2BKRB 4TUUA 4KZCA 2EMTA 2J59M 2WX0A 2RSGA 2QKMA 2M8SA 2LYDA 1WJ1A 3IVFA 2HE7A 3L17A 3DVGX 3VIAA 2KVRA 1E8ZA 2LJ5A 1U2BA 1WJMA 3K9OB 4I6PA 2AWTA 1EGXA 3WAOA 4L6EA 5D94A 4XC2A 4GZUA 4A20A 4PYUA 1UBQA 1AQCA 2KMCA 3A1QB 3ZNZB 2DZKA 2UVMA 1J19A 3M95A 3A8PA 2L7RA 4KSLC 2ZCBA 5D6JB 2N4FA 4FHKA 3R7RA 1UH6A 3VVWB 3ZW3A 4XWXA 2ZVOA 3PS6A 1U5GA 2EC1A 1EUVB 1WE7A 1I42A 3OJ3A 1V6EA 1W1GA 2JUOA 4A3OA 1BT0A 4FA6A 5E6OA 3LJ3A 2JXXA 3ALBA 4MGZE 2DHIA 4IFSA 1V81A 4PS8A 4KV2A 3KRWA 4A3PA 1E7UA 3MTNB 3T9LA 3RULA 2P0HA 4F8CB 1NBFC 3H7SA 4HATB 3EPYA 2D4QA 4BBNF 3AU4A 3R66C 4EMOA 2CQUA 1UGMA 1MAIA 2WWZA 3APDA 4B9KA 3PG7A 3M3JA 2GBKA 2XK5A 4ANVA 2DZJA 4EZLA 1FHOA 4I6LB 1WGUA 2MBBB 3X0WA 2LVPA 2IYDB 4WJPA 1P1AA 4J6IA 4IM0A 3ZNHB 1U5FA 1GC6A 2Z59B 3TIXA 3KYCD 3WYFB 1XQQA 5J3TA 1WJ4A 3TL5A 2DFKA 3JYUA 3DXEA 2DAFA 5HE3A 4MJSA 1TBEA 3Q3JA 3VUWA 2ZPNA 2GJYA 4BKTA 2CHXA 5C5BA 2XEWA 3QAQA 3QJZA 2W2XC 2HTHA 2KK8A 3VXWA 1DROA 1UNQA 2BYFA 1IP9A 5C23A 3D8FA 4G3XB 1V89A 1ZKHA 1P9DU 1V5TA 1NTVA 1G6JA 1WIAA 3BY4B 5G55A 3DBSA 2RVBB 3F5RA 4GDLA 3CMMB 2NPTA 1YIWA 2ELBA 1WZ3A 2L76A 4HJKA 4KDIC 1WE6A 5C6RA 1D3ZA 4A6HA 5HE0A 3PV1A 2Y5BB 2PEAA 1RFAA 4DBGA 4Y94A 1OEYJ 2KKCA 1Q1OA 4AP4C 2CY5A 4MGIE 2CY4A 2NBUA 1RRBA 1Z5SB 4HDQA 2QKLA 3QWZB 3ULCA 3HIZA 4DWFA 2RR9A 3A9JA 3QBVB 4LCDE 1P3RA 3VTWA 2W2WA 2YT1A 1P6SA 5IA7A 1MPHA 2VSZA 5DPRA 3PTFC 4NY0A 4K81A 2CKHB 3ULBA 5JH5C 1V9JA 3SU8X 5C1ZA 2V4LA 3P2BA 2DKQA 1LQBA 4MSMB 1X05A 3UIOB 1EVHA 1WI1A 1IYFA 2MBQA 4CYEA 2COPA 3IHPC 4IM2A 5AZHA 1ZW7A 1V5MA 1WJUA 1WR1A 1WMHA 1Y5OA 1GNUA 1UNRA 1ZVRA 4WWPA 1XR0B 2Z0QA 2G4DB 1I7AA 3NOBA 5HE1A 3A1QA 1AARA 4GB9A 2KC2A 4DXAB 1ZSQA 2N9XA 4NAWB 3DDCB 1WFYA 4ICVA 2MDXA 4GDKB 3UQAA 5LXHA 2C7NB 2FJLA 1UPQA 4BBKA 2DX1A 2IFSA 1BTKA 2M0XA 2KANA 5HKHA 1IRSA 2IZVB 4IUMB 1TQZA 4PNKA 1V5OA 1W1DA 2G3QB 2DKPA 5DCNA 2KQSA 1X1GA 3ZUNA 2KLGA 3PEGA 4MEMA 1WYWB 2KHWB 4FHJA 4G11A 5GOWB 3A9KB 2VKIA 2IBIB 2D11A 5L81A 1NTIA 2Z0DB 4EOYA 3X23A 5DPSA 1NVLA 1L2NA 1HE8A 4II3B 3MDBC 4JIOU 1QC6A 1WX7A 5CX3A 2LWPA 1XX0A 4WJOA 5DHAB 3ZDTA 2ZPYA 4HXDA 4HAXB 2YLMA 2CR5A 2RQ1A 3PHWB 2KJ6A 2PPHA 4WAAA 2DENB 2MA9B 1UEFA 4W9KA 4W9FA 1Z2MA 5C16A 3DCGA 2FCQA 5LOPB 4IM3A 3N7CA 4IAPA 3DXCA 5CHVC 2DLWA 5DHFB 2MFQA 4BKSD 2MKRA 2M4NA 4HPLB 4PYZA 4KVGB 2C7MB 2L8JA 3DQVA 2K39A 3LDZE 3WALA 3QK0A 4DDID 3VAWA 2L05A 3RYTA 4F7ZA 4WWOA 1UD7A 2KCJA 1EO6A 4EFOA 3FSSA 5IAAC 3HK0A 1FHWA 5EDSA 3OANA 2M1MA 3ML9A 1K5DB 1WF9A 4DX90 5KHQA 3GOEA 3ZNGC 1DYNA 1H10A 1WM3A 2JZZA 3AJ4A 3SDLC 2PE6B 2RD0A 3VOQA 1DBHA 2KX3A 2LASA 4GOCA 4E3CA 2VRRB 1V5UA 1S1QB 4WJNA 3MHSD 2O2VB 2R2QA 2KX0A 2PE9A 3QWMA 1HB8A 3DBRI 1EF1A 2D3GA 1J8CA 2NCNA 3VTUA 1E8WA 2JWZA 3M1IB 5CLLB 3KYDD 4HB2B 3GZNI 2DHZA 2UYZB 3IG3A 1V49A 4KDLB 2KTRB 5JP4A 2BCJA 1IPGA 3KSYA 1MIZB 4F7UP 5G2NA 2G45B 2OOBB 3D8DA 4M8MA 4WSFA 2BPSA 3PRZA 2DX5B 2KN5A 2NMBA 1SGHA 4BOZB 1P3QU 2KUPA 3APCA 1NU2A 2HJ8A 2CHZA 1I35A 1VCBA 2RGNB 1L7YA 1XODA 4MY6A 4PS7A 5LLIA 1UPRA 1ST7A 1W1HA 2V3SA 2CU1A 4GDKA 3VUXA 3EHVA 3KUZA 3KRXA 4M0WB 1EAZA 2HD5B 3PVWA 4AUQC 1YJ1A 4HAYB 3ZDMC 3QCAA 1YD8U 2KQ7A 3KUCB 3VDZA 2C5LC 2DTCA 1U5EA 5D3WA 1OY2A 1WGQA 2EKEC 3VUYA 1WJNA 2FCNA 4K2OA 3TJPA 4KIKB 3T06A 1LW3A 3OAWA 2K00A 4FBJB 3CXBB 4MGKE 2K25A 5JHHA 3SHQA 4TQ1A 1WGRA 2K1FA 4GSWA 3VH4B 2C9WB 4BFRA 1TGZB 4IOYX 4A6FB 4ICUA 4K7UA 3PVUA 2EMSA 5AZGA 3DBLI 3M63B 5FI1A 3RCZA 2BYVE 4IWOA 1BAKA 3B08A 2MP2B 4MT7A 4ZDVA 2JY6A 2ELAA 1C3TA 1C1YB 4EZKA 3MJWA 3FP5A 2MSED 2NBVB 2LXCA 3WAPA 3QA8A 4I6NB 2YS5A 3PPAA 4MH0E 4HVBA 1WJ6A 2V76A 2LVQA 1KZGA 4M8NA 2JRIB 3DVNU 3SNHA 5AEKB 1OEYA 5AZFA 2KMAA 4FN2A 5D3VA 3U8ZA 2YSZA 3AULA 3PREA 2FIFA 2I5FA 3RT3B 1OQNA 3PT2B 4CHMA 4IWPA 2LKOA 3QARA 3V60A 2LGYA 3HM6X 2IY1B 2COAA 1FOEA 1WXVA 5C79A 1X86A 3PZDA 1HBKA 1TZ1A 4ZRKA 2N0YA 3ZNID 2CS4A 2O6VA 2LGXA 1ZC4B 2FJ9A 2OJRA 4A6KA 2MX2A 1V80A 3TO1A 1Z87A 1GG3A 4GXBA 1P5TA 1KLVA 2JT4B 4PS3A 2GBMA 3V5WA 3ODOA 3H1UA 3KUDB 4B6HA 3L54A 2BF8B 2W2XD 3QHTA 2N7DA 5FR6A 2CHWA 4EEWA 2KTFA 1TJ6A 3TW1A 2KJRA 3D32A 2O2VA 5D2MB 5TR5A 5J3YA 4MDKE 2Z0OA 4OVVA 1SHCA 4HAZB 5JHBA 2K8CA 4Z2MB 3A98B 1WXMA 3KVFB 4HK2A 1WH3A 3ECIA 2RUKB 5LXIB 1U29A 1A5RA 1YX5B 4DHZB 1KJTA 2PZ1A 3RD2A 2KGXB 4E71A 2N9PC 1T0YA 2DYMA 1ZC3B 1V2YA 2RNRB 1HB6A 1OQYA 2DX5A 2JF5A 2H7EA 1ZGUB 1XD3B 1WGYA 1P0RA 4WWNA 3A8QA 3NY5A 4DHJD 2GS0A 2ASQA 3A33B 2KDIA 5BO4B 1UELA 3FM8C 3UIPB 4ANXA 2KC1A 4DHJB 5D3YA 1Q5WB 5D7GA 4NNJB 2LI5A 4NSWA 2J0JA 4B6WA 1LXDA 1MIXA 3G9WA 1J0GA 2IY0B 3IBEA 2L1CA 2BGFA 1WGDA 1R4NI 4DBBA 3ZLZA 4F1SA 2N9EB 1ISNA 3ODXA 1FXTB 1N3HA 1LFDA 3EC8A 1XD4A 4OVUA 3VHTC 1GUAB 1PQSA 3AI5A 3SD5A 4D0NB 3C0RB 3I3TB 3L08A 2KFKB 3VFKA 3W1YA 2DA0A 2KZRA 3VH3B 2DYOA 5CTRC 2ZNVC 2NS5A 2MBOA 3GYOA 3Q3FA 4NJ7A 5GMVA 3P7ZA 1E7VA 4B95A 3DOWA 3O65B 4MSQB 3A4RA 2L2IA 2I1KA 1MK7B 3RZWC 1E8XA 3R7QA 1BWNA 1U5DA 3B1LX 5JHGA 2KD0A 5CHFA 4FJYA 4X57B 5KQ1A 4W9EA 4K2PA 4G50A 1RRPB 3PLUA 2XBBC 3WANA 4HCNB 2NBWB 4EUTA 2FCSA 2IO1B 3QX1A 4DHZE 4NQKE 1E90A 4W9CA 3EECA 4BVUC 5J2RA 4Z2NA 2XK5B 3O96A 1LM8B 3V6EB 1KOTA 1P98A 4MELA
chains in the Genus database with same CATH superfamily
1SE9A 5JLJB 2WLBA 2P0FA 4GMVA 5I2SA 3PZ8A 1RLFA 4PK1A 2JPHA 1JWAD 4JX1C 4ZYSA 3JSVB 2Z0EB 2X8XX 2BS2B 4C0AA 1JCKB 4WVFB 3RCPA 2VRWB 1VD2A 2LD9A 3ZTCA 4YL8A 3E9SA 2WYQA 3AN1A 3AE7B 4MJSB 4LJOB 5J3QA 3AEAB 2KMMA 3PRPB 1WX8A 2LUEA 3PSEB 4KZ0A 3OHMB 3H6NA 1ZM0A 1FNWA 1GJZA 1XKEA 1MG4A 1VZ6A 2YF0A 5EE9A 1JRPA 1PFJA 4CHKA 5DI9B 4P6VF 3CIRB 3RUIB 2MCNB 1SF0A 1DDVA 4CO7A 3TVVA 1CQVA 3AE1B 1JALA 3CSFA 3TEXA 1FHXA 1UNPA 2LRWA 2H7DA 3KWVA 4DIXA 2LULA 1HA5A 1QZEA 4W9IA 4US9A 1VLBA 5E6PA 2JVCA 2DWQA 4YTPB 1JWMD 3BJIA 2Y7BA 4M00A 2E3TA 4QAYA 4P7IA 1OTRB 1NTYA 2GCJA 1Y8RC 4K1RB 3ZVVA 2ZW0A 3BVMA 4K7WA 4LDTD 3NHEB 2K9XA 2X0SA 2N7EA 2BWFA 3KY9A 2D2QA 2J0KA 3AMZA 1Q67A 1B55A 4XDCA 4HB3B 2V9HA 3BZDB 4F7HA 2KWCA 3BIID 5EFXA 1FGYA 4AJWA 1IBXB 1UBIA 4FJVB 4ASWC 2D10A 2WDVB 5DPTA 4EZJA 1C9FA 3ABVB 3T8MA 2I2YA 2IO0B 2YVCA 4EE2A 3SFEB 3ZXVA 5C2TB 2R2OA 2COCA 1PDXA 3A9JB 2ROVA 4FULA 4RF0A 1V1OA 2J52A 3AEGB 3N1XC 4LNFA 2OTXA 4ZRIA 1NI2A 4E74A 3AEFB 1QQGA 3P4QB 2JP2A 1IGDA 2L3ZA 3VR8B 1FNUA 4NAWA 4TKNA 1N62A 4JL9A 2P0DA 1L4DB 3JW0X 4RNAA 3C19A 3PLVA 1QOAA 3GYPA 1WR6E 4R3DA 1PLSA 3HRDD 3HM3A 4DK5A 2ZVNA 1QT9A 1X1MA 2KT7A 3CF6E 2KDMA 4H2AA 3URYA 3Q2AC 2KWUB 2MLBA 2BB6A 4FLHA 2QHOA 2JZ3B 2LVOA 2R0DA 2WU2B 1TY0A 4XX5A 4HAWB 3QQ8B 1WMHB 2JRHA 1SIFA 2IJ0A 2KNBA 4MGYE 1YN3A 4HDOA 2BWES 4AS1A 4QJ5B 1FPYA 3PGEA 3UINB 2WDTB 5L95C 3DHGC 1ET6A 3W5VB 1UUPA 3U7DA 3PP2A 1K5GB 4JQWC 1MJDA 2I5CA 2Z13A 3Q8FA 1BUIC 1MFWA 3RNCC 2HRJA 3KH0A 1L4ZB 2D9XA 2IYBA 1ZUD2 4W9GA 1E9MA 3QC8B 3A9KA 3NS8A 2KFKA 5JHAA 2V1YA 1XF5L 3WIMA 4QJ4B 3TBLD 3DXDA 3ZTDA 4MT5A 3UF8A 3WCQA 3DHHC 3DBHI 3NZUA 1E8YA 1FAOA 3N1ZC 3U30A 2ZCCA 2KACA 4DXGA 2B3AA 3ETRA 2LXAA 2LRUA 3DCXA 3F0WA 2K2JA 1M94A 2YEPB 2HJ1A 5E6NA 3FKYA 3L13A 4M01A 1NENB 1FMAD 3KQ4A 4ANUA 3ZGZA 3KZ1A 4GIVA 2DZMA 4JKEA 5KHOA 4FADA 2L0FA 1WG7A 1NVID 2M17A 2Z0PA 1XCGA 3NZSA 2WXKA 1H8CA 1DDMA 2Y8GA 4JK9A 2FNJB 3AH7A 2VH2A 1YN4A 4K7SA 4W9LA 1L0XB 4JKHA 4IWQA 2D3BA 1R4MB 2WU5B 1X1FA 2QIEB 2I1JA 2DAJA 5E6JA 4GN1A 2L0TA 4GU2A 4K3CA 2L83A 1WGKA 1E7PB 2OEDA 3AEBB 5HFYA 1P7FA 2ADZA 4HB0B 4A5KA 2DHJA 2N1VA 1V1PB 2JYTA 1MK9B 4XDDA 2KOXA 3ML8A 2WXLA 4P1BC 1WY8A 1SJHD 2ZZPB 3FILB 3HSAA 4K3BA 1UWXA 1ZPSA 1I4RA 2J0MA 2LOZA 3V05A 1AW7A 4TQ0A 1PMSA 4BKSA 5FR3A 3JSVA 2WH5A 1GC7A 4HAVB 4HWIB 2LG1A 4KHOA 4HCPB 3HW2B 2FAZA 2GOWA 4GMXB 4RFBA 3L0WB 4JLCA 2KJHB 2BW2A 1FB8A 2GBJA 3Q14C 2MRPA 2ZEQA 2X18A 4HPMB 2MWNB 3ZQ4A 1BTNA 5BYRA 3W5UB 1PGAA 3UZTA 1SEBD 4NPNA 3PSCA 2FUHB 2WX1A 2KN4A 2FUG1 3PVLA 2L00B 1XO3A 3ZRFA 2ABDA 2WDRB 3P4PB 4AJYB 1TXDA 3V6CB 1CK1A 3BINA 4KHAA 3NWFA 1JRUA 2KUQA 5DIFB 2OQBA 2D3AA 3ZIMA 1TS4A 3KW5B 3KLSX 4ANWA 3TEYA 4XWWA 4DX8A 1BMLC 4JKGB 1KM7A 3PHXB 5L83A 5KCVA 3QIJA 2K2UA 2KDEB 3H7PB 4GGQA 1JWSD 4P1CC 2PMVA 4ARCA 3MPXA 3P1MA 4ZRJA 2YS1A 3VQIA 4W9HA 2YT2A 3DVGY 5KQ4A 4JGHB 3PRMB 3AE4B 4ZYNA 2YT0A 3HQCA 2DHKA 4XE0A 1RJ2A 2N23A 3E9OA 1WXSA 1Q0WB 2KTRA 2MWSB 1CMXB 3CIKA 1NDDA 2M14A 1IBXA 1FD6A 1U4AA 3EA6A 3V62A 1Q10A 3P6AA 3ZO5B 3A4SC 3OG5A 4DDGD 3WAMA 3SO6A 3TSSA 5J18A 1STEA 4EKUA 4LNNA 3VTVA 1GGOA 2J4XA 2NZ8B 1QKZA 2CB8A 3OLMD 2KO3A 1OFFA 1SSNA 3ENEA 3NS1A 4MM3A 2AX5A 3CWIA 4NJ6A 3U7ZA 3J9CA 2GCLA 2LGDA 4RMAA 4YT0B 2JWUA 1J0WA 3HVDA 4II2B 3DPDA 2AL6A 1KZ7A 4JE3B 3ZVRA 2G9HD 1MI1A 2A5UA 1J7AA 3W1SA 1JMLA 1NYRA 3MC8A 4M0WA 4WQOB 1ZE3D 3LB8C 4REZA 2Q13A 1DDWA 1KI1B 2DYBA 2D9VA 1MG8A 3NSUA 2JXTA 3R3MA 4FJZA 2QDFA 1F9JA 3W9CB 3AM9A 5HG2A 3U2SC 1C4AA 4HHVA 4MK0A 1V88A 1AWEA 1V5PA 2BYEA 2QCZA 3I57A 1P7EA 2PVGC 1RAXA 4HPPA 4KIKA 5DH9B 1HZ5A 3H9DA 1KC7A 5HE2A 1I2HA 2K8BA 2KWVB 3B77A 3B0AA 4ACFA 4B0EA 1ACAA 3IAM1 3VRAB 4A9AA 2N0SB 2R09A 5J17A 2K8HA 3ODWA 4W9DA 3OJ4B 4ITKA 2IO2B 1UWMA 4RF1A 5AUKA 2ROZB 3ZRCA 4TYZA 2BYTA 4HEA1 3JVZX 1FM0D 4ZRPA 4ILGB 4W9JA 2W9NA 3FEHA 1WVHA 2CODA 3T3NA 2A4ZA 2COFA 4A6FA 2RPQA 2NVUI 2RGFA 1YX6B 2C60A 1R4MI 1EWYC 2AL3A 2OJWA 2LZ6A 2ZJDA 3SUZA 2YS3A 1XXGA 2RPVA 1OGWA 1J7BA 2MP2A 4EJNA 2LBBA 2D9WA 3AE2B 3FAHA 3K9PB 3N32A 3AXCA 2UZRA 4KAXB 1E5WA 1T0SC 1TTNA 2NBVA 3ZKJC 4H8SA 1TT5B 3ZJUA 2UWQA 2WXIA 4HKZE 1XLPA 4RM8A 5LG4B 1TKGA 1L0VB 1WRIA 1H4RA 1J7CA 2G35A 3SV1A 1WRDB 4QJ3B 1M7EA 3IFWB 4JKFA 3U12A 3HHMA 3SEBA 5FI0A 2UZSA 3N3KB 2G4SA 2INPE 4HLEA 2MH7A 4CHJA 1I7HA 2PJHA 2D5GA 4KGRA 1YQ3B 3I5JC 4URKA 2IO3B 1EF5A 3L16A 4BKGA 2FDQA 2J7QB 2QEJC 4YXDB 3M62B 1LB1A 1K8RB 1TKEA 1KBLA 2PTLA 2LOXA 2KDBA 2KQ4X 3APFA 3L10B 1KTKA 2CRFA 2NR2A 1YQBA 1WGHA 3V3XA 2ZNVB 3Q8CA 5CHWA 4PQ0A 3Q8EA 4A55A 1MVKA 3EFUA 2IPKD 4NQLB 2JX5A 4G0NB 2D07B 2DZIA 3ML4A 3RMKC 2P8VA 1E6EB 2XQNM 1I4HA 4C00A 2DN6A 5LONB 1GOZA 1RWSA 1TJEA 4NZLB 2N1WA 4RGMA 2FIDA 1D5MC 2MW5A 4TV3A 1IGCA 4IW0A 4BBNC 1WZ0A 4KHBB 3N30A 4L1BA 4JK7A 4RM9A 1MHHE 1Y56A 3S2AA 3V61A 3CSTA 1VR9A 1F2RI 2N9KA 2B76B 3DWMA 4KSKC 4XZ4A 2Y8FA 2L52A 4HAUB 2M38A 1C4PA 2QC8A 2D9ZA 3DVNV 1U27A 2DYNA 1MKEA 4HB4B 1RFKA 4N9F4 3UGBB 1WM2A 4AWJA 1S3SG 2KR0A 2DYQA 5C5BB 2E2XA 2GMIC 2V3PA 2BBCA 3RZFA 1Y19B 5CLQB 2HTHB 3FLVA 2O6VD 4JKGA 4WJ7A 1F0ZA 1GB1A 4F7GA 4OSNA 2RSUA 5T8IA 4WJQA 3H7PA 1TYGB 2O6VB 4LLGM 3R2IA 2D9YA 1ESFA 1ZP0B 2JSVX 2Z8LA 2LGIA 3ONSA 1TS3A 3AE3B 1OMWA 2PIAA 3LJUX 4OW0A 3SR6A 2FCMA 4GDLB 1B9RA 2REXA 3AU5A 2KDFB 2NPTB 4US8A 1F1HA 2K6DB 2KFJA 2AEHA 3SYXA 3B2GA 2GI9A 3WA0A 3TFMA 5JZEB 5D3XA 4WURA 2GBRA 1WXQA 1QOGA 2RLOA 2MBHA 1V61A 4GPTB 2BKFA 5DPWA 4GLSC 1PFDA 2BT6A 1VZ8A 4IG7B 2KXJA 2W3SA 5D3IB 4AOFA 1HZ6A 3UQBA 4IC7B 1FGZA 1V86A 2GBNA 4LDTB 4YONA 5I2MA 4OZBA 2CAYA 2YRYA 2RDHA 3T3OA 1JQ4A 3NW8A 2AYOB 1ACCA 1WX9A 4BOSC 4Q2JA 2EJ8A 5BMIA 5D27A 2K6QA 2KLCA 1GB4A 1WXAA 2J42A 3TCAA 3W1SC 1X11A 1WI0A 1UZXB 3D8EA 2KYWA 3P42A 2QJLA 2C7HA 2MQJA 2EKIA 2X38A 1WGGA 4K17A 2IGDA 2MBEA 1XT9B 4KGSA 2MJEA 1I4PA 1M7RA 1AN8A 3TMPB 4KGTA 4LJPB 5IJMA 1PGXA 2BKRB 4TUUA 4KZCA 3Q3MC 2EMTA 2J59M 2WX0A 2DIKA 2RSGA 2QKMA 2M8SA 2LYDA 3U4EG 1YNTE 1WJ1A 2H89B 3IVFA 2HE7A 3L17A 3DVGX 3EUB2 3VIAA 2KVRA 1E8ZA 2LJ5A 1U2BA 3RI7C 1WJMA 3K9OB 4I6PA 2AWTA 1EGXA 3WAOA 1T77A 4L6EA 3I63C 5D94A 4XC2A 4GZUA 4A20A 4PYUA 1TS5A 2JZPA 1UBQA 5G5GA 3NVZA 1AQCA 2KMCA 3A1QB 3ZNZB 2WQYB 2DZKA 2VH1A 2WXHA 2Z4DA 1J19A 2UVMA 2BS4B 3M95A 3A8PA 2L7RA 2K0PA 4MH8A 4KSLC 2ZCBA 2ZKMX 2W55A 5D6JB 2N4FA 4FHKA 2WDQB 3R7RA 1UH6A 3VVWB 3ZW3A 4XWXA 2ZVOA 1SJED 3PS6A 1U5GA 1FFVA 2EC1A 1EUVB 1WE7A 1N6ZA 2IGHA 1C78A 2DNFA 1I42A 4XGAB 2QMTA 1KF6B 3OJ3A 1V6EA 2W54A 1W1GA 1ZDXA 3NRZA 2JUOA 1JROA 4A3OA 1ZOYB 1BT0A 1UNSA 4FA6A 5E6OA 4C56C 2ICIA 4TSSA 3RNGC 1WSPA 5BMHA 3LJ3A 3Q6BA 2JXXA 3ALBA 2DHIA 4MGZE 4IFSA 1V81A 2GB1A 2W82A 1FO4A 4PS8A 3L4PA 4KV2A 3KRWA 4A3PA 1E7UA 1N5XA 3MTNB 1D6EC 3T9LA 3RFZB 3RULA 2P0HA 5HI1A 1SB3C 4F8CB 1NBFC 1MPEA 3H7SA 3IT6B 4HATB 3EPYA 2D4QA 4BBNF 3AU4A 3R66C 4EMOA 4CQNA 2Y5PA 2CQUA 1UGMA 4USAA 1MAIA 2WWZA 1FRDA 1NI3A 2HDEA 3MHZA 3UI3A 3NG0A 3APDA 4B9KA 1RYJA 3PG7A 3M3JA 2GBKA 3FVCA 2XK5A 4ANVA 2LHEA 2WXGA 2DZJA 4EZLA 1FHOA 4I6LB 1WGUA 2LJIA 2MBBB 3X0WA 5M4YB 2LVPA 2IYDB 1VZ7A 4WJPA 4ILJA 1P1AA 4J6IA 5HHDG 4IM0A 3ZNHB 3GE8C 4KHBA 1U5FA 1GC6A 3LYYA 2Z59B 1I4GA 3R8BA 3TIXA 3KYCD 3WYFB 1XQQA 5J3TA 1WJ4A 3TL5A 4BZAA 2DFKA 3JYUA 3P63A 3DXEA 3E9PA 5FK9C 2DAFA 5HE3A 4MJSA 1TBEA 3Q3JA 3VUWA 2ZPNA 2GJYA 1QF6A 4BKTA 2CHXA 5C5BA 2QILA 2XEWA 3QAQA 3QJZA 2W2XC 2HTHA 2KK8A 3VXWA 1DROA 1UNQA 2DLBA 2BYFA 5MPOA 1IP9A 2DBYA 3A58A 1F2RC 5C23A 3D8FA 4G3XB 1V89A 2D3CA 2AQ1B 1JDEA 2L1AA 1ZKHA 1P9DU 2R61A 1V5TA 1NTVA 2R2YA 3ZJVA 1G6JA 1WIAA 3BY4B 5G55A 3DBSA 2RVBB 3F5RA 4GDLA 2Q5WD 3CMMB 2NPTA 1YIWA 4A6QA 4HRSA 2ELBA 1WZ3A 2L76A 4HJKA 4KDIC 4C7ZA 1WE6A 5C6RA 1D3ZA 1SE2A 4A6HA 5HE0A 3PV1A 2Y5BB 2PEAA 1RFAA 4DBGA 3BVZA 5EE0A 2ACZB 1DOYA 4IOIE 3MC9A 4Y94A 1OEYJ 2KKCA 1Q1OA 2KVZA 4AP4C 1LO5D 2CY5A 4MGIE 1ZYIA 2CY4A 2NBUA 4DQOC 1YMHE 4ARIA 1RRBA 4OT1A 1Z5SB 4HDQA 5G5HA 2QKLA 3QWZB 1VBHA 2WXOA 4C80A 3ULCA 3HIZA 4DWFA 5IP4D 4ILHA 4JWUC 4LTUA 2RR9A 3SBTA 3A9JA 3N20C 3QBVB 3GP7A 4LCDE 1P3RA 3VTWA 1RM6C 2W2WA 2YT1A 2TSSA 3AE9B 1P6SA 5IA7A 1MPHA 2VSZA 5DPRA 3PTFC 2KIEA 4NY0A 4K81A 1WWTA 2CKHB 3ULBA 5JH5C 4P16A 1V9JA 3SU8X 5C1ZA 2V4LA 3P2BA 4N58A 1BXTA 2DKQA 1OQQA 2JU6X 1PGBA 1LQBA 1TKYA 1OQRA 1X05A 4MSMB 1EVHA 3UIOB 1WI1A 1IYFA 2MBQA 4CYEA 1XLQA 3DBRB 2YEPF 2VZKD 2COPA 4JKDA 4NAMA 3IHPC 4IM2A 5AZHA 3NWDA 1ZW7A 1V5MA 1WJUA 1WR1A 2PLPA 1WMHA 1Y5OA 2VZKB 1GNUA 1C4CA 3GZNB 5IN7A 4YTMB 1L6UA 1UNRA 1ZVRA 2K3UA 2G4DB 1XR0B 2Z0QA 3LXFA 4WWPA 3VRBB 5JXVA 1I7AA 3NOBA 5HE1A 4LK0M 3A1QA 1AARA 4GB9A 2KC2A 5AUIA 4DXAB 1ZSQA 2N9XA 4NAWB 3DDCB 1WFYA 4ICVA 2MDXA 4HSIA 2K49A 1ZXIA 1SE4A 4IKGA 1VDVA 4GDKB 2BS3B 1DYQA 3UQAA 2Z14A 5LXHA 3W2DA 2C7NB 2FJLA 1UPQA 5IRSA 4ZHOA 4BBKA 4IDIA 1T6BX 2DX1A 1XLNA 2IFSA 5BYQA 1BTKA 2M0XA 2KANA 5HKHA 2WXFA 1IRSA 2IZVB 1F77A 1K53A 4IUMB 5IKCM 1TQZA 4PNKA 1V5OA 1V97A 1W1DA 2G3QB 2NMQA 2DKPA 5DCNA 2KQSA 1X1GA 2ONQA 3ZUNA 2KLGA 3PEGA 2BQQA 4MEMA 1JWBD 1WYWB 2KHWB 4FHJA 4G11A 1VJKA 5GOWB 3A9KB 2VKIA 1WYGA 2IBIB 2WP9B 3BK2A 4JK8A 1CJEA 2D11A 5L81A 4D2KA 1NTIA 2Z0DB 4EOYA 1FXAA 3X23A 5DPSA 4M02A 3VR9B 1NVLA 1L2NA 1HE8A 4II3B 3MDBC 3E66A 3NJTA 4JIOU 2WXQA 3GE3C 1GAQB 1QC6A 4OZCA 1WX7A 1V1PA 4OVZA 1YOVB 5TSSA 1HTOA 5CX3A 2LWPA 1XX0A 4WJOA 5DHAB 3ZDTA 2ZPYA 4HXDA 1SE3A 4ZHPA 4HAXB 2YLMA 2ZW1A 3FILA 1TIFA 4YSYB 2V0GA 3NVWA 2CR5A 2RQ1A 3PHWB 2FJUB 2KJ6A 2JQRB 2WS3B 2Z59A 2PPHA 2LMCA 4WAAA 1FRRA 2PKOA 2DENB 2R82A 2MA9B 1QQRA 1SXTA 3AV8A 4FXCA 1UEFA 1XEEA 4N6EB 4W9KA 4W9FA 1Z2MA 5C16A 3DCGA 3BVGA 2FCQA 3NZ3A 3RNFC 5LOPB 1ENFA 4IM3A 3N7CA 3E56A 4IAPA 3DXCA 5CHVC 2DLWA 4TMAB 5DHFB 2MFQA 2AQ3B 4BKSD 2MKRA 2M4NA 1SIJA 4HPLB 4PYZA 4KVGB 2C7MB 1B1ZA 2L8JA 1EU4A 3DQVA 4OZAA 2K39A 2SAKA 3LDZE 3WALA 3QK0A 4DDID 1C76A 1N5WA 3VAWA 2L05A 3RYTA 4F7ZA 4WWOA 4MACA 2K8EA 4LNKA 1UD7A 2KCJA 1EO6A 4EFOA 3FC4A 3FSSA 4BAXA 1ET9A 5IAAC 3HK0A 1FHWA 1N60A 2GLSA 5EDSA 3OANA 2M1MA 2RDGA 2LFIA 3ML9A 1K5DB 1WF9A 4DX90 2BVCA 5KHQA 3GOEA 5H92C 3ZNGC 1DYNA 1L5PA 1H10A 2L32A 1WM3A 2RRFA 2JZZA 3AJ4A 3I9V1 3KWLA 3HUIA 3SDLC 2PE6B 1TY2A 1PYWD 2WXJA 4YWGG 4O1NA 2RD0A 4RGNA 1L0YB 3VOQA 1DBHA 1R7SA 2KX3A 4RGTA 2RDBC 2PW9A 2LASA 2MEKA 1T3QA 4A8XC 4GOCA 5BYSA 4E3CA 2VRRB 1V5UA 4AQ7A 1K51A 1S1QB 1UF0A 4WJNA 3MHSD 2O2VB 2R2QA 1MHXA 2KX0A 2PE9A 4GNKB 3QWMA 1HB8A 3ZJTA 3DBRI 1EF1A 2D3GA 1J8CA 2NCNA 3VTUA 1E8WA 3DHIC 2JWZA 4C4VB 3M1IB 1EWCA 2EELA 5CLLB 3KYDD 2UU7A 4J3OD 1KLUD 3R2TA 1FXIA 3U52E 2M19A 2LUMA 4HB2B 3GZNI 2DHZA 3SBGA 2UYZB 3IG3A 1V49A 3N1YC 4KDLB 4L2YA 2KTRB 1QOFA 5JP4A 2BCJA 3NWAA 1IPGA 1HQRD 4WQMA 3KSYA 2PVOD 4YTNB 1MIZB 4F7UP 5G2NA 2G45B 4L1RA 3RNAC 2OOBB 3Q8AA 4HKQA 3D8DA 4M8MA 4WSFA 2BPSA 3PRZA 2DX5B 1EM7A 5IO9A 2NTSA 1PUTA 3NVVA 2KN5A 2NMBA 1SGHA 3IT4B 1P3QU 4BOZB 2KUPA 3APCA 1NU2A 2HJ8A 2CHZA 1I35A 3RNEC 1VCBA 2RGNB 4MM3B 1L7YA 3Q69A 1XODA 4MY6A 3C8YA 4PS7A 2AQ2B 5LLIA 1UPRA 1ST7A 1W1HA 3P4SB 2JYEA 1XCTL 2V3SA 4GOUA 2CU1A 2MJ3A 4GDKA 3VUXA 3EHVA 3KUZA 3KRXA 4M0WB 2W3RA 1EAZA 2HD5B 3PVWA 4AUQC 1YJ1A 4HAYB 5GXGB 3AB5A 3ZDMC 3QCAA 1YD8U 2KQ7A 2IDYA 3KUCB 3VDZA 2WNMA 1VBGA 2C5LC 2DTCA 1U5EA 1NEKB 5D3WA 1OY2A 4S0RA 1WGQA 2EKEC 3VUYA 2I38A 1WJNA 1N61A 2FCNA 4K2OA 3TJPA 1HTQA 4KIKB 1E10A 3T06A 1LW3A 3OAWA 2RMMA 2K00A 4FBJB 3N9YC 4XYCA 3CXBB 4S17A 4MGKE 1K50A 4OHJA 1T0RC 5C3JB 2K25A 4WAFA 1QILA 5JHHA 3SHQA 1XCQL 4TQ1A 1WGRA 2K1FA 4GSWA 3VH4B 2C9WB 3IXSA 4BFRA 1TGZB 3IAS1 4IOYX 5IOIA 4A6FB 4ICUA 4K7UA 2CJNA 3PVUA 2EMSA 5AZGA 1I4QA 3DBLI 3M63B 5FI1A 5D3DA 3RCZA 1T0QC 1DIKA 3ZYYX 3Q3NC 2BYVE 4IWOA 2LHDA 1BAKA 3B08A 4L23A 2MP2B 3MP9A 4MT7A 4ZDVA 3AE6B 2JY6A 2ELAA 4KX6B 1R4NB 3BWUD 1C3TA 1C1YB 4EZKA 1XLOA 3FP5A 2MSED 3BYTB 2NBVB 3MJWA 3O13A 2LXCA 3WAPA 1MI0A 3QA8A 1K52A 3EGRA 4I6NB 2GRIA 2YS5A 3PPAA 1ROEA 1TS2A 4MH0E 3NUHB 4HVBA 2K5PA 1WJ6A 1D5XC 3PO0A 2V76A 2LVQA 1KZGA 4M8NA 2JRIB 3DWGC 3DVNU 3SFDB 3SNHA 5AEKB 1ZXHA 1OEYA 5JVLA 1DGJA 5AZFA 2KMAA 3MC0B 4FN2A 4RH6A 3RN9C 5D3VA 3U8ZA 2YSZA 1V8CA 3AULA 2NTTA 3PREA 3BYYB 2FIFA 2I5FA 2OHFA 2CU3A 3RT3B 2K22A 3EFCA 3P4RB 1OQNA 3PT2B 4CHMA 4C7YA 4IWPA 2LKOA 3QARA 3V60A 2LGYA 3HM6X 2IY1B 2COAA 1FOEA 1WXVA 5C79A 1X86A 3PZDA 1KRHA 1HBKA 1TZ1A 4ZRKA 2N0YA 4HROA 2CJOA 1QLBB 3ZNID 2CS4A 2O6VA 3GB1A 4CSQA 1E0ZA 2LGXA 1ZC4B 2FJ9A 2OJRA 4A6KA 2MX2A 1V80A 3TO1A 1Z87A 3HVZA 1I4XA 1GG3A 4ZRQA 4GXBA 1P5TA 1KLVA 2JT4B 4PS3A 5EE1A 2GBMA 3V5WA 4YSXB 3ODOA 3H1UA 3KUDB 4B6HA 3L54A 3RPFC 2BF8B 3AEEB 2W2XD 3QHTA 2XNAC 2N7DA 5FR6A 1FIQA 2CHWA 4EEWA 2KTFA 5EE3A 1TJ6A 3TW1A 2KJRA 3D32A 1EU3A 2O2VA 5D2MB 5TR5A 1DOIA 5J3YA 1N63A 4MDKE 3NVYA 2Z0OA 4OVVA 1SHCA 4HAZB 5JHBA 2K8CA 2KIGA 4Z2MB 3A98B 1WXMA 1ZDVA 3KVFB 4HK2A 4C4VA 4QXAB 1JWUD 1WH3A 4WH4A 3ECIA 2RUKB 1D4BA 3OWEB 5LXIB 2E6XA 1U29A 1YQ4B 1A5RA 1TZOA 5FKAC 1YX5B 1F52A 4DHZB 1KJTA 2PZ1A 4N59A 3RD2A 2KGXB 4E71A 4JKBA 1L6VA 3ENBA 2N9PC 1YJIA 1T0YA 3TUOA 2N7JA 3AE8B 3RNBC 2DYMA 4D6WA 1ZC3B 1V2YA 2RNRB 1HB6A 1KH0A 2M0AA 2M56B 5LNK1 1FNVA 4RCOA 1OQYA 2N9LA 2DX5A 2JF5A 1QOBA 2H7EA 2H88B 2FBWB 2BTEA 1ZGUB 4NJCA 1XD3B 2Y3AA 2LGSA 1WGYA 1P0RA 3TEZA 4WWNA 2KAJA 2WXRA 3A8QA 3NY5A 4DHJD 2GS0A 2G1EA 3Q8BA 1FCCC 4YSZB 2GUMA 2ASQA 3A33B 2KDIA 5BO4B 1UELA 2QSDA 2KWDA 2SEBD 3FM8C 3UIPB 4ANXA 2KC1A 4JPSA 4DHJB 2IGGA 4B0MA 3E9LA 4JWSC 3H8HA 1HXYD 5D3YA 1Q5WB 1GPXA 2Y5CA 3GS2A 5D7GA 4JKAA 4NNJB 1IUEA 2V4IB 2ON8A 2INDC 2INCC 2LI5A 4NSWA 2J0JA 4HJGE 2WXMA 4B6WA 4A90A 1LXDA 1MIXA 4ZOHC 1AYFA 3G9WA 2WGSA 2WHIA 1NYQA 1J0GA 2IY0B 3IBEA 3MFGA 2L1CA 2BGFA 1WGDA 1JW9D 1DOXA 2HTME 1A70A 3ZXRA 2J53A 1R4NI 4DBBA 3ZLZA 3BK1A 2WXPA 4F1SA 2N9EB 1ISNA 3ODXA 1CZPA 2XN9C 1FXTB 1N3HA 1LFDA 3EC8A 1XD4A 2FE8A 4OVUA 3AECB 1C77A 1YN5A 2MHJA 3VHTC 4LNIA 1GUAB 1PQSA 1LGRA 3AI5A 3MJ5A 4XWTA 3SD5A 4D0NB 3C0RB 4WWMA 3TEWA 4UDUC 5BMGA 1YJJA 3I3TB 4PT5A 1AWDA 3L08A 4KKJA 4KKIA 2KFKB 3VFKA 3AE5B 3W1YA 2DA0A 2KZRA 3VH3B 2DYOA 2MJDA 5CTRC 2ZNVC 2NS5A 4RGOS 2LEKA 2WXNA 3Q3OC 2MBOA 1KLGD 3GYOA 2BB5A 3Q3FA 5I4DA 3B2FA 1UGJA 1FFUA 4NJ7A 5GMVA 3P7ZA 1E7VA 2V3NA 4B95A 1C79A 3DOWA 3O65B 4MSQB 3A4RA 2L2IA 4DXFA 2I1KA 1MK7B 3RZWC 1E8XA 3R7QA 1SBBB 1BWNA 2INNE 1D5ZC 1U5DA 3B1LX 5JHGA 2KD0A 5CHFA 4FJYA 4X57B 5KQ1A 1HEZE 3DBHB 4K2PA 4JKCA 4G50A 1RRPB 4W9EA 5H8YE 3B9JA 3PLUA 2XBBC 3DBLB 1FEHA 3WANA 4HCNB 3AEDB 2NBWB 4EUTA 4WIPA 2FCSA 2IO1B 3QX1A 4DHZE 4LNOA 4NQKE 3HIEA 1E90A 4W9CA 1M4VA 3EECA 4BVUC 5J2RA 4Z2NA 1T5XD 2XK5B 3O96A 1LM8B 3V6EB 1KOTA 1VRAB 1P98A 1FCLA 1KFYB 4MELA 3PZ7A
chains in the Genus database with same CATH topology
1SE9A 5JLJB 2P0FA 4GMVA 1RLFA 2JPHA 3JSVB 2Z0EB 4C0AA 4WVFB 3RCPA 2VRWB 1VD2A 2LD9A 3ZTCA 4YL8A 2WYQA 4MJSB 4LJOB 5J3QA 3PRPB 1WX8A 2LUEA 3PSEB 4KZ0A 3H6NA 1ZM0A 1GJZA 1XKEA 2YF0A 1PFJA 4CHKA 5DI9B 3RUIB 2MCNB 1DDVA 4CO7A 3TVVA 3CSFA 1FHXA 1UNPA 2LRWA 2H7DA 2LULA 1QZEA 4W9IA 5E6PA 2JVCA 3BJIA 2Y7BA 4P7IA 1OTRB 1NTYA 2GCJA 1Y8RC 4K1RB 3ZVVA 4K7WA 4LDTD 3NHEB 2X0SA 2N7EA 2BWFA 3KY9A 2D2QA 2J0KA 1Q67A 1B55A 4HB3B 4F7HA 2KWCA 5EFXA 1FGYA 4AJWA 1UBIA 4FJVB 4ASWC 2D10A 5DPTA 4EZJA 3T8MA 2IO0B 2YVCA 2R2OA 2COCA 3A9JB 2ROVA 4FULA 2OTXA 4ZRIA 1NI2A 4E74A 1QQGA 2JP2A 2L3ZA 4NAWA 4TKNA 4JL9A 2P0DA 3JW0X 3PLVA 3GYPA 1WR6E 1PLSA 3HM3A 4DK5A 2ZVNA 1X1MA 3CF6E 2KWUB 2MLBA 4FLHA 2QHOA 2JZ3B 2LVOA 2R0DA 4XX5A 4HAWB 3QQ8B 1WMHB 2JRHA 1SIFA 2KNBA 4MGYE 4HDOA 2BWES 3PGEA 3UINB 2WDTB 5L95C 3U7DA 3PP2A 1K5GB 4JQWC 2I5CA 2HRJA 3KH0A 2D9XA 2IYBA 4W9GA 3QC8B 3A9KA 3NS8A 2KFKA 5JHAA 2V1YA 3WIMA 3TBLD 3DXDA 3ZTDA 3UF8A 3DBHI 3NZUA 1E8YA 1FAOA 3U30A 2ZCCA 2B3AA 2LXAA 2LRUA 3F0WA 2K2JA 1M94A 5E6NA 3L13A 4ANUA 3KZ1A 4GIVA 2DZMA 4JKEA 5KHOA 4FADA 2L0FA 1WG7A 2M17A 2Z0PA 1XCGA 3NZSA 1H8CA 1DDMA 2Y8GA 4JK9A 2FNJB 4K7SA 4W9LA 4JKHA 4IWQA 1X1FA 2I1JA 2DAJA 4GN1A 2L0TA 4GU2A 2ADZA 4HB0B 4A5KA 2DHJA 2N1VA 1MK9B 2KOXA 3ML8A 1WY8A 2ZZPB 2J0MA 2LOZA 4TQ0A 1PMSA 4BKSA 3JSVA 2WH5A 1GC7A 4HAVB 4HWIB 2LG1A 4KHOA 4HCPB 3HW2B 2FAZA 2GOWA 4GMXB 3L0WB 4JLCA 2KJHB 1FB8A 2GBJA 2MRPA 2ZEQA 2X18A 4HPMB 2MWNB 1BTNA 3UZTA 4NPNA 3PSCA 2FUHB 2WX1A 3PVLA 2L00B 3ZRFA 2ABDA 4AJYB 1TXDA 3V6CB 3BINA 4KHAA 1JRUA 5DIFB 2OQBA 3ZIMA 3KW5B 4ANWA 4DX8A 4JKGB 1KM7A 3PHXB 5L83A 5KCVA 3QIJA 2K2UA 2KDEB 3H7PB 4GGQA 3MPXA 4ZRJA 2YS1A 3VQIA 4W9HA 3DVGY 5KQ4A 4JGHB 3PRMB 4ZYNA 2YT0A 3HQCA 2DHKA 1RJ2A 2N23A 3E9OA 1WXSA 1Q0WB 2KTRA 2MWSB 1CMXB 3CIKA 1NDDA 2M14A 1U4AA 3V62A 3P6AA 3ZO5B 3A4SC 4DDGD 3WAMA 3SO6A 5J18A 4EKUA 3VTVA 1GGOA 2NZ8B 2CB8A 3OLMD 2KO3A 3ENEA 4MM3A 4NJ6A 2GCLA 2LGDA 4RMAA 1J0WA 4II2B 3DPDA 2AL6A 1KZ7A 3ZVRA 2A5UA 3W1SA 4WQOB 2Q13A 1DDWA 1KI1B 2DYBA 2D9VA 1MG8A 3NSUA 4FJZA 3R3MA 1F9JA 4HHVA 4MK0A 1V88A 1AWEA 1V5PA 2BYEA 1RAXA 4KIKA 5DH9B 3H9DA 1KC7A 5HE2A 1I2HA 2K8BA 2KWVB 3B0AA 1ACAA 2R09A 5J17A 2K8HA 3ODWA 4W9DA 3OJ4B 2IO2B 3ZRCA 2ROZB 4TYZA 3JVZX 4ILGB 4W9JA 2W9NA 3FEHA 1WVHA 2CODA 2A4ZA 2COFA 4A6FA 2RPQA 2NVUI 2RGFA 1YX6B 2C60A 1R4MI 2AL3A 2LZ6A 2ZJDA 3SUZA 2YS3A 1OGWA 2MP2A 4EJNA 2LBBA 2D9WA 3N32A 3K9PB 3AXCA 2UZRA 4KAXB 1E5WA 3ZKJC 1TTNA 4H8SA 2UWQA 4RM8A 1H4RA 2G35A 3SV1A 1WRDB 1M7EA 3IFWB 4JKFA 3HHMA 5FI0A 2UZSA 3N3KB 2G4SA 4HLEA 4CHJA 2PJHA 4URKA 2IO3B 1EF5A 3L16A 4BKGA 2FDQA 2J7QB 3M62B 1LB1A 1K8RB 1KBLA 2LOXA 2KDBA 3APFA 3L10B 2CRFA 2NR2A 1YQBA 1WGHA 2ZNVB 5CHWA 4PQ0A 3EFUA 4NQLB 4G0NB 2D07B 2DZIA 3ML4A 2P8VA 2XQNM 2DN6A 5LONB 2N1WA 2FIDA 2MW5A 4TV3A 4BBNC 4IW0A 1WZ0A 4KHBB 3N30A 4JK7A 4RM9A 3S2AA 3V61A 3CSTA 4KSKC 4XZ4A 2Y8FA 4HAUB 2M38A 2D9ZA 3DVNV 1U27A 2DYNA 1MKEA 4HB4B 4N9F4 3UGBB 1WM2A 4AWJA 1S3SG 2DYQA 5C5BB 2E2XA 2GMIC 3RZFA 1Y19B 5CLQB 2HTHB 3FLVA 2O6VD 4JKGA 4WJ7A 4F7GA 2RSUA 4WJQA 3H7PA 2O6VB 2D9YA 3ONSA 1OMWA 3LJUX 2FCMA 4GDLB 2REXA 3AU5A 2KDFB 2NPTB 2K6DB 2KFJA 2AEHA 3SYXA 3WA0A 3TFMA 5JZEB 5D3XA 2GBRA 2RLOA 2MBHA 1V61A 4GPTB 2BKFA 5DPWA 4IG7B 2KXJA 4AOFA 3UQBA 4IC7B 1FGZA 1V86A 2GBNA 4LDTB 4YONA 2CAYA 2YRYA 2AYOB 1WX9A 4BOSC 2EJ8A 5D27A 2K6QA 2KLCA 1WXAA 3TCAA 3W1SC 1X11A 1WI0A 1UZXB 3D8EA 2C7HA 2MQJA 1WGGA 4K17A 2MBEA 1XT9B 1M7RA 3TMPB 4LJPB 5IJMA 2BKRB 4TUUA 4KZCA 2EMTA 2J59M 2WX0A 2DIKA 2RSGA 2QKMA 2M8SA 2LYDA 1WJ1A 3IVFA 2HE7A 3L17A 3DVGX 3VIAA 2KVRA 1E8ZA 2LJ5A 1U2BA 1WJMA 3K9OB 4I6PA 2AWTA 1EGXA 3WAOA 4L6EA 5D94A 4XC2A 4GZUA 4A20A 4PYUA 1UBQA 1AQCA 2KMCA 3A1QB 3ZNZB 2DZKA 1J19A 2UVMA 3M95A 3A8PA 2L7RA 4KSLC 2ZCBA 5D6JB 2N4FA 4FHKA 3R7RA 1UH6A 3VVWB 3ZW3A 4XWXA 2ZVOA 3PS6A 1U5GA 2EC1A 1EUVB 1WE7A 1I42A 3OJ3A 1V6EA 1W1GA 2JUOA 4A3OA 1BT0A 4FA6A 5E6OA 3LJ3A 2JXXA 3ALBA 4MGZE 2DHIA 4IFSA 1V81A 4PS8A 4KV2A 3KRWA 4A3PA 1E7UA 3MTNB 3T9LA 3RULA 2P0HA 4F8CB 1NBFC 3H7SA 4HATB 3EPYA 2D4QA 4BBNF 3AU4A 3R66C 4EMOA 2CQUA 1UGMA 1MAIA 2WWZA 3APDA 4B9KA 3PG7A 3M3JA 2GBKA 2XK5A 4ANVA 2DZJA 4EZLA 1FHOA 4I6LB 1WGUA 2MBBB 3X0WA 2LVPA 2IYDB 4WJPA 4ILJA 1P1AA 4J6IA 4IM0A 3ZNHB 1U5FA 1GC6A 2Z59B 3TIXA 3KYCD 3WYFB 1XQQA 5J3TA 1WJ4A 3TL5A 2DFKA 3JYUA 3DXEA 3E9PA 2DAFA 5HE3A 4MJSA 1TBEA 3Q3JA 3VUWA 2ZPNA 2GJYA 4BKTA 2CHXA 5C5BA 2XEWA 3QAQA 3QJZA 2W2XC 2HTHA 2KK8A 3VXWA 1DROA 1UNQA 2BYFA 1IP9A 5C23A 3D8FA 4G3XB 1V89A 1JDEA 1ZKHA 1P9DU 1V5TA 1NTVA 1G6JA 1WIAA 3BY4B 5G55A 3DBSA 2RVBB 3F5RA 4GDLA 3CMMB 2NPTA 1YIWA 2ELBA 1WZ3A 2L76A 4HJKA 4KDIC 1WE6A 5C6RA 1D3ZA 4A6HA 5HE0A 3PV1A 2Y5BB 2PEAA 1RFAA 4DBGA 4Y94A 1OEYJ 2KKCA 1Q1OA 4AP4C 2CY5A 4MGIE 2CY4A 2NBUA 1RRBA 1Z5SB 4HDQA 2QKLA 3QWZB 1VBHA 3ULCA 3HIZA 4DWFA 4ILHA 2RR9A 3SBTA 3A9JA 3QBVB 4LCDE 1P3RA 3VTWA 2W2WA 2YT1A 1P6SA 5IA7A 1MPHA 2VSZA 5DPRA 3PTFC 4NY0A 4K81A 2CKHB 3ULBA 5JH5C 1V9JA 3SU8X 5C1ZA 2V4LA 3P2BA 2DKQA 1LQBA 4MSMB 1X05A 3UIOB 1EVHA 1WI1A 1IYFA 2MBQA 4CYEA 2COPA 4JKDA 3IHPC 4IM2A 5AZHA 1ZW7A 1V5MA 1WJUA 1WR1A 1WMHA 1Y5OA 1GNUA 1UNRA 1ZVRA 4WWPA 1XR0B 2Z0QA 2G4DB 1I7AA 3NOBA 5HE1A 3A1QA 1AARA 4GB9A 2KC2A 4DXAB 1ZSQA 2N9XA 4NAWB 3DDCB 1WFYA 4ICVA 2MDXA 4GDKB 3UQAA 5LXHA 2C7NB 2FJLA 1UPQA 4BBKA 2DX1A 2IFSA 1BTKA 2M0XA 2KANA 5HKHA 1IRSA 2IZVB 4IUMB 1TQZA 4PNKA 1V5OA 1W1DA 2G3QB 2DKPA 5DCNA 2KQSA 1X1GA 3ZUNA 2KLGA 3PEGA 4MEMA 1WYWB 2KHWB 4FHJA 4G11A 5GOWB 3A9KB 2VKIA 2IBIB 4JK8A 2D11A 5L81A 1NTIA 2Z0DB 4EOYA 3X23A 5DPSA 1NVLA 1L2NA 1HE8A 4II3B 3MDBC 3E66A 4JIOU 1QC6A 1WX7A 5CX3A 2LWPA 1XX0A 4WJOA 5DHAB 3ZDTA 2ZPYA 4HXDA 4HAXB 2YLMA 2CR5A 2RQ1A 3PHWB 2KJ6A 2PPHA 4WAAA 2DENB 2R82A 2MA9B 1UEFA 4W9KA 4W9FA 1Z2MA 5C16A 3DCGA 2FCQA 5LOPB 4IM3A 3N7CA 4IAPA 3DXCA 5CHVC 2DLWA 5DHFB 2MFQA 4BKSD 2MKRA 2M4NA 4HPLB 4PYZA 4KVGB 2C7MB 2L8JA 3DQVA 2K39A 3LDZE 3WALA 3QK0A 4DDID 3VAWA 2L05A 3RYTA 4F7ZA 4WWOA 1UD7A 2KCJA 1EO6A 4EFOA 3FSSA 5IAAC 3HK0A 1FHWA 5EDSA 3OANA 2M1MA 3ML9A 1K5DB 1WF9A 4DX90 5KHQA 3GOEA 3ZNGC 1DYNA 1H10A 1WM3A 2JZZA 3AJ4A 3SDLC 2PE6B 2RD0A 3VOQA 1DBHA 2KX3A 2LASA 4GOCA 4E3CA 2VRRB 1V5UA 1S1QB 4WJNA 3MHSD 2O2VB 2R2QA 2KX0A 2PE9A 3QWMA 1HB8A 3DBRI 1EF1A 2D3GA 1J8CA 2NCNA 3VTUA 1E8WA 2JWZA 3M1IB 5CLLB 3KYDD 4HB2B 3GZNI 2DHZA 3SBGA 2UYZB 3IG3A 1V49A 4KDLB 2KTRB 5JP4A 2BCJA 1IPGA 3KSYA 1MIZB 4F7UP 5G2NA 2G45B 2OOBB 3D8DA 4M8MA 4WSFA 2BPSA 3PRZA 2DX5B 2KN5A 2NMBA 1SGHA 4BOZB 1P3QU 2KUPA 3APCA 1NU2A 2HJ8A 2CHZA 1I35A 1VCBA 2RGNB 1L7YA 1XODA 4MY6A 4PS7A 5LLIA 1UPRA 1ST7A 1W1HA 2V3SA 2CU1A 4GDKA 3VUXA 3EHVA 3KUZA 3KRXA 4M0WB 1EAZA 2HD5B 3PVWA 4AUQC 1YJ1A 4HAYB 3ZDMC 3QCAA 1YD8U 2KQ7A 3KUCB 3VDZA 1VBGA 2C5LC 2DTCA 1U5EA 5D3WA 1OY2A 1WGQA 2EKEC 3VUYA 1WJNA 2FCNA 4K2OA 3TJPA 4KIKB 3T06A 1LW3A 3OAWA 2K00A 4FBJB 3CXBB 4MGKE 2K25A 5JHHA 3SHQA 4TQ1A 1WGRA 2K1FA 4GSWA 3VH4B 2C9WB 4BFRA 1TGZB 4IOYX 4A6FB 4ICUA 4K7UA 3PVUA 2EMSA 5AZGA 3DBLI 3M63B 5FI1A 3RCZA 1DIKA 2BYVE 4IWOA 1BAKA 3B08A 2MP2B 4MT7A 4ZDVA 2JY6A 2ELAA 1C3TA 1C1YB 4EZKA 3MJWA 3FP5A 2MSED 2NBVB 2LXCA 3WAPA 3QA8A 4I6NB 2YS5A 3PPAA 4MH0E 4HVBA 1WJ6A 2V76A 2LVQA 1KZGA 4M8NA 2JRIB 3DVNU 3SNHA 5AEKB 1OEYA 5JVLA 5AZFA 2KMAA 4FN2A 5D3VA 3U8ZA 2YSZA 3AULA 3PREA 2FIFA 2I5FA 3RT3B 1OQNA 3PT2B 4CHMA 4IWPA 2LKOA 3QARA 3V60A 2LGYA 3HM6X 2IY1B 2COAA 1FOEA 1WXVA 5C79A 1X86A 3PZDA 1HBKA 1TZ1A 4ZRKA 2N0YA 3ZNID 2CS4A 2O6VA 2LGXA 1ZC4B 2FJ9A 2OJRA 4A6KA 2MX2A 1V80A 3TO1A 1Z87A 1GG3A 4GXBA 1P5TA 1KLVA 2JT4B 4PS3A 2GBMA 3V5WA 3ODOA 3H1UA 3KUDB 4B6HA 3L54A 2BF8B 2W2XD 3QHTA 2N7DA 5FR6A 2CHWA 4EEWA 2KTFA 1TJ6A 3TW1A 2KJRA 3D32A 2O2VA 5D2MB 5TR5A 5J3YA 4MDKE 2Z0OA 4OVVA 1SHCA 4HAZB 5JHBA 2K8CA 4Z2MB 3A98B 1WXMA 3KVFB 4HK2A 1WH3A 3ECIA 2RUKB 5LXIB 1U29A 1A5RA 1YX5B 4DHZB 1KJTA 2PZ1A 3RD2A 2KGXB 4E71A 4JKBA 2N9PC 3ENBA 1T0YA 2DYMA 1ZC3B 1V2YA 2RNRB 1HB6A 1OQYA 2DX5A 2JF5A 2H7EA 1ZGUB 1XD3B 1WGYA 1P0RA 4WWNA 3A8QA 3NY5A 4DHJD 2GS0A 2ASQA 3A33B 2KDIA 5BO4B 1UELA 3FM8C 3UIPB 4ANXA 2KC1A 4DHJB 3E9LA 5D3YA 1Q5WB 5D7GA 4JKAA 4NNJB 2LI5A 4NSWA 2J0JA 4B6WA 1LXDA 1MIXA 3G9WA 1J0GA 2IY0B 3IBEA 2L1CA 2BGFA 1WGDA 1R4NI 4DBBA 3ZLZA 4F1SA 2N9EB 1ISNA 3ODXA 1FXTB 1N3HA 1LFDA 3EC8A 1XD4A 4OVUA 3VHTC 1GUAB 1PQSA 3AI5A 3SD5A 4D0NB 3C0RB 3I3TB 3L08A 2KFKB 3VFKA 3W1YA 2DA0A 2KZRA 3VH3B 2DYOA 5CTRC 2ZNVC 2NS5A 2MBOA 3GYOA 3Q3FA 4NJ7A 5GMVA 3P7ZA 1E7VA 4B95A 3DOWA 3O65B 4MSQB 3A4RA 2L2IA 2I1KA 1MK7B 3RZWC 1E8XA 3R7QA 1BWNA 1U5DA 3B1LX 5JHGA 2KD0A 5CHFA 4FJYA 4X57B 5KQ1A 4W9EA 4K2PA 4JKCA 4G50A 1RRPB 3PLUA 2XBBC 3WANA 4HCNB 2NBWB 4EUTA 2FCSA 2IO1B 3QX1A 4DHZE 4NQKE 1E90A 4W9CA 3EECA 4BVUC 5J2RA 4Z2NA 2XK5B 3O96A 1LM8B 3V6EB 1KOTA 1P98A 4MELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  5JLJ B;  2P0F A;  4GMV A;  1RLF A;  2JPH A;  3JSV B;  2Z0E B;  4C0A A;  4WVF B;  3RCP A;  2VRW B;  1VD2 A;  2LD9 A;  3ZTC A;  4YL8 A;  2WYQ A;  4MJS B;  4LJO B;  5J3Q A;  3PRP B;  1WX8 A;  2LUE A;  3PSE B;  4KZ0 A;  3H6N A;  1ZM0 A;  1GJZ A;  1XKE A;  2YF0 A;  1PFJ A;  4CHK A;  5DI9 B;  3RUI B;  2MCN B;  1DDV A;  4CO7 A;  3TVV A;  3CSF A;  1FHX A;  1UNP A;  2LRW A;  2H7D A;  2LUL A;  1QZE A;  4W9I A;  5E6P A;  2JVC A;  3BJI A;  2Y7B A;  4P7I A;  1OTR B;  1NTY A;  2GCJ A;  1Y8R C;  4K1R B;  3ZVV A;  4K7W A;  4LDT D;  3NHE B;  2N7E A;  2BWF A;  3KY9 A;  2D2Q A;  2J0K A;  1Q67 A;  1B55 A;  4HB3 B;  4F7H A;  2KWC A;  5EFX A;  1FGY A;  4AJW A;  1UBI A;  4FJV B;  4ASW C;  2D10 A;  5DPT A;  4EZJ A;  3T8M A;  2IO0 B;  2YVC A;  2R2O A;  2COC A;  3A9J B;  2ROV A;  4FUL A;  2OTX A;  4ZRI A;  1NI2 A;  4E74 A;  1QQG A;  2JP2 A;  2L3Z A;  4NAW A;  4TKN A;  4JL9 A;  2P0D A;  3JW0 X;  3PLV A;  3GYP A;  1WR6 E;  1PLS A;  3HM3 A;  4DK5 A;  2ZVN A;  1X1M A;  3CF6 E;  2KWU B;  2MLB A;  4FLH A;  2QHO A;  2JZ3 B;  2LVO A;  2R0D A;  4XX5 A;  4HAW B;  3QQ8 B;  1WMH B;  2JRH A;  1SIF A;  2KNB A;  4MGY E;  4HDO A;  2BWE S;  3PGE A;  3UIN B;  2WDT B;  5L95 C;  3U7D A;  3PP2 A;  1K5G B;  4JQW C;  2I5C A;  2HRJ A;  3KH0 A;  2D9X A;  2IYB A;  4W9G A;  3QC8 B;  3A9K A;  3NS8 A;  2KFK A;  5JHA A;  2V1Y A;  3WIM A;  3TBL D;  3DXD A;  3ZTD A;  3UF8 A;  3DBH I;  3NZU A;  1E8Y A;  1FAO A;  3U30 A;  2ZCC A;  2B3A A;  2LXA A;  2LRU A;  3F0W A;  2K2J A;  1M94 A;  5E6N A;  3L13 A;  4ANU A;  3KZ1 A;  4GIV A;  2DZM A;  5KHO A;  4FAD A;  2L0F A;  1WG7 A;  2M17 A;  2Z0P A;  1XCG A;  3NZS A;  1H8C A;  1DDM A;  2Y8G A;  2FNJ B;  4K7S A;  4W9L A;  4IWQ A;  1X1F A;  2I1J A;  2DAJ A;  4GN1 A;  2L0T A;  4GU2 A;  2ADZ A;  4HB0 B;  4A5K A;  2DHJ A;  2N1V A;  1MK9 B;  2KOX A;  3ML8 A;  1WY8 A;  2ZZP B;  2J0M A;  2LOZ A;  4TQ0 A;  1PMS A;  4BKS A;  3JSV A;  2WH5 A;  1GC7 A;  4HAV B;  4HWI B;  2LG1 A;  4KHO A;  4HCP B;  3HW2 B;  2FAZ A;  2GOW A;  4GMX B;  3L0W B;  4JLC A;  2KJH B;  1FB8 A;  2GBJ A;  2MRP A;  2ZEQ A;  2X18 A;  4HPM B;  2MWN B;  1BTN A;  3UZT A;  4NPN A;  3PSC A;  2FUH B;  2WX1 A;  3PVL A;  2L00 B;  3ZRF A;  2ABD A;  4AJY B;  1TXD A;  3V6C B;  3BIN A;  4KHA A;  1JRU A;  5DIF B;  2OQB A;  3ZIM A;  3KW5 B;  4ANW A;  4DX8 A;  1KM7 A;  3PHX B;  5L83 A;  5KCV A;  3QIJ A;  2K2U A;  2KDE B;  3H7P B;  4GGQ A;  3MPX A;  4ZRJ A;  2YS1 A;  3VQI A;  4W9H A;  3DVG Y;  5KQ4 A;  4JGH B;  3PRM B;  4ZYN A;  2YT0 A;  3HQC A;  2DHK A;  1RJ2 A;  2N23 A;  2KTR A;  1WXS A;  1Q0W B;  2MWS B;  1CMX B;  3CIK A;  1NDD A;  2M14 A;  1U4A A;  3V62 A;  3P6A A;  3ZO5 B;  3A4S C;  4DDG D;  3WAM A;  3SO6 A;  5J18 A;  4EKU A;  3VTV A;  2NZ8 B;  2CB8 A;  3OLM D;  2KO3 A;  3ENE A;  4MM3 A;  4NJ6 A;  2GCL A;  2LGD A;  4RMA A;  1J0W A;  4II2 B;  3DPD A;  2AL6 A;  1KZ7 A;  3ZVR A;  2A5U A;  3W1S A;  4WQO B;  2Q13 A;  1DDW A;  1KI1 B;  2DYB A;  2D9V A;  1MG8 A;  3NSU A;  4FJZ A;  3R3M A;  1F9J A;  4HHV A;  4MK0 A;  1V88 A;  1AWE A;  1V5P A;  2BYE A;  1RAX A;  4KIK A;  5DH9 B;  3H9D A;  5HE2 A;  1I2H A;  2K8B A;  2KWV B;  3B0A A;  1ACA A;  2R09 A;  5J17 A;  2K8H A;  3ODW A;  4W9D A;  3OJ4 B;  2IO2 B;  3ZRC A;  2ROZ B;  4TYZ A;  3JVZ X;  4W9J A;  2W9N A;  3FEH A;  1WVH A;  2COD A;  2A4Z A;  2COF A;  4A6F A;  2RPQ A;  2NVU I;  2RGF A;  1YX6 B;  2C60 A;  1R4M I;  2AL3 A;  2LZ6 A;  2ZJD A;  3SUZ A;  2YS3 A;  1OGW A;  2MP2 A;  4EJN A;  2LBB A;  2D9W A;  3N32 A;  3K9P B;  3AXC A;  2UZR A;  4KAX B;  1E5W A;  3ZKJ C;  1TTN A;  4H8S A;  2UWQ A;  4RM8 A;  1H4R A;  2G35 A;  3SV1 A;  1WRD B;  1M7E A;  3IFW B;  3HHM A;  5FI0 A;  2UZS A;  3N3K B;  2G4S A;  4HLE A;  4CHJ A;  2PJH A;  4URK A;  2IO3 B;  1EF5 A;  3L16 A;  4BKG A;  2FDQ A;  2J7Q B;  3M62 B;  1LB1 A;  1K8R B;  2LOX A;  2KDB A;  3APF A;  3L10 B;  2CRF A;  2NR2 A;  1YQB A;  1WGH A;  2ZNV B;  5CHW A;  4PQ0 A;  3EFU A;  4NQL B;  4G0N B;  2D07 B;  2DZI A;  3ML4 A;  2P8V A;  2XQN M;  2DN6 A;  5LON B;  2N1W A;  2FID A;  2MW5 A;  4TV3 A;  4BBN C;  4IW0 A;  1WZ0 A;  4KHB B;  3N30 A;  4RM9 A;  3S2A A;  3V61 A;  3CST A;  4KSK C;  4XZ4 A;  2Y8F A;  4HAU B;  2M38 A;  2D9Z A;  3DVN V;  1U27 A;  2DYN A;  1MKE A;  4HB4 B;  4N9F 4;  3UGB B;  1WM2 A;  4AWJ A;  1S3S G;  2DYQ A;  5C5B B;  2E2X A;  2GMI C;  3RZF A;  1Y19 B;  5CLQ B;  2HTH B;  3FLV A;  2O6V D;  4WJ7 A;  4F7G A;  2RSU A;  4WJQ A;  3H7P A;  2O6V B;  2D9Y A;  3ONS A;  1OMW A;  3LJU X;  2FCM A;  4GDL B;  2REX A;  3AU5 A;  2KDF B;  2NPT B;  2K6D B;  2KFJ A;  2AEH A;  3SYX A;  3WA0 A;  3TFM A;  5JZE B;  5D3X A;  2GBR A;  2RLO A;  2MBH A;  1V61 A;  4GPT B;  2BKF A;  5DPW A;  4IG7 B;  2KXJ A;  4AOF A;  3UQB A;  4IC7 B;  1FGZ A;  1V86 A;  2GBN A;  4LDT B;  4YON A;  2CAY A;  2YRY A;  2AYO B;  1WX9 A;  4BOS C;  2EJ8 A;  5D27 A;  2K6Q A;  2KLC A;  1WXA A;  3TCA A;  3W1S C;  1X11 A;  1WI0 A;  1UZX B;  3D8E A;  2C7H A;  2MQJ A;  1WGG A;  4K17 A;  2MBE A;  1XT9 B;  1M7R A;  3TMP B;  4LJP B;  5IJM A;  2BKR B;  4TUU A;  4KZC A;  2EMT A;  2J59 M;  2WX0 A;  2RSG A;  2QKM A;  2M8S A;  2LYD A;  1WJ1 A;  3IVF A;  2HE7 A;  3L17 A;  3DVG X;  3VIA A;  2KVR A;  1E8Z A;  2LJ5 A;  1U2B A;  1WJM A;  3K9O B;  4I6P A;  2AWT A;  1EGX A;  3WAO A;  4L6E A;  5D94 A;  4XC2 A;  4GZU A;  4A20 A;  4PYU A;  1UBQ A;  1AQC A;  2KMC A;  3A1Q B;  3ZNZ B;  2DZK A;  2UVM A;  1J19 A;  3M95 A;  3A8P A;  2L7R A;  4KSL C;  2ZCB A;  5D6J B;  2N4F A;  4FHK A;  3R7R A;  1UH6 A;  3VVW B;  3ZW3 A;  4XWX A;  2ZVO A;  3PS6 A;  1U5G A;  2EC1 A;  1EUV B;  1WE7 A;  1I42 A;  3OJ3 A;  1V6E A;  1W1G A;  2JUO A;  4A3O A;  1BT0 A;  4FA6 A;  5E6O A;  3LJ3 A;  2JXX A;  3ALB A;  4MGZ E;  2DHI A;  4IFS A;  1V81 A;  4PS8 A;  4KV2 A;  3KRW A;  4A3P A;  1E7U A;  3MTN B;  3T9L A;  3RUL A;  2P0H A;  4F8C B;  1NBF C;  3H7S A;  4HAT B;  3EPY A;  2D4Q A;  4BBN F;  3AU4 A;  3R66 C;  4EMO A;  2CQU A;  1UGM A;  1MAI A;  2WWZ A;  3APD A;  4B9K A;  3PG7 A;  3M3J A;  2GBK A;  2XK5 A;  4ANV A;  2DZJ A;  4EZL A;  1FHO A;  4I6L B;  1WGU A;  2MBB B;  3X0W A;  2LVP A;  2IYD B;  4WJP A;  1P1A A;  4J6I A;  4IM0 A;  3ZNH B;  1U5F A;  1GC6 A;  2Z59 B;  3TIX A;  3KYC D;  3WYF B;  1XQQ A;  5J3T A;  1WJ4 A;  3TL5 A;  2DFK A;  3JYU A;  3DXE A;  2DAF A;  5HE3 A;  4MJS A;  1TBE A;  3Q3J A;  3VUW A;  2ZPN A;  2GJY A;  4BKT A;  2CHX A;  5C5B A;  2XEW A;  3QAQ A;  3QJZ A;  2W2X C;  2HTH A;  2KK8 A;  3VXW A;  1DRO A;  1UNQ A;  2BYF A;  1IP9 A;  5C23 A;  3D8F A;  4G3X B;  1V89 A;  1ZKH A;  1P9D U;  1V5T A;  1NTV A;  1G6J A;  1WIA A;  3BY4 B;  5G55 A;  3DBS A;  2RVB B;  3F5R A;  4GDL A;  3CMM B;  2NPT A;  1YIW A;  2ELB A;  1WZ3 A;  2L76 A;  4HJK A;  4KDI C;  1WE6 A;  5C6R A;  1D3Z A;  4A6H A;  5HE0 A;  3PV1 A;  2Y5B B;  2PEA A;  1RFA A;  4DBG A;  4Y94 A;  1OEY J;  2KKC A;  1Q1O A;  4AP4 C;  2CY5 A;  4MGI E;  2CY4 A;  2NBU A;  1RRB A;  1Z5S B;  4HDQ A;  2QKL A;  3QWZ B;  3ULC A;  3HIZ A;  4DWF A;  2RR9 A;  3A9J A;  3QBV B;  4LCD E;  1P3R A;  3VTW A;  2W2W A;  2YT1 A;  1P6S A;  5IA7 A;  1MPH A;  2VSZ A;  5DPR A;  3PTF C;  4NY0 A;  4K81 A;  2CKH B;  3ULB A;  5JH5 C;  1V9J A;  3SU8 X;  5C1Z A;  2V4L A;  3P2B A;  2DKQ A;  1LQB A;  4MSM B;  1X05 A;  3UIO B;  1EVH A;  1WI1 A;  1IYF A;  2MBQ A;  4CYE A;  2COP A;  3IHP C;  4IM2 A;  5AZH A;  1ZW7 A;  1V5M A;  1WJU A;  1WR1 A;  1WMH A;  1Y5O A;  1GNU A;  1UNR A;  1ZVR A;  4WWP A;  1XR0 B;  2Z0Q A;  2G4D B;  1I7A A;  3NOB A;  5HE1 A;  3A1Q A;  1AAR A;  4GB9 A;  2KC2 A;  4DXA B;  1ZSQ A;  2N9X A;  4NAW B;  3DDC B;  1WFY A;  4ICV A;  2MDX A;  4GDK B;  3UQA A;  5LXH A;  2C7N B;  2FJL A;  1UPQ A;  4BBK A;  2DX1 A;  2IFS A;  1BTK A;  2M0X A;  2KAN A;  5HKH A;  1IRS A;  2IZV B;  4IUM B;  1TQZ A;  4PNK A;  1V5O A;  1W1D A;  2G3Q B;  2DKP A;  5DCN A;  2KQS A;  1X1G A;  3ZUN A;  2KLG A;  3PEG A;  4MEM A;  1WYW B;  2KHW B;  4FHJ A;  4G11 A;  5GOW B;  3A9K B;  2VKI A;  2IBI B;  2D11 A;  5L81 A;  1NTI A;  2Z0D B;  4EOY A;  3X23 A;  5DPS A;  1NVL A;  1L2N A;  1HE8 A;  4II3 B;  3MDB C;  4JIO U;  1QC6 A;  1WX7 A;  5CX3 A;  2LWP A;  1XX0 A;  4WJO A;  5DHA B;  3ZDT A;  2ZPY A;  4HXD A;  4HAX B;  2YLM A;  2CR5 A;  2RQ1 A;  3PHW B;  2KJ6 A;  2PPH A;  4WAA A;  2DEN B;  2MA9 B;  1UEF A;  4W9K A;  4W9F A;  1Z2M A;  5C16 A;  3DCG A;  2FCQ A;  5LOP B;  4IM3 A;  3N7C A;  4IAP A;  3DXC A;  5CHV C;  2DLW A;  5DHF B;  2MFQ A;  4BKS D;  2MKR A;  2M4N A;  4HPL B;  4PYZ A;  4KVG B;  2C7M B;  2L8J A;  3DQV A;  2K39 A;  3LDZ E;  3WAL A;  3QK0 A;  4DDI D;  3VAW A;  2L05 A;  3RYT A;  4F7Z A;  4WWO A;  1UD7 A;  2KCJ A;  1EO6 A;  4EFO A;  3FSS A;  5IAA C;  3HK0 A;  1FHW A;  5EDS A;  3OAN A;  2M1M A;  3ML9 A;  1K5D B;  1WF9 A;  4DX9 0;  5KHQ A;  3GOE A;  3ZNG C;  1DYN A;  1H10 A;  1WM3 A;  2JZZ A;  3AJ4 A;  3SDL C;  2PE6 B;  2RD0 A;  3VOQ A;  1DBH A;  2KX3 A;  2LAS A;  4GOC A;  4E3C A;  2VRR B;  1V5U A;  1S1Q B;  4WJN A;  3MHS D;  2O2V B;  2R2Q A;  2KX0 A;  2PE9 A;  3QWM A;  1HB8 A;  3DBR I;  1EF1 A;  2D3G A;  1J8C A;  2NCN A;  3VTU A;  1E8W A;  2JWZ A;  3M1I B;  5CLL B;  3KYD D;  4HB2 B;  3GZN I;  2DHZ A;  2UYZ B;  3IG3 A;  1V49 A;  4KDL B;  2KTR B;  5JP4 A;  2BCJ A;  1IPG A;  3KSY A;  1MIZ B;  4F7U P;  5G2N A;  2G45 B;  2OOB B;  3D8D A;  4M8M A;  4WSF A;  2BPS A;  3PRZ A;  2DX5 B;  2KN5 A;  2NMB A;  1SGH A;  4BOZ B;  1P3Q U;  2KUP A;  3APC A;  1NU2 A;  2HJ8 A;  2CHZ A;  1I35 A;  1VCB A;  2RGN B;  1L7Y A;  1XOD A;  4MY6 A;  4PS7 A;  5LLI A;  1UPR A;  1ST7 A;  1W1H A;  2V3S A;  2CU1 A;  4GDK A;  3VUX A;  3EHV A;  3KUZ A;  3KRX A;  4M0W B;  1EAZ A;  2HD5 B;  3PVW A;  4AUQ C;  1YJ1 A;  4HAY B;  3ZDM C;  3QCA A;  1YD8 U;  2KQ7 A;  3KUC B;  3VDZ A;  2C5L C;  2DTC A;  1U5E A;  5D3W A;  1OY2 A;  1WGQ A;  2EKE C;  3VUY A;  1WJN A;  2FCN A;  4K2O A;  3TJP A;  4KIK B;  3T06 A;  1LW3 A;  3OAW A;  2K00 A;  4FBJ B;  3CXB B;  4MGK E;  2K25 A;  5JHH A;  3SHQ A;  4TQ1 A;  1WGR A;  2K1F A;  4GSW A;  3VH4 B;  2C9W B;  4BFR A;  1TGZ B;  4IOY X;  4A6F B;  4ICU A;  4K7U A;  3PVU A;  2EMS A;  5AZG A;  3DBL I;  3M63 B;  5FI1 A;  3RCZ A;  2BYV E;  4IWO A;  1BAK A;  3B08 A;  2MP2 B;  4MT7 A;  4ZDV A;  2JY6 A;  2ELA A;  1C3T A;  1C1Y B;  4EZK A;  3MJW A;  3FP5 A;  2MSE D;  2NBV B;  2LXC A;  3WAP A;  3QA8 A;  4I6N B;  2YS5 A;  3PPA A;  4MH0 E;  4HVB A;  1WJ6 A;  2V76 A;  2LVQ A;  1KZG A;  4M8N A;  2JRI B;  3DVN U;  3SNH A;  5AEK B;  1OEY A;  5AZF A;  2KMA A;  4FN2 A;  5D3V A;  3U8Z A;  2YSZ A;  3AUL A;  3PRE A;  2FIF A;  2I5F A;  3RT3 B;  1OQN A;  3PT2 B;  4CHM A;  4IWP A;  2LKO A;  3QAR A;  3V60 A;  2LGY A;  3HM6 X;  2IY1 B;  2COA A;  1FOE A;  1WXV A;  5C79 A;  1X86 A;  3PZD A;  1HBK A;  1TZ1 A;  4ZRK A;  2N0Y A;  3ZNI D;  2CS4 A;  2O6V A;  2LGX A;  1ZC4 B;  2FJ9 A;  2OJR A;  4A6K A;  2MX2 A;  1V80 A;  3TO1 A;  1Z87 A;  1GG3 A;  4GXB A;  1P5T A;  1KLV A;  2JT4 B;  4PS3 A;  2GBM A;  3V5W A;  3ODO A;  3H1U A;  3KUD B;  4B6H A;  3L54 A;  2BF8 B;  2W2X D;  3QHT A;  2N7D A;  5FR6 A;  2CHW A;  4EEW A;  2KTF A;  1TJ6 A;  3TW1 A;  2KJR A;  3D32 A;  2O2V A;  5D2M B;  5TR5 A;  5J3Y A;  4MDK E;  2Z0O A;  4OVV A;  1SHC A;  4HAZ B;  5JHB A;  2K8C A;  4Z2M B;  3A98 B;  1WXM A;  3KVF B;  4HK2 A;  1WH3 A;  3ECI A;  2RUK B;  5LXI B;  1U29 A;  1A5R A;  1YX5 B;  4DHZ B;  1KJT A;  2PZ1 A;  3RD2 A;  2KGX B;  4E71 A;  2N9P C;  1T0Y A;  2DYM A;  1ZC3 B;  1V2Y A;  2RNR B;  1HB6 A;  1OQY A;  2DX5 A;  2JF5 A;  2H7E A;  1ZGU B;  1XD3 B;  1WGY A;  1P0R A;  4WWN A;  3A8Q A;  3NY5 A;  4DHJ D;  2GS0 A;  2ASQ A;  3A33 B;  2KDI A;  5BO4 B;  1UEL A;  3FM8 C;  3UIP B;  4ANX A;  2KC1 A;  4DHJ B;  5D3Y A;  1Q5W B;  5D7G A;  4NNJ B;  2LI5 A;  4NSW A;  2J0J A;  4B6W A;  1LXD A;  1MIX A;  3G9W A;  1J0G A;  2IY0 B;  3IBE A;  2L1C A;  2BGF A;  1WGD A;  1R4N I;  4DBB A;  3ZLZ A;  4F1S A;  2N9E B;  1ISN A;  3ODX A;  1FXT B;  1N3H A;  1LFD A;  3EC8 A;  1XD4 A;  4OVU A;  3VHT C;  1GUA B;  1PQS A;  3AI5 A;  3SD5 A;  4D0N B;  3C0R B;  3I3T B;  3L08 A;  2KFK B;  3VFK A;  3W1Y A;  2DA0 A;  2KZR A;  3VH3 B;  2DYO A;  5CTR C;  2ZNV C;  2NS5 A;  2MBO A;  3GYO A;  3Q3F A;  4NJ7 A;  5GMV A;  3P7Z A;  1E7V A;  4B95 A;  3DOW A;  3O65 B;  4MSQ B;  3A4R A;  2L2I A;  2I1K A;  1MK7 B;  3RZW C;  1E8X A;  3R7Q A;  1BWN A;  1U5D A;  3B1L X;  5JHG A;  2KD0 A;  5CHF A;  4FJY A;  4X57 B;  5KQ1 A;  4W9E A;  4K2P A;  4G50 A;  1RRP B;  3PLU A;  2XBB C;  3WAN A;  4HCN B;  2NBW B;  4EUT A;  2FCS A;  2IO1 B;  3QX1 A;  4DHZ E;  4NQK E;  1E90 A;  4W9C A;  3EEC A;  4BVU C;  5J2R A;  4Z2N A;  2XK5 B;  3O96 A;  1LM8 B;  3V6E B;  1KOT A;  1P98 A;  4MEL A; 
#chains in the Genus database with same CATH topology
 1SE9 A;  5JLJ B;  2WLB A;  2P0F A;  4GMV A;  5I2S A;  3PZ8 A;  1RLF A;  4PK1 A;  2JPH A;  1JWA D;  4JX1 C;  4ZYS A;  3JSV B;  2Z0E B;  2X8X X;  2BS2 B;  4C0A A;  1JCK B;  4WVF B;  3RCP A;  2VRW B;  1VD2 A;  2LD9 A;  3ZTC A;  4YL8 A;  3E9S A;  2WYQ A;  3AN1 A;  3AE7 B;  4MJS B;  4LJO B;  5J3Q A;  3AEA B;  2KMM A;  3PRP B;  1WX8 A;  2LUE A;  3PSE B;  4KZ0 A;  3OHM B;  3H6N A;  1ZM0 A;  1FNW A;  1GJZ A;  1XKE A;  1MG4 A;  1VZ6 A;  2YF0 A;  5EE9 A;  1JRP A;  1PFJ A;  4CHK A;  5DI9 B;  4P6V F;  3CIR B;  3RUI B;  2MCN B;  1SF0 A;  1DDV A;  4CO7 A;  3TVV A;  1CQV A;  3AE1 B;  1JAL A;  3CSF A;  3TEX A;  1FHX A;  1UNP A;  2LRW A;  2H7D A;  3KWV A;  4DIX A;  2LUL A;  1HA5 A;  1QZE A;  4W9I A;  4US9 A;  1VLB A;  5E6P A;  2JVC A;  2DWQ A;  4YTP B;  1JWM D;  3BJI A;  2Y7B A;  4M00 A;  2E3T A;  4QAY A;  4P7I A;  1OTR B;  1NTY A;  2GCJ A;  1Y8R C;  4K1R B;  3ZVV A;  2ZW0 A;  3BVM A;  4K7W A;  4LDT D;  3NHE B;  2K9X A;  2X0S A;  2N7E A;  2BWF A;  3KY9 A;  2D2Q A;  2J0K A;  3AMZ A;  1Q67 A;  1B55 A;  4XDC A;  4HB3 B;  2V9H A;  3BZD B;  4F7H A;  2KWC A;  3BII D;  5EFX A;  1FGY A;  4AJW A;  1IBX B;  1UBI A;  4FJV B;  4ASW C;  2D10 A;  2WDV B;  5DPT A;  4EZJ A;  1C9F A;  3ABV B;  3T8M A;  2I2Y A;  2IO0 B;  2YVC A;  4EE2 A;  3SFE B;  3ZXV A;  5C2T B;  2R2O A;  2COC A;  1PDX A;  3A9J B;  2ROV A;  4FUL A;  4RF0 A;  1V1O A;  2J52 A;  3AEG B;  3N1X C;  4LNF A;  2OTX A;  4ZRI A;  1NI2 A;  4E74 A;  3AEF B;  1QQG A;  3P4Q B;  2JP2 A;  1IGD A;  2L3Z A;  3VR8 B;  1FNU A;  4NAW A;  4TKN A;  1N62 A;  4JL9 A;  2P0D A;  1L4D B;  3JW0 X;  4RNA A;  3C19 A;  3PLV A;  1QOA A;  3GYP A;  1WR6 E;  4R3D A;  1PLS A;  3HRD D;  3HM3 A;  4DK5 A;  2ZVN A;  1QT9 A;  1X1M A;  2KT7 A;  3CF6 E;  2KDM A;  4H2A A;  3URY A;  3Q2A C;  2KWU B;  2MLB A;  2BB6 A;  4FLH A;  2QHO A;  2JZ3 B;  2LVO A;  2R0D A;  2WU2 B;  1TY0 A;  4XX5 A;  4HAW B;  3QQ8 B;  1WMH B;  2JRH A;  1SIF A;  2IJ0 A;  2KNB A;  4MGY E;  1YN3 A;  4HDO A;  2BWE S;  4AS1 A;  4QJ5 B;  1FPY A;  3PGE A;  3UIN B;  2WDT B;  5L95 C;  3DHG C;  1ET6 A;  3W5V B;  1UUP A;  3U7D A;  3PP2 A;  1K5G B;  4JQW C;  1MJD A;  2I5C A;  2Z13 A;  3Q8F A;  1BUI C;  1MFW A;  3RNC C;  2HRJ A;  3KH0 A;  1L4Z B;  2D9X A;  2IYB A;  1ZUD 2;  4W9G A;  1E9M A;  3QC8 B;  3A9K A;  3NS8 A;  2KFK A;  5JHA A;  2V1Y A;  1XF5 L;  3WIM A;  4QJ4 B;  3TBL D;  3DXD A;  3ZTD A;  4MT5 A;  3UF8 A;  3WCQ A;  3DHH C;  3DBH I;  3NZU A;  1E8Y A;  1FAO A;  3N1Z C;  3U30 A;  2ZCC A;  2KAC A;  4DXG A;  2B3A A;  3ETR A;  2LXA A;  2LRU A;  3DCX A;  3F0W A;  2K2J A;  1M94 A;  2YEP B;  2HJ1 A;  5E6N A;  3FKY A;  3L13 A;  4M01 A;  1NEN B;  1FMA D;  3KQ4 A;  4ANU A;  3ZGZ A;  3KZ1 A;  4GIV A;  2DZM A;  4JKE A;  5KHO A;  4FAD A;  2L0F A;  1WG7 A;  1NVI D;  2M17 A;  2Z0P A;  1XCG A;  3NZS A;  2WXK A;  1H8C A;  1DDM A;  2Y8G A;  4JK9 A;  2FNJ B;  3AH7 A;  2VH2 A;  1YN4 A;  4K7S A;  4W9L A;  1L0X B;  4JKH A;  4IWQ A;  2D3B A;  1R4M B;  2WU5 B;  1X1F A;  2QIE B;  2I1J A;  2DAJ A;  5E6J A;  4GN1 A;  2L0T A;  4GU2 A;  4K3C A;  2L83 A;  1WGK A;  1E7P B;  2OED A;  3AEB B;  5HFY A;  1P7F A;  2ADZ A;  4HB0 B;  4A5K A;  2DHJ A;  2N1V A;  1V1P B;  2JYT A;  1MK9 B;  4XDD A;  2KOX A;  3ML8 A;  2WXL A;  4P1B C;  1WY8 A;  1SJH D;  2ZZP B;  3FIL B;  3HSA A;  4K3B A;  1UWX A;  1ZPS A;  1I4R A;  2J0M A;  2LOZ A;  3V05 A;  1AW7 A;  4TQ0 A;  1PMS A;  4BKS A;  5FR3 A;  3JSV A;  2WH5 A;  1GC7 A;  4HAV B;  4HWI B;  2LG1 A;  4KHO A;  4HCP B;  3HW2 B;  2FAZ A;  2GOW A;  4GMX B;  4RFB A;  3L0W B;  4JLC A;  2KJH B;  2BW2 A;  1FB8 A;  2GBJ A;  3Q14 C;  2MRP A;  2ZEQ A;  2X18 A;  4HPM B;  2MWN B;  3ZQ4 A;  1BTN A;  5BYR A;  3W5U B;  1PGA A;  3UZT A;  1SEB D;  4NPN A;  3PSC A;  2FUH B;  2WX1 A;  2KN4 A;  2FUG 1;  3PVL A;  2L00 B;  1XO3 A;  3ZRF A;  2ABD A;  2WDR B;  3P4P B;  4AJY B;  1TXD A;  3V6C B;  1CK1 A;  3BIN A;  4KHA A;  3NWF A;  1JRU A;  2KUQ A;  5DIF B;  2OQB A;  2D3A A;  3ZIM A;  1TS4 A;  3KW5 B;  3KLS X;  4ANW A;  3TEY A;  4XWW A;  4DX8 A;  1BML C;  4JKG B;  1KM7 A;  3PHX B;  5L83 A;  5KCV A;  3QIJ A;  2K2U A;  2KDE B;  3H7P B;  4GGQ A;  1JWS D;  4P1C C;  2PMV A;  4ARC A;  3MPX A;  3P1M A;  4ZRJ A;  2YS1 A;  3VQI A;  4W9H A;  2YT2 A;  3DVG Y;  5KQ4 A;  4JGH B;  3PRM B;  3AE4 B;  4ZYN A;  2YT0 A;  3HQC A;  2DHK A;  4XE0 A;  1RJ2 A;  2N23 A;  3E9O A;  1WXS A;  1Q0W B;  2KTR A;  2MWS B;  1CMX B;  3CIK A;  1NDD A;  2M14 A;  1IBX A;  1FD6 A;  1U4A A;  3EA6 A;  3V62 A;  1Q10 A;  3P6A A;  3ZO5 B;  3A4S C;  3OG5 A;  4DDG D;  3WAM A;  3SO6 A;  3TSS A;  5J18 A;  1STE A;  4EKU A;  4LNN A;  3VTV A;  1GGO A;  2J4X A;  2NZ8 B;  1QKZ A;  2CB8 A;  3OLM D;  2KO3 A;  1OFF A;  1SSN A;  3ENE A;  3NS1 A;  4MM3 A;  2AX5 A;  3CWI A;  4NJ6 A;  3U7Z A;  3J9C A;  2GCL A;  2LGD A;  4RMA A;  4YT0 B;  2JWU A;  1J0W A;  3HVD A;  4II2 B;  3DPD A;  2AL6 A;  1KZ7 A;  4JE3 B;  3ZVR A;  2G9H D;  1MI1 A;  2A5U A;  1J7A A;  3W1S A;  1JML A;  1NYR A;  3MC8 A;  4M0W A;  4WQO B;  1ZE3 D;  3LB8 C;  4REZ A;  2Q13 A;  1DDW A;  1KI1 B;  2DYB A;  2D9V A;  1MG8 A;  3NSU A;  2JXT A;  3R3M A;  4FJZ A;  2QDF A;  1F9J A;  3W9C B;  3AM9 A;  5HG2 A;  3U2S C;  1C4A A;  4HHV A;  4MK0 A;  1V88 A;  1AWE A;  1V5P A;  2BYE A;  2QCZ A;  3I57 A;  1P7E A;  2PVG C;  1RAX A;  4HPP A;  4KIK A;  5DH9 B;  1HZ5 A;  3H9D A;  1KC7 A;  5HE2 A;  1I2H A;  2K8B A;  2KWV B;  3B77 A;  3B0A A;  4ACF A;  4B0E A;  1ACA A;  3IAM 1;  3VRA B;  4A9A A;  2N0S B;  2R09 A;  5J17 A;  2K8H A;  3ODW A;  4W9D A;  3OJ4 B;  4ITK A;  2IO2 B;  1UWM A;  4RF1 A;  5AUK A;  2ROZ B;  3ZRC A;  4TYZ A;  2BYT A;  4HEA 1;  3JVZ X;  1FM0 D;  4ZRP A;  4ILG B;  4W9J A;  2W9N A;  3FEH A;  1WVH A;  2COD A;  3T3N A;  2A4Z A;  2COF A;  4A6F A;  2RPQ A;  2NVU I;  2RGF A;  1YX6 B;  2C60 A;  1R4M I;  1EWY C;  2AL3 A;  2OJW A;  2LZ6 A;  2ZJD A;  3SUZ A;  2YS3 A;  1XXG A;  2RPV A;  1OGW A;  1J7B A;  2MP2 A;  4EJN A;  2LBB A;  2D9W A;  3AE2 B;  3FAH A;  3K9P B;  3N32 A;  3AXC A;  2UZR A;  4KAX B;  1E5W A;  1T0S C;  1TTN A;  2NBV A;  3ZKJ C;  4H8S A;  1TT5 B;  3ZJU A;  2UWQ A;  2WXI A;  4HKZ E;  1XLP A;  4RM8 A;  5LG4 B;  1TKG A;  1L0V B;  1WRI A;  1H4R A;  1J7C A;  2G35 A;  3SV1 A;  1WRD B;  4QJ3 B;  1M7E A;  3IFW B;  4JKF A;  3U12 A;  3HHM A;  3SEB A;  5FI0 A;  2UZS A;  3N3K B;  2G4S A;  2INP E;  4HLE A;  2MH7 A;  4CHJ A;  1I7H A;  2PJH A;  2D5G A;  4KGR A;  1YQ3 B;  3I5J C;  4URK A;  2IO3 B;  1EF5 A;  3L16 A;  4BKG A;  2FDQ A;  2J7Q B;  2QEJ C;  4YXD B;  3M62 B;  1LB1 A;  1K8R B;  1TKE A;  1KBL A;  2PTL A;  2LOX A;  2KDB A;  2KQ4 X;  3APF A;  3L10 B;  1KTK A;  2CRF A;  2NR2 A;  1YQB A;  1WGH A;  3V3X A;  2ZNV B;  3Q8C A;  5CHW A;  4PQ0 A;  3Q8E A;  4A55 A;  1MVK A;  3EFU A;  2IPK D;  4NQL B;  2JX5 A;  4G0N B;  2D07 B;  2DZI A;  3ML4 A;  3RMK C;  2P8V A;  1E6E B;  2XQN M;  1I4H A;  4C00 A;  2DN6 A;  5LON B;  1GOZ A;  1RWS A;  1TJE A;  4NZL B;  2N1W A;  4RGM A;  2FID A;  1D5M C;  2MW5 A;  4TV3 A;  1IGC A;  4IW0 A;  4BBN C;  1WZ0 A;  4KHB B;  3N30 A;  4L1B A;  4JK7 A;  4RM9 A;  1MHH E;  1Y56 A;  3S2A A;  3V61 A;  3CST A;  1VR9 A;  1F2R I;  2N9K A;  2B76 B;  3DWM A;  4KSK C;  4XZ4 A;  2Y8F A;  2L52 A;  4HAU B;  2M38 A;  1C4P A;  2QC8 A;  2D9Z A;  3DVN V;  1U27 A;  2DYN A;  1MKE A;  4HB4 B;  1RFK A;  4N9F 4;  3UGB B;  1WM2 A;  4AWJ A;  1S3S G;  2KR0 A;  2DYQ A;  5C5B B;  2E2X A;  2GMI C;  2V3P A;  2BBC A;  3RZF A;  1Y19 B;  5CLQ B;  2HTH B;  3FLV A;  2O6V D;  4JKG A;  4WJ7 A;  1F0Z A;  1GB1 A;  4F7G A;  4OSN A;  2RSU A;  5T8I A;  4WJQ A;  3H7P A;  1TYG B;  2O6V B;  4LLG M;  3R2I A;  2D9Y A;  1ESF A;  1ZP0 B;  2JSV X;  2Z8L A;  2LGI A;  3ONS A;  1TS3 A;  3AE3 B;  1OMW A;  2PIA A;  3LJU X;  4OW0 A;  3SR6 A;  2FCM A;  4GDL B;  1B9R A;  2REX A;  3AU5 A;  2KDF B;  2NPT B;  4US8 A;  1F1H A;  2K6D B;  2KFJ A;  2AEH A;  3SYX A;  3B2G A;  2GI9 A;  3WA0 A;  3TFM A;  5JZE B;  5D3X A;  4WUR A;  2GBR A;  1WXQ A;  1QOG A;  2RLO A;  2MBH A;  1V61 A;  4GPT B;  2BKF A;  5DPW A;  4GLS C;  1PFD A;  2BT6 A;  1VZ8 A;  4IG7 B;  2KXJ A;  2W3S A;  5D3I B;  4AOF A;  1HZ6 A;  3UQB A;  4IC7 B;  1FGZ A;  1V86 A;  2GBN A;  4LDT B;  4YON A;  5I2M A;  4OZB A;  2CAY A;  2YRY A;  2RDH A;  3T3O A;  1JQ4 A;  3NW8 A;  2AYO B;  1ACC A;  1WX9 A;  4BOS C;  4Q2J A;  2EJ8 A;  5BMI A;  5D27 A;  2K6Q A;  2KLC A;  1GB4 A;  1WXA A;  2J42 A;  3TCA A;  3W1S C;  1X11 A;  1WI0 A;  1UZX B;  3D8E A;  2KYW A;  3P42 A;  2QJL A;  2C7H A;  2MQJ A;  2EKI A;  2X38 A;  1WGG A;  4K17 A;  2IGD A;  2MBE A;  1XT9 B;  4KGS A;  2MJE A;  1I4P A;  1M7R A;  1AN8 A;  3TMP B;  4KGT A;  4LJP B;  5IJM A;  1PGX A;  2BKR B;  4TUU A;  4KZC A;  3Q3M C;  2EMT A;  2J59 M;  2WX0 A;  2DIK A;  2RSG A;  2QKM A;  2M8S A;  2LYD A;  3U4E G;  1YNT E;  1WJ1 A;  2H89 B;  3IVF A;  2HE7 A;  3L17 A;  3DVG X;  3EUB 2;  3VIA A;  2KVR A;  1E8Z A;  2LJ5 A;  1U2B A;  3RI7 C;  1WJM A;  3K9O B;  4I6P A;  2AWT A;  1EGX A;  3WAO A;  1T77 A;  4L6E A;  3I63 C;  5D94 A;  4XC2 A;  4GZU A;  4A20 A;  4PYU A;  1TS5 A;  2JZP A;  1UBQ A;  5G5G A;  3NVZ A;  1AQC A;  2KMC A;  3A1Q B;  3ZNZ B;  2WQY B;  2DZK A;  2VH1 A;  2WXH A;  2Z4D A;  1J19 A;  2UVM A;  2BS4 B;  3M95 A;  3A8P A;  2L7R A;  2K0P A;  4MH8 A;  4KSL C;  2ZCB A;  2ZKM X;  2W55 A;  5D6J B;  2N4F A;  4FHK A;  2WDQ B;  3R7R A;  1UH6 A;  3VVW B;  3ZW3 A;  4XWX A;  2ZVO A;  1SJE D;  3PS6 A;  1U5G A;  1FFV A;  2EC1 A;  1EUV B;  1WE7 A;  1N6Z A;  2IGH A;  1C78 A;  2DNF A;  1I42 A;  4XGA B;  2QMT A;  1KF6 B;  3OJ3 A;  1V6E A;  2W54 A;  1W1G A;  1ZDX A;  3NRZ A;  2JUO A;  1JRO A;  4A3O A;  1ZOY B;  1BT0 A;  1UNS A;  4FA6 A;  5E6O A;  4C56 C;  2ICI A;  4TSS A;  3RNG C;  1WSP A;  5BMH A;  3LJ3 A;  3Q6B A;  2JXX A;  3ALB A;  2DHI A;  4MGZ E;  4IFS A;  1V81 A;  2GB1 A;  2W82 A;  1FO4 A;  4PS8 A;  3L4P A;  4KV2 A;  3KRW A;  4A3P A;  1E7U A;  1N5X A;  3MTN B;  1D6E C;  3T9L A;  3RFZ B;  3RUL A;  2P0H A;  5HI1 A;  1SB3 C;  4F8C B;  1NBF C;  1MPE A;  3H7S A;  3IT6 B;  4HAT B;  3EPY A;  2D4Q A;  4BBN F;  3AU4 A;  3R66 C;  4EMO A;  4CQN A;  2Y5P A;  2CQU A;  1UGM A;  4USA A;  1MAI A;  2WWZ A;  1FRD A;  1NI3 A;  2HDE A;  3MHZ A;  3UI3 A;  3NG0 A;  3APD A;  4B9K A;  1RYJ A;  3PG7 A;  3M3J A;  2GBK A;  3FVC A;  2XK5 A;  4ANV A;  2LHE A;  2WXG A;  2DZJ A;  4EZL A;  1FHO A;  4I6L B;  1WGU A;  2LJI A;  2MBB B;  3X0W A;  5M4Y B;  2LVP A;  2IYD B;  1VZ7 A;  4WJP A;  4ILJ A;  1P1A A;  4J6I A;  5HHD G;  4IM0 A;  3ZNH B;  3GE8 C;  4KHB A;  1U5F A;  1GC6 A;  3LYY A;  2Z59 B;  1I4G A;  3R8B A;  3TIX A;  3KYC D;  3WYF B;  1XQQ A;  5J3T A;  1WJ4 A;  3TL5 A;  4BZA A;  2DFK A;  3JYU A;  3P63 A;  3DXE A;  3E9P A;  5FK9 C;  2DAF A;  5HE3 A;  4MJS A;  1TBE A;  3Q3J A;  3VUW A;  2ZPN A;  2GJY A;  1QF6 A;  4BKT A;  2CHX A;  5C5B A;  2QIL A;  2XEW A;  3QAQ A;  3QJZ A;  2W2X C;  2HTH A;  2KK8 A;  3VXW A;  1DRO A;  1UNQ A;  2DLB A;  2BYF A;  5MPO A;  1IP9 A;  2DBY A;  3A58 A;  1F2R C;  5C23 A;  3D8F A;  4G3X B;  1V89 A;  2D3C A;  2AQ1 B;  1JDE A;  2L1A A;  1ZKH A;  1P9D U;  2R61 A;  1V5T A;  1NTV A;  2R2Y A;  3ZJV A;  1G6J A;  1WIA A;  3BY4 B;  5G55 A;  3DBS A;  2RVB B;  3F5R A;  4GDL A;  2Q5W D;  3CMM B;  2NPT A;  1YIW A;  4A6Q A;  4HRS A;  2ELB A;  1WZ3 A;  2L76 A;  4HJK A;  4KDI C;  4C7Z A;  1WE6 A;  5C6R A;  1D3Z A;  1SE2 A;  4A6H A;  5HE0 A;  3PV1 A;  2Y5B B;  2PEA A;  1RFA A;  4DBG A;  3BVZ A;  5EE0 A;  2ACZ B;  1DOY A;  4IOI E;  3MC9 A;  4Y94 A;  1OEY J;  2KKC A;  1Q1O A;  2KVZ A;  4AP4 C;  1LO5 D;  2CY5 A;  4MGI E;  1ZYI A;  2CY4 A;  2NBU A;  4DQO C;  1YMH E;  4ARI A;  1RRB A;  4OT1 A;  1Z5S B;  4HDQ A;  5G5H A;  2QKL A;  3QWZ B;  1VBH A;  2WXO A;  4C80 A;  3ULC A;  3HIZ A;  4DWF A;  5IP4 D;  4ILH A;  4JWU C;  4LTU A;  2RR9 A;  3SBT A;  3A9J A;  3N20 C;  3QBV B;  3GP7 A;  4LCD E;  1P3R A;  3VTW A;  1RM6 C;  2W2W A;  2YT1 A;  2TSS A;  3AE9 B;  1P6S A;  5IA7 A;  1MPH A;  2VSZ A;  5DPR A;  3PTF C;  2KIE A;  4NY0 A;  4K81 A;  1WWT A;  2CKH B;  3ULB A;  5JH5 C;  4P16 A;  1V9J A;  3SU8 X;  5C1Z A;  2V4L A;  3P2B A;  4N58 A;  1BXT A;  2DKQ A;  1OQQ A;  2JU6 X;  1PGB A;  1LQB A;  1TKY A;  1OQR A;  1X05 A;  4MSM B;  1EVH A;  3UIO B;  1WI1 A;  1IYF A;  2MBQ A;  4CYE A;  1XLQ A;  3DBR B;  2YEP F;  2VZK D;  2COP A;  4JKD A;  4NAM A;  3IHP C;  4IM2 A;  5AZH A;  3NWD A;  1ZW7 A;  1V5M A;  1WJU A;  1WR1 A;  2PLP A;  1WMH A;  1Y5O A;  2VZK B;  1GNU A;  1C4C A;  3GZN B;  5IN7 A;  4YTM B;  1L6U A;  1UNR A;  1ZVR A;  2K3U A;  2G4D B;  1XR0 B;  2Z0Q A;  3LXF A;  4WWP A;  3VRB B;  5JXV A;  1I7A A;  3NOB A;  5HE1 A;  4LK0 M;  3A1Q A;  1AAR A;  4GB9 A;  2KC2 A;  5AUI A;  4DXA B;  1ZSQ A;  2N9X A;  4NAW B;  3DDC B;  1WFY A;  4ICV A;  2MDX A;  4HSI A;  2K49 A;  1ZXI A;  1SE4 A;  4IKG A;  1VDV A;  4GDK B;  2BS3 B;  1DYQ A;  3UQA A;  2Z14 A;  5LXH A;  3W2D A;  2C7N B;  2FJL A;  1UPQ A;  5IRS A;  4ZHO A;  4BBK A;  4IDI A;  1T6B X;  2DX1 A;  1XLN A;  2IFS A;  5BYQ A;  1BTK A;  2M0X A;  2KAN A;  5HKH A;  2WXF A;  1IRS A;  2IZV B;  1F77 A;  1K53 A;  4IUM B;  5IKC M;  1TQZ A;  4PNK A;  1V5O A;  1V97 A;  1W1D A;  2G3Q B;  2NMQ A;  2DKP A;  5DCN A;  2KQS A;  1X1G A;  2ONQ A;  3ZUN A;  2KLG A;  3PEG A;  2BQQ A;  4MEM A;  1JWB D;  1WYW B;  2KHW B;  4FHJ A;  4G11 A;  1VJK A;  5GOW B;  3A9K B;  2VKI A;  1WYG A;  2IBI B;  2WP9 B;  3BK2 A;  4JK8 A;  1CJE A;  2D11 A;  5L81 A;  4D2K A;  1NTI A;  2Z0D B;  4EOY A;  1FXA A;  3X23 A;  5DPS A;  4M02 A;  3VR9 B;  1NVL A;  1L2N A;  1HE8 A;  4II3 B;  3MDB C;  3E66 A;  3NJT A;  4JIO U;  2WXQ A;  3GE3 C;  1GAQ B;  1QC6 A;  4OZC A;  1WX7 A;  1V1P A;  4OVZ A;  1YOV B;  5TSS A;  1HTO A;  5CX3 A;  2LWP A;  1XX0 A;  4WJO A;  5DHA B;  3ZDT A;  2ZPY A;  4HXD A;  1SE3 A;  4ZHP A;  4HAX B;  2YLM A;  2ZW1 A;  3FIL A;  1TIF A;  4YSY B;  2V0G A;  3NVW A;  2CR5 A;  2RQ1 A;  3PHW B;  2FJU B;  2KJ6 A;  2JQR B;  2WS3 B;  2Z59 A;  2PPH A;  2LMC A;  4WAA A;  1FRR A;  2PKO A;  2DEN B;  2R82 A;  2MA9 B;  1QQR A;  1SXT A;  3AV8 A;  4FXC A;  1UEF A;  1XEE A;  4N6E B;  4W9K A;  4W9F A;  1Z2M A;  5C16 A;  3DCG A;  3BVG A;  2FCQ A;  3NZ3 A;  3RNF C;  5LOP B;  1ENF A;  4IM3 A;  3N7C A;  3E56 A;  4IAP A;  3DXC A;  5CHV C;  2DLW A;  4TMA B;  5DHF B;  2MFQ A;  2AQ3 B;  4BKS D;  2MKR A;  2M4N A;  1SIJ A;  4HPL B;  4PYZ A;  4KVG B;  2C7M B;  1B1Z A;  2L8J A;  1EU4 A;  3DQV A;  4OZA A;  2K39 A;  2SAK A;  3LDZ E;  3WAL A;  3QK0 A;  4DDI D;  1C76 A;  1N5W A;  3VAW A;  2L05 A;  3RYT A;  4F7Z A;  4WWO A;  4MAC A;  2K8E A;  4LNK A;  1UD7 A;  2KCJ A;  1EO6 A;  4EFO A;  3FC4 A;  3FSS A;  4BAX A;  1ET9 A;  5IAA C;  3HK0 A;  1FHW A;  1N60 A;  2GLS A;  5EDS A;  3OAN A;  2M1M A;  2RDG A;  2LFI A;  3ML9 A;  1K5D B;  1WF9 A;  4DX9 0;  2BVC A;  5KHQ A;  3GOE A;  5H92 C;  3ZNG C;  1DYN A;  1L5P A;  1H10 A;  2L32 A;  1WM3 A;  2RRF A;  2JZZ A;  3AJ4 A;  3I9V 1;  3KWL A;  3HUI A;  3SDL C;  2PE6 B;  1TY2 A;  1PYW D;  2WXJ A;  4YWG G;  4O1N A;  2RD0 A;  4RGN A;  1L0Y B;  3VOQ A;  1DBH A;  1R7S A;  2KX3 A;  4RGT A;  2RDB C;  2PW9 A;  2LAS A;  2MEK A;  1T3Q A;  4A8X C;  4GOC A;  5BYS A;  4E3C A;  2VRR B;  1V5U A;  4AQ7 A;  1K51 A;  1S1Q B;  1UF0 A;  4WJN A;  3MHS D;  2O2V B;  2R2Q A;  1MHX A;  2KX0 A;  2PE9 A;  4GNK B;  3QWM A;  1HB8 A;  3ZJT A;  3DBR I;  1EF1 A;  2D3G A;  1J8C A;  2NCN A;  3VTU A;  1E8W A;  3DHI C;  2JWZ A;  4C4V B;  3M1I B;  1EWC A;  2EEL A;  5CLL B;  3KYD D;  2UU7 A;  4J3O D;  1KLU D;  3R2T A;  1FXI A;  3U52 E;  2M19 A;  2LUM A;  4HB2 B;  3GZN I;  2DHZ A;  3SBG A;  2UYZ B;  3IG3 A;  1V49 A;  3N1Y C;  4KDL B;  4L2Y A;  2KTR B;  1QOF A;  5JP4 A;  2BCJ A;  3NWA A;  1IPG A;  1HQR D;  4WQM A;  3KSY A;  2PVO D;  4YTN B;  1MIZ B;  4F7U P;  5G2N A;  2G45 B;  4L1R A;  3RNA C;  2OOB B;  3Q8A A;  4HKQ A;  3D8D A;  4M8M A;  4WSF A;  2BPS A;  3PRZ A;  2DX5 B;  1EM7 A;  5IO9 A;  2NTS A;  1PUT A;  3NVV A;  2KN5 A;  2NMB A;  1SGH A;  3IT4 B;  1P3Q U;  4BOZ B;  2KUP A;  3APC A;  1NU2 A;  2HJ8 A;  2CHZ A;  1I35 A;  3RNE C;  1VCB A;  2RGN B;  4MM3 B;  1L7Y A;  3Q69 A;  1XOD A;  4MY6 A;  3C8Y A;  4PS7 A;  2AQ2 B;  5LLI A;  1UPR A;  1ST7 A;  1W1H A;  3P4S B;  2JYE A;  1XCT L;  2V3S A;  4GOU A;  2CU1 A;  2MJ3 A;  4GDK A;  3VUX A;  3EHV A;  3KUZ A;  3KRX A;  4M0W B;  2W3R A;  1EAZ A;  2HD5 B;  3PVW A;  4AUQ C;  1YJ1 A;  4HAY B;  5GXG B;  3AB5 A;  3ZDM C;  3QCA A;  1YD8 U;  2KQ7 A;  2IDY A;  3KUC B;  3VDZ A;  2WNM A;  1VBG A;  2C5L C;  2DTC A;  1U5E A;  1NEK B;  5D3W A;  1OY2 A;  4S0R A;  1WGQ A;  2EKE C;  3VUY A;  2I38 A;  1WJN A;  1N61 A;  2FCN A;  4K2O A;  3TJP A;  1HTQ A;  4KIK B;  1E10 A;  3T06 A;  1LW3 A;  3OAW A;  2RMM A;  2K00 A;  4FBJ B;  3N9Y C;  4XYC A;  3CXB B;  4S17 A;  4MGK E;  1K50 A;  4OHJ A;  1T0R C;  5C3J B;  2K25 A;  4WAF A;  1QIL A;  5JHH A;  3SHQ A;  1XCQ L;  4TQ1 A;  1WGR A;  2K1F A;  4GSW A;  3VH4 B;  2C9W B;  3IXS A;  4BFR A;  1TGZ B;  3IAS 1;  4IOY X;  5IOI A;  4A6F B;  4ICU A;  4K7U A;  2CJN A;  3PVU A;  2EMS A;  5AZG A;  1I4Q A;  3DBL I;  3M63 B;  5FI1 A;  5D3D A;  3RCZ A;  1T0Q C;  1DIK A;  3ZYY X;  3Q3N C;  2BYV E;  4IWO A;  2LHD A;  1BAK A;  3B08 A;  4L23 A;  2MP2 B;  3MP9 A;  4MT7 A;  4ZDV A;  3AE6 B;  2JY6 A;  2ELA A;  4KX6 B;  1R4N B;  3BWU D;  1C3T A;  1C1Y B;  4EZK A;  1XLO A;  3FP5 A;  2MSE D;  3BYT B;  2NBV B;  3MJW A;  3O13 A;  2LXC A;  3WAP A;  1MI0 A;  3QA8 A;  1K52 A;  3EGR A;  4I6N B;  2GRI A;  2YS5 A;  3PPA A;  1ROE A;  1TS2 A;  4MH0 E;  3NUH B;  4HVB A;  2K5P A;  1WJ6 A;  1D5X C;  3PO0 A;  2V76 A;  2LVQ A;  1KZG A;  4M8N A;  2JRI B;  3DWG C;  3DVN U;  3SFD B;  3SNH A;  5AEK B;  1ZXH A;  1OEY A;  5JVL A;  1DGJ A;  5AZF A;  2KMA A;  3MC0 B;  4FN2 A;  4RH6 A;  3RN9 C;  5D3V A;  3U8Z A;  2YSZ A;  1V8C A;  3AUL A;  2NTT A;  3PRE A;  3BYY B;  2FIF A;  2I5F A;  2OHF A;  2CU3 A;  3RT3 B;  2K22 A;  3EFC A;  3P4R B;  1OQN A;  3PT2 B;  4CHM A;  4C7Y A;  4IWP A;  2LKO A;  3QAR A;  3V60 A;  2LGY A;  3HM6 X;  2IY1 B;  2COA A;  1FOE A;  1WXV A;  5C79 A;  1X86 A;  3PZD A;  1KRH A;  1HBK A;  1TZ1 A;  4ZRK A;  2N0Y A;  4HRO A;  2CJO A;  1QLB B;  3ZNI D;  2CS4 A;  2O6V A;  3GB1 A;  4CSQ A;  1E0Z A;  2LGX A;  1ZC4 B;  2FJ9 A;  2OJR A;  4A6K A;  2MX2 A;  1V80 A;  3TO1 A;  1Z87 A;  3HVZ A;  1I4X A;  1GG3 A;  4ZRQ A;  4GXB A;  1P5T A;  1KLV A;  2JT4 B;  4PS3 A;  5EE1 A;  2GBM A;  3V5W A;  4YSX B;  3ODO A;  3H1U A;  3KUD B;  4B6H A;  3L54 A;  3RPF C;  2BF8 B;  3AEE B;  2W2X D;  3QHT A;  2XNA C;  2N7D A;  5FR6 A;  1FIQ A;  2CHW A;  4EEW A;  2KTF A;  5EE3 A;  1TJ6 A;  3TW1 A;  2KJR A;  3D32 A;  1EU3 A;  2O2V A;  5D2M B;  5TR5 A;  1DOI A;  5J3Y A;  1N63 A;  4MDK E;  3NVY A;  2Z0O A;  4OVV A;  1SHC A;  4HAZ B;  5JHB A;  2K8C A;  2KIG A;  4Z2M B;  3A98 B;  1WXM A;  1ZDV A;  3KVF B;  4HK2 A;  4C4V A;  4QXA B;  1JWU D;  1WH3 A;  4WH4 A;  3ECI A;  2RUK B;  1D4B A;  3OWE B;  5LXI B;  2E6X A;  1U29 A;  1YQ4 B;  1A5R A;  1TZO A;  5FKA C;  1YX5 B;  1F52 A;  4DHZ B;  1KJT A;  2PZ1 A;  4N59 A;  3RD2 A;  2KGX B;  4E71 A;  4JKB A;  1L6V A;  3ENB A;  2N9P C;  1YJI A;  1T0Y A;  3TUO A;  2N7J A;  3AE8 B;  3RNB C;  2DYM A;  4D6W A;  1ZC3 B;  1V2Y A;  2RNR B;  1HB6 A;  1KH0 A;  2M0A A;  2M56 B;  5LNK 1;  1FNV A;  4RCO A;  1OQY A;  2N9L A;  2DX5 A;  2JF5 A;  1QOB A;  2H7E A;  2H88 B;  2FBW B;  2BTE A;  1ZGU B;  4NJC A;  1XD3 B;  2Y3A A;  2LGS A;  1WGY A;  1P0R A;  3TEZ A;  4WWN A;  2KAJ A;  2WXR A;  3A8Q A;  3NY5 A;  4DHJ D;  2GS0 A;  2G1E A;  3Q8B A;  1FCC C;  4YSZ B;  2GUM A;  2ASQ A;  3A33 B;  2KDI A;  5BO4 B;  1UEL A;  2QSD A;  2KWD A;  2SEB D;  3FM8 C;  3UIP B;  4ANX A;  2KC1 A;  4JPS A;  4DHJ B;  2IGG A;  4B0M A;  3E9L A;  4JWS C;  3H8H A;  1HXY D;  5D3Y A;  1Q5W B;  1GPX A;  2Y5C A;  3GS2 A;  5D7G A;  4JKA A;  4NNJ B;  1IUE A;  2V4I B;  2ON8 A;  2IND C;  2INC C;  2LI5 A;  4NSW A;  2J0J A;  4HJG E;  2WXM A;  4B6W A;  4A90 A;  1LXD A;  1MIX A;  4ZOH C;  1AYF A;  3G9W A;  2WGS A;  2WHI A;  1NYQ A;  1J0G A;  2IY0 B;  3IBE A;  3MFG A;  2L1C A;  2BGF A;  1WGD A;  1JW9 D;  1DOX A;  2HTM E;  1A70 A;  3ZXR A;  2J53 A;  1R4N I;  4DBB A;  3ZLZ A;  3BK1 A;  2WXP A;  4F1S A;  2N9E B;  1ISN A;  3ODX A;  1CZP A;  2XN9 C;  1FXT B;  1N3H A;  1LFD A;  3EC8 A;  1XD4 A;  2FE8 A;  4OVU A;  3AEC B;  1C77 A;  1YN5 A;  2MHJ A;  3VHT C;  4LNI A;  1GUA B;  1PQS A;  1LGR A;  3AI5 A;  3MJ5 A;  4XWT A;  3SD5 A;  4D0N B;  3C0R B;  4WWM A;  3TEW A;  4UDU C;  5BMG A;  1YJJ A;  3I3T B;  4PT5 A;  1AWD A;  3L08 A;  4KKJ A;  4KKI A;  2KFK B;  3VFK A;  3AE5 B;  3W1Y A;  2DA0 A;  2KZR A;  3VH3 B;  2DYO A;  2MJD A;  5CTR C;  2ZNV C;  2NS5 A;  4RGO S;  2LEK A;  2WXN A;  3Q3O C;  2MBO A;  1KLG D;  3GYO A;  2BB5 A;  3Q3F A;  5I4D A;  3B2F A;  1UGJ A;  1FFU A;  4NJ7 A;  5GMV A;  3P7Z A;  1E7V A;  2V3N A;  4B95 A;  1C79 A;  3DOW A;  3O65 B;  4MSQ B;  3A4R A;  2L2I A;  4DXF A;  2I1K A;  1MK7 B;  3RZW C;  1E8X A;  3R7Q A;  1SBB B;  1BWN A;  2INN E;  1D5Z C;  1U5D A;  3B1L X;  5JHG A;  2KD0 A;  5CHF A;  4FJY A;  4X57 B;  5KQ1 A;  1HEZ E;  3DBH B;  4K2P A;  4JKC A;  4G50 A;  1RRP B;  4W9E A;  5H8Y E;  3B9J A;  3PLU A;  2XBB C;  3DBL B;  1FEH A;  3WAN A;  4HCN B;  3AED B;  2NBW B;  4EUT A;  4WIP A;  2FCS A;  2IO1 B;  3QX1 A;  4DHZ E;  4LNO A;  4NQK E;  3HIE A;  1E90 A;  4W9C A;  1M4V A;  3EEC A;  4BVU C;  5J2R A;  4Z2N A;  1T5X D;  2XK5 B;  3O96 A;  1LM8 B;  3V6E B;  1KOT A;  1VRA B;  1P98 A;  1FCL A;  1KFY B;  4MEL A;  3PZ7 A; 
#chains in the Genus database with same CATH homology
 1SE9 A;  5JLJ B;  2P0F A;  4GMV A;  1RLF A;  2JPH A;  3JSV B;  2Z0E B;  4C0A A;  4WVF B;  3RCP A;  2VRW B;  1VD2 A;  2LD9 A;  3ZTC A;  4YL8 A;  2WYQ A;  4MJS B;  4LJO B;  5J3Q A;  3PRP B;  1WX8 A;  2LUE A;  3PSE B;  4KZ0 A;  3H6N A;  1ZM0 A;  1GJZ A;  1XKE A;  2YF0 A;  1PFJ A;  4CHK A;  5DI9 B;  3RUI B;  2MCN B;  1DDV A;  4CO7 A;  3TVV A;  3CSF A;  1FHX A;  1UNP A;  2LRW A;  2H7D A;  2LUL A;  1QZE A;  4W9I A;  5E6P A;  2JVC A;  3BJI A;  2Y7B A;  4P7I A;  1OTR B;  1NTY A;  2GCJ A;  1Y8R C;  4K1R B;  3ZVV A;  4K7W A;  4LDT D;  3NHE B;  2X0S A;  2N7E A;  2BWF A;  3KY9 A;  2D2Q A;  2J0K A;  1Q67 A;  1B55 A;  4HB3 B;  4F7H A;  2KWC A;  5EFX A;  1FGY A;  4AJW A;  1UBI A;  4FJV B;  4ASW C;  2D10 A;  5DPT A;  4EZJ A;  3T8M A;  2IO0 B;  2YVC A;  2R2O A;  2COC A;  3A9J B;  2ROV A;  4FUL A;  2OTX A;  4ZRI A;  1NI2 A;  4E74 A;  1QQG A;  2JP2 A;  2L3Z A;  4NAW A;  4TKN A;  4JL9 A;  2P0D A;  3JW0 X;  3PLV A;  3GYP A;  1WR6 E;  1PLS A;  3HM3 A;  4DK5 A;  2ZVN A;  1X1M A;  3CF6 E;  2KWU B;  2MLB A;  4FLH A;  2QHO A;  2JZ3 B;  2LVO A;  2R0D A;  4XX5 A;  4HAW B;  3QQ8 B;  1WMH B;  2JRH A;  1SIF A;  2KNB A;  4MGY E;  4HDO A;  2BWE S;  3PGE A;  3UIN B;  2WDT B;  5L95 C;  3U7D A;  3PP2 A;  1K5G B;  4JQW C;  2I5C A;  2HRJ A;  3KH0 A;  2D9X A;  2IYB A;  4W9G A;  3QC8 B;  3A9K A;  3NS8 A;  2KFK A;  5JHA A;  2V1Y A;  3WIM A;  3TBL D;  3DXD A;  3ZTD A;  3UF8 A;  3DBH I;  3NZU A;  1E8Y A;  1FAO A;  3U30 A;  2ZCC A;  2B3A A;  2LXA A;  2LRU A;  3F0W A;  2K2J A;  1M94 A;  5E6N A;  3L13 A;  4ANU A;  3KZ1 A;  4GIV A;  2DZM A;  4JKE A;  5KHO A;  4FAD A;  2L0F A;  1WG7 A;  2M17 A;  2Z0P A;  1XCG A;  3NZS A;  1H8C A;  1DDM A;  2Y8G A;  4JK9 A;  2FNJ B;  4K7S A;  4W9L A;  4JKH A;  4IWQ A;  1X1F A;  2I1J A;  2DAJ A;  4GN1 A;  2L0T A;  4GU2 A;  2ADZ A;  4HB0 B;  4A5K A;  2DHJ A;  2N1V A;  1MK9 B;  2KOX A;  3ML8 A;  1WY8 A;  2ZZP B;  2J0M A;  2LOZ A;  4TQ0 A;  1PMS A;  4BKS A;  3JSV A;  2WH5 A;  1GC7 A;  4HAV B;  4HWI B;  2LG1 A;  4KHO A;  4HCP B;  3HW2 B;  2FAZ A;  2GOW A;  4GMX B;  3L0W B;  4JLC A;  2KJH B;  1FB8 A;  2GBJ A;  2MRP A;  2ZEQ A;  2X18 A;  4HPM B;  2MWN B;  1BTN A;  3UZT A;  4NPN A;  3PSC A;  2FUH B;  2WX1 A;  3PVL A;  2L00 B;  3ZRF A;  2ABD A;  4AJY B;  1TXD A;  3V6C B;  3BIN A;  4KHA A;  1JRU A;  5DIF B;  2OQB A;  3ZIM A;  3KW5 B;  4ANW A;  4DX8 A;  4JKG B;  1KM7 A;  3PHX B;  5L83 A;  5KCV A;  3QIJ A;  2K2U A;  2KDE B;  3H7P B;  4GGQ A;  3MPX A;  4ZRJ A;  2YS1 A;  3VQI A;  4W9H A;  3DVG Y;  5KQ4 A;  4JGH B;  3PRM B;  4ZYN A;  2YT0 A;  3HQC A;  2DHK A;  1RJ2 A;  2N23 A;  3E9O A;  1WXS A;  1Q0W B;  2KTR A;  2MWS B;  1CMX B;  3CIK A;  1NDD A;  2M14 A;  1U4A A;  3V62 A;  3P6A A;  3ZO5 B;  3A4S C;  4DDG D;  3WAM A;  3SO6 A;  5J18 A;  4EKU A;  3VTV A;  1GGO A;  2NZ8 B;  2CB8 A;  3OLM D;  2KO3 A;  3ENE A;  4MM3 A;  4NJ6 A;  2GCL A;  2LGD A;  4RMA A;  1J0W A;  4II2 B;  3DPD A;  2AL6 A;  1KZ7 A;  3ZVR A;  2A5U A;  3W1S A;  4WQO B;  2Q13 A;  1DDW A;  1KI1 B;  2DYB A;  2D9V A;  1MG8 A;  3NSU A;  4FJZ A;  3R3M A;  1F9J A;  4HHV A;  4MK0 A;  1V88 A;  1AWE A;  1V5P A;  2BYE A;  1RAX A;  4KIK A;  5DH9 B;  3H9D A;  1KC7 A;  5HE2 A;  1I2H A;  2K8B A;  2KWV B;  3B0A A;  1ACA A;  2R09 A;  5J17 A;  2K8H A;  3ODW A;  4W9D A;  3OJ4 B;  2IO2 B;  3ZRC A;  2ROZ B;  4TYZ A;  3JVZ X;  4ILG B;  4W9J A;  2W9N A;  3FEH A;  1WVH A;  2COD A;  2A4Z A;  2COF A;  4A6F A;  2RPQ A;  2NVU I;  2RGF A;  1YX6 B;  2C60 A;  1R4M I;  2AL3 A;  2LZ6 A;  2ZJD A;  3SUZ A;  2YS3 A;  1OGW A;  2MP2 A;  4EJN A;  2LBB A;  2D9W A;  3N32 A;  3K9P B;  3AXC A;  2UZR A;  4KAX B;  1E5W A;  3ZKJ C;  1TTN A;  4H8S A;  2UWQ A;  4RM8 A;  1H4R A;  2G35 A;  3SV1 A;  1WRD B;  1M7E A;  3IFW B;  4JKF A;  3HHM A;  5FI0 A;  2UZS A;  3N3K B;  2G4S A;  4HLE A;  4CHJ A;  2PJH A;  4URK A;  2IO3 B;  1EF5 A;  3L16 A;  4BKG A;  2FDQ A;  2J7Q B;  3M62 B;  1LB1 A;  1K8R B;  1KBL A;  2LOX A;  2KDB A;  3APF A;  3L10 B;  2CRF A;  2NR2 A;  1YQB A;  1WGH A;  2ZNV B;  5CHW A;  4PQ0 A;  3EFU A;  4NQL B;  4G0N B;  2D07 B;  2DZI A;  3ML4 A;  2P8V A;  2XQN M;  2DN6 A;  5LON B;  2N1W A;  2FID A;  2MW5 A;  4TV3 A;  4BBN C;  4IW0 A;  1WZ0 A;  4KHB B;  3N30 A;  4JK7 A;  4RM9 A;  3S2A A;  3V61 A;  3CST A;  4KSK C;  4XZ4 A;  2Y8F A;  4HAU B;  2M38 A;  2D9Z A;  3DVN V;  1U27 A;  2DYN A;  1MKE A;  4HB4 B;  4N9F 4;  3UGB B;  1WM2 A;  4AWJ A;  1S3S G;  2DYQ A;  5C5B B;  2E2X A;  2GMI C;  3RZF A;  1Y19 B;  5CLQ B;  2HTH B;  3FLV A;  2O6V D;  4JKG A;  4WJ7 A;  4F7G A;  2RSU A;  4WJQ A;  3H7P A;  2O6V B;  2D9Y A;  3ONS A;  1OMW A;  3LJU X;  2FCM A;  4GDL B;  2REX A;  3AU5 A;  2KDF B;  2NPT B;  2K6D B;  2KFJ A;  2AEH A;  3SYX A;  3WA0 A;  3TFM A;  5JZE B;  5D3X A;  2GBR A;  2RLO A;  2MBH A;  1V61 A;  4GPT B;  2BKF A;  5DPW A;  4IG7 B;  2KXJ A;  4AOF A;  3UQB A;  4IC7 B;  1FGZ A;  1V86 A;  2GBN A;  4LDT B;  4YON A;  2CAY A;  2YRY A;  2AYO B;  1WX9 A;  4BOS C;  2EJ8 A;  5D27 A;  2K6Q A;  2KLC A;  1WXA A;  3TCA A;  3W1S C;  1X11 A;  1WI0 A;  1UZX B;  3D8E A;  2C7H A;  2MQJ A;  1WGG A;  4K17 A;  2MBE A;  1XT9 B;  1M7R A;  3TMP B;  4LJP B;  5IJM A;  2BKR B;  4TUU A;  4KZC A;  2EMT A;  2J59 M;  2WX0 A;  2DIK A;  2RSG A;  2QKM A;  2M8S A;  2LYD A;  1WJ1 A;  3IVF A;  2HE7 A;  3L17 A;  3DVG X;  3VIA A;  2KVR A;  1E8Z A;  2LJ5 A;  1U2B A;  1WJM A;  3K9O B;  4I6P A;  2AWT A;  1EGX A;  3WAO A;  4L6E A;  5D94 A;  4XC2 A;  4GZU A;  4A20 A;  4PYU A;  1UBQ A;  1AQC A;  2KMC A;  3A1Q B;  3ZNZ B;  2DZK A;  1J19 A;  2UVM A;  3M95 A;  3A8P A;  2L7R A;  4KSL C;  2ZCB A;  5D6J B;  2N4F A;  4FHK A;  3R7R A;  1UH6 A;  3VVW B;  3ZW3 A;  4XWX A;  2ZVO A;  3PS6 A;  1U5G A;  2EC1 A;  1EUV B;  1WE7 A;  1I42 A;  3OJ3 A;  1V6E A;  1W1G A;  2JUO A;  4A3O A;  1BT0 A;  4FA6 A;  5E6O A;  3LJ3 A;  2JXX A;  3ALB A;  4MGZ E;  2DHI A;  4IFS A;  1V81 A;  4PS8 A;  4KV2 A;  3KRW A;  4A3P A;  1E7U A;  3MTN B;  3T9L A;  3RUL A;  2P0H A;  4F8C B;  1NBF C;  3H7S A;  4HAT B;  3EPY A;  2D4Q A;  4BBN F;  3AU4 A;  3R66 C;  4EMO A;  2CQU A;  1UGM A;  1MAI A;  2WWZ A;  3APD A;  4B9K A;  3PG7 A;  3M3J A;  2GBK A;  2XK5 A;  4ANV A;  2DZJ A;  4EZL A;  1FHO A;  4I6L B;  1WGU A;  2MBB B;  3X0W A;  2LVP A;  2IYD B;  4WJP A;  4ILJ A;  1P1A A;  4J6I A;  4IM0 A;  3ZNH B;  1U5F A;  1GC6 A;  2Z59 B;  3TIX A;  3KYC D;  3WYF B;  1XQQ A;  5J3T A;  1WJ4 A;  3TL5 A;  2DFK A;  3JYU A;  3DXE A;  3E9P A;  2DAF A;  5HE3 A;  4MJS A;  1TBE A;  3Q3J A;  3VUW A;  2ZPN A;  2GJY A;  4BKT A;  2CHX A;  5C5B A;  2XEW A;  3QAQ A;  3QJZ A;  2W2X C;  2HTH A;  2KK8 A;  3VXW A;  1DRO A;  1UNQ A;  2BYF A;  1IP9 A;  5C23 A;  3D8F A;  4G3X B;  1V89 A;  1JDE A;  1ZKH A;  1P9D U;  1V5T A;  1NTV A;  1G6J A;  1WIA A;  3BY4 B;  5G55 A;  3DBS A;  2RVB B;  3F5R A;  4GDL A;  3CMM B;  2NPT A;  1YIW A;  2ELB A;  1WZ3 A;  2L76 A;  4HJK A;  4KDI C;  1WE6 A;  5C6R A;  1D3Z A;  4A6H A;  5HE0 A;  3PV1 A;  2Y5B B;  2PEA A;  1RFA A;  4DBG A;  4Y94 A;  1OEY J;  2KKC A;  1Q1O A;  4AP4 C;  2CY5 A;  4MGI E;  2CY4 A;  2NBU A;  1RRB A;  1Z5S B;  4HDQ A;  2QKL A;  3QWZ B;  1VBH A;  3ULC A;  3HIZ A;  4DWF A;  4ILH A;  2RR9 A;  3SBT A;  3A9J A;  3QBV B;  4LCD E;  1P3R A;  3VTW A;  2W2W A;  2YT1 A;  1P6S A;  5IA7 A;  1MPH A;  2VSZ A;  5DPR A;  3PTF C;  4NY0 A;  4K81 A;  2CKH B;  3ULB A;  5JH5 C;  1V9J A;  3SU8 X;  5C1Z A;  2V4L A;  3P2B A;  2DKQ A;  1LQB A;  4MSM B;  1X05 A;  3UIO B;  1EVH A;  1WI1 A;  1IYF A;  2MBQ A;  4CYE A;  2COP A;  4JKD A;  3IHP C;  4IM2 A;  5AZH A;  1ZW7 A;  1V5M A;  1WJU A;  1WR1 A;  1WMH A;  1Y5O A;  1GNU A;  1UNR A;  1ZVR A;  4WWP A;  1XR0 B;  2Z0Q A;  2G4D B;  1I7A A;  3NOB A;  5HE1 A;  3A1Q A;  1AAR A;  4GB9 A;  2KC2 A;  4DXA B;  1ZSQ A;  2N9X A;  4NAW B;  3DDC B;  1WFY A;  4ICV A;  2MDX A;  4GDK B;  3UQA A;  5LXH A;  2C7N B;  2FJL A;  1UPQ A;  4BBK A;  2DX1 A;  2IFS A;  1BTK A;  2M0X A;  2KAN A;  5HKH A;  1IRS A;  2IZV B;  4IUM B;  1TQZ A;  4PNK A;  1V5O A;  1W1D A;  2G3Q B;  2DKP A;  5DCN A;  2KQS A;  1X1G A;  3ZUN A;  2KLG A;  3PEG A;  4MEM A;  1WYW B;  2KHW B;  4FHJ A;  4G11 A;  5GOW B;  3A9K B;  2VKI A;  2IBI B;  4JK8 A;  2D11 A;  5L81 A;  1NTI A;  2Z0D B;  4EOY A;  3X23 A;  5DPS A;  1NVL A;  1L2N A;  1HE8 A;  4II3 B;  3MDB C;  3E66 A;  4JIO U;  1QC6 A;  1WX7 A;  5CX3 A;  2LWP A;  1XX0 A;  4WJO A;  5DHA B;  3ZDT A;  2ZPY A;  4HXD A;  4HAX B;  2YLM A;  2CR5 A;  2RQ1 A;  3PHW B;  2KJ6 A;  2PPH A;  4WAA A;  2DEN B;  2R82 A;  2MA9 B;  1UEF A;  4W9K A;  4W9F A;  1Z2M A;  5C16 A;  3DCG A;  2FCQ A;  5LOP B;  4IM3 A;  3N7C A;  4IAP A;  3DXC A;  5CHV C;  2DLW A;  5DHF B;  2MFQ A;  4BKS D;  2MKR A;  2M4N A;  4HPL B;  4PYZ A;  4KVG B;  2C7M B;  2L8J A;  3DQV A;  2K39 A;  3LDZ E;  3WAL A;  3QK0 A;  4DDI D;  3VAW A;  2L05 A;  3RYT A;  4F7Z A;  4WWO A;  1UD7 A;  2KCJ A;  1EO6 A;  4EFO A;  3FSS A;  5IAA C;  3HK0 A;  1FHW A;  5EDS A;  3OAN A;  2M1M A;  3ML9 A;  1K5D B;  1WF9 A;  4DX9 0;  5KHQ A;  3GOE A;  3ZNG C;  1DYN A;  1H10 A;  1WM3 A;  2JZZ A;  3AJ4 A;  3SDL C;  2PE6 B;  2RD0 A;  3VOQ A;  1DBH A;  2KX3 A;  2LAS A;  4GOC A;  4E3C A;  2VRR B;  1V5U A;  1S1Q B;  4WJN A;  3MHS D;  2O2V B;  2R2Q A;  2KX0 A;  2PE9 A;  3QWM A;  1HB8 A;  3DBR I;  1EF1 A;  2D3G A;  1J8C A;  2NCN A;  3VTU A;  1E8W A;  2JWZ A;  3M1I B;  5CLL B;  3KYD D;  4HB2 B;  3GZN I;  2DHZ A;  3SBG A;  2UYZ B;  3IG3 A;  1V49 A;  4KDL B;  2KTR B;  5JP4 A;  2BCJ A;  1IPG A;  3KSY A;  1MIZ B;  4F7U P;  5G2N A;  2G45 B;  2OOB B;  3D8D A;  4M8M A;  4WSF A;  2BPS A;  3PRZ A;  2DX5 B;  2KN5 A;  2NMB A;  1SGH A;  4BOZ B;  1P3Q U;  2KUP A;  3APC A;  1NU2 A;  2HJ8 A;  2CHZ A;  1I35 A;  1VCB A;  2RGN B;  1L7Y A;  1XOD A;  4MY6 A;  4PS7 A;  5LLI A;  1UPR A;  1ST7 A;  1W1H A;  2V3S A;  2CU1 A;  4GDK A;  3VUX A;  3EHV A;  3KUZ A;  3KRX A;  4M0W B;  1EAZ A;  2HD5 B;  3PVW A;  4AUQ C;  1YJ1 A;  4HAY B;  3ZDM C;  3QCA A;  1YD8 U;  2KQ7 A;  3KUC B;  3VDZ A;  1VBG A;  2C5L C;  2DTC A;  1U5E A;  5D3W A;  1OY2 A;  1WGQ A;  2EKE C;  3VUY A;  1WJN A;  2FCN A;  4K2O A;  3TJP A;  4KIK B;  3T06 A;  1LW3 A;  3OAW A;  2K00 A;  4FBJ B;  3CXB B;  4MGK E;  2K25 A;  5JHH A;  3SHQ A;  4TQ1 A;  1WGR A;  2K1F A;  4GSW A;  3VH4 B;  2C9W B;  4BFR A;  1TGZ B;  4IOY X;  4A6F B;  4ICU A;  4K7U A;  3PVU A;  2EMS A;  5AZG A;  3DBL I;  3M63 B;  5FI1 A;  3RCZ A;  1DIK A;  2BYV E;  4IWO A;  1BAK A;  3B08 A;  2MP2 B;  4MT7 A;  4ZDV A;  2JY6 A;  2ELA A;  1C3T A;  1C1Y B;  4EZK A;  3MJW A;  3FP5 A;  2MSE D;  2NBV B;  2LXC A;  3WAP A;  3QA8 A;  4I6N B;  2YS5 A;  3PPA A;  4MH0 E;  4HVB A;  1WJ6 A;  2V76 A;  2LVQ A;  1KZG A;  4M8N A;  2JRI B;  3DVN U;  3SNH A;  5AEK B;  1OEY A;  5JVL A;  5AZF A;  2KMA A;  4FN2 A;  5D3V A;  3U8Z A;  2YSZ A;  3AUL A;  3PRE A;  2FIF A;  2I5F A;  3RT3 B;  1OQN A;  3PT2 B;  4CHM A;  4IWP A;  2LKO A;  3QAR A;  3V60 A;  2LGY A;  3HM6 X;  2IY1 B;  2COA A;  1FOE A;  1WXV A;  5C79 A;  1X86 A;  3PZD A;  1HBK A;  1TZ1 A;  4ZRK A;  2N0Y A;  3ZNI D;  2CS4 A;  2O6V A;  2LGX A;  1ZC4 B;  2FJ9 A;  2OJR A;  4A6K A;  2MX2 A;  1V80 A;  3TO1 A;  1Z87 A;  1GG3 A;  4GXB A;  1P5T A;  1KLV A;  2JT4 B;  4PS3 A;  2GBM A;  3V5W A;  3ODO A;  3H1U A;  3KUD B;  4B6H A;  3L54 A;  2BF8 B;  2W2X D;  3QHT A;  2N7D A;  5FR6 A;  2CHW A;  4EEW A;  2KTF A;  1TJ6 A;  3TW1 A;  2KJR A;  3D32 A;  2O2V A;  5D2M B;  5TR5 A;  5J3Y A;  4MDK E;  2Z0O A;  4OVV A;  1SHC A;  4HAZ B;  5JHB A;  2K8C A;  4Z2M B;  3A98 B;  1WXM A;  3KVF B;  4HK2 A;  1WH3 A;  3ECI A;  2RUK B;  5LXI B;  1U29 A;  1A5R A;  1YX5 B;  4DHZ B;  1KJT A;  2PZ1 A;  3RD2 A;  2KGX B;  4E71 A;  4JKB A;  2N9P C;  3ENB A;  1T0Y A;  2DYM A;  1ZC3 B;  1V2Y A;  2RNR B;  1HB6 A;  1OQY A;  2DX5 A;  2JF5 A;  2H7E A;  1ZGU B;  1XD3 B;  1WGY A;  1P0R A;  4WWN A;  3A8Q A;  3NY5 A;  4DHJ D;  2GS0 A;  2ASQ A;  3A33 B;  2KDI A;  5BO4 B;  1UEL A;  3FM8 C;  3UIP B;  4ANX A;  2KC1 A;  4DHJ B;  3E9L A;  5D3Y A;  1Q5W B;  5D7G A;  4JKA A;  4NNJ B;  2LI5 A;  4NSW A;  2J0J A;  4B6W A;  1LXD A;  1MIX A;  3G9W A;  1J0G A;  2IY0 B;  3IBE A;  2L1C A;  2BGF A;  1WGD A;  1R4N I;  4DBB A;  3ZLZ A;  4F1S A;  2N9E B;  1ISN A;  3ODX A;  1FXT B;  1N3H A;  1LFD A;  3EC8 A;  1XD4 A;  4OVU A;  3VHT C;  1GUA B;  1PQS A;  3AI5 A;  3SD5 A;  4D0N B;  3C0R B;  3I3T B;  3L08 A;  2KFK B;  3VFK A;  3W1Y A;  2DA0 A;  2KZR A;  3VH3 B;  2DYO A;  5CTR C;  2ZNV C;  2NS5 A;  2MBO A;  3GYO A;  3Q3F A;  4NJ7 A;  5GMV A;  3P7Z A;  1E7V A;  4B95 A;  3DOW A;  3O65 B;  4MSQ B;  3A4R A;  2L2I A;  2I1K A;  1MK7 B;  3RZW C;  1E8X A;  3R7Q A;  1BWN A;  1U5D A;  3B1L X;  5JHG A;  2KD0 A;  5CHF A;  4FJY A;  4X57 B;  5KQ1 A;  4W9E A;  4K2P A;  4JKC A;  4G50 A;  1RRP B;  3PLU A;  2XBB C;  3WAN A;  4HCN B;  2NBW B;  4EUT A;  2FCS A;  2IO1 B;  3QX1 A;  4DHZ E;  4NQK E;  1E90 A;  4W9C A;  3EEC A;  4BVU C;  5J2R A;  4Z2N A;  2XK5 B;  3O96 A;  1LM8 B;  3V6E B;  1KOT A;  1P98 A;  4MEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...