1EF1A

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOESIN
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 89
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ef1A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ef1A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef1A01
3NY5A 3R7QA 2RNRB 1UELA 1U5GA 4EZLA 4HHVA 3CIKA 2FCMA 1S3SG 3UIOB 2D9WA 1MG8A 4K17A 1Y5OA 1C3TA 1V2YA 3ZVRA 4IUMB 4EEWA 5CTRC 3T8MA 3PSCA 3LJ3A 5HE0A 2BWFA 2CS4A 2JPHA 2KNBA 1M7RA 3D8EA 5JLJB 1KI1B 3EFUA 4IM3A 5KHQA 1GC6A 1UBIA 4F7GA 2O6VD 4JGHB 2UVMA 2FCNA 2IO3B 4W9IA 1GJZA 1V61A 3PVWA 4MY6A 3IVFA 2GMIC 3ULBA 4EZKA 3ZUNA 2LULA 2AL6A 2N1WA 4GN1A 4TKNA 4AUQC 3H7SA 2H7EA 1MAIA 1GG3A 2MDXA 2DAJA 4CO7A 2ROZB 4DK5A 2Y8FA 2C5LC 2KK8A 3V60A 3G9WA 3A98B 2JF5A 2OQBA 4EUTA 4FLHA 1WGGA 2W2XD 3KVFB 2P8VA 4A20A 3W1YA 1HE8A 1ZC3B 1HB6A 5L83A 5JP4A 2KDBA 3O65B 2M0XA 3TVVA 3M63B 2R0DA 2DYBA 1QQGA 2D3GA 2LOZA 1XD3B 2GBMA 3HQCA 1KZGA 3CSTA 3M1IB 1W1DA 1V9JA 1YX5B 4KV2A 4LDTD 2D4QA 3P2BA 2NS5A 3DXDA 3T06A 5J3TA 1ACAA 1Y8RC 4AJYB 3SO6A 4HCNB 1E7VA 3A33B 1NBFC 1EUVB 3FP5A 1V5TA 2AL3A 1OQYA 5DIFB 4Z2MB 4ICVA 2EJ8A 3CMMB 5GMVA 4GDLA 2ZVOA 1EAZA 1V88A 2MP2A 2LRUA 2ZZPB 4OVVA 2KMCA 4GMXB 3FEHA 1NI2A 2VSZA 2LGXA 1E8YA 2ZPNA 3A9KA 4ANXA 1Q0WB 1I42A 1DROA 3NS8A 3PSEB 1FHWA 3L17A 4TYZA 3ZKJC 1OQNA 2L3ZA 3KH0A 1J19A 5D7GA 1LM8B 2LASA 1MKEA 3NSUA 4PNKA 2MRPA 2O2VA 3OLMD 2NVUI 3WAPA 3DXCA 2DAFA 3I3TB 2JXXA 3ZTDA 4MEMA 2W9NA 1X1MA 4HK2A 2KO3A 2YRYA 1MK9B 2UZRA 4FA6A 4HB3B 4DHJD 4EKUA 4HAYB 4GZUA 3VDZA 4F7UP 1WJ1A 4GPTB 4HAZB 4PYZA 4IM2A 4WWOA 2KANA 4JQWC 1SIFA 2LVPA 3RZWC 1P3RA 3SDLC 3A1QB 1NTVA 2Z0DB 5D6JB 3UQBA 3RZFA 2DN6A 4PS8A 5DPWA 1E7UA 1UNRA 1LXDA 1WMHB 4WQOB 2A5UA 2M4NA 2N23A 3BJIA 2MX2A 1TTNA 5CHWA 4IFSA 1D3ZA 1ST7A 1WVHA 3WAMA 1AQCA 1WGRA 2C7MB 4HXDA 1WZ0A 2DYOA 2G35A 2GOWA 2HD5B 2D10A 3N7CA 3ODWA 2BCJA 1P5TA 4KHAA 3PG7A 3ZW3A 3HK0A 2ZPYA 2ZNVC 2Z0EB 3VVWB 5J3YA 4NJ7A 2K2JA 1YX6B 2L1CA 1M94A 2DENB 2D9VA 1XD4A 4EFOA 1GC7A 1IRSA 4IOYX 2COFA 5DPTA 1TGZB 2A4ZA 1P0RA 1DDVA 1OTRB 2BKRB 1WXVA 1L2NA 1R4NI 2LXAA 4A5KA 2LI5A 1WXAA 1Q5WB 1EVHA 5FR6A 2K39A 2KX3A 2DLWA 4E74A 3KYDD 2IO0B 2BYEA 3K9PB 4TUUA 3PHXB 4NSWA 4AOFA 3H9DA 2DYMA 3ALBA 3V5WA 2ELBA 2EC1A 4HB4B 4DWFA 3L16A 1SGHA 2V1YA 2XK5A 3KUDB 4HDQA 2MBHA 3JW0X 5JHBA 2COAA 2HTHB 3A4SC 4HAVB 5TR5A 1C1YB 3GOEA 3U30A 4BKSD 4CHJA 2BGFA 5AEKB 3CSFA 3VH3B 3TFMA 2MWSB 5HE3A 2ASQA 1P98A 3VXWA 2KWUB 2JWZA 2L0FA 4TQ0A 4HATB 1WG7A 5JH5C 2Z0OA 1WX8A 3TO1A 3ONSA 4KSLC 3WANA 1LQBA 4CHKA 3BINA 5FI0A 2KTFA 3ODXA 2N9XA 2I1KA 1WH3A 1E8WA 5LLIA 2HTHA 4MSMB 2BYFA 2O6VB 1ZSQA 1U5FA 1ZGUB 4EMOA 4YONA 2LXCA 1OMWA 2KWCA 3DXEA 5IA7A 2WYQA 2CQUA 3PHWB 1KOTA 5JZEB 3T9LA 3ZLZA 4NAWB 4II2B 2B3AA 2MA9B 5AZGA 2UWQA 2NBWB 2KFJA 5DHFB 3ZRCA 2YVCA 1VCBA 4W9CA 4G11A 5J17A 1YQBA 3JVZX 3W1SC 1V6EA 3PRMB 2NMBA 1XODA 1NTYA 4GMVA 1U5EA 4A6KA 4GDKB 1IP9A 2KOXA 3QIJA 4DX8A 3L54A 2H7DA 3IFWB 1A5RA 4WVFB 4BKTA 1PLSA 4KDIC 2GS0A 2BWES 2GCLA 5CHFA 4NAWA 4ASWC 4W9LA 1UGMA 4OVUA 2LWPA 4BBNF 3V6CB 4B95A 1J0WA 2LG1A 3LDZE 3DVNV 2L00B 4K7SA 1WZ3A 2V76A 1Z87A 2DZIA 4WJQA 4F1SA 4HAXB 5HE2A 1ZC4B 5BO4B 3WIMA 4P7IA 1FXTB 1P6SA 1NTIA 4GOCA 4FADA 3UGBB 3VTUA 2W2WA 4LCDE 2W2XC 2KD0A 5DH9B 3PT2B 3APDA 2WX0A 4EJNA 3QX1A 1F9JA 4KVGB 4DHZE 2KCJA 2DHKA 2D9XA 1MK7B 1J0GA 3KYCD 4ICUA 2RR9A 1XKEA 1DBHA 3EPYA 4I6PA 3L13A 4PS7A 4CYEA 3Q3JA 3IG3A 1E90A 4J6IA 5AZHA 2NBUA 4HCPB 3OANA 3PV1A 1U2BA 2DHZA 1K8RB 2J0KA 1SE9A 4PS3A 3VH4B 3RD2A 1WX9A 2ZJDA 4IW0A 4M8NA 4G50A 5J2RA 3WAOA 2YLMA 1RRPB 1W1GA 5DCNA 3S2AA 4K7WA 4MDKE 2NZ8B 3AU5A 2NR2A 3HIZA 3PTFC 2L8JA 2M8SA 5LXHA 3SUZA 2FJ9A 2JVCA 1V5UA 2LZ6A 2CY4A 1UH6A 2IYDB 4PYUA 2DKQA 3A9JB 2GBRA 1WJNA 4ZRJA 1X11A 2Y7BA 1OGWA 2G3QB 4XZ4A 3KRXA 1FOEA 3IBEA 2C7HA 2R2QA 3FLVA 1X1GA 2LUEA 3RCPA 2K25A 1KZ7A 2YF0A 1ZW7A 1WGQA 3TL5A 1AWEA 3RYTA 5DI9B 2N7EA 2QHOA 2JUOA 2DHIA 4E71A 1UBQA 5J18A 1WXSA 3ZNHB 3O96A 4GB9A 4MT7A 5D3VA 3ML9A 3MHSD 5DPRA 2Y5BB 1FAOA 2N1VA 4IG7B 1EF1A 2JZ3B 4BOSC 3U7DA 2V3SA 4MH0E 3H1UA 1WJMA 3PREA 4BVUC 3VOQA 5DPSA 1I2HA 3QWMA 1KJTA 3AI5A 2IYBA 3WYFB 5G2NA 2ZNVB 1T0YA 4EZJA 2FIDA 3L0WB 3HHMA 3DBHI 2CB8A 2MW5A 2JRIB 1JRUA 4WJNA 1WGDA 2MQJA 2GBKA 3K9OB 3V6EB 1KLVA 3QBVB 2YS3A 4ZRIA 3QCAA 1WJ6A 2QKLA 2COPA 5C23A 2ZVNA 1E8ZA 2FCQA 3QHTA 2KJRA 4KZ0A 1I7AA 4H8SA 1TJ6A 2KDIA 5CHVC 3C0RB 3NZUA 2KGXB 2RSGA 2AEHA 2D9YA 4MJSB 3UIPB 3TMPB 4WJPA 5DHAB 2VRRB 3GYPA 5LOPB 1S1QB 2KDFB 5AZFA 5C79A 2CR5A 1H8CA 2K00A 2K1FA 3DBLI 2FJLA 1GNUA 3DVGY 4NPNA 4RM9A 1V49A 4W9EA 3A1QA 2UZSA 4DX90 2P0FA 3APFA 3ENEA 2G4SA 4GIVA 1UNQA 1IYFA 2CODA 2CU1A 1YJ1A 2RSUA 1WMHA 1WXMA 4MJSA 1J8CA 2N9PC 3WALA 3D8FA 3P7ZA 4K81A 2FDQA 2BKFA 1WJUA 1SHCA 4D0NB 3ZNGC 3QWZB 1K5DB 3V62A 2D2QA 2FIFA 2IZVB 4ANUA 4NJ6A 2MFQA 1H10A 4MK0A 2L2IA 1KM7A 4B6HA 2DX1A 3QAQA 1WGHA 1YD8U 5D3YA 4MELA 1WM3A 2LVOA 3MJWA 4L6EA 4FHJA 1Y19B 3KY9A 4G0NB 2IFSA 5KHOA 1FHOA 3A8PA 2ROVA 3TIXA 5C5BB 4JLCA 3DCGA 4HPLB 1ZM0A 3MPXA 5JHGA 1WM2A 4WWPA 1BTKA 1L7YA 1WE6A 3QJZA 1V89A 3FM8C 4FULA 2XBBC 3ZNID 2KWVB 2LYDA 2KTRB 5D2MB 1FGZA 4AWJA 2MLBA 3KRWA 1WRDB 2LOXA 2WX1A 4GSWA 4K2PA 3B08A 2NPTB 3VQIA 4HVBA 2RD0A 1WR6E 4JL9A 5C5BA 4I6LB 3TJPA 1XR0B 1MIXA 1TXDA 2DYNA 4A3OA 3F5RA 3W1SA 4DBBA 3R66C 2K6DB 3N32A 2WWZA 2ZEQA 2YSZA 3U8ZA 1WE7A 2WDTB 1WI1A 1WF9A 2G45B 1U4AA 2CHZA 2UYZB 2MCNB 2VRWB 2LRWA 1MIZB 4A6FB 3NZSA 2O6VA 4KIKB 5D3XA 3ZIMA 3VUWA 1EF5A 3UQAA 1NDDA 4IM0A 4W9HA 4KDLB 2LKOA 5E6PA 2MSED 3HM6X 3ZRFA 3DQVA 4IWPA 3DOWA 4BBKA 2IY1B 4KHBB 4LDTB 4Y94A 4K1RB 4LJPB 2MBOA 3AXCA 3ZDTA 2IBIB 2GJYA 2KC1A 2CAYA 1RRBA 4AP4C 3EC8A 1Z2MA 2RUKB 3KZ1A 3M62B 2G4DB 2OOBB 4DDID 1ZVRA 3HW2B 2M17A 2RQ1A 4KIKA 3RT3B 2DHJA 4GDKA 2BPSA 2VKIA 4IWQA 4JIOU 2IY0B 1RFAA 3TBLD 2M14A 3JYUA 3KSYA 4A6HA 5JHAA 4AJWA 1MPHA 4FBJB 4M0WB 2KLGA 4NQLB 1UPQA 5GOWB 2LGYA 2I5FA 2LJ5A 2EMSA 2KQSA 1WY8A 3KW5B 2GBNA 4HAWB 2FCSA 4TV3A 1XX0A 1I35A 1ISNA 2KUPA 1IPGA 3R7RA 4HDOA 4DDGD 3ODOA 1BT0A 4BBNC 1PMSA 5KQ4A 3DBRI 4F7ZA 5HE1A 2K8BA 3QA8A 4MGZE 4X57B 3BY4B 1EGXA 4IAPA 2P0DA 2J0JA 3VUXA 2I1JA 4DHJB 2DZMA 4M8MA 3UZTA 3D8DA 2HE7A 1M7EA 2ZCCA 3QARA 2N7DA 2CRFA 2KZRA 4RMAA 2KHWB 1H4RA 3N30A 3RULA 2HRJA 4F7HA 2XQNM 3VTVA 3FSSA 2ABDA 2FNJB 4BFRA 3SYXA 3OJ3A 3IHPC 3NOBA 3MTNB 3QK0A 2C60A 3QQ8B 2DZJA 2KC2A 1UNPA 1N3HA 4NNJB 2COCA 1V81A 4HAUB 1OEYA 2M1MA 3EHVA 4W9DA 4E3CA 5C16A 3VHTC 2NCNA 4GDLB 2MBQA 4DXAB 1WI0A 2MP2B 1OY2A 1P9DU 5LONB 1FGYA 2DKPA 2M38A 4C0AA 3A9KB 2PE9A 5CLLB 4BOZB 3CF6E 4YL8A 2J59M 2LBBA 3SNHA 4MGIE 5KQ1A 5D27A 2Z59B 1CMXB 1XT9B 1XQQA 1PFJA 4WJ7A 1TBEA 4GXBA 2O2VB 1QZEA 4DHZB 2BF8B 3UF8A 3ML8A 4K7UA 3X0WA 2CKHB 2I5CA 2V4LA 1BWNA 4WWNA 3VTWA 4A3PA 1W1HA 3A9JA 4G3XB 2RPQA 2EKEC 3VAWA 2GCJA 2Y8GA 4EOYA 3DDCB 3B0AA 1K5GB 1EO6A 2D9ZA 4FJVB 1UEFA 4I6NB 5D94A 2OJRA 1V80A 2KQ7A 2PE6B 1VD2A 2Z0PA 3ML4A 2BYVE 1DDMA 3PP2A 4WJOA 3L08A 5FI1A 2CHWA 4IWOA 2WH5A 2DYQA 2MBEA 4TQ1A 2YT0A 1V5MA 5E6OA 1RJ2A 2KX0A 2PZ1A 2YT1A 2FUHB 3D32A 2R2OA 5C1ZA 2JP2A 3H6NA 2E2XA 1HBKA 3EECA 3ZVVA 2KLCA 1TQZA 4CHMA 4KHOA 1X05A 3VUYA 2JZZA 1WGYA 3VIAA 1PQSA 4ANVA 1E8XA 5L81A 3KUCB 5IJMA 1UPRA 4GU2A 2YS5A 3OJ4B 4II3B 3L10B 1GUAB 1V86A 4MM3A 5D3WA 4IC7B 1TZ1A 4HJKA 4F8CB 3ULCA 1X1FA 4BKSA 3PS6A 2K2UA 2DTCA 3MDBC 4ZRKA 4DBGA 3ZDMC 1WJ4A 4WSFA 2GBJA 3SV1A 4HB2B 2DZKA 4PQ0A 4ZDVA 3P6AA 3KUZA 3SD5A 5E6NA 1Q67A 4XWXA 2JT4B 1QC6A 2KDEB 2DX5B 2L7RA 4MGKE 4W9FA 3V61A 3PVLA 1U29A 2AWTA 3RCZA 3Q3FA 2NBVB 1WR1A 1U5DA 5EFXA 2XK5B 3ZTCA 5C6RA 5IAAC 1RLFA 2KJ6A 4FHKA 1ZKHA 4FJYA 4N9F4 2IO2B 1P1AA 1XCGA 4W9KA 4W9JA 4HLEA 4Z2NA 2JY6A 4FJZA 3ZO5B 4RM8A 3GZNI 4B9KA 3DPDA 5J3QA 2RGNB 2REXA 1G6JA 2ZCBA 3ZNZB 3DVGX 1BTNA 3TCAA 2DX5A 3PLVA 2L05A 5L95C 3HM3A 1RAXA 2L0TA 2FAZA 2ADZA 2K8HA 2KXJA 3F0WA 3R3MA 2HJ8A 1WYWB 5CX3A 3PPAA 3DVNU 4KAXB 3TW1A 4HWIB 3PZDA 3AULA 2KMAA 1UZXB 4MGYE 2PEAA 4LJOB 2RGFA 2MWNB 3A8QA 1B55A 3PRPB 5G55A 2X18A 4NY0A 4ZYNA 5KCVA 3B1LX 1Z5SB 2DA0A 5HKHA 3PVUA 3AU4A 1FB8A 4WAAA 5CLQB 2N0YA 1YIWA 3M3JA 2YS1A 4K2OA 2J7QB 3DBSA 2KJHB 1DYNA 4KSKC 2D11A 2KKCA 3RUIB 3M95A 2J0MA 2QKMA 2K6QA 4ANWA 5EDSA 2IO1B 4KZCA 2PPHA 3SHQA 3N3KB 1NVLA 1BAKA 2KFKB 2CHXA 1NU2A 4NQKE 4XX5A 1UD7A 1FHXA 2RLOA 1WX7A 3ECIA 2ELAA 2CY5A 3GYOA 2AYOB 3A4RA 3LJUX 2PJHA 2LD9A 1V5OA 4HPMB 3JSVB 1WIAA 3CXBB 4GGQA 2N9EB 1E5WA 2C9WB 3X23A 4BKGA 1LFDA 4XC2A 1P3QU 2KTRA 1V5PA 2OTXA 3PEGA 1U27A 3H7PB 4FN2A 2Z0QA 2KVRA 3PGEA 4HB0B 5JHHA 3UINB 1OEYJ 2NPTA 2KFKA 4W9GA 4URKA 4MSQB 1R4MI 2MBBB 1Q1OA 2C7NB 2N4FA 1HB8A 2EMTA 1WFYA 3AJ4A 3JSVA 2JRHA 2LVQA 1DDWA 3PLUA 2KN5A 3OAWA 3APCA 2K8CA 2Q13A 2XEWA 2P0HA 2MKRA 3WA0A 2R09A 2D07B 3VFKA 2LGDA 1LW3A 3H7PA 4B6WA 2L76A 3PRZA 5LXIB 1WGUA 3NHEB 3SU8X 1AARA 1LB1A 3QC8B 2DFKA 2RVBB 1X86A 4A6FA
chains in the Genus database with same CATH superfamily
3KLSX 1RYJA 3NY5A 3R7QA 2RNRB 1AN8A 2JXTA 3PZ8A 1UELA 1U5GA 4EZLA 4HHVA 4C4VA 3CIKA 2FCMA 1S3SG 3UIOB 2D9WA 1MG8A 4K17A 1Y5OA 1C3TA 1V2YA 3ZVRA 4J3OD 2SEBD 4KHBA 1KH0A 3L4PA 4A9AA 2FUG1 4IUMB 3AE6B 4LNFA 4LNIA 4EEWA 2K5PA 1YN5A 4HEA1 5CTRC 3T8MA 1TZOA 3PSCA 3LJ3A 5HE0A 4KX6B 3P4QB 2BWFA 2CS4A 1RM6C 4ZRQA 2JPHA 2KDMA 2KNBA 4WAFA 1QF6A 1M7RA 3D8EA 3BYYB 5JLJB 1MI0A 1P7EA 1KI1B 3EFUA 4IM3A 5KHQA 3AE3B 1GC6A 1UBIA 2WXNA 1HTOA 4F7GA 1N6ZA 2O6VD 4JGHB 2UVMA 3H8HA 2FCNA 2IO3B 2AQ3B 4XWTA 4W9IA 1GJZA 1V61A 3PVWA 4MY6A 3IVFA 2GMIC 3ULBA 3UI3A 4EZKA 1K50A 3ZUNA 2LULA 2AL6A 2N1WA 1AWDA 4TKNA 4JKBA 4GN1A 1VRAB 3N1YC 4AUQC 3H7SA 3I63C 2H88B 2H7EA 1MAIA 1GG3A 1TYGB 2MDXA 2DAJA 4CO7A 2ROZB 5I2SA 4DK5A 2Y8FA 1JCKB 2C5LC 2KK8A 1XLPA 1PGXA 3V60A 1E0ZA 3G9WA 3A98B 3BIID 3AEDB 2JF5A 2OQBA 4EUTA 4FLHA 2WDRB 1NEKB 1WGGA 4XYCA 4XE0A 2W2XD 3KVFB 4MT5A 1JMLA 2P8VA 3HIEA 1DOYA 4A20A 2Z13A 3W1YA 1HE8A 1ZC3B 1HB6A 4XGAB 5L83A 5JP4A 2KDBA 2WGSA 3O65B 1HA5A 2M0XA 3TVVA 2N0SB 3M63B 2R0DA 4WWMA 2DYBA 1QQGA 1JW9D 2D3GA 2WXGA 5D3IB 2LOZA 1XD3B 2JWUA 2GBMA 3HQCA 1KZGA 3CSTA 1HZ5A 5LNK1 1YJJA 3M1IB 1W1DA 1V9JA 1YX5B 4KV2A 4LDTD 3TEXA 4ZYSA 2JYEA 1JQ4A 2D4QA 3P2BA 2NS5A 3DXDA 3T06A 5J3TA 1R4NB 3Q2AC 2XN9C 4OW0A 5M4YB 1ACAA 1Y8RC 4AJYB 3SO6A 4HCNB 1E7VA 3A33B 1NBFC 3NWAA 1EUVB 3FP5A 1UUPA 5T8IA 1V5TA 2AL3A 4RGTA 1OQYA 2GLSA 3OG5A 2XNAC 5DIFB 4Z2MB 4ICVA 2EJ8A 1WSPA 1RFKA 3CMMB 1SB3C 5GMVA 4GDLA 2ZVOA 1EAZA 1V88A 2MP2A 2LRUA 2ZZPB 4OVVA 2KMCA 4GMXB 3FEHA 3U2SC 1NI2A 2VSZA 2LGXA 1E8YA 2J53A 2ZPNA 2HJ1A 1FPYA 2PMVA 3A9KA 1I4XA 4ANXA 1Q0WB 1I42A 1DROA 3NS8A 3PSEB 1FHWA 1FFUA 3L17A 4TYZA 3ZKJC 1OQNA 5EE3A 2L3ZA 3KH0A 4NZLB 2LHEA 1J19A 5D7GA 5FK9C 1LM8B 2Z59A 1JALA 2LASA 1MKEA 1KF6B 3NSUA 3Q3OC 3U4EG 4PNKA 2MRPA 3ZJTA 1PDXA 2O2VA 5HHDG 3OLMD 1T0QC 4RH6A 3DHHC 3RNCC 2NVUI 3WAPA 3DXCA 2DAFA 4B0MA 2L52A 3I3TB 2JXXA 3T3NA 3ZTDA 4MEMA 1J7CA 1X1MA 2W9NA 1D5XC 4HK2A 1I7HA 2KO3A 2YRYA 1MK9B 3P63A 2UZRA 3Q6BA 2JYTA 2QC8A 4FA6A 1TKGA 1AYFA 2RDHA 2INCC 4HB3B 4DHJD 4EKUA 4HAYB 2WHIA 4GZUA 3VDZA 4F7UP 3NVWA 1WJ1A 2MEKA 4GPTB 4HAZB 1FMAD 4PYZA 4IM2A 4WWOA 2KANA 4D2KA 4PK1A 4JQWC 1EU3A 1E9MA 4DIXA 1SIFA 1OQRA 3CIRB 2LVPA 3RZWC 1P3RA 2Q5WD 3SDLC 1DOIA 2D3AA 3A1QB 1HXYD 3SEBA 1ESFA 1NTVA 2Z0DB 3HVDA 2WU2B 2K0PA 5D6JB 3RZFA 3UQBA 2DN6A 2LUMA 4KGSA 2M56B 2PIAA 2ACZB 4PS8A 5DPWA 1E7UA 1UNRA 1LXDA 1WMHB 2SAKA 4WQOB 2A5UA 2M4NA 2N23A 2WXLA 3BJIA 2MX2A 1TTNA 1XEEA 5JXVA 3P42A 4R3DA 5CHWA 4IFSA 1D3ZA 2BQQA 1ST7A 1WVHA 3WAMA 4MH8A 1C76A 1AQCA 1WGKA 1WGRA 2C7MB 4HXDA 1WZ0A 2DYOA 2G35A 3NWFA 2GOWA 2HD5B 2D10A 3N7CA 3ODWA 1DGJA 2BCJA 1P5TA 4KHAA 3PG7A 1SIJA 3ZW3A 3HK0A 4KGTA 2V0GA 2ZPYA 2ZNVC 1TS4A 2Z0EB 3VVWB 3OHMB 5J3YA 4NJ7A 2K2JA 1YX6B 2L1CA 1FEHA 1F2RC 1M94A 2DENB 3NG0A 2D9VA 1XD4A 4EFOA 1QOAA 1GC7A 1IRSA 4IOYX 3TEWA 1NENB 2COFA 5DPTA 3R2IA 1TGZB 2A4ZA 3E9OA 1L0YB 1UGJA 1P0RA 1DDVA 1I4QA 1OTRB 1FM0D 2BKRB 1WXVA 1L2NA 1R4NI 4C7ZA 2LXAA 2W55A 1FXAA 3RNAC 4A5KA 3I9V1 2LI5A 1WXAA 3ZYYX 1Q5WB 1EVHA 5FR6A 2K39A 4N6EB 2KX3A 2DLWA 4E74A 3B2GA 3KYDD 2IO0B 1JWUD 1EM7A 3DHGC 2BYEA 3K9PB 1GOZA 4TUUA 3PHXB 4NSWA 4AOFA 3H9DA 2DYMA 2X0SA 3ALBA 3V5WA 2ELBA 2PKOA 5H8YE 2E3TA 1NVID 2EC1A 4HB4B 4DWFA 3L16A 1SGHA 2V1YA 2XK5A 3KUDB 4M00A 4HDQA 2MBHA 2W3SA 1T77A 3JW0X 5JHBA 2COAA 2HTHB 3AE1B 3A4SC 4HAVB 5TR5A 1C1YB 3GOEA 5BYSA 3U30A 2CJOA 4BKSD 1ZP0B 4RGMA 4CHJA 2BGFA 1LGRA 5AEKB 3IT6B 3CSFA 3VH3B 1T5XD 1FNWA 3TFMA 2MWSB 1N62A 1YQ4B 5HE3A 2ASQA 4L1RA 1L0VB 1P98A 3VXWA 1Y56A 2KWUB 2JWZA 2L0FA 4TQ0A 4JKAA 1E7PB 4HATB 1WG7A 5JH5C 2Z0OA 1WX8A 3TO1A 2JZPA 4HROA 3ONSA 4KSLC 3AMZA 3WANA 1LQBA 4CHKA 3BINA 4RF0A 5FI0A 2KTFA 3ODXA 2N9XA 2I1KA 1WH3A 1E8WA 5LLIA 1ZPSA 2HTHA 4MSMB 2BYFA 2PW9A 2O6VB 3W5VB 1ZSQA 4HJGE 2HTME 1U5FA 1ZGUB 4EMOA 4YONA 2LXCA 3AEBB 1OMWA 2KWCA 3DXEA 2WLBA 5IA7A 2WYQA 1I4HA 2CQUA 2WXQA 3PHWB 4JPSA 1KOTA 3SFEB 5JZEB 1GPXA 4LK0M 1MVKA 3T9LA 3ZLZA 4NAWB 4II2B 2B3AA 2JU6X 2MA9B 3R2TA 1QILA 5AZGA 2L32A 1BMLC 2UWQA 2NBWB 2KFJA 5DHFB 3ZRCA 2YVCA 1P7FA 2ZKMX 1FRRA 1VCBA 3EA6A 4W9CA 4G11A 4FXCA 5J17A 2WU5B 3NUHB 1N60A 1YQBA 4ZHPA 3JVZX 3W1SC 1V6EA 3Q69A 3PRMB 2NMBA 1XODA 3DWMA 1NTYA 4GMVA 4LTUA 3V05A 1U5EA 4A6KA 3BK2A 4GDKB 5G5GA 1IP9A 4YTMB 2KOXA 3QIJA 4DX8A 3L54A 2QIEB 2YT2A 3FILB 2H7DA 2D3BA 3IFWB 1MI1A 1A5RA 4JKGB 4WVFB 1HEZE 2CJNA 2WXIA 4BKTA 1JWAD 1PLSA 3AH7A 4KDIC 2GS0A 2BWES 2GCLA 5CHFA 2QDFA 4NAWA 4ASWC 4W9LA 1UGMA 4OVUA 2LWPA 4BBNF 4CQNA 3V6CB 3N20C 3BVZA 4B95A 5D3DA 4AS1A 1QOFA 5EE0A 3ZXVA 1J0WA 2LG1A 2N9KA 1NYRA 2ON8A 4GLSC 2IPKD 3LDZE 3DVNV 2L00B 3NWDA 2CU3A 3KQ4A 4IOIE 4K7SA 1WZ3A 4USAA 2V76A 1Z87A 2DZIA 4WJQA 4F1SA 1MG4A 1YQ3B 4HAXB 3U12A 1IGDA 1MHXA 5HE2A 1ZC4B 1XCQL 2INPE 5C2TB 5BO4B 3URYA 3WIMA 1VDVA 5C3JB 4P7IA 1FXTB 1I4PA 2KACA 5JVLA 5EE9A 3W2DA 1AW7A 1P6SA 2RDBC 1NTIA 4GOCA 4FADA 3UGBB 4KKJA 2M0AA 2GI9A 2PVOD 1QLBB 1ZDVA 3VTUA 1UWXA 2W2WA 4LCDE 2W2XC 1NYQA 2Y5PA 2KD0A 5DH9B 3PT2B 1B1ZA 2BW2A 3APDA 2WX0A 4EJNA 3RFZB 4ARIA 3QX1A 2N9LA 4MACA 1F9JA 4KVGB 4DHZE 4DQOC 2KCJA 2DHKA 3DBHB 3Q3MC 2D9XA 1MK7B 1QOBA 2WXMA 2VH2A 2KQ4X 1J0GA 2KMMA 3KYCD 4ICUA 1C78A 4YSXB 2RR9A 5FKAC 1XKEA 1D5ZC 5I2MA 3RN9C 1CQVA 4K3CA 1DBHA 3EPYA 1L4ZB 4I6PA 3L13A 1VBGA 3ABVB 4PS7A 4BZAA 1WRIA 4CYEA 3Q3JA 2DLBA 4ILHA 3IG3A 1R7SA 1E90A 4J6IA 1L6VA 5AZHA 4P16A 2NBUA 4HCPB 2IDYA 3OANA 3E9SA 3PV1A 3TEZA 1U2BA 2M19A 2DHZA 1V1PB 1K8RB 3BWUD 2J0KA 1SE9A 4PS3A 3NW8A 3BYTB 3VH4B 3RD2A 1WYGA 1WX9A 4ILGB 1WXQA 3AE5B 2ZJDA 4IW0A 4M8NA 4RGNA 4G50A 5J2RA 3WAOA 2ZW1A 3VR9B 2YLMA 2R82A 1TIFA 1RRPB 1W1GA 1J7BA 5DCNA 2KAJA 3S2AA 2JSVX 4D6WA 4K7WA 4RFBA 4MDKE 1XLNA 1DOXA 2NZ8B 3AU5A 2NR2A 3HIZA 3PTFC 2L8JA 2M8SA 2OHFA 3DBLB 1D5MC 5LXHA 4OT1A 3SUZA 4M01A 4Q2JA 4WIPA 1KC7A 2FJ9A 3IAS1 2JVCA 4AQ7A 1V5UA 1TS2A 1SJHD 2WXPA 5HFYA 4L23A 2X8XX 4A90A 2LZ6A 2BB6A 1ZXIA 4JE3B 2CY4A 4EE2A 1UH6A 2IYDB 4PYUA 1QOGA 2BS4B 3IXSA 5I4DA 2DKQA 3A9JB 2GBRA 1WJNA 4ZRJA 1X11A 1YOVB 3NZ3A 2Y7BA 1OGWA 2G3QB 1K51A 4XZ4A 4JKCA 3KRXA 1FOEA 3IBEA 2C7HA 1JWBD 2R2QA 3FLVA 1X1GA 1A70A 2LUEA 3RCPA 2K25A 1L0XB 1KZ7A 3RNEC 4L2YA 2V3NA 2YF0A 1ZW7A 1WGQA 4YWGG 2ICIA 3TL5A 1AWEA 3PO0A 3RYTA 5DI9B 3Q3NC 2N7EA 2QHOA 2JUOA 2KIEA 4JX1C 2DHIA 4E71A 1ZDXA 1YJIA 3FC4A 4XWWA 1UBQA 5J18A 1WXSA 3ZNHB 3O96A 4GB9A 4MT7A 5D3VA 3ML9A 3MHSD 5DPRA 1L4DB 2Y5BB 1FAOA 4ACFA 3ZJVA 3I5JC 2INNE 2N1VA 4IG7B 3GE8C 1EF1A 2JZ3B 4BOSC 3LB8C 2FE8A 4YSYB 3U7DA 2V3SA 4ILJA 1C4CA 4MH0E 4CSQA 3H1UA 1WJMA 3PREA 3AEGB 3EGRA 3VOQA 3SR6A 4BVUC 1SEBD 5DPSA 3RNBC 1SF0A 1I2HA 5IN7A 3QWMA 1KJTA 3AI5A 2IYBA 1OFFA 3WYFB 3B9JA 5G2NA 2ZNVB 5H92C 3OWEB 4L1BA 1T0YA 3P4PB 4EZJA 2INDC 2FIDA 1UF0A 3L0WB 2J4XA 3AN1A 2WDVB 3HHMA 3DBHI 2CB8A 2MW5A 2JRIB 1JRUA 4WJNA 1WGDA 2MQJA 2GBKA 3K9OB 3V6EB 1KLVA 3QBVB 3AE7B 2YS3A 2KR0A 1MPEA 2TSSA 4ZRIA 3NS1A 1KRHA 3QCAA 3HVZA 1WJ6A 1EWCA 2QKLA 2COPA 5C23A 2ZVNA 1E8ZA 2FCQA 3QHTA 4LNOA 2RRFA 2DWQA 2G9HD 2KJRA 4KZ0A 1I7AA 4H8SA 1TJ6A 1VR9A 2KDIA 5CHVC 4JWUC 3C0RB 2VZKB 3NZUA 2BTEA 3NVVA 2KGXB 2YEPF 4YXDB 2RSGA 2J42A 2AEHA 2D9YA 4MJSB 2E6XA 3UIPB 2WXKA 3TMPB 3RI7C 1SSNA 1HQRD 1XXGA 4WJPA 5DHAB 2VRRB 4C80A 3GYPA 5LOPB 3AE9B 4QJ4B 1S1QB 2KDFB 4NAMA 5C79A 2AQ2B 5AZFA 2CR5A 3A58A 1H8CA 2K00A 3MC8A 2DIKA 2K1FA 2D3CA 3DBLI 5IP4D 2FJLA 1GNUA 4XDCA 3CWIA 4QJ5B 1N5XA 3DVGY 4NPNA 4RM9A 1V49A 3HUIA 1SXTA 2B76B 4OVZA 4W9EA 3A1QA 2UZSA 4DX90 2P0FA 3APFA 3P1MA 3ENEA 2G4SA 4GIVA 1UNQA 5BMHA 1IYFA 2CODA 2CU1A 1YJ1A 2RSUA 3C19A 1WMHA 1WXMA 4MJSA 1J8CA 2N9PC 3WALA 3D8FA 3P7ZA 2DNFA 4K81A 3AEFB 1VZ6A 2FDQA 2ONQA 2BKFA 1WJUA 1SHCA 4D0NB 2GB1A 1GGOA 2QCZA 2EELA 3AECB 4DXFA 1L5PA 3ZNGC 3QWZB 1K5DB 3V62A 1QKZA 2L83A 2D2QA 1VZ7A 2FIFA 2IZVB 4ANUA 4NJ6A 2LHDA 2MFQA 1H10A 1BUIC 2QILA 4MK0A 4OSNA 2L2IA 1KM7A 4B6HA 2DX1A 3E66A 4US9A 3QAQA 1WGHA 1YD8U 5D3YA 1YNTE 4MELA 1WM3A 2LVOA 2D5GA 1BXTA 3MJWA 4L6EA 4LLGM 4O1NA 4FHJA 3GB1A 1Y19B 2VH1A 3B77A 1XLQA 3KY9A 2BT6A 1TS5A 4G0NB 2IFSA 5KHOA 1FHOA 3A8PA 2ROVA 2QMTA 3TIXA 5C5BB 4JLCA 3DCGA 4HPLB 1ZM0A 3MPXA 4OZBA 5JHGA 1WM2A 4WWPA 2W82A 1BTKA 1L7YA 3HSAA 1WE6A 3QJZA 1V89A 3FM8C 3P4SB 4FULA 2XBBC 3DBRB 3ZNID 3PZ7A 2WP9B 2KWVB 2LYDA 4JK9A 3E9PA 2KTRB 1FO4A 2NTTA 5D2MB 1FGZA 4AWJA 2MLBA 3KRWA 2HDEA 1FFVA 1WRDB 2IJ0A 3TSSA 2LOXA 2KUQA 2V9HA 2WX1A 2G1EA 1T6BX 1JRPA 4GSWA 1MJDA 4K2PA 3MP9A 3B08A 4JK8A 2NPTB 4PT5A 3VQIA 1PFDA 1N61A 3MJ5A 4HVBA 2RD0A 1WR6E 4JL9A 5C5BA 4I6LB 4YSZB 3TJPA 1XR0B 3MHZA 1T0RC 2N7JA 1MIXA 5BMGA 1TXDA 2RDGA 4IKGA 3SFDB 2DYNA 4A3OA 3F5RA 3W1SA 4DBBA 1Q10A 4NJCA 2GUMA 3R66C 2K6DB 3N32A 2WWZA 1ZUD2 4KGRA 2JX5A 2ZEQA 4WQMA 2K22A 2AQ1B 3MC9A 2YSZA 3U8ZA 1V8CA 1WE7A 2WDTB 4JK7A 1WI1A 1WF9A 2G45B 3T3OA 1GB1A 1U4AA 1YN3A 4ARCA 1IGCA 2CHZA 2UYZB 3IAM1 2MCNB 1FIQA 2VRWB 2LRWA 1MIZB 4A6FB 1ROEA 3NZSA 2O6VA 4KIKB 1NI3A 2R2YA 5D3XA 3ZIMA 3VUWA 4QXAB 1EF5A 3UQAA 1NDDA 4IM0A 4W9HA 4RF1A 4KDLB 2LKOA 2OEDA 4C4VB 5BYRA 5E6PA 1UWMA 1KLUD 2MSED 4JWSC 3HM6X 3ZRFA 4OHJA 1RWSA 3DQVA 4IWPA 3DOWA 4BBKA 2IY1B 5GXGB 4N59A 3LYYA 1EU4A 4KHBB 4LDTB 4Y94A 4K1RB 4LJPB 2MBOA 1JWSD 3AXCA 2FJUB 3U52E 3ZDTA 2WXJA 3DHIC 3DWGC 2IBIB 3Q8BA 2GJYA 2KC1A 2CAYA 1RRBA 4AP4C 3EC8A 1Z2MA 2LMCA 2RUKB 2LGSA 2QEJC 3AV8A 2K9XA 2Y5CA 3KZ1A 4HKQA 3M62B 2G4DB 2OOBB 4DDID 1ZVRA 3HW2B 1T3QA 2RQ1A 2M17A 4KIKA 3RT3B 2KT7A 2DHJA 4GDKA 2BPSA 2BBCA 2VKIA 2IY0B 4JIOU 4IWQA 1RFAA 3TBLD 2M14A 3JYUA 3FILA 3AE2B 3KSYA 4A6HA 5JHAA 3TUOA 1MPHA 4AJWA 4FBJB 3NRZA 4JKGA 3AEEB 1VBHA 3BZDB 4M0WB 2KLGA 3C8YA 4BAXA 3VRAB 4NQLB 1UPQA 5GOWB 3ETRA 2LGYA 2I5FA 2LJ5A 2K49A 2EMSA 2KQSA 1WY8A 3SBGA 3KW5B 2GBNA 4HAWB 1GB4A 1YMHE 2FCSA 1FNVA 2BVCA 2LFIA 4TV3A 5EE1A 1XX0A 1I35A 1ISNA 4JKDA 4JKFA 2KUPA 1IPGA 3R7RA 4HDOA 3N9YC 2R61A 4DDGD 4ITKA 3BVMA 2WS3B 3ODOA 1M4VA 1BT0A 4BBNC 1PMSA 5KQ4A 3DBRI 4F7ZA 5HE1A 2QSDA 2K8BA 3QA8A 4HRSA 4MGZE 2ZW0A 4X57B 3BY4B 1EGXA 1DIKA 2GRIA 4IAPA 1ZOYB 2P0DA 2J0JA 3BVGA 2BB5A 3VUXA 2FBWB 1FD6A 2I1JA 4DHJB 3KWVA 2DZMA 4M0WA 4M8MA 3UZTA 3D8DA 2HE7A 1CK1A 1SE3A 1M7EA 1TY0A 1SBBB 2ZCCA 2NMQA 4HSIA 1F52A 3QARA 2N7DA 1FRDA 1ZXHA 2CRFA 1ZE3D 2KZRA 4RMAA 2KHWB 1H4RA 3N30A 3RULA 2HRJA 4WURA 3ZGZA 4F7HA 2XQNM 3LXFA 3VTVA 3FSSA 1LO5D 1FXIA 2ABDA 2FNJB 1MHHE 4BFRA 3SYXA 3OJ3A 1STEA 3IHPC 3NOBA 1F0ZA 3MTNB 3QK0A 1MFWA 3ZQ4A 3O13A 1HTQA 3ZXRA 2C60A 4YT0B 1C77A 3QQ8B 2DZJA 2KC2A 1UNPA 1N3HA 4NNJB 3AM9A 2COCA 3RPFC 4C7YA 2DBYA 1V81A 4OZCA 5FR3A 4HAUB 1OEYA 2M1MA 4ZOHC 2MJDA 3EHVA 4W9DA 4E3CA 5C16A 3VHTC 2BS2B 2NCNA 4GDLB 2MBQA 4DXAB 1FCCC 2KIGA 1TKEA 1OY2A 1WI0A 2MP2B 2PLPA 3AB5A 1P9DU 5LONB 1PYWD 1V1PA 4KKIA 1JDEA 1FGYA 2DKPA 4XDDA 2M38A 2I38A 4C0AA 3B2FA 1KFYB 3A9KB 2PE9A 5CLLB 4US8A 4BOZB 3CF6E 1ZYIA 4YL8A 2J59M 2LBBA 3SNHA 3P4RB 3FKYA 4MGIE 5KQ1A 5D27A 3GZNB 2Z59B 1CMXB 2PVGC 5E6JA 1XT9B 1XQQA 3N1XC 1PFJA 4WJ7A 2RMMA 1JWMD 1TBEA 4GXBA 1SE2A 2O2VB 1QZEA 5IO9A 4DHZB 2BF8B 1N63A 3UF8A 1IUEA 3ML8A 2V4IB 4K7UA 3X0WA 2WXRA 2CKHB 2Z14A 1CZPA 4IDIA 2I5CA 2LGIA 2V4LA 1BWNA 4WWNA 3VTWA 3Q8AA 4A3PA 1W1HA 5MPOA 1ACCA 2LJIA 1T0SC 3A9JA 4G3XB 2RPQA 2EKEC 3VAWA 2GCJA 2Y8GA 4EOYA 5AUKA 3DDCB 3B0AA 1K5GB 1EO6A 2KVZA 2K8EA 4HKZE 5HI1A 3E9LA 1C4AA 2D9ZA 4RGOS 4FJVB 1UEFA 4I6NB 5D94A 3Q8CA 3VR8B 2OJRA 3EUB2 1V80A 1GAQB 2KQ7A 2PE6B 1VD2A 2Z0PA 3ML4A 2BYVE 1DDMA 4MM3B 2AX5A 3PP2A 4WJOA 1HZ6A 3L08A 5FI1A 1XF5L 2CHWA 4IWOA 2WH5A 2DYQA 2MBEA 4TQ1A 2YT0A 1V5MA 5E6OA 1RJ2A 2KX0A 2PZ1A 2YT1A 2FUHB 3D32A 2R2OA 2Z8LA 5C1ZA 3MFGA 2JP2A 3H6NA 2E2XA 1HBKA 3EECA 1XLOA 3ZVVA 1V1OA 2KLCA 1TQZA 4CHMA 5IOIA 3Q8FA 4KHOA 4QAYA 4S0RA 2V3PA 1X05A 3VUYA 2JZZA 1WGYA 3VIAA 1PQSA 4ANVA 4P1CC 5HG2A 1E8XA 2KYWA 1DYQA 5L81A 2JQRB 1V97A 3KUCB 2YEPB 5IJMA 1UPRA 2LEKA 2YS5A 3OJ4B 4GU2A 4A6QA 2BS3B 4YTPB 4II3B 3L10B 4TMAB 3E56A 1GUAB 4QJ3B 1PUTA 1V86A 4MM3A 5D3WA 4IC7B 1YN4A 1TZ1A 4HJKA 4F8CB 3ULCA 3IT4B 1X1FA 4BKSA 1PGAA 3PS6A 2K2UA 2DTCA 4GOUA 3MDBC 4ZRKA 2Z4DA 4DBGA 1K52A 3ZDMC 1ET9A 2Y3AA 1WJ4A 3N1ZC 4WSFA 2GBJA 2IGGA 3SV1A 4HB2B 4S17A 2DZKA 4PQ0A 4ZDVA 3P6AA 3GE3C 3GS2A 3KUZA 3SBTA 3SD5A 1UNSA 1B9RA 5E6NA 1Q67A 4XWXA 1L6UA 2JT4B 4ZHOA 1QC6A 2KDEB 1R4MB 3Q8EA 2DX5B 3NVYA 2L7RA 4MGKE 4W9FA 3V61A 1K53A 2J52A 5G5HA 3PVLA 1U29A 2AWTA 1TS3A 3RCZA 1ET6A 2I2YA 2WQYB 3Q3FA 2NBVB 1WR1A 2WXHA 1KBLA 1U5DA 5EFXA 4JKHA 2XK5B 3ZTCA 5C6RA 3VRBB 1VLBA 5IAAC 2BYTA 1RLFA 2KJ6A 4FHKA 3ENBA 1ZKHA 2PTLA 4FJYA 4N9F4 2IO2B 1P1AA 1XCGA 4W9KA 4OZAA 4W9JA 4HLEA 4Z2NA 2EKIA 2JY6A 4FJZA 3ZO5B 4RM8A 2IGHA 4RNAA 3AEAB 3GZNI 4B9KA 5IRSA 3DPDA 3W9CB 2WXOA 5J3QA 2MH7A 2RGNB 2REXA 3FAHA 1G6JA 1F1HA 2ZCBA 1KLGD 3ZNZB 3DVGX 1BTNA 3TCAA 2DX5A 2H89B 1EWYC 3PLVA 2L05A 5L95C 1PGBA 3HM3A 1RAXA 2L0TA 2FAZA 2ADZA 4C00A 2K8HA 4LNNA 1KTKA 4RCOA 2KXJA 3F0WA 3R3MA 4P1BC 2NBVA 2HJ8A 1WYWB 2IGDA 5CX3A 3PPAA 1TJEA 3DVNU 4KAXB 3TW1A 4HWIB 3PZDA 5TSSA 3AULA 2KMAA 1IBXB 1UZXB 4MGYE 2PEAA 4C56C 4LJOB 2RGFA 2MWNB 2MJ3A 3A8QA 3MC0B 1B55A 1C79A 3PRPB 5G55A 1VZ8A 2X18A 4NY0A 1F77A 4ZYNA 4A55A 5KCVA 3B1LX 1J7AA 1Z5SB 2DA0A 1ENFA 2UU7A 5HKHA 3PVUA 2WDQB 3AU4A 3HRDD 1FB8A 4LNKA 4WAAA 1FNUA 4K3BA 5CLQB 4TSSA 1E6EB 2QJLA 2N0YA 1F2RI 2X38A 1YIWA 5IKCM 3M3JA 2YS1A 4K2OA 2J7QB 3DBSA 2KJHB 3ZJUA 3BK1A 1DYNA 3R8BA 2KWDA 3TEYA 4WH4A 4KSKC 2D11A 2KKCA 3RUIB 3M95A 2J0MA 2QKMA 2K6QA 4ANWA 3Q14C 5EDSA 2IO1B 4KZCA 2PPHA 3SHQA 3N3KB 1D6EC 1NVLA 1BAKA 3DCXA 2KFKB 2CHXA 2W54A 3V3XA 1NU2A 4NQKE 3EFCA 4XX5A 1UD7A 3KWLA 1FHXA 2VZKD 1IBXA 2RLOA 1WX7A 1N5WA 3ECIA 1D4BA 5BYQA 2ELAA 2CY5A 3GYOA 2AYOB 1SE4A 3A4RA 3LJUX 1CJEA 2PJHA 4A8XC 3RNGC 2LD9A 3FVCA 1V5OA 4HPMB 2MJEA 1WIAA 3JSVB 3CXBB 1VJKA 1TY2A 4GGQA 3GP7A 2N9EB 1E5WA 2C9WB 3X23A 5LG4B 4BKGA 3RMKC 1LFDA 3I57A 4XC2A 3W5UB 1C9FA 1P3QU 2KTRA 1XCTL 1V5PA 2RPVA 2K3UA 2OTXA 1TT5B 3PEGA 1U27A 3H7PB 4FN2A 2Z0QA 2WNMA 3NVZA 1OQQA 4B0EA 1JROA 2KVRA 3PGEA 5BMIA 4GNKB 2WXFA 3J9CA 4HB0B 5JHHA 3UINB 4UDUC 2NTSA 4ZRPA 1OEYJ 2NPTA 1I4RA 1TKYA 2KFKA 4W9GA 3AE4B 4URKA 4MSQB 4DXGA 1R4MI 1QQRA 2L1AA 4P6VF 2MBBB 1Q1OA 2C7NB 3WCQA 2N4FA 1E10A 1HB8A 2EMTA 4N58A 1WFYA 3AJ4A 4REZA 3JSVA 2JRHA 1XO3A 2LVQA 1DDWA 3PLUA 4YTNB 1C4PA 2KN5A 3AE8B 3OAWA 3APCA 2K8CA 2Q13A 2XEWA 3RNFC 2P0HA 2MKRA 3WA0A 1SJED 5AUIA 1QT9A 4JKEA 4M02A 3U7ZA 2R09A 2D07B 3VFKA 2LGDA 1LW3A 3H7PA 3NJTA 4B6WA 2L76A 3PRZA 5LXIB 2KN4A 1WGUA 1WWTA 3NHEB 3SU8X 1I4GA 1AARA 4HPPA 1LB1A 2MHJA 2DFKA 3QC8B 2RVBB 1X86A 4A6FA 4H2AA 2W3RA 1FCLA 2OJWA
chains in the Genus database with same CATH topology
3NY5A 3R7QA 2RNRB 1UELA 1U5GA 4EZLA 4HHVA 3CIKA 2FCMA 1S3SG 3UIOB 2D9WA 1MG8A 4K17A 1Y5OA 1C3TA 1V2YA 3ZVRA 4IUMB 4EEWA 5CTRC 3T8MA 3PSCA 3LJ3A 5HE0A 2BWFA 2CS4A 2JPHA 2KNBA 1M7RA 3D8EA 5JLJB 1KI1B 3EFUA 4IM3A 5KHQA 1GC6A 1UBIA 4F7GA 2O6VD 4JGHB 2UVMA 2FCNA 2IO3B 4W9IA 1GJZA 1V61A 3PVWA 4MY6A 3IVFA 2GMIC 3ULBA 4EZKA 3ZUNA 2LULA 2AL6A 2N1WA 4TKNA 4JKBA 4GN1A 4AUQC 3H7SA 2H7EA 1MAIA 1GG3A 2MDXA 2DAJA 4CO7A 2ROZB 4DK5A 2Y8FA 2C5LC 2KK8A 3V60A 3G9WA 3A98B 2JF5A 2OQBA 4EUTA 4FLHA 1WGGA 2W2XD 3KVFB 2P8VA 4A20A 3W1YA 1HE8A 1ZC3B 1HB6A 5L83A 5JP4A 2KDBA 3O65B 2M0XA 3TVVA 3M63B 2R0DA 2DYBA 1QQGA 2D3GA 2LOZA 1XD3B 2GBMA 3HQCA 1KZGA 3CSTA 3M1IB 1W1DA 1V9JA 1YX5B 4KV2A 4LDTD 2D4QA 3P2BA 2NS5A 3DXDA 3T06A 5J3TA 1ACAA 1Y8RC 4AJYB 3SO6A 4HCNB 1E7VA 3A33B 1NBFC 1EUVB 3FP5A 1V5TA 2AL3A 1OQYA 5DIFB 4Z2MB 4ICVA 2EJ8A 3CMMB 5GMVA 4GDLA 2ZVOA 1EAZA 1V88A 2MP2A 2LRUA 2ZZPB 4OVVA 2KMCA 4GMXB 3FEHA 1NI2A 2VSZA 2LGXA 1E8YA 2ZPNA 3A9KA 4ANXA 1Q0WB 1I42A 1DROA 3NS8A 3PSEB 1FHWA 3L17A 4TYZA 3ZKJC 1OQNA 2L3ZA 3KH0A 1J19A 5D7GA 1LM8B 2LASA 1MKEA 3NSUA 4PNKA 2MRPA 2O2VA 3OLMD 2NVUI 3WAPA 3DXCA 2DAFA 3I3TB 2JXXA 3ZTDA 4MEMA 2W9NA 1X1MA 4HK2A 2KO3A 2YRYA 1MK9B 2UZRA 4FA6A 4HB3B 4DHJD 4EKUA 4HAYB 4GZUA 3VDZA 4F7UP 1WJ1A 4GPTB 4HAZB 4PYZA 4IM2A 4WWOA 2KANA 4JQWC 1SIFA 2LVPA 3RZWC 1P3RA 3SDLC 3A1QB 1NTVA 2Z0DB 5D6JB 3UQBA 3RZFA 2DN6A 4PS8A 5DPWA 1E7UA 1UNRA 1LXDA 1WMHB 4WQOB 2A5UA 2M4NA 2N23A 3BJIA 2MX2A 1TTNA 5CHWA 4IFSA 1D3ZA 1ST7A 1WVHA 3WAMA 1AQCA 1WGRA 2C7MB 4HXDA 1WZ0A 2DYOA 2G35A 2GOWA 2HD5B 2D10A 3N7CA 3ODWA 2BCJA 1P5TA 4KHAA 3PG7A 3ZW3A 3HK0A 2ZPYA 2ZNVC 2Z0EB 3VVWB 5J3YA 4NJ7A 2K2JA 1YX6B 2L1CA 1M94A 2DENB 2D9VA 1XD4A 4EFOA 1GC7A 1IRSA 4IOYX 2COFA 5DPTA 1TGZB 2A4ZA 3E9OA 1P0RA 1DDVA 1OTRB 2BKRB 1WXVA 1L2NA 1R4NI 2LXAA 4A5KA 2LI5A 1WXAA 1Q5WB 1EVHA 5FR6A 2K39A 2KX3A 2DLWA 4E74A 3KYDD 2IO0B 2BYEA 3K9PB 4TUUA 3PHXB 4NSWA 4AOFA 3H9DA 2DYMA 2X0SA 3ALBA 3V5WA 2ELBA 2EC1A 4HB4B 4DWFA 3L16A 1SGHA 2V1YA 2XK5A 3KUDB 4HDQA 2MBHA 3JW0X 5JHBA 2COAA 2HTHB 3A4SC 4HAVB 5TR5A 1C1YB 3GOEA 3U30A 4BKSD 4CHJA 2BGFA 5AEKB 3CSFA 3VH3B 3TFMA 2MWSB 5HE3A 2ASQA 1P98A 3VXWA 2KWUB 2JWZA 2L0FA 4TQ0A 4JKAA 4HATB 1WG7A 5JH5C 2Z0OA 1WX8A 3TO1A 3ONSA 4KSLC 3WANA 1LQBA 4CHKA 3BINA 5FI0A 2KTFA 3ODXA 2N9XA 2I1KA 1WH3A 1E8WA 5LLIA 2HTHA 4MSMB 2BYFA 2O6VB 1ZSQA 1U5FA 1ZGUB 4EMOA 4YONA 2LXCA 1OMWA 2KWCA 3DXEA 5IA7A 2WYQA 2CQUA 3PHWB 1KOTA 5JZEB 3T9LA 3ZLZA 4NAWB 4II2B 2B3AA 2MA9B 5AZGA 2UWQA 2NBWB 2KFJA 5DHFB 3ZRCA 2YVCA 1VCBA 4W9CA 4G11A 5J17A 1YQBA 3JVZX 3W1SC 1V6EA 3PRMB 2NMBA 1XODA 1NTYA 4GMVA 1U5EA 4A6KA 4GDKB 1IP9A 2KOXA 3QIJA 4DX8A 3L54A 2H7DA 3IFWB 1A5RA 4JKGB 4WVFB 4BKTA 1PLSA 4KDIC 2GS0A 2BWES 2GCLA 5CHFA 4NAWA 4ASWC 4W9LA 1UGMA 4OVUA 2LWPA 4BBNF 3V6CB 4B95A 1J0WA 2LG1A 3LDZE 3DVNV 2L00B 4K7SA 1WZ3A 2V76A 1Z87A 2DZIA 4WJQA 4F1SA 4HAXB 5HE2A 1ZC4B 5BO4B 3WIMA 4P7IA 1FXTB 5JVLA 1P6SA 1NTIA 4GOCA 4FADA 3UGBB 3VTUA 2W2WA 4LCDE 2W2XC 2KD0A 5DH9B 3PT2B 3APDA 2WX0A 4EJNA 3QX1A 1F9JA 4KVGB 4DHZE 2KCJA 2DHKA 2D9XA 1MK7B 1J0GA 3KYCD 4ICUA 2RR9A 1XKEA 1DBHA 3EPYA 4I6PA 3L13A 1VBGA 4PS7A 4CYEA 3Q3JA 4ILHA 3IG3A 1E90A 4J6IA 5AZHA 2NBUA 4HCPB 3OANA 3PV1A 1U2BA 2DHZA 1K8RB 2J0KA 1SE9A 4PS3A 3VH4B 3RD2A 1WX9A 4ILGB 2ZJDA 4IW0A 4M8NA 4G50A 5J2RA 3WAOA 2YLMA 2R82A 1RRPB 1W1GA 5DCNA 3S2AA 4K7WA 4MDKE 2NZ8B 3AU5A 2NR2A 3HIZA 3PTFC 2L8JA 2M8SA 5LXHA 3SUZA 1KC7A 2FJ9A 2JVCA 1V5UA 2LZ6A 2CY4A 1UH6A 2IYDB 4PYUA 2DKQA 3A9JB 2GBRA 1WJNA 4ZRJA 1X11A 2Y7BA 1OGWA 2G3QB 4XZ4A 4JKCA 3KRXA 1FOEA 3IBEA 2C7HA 2R2QA 3FLVA 1X1GA 2LUEA 3RCPA 2K25A 1KZ7A 2YF0A 1ZW7A 1WGQA 3TL5A 1AWEA 3RYTA 5DI9B 2N7EA 2QHOA 2JUOA 2DHIA 4E71A 1UBQA 5J18A 1WXSA 3ZNHB 3O96A 4GB9A 4MT7A 5D3VA 3ML9A 3MHSD 5DPRA 2Y5BB 1FAOA 2N1VA 4IG7B 1EF1A 2JZ3B 4BOSC 3U7DA 2V3SA 4ILJA 4MH0E 3H1UA 1WJMA 3PREA 4BVUC 3VOQA 5DPSA 1I2HA 3QWMA 1KJTA 3AI5A 2IYBA 3WYFB 5G2NA 2ZNVB 1T0YA 4EZJA 2FIDA 3L0WB 3HHMA 3DBHI 2CB8A 2MW5A 2JRIB 1JRUA 4WJNA 1WGDA 2MQJA 2GBKA 3K9OB 3V6EB 1KLVA 3QBVB 2YS3A 4ZRIA 3QCAA 1WJ6A 2QKLA 2COPA 5C23A 2ZVNA 1E8ZA 2FCQA 3QHTA 2KJRA 4KZ0A 1I7AA 4H8SA 1TJ6A 2KDIA 5CHVC 3C0RB 3NZUA 2KGXB 2RSGA 2AEHA 2D9YA 4MJSB 3UIPB 3TMPB 4WJPA 5DHAB 2VRRB 3GYPA 5LOPB 1S1QB 2KDFB 5AZFA 5C79A 2CR5A 1H8CA 2K00A 2DIKA 2K1FA 3DBLI 2FJLA 1GNUA 3DVGY 4NPNA 4RM9A 1V49A 4W9EA 3A1QA 2UZSA 4DX90 2P0FA 3APFA 3ENEA 2G4SA 4GIVA 1UNQA 1IYFA 2CODA 2CU1A 1YJ1A 2RSUA 1WMHA 1WXMA 4MJSA 1J8CA 2N9PC 3WALA 3D8FA 3P7ZA 4K81A 2FDQA 2BKFA 1WJUA 1SHCA 4D0NB 1GGOA 3ZNGC 3QWZB 1K5DB 3V62A 2D2QA 2FIFA 2IZVB 4ANUA 4NJ6A 2MFQA 1H10A 4MK0A 2L2IA 1KM7A 4B6HA 2DX1A 3E66A 3QAQA 1WGHA 1YD8U 5D3YA 4MELA 1WM3A 2LVOA 3MJWA 4L6EA 4FHJA 1Y19B 3KY9A 4G0NB 2IFSA 5KHOA 1FHOA 3A8PA 2ROVA 3TIXA 5C5BB 4JLCA 3DCGA 4HPLB 1ZM0A 3MPXA 5JHGA 1WM2A 4WWPA 1BTKA 1L7YA 1WE6A 3QJZA 1V89A 3FM8C 4FULA 2XBBC 3ZNID 2KWVB 2LYDA 4JK9A 3E9PA 2KTRB 5D2MB 1FGZA 4AWJA 2MLBA 3KRWA 1WRDB 2LOXA 2WX1A 4GSWA 4K2PA 3B08A 4JK8A 2NPTB 3VQIA 4HVBA 2RD0A 1WR6E 4JL9A 5C5BA 4I6LB 3TJPA 1XR0B 1MIXA 1TXDA 2DYNA 4A3OA 3F5RA 3W1SA 4DBBA 3R66C 2K6DB 3N32A 2WWZA 2ZEQA 2YSZA 3U8ZA 1WE7A 2WDTB 4JK7A 1WI1A 1WF9A 2G45B 1U4AA 2CHZA 2UYZB 2MCNB 2VRWB 2LRWA 1MIZB 4A6FB 3NZSA 2O6VA 4KIKB 5D3XA 3ZIMA 3VUWA 1EF5A 3UQAA 1NDDA 4IM0A 4W9HA 4KDLB 2LKOA 5E6PA 2MSED 3HM6X 3ZRFA 3DQVA 4IWPA 3DOWA 4BBKA 2IY1B 4KHBB 4LDTB 4Y94A 4K1RB 4LJPB 2MBOA 3AXCA 3ZDTA 2IBIB 2GJYA 2KC1A 2CAYA 1RRBA 4AP4C 3EC8A 1Z2MA 2RUKB 3KZ1A 3M62B 2G4DB 2OOBB 4DDID 1ZVRA 3HW2B 2M17A 2RQ1A 4KIKA 3RT3B 2DHJA 4GDKA 2BPSA 2VKIA 4IWQA 4JIOU 2IY0B 1RFAA 3TBLD 2M14A 3JYUA 3KSYA 4A6HA 5JHAA 4AJWA 1MPHA 4FBJB 4JKGA 1VBHA 4M0WB 2KLGA 4NQLB 1UPQA 5GOWB 2LGYA 2I5FA 2LJ5A 2EMSA 2KQSA 1WY8A 3SBGA 3KW5B 2GBNA 4HAWB 2FCSA 4TV3A 1XX0A 1I35A 1ISNA 4JKDA 4JKFA 2KUPA 1IPGA 3R7RA 4HDOA 4DDGD 3ODOA 1BT0A 4BBNC 1PMSA 5KQ4A 3DBRI 4F7ZA 5HE1A 2K8BA 3QA8A 4MGZE 4X57B 3BY4B 1EGXA 1DIKA 4IAPA 2P0DA 2J0JA 3VUXA 2I1JA 4DHJB 2DZMA 4M8MA 3UZTA 3D8DA 2HE7A 1M7EA 2ZCCA 3QARA 2N7DA 2CRFA 2KZRA 4RMAA 2KHWB 1H4RA 3N30A 3RULA 2HRJA 4F7HA 2XQNM 3VTVA 3FSSA 2ABDA 2FNJB 4BFRA 3SYXA 3OJ3A 3IHPC 3NOBA 3MTNB 3QK0A 2C60A 3QQ8B 2DZJA 2KC2A 1UNPA 1N3HA 4NNJB 2COCA 1V81A 4HAUB 1OEYA 2M1MA 3EHVA 4W9DA 4E3CA 5C16A 3VHTC 2NCNA 4GDLB 2MBQA 4DXAB 1WI0A 2MP2B 1OY2A 1P9DU 5LONB 1JDEA 1FGYA 2DKPA 2M38A 4C0AA 3A9KB 2PE9A 5CLLB 4BOZB 3CF6E 4YL8A 2J59M 2LBBA 3SNHA 4MGIE 5KQ1A 5D27A 2Z59B 1CMXB 1XT9B 1XQQA 1PFJA 4WJ7A 1TBEA 4GXBA 2O2VB 1QZEA 4DHZB 2BF8B 3UF8A 3ML8A 4K7UA 3X0WA 2CKHB 2I5CA 2V4LA 1BWNA 4WWNA 3VTWA 4A3PA 1W1HA 3A9JA 4G3XB 2RPQA 2EKEC 3VAWA 2GCJA 2Y8GA 4EOYA 3DDCB 3B0AA 1K5GB 1EO6A 3E9LA 2D9ZA 4FJVB 1UEFA 4I6NB 5D94A 2OJRA 1V80A 2KQ7A 2PE6B 1VD2A 2Z0PA 3ML4A 2BYVE 1DDMA 3PP2A 4WJOA 3L08A 5FI1A 2CHWA 4IWOA 2WH5A 2DYQA 2MBEA 4TQ1A 2YT0A 1V5MA 5E6OA 1RJ2A 2KX0A 2PZ1A 2YT1A 2FUHB 3D32A 2R2OA 5C1ZA 2JP2A 3H6NA 2E2XA 1HBKA 3EECA 3ZVVA 2KLCA 1TQZA 4CHMA 4KHOA 1X05A 3VUYA 2JZZA 1WGYA 3VIAA 1PQSA 4ANVA 1E8XA 5L81A 3KUCB 5IJMA 1UPRA 4GU2A 2YS5A 3OJ4B 4II3B 3L10B 1GUAB 1V86A 4MM3A 5D3WA 4IC7B 1TZ1A 4HJKA 4F8CB 3ULCA 1X1FA 4BKSA 3PS6A 2K2UA 2DTCA 3MDBC 4ZRKA 4DBGA 3ZDMC 1WJ4A 4WSFA 2GBJA 3SV1A 4HB2B 2DZKA 4PQ0A 4ZDVA 3P6AA 3KUZA 3SBTA 3SD5A 5E6NA 1Q67A 4XWXA 2JT4B 1QC6A 2KDEB 2DX5B 2L7RA 4MGKE 4W9FA 3V61A 3PVLA 1U29A 2AWTA 3RCZA 3Q3FA 2NBVB 1WR1A 1KBLA 1U5DA 5EFXA 4JKHA 2XK5B 3ZTCA 5C6RA 5IAAC 1RLFA 2KJ6A 4FHKA 3ENBA 1ZKHA 4FJYA 4N9F4 2IO2B 1P1AA 1XCGA 4W9KA 4W9JA 4HLEA 4Z2NA 2JY6A 4FJZA 3ZO5B 4RM8A 3GZNI 4B9KA 3DPDA 5J3QA 2RGNB 2REXA 1G6JA 2ZCBA 3ZNZB 3DVGX 1BTNA 3TCAA 2DX5A 3PLVA 2L05A 5L95C 3HM3A 1RAXA 2L0TA 2FAZA 2ADZA 2K8HA 2KXJA 3F0WA 3R3MA 2HJ8A 1WYWB 5CX3A 3PPAA 3DVNU 4KAXB 3TW1A 4HWIB 3PZDA 3AULA 2KMAA 1UZXB 4MGYE 2PEAA 4LJOB 2RGFA 2MWNB 3A8QA 1B55A 3PRPB 5G55A 2X18A 4NY0A 4ZYNA 5KCVA 3B1LX 1Z5SB 2DA0A 5HKHA 3PVUA 3AU4A 1FB8A 4WAAA 5CLQB 2N0YA 1YIWA 3M3JA 2YS1A 4K2OA 2J7QB 3DBSA 2KJHB 1DYNA 4KSKC 2D11A 2KKCA 3RUIB 3M95A 2QKMA 2J0MA 2K6QA 4ANWA 5EDSA 2IO1B 4KZCA 2PPHA 3SHQA 3N3KB 1NVLA 1BAKA 2KFKB 2CHXA 1NU2A 4NQKE 4XX5A 1UD7A 1FHXA 2RLOA 1WX7A 3ECIA 2ELAA 2CY5A 3GYOA 2AYOB 3A4RA 3LJUX 2PJHA 2LD9A 1V5OA 4HPMB 3JSVB 1WIAA 3CXBB 4GGQA 2N9EB 1E5WA 2C9WB 3X23A 4BKGA 1LFDA 4XC2A 1P3QU 2KTRA 1V5PA 2OTXA 3PEGA 1U27A 3H7PB 4FN2A 2Z0QA 2KVRA 3PGEA 4HB0B 5JHHA 3UINB 1OEYJ 2NPTA 2KFKA 4W9GA 4URKA 4MSQB 1R4MI 2MBBB 1Q1OA 2C7NB 2N4FA 1HB8A 2EMTA 1WFYA 3AJ4A 3JSVA 2JRHA 2LVQA 1DDWA 3PLUA 2KN5A 3OAWA 3APCA 2K8CA 2Q13A 2XEWA 2P0HA 2MKRA 3WA0A 4JKEA 2R09A 2D07B 3VFKA 2LGDA 1LW3A 3H7PA 4B6WA 2L76A 3PRZA 5LXIB 1WGUA 3NHEB 3SU8X 1AARA 1LB1A 3QC8B 2DFKA 2RVBB 1X86A 4A6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NY5 A;  3R7Q A;  2RNR B;  1UEL A;  1U5G A;  4EZL A;  4HHV A;  3CIK A;  2FCM A;  1S3S G;  3UIO B;  2D9W A;  1MG8 A;  4K17 A;  1Y5O A;  1C3T A;  1V2Y A;  3ZVR A;  4IUM B;  4EEW A;  5CTR C;  3T8M A;  3PSC A;  3LJ3 A;  5HE0 A;  2BWF A;  2CS4 A;  2JPH A;  2KNB A;  1M7R A;  3D8E A;  5JLJ B;  1KI1 B;  3EFU A;  4IM3 A;  5KHQ A;  1GC6 A;  1UBI A;  4F7G A;  2O6V D;  4JGH B;  2UVM A;  2FCN A;  2IO3 B;  4W9I A;  1GJZ A;  1V61 A;  3PVW A;  4MY6 A;  3IVF A;  2GMI C;  3ULB A;  4EZK A;  3ZUN A;  2LUL A;  2AL6 A;  2N1W A;  4GN1 A;  4TKN A;  4AUQ C;  3H7S A;  2H7E A;  1MAI A;  1GG3 A;  2MDX A;  2DAJ A;  4CO7 A;  2ROZ B;  4DK5 A;  2Y8F A;  2C5L C;  2KK8 A;  3V60 A;  3G9W A;  3A98 B;  2JF5 A;  2OQB A;  4EUT A;  4FLH A;  1WGG A;  2W2X D;  3KVF B;  2P8V A;  4A20 A;  3W1Y A;  1HE8 A;  1ZC3 B;  1HB6 A;  5L83 A;  5JP4 A;  2KDB A;  3O65 B;  2M0X A;  3TVV A;  3M63 B;  2R0D A;  2DYB A;  1QQG A;  2D3G A;  2LOZ A;  1XD3 B;  2GBM A;  3HQC A;  1KZG A;  3CST A;  3M1I B;  1W1D A;  1V9J A;  1YX5 B;  4KV2 A;  4LDT D;  2D4Q A;  3P2B A;  2NS5 A;  3DXD A;  3T06 A;  5J3T A;  1ACA A;  1Y8R C;  4AJY B;  3SO6 A;  4HCN B;  1E7V A;  3A33 B;  1NBF C;  1EUV B;  3FP5 A;  1V5T A;  2AL3 A;  1OQY A;  5DIF B;  4Z2M B;  4ICV A;  2EJ8 A;  3CMM B;  5GMV A;  4GDL A;  2ZVO A;  1EAZ A;  1V88 A;  2MP2 A;  2LRU A;  2ZZP B;  4OVV A;  2KMC A;  4GMX B;  3FEH A;  1NI2 A;  2VSZ A;  2LGX A;  1E8Y A;  2ZPN A;  3A9K A;  4ANX A;  1Q0W B;  1I42 A;  1DRO A;  3NS8 A;  3PSE B;  1FHW A;  3L17 A;  4TYZ A;  3ZKJ C;  1OQN A;  2L3Z A;  3KH0 A;  1J19 A;  5D7G A;  1LM8 B;  2LAS A;  1MKE A;  3NSU A;  4PNK A;  2MRP A;  2O2V A;  3OLM D;  2NVU I;  3WAP A;  3DXC A;  2DAF A;  3I3T B;  2JXX A;  3ZTD A;  4MEM A;  2W9N A;  1X1M A;  4HK2 A;  2KO3 A;  2YRY A;  1MK9 B;  2UZR A;  4FA6 A;  4HB3 B;  4DHJ D;  4EKU A;  4HAY B;  4GZU A;  3VDZ A;  4F7U P;  1WJ1 A;  4GPT B;  4HAZ B;  4PYZ A;  4IM2 A;  4WWO A;  2KAN A;  4JQW C;  1SIF A;  2LVP A;  3RZW C;  1P3R A;  3SDL C;  3A1Q B;  1NTV A;  2Z0D B;  5D6J B;  3UQB A;  3RZF A;  2DN6 A;  4PS8 A;  5DPW A;  1E7U A;  1UNR A;  1LXD A;  1WMH B;  4WQO B;  2A5U A;  2M4N A;  2N23 A;  3BJI A;  2MX2 A;  1TTN A;  5CHW A;  4IFS A;  1D3Z A;  1ST7 A;  1WVH A;  3WAM A;  1AQC A;  1WGR A;  2C7M B;  4HXD A;  1WZ0 A;  2DYO A;  2G35 A;  2GOW A;  2HD5 B;  2D10 A;  3N7C A;  3ODW A;  2BCJ A;  1P5T A;  4KHA A;  3PG7 A;  3ZW3 A;  3HK0 A;  2ZPY A;  2ZNV C;  2Z0E B;  3VVW B;  5J3Y A;  4NJ7 A;  2K2J A;  1YX6 B;  2L1C A;  1M94 A;  2DEN B;  2D9V A;  1XD4 A;  4EFO A;  1GC7 A;  1IRS A;  4IOY X;  2COF A;  5DPT A;  1TGZ B;  2A4Z A;  1P0R A;  1DDV A;  1OTR B;  2BKR B;  1WXV A;  1L2N A;  1R4N I;  2LXA A;  4A5K A;  2LI5 A;  1WXA A;  1Q5W B;  1EVH A;  5FR6 A;  2K39 A;  2KX3 A;  2DLW A;  4E74 A;  3KYD D;  2IO0 B;  2BYE A;  3K9P B;  4TUU A;  3PHX B;  4NSW A;  4AOF A;  3H9D A;  2DYM A;  3ALB A;  3V5W A;  2ELB A;  2EC1 A;  4HB4 B;  4DWF A;  3L16 A;  1SGH A;  2V1Y A;  2XK5 A;  3KUD B;  4HDQ A;  2MBH A;  3JW0 X;  5JHB A;  2COA A;  2HTH B;  3A4S C;  4HAV B;  5TR5 A;  1C1Y B;  3GOE A;  3U30 A;  4BKS D;  4CHJ A;  2BGF A;  5AEK B;  3CSF A;  3VH3 B;  3TFM A;  2MWS B;  5HE3 A;  2ASQ A;  1P98 A;  3VXW A;  2KWU B;  2JWZ A;  2L0F A;  4TQ0 A;  4HAT B;  1WG7 A;  5JH5 C;  2Z0O A;  1WX8 A;  3TO1 A;  3ONS A;  4KSL C;  3WAN A;  1LQB A;  4CHK A;  3BIN A;  5FI0 A;  2KTF A;  3ODX A;  2N9X A;  2I1K A;  1WH3 A;  1E8W A;  5LLI A;  2HTH A;  4MSM B;  2BYF A;  2O6V B;  1ZSQ A;  1U5F A;  1ZGU B;  4EMO A;  4YON A;  2LXC A;  1OMW A;  2KWC A;  3DXE A;  5IA7 A;  2WYQ A;  2CQU A;  3PHW B;  1KOT A;  5JZE B;  3T9L A;  3ZLZ A;  4NAW B;  4II2 B;  2B3A A;  2MA9 B;  5AZG A;  2UWQ A;  2NBW B;  2KFJ A;  5DHF B;  3ZRC A;  2YVC A;  1VCB A;  4W9C A;  4G11 A;  5J17 A;  1YQB A;  3JVZ X;  3W1S C;  1V6E A;  3PRM B;  2NMB A;  1XOD A;  1NTY A;  4GMV A;  1U5E A;  4A6K A;  4GDK B;  1IP9 A;  2KOX A;  3QIJ A;  4DX8 A;  3L54 A;  2H7D A;  3IFW B;  1A5R A;  4WVF B;  4BKT A;  1PLS A;  4KDI C;  2GS0 A;  2BWE S;  2GCL A;  5CHF A;  4NAW A;  4ASW C;  4W9L A;  1UGM A;  4OVU A;  2LWP A;  4BBN F;  3V6C B;  4B95 A;  1J0W A;  2LG1 A;  3LDZ E;  3DVN V;  2L00 B;  4K7S A;  1WZ3 A;  2V76 A;  1Z87 A;  2DZI A;  4WJQ A;  4F1S A;  4HAX B;  5HE2 A;  1ZC4 B;  5BO4 B;  3WIM A;  4P7I A;  1FXT B;  1P6S A;  1NTI A;  4GOC A;  4FAD A;  3UGB B;  3VTU A;  2W2W A;  4LCD E;  2W2X C;  2KD0 A;  5DH9 B;  3PT2 B;  3APD A;  2WX0 A;  4EJN A;  3QX1 A;  1F9J A;  4KVG B;  4DHZ E;  2KCJ A;  2DHK A;  2D9X A;  1MK7 B;  1J0G A;  3KYC D;  4ICU A;  2RR9 A;  1XKE A;  1DBH A;  3EPY A;  4I6P A;  3L13 A;  4PS7 A;  4CYE A;  3Q3J A;  3IG3 A;  1E90 A;  4J6I A;  5AZH A;  2NBU A;  4HCP B;  3OAN A;  3PV1 A;  1U2B A;  2DHZ A;  1K8R B;  2J0K A;  1SE9 A;  4PS3 A;  3VH4 B;  3RD2 A;  1WX9 A;  2ZJD A;  4IW0 A;  4M8N A;  4G50 A;  5J2R A;  3WAO A;  2YLM A;  1RRP B;  1W1G A;  5DCN A;  3S2A A;  4K7W A;  4MDK E;  2NZ8 B;  3AU5 A;  2NR2 A;  3HIZ A;  3PTF C;  2L8J A;  2M8S A;  5LXH A;  3SUZ A;  2FJ9 A;  2JVC A;  1V5U A;  2LZ6 A;  2CY4 A;  1UH6 A;  2IYD B;  4PYU A;  2DKQ A;  3A9J B;  2GBR A;  1WJN A;  4ZRJ A;  1X11 A;  2Y7B A;  1OGW A;  2G3Q B;  4XZ4 A;  3KRX A;  1FOE A;  3IBE A;  2C7H A;  2R2Q A;  3FLV A;  1X1G A;  2LUE A;  3RCP A;  2K25 A;  1KZ7 A;  2YF0 A;  1ZW7 A;  1WGQ A;  3TL5 A;  1AWE A;  3RYT A;  5DI9 B;  2N7E A;  2QHO A;  2JUO A;  2DHI A;  4E71 A;  1UBQ A;  5J18 A;  1WXS A;  3ZNH B;  3O96 A;  4GB9 A;  4MT7 A;  5D3V A;  3ML9 A;  3MHS D;  5DPR A;  2Y5B B;  1FAO A;  2N1V A;  4IG7 B;  1EF1 A;  2JZ3 B;  4BOS C;  3U7D A;  2V3S A;  4MH0 E;  3H1U A;  1WJM A;  3PRE A;  4BVU C;  3VOQ A;  5DPS A;  1I2H A;  3QWM A;  1KJT A;  3AI5 A;  2IYB A;  3WYF B;  5G2N A;  2ZNV B;  1T0Y A;  4EZJ A;  2FID A;  3L0W B;  3HHM A;  3DBH I;  2CB8 A;  2MW5 A;  2JRI B;  1JRU A;  4WJN A;  1WGD A;  2MQJ A;  2GBK A;  3K9O B;  3V6E B;  1KLV A;  3QBV B;  2YS3 A;  4ZRI A;  3QCA A;  1WJ6 A;  2QKL A;  2COP A;  5C23 A;  2ZVN A;  1E8Z A;  2FCQ A;  3QHT A;  2KJR A;  4KZ0 A;  1I7A A;  4H8S A;  1TJ6 A;  2KDI A;  5CHV C;  3C0R B;  3NZU A;  2KGX B;  2RSG A;  2AEH A;  2D9Y A;  4MJS B;  3UIP B;  3TMP B;  4WJP A;  5DHA B;  2VRR B;  3GYP A;  5LOP B;  1S1Q B;  2KDF B;  5AZF A;  5C79 A;  2CR5 A;  1H8C A;  2K00 A;  2K1F A;  3DBL I;  2FJL A;  1GNU A;  3DVG Y;  4NPN A;  4RM9 A;  1V49 A;  4W9E A;  3A1Q A;  2UZS A;  4DX9 0;  2P0F A;  3APF A;  3ENE A;  2G4S A;  4GIV A;  1UNQ A;  1IYF A;  2COD A;  2CU1 A;  1YJ1 A;  2RSU A;  1WMH A;  1WXM A;  4MJS A;  1J8C A;  2N9P C;  3WAL A;  3D8F A;  3P7Z A;  4K81 A;  2FDQ A;  2BKF A;  1WJU A;  1SHC A;  4D0N B;  3ZNG C;  3QWZ B;  1K5D B;  3V62 A;  2D2Q A;  2FIF A;  2IZV B;  4ANU A;  4NJ6 A;  2MFQ A;  1H10 A;  4MK0 A;  2L2I A;  1KM7 A;  4B6H A;  2DX1 A;  3QAQ A;  1WGH A;  1YD8 U;  5D3Y A;  4MEL A;  1WM3 A;  2LVO A;  3MJW A;  4L6E A;  4FHJ A;  1Y19 B;  3KY9 A;  4G0N B;  2IFS A;  5KHO A;  1FHO A;  3A8P A;  2ROV A;  3TIX A;  5C5B B;  4JLC A;  3DCG A;  4HPL B;  1ZM0 A;  3MPX A;  5JHG A;  1WM2 A;  4WWP A;  1BTK A;  1L7Y A;  1WE6 A;  3QJZ A;  1V89 A;  3FM8 C;  4FUL A;  2XBB C;  3ZNI D;  2KWV B;  2LYD A;  2KTR B;  5D2M B;  1FGZ A;  4AWJ A;  2MLB A;  3KRW A;  1WRD B;  2LOX A;  2WX1 A;  4GSW A;  4K2P A;  3B08 A;  2NPT B;  3VQI A;  4HVB A;  2RD0 A;  1WR6 E;  4JL9 A;  5C5B A;  4I6L B;  3TJP A;  1XR0 B;  1MIX A;  1TXD A;  2DYN A;  4A3O A;  3F5R A;  3W1S A;  4DBB A;  3R66 C;  2K6D B;  3N32 A;  2WWZ A;  2ZEQ A;  2YSZ A;  3U8Z A;  1WE7 A;  2WDT B;  1WI1 A;  1WF9 A;  2G45 B;  1U4A A;  2CHZ A;  2UYZ B;  2MCN B;  2VRW B;  2LRW A;  1MIZ B;  4A6F B;  3NZS A;  2O6V A;  4KIK B;  5D3X A;  3ZIM A;  3VUW A;  1EF5 A;  3UQA A;  1NDD A;  4IM0 A;  4W9H A;  4KDL B;  2LKO A;  5E6P A;  2MSE D;  3HM6 X;  3ZRF A;  3DQV A;  4IWP A;  3DOW A;  4BBK A;  2IY1 B;  4KHB B;  4LDT B;  4Y94 A;  4K1R B;  4LJP B;  2MBO A;  3AXC A;  3ZDT A;  2IBI B;  2GJY A;  2KC1 A;  2CAY A;  1RRB A;  4AP4 C;  3EC8 A;  1Z2M A;  2RUK B;  3KZ1 A;  3M62 B;  2G4D B;  2OOB B;  4DDI D;  1ZVR A;  3HW2 B;  2M17 A;  2RQ1 A;  4KIK A;  3RT3 B;  2DHJ A;  4GDK A;  2BPS A;  2VKI A;  4IWQ A;  4JIO U;  2IY0 B;  1RFA A;  3TBL D;  2M14 A;  3JYU A;  3KSY A;  4A6H A;  5JHA A;  4AJW A;  1MPH A;  4FBJ B;  4M0W B;  2KLG A;  4NQL B;  1UPQ A;  5GOW B;  2LGY A;  2I5F A;  2LJ5 A;  2EMS A;  2KQS A;  1WY8 A;  3KW5 B;  2GBN A;  4HAW B;  2FCS A;  4TV3 A;  1XX0 A;  1I35 A;  1ISN A;  2KUP A;  1IPG A;  3R7R A;  4HDO A;  4DDG D;  3ODO A;  1BT0 A;  4BBN C;  1PMS A;  5KQ4 A;  3DBR I;  4F7Z A;  5HE1 A;  2K8B A;  3QA8 A;  4MGZ E;  4X57 B;  3BY4 B;  1EGX A;  4IAP A;  2P0D A;  2J0J A;  3VUX A;  2I1J A;  4DHJ B;  2DZM A;  4M8M A;  3UZT A;  3D8D A;  2HE7 A;  1M7E A;  2ZCC A;  3QAR A;  2N7D A;  2CRF A;  2KZR A;  4RMA A;  2KHW B;  1H4R A;  3N30 A;  3RUL A;  2HRJ A;  4F7H A;  2XQN M;  3VTV A;  3FSS A;  2ABD A;  2FNJ B;  4BFR A;  3SYX A;  3OJ3 A;  3IHP C;  3NOB A;  3MTN B;  3QK0 A;  2C60 A;  3QQ8 B;  2DZJ A;  2KC2 A;  1UNP A;  1N3H A;  4NNJ B;  2COC A;  1V81 A;  4HAU B;  1OEY A;  2M1M A;  3EHV A;  4W9D A;  4E3C A;  5C16 A;  3VHT C;  2NCN A;  4GDL B;  2MBQ A;  4DXA B;  1WI0 A;  2MP2 B;  1OY2 A;  1P9D U;  5LON B;  1FGY A;  2DKP A;  2M38 A;  4C0A A;  3A9K B;  2PE9 A;  5CLL B;  4BOZ B;  3CF6 E;  4YL8 A;  2J59 M;  2LBB A;  3SNH A;  4MGI E;  5KQ1 A;  5D27 A;  2Z59 B;  1CMX B;  1XT9 B;  1XQQ A;  1PFJ A;  4WJ7 A;  1TBE A;  4GXB A;  2O2V B;  1QZE A;  4DHZ B;  2BF8 B;  3UF8 A;  3ML8 A;  4K7U A;  3X0W A;  2CKH B;  2I5C A;  2V4L A;  1BWN A;  4WWN A;  3VTW A;  4A3P A;  1W1H A;  3A9J A;  4G3X B;  2RPQ A;  2EKE C;  3VAW A;  2GCJ A;  2Y8G A;  4EOY A;  3DDC B;  3B0A A;  1K5G B;  1EO6 A;  2D9Z A;  4FJV B;  1UEF A;  4I6N B;  5D94 A;  2OJR A;  1V80 A;  2KQ7 A;  2PE6 B;  1VD2 A;  2Z0P A;  3ML4 A;  2BYV E;  1DDM A;  3PP2 A;  4WJO A;  3L08 A;  5FI1 A;  2CHW A;  4IWO A;  2WH5 A;  2DYQ A;  2MBE A;  4TQ1 A;  2YT0 A;  1V5M A;  5E6O A;  1RJ2 A;  2KX0 A;  2PZ1 A;  2YT1 A;  2FUH B;  3D32 A;  2R2O A;  5C1Z A;  2JP2 A;  3H6N A;  2E2X A;  1HBK A;  3EEC A;  3ZVV A;  2KLC A;  1TQZ A;  4CHM A;  4KHO A;  1X05 A;  3VUY A;  2JZZ A;  1WGY A;  3VIA A;  1PQS A;  4ANV A;  1E8X A;  5L81 A;  3KUC B;  5IJM A;  1UPR A;  4GU2 A;  2YS5 A;  3OJ4 B;  4II3 B;  3L10 B;  1GUA B;  1V86 A;  4MM3 A;  5D3W A;  4IC7 B;  1TZ1 A;  4HJK A;  4F8C B;  3ULC A;  1X1F A;  4BKS A;  3PS6 A;  2K2U A;  2DTC A;  3MDB C;  4ZRK A;  4DBG A;  3ZDM C;  1WJ4 A;  4WSF A;  2GBJ A;  3SV1 A;  4HB2 B;  2DZK A;  4PQ0 A;  4ZDV A;  3P6A A;  3KUZ A;  3SD5 A;  5E6N A;  1Q67 A;  4XWX A;  2JT4 B;  1QC6 A;  2KDE B;  2DX5 B;  2L7R A;  4MGK E;  4W9F A;  3V61 A;  3PVL A;  1U29 A;  2AWT A;  3RCZ A;  3Q3F A;  2NBV B;  1WR1 A;  1U5D A;  5EFX A;  2XK5 B;  3ZTC A;  5C6R A;  5IAA C;  1RLF A;  2KJ6 A;  4FHK A;  1ZKH A;  4FJY A;  4N9F 4;  2IO2 B;  1P1A A;  1XCG A;  4W9K A;  4W9J A;  4HLE A;  4Z2N A;  2JY6 A;  4FJZ A;  3ZO5 B;  4RM8 A;  3GZN I;  4B9K A;  3DPD A;  5J3Q A;  2RGN B;  2REX A;  1G6J A;  2ZCB A;  3ZNZ B;  3DVG X;  1BTN A;  3TCA A;  2DX5 A;  3PLV A;  2L05 A;  5L95 C;  3HM3 A;  1RAX A;  2L0T A;  2FAZ A;  2ADZ A;  2K8H A;  2KXJ A;  3F0W A;  3R3M A;  2HJ8 A;  1WYW B;  5CX3 A;  3PPA A;  3DVN U;  4KAX B;  3TW1 A;  4HWI B;  3PZD A;  3AUL A;  2KMA A;  1UZX B;  4MGY E;  2PEA A;  4LJO B;  2RGF A;  2MWN B;  3A8Q A;  1B55 A;  3PRP B;  5G55 A;  2X18 A;  4NY0 A;  4ZYN A;  5KCV A;  3B1L X;  1Z5S B;  2DA0 A;  5HKH A;  3PVU A;  3AU4 A;  1FB8 A;  4WAA A;  5CLQ B;  2N0Y A;  1YIW A;  3M3J A;  2YS1 A;  4K2O A;  2J7Q B;  3DBS A;  2KJH B;  1DYN A;  4KSK C;  2D11 A;  2KKC A;  3RUI B;  3M95 A;  2J0M A;  2QKM A;  2K6Q A;  4ANW A;  5EDS A;  2IO1 B;  4KZC A;  2PPH A;  3SHQ A;  3N3K B;  1NVL A;  1BAK A;  2KFK B;  2CHX A;  1NU2 A;  4NQK E;  4XX5 A;  1UD7 A;  1FHX A;  2RLO A;  1WX7 A;  3ECI A;  2ELA A;  2CY5 A;  3GYO A;  2AYO B;  3A4R A;  3LJU X;  2PJH A;  2LD9 A;  1V5O A;  4HPM B;  3JSV B;  1WIA A;  3CXB B;  4GGQ A;  2N9E B;  1E5W A;  2C9W B;  3X23 A;  4BKG A;  1LFD A;  4XC2 A;  1P3Q U;  2KTR A;  1V5P A;  2OTX A;  3PEG A;  1U27 A;  3H7P B;  4FN2 A;  2Z0Q A;  2KVR A;  3PGE A;  4HB0 B;  5JHH A;  3UIN B;  1OEY J;  2NPT A;  2KFK A;  4W9G A;  4URK A;  4MSQ B;  1R4M I;  2MBB B;  1Q1O A;  2C7N B;  2N4F A;  1HB8 A;  2EMT A;  1WFY A;  3AJ4 A;  3JSV A;  2JRH A;  2LVQ A;  1DDW A;  3PLU A;  2KN5 A;  3OAW A;  3APC A;  2K8C A;  2Q13 A;  2XEW A;  2P0H A;  2MKR A;  3WA0 A;  2R09 A;  2D07 B;  3VFK A;  2LGD A;  1LW3 A;  3H7P A;  4B6W A;  2L76 A;  3PRZ A;  5LXI B;  1WGU A;  3NHE B;  3SU8 X;  1AAR A;  1LB1 A;  3QC8 B;  2DFK A;  2RVB B;  1X86 A;  4A6F A; 
#chains in the Genus database with same CATH topology
 3KLS X;  1RYJ A;  3NY5 A;  3R7Q A;  2RNR B;  1AN8 A;  2JXT A;  3PZ8 A;  1UEL A;  1U5G A;  4EZL A;  4HHV A;  4C4V A;  3CIK A;  2FCM A;  1S3S G;  3UIO B;  2D9W A;  1MG8 A;  4K17 A;  1Y5O A;  1C3T A;  1V2Y A;  3ZVR A;  4J3O D;  2SEB D;  4KHB A;  1KH0 A;  3L4P A;  4A9A A;  2FUG 1;  4IUM B;  3AE6 B;  4LNF A;  4LNI A;  4EEW A;  2K5P A;  1YN5 A;  4HEA 1;  5CTR C;  3T8M A;  1TZO A;  3PSC A;  3LJ3 A;  5HE0 A;  4KX6 B;  3P4Q B;  2BWF A;  2CS4 A;  1RM6 C;  4ZRQ A;  2JPH A;  2KDM A;  2KNB A;  4WAF A;  1QF6 A;  1M7R A;  3D8E A;  3BYY B;  5JLJ B;  1MI0 A;  1P7E A;  1KI1 B;  3EFU A;  4IM3 A;  5KHQ A;  3AE3 B;  1GC6 A;  1UBI A;  2WXN A;  1HTO A;  4F7G A;  1N6Z A;  2O6V D;  4JGH B;  2UVM A;  3H8H A;  2FCN A;  2IO3 B;  2AQ3 B;  4XWT A;  4W9I A;  1GJZ A;  1V61 A;  3PVW A;  4MY6 A;  3IVF A;  2GMI C;  3ULB A;  3UI3 A;  4EZK A;  1K50 A;  3ZUN A;  2LUL A;  2AL6 A;  2N1W A;  1AWD A;  4TKN A;  4JKB A;  4GN1 A;  1VRA B;  3N1Y C;  4AUQ C;  3H7S A;  3I63 C;  2H88 B;  2H7E A;  1MAI A;  1GG3 A;  1TYG B;  2MDX A;  2DAJ A;  4CO7 A;  2ROZ B;  5I2S A;  4DK5 A;  2Y8F A;  1JCK B;  2C5L C;  2KK8 A;  1XLP A;  1PGX A;  3V60 A;  1E0Z A;  3G9W A;  3A98 B;  3BII D;  3AED B;  2JF5 A;  2OQB A;  4EUT A;  4FLH A;  2WDR B;  1NEK B;  1WGG A;  4XYC A;  4XE0 A;  2W2X D;  3KVF B;  4MT5 A;  1JML A;  2P8V A;  3HIE A;  1DOY A;  4A20 A;  2Z13 A;  3W1Y A;  1HE8 A;  1ZC3 B;  1HB6 A;  4XGA B;  5L83 A;  5JP4 A;  2KDB A;  2WGS A;  3O65 B;  1HA5 A;  2M0X A;  3TVV A;  2N0S B;  3M63 B;  2R0D A;  4WWM A;  2DYB A;  1QQG A;  1JW9 D;  2D3G A;  2WXG A;  5D3I B;  2LOZ A;  1XD3 B;  2JWU A;  2GBM A;  3HQC A;  1KZG A;  3CST A;  1HZ5 A;  5LNK 1;  1YJJ A;  3M1I B;  1W1D A;  1V9J A;  1YX5 B;  4KV2 A;  4LDT D;  3TEX A;  4ZYS A;  2JYE A;  1JQ4 A;  2D4Q A;  3P2B A;  2NS5 A;  3DXD A;  3T06 A;  5J3T A;  1R4N B;  3Q2A C;  2XN9 C;  4OW0 A;  5M4Y B;  1ACA A;  1Y8R C;  4AJY B;  3SO6 A;  4HCN B;  1E7V A;  3A33 B;  1NBF C;  3NWA A;  1EUV B;  3FP5 A;  1UUP A;  5T8I A;  1V5T A;  2AL3 A;  4RGT A;  1OQY A;  2GLS A;  3OG5 A;  2XNA C;  5DIF B;  4Z2M B;  4ICV A;  2EJ8 A;  1WSP A;  1RFK A;  3CMM B;  1SB3 C;  5GMV A;  4GDL A;  2ZVO A;  1EAZ A;  1V88 A;  2MP2 A;  2LRU A;  2ZZP B;  4OVV A;  2KMC A;  4GMX B;  3FEH A;  3U2S C;  1NI2 A;  2VSZ A;  2LGX A;  1E8Y A;  2J53 A;  2ZPN A;  2HJ1 A;  1FPY A;  2PMV A;  3A9K A;  1I4X A;  4ANX A;  1Q0W B;  1I42 A;  1DRO A;  3NS8 A;  3PSE B;  1FHW A;  1FFU A;  3L17 A;  4TYZ A;  3ZKJ C;  1OQN A;  5EE3 A;  2L3Z A;  3KH0 A;  4NZL B;  2LHE A;  1J19 A;  5D7G A;  5FK9 C;  1LM8 B;  2Z59 A;  1JAL A;  2LAS A;  1MKE A;  1KF6 B;  3NSU A;  3Q3O C;  3U4E G;  4PNK A;  2MRP A;  3ZJT A;  1PDX A;  2O2V A;  5HHD G;  3OLM D;  1T0Q C;  4RH6 A;  3DHH C;  3RNC C;  2NVU I;  3WAP A;  3DXC A;  2DAF A;  4B0M A;  2L52 A;  3I3T B;  2JXX A;  3T3N A;  3ZTD A;  4MEM A;  1J7C A;  1X1M A;  2W9N A;  1D5X C;  4HK2 A;  1I7H A;  2KO3 A;  2YRY A;  1MK9 B;  3P63 A;  2UZR A;  3Q6B A;  2JYT A;  2QC8 A;  4FA6 A;  1TKG A;  1AYF A;  2RDH A;  2INC C;  4HB3 B;  4DHJ D;  4EKU A;  4HAY B;  2WHI A;  4GZU A;  3VDZ A;  4F7U P;  3NVW A;  1WJ1 A;  2MEK A;  4GPT B;  4HAZ B;  1FMA D;  4PYZ A;  4IM2 A;  4WWO A;  2KAN A;  4D2K A;  4PK1 A;  4JQW C;  1EU3 A;  1E9M A;  4DIX A;  1SIF A;  1OQR A;  3CIR B;  2LVP A;  3RZW C;  1P3R A;  2Q5W D;  3SDL C;  1DOI A;  2D3A A;  3A1Q B;  1HXY D;  3SEB A;  1ESF A;  1NTV A;  2Z0D B;  3HVD A;  2WU2 B;  2K0P A;  5D6J B;  3RZF A;  3UQB A;  2DN6 A;  2LUM A;  4KGS A;  2M56 B;  2PIA A;  2ACZ B;  4PS8 A;  5DPW A;  1E7U A;  1UNR A;  1LXD A;  1WMH B;  2SAK A;  4WQO B;  2A5U A;  2M4N A;  2N23 A;  2WXL A;  3BJI A;  2MX2 A;  1TTN A;  1XEE A;  5JXV A;  3P42 A;  4R3D A;  5CHW A;  4IFS A;  1D3Z A;  2BQQ A;  1ST7 A;  1WVH A;  3WAM A;  4MH8 A;  1C76 A;  1AQC A;  1WGK A;  1WGR A;  2C7M B;  4HXD A;  1WZ0 A;  2DYO A;  2G35 A;  3NWF A;  2GOW A;  2HD5 B;  2D10 A;  3N7C A;  3ODW A;  1DGJ A;  2BCJ A;  1P5T A;  4KHA A;  3PG7 A;  1SIJ A;  3ZW3 A;  3HK0 A;  4KGT A;  2V0G A;  2ZPY A;  2ZNV C;  1TS4 A;  2Z0E B;  3VVW B;  3OHM B;  5J3Y A;  4NJ7 A;  2K2J A;  1YX6 B;  2L1C A;  1FEH A;  1F2R C;  1M94 A;  2DEN B;  3NG0 A;  2D9V A;  1XD4 A;  4EFO A;  1QOA A;  1GC7 A;  1IRS A;  4IOY X;  3TEW A;  1NEN B;  2COF A;  5DPT A;  3R2I A;  1TGZ B;  2A4Z A;  3E9O A;  1L0Y B;  1UGJ A;  1P0R A;  1DDV A;  1I4Q A;  1OTR B;  1FM0 D;  2BKR B;  1WXV A;  1L2N A;  1R4N I;  4C7Z A;  2LXA A;  2W55 A;  1FXA A;  3RNA C;  4A5K A;  3I9V 1;  2LI5 A;  1WXA A;  3ZYY X;  1Q5W B;  1EVH A;  5FR6 A;  2K39 A;  4N6E B;  2KX3 A;  2DLW A;  4E74 A;  3B2G A;  3KYD D;  2IO0 B;  1JWU D;  1EM7 A;  3DHG C;  2BYE A;  3K9P B;  1GOZ A;  4TUU A;  3PHX B;  4NSW A;  4AOF A;  3H9D A;  2DYM A;  2X0S A;  3ALB A;  3V5W A;  2ELB A;  2PKO A;  5H8Y E;  2E3T A;  1NVI D;  2EC1 A;  4HB4 B;  4DWF A;  3L16 A;  1SGH A;  2V1Y A;  2XK5 A;  3KUD B;  4M00 A;  4HDQ A;  2MBH A;  2W3S A;  1T77 A;  3JW0 X;  5JHB A;  2COA A;  2HTH B;  3AE1 B;  3A4S C;  4HAV B;  5TR5 A;  1C1Y B;  3GOE A;  5BYS A;  3U30 A;  2CJO A;  4BKS D;  1ZP0 B;  4RGM A;  4CHJ A;  2BGF A;  1LGR A;  5AEK B;  3IT6 B;  3CSF A;  3VH3 B;  1T5X D;  1FNW A;  3TFM A;  2MWS B;  1N62 A;  1YQ4 B;  5HE3 A;  2ASQ A;  4L1R A;  1L0V B;  1P98 A;  3VXW A;  1Y56 A;  2KWU B;  2JWZ A;  2L0F A;  4TQ0 A;  4JKA A;  1E7P B;  4HAT B;  1WG7 A;  5JH5 C;  2Z0O A;  1WX8 A;  3TO1 A;  2JZP A;  4HRO A;  3ONS A;  4KSL C;  3AMZ A;  3WAN A;  1LQB A;  4CHK A;  3BIN A;  4RF0 A;  5FI0 A;  2KTF A;  3ODX A;  2N9X A;  2I1K A;  1WH3 A;  1E8W A;  5LLI A;  1ZPS A;  2HTH A;  4MSM B;  2BYF A;  2PW9 A;  2O6V B;  3W5V B;  1ZSQ A;  4HJG E;  2HTM E;  1U5F A;  1ZGU B;  4EMO A;  4YON A;  2LXC A;  3AEB B;  1OMW A;  2KWC A;  3DXE A;  2WLB A;  5IA7 A;  2WYQ A;  1I4H A;  2CQU A;  2WXQ A;  3PHW B;  4JPS A;  1KOT A;  3SFE B;  5JZE B;  1GPX A;  4LK0 M;  1MVK A;  3T9L A;  3ZLZ A;  4NAW B;  4II2 B;  2B3A A;  2JU6 X;  2MA9 B;  3R2T A;  1QIL A;  5AZG A;  2L32 A;  1BML C;  2UWQ A;  2NBW B;  2KFJ A;  5DHF B;  3ZRC A;  2YVC A;  1P7F A;  2ZKM X;  1FRR A;  1VCB A;  3EA6 A;  4W9C A;  4G11 A;  4FXC A;  5J17 A;  2WU5 B;  3NUH B;  1N60 A;  1YQB A;  4ZHP A;  3JVZ X;  3W1S C;  1V6E A;  3Q69 A;  3PRM B;  2NMB A;  1XOD A;  3DWM A;  1NTY A;  4GMV A;  4LTU A;  3V05 A;  1U5E A;  4A6K A;  3BK2 A;  4GDK B;  5G5G A;  1IP9 A;  4YTM B;  2KOX A;  3QIJ A;  4DX8 A;  3L54 A;  2QIE B;  2YT2 A;  3FIL B;  2H7D A;  2D3B A;  3IFW B;  1MI1 A;  1A5R A;  4JKG B;  4WVF B;  1HEZ E;  2CJN A;  2WXI A;  4BKT A;  1JWA D;  1PLS A;  3AH7 A;  4KDI C;  2GS0 A;  2BWE S;  2GCL A;  5CHF A;  2QDF A;  4NAW A;  4ASW C;  4W9L A;  1UGM A;  4OVU A;  2LWP A;  4BBN F;  4CQN A;  3V6C B;  3N20 C;  3BVZ A;  4B95 A;  5D3D A;  4AS1 A;  1QOF A;  5EE0 A;  3ZXV A;  1J0W A;  2LG1 A;  2N9K A;  1NYR A;  2ON8 A;  4GLS C;  2IPK D;  3LDZ E;  3DVN V;  2L00 B;  3NWD A;  2CU3 A;  3KQ4 A;  4IOI E;  4K7S A;  1WZ3 A;  4USA A;  2V76 A;  1Z87 A;  2DZI A;  4WJQ A;  4F1S A;  1MG4 A;  1YQ3 B;  4HAX B;  3U12 A;  1IGD A;  1MHX A;  5HE2 A;  1ZC4 B;  1XCQ L;  2INP E;  5C2T B;  5BO4 B;  3URY A;  3WIM A;  1VDV A;  5C3J B;  4P7I A;  1FXT B;  1I4P A;  2KAC A;  5JVL A;  5EE9 A;  3W2D A;  1AW7 A;  1P6S A;  2RDB C;  1NTI A;  4GOC A;  4FAD A;  3UGB B;  4KKJ A;  2M0A A;  2GI9 A;  2PVO D;  1QLB B;  1ZDV A;  3VTU A;  1UWX A;  2W2W A;  4LCD E;  2W2X C;  1NYQ A;  2Y5P A;  2KD0 A;  5DH9 B;  3PT2 B;  1B1Z A;  2BW2 A;  3APD A;  2WX0 A;  4EJN A;  3RFZ B;  4ARI A;  3QX1 A;  2N9L A;  4MAC A;  1F9J A;  4KVG B;  4DHZ E;  4DQO C;  2KCJ A;  2DHK A;  3DBH B;  3Q3M C;  2D9X A;  1MK7 B;  1QOB A;  2WXM A;  2VH2 A;  2KQ4 X;  1J0G A;  2KMM A;  3KYC D;  4ICU A;  1C78 A;  4YSX B;  2RR9 A;  5FKA C;  1XKE A;  1D5Z C;  5I2M A;  3RN9 C;  1CQV A;  4K3C A;  1DBH A;  3EPY A;  1L4Z B;  4I6P A;  3L13 A;  1VBG A;  3ABV B;  4PS7 A;  4BZA A;  1WRI A;  4CYE A;  3Q3J A;  2DLB A;  4ILH A;  3IG3 A;  1R7S A;  1E90 A;  4J6I A;  1L6V A;  5AZH A;  4P16 A;  2NBU A;  4HCP B;  2IDY A;  3OAN A;  3E9S A;  3PV1 A;  3TEZ A;  1U2B A;  2M19 A;  2DHZ A;  1V1P B;  1K8R B;  3BWU D;  2J0K A;  1SE9 A;  4PS3 A;  3NW8 A;  3BYT B;  3VH4 B;  3RD2 A;  1WYG A;  1WX9 A;  4ILG B;  1WXQ A;  3AE5 B;  2ZJD A;  4IW0 A;  4M8N A;  4RGN A;  4G50 A;  5J2R A;  3WAO A;  2ZW1 A;  3VR9 B;  2YLM A;  2R82 A;  1TIF A;  1RRP B;  1W1G A;  1J7B A;  5DCN A;  2KAJ A;  3S2A A;  2JSV X;  4D6W A;  4K7W A;  4RFB A;  4MDK E;  1XLN A;  1DOX A;  2NZ8 B;  3AU5 A;  2NR2 A;  3HIZ A;  3PTF C;  2L8J A;  2M8S A;  2OHF A;  3DBL B;  1D5M C;  5LXH A;  4OT1 A;  3SUZ A;  4M01 A;  4Q2J A;  4WIP A;  1KC7 A;  2FJ9 A;  3IAS 1;  2JVC A;  4AQ7 A;  1V5U A;  1TS2 A;  1SJH D;  2WXP A;  5HFY A;  4L23 A;  2X8X X;  4A90 A;  2LZ6 A;  2BB6 A;  1ZXI A;  4JE3 B;  2CY4 A;  4EE2 A;  1UH6 A;  2IYD B;  4PYU A;  1QOG A;  2BS4 B;  3IXS A;  5I4D A;  2DKQ A;  3A9J B;  2GBR A;  1WJN A;  4ZRJ A;  1X11 A;  1YOV B;  3NZ3 A;  2Y7B A;  1OGW A;  2G3Q B;  1K51 A;  4XZ4 A;  4JKC A;  3KRX A;  1FOE A;  3IBE A;  2C7H A;  1JWB D;  2R2Q A;  3FLV A;  1X1G A;  1A70 A;  2LUE A;  3RCP A;  2K25 A;  1L0X B;  1KZ7 A;  3RNE C;  4L2Y A;  2V3N A;  2YF0 A;  1ZW7 A;  1WGQ A;  4YWG G;  2ICI A;  3TL5 A;  1AWE A;  3PO0 A;  3RYT A;  5DI9 B;  3Q3N C;  2N7E A;  2QHO A;  2JUO A;  2KIE A;  4JX1 C;  2DHI A;  4E71 A;  1ZDX A;  1YJI A;  3FC4 A;  4XWW A;  1UBQ A;  5J18 A;  1WXS A;  3ZNH B;  3O96 A;  4GB9 A;  4MT7 A;  5D3V A;  3ML9 A;  3MHS D;  5DPR A;  1L4D B;  2Y5B B;  1FAO A;  4ACF A;  3ZJV A;  3I5J C;  2INN E;  2N1V A;  4IG7 B;  3GE8 C;  1EF1 A;  2JZ3 B;  4BOS C;  3LB8 C;  2FE8 A;  4YSY B;  3U7D A;  2V3S A;  4ILJ A;  1C4C A;  4MH0 E;  4CSQ A;  3H1U A;  1WJM A;  3PRE A;  3AEG B;  3EGR A;  3VOQ A;  3SR6 A;  4BVU C;  1SEB D;  5DPS A;  3RNB C;  1SF0 A;  1I2H A;  5IN7 A;  3QWM A;  1KJT A;  3AI5 A;  2IYB A;  1OFF A;  3WYF B;  3B9J A;  5G2N A;  2ZNV B;  5H92 C;  3OWE B;  4L1B A;  1T0Y A;  3P4P B;  4EZJ A;  2IND C;  2FID A;  1UF0 A;  3L0W B;  2J4X A;  3AN1 A;  2WDV B;  3HHM A;  3DBH I;  2CB8 A;  2MW5 A;  2JRI B;  1JRU A;  4WJN A;  1WGD A;  2MQJ A;  2GBK A;  3K9O B;  3V6E B;  1KLV A;  3QBV B;  3AE7 B;  2YS3 A;  2KR0 A;  1MPE A;  2TSS A;  4ZRI A;  3NS1 A;  1KRH A;  3QCA A;  3HVZ A;  1WJ6 A;  1EWC A;  2QKL A;  2COP A;  5C23 A;  2ZVN A;  1E8Z A;  2FCQ A;  3QHT A;  4LNO A;  2RRF A;  2DWQ A;  2G9H D;  2KJR A;  4KZ0 A;  1I7A A;  4H8S A;  1TJ6 A;  1VR9 A;  2KDI A;  5CHV C;  4JWU C;  3C0R B;  2VZK B;  3NZU A;  2BTE A;  3NVV A;  2KGX B;  2YEP F;  4YXD B;  2RSG A;  2J42 A;  2AEH A;  2D9Y A;  4MJS B;  2E6X A;  3UIP B;  2WXK A;  3TMP B;  3RI7 C;  1SSN A;  1HQR D;  1XXG A;  4WJP A;  5DHA B;  2VRR B;  4C80 A;  3GYP A;  5LOP B;  3AE9 B;  4QJ4 B;  1S1Q B;  2KDF B;  4NAM A;  5C79 A;  2AQ2 B;  5AZF A;  2CR5 A;  3A58 A;  1H8C A;  2K00 A;  3MC8 A;  2DIK A;  2K1F A;  2D3C A;  3DBL I;  5IP4 D;  2FJL A;  1GNU A;  4XDC A;  3CWI A;  4QJ5 B;  1N5X A;  3DVG Y;  4NPN A;  4RM9 A;  1V49 A;  3HUI A;  1SXT A;  2B76 B;  4OVZ A;  4W9E A;  3A1Q A;  2UZS A;  4DX9 0;  2P0F A;  3APF A;  3P1M A;  3ENE A;  2G4S A;  4GIV A;  1UNQ A;  5BMH A;  1IYF A;  2COD A;  2CU1 A;  1YJ1 A;  2RSU A;  3C19 A;  1WMH A;  1WXM A;  4MJS A;  1J8C A;  2N9P C;  3WAL A;  3D8F A;  3P7Z A;  2DNF A;  4K81 A;  3AEF B;  1VZ6 A;  2FDQ A;  2ONQ A;  2BKF A;  1WJU A;  1SHC A;  4D0N B;  2GB1 A;  1GGO A;  2QCZ A;  2EEL A;  3AEC B;  4DXF A;  1L5P A;  3ZNG C;  3QWZ B;  1K5D B;  3V62 A;  1QKZ A;  2L83 A;  2D2Q A;  1VZ7 A;  2FIF A;  2IZV B;  4ANU A;  4NJ6 A;  2LHD A;  2MFQ A;  1H10 A;  1BUI C;  2QIL A;  4MK0 A;  4OSN A;  2L2I A;  1KM7 A;  4B6H A;  2DX1 A;  3E66 A;  4US9 A;  3QAQ A;  1WGH A;  1YD8 U;  5D3Y A;  1YNT E;  4MEL A;  1WM3 A;  2LVO A;  2D5G A;  1BXT A;  3MJW A;  4L6E A;  4LLG M;  4O1N A;  4FHJ A;  3GB1 A;  1Y19 B;  2VH1 A;  3B77 A;  1XLQ A;  3KY9 A;  2BT6 A;  1TS5 A;  4G0N B;  2IFS A;  5KHO A;  1FHO A;  3A8P A;  2ROV A;  2QMT A;  3TIX A;  5C5B B;  4JLC A;  3DCG A;  4HPL B;  1ZM0 A;  3MPX A;  4OZB A;  5JHG A;  1WM2 A;  4WWP A;  2W82 A;  1BTK A;  1L7Y A;  3HSA A;  1WE6 A;  3QJZ A;  1V89 A;  3FM8 C;  3P4S B;  4FUL A;  2XBB C;  3DBR B;  3ZNI D;  3PZ7 A;  2WP9 B;  2KWV B;  2LYD A;  4JK9 A;  3E9P A;  2KTR B;  1FO4 A;  2NTT A;  5D2M B;  1FGZ A;  4AWJ A;  2MLB A;  3KRW A;  2HDE A;  1FFV A;  1WRD B;  2IJ0 A;  3TSS A;  2LOX A;  2KUQ A;  2V9H A;  2WX1 A;  2G1E A;  1T6B X;  1JRP A;  4GSW A;  1MJD A;  4K2P A;  3MP9 A;  3B08 A;  4JK8 A;  2NPT B;  4PT5 A;  3VQI A;  1PFD A;  1N61 A;  3MJ5 A;  4HVB A;  2RD0 A;  1WR6 E;  4JL9 A;  5C5B A;  4I6L B;  4YSZ B;  3TJP A;  1XR0 B;  3MHZ A;  1T0R C;  2N7J A;  1MIX A;  5BMG A;  1TXD A;  2RDG A;  4IKG A;  3SFD B;  2DYN A;  4A3O A;  3F5R A;  3W1S A;  4DBB A;  1Q10 A;  4NJC A;  2GUM A;  3R66 C;  2K6D B;  3N32 A;  2WWZ A;  1ZUD 2;  4KGR A;  2JX5 A;  2ZEQ A;  4WQM A;  2K22 A;  2AQ1 B;  3MC9 A;  2YSZ A;  3U8Z A;  1V8C A;  1WE7 A;  2WDT B;  4JK7 A;  1WI1 A;  1WF9 A;  2G45 B;  3T3O A;  1GB1 A;  1U4A A;  1YN3 A;  4ARC A;  1IGC A;  2CHZ A;  2UYZ B;  3IAM 1;  2MCN B;  1FIQ A;  2VRW B;  2LRW A;  1MIZ B;  4A6F B;  1ROE A;  3NZS A;  2O6V A;  4KIK B;  1NI3 A;  2R2Y A;  5D3X A;  3ZIM A;  3VUW A;  4QXA B;  1EF5 A;  3UQA A;  1NDD A;  4IM0 A;  4W9H A;  4RF1 A;  4KDL B;  2LKO A;  2OED A;  4C4V B;  5BYR A;  5E6P A;  1UWM A;  1KLU D;  2MSE D;  4JWS C;  3HM6 X;  3ZRF A;  4OHJ A;  1RWS A;  3DQV A;  4IWP A;  3DOW A;  4BBK A;  2IY1 B;  5GXG B;  4N59 A;  3LYY A;  1EU4 A;  4KHB B;  4LDT B;  4Y94 A;  4K1R B;  4LJP B;  2MBO A;  1JWS D;  3AXC A;  2FJU B;  3U52 E;  3ZDT A;  2WXJ A;  3DHI C;  3DWG C;  2IBI B;  3Q8B A;  2GJY A;  2KC1 A;  2CAY A;  1RRB A;  4AP4 C;  3EC8 A;  1Z2M A;  2LMC A;  2RUK B;  2LGS A;  2QEJ C;  3AV8 A;  2K9X A;  2Y5C A;  3KZ1 A;  4HKQ A;  3M62 B;  2G4D B;  2OOB B;  4DDI D;  1ZVR A;  3HW2 B;  1T3Q A;  2RQ1 A;  2M17 A;  4KIK A;  3RT3 B;  2KT7 A;  2DHJ A;  4GDK A;  2BPS A;  2BBC A;  2VKI A;  2IY0 B;  4JIO U;  4IWQ A;  1RFA A;  3TBL D;  2M14 A;  3JYU A;  3FIL A;  3AE2 B;  3KSY A;  4A6H A;  5JHA A;  3TUO A;  1MPH A;  4AJW A;  4FBJ B;  3NRZ A;  4JKG A;  3AEE B;  1VBH A;  3BZD B;  4M0W B;  2KLG A;  3C8Y A;  4BAX A;  3VRA B;  4NQL B;  1UPQ A;  5GOW B;  3ETR A;  2LGY A;  2I5F A;  2LJ5 A;  2K49 A;  2EMS A;  2KQS A;  1WY8 A;  3SBG A;  3KW5 B;  2GBN A;  4HAW B;  1GB4 A;  1YMH E;  2FCS A;  1FNV A;  2BVC A;  2LFI A;  4TV3 A;  5EE1 A;  1XX0 A;  1I35 A;  1ISN A;  4JKD A;  4JKF A;  2KUP A;  1IPG A;  3R7R A;  4HDO A;  3N9Y C;  2R61 A;  4DDG D;  4ITK A;  3BVM A;  2WS3 B;  3ODO A;  1M4V A;  1BT0 A;  4BBN C;  1PMS A;  5KQ4 A;  3DBR I;  4F7Z A;  5HE1 A;  2QSD A;  2K8B A;  3QA8 A;  4HRS A;  4MGZ E;  2ZW0 A;  4X57 B;  3BY4 B;  1EGX A;  1DIK A;  2GRI A;  4IAP A;  1ZOY B;  2P0D A;  2J0J A;  3BVG A;  2BB5 A;  3VUX A;  2FBW B;  1FD6 A;  2I1J A;  4DHJ B;  3KWV A;  2DZM A;  4M0W A;  4M8M A;  3UZT A;  3D8D A;  2HE7 A;  1CK1 A;  1SE3 A;  1M7E A;  1TY0 A;  1SBB B;  2ZCC A;  2NMQ A;  4HSI A;  1F52 A;  3QAR A;  2N7D A;  1FRD A;  1ZXH A;  2CRF A;  1ZE3 D;  2KZR A;  4RMA A;  2KHW B;  1H4R A;  3N30 A;  3RUL A;  2HRJ A;  4WUR A;  3ZGZ A;  4F7H A;  2XQN M;  3LXF A;  3VTV A;  3FSS A;  1LO5 D;  1FXI A;  2ABD A;  2FNJ B;  1MHH E;  4BFR A;  3SYX A;  3OJ3 A;  1STE A;  3IHP C;  3NOB A;  1F0Z A;  3MTN B;  3QK0 A;  1MFW A;  3ZQ4 A;  3O13 A;  1HTQ A;  3ZXR A;  2C60 A;  4YT0 B;  1C77 A;  3QQ8 B;  2DZJ A;  2KC2 A;  1UNP A;  1N3H A;  4NNJ B;  3AM9 A;  2COC A;  3RPF C;  4C7Y A;  2DBY A;  1V81 A;  4OZC A;  5FR3 A;  4HAU B;  1OEY A;  2M1M A;  4ZOH C;  2MJD A;  3EHV A;  4W9D A;  4E3C A;  5C16 A;  3VHT C;  2BS2 B;  2NCN A;  4GDL B;  2MBQ A;  4DXA B;  1FCC C;  2KIG A;  1TKE A;  1OY2 A;  1WI0 A;  2MP2 B;  2PLP A;  3AB5 A;  1P9D U;  5LON B;  1PYW D;  1V1P A;  4KKI A;  1JDE A;  1FGY A;  2DKP A;  4XDD A;  2M38 A;  2I38 A;  4C0A A;  3B2F A;  1KFY B;  3A9K B;  2PE9 A;  5CLL B;  4US8 A;  4BOZ B;  3CF6 E;  1ZYI A;  4YL8 A;  2J59 M;  2LBB A;  3SNH A;  3P4R B;  3FKY A;  4MGI E;  5KQ1 A;  5D27 A;  3GZN B;  2Z59 B;  1CMX B;  2PVG C;  5E6J A;  1XT9 B;  1XQQ A;  3N1X C;  1PFJ A;  4WJ7 A;  2RMM A;  1JWM D;  1TBE A;  4GXB A;  1SE2 A;  2O2V B;  1QZE A;  5IO9 A;  4DHZ B;  2BF8 B;  1N63 A;  3UF8 A;  1IUE A;  3ML8 A;  2V4I B;  4K7U A;  3X0W A;  2WXR A;  2CKH B;  2Z14 A;  1CZP A;  4IDI A;  2I5C A;  2LGI A;  2V4L A;  1BWN A;  4WWN A;  3VTW A;  3Q8A A;  4A3P A;  1W1H A;  5MPO A;  1ACC A;  2LJI A;  1T0S C;  3A9J A;  4G3X B;  2RPQ A;  2EKE C;  3VAW A;  2GCJ A;  2Y8G A;  4EOY A;  5AUK A;  3DDC B;  3B0A A;  1K5G B;  1EO6 A;  2KVZ A;  2K8E A;  4HKZ E;  5HI1 A;  3E9L A;  1C4A A;  2D9Z A;  4RGO S;  4FJV B;  1UEF A;  4I6N B;  5D94 A;  3Q8C A;  3VR8 B;  2OJR A;  3EUB 2;  1V80 A;  1GAQ B;  2KQ7 A;  2PE6 B;  1VD2 A;  2Z0P A;  3ML4 A;  2BYV E;  1DDM A;  4MM3 B;  2AX5 A;  3PP2 A;  4WJO A;  1HZ6 A;  3L08 A;  5FI1 A;  1XF5 L;  2CHW A;  4IWO A;  2WH5 A;  2DYQ A;  2MBE A;  4TQ1 A;  2YT0 A;  1V5M A;  5E6O A;  1RJ2 A;  2KX0 A;  2PZ1 A;  2YT1 A;  2FUH B;  3D32 A;  2R2O A;  2Z8L A;  5C1Z A;  3MFG A;  2JP2 A;  3H6N A;  2E2X A;  1HBK A;  3EEC A;  1XLO A;  3ZVV A;  1V1O A;  2KLC A;  1TQZ A;  4CHM A;  5IOI A;  3Q8F A;  4KHO A;  4QAY A;  4S0R A;  2V3P A;  1X05 A;  3VUY A;  2JZZ A;  1WGY A;  3VIA A;  1PQS A;  4ANV A;  4P1C C;  5HG2 A;  1E8X A;  2KYW A;  1DYQ A;  5L81 A;  2JQR B;  1V97 A;  3KUC B;  2YEP B;  5IJM A;  1UPR A;  2LEK A;  2YS5 A;  3OJ4 B;  4GU2 A;  4A6Q A;  2BS3 B;  4YTP B;  4II3 B;  3L10 B;  4TMA B;  3E56 A;  1GUA B;  4QJ3 B;  1PUT A;  1V86 A;  4MM3 A;  5D3W A;  4IC7 B;  1YN4 A;  1TZ1 A;  4HJK A;  4F8C B;  3ULC A;  3IT4 B;  1X1F A;  4BKS A;  1PGA A;  3PS6 A;  2K2U A;  2DTC A;  4GOU A;  3MDB C;  4ZRK A;  2Z4D A;  4DBG A;  1K52 A;  3ZDM C;  1ET9 A;  2Y3A A;  1WJ4 A;  3N1Z C;  4WSF A;  2GBJ A;  2IGG A;  3SV1 A;  4HB2 B;  4S17 A;  2DZK A;  4PQ0 A;  4ZDV A;  3P6A A;  3GE3 C;  3GS2 A;  3KUZ A;  3SBT A;  3SD5 A;  1UNS A;  1B9R A;  5E6N A;  1Q67 A;  4XWX A;  1L6U A;  2JT4 B;  4ZHO A;  1QC6 A;  2KDE B;  1R4M B;  3Q8E A;  2DX5 B;  3NVY A;  2L7R A;  4MGK E;  4W9F A;  3V61 A;  1K53 A;  2J52 A;  5G5H A;  3PVL A;  1U29 A;  2AWT A;  1TS3 A;  3RCZ A;  1ET6 A;  2I2Y A;  2WQY B;  3Q3F A;  2NBV B;  1WR1 A;  2WXH A;  1KBL A;  1U5D A;  5EFX A;  4JKH A;  2XK5 B;  3ZTC A;  5C6R A;  3VRB B;  1VLB A;  5IAA C;  2BYT A;  1RLF A;  2KJ6 A;  4FHK A;  3ENB A;  1ZKH A;  2PTL A;  4FJY A;  4N9F 4;  2IO2 B;  1P1A A;  1XCG A;  4W9K A;  4OZA A;  4W9J A;  4HLE A;  4Z2N A;  2EKI A;  2JY6 A;  4FJZ A;  3ZO5 B;  4RM8 A;  2IGH A;  4RNA A;  3AEA B;  3GZN I;  4B9K A;  5IRS A;  3DPD A;  3W9C B;  2WXO A;  5J3Q A;  2MH7 A;  2RGN B;  2REX A;  3FAH A;  1G6J A;  1F1H A;  2ZCB A;  1KLG D;  3ZNZ B;  3DVG X;  1BTN A;  3TCA A;  2DX5 A;  2H89 B;  1EWY C;  3PLV A;  2L05 A;  5L95 C;  1PGB A;  3HM3 A;  1RAX A;  2L0T A;  2FAZ A;  2ADZ A;  4C00 A;  2K8H A;  4LNN A;  1KTK A;  4RCO A;  2KXJ A;  3F0W A;  3R3M A;  4P1B C;  2NBV A;  2HJ8 A;  1WYW B;  2IGD A;  5CX3 A;  3PPA A;  1TJE A;  3DVN U;  4KAX B;  3TW1 A;  4HWI B;  3PZD A;  5TSS A;  3AUL A;  2KMA A;  1IBX B;  1UZX B;  4MGY E;  2PEA A;  4C56 C;  4LJO B;  2RGF A;  2MWN B;  2MJ3 A;  3A8Q A;  3MC0 B;  1B55 A;  1C79 A;  3PRP B;  5G55 A;  1VZ8 A;  2X18 A;  4NY0 A;  1F77 A;  4ZYN A;  4A55 A;  5KCV A;  3B1L X;  1J7A A;  1Z5S B;  2DA0 A;  1ENF A;  2UU7 A;  5HKH A;  3PVU A;  2WDQ B;  3AU4 A;  3HRD D;  1FB8 A;  4LNK A;  4WAA A;  1FNU A;  4K3B A;  5CLQ B;  4TSS A;  1E6E B;  2QJL A;  2N0Y A;  1F2R I;  2X38 A;  1YIW A;  5IKC M;  3M3J A;  2YS1 A;  4K2O A;  2J7Q B;  3DBS A;  2KJH B;  3ZJU A;  3BK1 A;  1DYN A;  3R8B A;  2KWD A;  3TEY A;  4WH4 A;  4KSK C;  2D11 A;  2KKC A;  3RUI B;  3M95 A;  2J0M A;  2QKM A;  2K6Q A;  4ANW A;  3Q14 C;  5EDS A;  2IO1 B;  4KZC A;  2PPH A;  3SHQ A;  3N3K B;  1D6E C;  1NVL A;  1BAK A;  3DCX A;  2KFK B;  2CHX A;  2W54 A;  3V3X A;  1NU2 A;  4NQK E;  3EFC A;  4XX5 A;  1UD7 A;  3KWL A;  1FHX A;  2VZK D;  1IBX A;  2RLO A;  1WX7 A;  1N5W A;  3ECI A;  1D4B A;  5BYQ A;  2ELA A;  2CY5 A;  3GYO A;  2AYO B;  1SE4 A;  3A4R A;  3LJU X;  1CJE A;  2PJH A;  4A8X C;  3RNG C;  2LD9 A;  3FVC A;  1V5O A;  4HPM B;  2MJE A;  1WIA A;  3JSV B;  3CXB B;  1VJK A;  1TY2 A;  4GGQ A;  3GP7 A;  2N9E B;  1E5W A;  2C9W B;  3X23 A;  5LG4 B;  4BKG A;  3RMK C;  1LFD A;  3I57 A;  4XC2 A;  3W5U B;  1C9F A;  1P3Q U;  2KTR A;  1XCT L;  1V5P A;  2RPV A;  2K3U A;  2OTX A;  1TT5 B;  3PEG A;  1U27 A;  3H7P B;  4FN2 A;  2Z0Q A;  2WNM A;  3NVZ A;  1OQQ A;  4B0E A;  1JRO A;  2KVR A;  3PGE A;  5BMI A;  4GNK B;  2WXF A;  3J9C A;  4HB0 B;  5JHH A;  3UIN B;  4UDU C;  2NTS A;  4ZRP A;  1OEY J;  2NPT A;  1I4R A;  1TKY A;  2KFK A;  4W9G A;  3AE4 B;  4URK A;  4MSQ B;  4DXG A;  1R4M I;  1QQR A;  2L1A A;  4P6V F;  2MBB B;  1Q1O A;  2C7N B;  3WCQ A;  2N4F A;  1E10 A;  1HB8 A;  2EMT A;  4N58 A;  1WFY A;  3AJ4 A;  4REZ A;  3JSV A;  2JRH A;  1XO3 A;  2LVQ A;  1DDW A;  3PLU A;  4YTN B;  1C4P A;  2KN5 A;  3AE8 B;  3OAW A;  3APC A;  2K8C A;  2Q13 A;  2XEW A;  3RNF C;  2P0H A;  2MKR A;  3WA0 A;  1SJE D;  5AUI A;  1QT9 A;  4JKE A;  4M02 A;  3U7Z A;  2R09 A;  2D07 B;  3VFK A;  2LGD A;  1LW3 A;  3H7P A;  3NJT A;  4B6W A;  2L76 A;  3PRZ A;  5LXI B;  2KN4 A;  1WGU A;  1WWT A;  3NHE B;  3SU8 X;  1I4G A;  1AAR A;  4HPP A;  1LB1 A;  2MHJ A;  2DFK A;  3QC8 B;  2RVB B;  1X86 A;  4A6F A;  4H2A A;  2W3R A;  1FCL A;  2OJW A; 
#chains in the Genus database with same CATH homology
 3NY5 A;  3R7Q A;  2RNR B;  1UEL A;  1U5G A;  4EZL A;  4HHV A;  3CIK A;  2FCM A;  1S3S G;  3UIO B;  2D9W A;  1MG8 A;  4K17 A;  1Y5O A;  1C3T A;  1V2Y A;  3ZVR A;  4IUM B;  4EEW A;  5CTR C;  3T8M A;  3PSC A;  3LJ3 A;  5HE0 A;  2BWF A;  2CS4 A;  2JPH A;  2KNB A;  1M7R A;  3D8E A;  5JLJ B;  1KI1 B;  3EFU A;  4IM3 A;  5KHQ A;  1GC6 A;  1UBI A;  4F7G A;  2O6V D;  4JGH B;  2UVM A;  2FCN A;  2IO3 B;  4W9I A;  1GJZ A;  1V61 A;  3PVW A;  4MY6 A;  3IVF A;  2GMI C;  3ULB A;  4EZK A;  3ZUN A;  2LUL A;  2AL6 A;  2N1W A;  4TKN A;  4JKB A;  4GN1 A;  4AUQ C;  3H7S A;  2H7E A;  1MAI A;  1GG3 A;  2MDX A;  2DAJ A;  4CO7 A;  2ROZ B;  4DK5 A;  2Y8F A;  2C5L C;  2KK8 A;  3V60 A;  3G9W A;  3A98 B;  2JF5 A;  2OQB A;  4EUT A;  4FLH A;  1WGG A;  2W2X D;  3KVF B;  2P8V A;  4A20 A;  3W1Y A;  1HE8 A;  1ZC3 B;  1HB6 A;  5L83 A;  5JP4 A;  2KDB A;  3O65 B;  2M0X A;  3TVV A;  3M63 B;  2R0D A;  2DYB A;  1QQG A;  2D3G A;  2LOZ A;  1XD3 B;  2GBM A;  3HQC A;  1KZG A;  3CST A;  3M1I B;  1W1D A;  1V9J A;  1YX5 B;  4KV2 A;  4LDT D;  2D4Q A;  3P2B A;  2NS5 A;  3DXD A;  3T06 A;  5J3T A;  1ACA A;  1Y8R C;  4AJY B;  3SO6 A;  4HCN B;  1E7V A;  3A33 B;  1NBF C;  1EUV B;  3FP5 A;  1V5T A;  2AL3 A;  1OQY A;  5DIF B;  4Z2M B;  4ICV A;  2EJ8 A;  3CMM B;  5GMV A;  4GDL A;  2ZVO A;  1EAZ A;  1V88 A;  2MP2 A;  2LRU A;  2ZZP B;  4OVV A;  2KMC A;  4GMX B;  3FEH A;  1NI2 A;  2VSZ A;  2LGX A;  1E8Y A;  2ZPN A;  3A9K A;  4ANX A;  1Q0W B;  1I42 A;  1DRO A;  3NS8 A;  3PSE B;  1FHW A;  3L17 A;  4TYZ A;  3ZKJ C;  1OQN A;  2L3Z A;  3KH0 A;  1J19 A;  5D7G A;  1LM8 B;  2LAS A;  1MKE A;  3NSU A;  4PNK A;  2MRP A;  2O2V A;  3OLM D;  2NVU I;  3WAP A;  3DXC A;  2DAF A;  3I3T B;  2JXX A;  3ZTD A;  4MEM A;  2W9N A;  1X1M A;  4HK2 A;  2KO3 A;  2YRY A;  1MK9 B;  2UZR A;  4FA6 A;  4HB3 B;  4DHJ D;  4EKU A;  4HAY B;  4GZU A;  3VDZ A;  4F7U P;  1WJ1 A;  4GPT B;  4HAZ B;  4PYZ A;  4IM2 A;  4WWO A;  2KAN A;  4JQW C;  1SIF A;  2LVP A;  3RZW C;  1P3R A;  3SDL C;  3A1Q B;  1NTV A;  2Z0D B;  5D6J B;  3UQB A;  3RZF A;  2DN6 A;  4PS8 A;  5DPW A;  1E7U A;  1UNR A;  1LXD A;  1WMH B;  4WQO B;  2A5U A;  2M4N A;  2N23 A;  3BJI A;  2MX2 A;  1TTN A;  5CHW A;  4IFS A;  1D3Z A;  1ST7 A;  1WVH A;  3WAM A;  1AQC A;  1WGR A;  2C7M B;  4HXD A;  1WZ0 A;  2DYO A;  2G35 A;  2GOW A;  2HD5 B;  2D10 A;  3N7C A;  3ODW A;  2BCJ A;  1P5T A;  4KHA A;  3PG7 A;  3ZW3 A;  3HK0 A;  2ZPY A;  2ZNV C;  2Z0E B;  3VVW B;  5J3Y A;  4NJ7 A;  2K2J A;  1YX6 B;  2L1C A;  1M94 A;  2DEN B;  2D9V A;  1XD4 A;  4EFO A;  1GC7 A;  1IRS A;  4IOY X;  2COF A;  5DPT A;  1TGZ B;  2A4Z A;  3E9O A;  1P0R A;  1DDV A;  1OTR B;  2BKR B;  1WXV A;  1L2N A;  1R4N I;  2LXA A;  4A5K A;  2LI5 A;  1WXA A;  1Q5W B;  1EVH A;  5FR6 A;  2K39 A;  2KX3 A;  2DLW A;  4E74 A;  3KYD D;  2IO0 B;  2BYE A;  3K9P B;  4TUU A;  3PHX B;  4NSW A;  4AOF A;  3H9D A;  2DYM A;  2X0S A;  3ALB A;  3V5W A;  2ELB A;  2EC1 A;  4HB4 B;  4DWF A;  3L16 A;  1SGH A;  2V1Y A;  2XK5 A;  3KUD B;  4HDQ A;  2MBH A;  3JW0 X;  5JHB A;  2COA A;  2HTH B;  3A4S C;  4HAV B;  5TR5 A;  1C1Y B;  3GOE A;  3U30 A;  4BKS D;  4CHJ A;  2BGF A;  5AEK B;  3CSF A;  3VH3 B;  3TFM A;  2MWS B;  5HE3 A;  2ASQ A;  1P98 A;  3VXW A;  2KWU B;  2JWZ A;  2L0F A;  4TQ0 A;  4JKA A;  4HAT B;  1WG7 A;  5JH5 C;  2Z0O A;  1WX8 A;  3TO1 A;  3ONS A;  4KSL C;  3WAN A;  1LQB A;  4CHK A;  3BIN A;  5FI0 A;  2KTF A;  3ODX A;  2N9X A;  2I1K A;  1WH3 A;  1E8W A;  5LLI A;  2HTH A;  4MSM B;  2BYF A;  2O6V B;  1ZSQ A;  1U5F A;  1ZGU B;  4EMO A;  4YON A;  2LXC A;  1OMW A;  2KWC A;  3DXE A;  5IA7 A;  2WYQ A;  2CQU A;  3PHW B;  1KOT A;  5JZE B;  3T9L A;  3ZLZ A;  4NAW B;  4II2 B;  2B3A A;  2MA9 B;  5AZG A;  2UWQ A;  2NBW B;  2KFJ A;  5DHF B;  3ZRC A;  2YVC A;  1VCB A;  4W9C A;  4G11 A;  5J17 A;  1YQB A;  3JVZ X;  3W1S C;  1V6E A;  3PRM B;  2NMB A;  1XOD A;  1NTY A;  4GMV A;  1U5E A;  4A6K A;  4GDK B;  1IP9 A;  2KOX A;  3QIJ A;  4DX8 A;  3L54 A;  2H7D A;  3IFW B;  1A5R A;  4JKG B;  4WVF B;  4BKT A;  1PLS A;  4KDI C;  2GS0 A;  2BWE S;  2GCL A;  5CHF A;  4NAW A;  4ASW C;  4W9L A;  1UGM A;  4OVU A;  2LWP A;  4BBN F;  3V6C B;  4B95 A;  1J0W A;  2LG1 A;  3LDZ E;  3DVN V;  2L00 B;  4K7S A;  1WZ3 A;  2V76 A;  1Z87 A;  2DZI A;  4WJQ A;  4F1S A;  4HAX B;  5HE2 A;  1ZC4 B;  5BO4 B;  3WIM A;  4P7I A;  1FXT B;  5JVL A;  1P6S A;  1NTI A;  4GOC A;  4FAD A;  3UGB B;  3VTU A;  2W2W A;  4LCD E;  2W2X C;  2KD0 A;  5DH9 B;  3PT2 B;  3APD A;  2WX0 A;  4EJN A;  3QX1 A;  1F9J A;  4KVG B;  4DHZ E;  2KCJ A;  2DHK A;  2D9X A;  1MK7 B;  1J0G A;  3KYC D;  4ICU A;  2RR9 A;  1XKE A;  1DBH A;  3EPY A;  4I6P A;  3L13 A;  1VBG A;  4PS7 A;  4CYE A;  3Q3J A;  4ILH A;  3IG3 A;  1E90 A;  4J6I A;  5AZH A;  2NBU A;  4HCP B;  3OAN A;  3PV1 A;  1U2B A;  2DHZ A;  1K8R B;  2J0K A;  1SE9 A;  4PS3 A;  3VH4 B;  3RD2 A;  1WX9 A;  4ILG B;  2ZJD A;  4IW0 A;  4M8N A;  4G50 A;  5J2R A;  3WAO A;  2YLM A;  2R82 A;  1RRP B;  1W1G A;  5DCN A;  3S2A A;  4K7W A;  4MDK E;  2NZ8 B;  3AU5 A;  2NR2 A;  3HIZ A;  3PTF C;  2L8J A;  2M8S A;  5LXH A;  3SUZ A;  1KC7 A;  2FJ9 A;  2JVC A;  1V5U A;  2LZ6 A;  2CY4 A;  1UH6 A;  2IYD B;  4PYU A;  2DKQ A;  3A9J B;  2GBR A;  1WJN A;  4ZRJ A;  1X11 A;  2Y7B A;  1OGW A;  2G3Q B;  4XZ4 A;  4JKC A;  3KRX A;  1FOE A;  3IBE A;  2C7H A;  2R2Q A;  3FLV A;  1X1G A;  2LUE A;  3RCP A;  2K25 A;  1KZ7 A;  2YF0 A;  1ZW7 A;  1WGQ A;  3TL5 A;  1AWE A;  3RYT A;  5DI9 B;  2N7E A;  2QHO A;  2JUO A;  2DHI A;  4E71 A;  1UBQ A;  5J18 A;  1WXS A;  3ZNH B;  3O96 A;  4GB9 A;  4MT7 A;  5D3V A;  3ML9 A;  3MHS D;  5DPR A;  2Y5B B;  1FAO A;  2N1V A;  4IG7 B;  1EF1 A;  2JZ3 B;  4BOS C;  3U7D A;  2V3S A;  4ILJ A;  4MH0 E;  3H1U A;  1WJM A;  3PRE A;  4BVU C;  3VOQ A;  5DPS A;  1I2H A;  3QWM A;  1KJT A;  3AI5 A;  2IYB A;  3WYF B;  5G2N A;  2ZNV B;  1T0Y A;  4EZJ A;  2FID A;  3L0W B;  3HHM A;  3DBH I;  2CB8 A;  2MW5 A;  2JRI B;  1JRU A;  4WJN A;  1WGD A;  2MQJ A;  2GBK A;  3K9O B;  3V6E B;  1KLV A;  3QBV B;  2YS3 A;  4ZRI A;  3QCA A;  1WJ6 A;  2QKL A;  2COP A;  5C23 A;  2ZVN A;  1E8Z A;  2FCQ A;  3QHT A;  2KJR A;  4KZ0 A;  1I7A A;  4H8S A;  1TJ6 A;  2KDI A;  5CHV C;  3C0R B;  3NZU A;  2KGX B;  2RSG A;  2AEH A;  2D9Y A;  4MJS B;  3UIP B;  3TMP B;  4WJP A;  5DHA B;  2VRR B;  3GYP A;  5LOP B;  1S1Q B;  2KDF B;  5AZF A;  5C79 A;  2CR5 A;  1H8C A;  2K00 A;  2DIK A;  2K1F A;  3DBL I;  2FJL A;  1GNU A;  3DVG Y;  4NPN A;  4RM9 A;  1V49 A;  4W9E A;  3A1Q A;  2UZS A;  4DX9 0;  2P0F A;  3APF A;  3ENE A;  2G4S A;  4GIV A;  1UNQ A;  1IYF A;  2COD A;  2CU1 A;  1YJ1 A;  2RSU A;  1WMH A;  1WXM A;  4MJS A;  1J8C A;  2N9P C;  3WAL A;  3D8F A;  3P7Z A;  4K81 A;  2FDQ A;  2BKF A;  1WJU A;  1SHC A;  4D0N B;  1GGO A;  3ZNG C;  3QWZ B;  1K5D B;  3V62 A;  2D2Q A;  2FIF A;  2IZV B;  4ANU A;  4NJ6 A;  2MFQ A;  1H10 A;  4MK0 A;  2L2I A;  1KM7 A;  4B6H A;  2DX1 A;  3E66 A;  3QAQ A;  1WGH A;  1YD8 U;  5D3Y A;  4MEL A;  1WM3 A;  2LVO A;  3MJW A;  4L6E A;  4FHJ A;  1Y19 B;  3KY9 A;  4G0N B;  2IFS A;  5KHO A;  1FHO A;  3A8P A;  2ROV A;  3TIX A;  5C5B B;  4JLC A;  3DCG A;  4HPL B;  1ZM0 A;  3MPX A;  5JHG A;  1WM2 A;  4WWP A;  1BTK A;  1L7Y A;  1WE6 A;  3QJZ A;  1V89 A;  3FM8 C;  4FUL A;  2XBB C;  3ZNI D;  2KWV B;  2LYD A;  4JK9 A;  3E9P A;  2KTR B;  5D2M B;  1FGZ A;  4AWJ A;  2MLB A;  3KRW A;  1WRD B;  2LOX A;  2WX1 A;  4GSW A;  4K2P A;  3B08 A;  4JK8 A;  2NPT B;  3VQI A;  4HVB A;  2RD0 A;  1WR6 E;  4JL9 A;  5C5B A;  4I6L B;  3TJP A;  1XR0 B;  1MIX A;  1TXD A;  2DYN A;  4A3O A;  3F5R A;  3W1S A;  4DBB A;  3R66 C;  2K6D B;  3N32 A;  2WWZ A;  2ZEQ A;  2YSZ A;  3U8Z A;  1WE7 A;  2WDT B;  4JK7 A;  1WI1 A;  1WF9 A;  2G45 B;  1U4A A;  2CHZ A;  2UYZ B;  2MCN B;  2VRW B;  2LRW A;  1MIZ B;  4A6F B;  3NZS A;  2O6V A;  4KIK B;  5D3X A;  3ZIM A;  3VUW A;  1EF5 A;  3UQA A;  1NDD A;  4IM0 A;  4W9H A;  4KDL B;  2LKO A;  5E6P A;  2MSE D;  3HM6 X;  3ZRF A;  3DQV A;  4IWP A;  3DOW A;  4BBK A;  2IY1 B;  4KHB B;  4LDT B;  4Y94 A;  4K1R B;  4LJP B;  2MBO A;  3AXC A;  3ZDT A;  2IBI B;  2GJY A;  2KC1 A;  2CAY A;  1RRB A;  4AP4 C;  3EC8 A;  1Z2M A;  2RUK B;  3KZ1 A;  3M62 B;  2G4D B;  2OOB B;  4DDI D;  1ZVR A;  3HW2 B;  2M17 A;  2RQ1 A;  4KIK A;  3RT3 B;  2DHJ A;  4GDK A;  2BPS A;  2VKI A;  4IWQ A;  4JIO U;  2IY0 B;  1RFA A;  3TBL D;  2M14 A;  3JYU A;  3KSY A;  4A6H A;  5JHA A;  4AJW A;  1MPH A;  4FBJ B;  4JKG A;  1VBH A;  4M0W B;  2KLG A;  4NQL B;  1UPQ A;  5GOW B;  2LGY A;  2I5F A;  2LJ5 A;  2EMS A;  2KQS A;  1WY8 A;  3SBG A;  3KW5 B;  2GBN A;  4HAW B;  2FCS A;  4TV3 A;  1XX0 A;  1I35 A;  1ISN A;  4JKD A;  4JKF A;  2KUP A;  1IPG A;  3R7R A;  4HDO A;  4DDG D;  3ODO A;  1BT0 A;  4BBN C;  1PMS A;  5KQ4 A;  3DBR I;  4F7Z A;  5HE1 A;  2K8B A;  3QA8 A;  4MGZ E;  4X57 B;  3BY4 B;  1EGX A;  1DIK A;  4IAP A;  2P0D A;  2J0J A;  3VUX A;  2I1J A;  4DHJ B;  2DZM A;  4M8M A;  3UZT A;  3D8D A;  2HE7 A;  1M7E A;  2ZCC A;  3QAR A;  2N7D A;  2CRF A;  2KZR A;  4RMA A;  2KHW B;  1H4R A;  3N30 A;  3RUL A;  2HRJ A;  4F7H A;  2XQN M;  3VTV A;  3FSS A;  2ABD A;  2FNJ B;  4BFR A;  3SYX A;  3OJ3 A;  3IHP C;  3NOB A;  3MTN B;  3QK0 A;  2C60 A;  3QQ8 B;  2DZJ A;  2KC2 A;  1UNP A;  1N3H A;  4NNJ B;  2COC A;  1V81 A;  4HAU B;  1OEY A;  2M1M A;  3EHV A;  4W9D A;  4E3C A;  5C16 A;  3VHT C;  2NCN A;  4GDL B;  2MBQ A;  4DXA B;  1WI0 A;  2MP2 B;  1OY2 A;  1P9D U;  5LON B;  1JDE A;  1FGY A;  2DKP A;  2M38 A;  4C0A A;  3A9K B;  2PE9 A;  5CLL B;  4BOZ B;  3CF6 E;  4YL8 A;  2J59 M;  2LBB A;  3SNH A;  4MGI E;  5KQ1 A;  5D27 A;  2Z59 B;  1CMX B;  1XT9 B;  1XQQ A;  1PFJ A;  4WJ7 A;  1TBE A;  4GXB A;  2O2V B;  1QZE A;  4DHZ B;  2BF8 B;  3UF8 A;  3ML8 A;  4K7U A;  3X0W A;  2CKH B;  2I5C A;  2V4L A;  1BWN A;  4WWN A;  3VTW A;  4A3P A;  1W1H A;  3A9J A;  4G3X B;  2RPQ A;  2EKE C;  3VAW A;  2GCJ A;  2Y8G A;  4EOY A;  3DDC B;  3B0A A;  1K5G B;  1EO6 A;  3E9L A;  2D9Z A;  4FJV B;  1UEF A;  4I6N B;  5D94 A;  2OJR A;  1V80 A;  2KQ7 A;  2PE6 B;  1VD2 A;  2Z0P A;  3ML4 A;  2BYV E;  1DDM A;  3PP2 A;  4WJO A;  3L08 A;  5FI1 A;  2CHW A;  4IWO A;  2WH5 A;  2DYQ A;  2MBE A;  4TQ1 A;  2YT0 A;  1V5M A;  5E6O A;  1RJ2 A;  2KX0 A;  2PZ1 A;  2YT1 A;  2FUH B;  3D32 A;  2R2O A;  5C1Z A;  2JP2 A;  3H6N A;  2E2X A;  1HBK A;  3EEC A;  3ZVV A;  2KLC A;  1TQZ A;  4CHM A;  4KHO A;  1X05 A;  3VUY A;  2JZZ A;  1WGY A;  3VIA A;  1PQS A;  4ANV A;  1E8X A;  5L81 A;  3KUC B;  5IJM A;  1UPR A;  4GU2 A;  2YS5 A;  3OJ4 B;  4II3 B;  3L10 B;  1GUA B;  1V86 A;  4MM3 A;  5D3W A;  4IC7 B;  1TZ1 A;  4HJK A;  4F8C B;  3ULC A;  1X1F A;  4BKS A;  3PS6 A;  2K2U A;  2DTC A;  3MDB C;  4ZRK A;  4DBG A;  3ZDM C;  1WJ4 A;  4WSF A;  2GBJ A;  3SV1 A;  4HB2 B;  2DZK A;  4PQ0 A;  4ZDV A;  3P6A A;  3KUZ A;  3SBT A;  3SD5 A;  5E6N A;  1Q67 A;  4XWX A;  2JT4 B;  1QC6 A;  2KDE B;  2DX5 B;  2L7R A;  4MGK E;  4W9F A;  3V61 A;  3PVL A;  1U29 A;  2AWT A;  3RCZ A;  3Q3F A;  2NBV B;  1WR1 A;  1KBL A;  1U5D A;  5EFX A;  4JKH A;  2XK5 B;  3ZTC A;  5C6R A;  5IAA C;  1RLF A;  2KJ6 A;  4FHK A;  3ENB A;  1ZKH A;  4FJY A;  4N9F 4;  2IO2 B;  1P1A A;  1XCG A;  4W9K A;  4W9J A;  4HLE A;  4Z2N A;  2JY6 A;  4FJZ A;  3ZO5 B;  4RM8 A;  3GZN I;  4B9K A;  3DPD A;  5J3Q A;  2RGN B;  2REX A;  1G6J A;  2ZCB A;  3ZNZ B;  3DVG X;  1BTN A;  3TCA A;  2DX5 A;  3PLV A;  2L05 A;  5L95 C;  3HM3 A;  1RAX A;  2L0T A;  2FAZ A;  2ADZ A;  2K8H A;  2KXJ A;  3F0W A;  3R3M A;  2HJ8 A;  1WYW B;  5CX3 A;  3PPA A;  3DVN U;  4KAX B;  3TW1 A;  4HWI B;  3PZD A;  3AUL A;  2KMA A;  1UZX B;  4MGY E;  2PEA A;  4LJO B;  2RGF A;  2MWN B;  3A8Q A;  1B55 A;  3PRP B;  5G55 A;  2X18 A;  4NY0 A;  4ZYN A;  5KCV A;  3B1L X;  1Z5S B;  2DA0 A;  5HKH A;  3PVU A;  3AU4 A;  1FB8 A;  4WAA A;  5CLQ B;  2N0Y A;  1YIW A;  3M3J A;  2YS1 A;  4K2O A;  2J7Q B;  3DBS A;  2KJH B;  1DYN A;  4KSK C;  2D11 A;  2KKC A;  3RUI B;  3M95 A;  2QKM A;  2J0M A;  2K6Q A;  4ANW A;  5EDS A;  2IO1 B;  4KZC A;  2PPH A;  3SHQ A;  3N3K B;  1NVL A;  1BAK A;  2KFK B;  2CHX A;  1NU2 A;  4NQK E;  4XX5 A;  1UD7 A;  1FHX A;  2RLO A;  1WX7 A;  3ECI A;  2ELA A;  2CY5 A;  3GYO A;  2AYO B;  3A4R A;  3LJU X;  2PJH A;  2LD9 A;  1V5O A;  4HPM B;  3JSV B;  1WIA A;  3CXB B;  4GGQ A;  2N9E B;  1E5W A;  2C9W B;  3X23 A;  4BKG A;  1LFD A;  4XC2 A;  1P3Q U;  2KTR A;  1V5P A;  2OTX A;  3PEG A;  1U27 A;  3H7P B;  4FN2 A;  2Z0Q A;  2KVR A;  3PGE A;  4HB0 B;  5JHH A;  3UIN B;  1OEY J;  2NPT A;  2KFK A;  4W9G A;  4URK A;  4MSQ B;  1R4M I;  2MBB B;  1Q1O A;  2C7N B;  2N4F A;  1HB8 A;  2EMT A;  1WFY A;  3AJ4 A;  3JSV A;  2JRH A;  2LVQ A;  1DDW A;  3PLU A;  2KN5 A;  3OAW A;  3APC A;  2K8C A;  2Q13 A;  2XEW A;  2P0H A;  2MKR A;  3WA0 A;  4JKE A;  2R09 A;  2D07 B;  3VFK A;  2LGD A;  1LW3 A;  3H7P A;  4B6W A;  2L76 A;  3PRZ A;  5LXI B;  1WGU A;  3NHE B;  3SU8 X;  1AAR A;  1LB1 A;  3QC8 B;  2DFK A;  2RVB B;  1X86 A;  4A6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...