1EF1A

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MOESIN
total genus 89
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ef1A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ef1A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef1A01
4LJPB 2LRUA 3JYUA 1WGUA 2GBRA 2IYBA 3DVGX 3I3TB 4GMVA 3KYCD 3M63B 4GGQA 1R4MI 4RMAA 3AU5A 2L3ZA 2QKMA 4AJYB 5DHAB 1V2YA 3KRWA 4HB3B 2G4SA 2KDEB 3PSEB 5D3WA 1AARA 1U27A 3L0WB 1TQZA 4WJQA 3ZNID 2L2IA 4HB0B 2IO0B 2LYDA 2G3QB 1X1FA 1V5MA 1WH3A 3P2BA 2K25A 1UELA 3JSVA 3K9PB 1K8RB 2YS5A 1EF1A 4B6HA 2AWTA 3ODXA 2RNRB 4DX8A 1XX0A 1OEYA 1YQBA 2O2VA 3RZFA 2COFA 1VCBA 3LJ3A 4FJYA 1FHXA 2PJHA 1WVHA 4JL9A 3SHQA 3X23A 2MLBA 4DBGA 1BTNA 2LGXA 1JRUA 2RVBB 3VHTC 1S1QB 1MKEA 2JRHA 2V1YA 2K6DB 1WJ4A 2DZKA 1P3RA 2KXJA 2KD0A 1XR0B 3JVZX 3NOBA 4CO7A 2LGYA 1V86A 2ZPYA 2NS5A 4B95A 3X0WA 2YVCA 4K17A 5GMVA 3V61A 2WX0A 3PRZA 4NSWA 4D0NB 2KJHB 2AL6A 2KVRA 4K81A 1K5DB 1SE9A 2R0DA 1NVLA 1WGYA 2DX5A 2KCJA 2M38A 3KZ1A 1OY2A 2X18A 1MIXA 1EUVB 2BF8B 3DBSA 3PLVA 3V60A 2JXXA 3D8DA 2LVQA 4EUTA 1PMSA 1BAKA 4CHJA 2YT1A 1UBIA 5AEKB 1WR6E 4ICVA 1I42A 1MK9B 2KGXB 2KLGA 3TL5A 1OQYA 2M1MA 3KW5B 3RCPA 2KMCA 3P7ZA 3H6NA 2OJRA 5DPTA 4MK0A 2RSUA 4DHJD 5DCNA 2D9YA 3SU8X 2OQBA 2YS3A 2DAJA 3QJZA 2NPTB 3PVLA 2G45B 1V6EA 1ZW7A 3RZWC 2DAFA 4G0NB 3Q3FA 1NTIA 4BBKA 3RD2A 3KYDD 1SHCA 3RYTA 1MPHA 4H8SA 2LGDA 2ROZB 4DX90 3ZVVA 5D94A 1KLVA 2EKEC 2IFSA 2DHZA 2P8VA 2LI5A 4KV2A 2C9WB 4A6HA 5HE3A 4EMOA 2KQ7A 5KQ4A 3ONSA 1M7EA 5D3XA 3QWMA 2RGFA 1E8WA 2HD5B 3WIMA 3DCGA 4PYUA 2UZRA 4EEWA 1RAXA 4M8MA 3KY9A 1NBFC 3PGEA 5IJMA 2G35A 4GB9A 1BWNA 4FJVB 5EFXA 2LXCA 1Z87A 2NBWB 4MGIE 4K2PA 3HM6X 1LXDA 1WJNA 1ZC3B 4BKTA 4GSWA 2FCSA 3QX1A 4ANVA 4IWOA 2MA9B 2PZ1A 1WF9A 2GBNA 2MX2A 4WWOA 3JW0X 1GC6A 3ULCA 2L8JA 2MP2A 2Z0DB 2KK8A 2ZCCA 1WGRA 4NJ7A 2ZZPB 1V80A 1U5EA 2DHIA 2WWZA 4IC7B 4IM2A 4I6NB 3TVVA 3S2AA 3L10B 3HM3A 4J6IA 2M8SA 4HCNB 1WE7A 4GDLB 3A9KB 2ZJDA 1PLSA 1UZXB 2ABDA 2NPTA 3NY5A 1P6SA 2LXAA 3DPDA 3FSSA 2GBKA 2JWZA 3UINB 1SGHA 4TQ0A 1HE8A 3F5RA 4AJWA 3T8MA 5DI9B 2ADZA 2K8BA 3VTVA 2CY4A 2OOBB 1P1AA 2KFKA 4PS3A 2K1FA 2FAZA 3M95A 1PFJA 3GZNI 1OMWA 2ELAA 4HB2B 3H1UA 2D07B 3K9OB 4HPMB 5J3YA 1E8YA 3QWZB 2CB8A 4K1RB 3U30A 3ZNHB 4LDTD 3UQBA 5CX3A 4BOZB 2ZNVC 5CHFA 3SNHA 2RD0A 4HB4B 5CLQB 4HLEA 2NZ8B 1V88A 4A3PA 2KUPA 4BBNF 3F0WA 1X1MA 3L54A 1QC6A 4ANXA 4HK2A 4NQKE 3SD5A 5DIFB 3TFMA 4BKGA 1A5RA 3FLVA 1AQCA 1ZM0A 3MTNB 2ZNVB 4KDIC 1YIWA 4DDGD 4MGYE 2XK5A 1V9JA 3MJWA 4HXDA 2LWPA 1WXMA 3GOEA 4ICUA 2VRWB 1KJTA 3A98B 4PNKA 1UPQA 2COAA 2FCNA 4B6WA 2CQUA 5J17A 2L05A 1D3ZA 3AXCA 2GJYA 2ZCBA 1Y19B 5J3TA 1WYWB 2A4ZA 2M0XA 1OTRB 2MBBB 1WG7A 2LULA 2JUOA 4HCPB 1FB8A 2D9ZA 3CSFA 5KHQA 3W1YA 3VFKA 3APDA 2MBOA 2N9EB 1FHWA 2R2OA 4KSKC 1EF5A 4Z2MB 1H4RA 4K2OA 2ZEQA 2DLWA 4MY6A 4EJNA 1Z2MA 1KZ7A 2KZRA 2D11A 2Z59B 5HE1A 3QHTA 1TGZB 2MKRA 2D9VA 3FP5A 1M7RA 2NBUA 3OJ3A 1RJ2A 5D3VA 4DDID 4HATB 1V89A 2DX1A 1RRBA 1X05A 1CMXB 1UD7A 1ZVRA 4GZUA 1WZ0A 2CHWA 2KFKB 2KJ6A 2KWCA 1HBKA 2J0KA 3DXEA 2LVOA 4WVFB 2LVPA 4XZ4A 3QC8B 3EC8A 2RSGA 4HAUB 4XWXA 3PLUA 1OEYJ 1ISNA 5C6RA 3A9KA 3BY4B 2KNBA 1U29A 2NCNA 2K8CA 2WX1A 1OGWA 4KDLB 3C0RB 5AZFA 3AI5A 2V3SA 3L16A 4FLHA 1FGYA 2LJ5A 4HJKA 4A20A 2IY0B 4GIVA 1ZC4B 1F9JA 4OVUA 4KHOA 4A6FA 2Y8FA 2CKHB 2KC1A 4F1SA 3TBLD 1WE6A 1LFDA 2DYBA 1HB6A 5JLJB 3EPYA 2EC1A 2N7EA 1XD4A 2Z0QA 5LOPB 1NU2A 2FJLA 5TR5A 5LXHA 2QHOA 2C7HA 2KOXA 1YD8U 2CODA 2C5LC 4IAPA 1DDMA 2PE6B 3PPAA 4WJOA 3O65B 2M4NA 4W9DA 2EMTA 2MWSB 2IY1B 2D9XA 1NDDA 2IO3B 1WXAA 2LASA 2VSZA 3VTUA 2CHZA 1UNQA 5J3QA 3B1LX 2PPHA 4BKSA 2FJ9A 4W9CA 3VDZA 3A8PA 2LD9A 3ZUNA 3HHMA 2MDXA 2RLOA 4F7ZA 3DXDA 2FDQA 3LDZE 3PREA 3ML9A 1Q1OA 2HTHB 2CAYA 5JHHA 1V81A 4ZYNA 2BPSA 1J19A 4IW0A 2AEHA 4M8NA 3OAWA 4FN2A 2FNJB 2W2XD 2DZIA 4MGZE 4DK5A 3QK0A 3M62B 4HAVB 4HHVA 4IG7B 3PP2A 2MBEA 2N1WA 1M94A 3UGBB 2RUKB 1S3SG 2DYMA 2N9XA 5L83A 4L6EA 1WGQA 4F7GA 1WJ6A 3SUZA 3WAOA 3FM8C 5C23A 2LG1A 2W2XC 4MT7A 2Z0EB 5LXIB 2MBHA 2YSZA 2GCJA 2O6VB 1ZSQA 1XQQA 4I6PA 2KTRB 4URKA 3A4SC 2CHXA 4AP4C 4ZRKA 2CU1A 3EHVA 1I7AA 3KUCB 2YLMA 2N7DA 5KCVA 2MP2B 4TUUA 3KVFB 1UNPA 4KSLC 3HQCA 3KUZA 4DHZB 1XT9B 3DDCB 2D9WA 3APFA 2ZVNA 3QAQA 3ODWA 4WJPA 3VQIA 2VKIA 3ZO5B 4FA6A 2KTFA 2PE9A 1X86A 2Y7BA 1WRDB 3TO1A 5KQ1A 4GDLA 2ELBA 3H7SA 4HWIB 3VUYA 4N9F4 2CY5A 2NBVB 3A1QA 4LCDE 2GCLA 2P0DA 4KZ0A 4FADA 5IA7A 2K2UA 2I1JA 1NTYA 1BT0A 4E74A 3IFWB 2KN5A 1YJ1A 4E71A 2I5CA 1UEFA 2YRYA 1LM8B 4KIKB 3RUIB 3R7RA 1P3QU 3KSYA 1H10A 3UZTA 1XD3B 4W9HA 4PYZA 5JHBA 3PVWA 2KQSA 3CXBB 4WJ7A 3CIKA 1T0YA 1H8CA 3CF6E 3NSUA 1Q5WB 4TV3A 1Q67A 3GYOA 2JF5A 3IG3A 5JZEB 2N0YA 3TMPB 1LQBA 4CHKA 1U4AA 5DPWA 5CHWA 3A8QA 3D8FA 4EZKA 5G2NA 2HRJA 4CHMA 3D32A 5FI1A 3IVFA 5D7GA 3RT3B 1WJUA 3W1SA 2C60A 1ACAA 2K2JA 1HB8A 2HTHA 2M14A 1UH6A 2KC2A 2XBBC 2O6VA 4GOCA 4B9KA 3BINA 4G50A 3PVUA 1ST7A 2BYEA 3H7PB 2L0TA 1DDWA 4CYEA 2KMAA 3N30A 1NI2A 2KTRA 4GU2A 5D3YA 1ZGUB 4EZLA 5C16A 2XK5B 2CRFA 1V49A 3ALBA 2N1VA 4WAAA 5CTRC 4FBJB 5JH5C 4ZRIA 4II3B 4OVVA 2DA0A 3BJIA 4E3CA 1U2BA 2IO1B 2LKOA 3KH0A 1IP9A 4M0WB 4DWFA 2MWNB 1XKEA 5FI0A 3PHWB 3Q3JA 1QQGA 4GDKA 1WGGA 3DOWA 4MSQB 3ZIMA 2IBIB 3RULA 2AL3A 2ZVOA 5D27A 2J59M 1WXVA 2G4DB 2C7MB 2L7RA 4II2B 3P6AA 4PS7A 3ZTCA 4IFSA 3PS6A 2P0FA 3DVGY 3VH4B 2GOWA 1W1DA 2D10A 2EMSA 2DN6A 2JP2A 2BWES 4MGKE 1YX5B 2RQ1A 1B55A 1EGXA 3AU4A 2KWUB 3OJ4B 5E6OA 2N4FA 4TYZA 2J0MA 3UIPB 2LUEA 3ZDMC 1WX9A 5LONB 2RPQA 4BOSC 1C3TA 3U8ZA 3NZUA 4PQ0A 3QBVB 4DHJB 3A1QB 5E6PA 2NMBA 3KUDB 1TXDA 1E7UA 4MM3A 3LJUX 5DH9B 3PRMB 4MJSA 2D2QA 5J2RA 1FGZA 1Y8RC 4KIKA 2DYNA 4NPNA 2Z0PA 3VIAA 3SO6A 3H7PA 3V62A 3ZRFA 4ZRJA 3VUWA 4A6FB 2FUHB 3UF8A 2IZVB 2KX3A 1RFAA 4W9LA 4K7WA 2ASQA 2BKFA 2FCMA 1L2NA 1IRSA 2AYOB 1AWEA 2YS1A 4KZCA 2GBJA 2A5UA 3DXCA 3WYFB 5L81A 2MSED 2CR5A 1MIZB 5E6NA 4ASWC 1UPRA 3SV1A 1MG8A 4GDKB 1LW3A 3H9DA 3PT2B 3PSCA 1E5WA 2DKPA 4IOYX 3DVNU 3L17A 3WAPA 2NR2A 2KANA 1E7VA 1WZ3A 3R66C 3ML4A 1DYNA 3PRPB 4NAWB 1C1YB 1GUAB 1P98A 1FHOA 2WDTB 1WR1A 2J7QB 1DROA 1WI1A 4MJSB 1EVHA 3PEGA 3DQVA 3VUXA 3QIJA 1WI0A 2W2WA 2H7DA 2GMIC 3WALA 5CLLB 3WA0A 2COPA 1SIFA 4FJZA 4NJ6A 4IM0A 4RM9A 3R7QA 1TZ1A 2COCA 3V5WA 1P9DU 1WXSA 2KHWB 2XEWA 3MHSD 4IWQA 4MEMA 4FHKA 4WJNA 4BBNC 4MELA 1E8ZA 4YONA 1UBQA 1V5PA 4K7UA 5FR6A 2XQNM 4I6LB 3MPXA 5C79A 4KHBB 2BGFA 1WMHB 2VRRB 3ZTDA 2MW5A 1W1HA 4RM8A 3ZKJC 2C7NB 5D6JB 4KAXB 5DPRA 2M17A 1FOEA 2K6QA 3B08A 4TKNA 2JZZA 4AWJA 1G6JA 3A9JB 2HJ8A 2YT0A 4KHAA 2UYZB 3IBEA 2JRIB 4C0AA 2B3AA 1DBHA 1WFYA 3G9WA 1Z5SB 1R4NI 2V76A 3CSTA 3EFUA 1KI1B 4HAZB 4WQOB 3HIZA 4WWNA 3VXWA 2MRPA 3TIXA 5GOWB 4A5KA 2BKRB 1X1GA 2J0JA 5DPSA 4A6KA 1E90A 2KO3A 2MQJA 2DYOA 1P0RA 1WM2A 4LDTB 2IYDB 3WANA 3VH3B 4HAWB 1Y5OA 4ZDVA 2DYQA 1WGDA 4YL8A 1WIAA 4BFRA 1V5OA 1N3HA 1XCGA 4DBBA 2JPHA 3PZDA 4FHJA 4FULA 3NS8A 3ODOA 1K5GB 3AJ4A 5HE2A 4GN1A 2L0FA 2I1KA 4NAWA 4IWPA 5D2MB 2KFJA 4BVUC 3ZNZB 2DFKA 3N3KB 4X57B 2W9NA 5C1ZA 3N7CA 3CMMB 3PHXB 3PTFC 5C5BB 3WAMA 2FIDA 5IAAC 1X11A 4HAYB 1RRPB 3M3JA 4XC2A 2DX5B 2KDIA 4W9KA 3QCAA 5JP4A 2REXA 1RLFA 4NQLB 1PQSA 3TJPA 3MDBC 1WJ1A 5KHOA 3T9LA 1GG3A 2QKLA 3A4RA 3ZLZA 5JHAA 2DHJA 2BWFA 3DBLI 1DDVA 3ZRCA 4IUMB 1V5TA 3HK0A 2Y8GA 2WH5A 3ZVRA 2BYFA 3ZDTA 2LZ6A 3O96A 2Z0OA 4GMXB 4HPLB 1J0WA 3DBRI 2RR9A 4A3OA 2PEAA 2V4LA 2DZMA 1V5UA 2ZPNA 1WJMA 3EECA 3R3MA 1NTVA 4JQWC 4MSMB 3B0AA 4AUQC 2JZ3B 2RGNB 5BO4B 2MFQA 3VAWA 4PS8A 1EAZA 3OANA 1Q0WB 1WY8A 3ML8A 4W9JA 1UNRA 2I5FA 4HAXB 2JY6A 5C5BA 1FAOA 1I2HA 2R2QA 4G3XB 1WMHA 4G11A 2ROVA 4JIOU 1J0GA 3VTWA 2E2XA 1UGMA 1FXTB 4EKUA 4GXBA 3TW1A 2JVCA 2KWVB 4AOFA 3QARA 3NHEB 1LB1A 2YF0A 2LRWA 3QA8A 2K39A 3A33B 3NZSA 4HDQA 3IHPC 4ANUA 3A9JA 4WWPA 2L1CA 2FCQA 3HW2B 2OTXA 1E8XA 1WM3A 3ECIA 4HVBA 2UVMA 2K00A 3M1IB 3FEHA 1WX8A 4IM3A 4P7IA 4LJOB 2P0HA 4NY0A 4WSFA 1VD2A 2KX0A 3APCA 3DVNV 3RCZA 5CHVC 1IYFA 2LOXA 1GJZA 2CS4A 5LLIA 3PV1A 2K8HA 2WYQA 1U5DA 3L13A 2D3GA 4W9GA 1EO6A 1P5TA 4NNJB 3JSVB 4JGHB 1I35A 2L76A 4W9FA 2FIFA 3UIOB 3ENEA 2D4QA 3OLMD 3L08A 4DXAB 3UQAA 2DHKA 1KOTA 2GBMA 2O2VB 3V6EB 2HE7A 1XODA 2R09A 5HE0A 2Q13A 1TTNA 1MAIA 1KM7A 4EZJA 2JT4B 2KDFB 1WX7A 5L95C 4W9EA 3PG7A 5DHFB 1KZGA 1OQNA 1IPGA 3ZNGC 2NVUI 1BTKA 2KDBA 3N32A 2BYVE 4XX5A 4K7SA 5JHGA 2MBQA 3DBHI 4BKSD 2UZSA 4ANWA 4EOYA 4JLCA 2MCNB 1TBEA 2BCJA 2N9PC 2DZJA 4Z2NA 2DKQA 2KLCA 4MH0E 1J8CA 2UWQA 2LBBA 4F7HA 1TJ6A 2KKCA 2GS0A 4DHZE 4Y94A 5AZGA 3KRXA 1MK7B 1YX6B 4EFOA 1W1GA 4KVGB 4TQ1A 3VVWB 5J18A 2N23A 3SYXA 2IO2B 3VOQA 3GYPA 1L7YA 1ZKHA 2L00B 3W1SC 2DENB 3V6CB 3T06A 1QZEA 4F8CB 3ZW3A 2H7EA 3AULA 1U5GA 3QQ8B 4HDOA 5EDSA 3ULBA 3U7DA 4F7UP 1V61A 2LOZA 3D8EA 2KJRA 2O6VD 1GC7A 4W9IA 5HKHA 4GPTB 1WGHA 5AZHA 2Y5BB 2EJ8A 2DTCA 1U5FA 1GNUA 3TCAA 3SDLC 5G55A 4MDKE
chains in the Genus database with same CATH superfamily
2BTEA 1WGUA 3DVGX 1D5XC 1R4MI 4JWUC 1AARA 3ZNID 1TQZA 2L2IA 1V5MA 5HG2A 3K9PB 3EFCA 5LNK1 1EF1A 4B6HA 3WCQA 2RNRB 1F1HA 2PJHA 1UWMA 3PZ8A 3RNBC 3NVVA 1P3RA 1XR0B 2LGYA 2J53A 1FXAA 4XDDA 2YVCA 4L2YA 2AL6A 4K81A 2R0DA 3DBSA 2JXXA 3D8DA 3RPFC 1BAKA 1UBIA 1FM0D 1WR6E 1I42A 2LGSA 2IJ0A 1ZP0B 3N20C 1C4AA 4MK0A 2RSUA 2YS3A 2K0PA 1FNWA 1V6EA 2FUG1 3AMZA 3RZWC 2DAFA 4G0NB 1NTIA 4BBKA 1SHCA 4P1CC 3DHGC 1MPHA 4QJ3B 3ZVVA 4US8A 2IFSA 1L0VB 2BB6A 2LI5A 4A6HA 1FEHA 1M7EA 2RGFA 4XYCA 3URYA 4ILHA 5IO9A 5IJMA 4RFBA 1K53A 2KIGA 2NBWB 4MGIE 4K2PA 1ZC3B 4BKTA 5HI1A 2MX2A 4JK8A 1WF9A 2GBNA 2Z59A 4D6WA 4C4VB 2L8JA 1JWMD 3AEFB 2WWZA 1I4RA 4IM2A 3TVVA 4JKGB 3ZGZA 2L83A 3AM9A 4J6IA 2M8SA 2NPTA 3P4RB 5EE9A 2JWZA 4P16A 5DI9B 2KN4A 1TJEA 2INDC 2FJUB 1OMWA 2ELAA 2D07B 3K9OB 2CB8A 2J4XA 4LDTD 1PGAA 4KX6B 5CHFA 1V88A 2KUPA 2WXGA 3FILA 4BKGA 3I5JC 2YEPF 4DDGD 3MJWA 1V9JA 2AQ3B 2VRWB 1KJTA 3BK1A 1D3ZA 2FCNA 2L05A 3AXCA 4HCPB 2M0XA 1WG7A 2QC8A 3CSFA 2N9LA 3OWEB 1TS3A 3VFKA 2R2OA 1FHWA 1EF5A 4Z2MB 2KZRA 1ZPSA 2D11A 4RGMA 4JX1C 5CX3A 3FP5A 4N6EB 5D3VA 2BW2A 1J7CA 4HATB 1WZ0A 3E56A 3FILB 1X05A 2CHWA 5BYQA 1ZVRA 2KWCA 1HBKA 2J0KA 2LVPA 3E9LA 3QC8B 2RSGA 4HAUB 3BY4B 3W9CB 4LNFA 5AZFA 4FLHA 3NW8A 2IY0B 4GIVA 4OVUA 4A6FA 2KC1A 5FKAC 2DYBA 2N7EA 2EC1A 5LXHA 5LOPB 2Z0QA 5TR5A 3FC4A 2FJLA 2IGDA 3AE9B 1SJHD 2H88B 2QHOA 3Q3OC 1YD8U 2WNMA 4WJOA 1V1OA 2MWSB 2LASA 3AEEB 1UNQA 3TUOA 3B1LX 3SEBA 1BUIC 3VDZA 4JKDA 1FMAD 2HTHB 4IOIE 1J19A 4M8NA 2FNJB 4MGZE 3QK0A 4HAVB 2W55A 2RUKB 2G1EA 1S3SG 5L83A 4L6EA 2JYTA 4F7GA 2WXNA 2W2XC 2Z0EB 1P7EA 4A6QA 2LHEA 1FFUA 1I4HA 3B77A 4ILGB 2CHXA 3A4SC 4AP4C 1T3QA 1MHXA 2LEKA 4TUUA 3BYTB 2PIAA 4KSLC 3HQCA 3Q8AA 2WP9B 3DDCB 2ZVNA 3VQIA 3ODWA 3ZO5B 3VRAB 2Y7BA 2KAJA 2W82A 4NZLB 4HWIB 3H7SA 3VUYA 2V3NA 4LCDE 1FRRA 3A1QA 2GCLA 4KZ0A 4ZOHC 1YJ1A 1LM8B 1UEFA 2INCC 3R7RA 1H10A 4M0WA 5JHBA 3PVWA 1T0YA 4Q2JA 2JF5A 3TMPB 1LQBA 2HRJA 4CHMA 3D32A 2K49A 1WJUA 2M0AA 2HTHA 1ACAA 2M14A 2O6VA 3H7PB 4CYEA 1ZGUB 5C16A 1RM6C 2IO1B 3KH0A 4M0WB 5FI0A 3BVGA 4GDKA 1WGGA 3DOWA 2ZVOA 3GB1A 2SAKA 2RDBC 1HA5A 4II2B 2ONQA 5GXGB 3P6AA 1EU4A 1JWSD 3PS6A 4USAA 4C7ZA 1DOYA 1GPXA 3P4SB 1NVID 3AEBB 2EELA 2LUEA 1C3TA 1HEZE 3QBVB 3KUDB 1FPYA 5TSSA 4MJSA 1XO3A 3VIAA 1R7SA 2FUHB 2IZVB 1RFAA 4K7WA 2BKFA 1VBGA 1IRSA 2GBJA 4YXDB 1L4DB 3DXCA 3DBRB 2DKPA 1VLBA 5I4DA 2NMQA 1DYNA 1P98A 1WR1A 1DROA 1WI1A 4MJSB 1WI0A 1FIQA 1SIFA 3R7QA 3R2TA 4FJZA 4NJ6A 5G5GA 2XEWA 3MHSD 4WJNA 4WURA 3MPXA 1W1HA 5D6JB 1PGBA 1FOEA 1KC7A 2E6XA 3B08A 4TKNA 2JZZA 4AWJA 2HJ8A 2JRIB 1ZXIA 1DBHA 2WQYB 1R4NI 2Q5WD 3HIZA 3ZXVA 2KUQA 2BKRB 4KGSA 3NWDA 4A6KA 1WM2A 2QJLA 3P42A 4HAWB 1Y5OA 5AUIA 1GB1A 1WGDA 3C19A 2BS2B 4BFRA 4FHJA 2JPHA 4FULA 3AJ4A 4GN1A 5D2MB 3KWLA 4BVUC 3N7CA 3CMMB 4OT1A 3Q14C 4LNNA 3QCAA 1WJ1A 3J9CA 2BS4B 2BWFA 2FBWB 3DBLI 2LZ6A 2WH5A 5JXVA 3O96A 3DBRI 4A3OA 1WJMA 3EECA 4MSMB 2RGNB 5BO4B 3V3XA 3VAWA 1EAZA 5DPSA 4W9JA 2R2QA 2JY6A 1FAOA 1XLPA 2LGIA 2E2XA 1FXTB 4EKUA 4GXBA 4DIXA 1OQRA 1XLQA 2WDVB 4RCOA 2LRWA 2WLBA 4ILJA 2K39A 3A33B 4M01A 3A9JA 4WWPA 1TKGA 2KT7A 1C77A 3FEHA 2VH1A 1WX8A 1ZYIA 1QT9A 3DVNV 3APCA 2K8HA 1U5DA 2QSDA 3UIOB 2INPE 3ENEA 4ZHPA 4O1NA 2HE7A 2Q13A 4OZAA 2JT4B 1WX7A 4W9EA 1OQNA 1UF0A 3ZNGC 1KRHA 2SEBD 3N32A 3VR9B 4XX5A 4K7SA 3DBHI 2UZSA 4EOYA 2BCJA 4MH0E 4Z2NA 2VH2A 2KKCA 1TJ6A 2ACZB 2GS0A 1I4PA 5AZGA 4HJGE 1YX6B 4KVGB 4TQ1A 2N23A 3SYXA 1GAQB 2L00B 1ZKHA 2W54A 1QZEA 2H7EA 5IOIA 4F7UP 2WHIA 2IGGA 1U5FA 1GNUA 3TCAA 4HKQA 5G55A 4MDKE 2LRUA 3I3TB 2GBRA 2IYBA 3M63B 4GGQA 4GMVA 1IGCA 2CJNA 4JK7A 3NUHB 2Z13A 4AJYB 5DHAB 1V2YA 4HB3B 2KDEB 5D3WA 1UGJA 4HB0B 2IO0B 2L1AA 2AWTA 1OEYA 1XX0A 3RZFA 4FJYA 1FO4A 4JL9A 3X23A 1BTNA 2RVBB 1MKEA 2V1YA 4CO7A 1ZXHA 1CJEA 2D3BA 1L0YB 4K17A 2WX0A 3PRZA 4NSWA 4D0NB 2PVGC 1KTKA 2M38A 3V60A 1OY2A 4EUTA 1F2RI 3SFEB 3N1YC 1MK9B 1YN3A 1Y56A 3KW5B 4DHJD 3UI3A 5IKCM 1TS4A 3SU8X 1WXQA 2NPTB 3ZJUA 3RYTA 4RGOS 1YJIA 4H8SA 2ROZB 4IKGA 5D94A 1N62A 1KLVA 1T77A 4C80A 2C9WB 5HE3A 2RPVA 3ONSA 2V9HA 4JKFA 4EEWA 2G35A 4GB9A 1F0ZA 3R2IA 5EFXA 1MVKA 3HM6X 1LXDA 1C76A 2BVCA 2FCSA 4ANVA 2PZ1A 1ET9A 4WWOA 1GC6A 4B0EA 2N0SB 1YN4A 1U5EA 2DHIA 1FD6A 4I6NB 3S2AA 3L10B 4HCNB 1PLSA 2ABDA 1P6SA 2LXAA 3UINB 4A8XC 3ZXRA 1HE8A 1ZDVA 1TZOA 3F5RA 3Q69A 2ADZA 2JQRB 4JE3B 3GE8C 2CY4A 2OOBB 4KGRA 1P1AA 4QJ4B 2KFKA 2K1FA 2FAZA 1PFJA 3ZNHB 2I2YA 3SNHA 3TEWA 4HLEA 2NZ8B 2D3AA 4A3PA 1E6EB 3F0WA 1QC6A 3EUB2 4L23A 4RF1A 4ANXA 4NQKE 3SD5A 5DIFB 4FXCA 4KKIA 1YIWA 4J3OD 3IT4B 1L0XB 3A98B 1XCTL 2CQUA 3RNEC 3ZQ4A 2GJYA 1SB3C 2ZCBA 1Y19B 5J3TA 1OTRB 2LULA 1FB8A 2RDGA 1I4QA 2L32A 2N9EB 4K2OA 2ZEQA 4BBNF 2DLWA 4MY6A 1KZ7A 1RJ2A 1SIJA 1RRBA 4B95A 2Y5PA 4XZ4A 1YJJA 4XWXA 1L5PA 1OEYJ 2FE8A 2JYEA 4KDLB 2WX1A 1OGWA 5FK9C 3AI5A 4WWMA 1FNUA 4HJKA 4A20A 4QXAB 4KHOA 2Y8FA 2CKHB 3TBLD 5JLJB 3EPYA 2JU6X 1XD4A 1NU2A 2KOXA 2CODA 2C5LC 3PPAA 4WIPA 2M4NA 1F52A 4YTNB 2CHZA 4BKSA 2FJ9A 1N6ZA 2LD9A 3HHMA 2RLOA 4KKJA 1Q1OA 3MC9A 4ZYNA 3IXSA 1QLBB 1OQQA 4IW0A 1HZ5A 4IG7B 4HHVA 2UU7A 1M94A 2N9XA 1WJ6A 3SUZA 2LG1A 2H89B 2Z14A 2YSZA 1M4VA 2IPKD 2O6VB 1YN5A 1XQQA 2KTRB 4URKA 3EHVA 1TKYA 1UNPA 3KUZA 1XF5L 3QAQA 3APFA 4WJPA 2KTFA 4US9A 1AYFA 2ELBA 4FADA 1PUTA 1XEEA 3Q3MC 2I1JA 1NTYA 3DBLB 3AEAB 4S0RA 3RUIB 4HEA1 1P3QU 1XD3B 3UZTA 4PYZA 3CXBB 1JDEA 1KH0A 3NSUA 1Q5WB 4TV3A 3GYOA 3IG3A 3Q6BA 5HHDG 1N63A 3LB8C 1N5WA 5G2NA 1RWSA 4YTMB 3W1SA 4GOCA 3BINA 1EM7A 5D3YA 5MPOA 2PW9A 2XK5B 3ALBA 2N1VA 4WAAA 4FBJB 4ZRIA 4E3CA 1UUPA 3BJIA 3Q8FA 1KF6B 1EU3A 2V3PA 2J59M 3O13A 1F77A 3VH4B 4EE2A 2GOWA 1W1DA 2D10A 3BK2A 4DXGA 2DN6A 2JP2A 2MJEA 1XLNA 1YX5B 2RQ1A 4KGTA 2K3UA 1EGXA 3AU4A 2KWUB 5E6OA 2N4FA 2K22A 3UIPB 3ZDMC 2HDEA 4KHBA 4PQ0A 5BMHA 4XWTA 4MM3A 5DH9B 2KWDA 3PRMB 1ZOYB 1Y8RC 4KIKA 2Z0PA 3SO6A 4HROA 3V62A 3MC8A 4W9LA 2ASQA 4WAFA 1L2NA 2AYOB 3AH7A 1AWEA 4KZCA 2B76B 3SBTA 2MSED 2CR5A 4ASWC 1UPRA 1MG8A 4ZYSA 3PT2B 4IOYX 3WAPA 2KMMA 2KANA 1E7VA 3ML4A 1JWAD 1FHOA 2WDTB 1EVHA 3E9SA 5C3JB 2OHFA 2EKIA 2H7DA 3WA0A 1V97A 4HSIA 4IM0A 1TZ1A 1WXSA 1WGKA 2KHWB 4GLSC 4MELA 5FR6A 4YONA 1V5PA 2X8XX 1NEKB 1WMHB 2K5PA 3ZTDA 3A58A 1XCQL 3NWFA 4RM8A 3ZKJC 2C7NB 4KAXB 2M17A 2YEPB 3C8YA 4YT0B 1QOGA 3IBEA 2B3AA 4KSKC 3ZRCA 3G9WA 1Z5SB 2MHJA 3EFUA 5CTRC 4BKSD 1KI1B 4HAZB 4DDID 4WWNA 5GOWB 4A5KA 2BS3B 2KR0A 2J0JA 2D5GA 1T6BX 2MQJA 2IYDB 4YWGG 2DYQA 4YL8A 1YQ3B 4ITKA 1XCGA 3PZDA 3LYYA 3NS8A 3ODOA 1K5GB 1YOVB 4IWPA 1QOBA 1MPEA 5C5BB 3WAMA 2FIDA 5IAAC 4XC2A 3OG5A 1SJED 3TJPA 3MDBC 2W3SA 1GG3A 3ZLZA 5JHAA 1WYGA 1V8CA 4IUMB 3ZVRA 3NRZA 2BYTA 4GMXB 1J0WA 5IP4D 2PEAA 2DZMA 1V5UA 4JQWC 1NTVA 3B0AA 1L6UA 3OANA 1UNRA 4GNKB 5C5BA 3HUIA 1J0GA 3Q2AC 3Q8CA 3N1XC 4AOFA 1L6VA 3IHPC 1VZ8A 2L1CA 3HW2B 4HVBA 1C4CA 2K00A 2M19A 2LFIA 4IM3A 4P7IA 1HQRD 4LJOB 4NJCA 1IYFA 5CHVC 2LOXA 2ZW0A 2CS4A 5LLIA 3VHTC 2D3GA 4NNJB 3JSVB 1C79A 4JGHB 1I35A 4JK9A 2D4QA 3L08A 2R09A 1TTNA 1TS5A 5L95C 1KZGA 2NVUI 1BTKA 2KDBA 5M4YB 2BYVE 2IGHA 2N9PC 1TT5B 2DZJA 1KLUD 2VZKB 4Y94A 1MFWA 2L52A 3KRXA 4EFOA 4JKHA 2MJDA 2IO2B 1E9MA 3GYPA 1L7YA 3NWAA 4UDUC 3ZW3A 3AULA 3QQ8B 3ULBA 2O6VD 1V61A 2RMMA 5AZHA 2Y5BB 2EJ8A 2GB1A 2DTCA 1B1ZA 1IGDA 4LJPB 2GRIA 5T8IA 1DGJA 1SE3A 2KYWA 5FR3A 1AW7A 4LLGM 1WRIA 3FVCA 2G4SA 3I63C 1BMLC 3L0WB 1U27A 2LYDA 1X1FA 2Z4DA 2WU5B 3GP7A 3P2BA 3EA6A 3JSVA 1K8RB 3ODXA 4DX8A 3AEGB 1VCBA 1FHXA 1WVHA 2R61A 3SHQA 3KQ4A 4LK0M 2LGXA 1JRUA 1HXYD 2JRHA 4ZRPA 3ABVB 2DZKA 2G9HD 3NOBA 4A90A 3HVZA 3AE4B 4AQ7A 2R82A 2ZPYA 5EE3A 3X0WA 5GMVA 3V61A 1WWTA 2IDYA 1VZ7A 4HRSA 1K5DB 1SE9A 3KZ1A 2KCJA 1EUVB 1MIXA 3PLVA 1E0ZA 2LVQA 5AEKB 2KGXB 2QILA 1OQYA 2KMCA 3P7ZA 1SEBD 3H6NA 2HJ1A 5DCNA 3T3NA 2D9YA 2DAJA 4LNIA 1ZW7A 4ZRQA 3Q3FA 2WDRB 2LGDA 1J7BA 2QEJC 2V0GA 4DX90 1JW9D 3P63A 3I9V1 3ENBA 3E66A 1EWYC 1KFYB 2P8VA 1N5XA 2DHZA 3ETRA 1E8WA 4PYUA 1C9FA 1RAXA 3OHMB 4M8MA 4HPPA 3KLSX 4YTPB 1Z87A 1WJNA 2WXKA 3H8HA 3QX1A 2WDQB 3ULCA 3TEYA 2KK8A 2ZCCA 1YMHE 2WXRA 2ZZPB 1V80A 2ICIA 3U52E 3HM3A 3A9KB 2ZJDA 3NY5A 3DPDA 3FSSA 1SGHA 2LMCA 2INNE 3N9YC 1E10A 3T8MA 2BT6A 1VR9A 4PS3A 4B0MA 3M95A 3GZNI 4HB2B 3RNGC 3H1UA 3U30A 1T0QC 1E8YA 3QWZB 3FKYA 4K1RB 3Q8EA 4BOZB 5CLQB 1QQRA 4P6VF 4OHJA 1X1MA 4RF0A 1ACCA 1PFDA 1A5RA 1AQCA 1ZM0A 3AECB 2ZNVB 4MGYE 2XK5A 1TIFA 2LWPA 4ICUA 3RN9C 5J17A 4PNKA 1UPQA 3BWUD 2MBBB 2A4ZA 2JUOA 1V1PA 3W1YA 5IN7A 2MBOA 1H4RA 2Z59B 2PMVA 3PO0A 5HE1A 3OJ3A 2MKRA 2KJ6A 1UD7A 1FFVA 2KFKB 1GGOA 2LVOA 5LG4B 4QAYA 3EC8A 4LTUA 3PLUA 4XWWA 3A9KA 1ISNA 3B9JA 2KNBA 1U29A 3SBGA 3E9PA 2NCNA 2K8CA 3NJTA 3C0RB 3L16A 3L4PA 1D4BA 1FGYA 2LJ5A 1F9JA 5G5HA 1LGRA 4C7YA 1WE6A 1LFDA 4AS1A 3DBHB 1L4ZB 4W9DA 5J3QA 4W9CA 2NBVA 1MJDA 3A8PA 5I2MA 3ZUNA 2MDXA 2FDQA 3LDZE 3R8BA 5JHHA 1JQ4A 2Y3AA 1T5XD 2W2XD 2DZIA 4DK5A 3M62B 3UGBB 3PP2A 1ROEA 2DYMA 3AE7B 1V1PB 2MH7A 1NYQA 4MT7A 4HKZE 2Z8LA 5LXIB 2MBHA 2GCJA 4OVZA 1ZSQA 4I6PA 1D6EC 1ESFA 2WXPA 3MFGA 1I7AA 2YLMA 3EGRA 2N7DA 5KCVA 2MP2B 4RGNA 4DHZB 1NI3A 1XT9B 3VR8B 4FA6A 2VKIA 1X86A 1HTQA 2J42A 5KQ1A 4GDLA 4N9F4 4BAXA 1JMLA 2M56B 2K2UA 5I2SA 3IFWB 1AWDA 4E71A 2I5CA 2YRYA 1QOFA 1ZUD2 3RNAC 4D2KA 5JZEB 2N0YA 3U12A 1U4AA 2WXMA 5DPWA 3A8QA 4EZKA 4MM3B 5FI1A 3IVFA 5D7GA 4DXFA 1HB8A 1UH6A 2XBBC 4B9KA 3MC0B 1VZ6A 2L0TA 1NI2A 2KTRA 4GU2A 3NVYA 2CRFA 2DA0A 4WH4A 4DWFA 5EE0A 1XKEA 1UWXA 3PHWB 2QMTA 5D27A 1WXVA 4PS7A 4IFSA 3DVGY 1DOIA 2EMSA 5D3IB 1ET6A 3LXFA 1SE2A 3HRDD 3HVDA 5LONB 3U8ZA 3AE2B 3NZUA 4CQNA 2DBYA 3A1QB 1TXDA 2TSSA 3LJUX 1P7FA 4OZBA 2D2QA 2DYNA 3ZRFA 3DCXA 1JWBD 2KX3A 3SR6A 4GOUA 2K8EA 2FCMA 3TEZA 2A5UA 3WYFB 5L81A 1MIZB 1LW3A 1T0SC 3H9DA 3PSCA 1E5WA 3DVNU 1EWCA 3L17A 4ARCA 2NR2A 1WZ3A 3GZNB 3R66C 4NAWB 1GUAB 2WXJA 2J7QB 4LNOA 1J7AA 3DQVA 3VUXA 3QIJA 3SDLC 3V05A 2COCA 3V5WA 1C78A 4MEMA 2YT2A 2D3CA 4FHKA 1E8ZA 4KHBB 2BGFA 1N60A 1SF0A 5DPRA 2LHDA 1D5MC 3P4PB 4JKCA 4OZCA 1G6JA 3A9JB 2YT0A 2UYZB 1WFYA 3CSTA 3I57A 2V76A 1XLOA 2MRPA 2WU2B 1E90A 2KO3A 5BYSA 2DYOA 3NZ3A 4LDTB 4ZDVA 1WIAA 2PLPA 1V5OA 1N3HA 1K51A 4OSNA 5HE2A 4MH8A 2L0FA 2I1KA 2KFJA 3VRBB 3N3KB 5C1ZA 2W9NA 1X11A 4HAYB 1MHHE 3M3JA 2K9XA 4W9KA 3AE3B 5JP4A 4NQLB 1RLFA 1PQSA 2BB5A 3T9LA 3A4RA 1V5TA 3HK0A 2BYFA 3MJ5A 3RI7C 4HPLB 2RR9A 1BXTA 2V4LA 5BMIA 3R3MA 2AX5A 3NVWA 2JZ3B 2MFQA 1WY8A 1Q0WB 3ML8A 4HAXB 2BBCA 1C4PA 1I2HA 4JIOU 3VTWA 2JVCA 3TW1A 4JKBA 2OJWA 3NHEB 1LB1A 2YF0A 3QA8A 4JPSA 3NZSA 4HDQA 5BMGA 2KDMA 2FCQA 2OTXA 1WM3A 2WGSA 3ECIA 1VBHA 4P1BC 1KBLA 3M1IB 2N9KA 2HTME 4H2AA 4IDIA 4WSFA 4NY0A 2KX0A 1GJZA 3PV1A 3L13A 4W9GA 1P5TA 4ACFA 2WS3B 3UQAA 1KOTA 2O2VB 3V6EB 1XODA 1MAIA 3P4QB 2VZKD 3DWGC 3DHHC 4ANWA 3RMKC 2MCNB 1TBEA 1J8CA 2LBBA 4TSSA 3VVWB 2MEKA 2WXFA 3VOQA 3W1SC 1CK1A 2DENB 1HZ6A 3NG0A 1U5GA 5EDSA 4HDOA 4CSQA 2KJRA 1STEA 4W9IA 1ZDXA 1GC7A 4GPTB 2V4IB 4K3CA 2XNAC 2X38A 4MT5A 3JYUA 4RMAA 3KYCD 4L1BA 4L1RA 3AU5A 2L3ZA 2QKMA 3KRWA 2DWQA 3PSEB 1TY2A 3NVZA 4WJQA 1F2RC 2G3QB 1WH3A 3U7ZA 2K25A 1UELA 2QDFA 4N58A 2YS5A 3HIEA 4JKEA 1YQBA 2O2VA 2COFA 3LJ3A 2MLBA 4DBGA 1VJKA 1S1QB 4NAMA 3IAS1 1K52A 2K6DB 1WJ4A 1QKZA 2DLBA 2KXJA 2KD0A 3JVZX 3ZJTA 1HTOA 1V86A 2NS5A 3IT6B 2KJHB 2KVRA 1NVLA 1FNVA 3RFZB 1WGYA 2DX5A 2BF8B 2X18A 1PMSA 4CHJA 2YT1A 2KACA 4ICVA 2KLGA 3TL5A 1JWUD 2M1MA 3RCPA 2OJRA 3DWMA 2OQBA 1RYJA 3QJZA 3PVLA 2G45B 1FCCC 1SBBB 2DIKA 3GS2A 3RD2A 3KYDD 4RH6A 3HSAA 2OEDA 2BQQA 4C00A 2EKEC 4KV2A 2PVOD 1VDVA 4EMOA 2KQ7A 5KQ4A 3WIMA 5D3XA 3QWMA 2HD5B 3BVZA 1LO5D 3DCGA 4M02A 2UZRA 3KY9A 1NBFC 3CIRB 3PGEA 4TMAB 2XN9C 1BWNA 4FJVB 2LXCA 4DQOC 3FAHA 1KLGD 2I38A 4GSWA 4IWOA 2QCZA 2MA9B 5C2TB 3JW0X 1ZE3D 1I7HA 1XXGA 1ENFA 1JALA 2MP2A 2Z0DB 1WGRA 4NJ7A 4IC7B 1WE7A 4GDLB 3P1MA 1D5ZC 1UZXB 2GBKA 2KQ4X 5BYRA 4TQ0A 4AJWA 1Q10A 4R3DA 2K8BA 1MI1A 3VTVA 1FXIA 3Q8BA 2AQ2B 4HPMB 4S17A 3UQBA 3E9OA 5J3YA 2ZNVC 2RD0A 4HB4B 2WXLA 3AE8B 3L54A 2WXHA 4HK2A 3TFMA 3FLVA 2KIEA 3B2FA 3AN1A 3MTNB 3TSSA 1UNSA 4KDIC 1WSPA 4HXDA 4C4VA 1WXMA 3GOEA 1RFKA 4B6WA 2COAA 3U4EG 2NTSA 3Q3NC 1WYWB 2D9ZA 5KHQA 3BZDB 1FRDA 3APDA 4EJNA 1Z2MA 3QHTA 1TGZB 2D9VA 1M7RA 2NBUA 1VRAB 1V89A 2DX1A 1JROA 1CMXB 2PE6B 4GZUA 5D3DA 3DXEA 1NYRA 4WVFB 3DHIC 2RDHA 5H8YE 1IUEA 5C6RA 2JWUA 2V3SA 1GOZA 1E7PB 2ZKMX 1ZC4B 4F1SA 5IRSA 1CZPA 1YNTE 1HB6A 5DPTA 3AE6B 3TEXA 4RNAA 2C7HA 4IAPA 1DDMA 2NTTA 3O65B 2EMTA 2IY1B 2D9XA 1NDDA 2IO3B 1WXAA 5EE1A 2VSZA 3VTUA 2PPHA 2JZPA 2GI9A 1I4XA 3AB5A 4F7ZA 3DXDA 1I4GA 3PREA 3ML9A 3AEDB 3N1ZC 3W5VB 2CAYA 1V81A 2BPSA 2JXTA 2AEHA 3OAWA 4FN2A 2MBEA 2N1WA 3WAOA 1WGQA 3FM8C 3BYYB 5C23A 3ZJVA 4MACA 2QIEB 1AN8A 2WXOA 2Y5CA 4ZRKA 2CU1A 2LJIA 3KUCB 1MI0A 3KVFB 5HFYA 2D9WA 1PGXA 1K50A 2PE9A 4JKGA 1WRDB 3TO1A 4A55A 4YSXB 2E3TA 2CY5A 2NBVB 3GE3C 2P0DA 2W3RA 1BT0A 4E74A 4XDCA 2KN5A 2CU3A 4KIKB 2ON8A 4A9AA 2WXQA 3KSYA 4W9HA 2GUMA 2KQSA 4WJ7A 3CIKA 1H8CA 3CF6E 1Q67A 1SXTA 4CHKA 3BIID 5CHWA 3B2GA 3D8FA 4XGAB 3RT3B 2C60A 2K2JA 2KC2A 4G50A 3PVUA 1ST7A 2BYEA 3N30A 1DDWA 2KMAA 1A70A 4EZLA 4ZHOA 1V49A 5JH5C 4II3B 4OVVA 1U2BA 2LKOA 1YQ4B 1IP9A 2MWNB 3Q3JA 4MSQB 1QQGA 3ZIMA 1DYQA 2IBIB 3RULA 2AL3A 2L7RA 2G4DB 2C7MB 4JKAA 4C56C 3ZTCA 2P0FA 4WQMA 1CQVA 2BWES 4MGKE 3T3OA 1B55A 2LUMA 3OJ4B 4TYZA 2J0MA 1SE4A 3MP9A 4BOSC 1WX9A 2RPQA 4DHJB 4YSZB 5E6PA 2NMBA 4ARIA 1E7UA 2X0SA 5J2RA 1FGZA 2MJ3A 4NPNA 3RNCC 2AQ1B 3H7PA 4ZRJA 3VUWA 4A6FB 1N61A 3UF8A 2YS1A 3BVMA 5E6NA 3SV1A 4GDKB 4M00A 5H92C 3PRPB 2ZW1A 1C1YB 5JVLA 1NENB 1R4MB 3PEGA 5AUKA 4PK1A 1IBXB 2W2WA 3WALA 2GMIC 5CLLB 2PKOA 2COPA 4RM9A 1P9DU 4BBNC 4IWQA 3KWVA 1UBQA 2WXIA 4K7UA 4XE0A 2XQNM 4I6LB 5C79A 2VRRB 3IAM1 2PTLA 2K6QA 3RNFC 1TS2A 2JX5A 4PT5A 4KHAA 4C0AA 4WQOB 3VXWA 1TYGB 3TIXA 1QILA 1IBXA 1X1GA 1SSNA 1JCKB 1P0RA 2CJOA 3WANA 3VH3B 1DIKA 1QF6A 1T0RC 4RGTA 4DBBA 3U2SC 3NS1A 4NAWA 3ZNZB 2DFKA 4X57B 3PHXB 3PTFC 4BZAA 3MHZA 1RRPB 2DX5B 2KDIA 2J52A 2REXA 1OFFA 5KHOA 2JSVX 2QKLA 1PDXA 1GB4A 2DHJA 1DDVA 3AV8A 2Y8GA 3ZDTA 2RRFA 2Z0OA 1TY0A 2ZPNA 1B9RA 4AUQC 3PZ7A 4PS8A 2I5FA 5E6JA 5IA7A 4G11A 4G3XB 1WMHA 2ROVA 1UGMA 2R2YA 2KWVB 3ZYYX 3QARA 4OW0A 4ANUA 4LNKA 1E8XA 2UVMA 4N59A 2P0HA 1VD2A 3RCZA 5HKHA 3SFDB 2WYQA 1EO6A 1R4NB 2L76A 4W9FA 2FIFA 4QJ5B 3OLMD 3W2DA 4DXAB 2DHKA 2GBMA 1FCLA 1TKEA 5HE0A 4JWSC 4EZJA 1DOXA 1KM7A 2KDFB 3PG7A 5DHFB 1IPGA 3CWIA 2DNFA 5JHGA 2MBQA 4JLCA 2KLCA 2DKQA 3AE1B 4YSYB 2UWQA 4DHZE 4F7HA 2N7JA 1MK7B 1QOAA 1W1GA 4K3BA 3W5UB 1MG4A 5J18A 1JRPA 4REZA 3V6CB 3T06A 4F8CB 1PYWD 3U7DA 3D8EA 2LOZA 2KVZA 1WGHA 2GLSA 3AE5B 2MW5A
chains in the Genus database with same CATH topology
1WGUA 3DVGX 1R4MI 1AARA 3ZNID 1TQZA 2L2IA 1V5MA 3K9PB 1EF1A 4B6HA 2RNRB 2PJHA 1P3RA 1XR0B 2LGYA 2YVCA 2AL6A 4K81A 2R0DA 3DBSA 2JXXA 3D8DA 1BAKA 1UBIA 1WR6E 1I42A 4MK0A 2RSUA 2YS3A 1V6EA 3RZWC 2DAFA 4G0NB 1NTIA 4BBKA 1SHCA 1MPHA 3ZVVA 2IFSA 2LI5A 4A6HA 1M7EA 2RGFA 4ILHA 5IJMA 4MGIE 2NBWB 4K2PA 1ZC3B 4BKTA 2MX2A 4JK8A 1WF9A 2GBNA 2L8JA 2WWZA 4IM2A 3TVVA 4JKGB 4J6IA 2M8SA 2NPTA 2JWZA 5DI9B 1OMWA 2ELAA 2D07B 3K9OB 2CB8A 4LDTD 5CHFA 1V88A 2KUPA 4BKGA 4DDGD 3MJWA 1V9JA 2VRWB 1KJTA 1D3ZA 2FCNA 2L05A 3AXCA 4HCPB 2M0XA 1WG7A 3CSFA 3VFKA 2R2OA 1FHWA 1EF5A 4Z2MB 2KZRA 5CX3A 2D11A 3FP5A 5D3VA 4HATB 1WZ0A 1X05A 2CHWA 1ZVRA 2KWCA 1HBKA 2J0KA 2LVPA 3E9LA 3QC8B 2RSGA 4HAUB 3BY4B 5AZFA 4FLHA 2IY0B 4GIVA 4OVUA 4A6FA 2KC1A 2DYBA 2N7EA 2EC1A 5LXHA 5LOPB 2Z0QA 5TR5A 2FJLA 2QHOA 1YD8U 4WJOA 2MWSB 2LASA 1UNQA 3B1LX 3VDZA 4JKDA 2HTHB 1J19A 4M8NA 2FNJB 4MGZE 3QK0A 4HAVB 2RUKB 1S3SG 5L83A 4L6EA 4F7GA 2W2XC 2Z0EB 4ILGB 2CHXA 3A4SC 4AP4C 4TUUA 4KSLC 3HQCA 3DDCB 2ZVNA 3VQIA 3ODWA 3ZO5B 2Y7BA 4HWIB 3H7SA 3VUYA 4LCDE 3A1QA 4KZ0A 2GCLA 1YJ1A 1LM8B 1UEFA 3R7RA 1H10A 5JHBA 3PVWA 1T0YA 2JF5A 3TMPB 1LQBA 2HRJA 4CHMA 3D32A 1WJUA 2HTHA 1ACAA 2M14A 2O6VA 3H7PB 4CYEA 1ZGUB 5C16A 2IO1B 3KH0A 4M0WB 5FI0A 4GDKA 1WGGA 3DOWA 2ZVOA 4II2B 3P6AA 3PS6A 2LUEA 1C3TA 3QBVB 3KUDB 4MJSA 3VIAA 2FUHB 2IZVB 1RFAA 4K7WA 2BKFA 1VBGA 1IRSA 2GBJA 3DXCA 2DKPA 1DYNA 1P98A 1WR1A 1DROA 1WI1A 4MJSB 1WI0A 1SIFA 3R7QA 4NJ6A 4FJZA 2XEWA 3MHSD 4WJNA 3MPXA 1W1HA 5D6JB 1FOEA 1KC7A 3B08A 4TKNA 2JZZA 4AWJA 2HJ8A 2JRIB 1DBHA 1R4NI 3HIZA 2BKRB 4A6KA 1WM2A 4HAWB 1Y5OA 1WGDA 4BFRA 4FHJA 2JPHA 4FULA 3AJ4A 4GN1A 5D2MB 4BVUC 3N7CA 3CMMB 3QCAA 1WJ1A 2BWFA 3DBLI 2LZ6A 2WH5A 3O96A 3DBRI 4A3OA 1WJMA 3EECA 4MSMB 2RGNB 5BO4B 3VAWA 5DPSA 1EAZA 4W9JA 2R2QA 2JY6A 1FAOA 2E2XA 1FXTB 4EKUA 4GXBA 2LRWA 4ILJA 2K39A 3A33B 3A9JA 4WWPA 3FEHA 1WX8A 3DVNV 3APCA 2K8HA 1U5DA 3UIOB 3ENEA 2HE7A 2Q13A 2JT4B 1WX7A 4W9EA 1OQNA 3ZNGC 3N32A 4XX5A 4K7SA 3DBHI 2UZSA 4EOYA 2BCJA 4MH0E 4Z2NA 2KKCA 1TJ6A 2GS0A 5AZGA 1YX6B 4KVGB 4TQ1A 2N23A 3SYXA 2L00B 1ZKHA 1QZEA 2H7EA 4F7UP 1U5FA 1GNUA 3TCAA 5G55A 4MDKE 2LRUA 3I3TB 2GBRA 2IYBA 3M63B 4GGQA 4GMVA 4JK7A 4AJYB 5DHAB 1V2YA 4HB3B 2KDEB 5D3WA 4HB0B 2IO0B 2AWTA 1OEYA 1XX0A 3RZFA 4FJYA 4JL9A 3X23A 1BTNA 2RVBB 1MKEA 2V1YA 4CO7A 4K17A 2WX0A 3PRZA 4NSWA 4D0NB 2M38A 3V60A 1OY2A 4EUTA 1MK9B 3KW5B 4DHJD 3SU8X 2NPTB 3RYTA 4H8SA 2ROZB 5D94A 1KLVA 2C9WB 5HE3A 3ONSA 4JKFA 4EEWA 2G35A 4GB9A 5EFXA 3HM6X 1LXDA 2FCSA 4ANVA 2PZ1A 4WWOA 1GC6A 1U5EA 2DHIA 4I6NB 3S2AA 3L10B 4HCNB 1PLSA 2ABDA 1P6SA 2LXAA 3UINB 1HE8A 3F5RA 2ADZA 2CY4A 2OOBB 1P1AA 2KFKA 2K1FA 2FAZA 1PFJA 3ZNHB 3SNHA 4HLEA 2NZ8B 4A3PA 3F0WA 1QC6A 4ANXA 4NQKE 3SD5A 5DIFB 1YIWA 3A98B 2CQUA 2GJYA 2ZCBA 1Y19B 5J3TA 1OTRB 2LULA 1FB8A 2N9EB 4K2OA 4BBNF 2ZEQA 2DLWA 4MY6A 1KZ7A 1RJ2A 1RRBA 4B95A 4XZ4A 4XWXA 1OEYJ 4KDLB 2WX1A 1OGWA 3AI5A 4HJKA 4A20A 4KHOA 2Y8FA 2CKHB 3TBLD 5JLJB 3EPYA 1XD4A 1NU2A 2KOXA 2CODA 2C5LC 3PPAA 2M4NA 2CHZA 4BKSA 2FJ9A 2LD9A 3HHMA 2RLOA 1Q1OA 4ZYNA 4IW0A 4IG7B 4HHVA 1M94A 2N9XA 1WJ6A 3SUZA 2LG1A 2YSZA 2O6VB 1XQQA 2KTRB 4URKA 3EHVA 1UNPA 3KUZA 3QAQA 3APFA 4WJPA 2KTFA 2ELBA 4FADA 2I1JA 1NTYA 3RUIB 1P3QU 1XD3B 3UZTA 4PYZA 3CXBB 1JDEA 3NSUA 1Q5WB 4TV3A 3GYOA 3IG3A 5G2NA 3W1SA 4GOCA 3BINA 5D3YA 2XK5B 3ALBA 2N1VA 4WAAA 4FBJB 4ZRIA 4E3CA 3BJIA 2J59M 3VH4B 2GOWA 1W1DA 2D10A 2DN6A 2JP2A 1YX5B 2RQ1A 1EGXA 3AU4A 2KWUB 5E6OA 2N4FA 3UIPB 3ZDMC 4PQ0A 4MM3A 5DH9B 3PRMB 1Y8RC 4KIKA 2Z0PA 3SO6A 3V62A 4W9LA 2ASQA 1L2NA 2AYOB 1AWEA 4KZCA 3SBTA 2MSED 2CR5A 4ASWC 1UPRA 1MG8A 3PT2B 4IOYX 3WAPA 2KANA 1E7VA 3ML4A 1FHOA 2WDTB 1EVHA 2H7DA 3WA0A 4IM0A 1TZ1A 1WXSA 2KHWB 4MELA 5FR6A 4YONA 1V5PA 1WMHB 3ZTDA 4RM8A 3ZKJC 2C7NB 4KAXB 2M17A 3IBEA 2B3AA 4KSKC 3ZRCA 5CTRC 3G9WA 1Z5SB 4DDID 3EFUA 4BKSD 1KI1B 4HAZB 4WWNA 5GOWB 4A5KA 2J0JA 2MQJA 2IYDB 2DYQA 4YL8A 1XCGA 3PZDA 3NS8A 3ODOA 1K5GB 4IWPA 5C5BB 3WAMA 2FIDA 5IAAC 4XC2A 3TJPA 3MDBC 1GG3A 3ZLZA 5JHAA 4IUMB 3ZVRA 4GMXB 1J0WA 2PEAA 2DZMA 1V5UA 4JQWC 1NTVA 3B0AA 3OANA 1UNRA 5C5BA 1J0GA 4AOFA 3IHPC 2L1CA 3HW2B 4HVBA 2K00A 4IM3A 4P7IA 4LJOB 1IYFA 5CHVC 2LOXA 2CS4A 5LLIA 3VHTC 2D3GA 4NNJB 3JSVB 4JGHB 1I35A 4JK9A 2D4QA 3L08A 2R09A 1TTNA 5L95C 1KZGA 2NVUI 1BTKA 2KDBA 2BYVE 2N9PC 2DZJA 4Y94A 3KRXA 4EFOA 4JKHA 2IO2B 3GYPA 1L7YA 3ZW3A 3AULA 3QQ8B 3ULBA 2O6VD 1V61A 5AZHA 2Y5BB 2EJ8A 2DTCA 4LJPB 2G4SA 3L0WB 1U27A 2LYDA 1X1FA 3P2BA 3JSVA 1K8RB 3ODXA 4DX8A 1VCBA 1FHXA 1WVHA 3SHQA 2LGXA 1JRUA 2JRHA 2DZKA 3NOBA 2R82A 2ZPYA 3X0WA 5GMVA 3V61A 1K5DB 1SE9A 3KZ1A 2KCJA 1EUVB 1MIXA 3PLVA 2LVQA 5AEKB 2KGXB 1OQYA 2KMCA 3P7ZA 3H6NA 5DCNA 2D9YA 2DAJA 1ZW7A 3Q3FA 2LGDA 4DX90 3ENBA 3E66A 2DHZA 2P8VA 1E8WA 4PYUA 1RAXA 4M8MA 1Z87A 1WJNA 3QX1A 3ULCA 2KK8A 2ZCCA 2ZZPB 1V80A 3HM3A 3A9KB 2ZJDA 3NY5A 3DPDA 3FSSA 1SGHA 3T8MA 4PS3A 3M95A 3GZNI 4HB2B 3H1UA 3U30A 1E8YA 3QWZB 4K1RB 4BOZB 5CLQB 1X1MA 1A5RA 1AQCA 1ZM0A 2ZNVB 4MGYE 2XK5A 2LWPA 4ICUA 5J17A 4PNKA 1UPQA 2MBBB 2A4ZA 2JUOA 3W1YA 2MBOA 1H4RA 2Z59B 5HE1A 3OJ3A 2MKRA 2KJ6A 1UD7A 2KFKB 1GGOA 2LVOA 3EC8A 3PLUA 3A9KA 1ISNA 2KNBA 1U29A 3SBGA 3E9PA 2NCNA 2K8CA 3C0RB 3L16A 1FGYA 2LJ5A 1F9JA 1WE6A 1LFDA 4W9DA 5J3QA 4W9CA 3A8PA 3ZUNA 2MDXA 2FDQA 3LDZE 5JHHA 2W2XD 2DZIA 4DK5A 3M62B 3UGBB 3PP2A 2DYMA 4MT7A 5LXIB 2MBHA 2GCJA 1ZSQA 4I6PA 1I7AA 2YLMA 2N7DA 5KCVA 2MP2B 4DHZB 1XT9B 4FA6A 2VKIA 1X86A 5KQ1A 4GDLA 4N9F4 2K2UA 3IFWB 4E71A 2I5CA 2YRYA 5JZEB 2N0YA 1U4AA 5DPWA 3A8QA 4EZKA 5FI1A 3IVFA 5D7GA 1HB8A 1UH6A 2XBBC 4B9KA 2L0TA 1NI2A 2KTRA 4GU2A 2CRFA 2DA0A 4DWFA 1XKEA 3PHWB 5D27A 1WXVA 4PS7A 4IFSA 3DVGY 2EMSA 5LONB 3U8ZA 3NZUA 3A1QB 1TXDA 3LJUX 2D2QA 2DYNA 3ZRFA 2KX3A 2FCMA 2A5UA 3WYFB 5L81A 1MIZB 1LW3A 3H9DA 3PSCA 1E5WA 3DVNU 3L17A 2NR2A 1WZ3A 3R66C 4NAWB 1GUAB 2J7QB 3DQVA 3VUXA 3QIJA 3SDLC 2COCA 3V5WA 4MEMA 4FHKA 1E8ZA 4KHBB 2BGFA 5DPRA 4JKCA 1G6JA 3A9JB 2YT0A 2UYZB 1WFYA 3CSTA 2V76A 2MRPA 1E90A 2KO3A 2DYOA 4LDTB 4ZDVA 1WIAA 1V5OA 1N3HA 5HE2A 2L0FA 2I1KA 2KFJA 3N3KB 5C1ZA 2W9NA 1X11A 4HAYB 3M3JA 4W9KA 5JP4A 4NQLB 1RLFA 1PQSA 3T9LA 3A4RA 1V5TA 3HK0A 2BYFA 4HPLB 2RR9A 2V4LA 3R3MA 2JZ3B 2MFQA 1WY8A 1Q0WB 3ML8A 4HAXB 4JIOU 1I2HA 3VTWA 3TW1A 2JVCA 4JKBA 3NHEB 1LB1A 2YF0A 3QA8A 3NZSA 4HDQA 2FCQA 2OTXA 1WM3A 3ECIA 1VBHA 1KBLA 3M1IB 4WSFA 4NY0A 2KX0A 1GJZA 3PV1A 3L13A 4W9GA 1P5TA 3UQAA 1KOTA 2O2VB 3V6EB 1XODA 1MAIA 4ANWA 2MCNB 1TBEA 1J8CA 2LBBA 3VVWB 3VOQA 3W1SC 2DENB 1U5GA 5EDSA 4HDOA 2KJRA 4W9IA 1GC7A 4GPTB 3JYUA 4RMAA 3KYCD 3AU5A 2L3ZA 2QKMA 3KRWA 3PSEB 4WJQA 2G3QB 1WH3A 2K25A 1UELA 2YS5A 4JKEA 1YQBA 2O2VA 2COFA 3LJ3A 2MLBA 4DBGA 1S1QB 2K6DB 1WJ4A 3JVZX 2KXJA 2KD0A 1V86A 2NS5A 2KJHB 2KVRA 1NVLA 1WGYA 2DX5A 2BF8B 2X18A 1PMSA 4CHJA 2YT1A 4ICVA 2KLGA 3TL5A 2M1MA 3RCPA 2OJRA 2OQBA 3QJZA 3PVLA 2G45B 2DIKA 3RD2A 3KYDD 2EKEC 4KV2A 4EMOA 2KQ7A 5KQ4A 3WIMA 5D3XA 3QWMA 2HD5B 3DCGA 2UZRA 3KY9A 1NBFC 3PGEA 1BWNA 4FJVB 2LXCA 4GSWA 4IWOA 2MA9B 3JW0X 2MP2A 2Z0DB 1WGRA 4NJ7A 4IC7B 1WE7A 4GDLB 1UZXB 2GBKA 4TQ0A 4AJWA 2K8BA 3VTVA 4HPMB 3UQBA 3E9OA 5J3YA 2ZNVC 2RD0A 4HB4B 3L54A 4HK2A 3TFMA 3FLVA 3MTNB 4KDIC 4HXDA 1WXMA 3GOEA 4B6WA 2COAA 1WYWB 2D9ZA 5KHQA 3APDA 4EJNA 1Z2MA 3QHTA 1TGZB 2D9VA 1M7RA 2NBUA 1V89A 2DX1A 2PE6B 1CMXB 4GZUA 3DXEA 4WVFB 5C6RA 2V3SA 1ZC4B 4F1SA 5DPTA 1HB6A 2C7HA 4IAPA 1DDMA 3O65B 2EMTA 2IY1B 2D9XA 1NDDA 2IO3B 1WXAA 2VSZA 3VTUA 2PPHA 4F7ZA 3DXDA 3PREA 3ML9A 2CAYA 1V81A 2BPSA 2AEHA 3OAWA 4FN2A 2MBEA 2N1WA 3WAOA 1WGQA 3FM8C 5C23A 4ZRKA 2CU1A 3KUCB 3KVFB 2D9WA 2PE9A 4JKGA 1WRDB 3TO1A 2CY5A 2NBVB 2P0DA 1BT0A 4E74A 2KN5A 4KIKB 3KSYA 4W9HA 2KQSA 4WJ7A 3CIKA 1H8CA 3CF6E 1Q67A 4CHKA 5CHWA 3D8FA 3RT3B 2C60A 2K2JA 2KC2A 4G50A 3PVUA 1ST7A 2BYEA 3N30A 1DDWA 2KMAA 4EZLA 1V49A 5JH5C 4II3B 4OVVA 1U2BA 2LKOA 1IP9A 2MWNB 3Q3JA 4MSQB 1QQGA 3ZIMA 2IBIB 3RULA 2AL3A 2L7RA 2G4DB 2C7MB 4JKAA 3ZTCA 2P0FA 2BWES 4MGKE 1B55A 3OJ4B 4TYZA 2J0MA 4BOSC 1WX9A 2RPQA 4DHJB 5E6PA 2NMBA 1E7UA 2X0SA 5J2RA 1FGZA 4NPNA 3H7PA 4ZRJA 3VUWA 4A6FB 3UF8A 2YS1A 5E6NA 3SV1A 4GDKB 3PRPB 1C1YB 5JVLA 3PEGA 2W2WA 3WALA 2GMIC 5CLLB 2COPA 4RM9A 1P9DU 4BBNC 4IWQA 1UBQA 4K7UA 2XQNM 4I6LB 5C79A 2VRRB 2K6QA 4KHAA 4C0AA 4WQOB 3VXWA 3TIXA 1X1GA 1P0RA 3WANA 3VH3B 1DIKA 4DBBA 4NAWA 3ZNZB 2DFKA 4X57B 3PHXB 3PTFC 1RRPB 2DX5B 2KDIA 2REXA 5KHOA 2QKLA 2DHJA 1DDVA 2Y8GA 3ZDTA 2Z0OA 2ZPNA 4AUQC 4PS8A 2I5FA 5IA7A 4G11A 4G3XB 1WMHA 2ROVA 1UGMA 2KWVB 3QARA 4ANUA 1E8XA 2UVMA 2P0HA 1VD2A 3RCZA 5HKHA 2WYQA 1EO6A 2L76A 4W9FA 2FIFA 3OLMD 4DXAB 2DHKA 2GBMA 5HE0A 4EZJA 1KM7A 2KDFB 3PG7A 5DHFB 1IPGA 5JHGA 2MBQA 4JLCA 2KLCA 2DKQA 2UWQA 4DHZE 4F7HA 1MK7B 1W1GA 5J18A 3V6CB 3T06A 4F8CB 3U7DA 3D8EA 2LOZA 1WGHA 2MW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJP B;  2LRU A;  3JYU A;  1WGU A;  2GBR A;  2IYB A;  3DVG X;  3I3T B;  4GMV A;  3KYC D;  3M63 B;  4GGQ A;  1R4M I;  4RMA A;  3AU5 A;  2L3Z A;  2QKM A;  4AJY B;  5DHA B;  1V2Y A;  3KRW A;  4HB3 B;  2G4S A;  2KDE B;  3PSE B;  5D3W A;  1AAR A;  1U27 A;  3L0W B;  1TQZ A;  4WJQ A;  3ZNI D;  2L2I A;  4HB0 B;  2IO0 B;  2LYD A;  2G3Q B;  1X1F A;  1V5M A;  1WH3 A;  3P2B A;  2K25 A;  1UEL A;  3JSV A;  3K9P B;  1K8R B;  2YS5 A;  1EF1 A;  4B6H A;  2AWT A;  3ODX A;  2RNR B;  4DX8 A;  1XX0 A;  1OEY A;  1YQB A;  2O2V A;  3RZF A;  2COF A;  1VCB A;  3LJ3 A;  4FJY A;  1FHX A;  2PJH A;  1WVH A;  4JL9 A;  3SHQ A;  3X23 A;  2MLB A;  4DBG A;  1BTN A;  2LGX A;  1JRU A;  2RVB B;  3VHT C;  1S1Q B;  1MKE A;  2JRH A;  2V1Y A;  2K6D B;  1WJ4 A;  2DZK A;  1P3R A;  2KXJ A;  2KD0 A;  1XR0 B;  3JVZ X;  3NOB A;  4CO7 A;  2LGY A;  1V86 A;  2ZPY A;  2NS5 A;  4B95 A;  3X0W A;  2YVC A;  4K17 A;  5GMV A;  3V61 A;  2WX0 A;  3PRZ A;  4NSW A;  4D0N B;  2KJH B;  2AL6 A;  2KVR A;  4K81 A;  1K5D B;  1SE9 A;  2R0D A;  1NVL A;  1WGY A;  2DX5 A;  2KCJ A;  2M38 A;  3KZ1 A;  1OY2 A;  2X18 A;  1MIX A;  1EUV B;  2BF8 B;  3DBS A;  3PLV A;  3V60 A;  2JXX A;  3D8D A;  2LVQ A;  4EUT A;  1PMS A;  1BAK A;  4CHJ A;  2YT1 A;  1UBI A;  5AEK B;  1WR6 E;  4ICV A;  1I42 A;  1MK9 B;  2KGX B;  2KLG A;  3TL5 A;  1OQY A;  2M1M A;  3KW5 B;  3RCP A;  2KMC A;  3P7Z A;  3H6N A;  2OJR A;  5DPT A;  4MK0 A;  2RSU A;  4DHJ D;  5DCN A;  2D9Y A;  3SU8 X;  2OQB A;  2YS3 A;  2DAJ A;  3QJZ A;  2NPT B;  3PVL A;  2G45 B;  1V6E A;  1ZW7 A;  3RZW C;  2DAF A;  4G0N B;  3Q3F A;  1NTI A;  4BBK A;  3RD2 A;  3KYD D;  1SHC A;  3RYT A;  1MPH A;  4H8S A;  2LGD A;  2ROZ B;  4DX9 0;  3ZVV A;  5D94 A;  1KLV A;  2EKE C;  2IFS A;  2DHZ A;  2P8V A;  2LI5 A;  4KV2 A;  2C9W B;  4A6H A;  5HE3 A;  4EMO A;  2KQ7 A;  5KQ4 A;  3ONS A;  1M7E A;  5D3X A;  3QWM A;  2RGF A;  1E8W A;  2HD5 B;  3WIM A;  3DCG A;  4PYU A;  2UZR A;  4EEW A;  1RAX A;  4M8M A;  3KY9 A;  1NBF C;  3PGE A;  5IJM A;  2G35 A;  4GB9 A;  1BWN A;  4FJV B;  5EFX A;  2LXC A;  1Z87 A;  2NBW B;  4MGI E;  4K2P A;  3HM6 X;  1LXD A;  1WJN A;  1ZC3 B;  4BKT A;  4GSW A;  2FCS A;  3QX1 A;  4ANV A;  4IWO A;  2MA9 B;  2PZ1 A;  1WF9 A;  2GBN A;  2MX2 A;  4WWO A;  3JW0 X;  1GC6 A;  3ULC A;  2L8J A;  2MP2 A;  2Z0D B;  2KK8 A;  2ZCC A;  1WGR A;  4NJ7 A;  2ZZP B;  1V80 A;  1U5E A;  2DHI A;  2WWZ A;  4IC7 B;  4IM2 A;  4I6N B;  3TVV A;  3S2A A;  3L10 B;  3HM3 A;  4J6I A;  2M8S A;  4HCN B;  1WE7 A;  4GDL B;  3A9K B;  2ZJD A;  1PLS A;  1UZX B;  2ABD A;  2NPT A;  3NY5 A;  1P6S A;  2LXA A;  3DPD A;  3FSS A;  2GBK A;  2JWZ A;  3UIN B;  1SGH A;  4TQ0 A;  1HE8 A;  3F5R A;  4AJW A;  3T8M A;  5DI9 B;  2ADZ A;  2K8B A;  3VTV A;  2CY4 A;  2OOB B;  1P1A A;  2KFK A;  4PS3 A;  2K1F A;  2FAZ A;  3M95 A;  1PFJ A;  3GZN I;  1OMW A;  2ELA A;  4HB2 B;  3H1U A;  2D07 B;  3K9O B;  4HPM B;  5J3Y A;  1E8Y A;  3QWZ B;  2CB8 A;  4K1R B;  3U30 A;  3ZNH B;  4LDT D;  3UQB A;  5CX3 A;  4BOZ B;  2ZNV C;  5CHF A;  3SNH A;  2RD0 A;  4HB4 B;  5CLQ B;  4HLE A;  2NZ8 B;  1V88 A;  4A3P A;  2KUP A;  4BBN F;  3F0W A;  1X1M A;  3L54 A;  1QC6 A;  4ANX A;  4HK2 A;  4NQK E;  3SD5 A;  5DIF B;  3TFM A;  4BKG A;  1A5R A;  3FLV A;  1AQC A;  1ZM0 A;  3MTN B;  2ZNV B;  4KDI C;  1YIW A;  4DDG D;  4MGY E;  2XK5 A;  1V9J A;  3MJW A;  4HXD A;  2LWP A;  1WXM A;  3GOE A;  4ICU A;  2VRW B;  1KJT A;  3A98 B;  4PNK A;  1UPQ A;  2COA A;  2FCN A;  4B6W A;  2CQU A;  5J17 A;  2L05 A;  1D3Z A;  3AXC A;  2GJY A;  2ZCB A;  1Y19 B;  5J3T A;  1WYW B;  2A4Z A;  2M0X A;  1OTR B;  2MBB B;  1WG7 A;  2LUL A;  2JUO A;  4HCP B;  1FB8 A;  2D9Z A;  3CSF A;  5KHQ A;  3W1Y A;  3VFK A;  3APD A;  2MBO A;  2N9E B;  1FHW A;  2R2O A;  4KSK C;  1EF5 A;  4Z2M B;  1H4R A;  4K2O A;  2ZEQ A;  2DLW A;  4MY6 A;  4EJN A;  1Z2M A;  1KZ7 A;  2KZR A;  2D11 A;  2Z59 B;  5HE1 A;  3QHT A;  1TGZ B;  2MKR A;  2D9V A;  3FP5 A;  1M7R A;  2NBU A;  3OJ3 A;  1RJ2 A;  5D3V A;  4DDI D;  4HAT B;  1V89 A;  2DX1 A;  1RRB A;  1X05 A;  1CMX B;  1UD7 A;  1ZVR A;  4GZU A;  1WZ0 A;  2CHW A;  2KFK B;  2KJ6 A;  2KWC A;  1HBK A;  2J0K A;  3DXE A;  2LVO A;  4WVF B;  2LVP A;  4XZ4 A;  3QC8 B;  3EC8 A;  2RSG A;  4HAU B;  4XWX A;  3PLU A;  1OEY J;  1ISN A;  5C6R A;  3A9K A;  3BY4 B;  2KNB A;  1U29 A;  2NCN A;  2K8C A;  2WX1 A;  1OGW A;  4KDL B;  3C0R B;  5AZF A;  3AI5 A;  2V3S A;  3L16 A;  4FLH A;  1FGY A;  2LJ5 A;  4HJK A;  4A20 A;  2IY0 B;  4GIV A;  1ZC4 B;  1F9J A;  4OVU A;  4KHO A;  4A6F A;  2Y8F A;  2CKH B;  2KC1 A;  4F1S A;  3TBL D;  1WE6 A;  1LFD A;  2DYB A;  1HB6 A;  5JLJ B;  3EPY A;  2EC1 A;  2N7E A;  1XD4 A;  2Z0Q A;  5LOP B;  1NU2 A;  2FJL A;  5TR5 A;  5LXH A;  2QHO A;  2C7H A;  2KOX A;  1YD8 U;  2COD A;  2C5L C;  4IAP A;  1DDM A;  2PE6 B;  3PPA A;  4WJO A;  3O65 B;  2M4N A;  4W9D A;  2EMT A;  2MWS B;  2IY1 B;  2D9X A;  1NDD A;  2IO3 B;  1WXA A;  2LAS A;  2VSZ A;  3VTU A;  2CHZ A;  1UNQ A;  5J3Q A;  3B1L X;  2PPH A;  4BKS A;  2FJ9 A;  4W9C A;  3VDZ A;  3A8P A;  2LD9 A;  3ZUN A;  3HHM A;  2MDX A;  2RLO A;  4F7Z A;  3DXD A;  2FDQ A;  3LDZ E;  3PRE A;  3ML9 A;  1Q1O A;  2HTH B;  2CAY A;  5JHH A;  1V81 A;  4ZYN A;  2BPS A;  1J19 A;  4IW0 A;  2AEH A;  4M8N A;  3OAW A;  4FN2 A;  2FNJ B;  2W2X D;  2DZI A;  4MGZ E;  4DK5 A;  3QK0 A;  3M62 B;  4HAV B;  4HHV A;  4IG7 B;  3PP2 A;  2MBE A;  2N1W A;  1M94 A;  3UGB B;  2RUK B;  1S3S G;  2DYM A;  2N9X A;  5L83 A;  4L6E A;  1WGQ A;  4F7G A;  1WJ6 A;  3SUZ A;  3WAO A;  3FM8 C;  5C23 A;  2LG1 A;  2W2X C;  4MT7 A;  2Z0E B;  5LXI B;  2MBH A;  2YSZ A;  2GCJ A;  2O6V B;  1ZSQ A;  1XQQ A;  4I6P A;  2KTR B;  4URK A;  3A4S C;  2CHX A;  4AP4 C;  4ZRK A;  2CU1 A;  3EHV A;  1I7A A;  3KUC B;  2YLM A;  2N7D A;  5KCV A;  2MP2 B;  4TUU A;  3KVF B;  1UNP A;  4KSL C;  3HQC A;  3KUZ A;  4DHZ B;  1XT9 B;  3DDC B;  2D9W A;  3APF A;  2ZVN A;  3QAQ A;  3ODW A;  4WJP A;  3VQI A;  2VKI A;  3ZO5 B;  4FA6 A;  2KTF A;  2PE9 A;  1X86 A;  2Y7B A;  1WRD B;  3TO1 A;  5KQ1 A;  4GDL A;  2ELB A;  3H7S A;  4HWI B;  3VUY A;  4N9F 4;  2CY5 A;  2NBV B;  3A1Q A;  4LCD E;  2GCL A;  2P0D A;  4KZ0 A;  4FAD A;  5IA7 A;  2K2U A;  2I1J A;  1NTY A;  1BT0 A;  4E74 A;  3IFW B;  2KN5 A;  1YJ1 A;  4E71 A;  2I5C A;  1UEF A;  2YRY A;  1LM8 B;  4KIK B;  3RUI B;  3R7R A;  1P3Q U;  3KSY A;  1H10 A;  3UZT A;  1XD3 B;  4W9H A;  4PYZ A;  5JHB A;  3PVW A;  2KQS A;  3CXB B;  4WJ7 A;  3CIK A;  1T0Y A;  1H8C A;  3CF6 E;  3NSU A;  1Q5W B;  4TV3 A;  1Q67 A;  3GYO A;  2JF5 A;  3IG3 A;  5JZE B;  2N0Y A;  3TMP B;  1LQB A;  4CHK A;  1U4A A;  5DPW A;  5CHW A;  3A8Q A;  3D8F A;  4EZK A;  5G2N A;  2HRJ A;  4CHM A;  3D32 A;  5FI1 A;  3IVF A;  5D7G A;  3RT3 B;  1WJU A;  3W1S A;  2C60 A;  1ACA A;  2K2J A;  1HB8 A;  2HTH A;  2M14 A;  1UH6 A;  2KC2 A;  2XBB C;  2O6V A;  4GOC A;  4B9K A;  3BIN A;  4G50 A;  3PVU A;  1ST7 A;  2BYE A;  3H7P B;  2L0T A;  1DDW A;  4CYE A;  2KMA A;  3N30 A;  1NI2 A;  2KTR A;  4GU2 A;  5D3Y A;  1ZGU B;  4EZL A;  5C16 A;  2XK5 B;  2CRF A;  1V49 A;  3ALB A;  2N1V A;  4WAA A;  5CTR C;  4FBJ B;  5JH5 C;  4ZRI A;  4II3 B;  4OVV A;  2DA0 A;  3BJI A;  4E3C A;  1U2B A;  2IO1 B;  2LKO A;  3KH0 A;  1IP9 A;  4M0W B;  4DWF A;  2MWN B;  1XKE A;  5FI0 A;  3PHW B;  3Q3J A;  1QQG A;  4GDK A;  1WGG A;  3DOW A;  4MSQ B;  3ZIM A;  2IBI B;  3RUL A;  2AL3 A;  2ZVO A;  5D27 A;  2J59 M;  1WXV A;  2G4D B;  2C7M B;  2L7R A;  4II2 B;  3P6A A;  4PS7 A;  3ZTC A;  4IFS A;  3PS6 A;  2P0F A;  3DVG Y;  3VH4 B;  2GOW A;  1W1D A;  2D10 A;  2EMS A;  2DN6 A;  2JP2 A;  2BWE S;  4MGK E;  1YX5 B;  2RQ1 A;  1B55 A;  1EGX A;  3AU4 A;  2KWU B;  3OJ4 B;  5E6O A;  2N4F A;  4TYZ A;  2J0M A;  3UIP B;  2LUE A;  3ZDM C;  1WX9 A;  5LON B;  2RPQ A;  4BOS C;  1C3T A;  3U8Z A;  3NZU A;  4PQ0 A;  3QBV B;  4DHJ B;  3A1Q B;  5E6P A;  2NMB A;  3KUD B;  1TXD A;  1E7U A;  4MM3 A;  3LJU X;  5DH9 B;  3PRM B;  4MJS A;  2D2Q A;  5J2R A;  1FGZ A;  1Y8R C;  4KIK A;  2DYN A;  4NPN A;  2Z0P A;  3VIA A;  3SO6 A;  3H7P A;  3V62 A;  3ZRF A;  4ZRJ A;  3VUW A;  4A6F B;  2FUH B;  3UF8 A;  2IZV B;  2KX3 A;  1RFA A;  4W9L A;  4K7W A;  2ASQ A;  2BKF A;  2FCM A;  1L2N A;  1IRS A;  2AYO B;  1AWE A;  2YS1 A;  4KZC A;  2GBJ A;  2A5U A;  3DXC A;  3WYF B;  5L81 A;  2MSE D;  2CR5 A;  1MIZ B;  5E6N A;  4ASW C;  1UPR A;  3SV1 A;  1MG8 A;  4GDK B;  1LW3 A;  3H9D A;  3PT2 B;  3PSC A;  1E5W A;  2DKP A;  4IOY X;  3DVN U;  3L17 A;  3WAP A;  2NR2 A;  2KAN A;  1E7V A;  1WZ3 A;  3R66 C;  3ML4 A;  1DYN A;  3PRP B;  4NAW B;  1C1Y B;  1GUA B;  1P98 A;  1FHO A;  2WDT B;  1WR1 A;  2J7Q B;  1DRO A;  1WI1 A;  4MJS B;  1EVH A;  3PEG A;  3DQV A;  3VUX A;  3QIJ A;  1WI0 A;  2W2W A;  2H7D A;  2GMI C;  3WAL A;  5CLL B;  3WA0 A;  2COP A;  1SIF A;  4FJZ A;  4NJ6 A;  4IM0 A;  4RM9 A;  3R7Q A;  1TZ1 A;  2COC A;  3V5W A;  1P9D U;  1WXS A;  2KHW B;  2XEW A;  3MHS D;  4IWQ A;  4MEM A;  4FHK A;  4WJN A;  4BBN C;  4MEL A;  1E8Z A;  4YON A;  1UBQ A;  1V5P A;  4K7U A;  5FR6 A;  2XQN M;  4I6L B;  3MPX A;  5C79 A;  4KHB B;  2BGF A;  1WMH B;  2VRR B;  3ZTD A;  2MW5 A;  1W1H A;  4RM8 A;  3ZKJ C;  2C7N B;  5D6J B;  4KAX B;  5DPR A;  2M17 A;  1FOE A;  2K6Q A;  3B08 A;  4TKN A;  2JZZ A;  4AWJ A;  1G6J A;  3A9J B;  2HJ8 A;  2YT0 A;  4KHA A;  2UYZ B;  3IBE A;  2JRI B;  4C0A A;  2B3A A;  1DBH A;  1WFY A;  3G9W A;  1Z5S B;  1R4N I;  2V76 A;  3CST A;  3EFU A;  1KI1 B;  4HAZ B;  4WQO B;  3HIZ A;  4WWN A;  3VXW A;  2MRP A;  3TIX A;  5GOW B;  4A5K A;  2BKR B;  1X1G A;  2J0J A;  5DPS A;  4A6K A;  1E90 A;  2KO3 A;  2MQJ A;  2DYO A;  1P0R A;  1WM2 A;  4LDT B;  2IYD B;  3WAN A;  3VH3 B;  4HAW B;  1Y5O A;  4ZDV A;  2DYQ A;  1WGD A;  4YL8 A;  1WIA A;  4BFR A;  1V5O A;  1N3H A;  1XCG A;  4DBB A;  2JPH A;  3PZD A;  4FHJ A;  4FUL A;  3NS8 A;  3ODO A;  1K5G B;  3AJ4 A;  5HE2 A;  4GN1 A;  2L0F A;  2I1K A;  4NAW A;  4IWP A;  5D2M B;  2KFJ A;  4BVU C;  3ZNZ B;  2DFK A;  3N3K B;  4X57 B;  2W9N A;  5C1Z A;  3N7C A;  3CMM B;  3PHX B;  3PTF C;  5C5B B;  3WAM A;  2FID A;  5IAA C;  1X11 A;  4HAY B;  1RRP B;  3M3J A;  4XC2 A;  2DX5 B;  2KDI A;  4W9K A;  3QCA A;  5JP4 A;  2REX A;  1RLF A;  4NQL B;  1PQS A;  3TJP A;  3MDB C;  1WJ1 A;  5KHO A;  3T9L A;  1GG3 A;  2QKL A;  3A4R A;  3ZLZ A;  5JHA A;  2DHJ A;  2BWF A;  3DBL I;  1DDV A;  3ZRC A;  4IUM B;  1V5T A;  3HK0 A;  2Y8G A;  2WH5 A;  3ZVR A;  2BYF A;  3ZDT A;  2LZ6 A;  3O96 A;  2Z0O A;  4GMX B;  4HPL B;  1J0W A;  3DBR I;  2RR9 A;  4A3O A;  2PEA A;  2V4L A;  2DZM A;  1V5U A;  2ZPN A;  1WJM A;  3EEC A;  3R3M A;  1NTV A;  4JQW C;  4MSM B;  3B0A A;  4AUQ C;  2JZ3 B;  2RGN B;  5BO4 B;  2MFQ A;  3VAW A;  4PS8 A;  1EAZ A;  3OAN A;  1Q0W B;  1WY8 A;  3ML8 A;  4W9J A;  1UNR A;  2I5F A;  4HAX B;  2JY6 A;  5C5B A;  1FAO A;  1I2H A;  2R2Q A;  4G3X B;  1WMH A;  4G11 A;  2ROV A;  4JIO U;  1J0G A;  3VTW A;  2E2X A;  1UGM A;  1FXT B;  4EKU A;  4GXB A;  3TW1 A;  2JVC A;  2KWV B;  4AOF A;  3QAR A;  3NHE B;  1LB1 A;  2YF0 A;  2LRW A;  3QA8 A;  2K39 A;  3A33 B;  3NZS A;  4HDQ A;  3IHP C;  4ANU A;  3A9J A;  4WWP A;  2L1C A;  2FCQ A;  3HW2 B;  2OTX A;  1E8X A;  1WM3 A;  3ECI A;  4HVB A;  2UVM A;  2K00 A;  3M1I B;  3FEH A;  1WX8 A;  4IM3 A;  4P7I A;  4LJO B;  2P0H A;  4NY0 A;  4WSF A;  1VD2 A;  2KX0 A;  3APC A;  3DVN V;  3RCZ A;  5CHV C;  1IYF A;  2LOX A;  1GJZ A;  2CS4 A;  5LLI A;  3PV1 A;  2K8H A;  2WYQ A;  1U5D A;  3L13 A;  2D3G A;  4W9G A;  1EO6 A;  1P5T A;  4NNJ B;  3JSV B;  4JGH B;  1I35 A;  2L76 A;  4W9F A;  2FIF A;  3UIO B;  3ENE A;  2D4Q A;  3OLM D;  3L08 A;  4DXA B;  3UQA A;  2DHK A;  1KOT A;  2GBM A;  2O2V B;  3V6E B;  2HE7 A;  1XOD A;  2R09 A;  5HE0 A;  2Q13 A;  1TTN A;  1MAI A;  1KM7 A;  4EZJ A;  2JT4 B;  2KDF B;  1WX7 A;  5L95 C;  4W9E A;  3PG7 A;  5DHF B;  1KZG A;  1OQN A;  1IPG A;  3ZNG C;  2NVU I;  1BTK A;  2KDB A;  3N32 A;  2BYV E;  4XX5 A;  4K7S A;  5JHG A;  2MBQ A;  3DBH I;  4BKS D;  2UZS A;  4ANW A;  4EOY A;  4JLC A;  2MCN B;  1TBE A;  2BCJ A;  2N9P C;  2DZJ A;  4Z2N A;  2DKQ A;  2KLC A;  4MH0 E;  1J8C A;  2UWQ A;  2LBB A;  4F7H A;  1TJ6 A;  2KKC A;  2GS0 A;  4DHZ E;  4Y94 A;  5AZG A;  3KRX A;  1MK7 B;  1YX6 B;  4EFO A;  1W1G A;  4KVG B;  4TQ1 A;  3VVW B;  5J18 A;  2N23 A;  3SYX A;  2IO2 B;  3VOQ A;  3GYP A;  1L7Y A;  1ZKH A;  2L00 B;  3W1S C;  2DEN B;  3V6C B;  3T06 A;  1QZE A;  4F8C B;  3ZW3 A;  2H7E A;  3AUL A;  1U5G A;  3QQ8 B;  4HDO A;  5EDS A;  3ULB A;  3U7D A;  4F7U P;  1V61 A;  2LOZ A;  3D8E A;  2KJR A;  2O6V D;  1GC7 A;  4W9I A;  5HKH A;  4GPT B;  1WGH A;  5AZH A;  2Y5B B;  2EJ8 A;  2DTC A;  1U5F A;  1GNU A;  3TCA A;  3SDL C;  5G55 A;  4MDK E; 
#chains in the Genus database with same CATH topology
 2BTE A;  1WGU A;  3DVG X;  1D5X C;  1R4M I;  4JWU C;  1AAR A;  3ZNI D;  1TQZ A;  2L2I A;  1V5M A;  5HG2 A;  3K9P B;  3EFC A;  5LNK 1;  1EF1 A;  4B6H A;  3WCQ A;  2RNR B;  1F1H A;  2PJH A;  1UWM A;  3PZ8 A;  3RNB C;  3NVV A;  1P3R A;  1XR0 B;  2LGY A;  2J53 A;  1FXA A;  4XDD A;  2YVC A;  4L2Y A;  2AL6 A;  4K81 A;  2R0D A;  3DBS A;  2JXX A;  3D8D A;  3RPF C;  1BAK A;  1UBI A;  1FM0 D;  1WR6 E;  1I42 A;  2LGS A;  2IJ0 A;  1ZP0 B;  3N20 C;  1C4A A;  4MK0 A;  2RSU A;  2YS3 A;  2K0P A;  1FNW A;  1V6E A;  2FUG 1;  3AMZ A;  3RZW C;  2DAF A;  4G0N B;  1NTI A;  4BBK A;  1SHC A;  4P1C C;  3DHG C;  1MPH A;  4QJ3 B;  3ZVV A;  4US8 A;  2IFS A;  1L0V B;  2BB6 A;  2LI5 A;  4A6H A;  1FEH A;  1M7E A;  2RGF A;  4XYC A;  3URY A;  4ILH A;  5IO9 A;  5IJM A;  4RFB A;  1K53 A;  2KIG A;  2NBW B;  4MGI E;  4K2P A;  1ZC3 B;  4BKT A;  5HI1 A;  2MX2 A;  4JK8 A;  1WF9 A;  2GBN A;  2Z59 A;  4D6W A;  4C4V B;  2L8J A;  1JWM D;  3AEF B;  2WWZ A;  1I4R A;  4IM2 A;  3TVV A;  4JKG B;  3ZGZ A;  2L83 A;  3AM9 A;  4J6I A;  2M8S A;  2NPT A;  3P4R B;  5EE9 A;  2JWZ A;  4P16 A;  5DI9 B;  2KN4 A;  1TJE A;  2IND C;  2FJU B;  1OMW A;  2ELA A;  2D07 B;  3K9O B;  2CB8 A;  2J4X A;  4LDT D;  1PGA A;  4KX6 B;  5CHF A;  1V88 A;  2KUP A;  2WXG A;  3FIL A;  4BKG A;  3I5J C;  2YEP F;  4DDG D;  3MJW A;  1V9J A;  2AQ3 B;  2VRW B;  1KJT A;  3BK1 A;  1D3Z A;  2FCN A;  2L05 A;  3AXC A;  4HCP B;  2M0X A;  1WG7 A;  2QC8 A;  3CSF A;  2N9L A;  3OWE B;  1TS3 A;  3VFK A;  2R2O A;  1FHW A;  1EF5 A;  4Z2M B;  2KZR A;  1ZPS A;  2D11 A;  4RGM A;  4JX1 C;  5CX3 A;  3FP5 A;  4N6E B;  5D3V A;  2BW2 A;  1J7C A;  4HAT B;  1WZ0 A;  3E56 A;  3FIL B;  1X05 A;  2CHW A;  5BYQ A;  1ZVR A;  2KWC A;  1HBK A;  2J0K A;  2LVP A;  3E9L A;  3QC8 B;  2RSG A;  4HAU B;  3BY4 B;  3W9C B;  4LNF A;  5AZF A;  4FLH A;  3NW8 A;  2IY0 B;  4GIV A;  4OVU A;  4A6F A;  2KC1 A;  5FKA C;  2DYB A;  2N7E A;  2EC1 A;  5LXH A;  5LOP B;  2Z0Q A;  5TR5 A;  3FC4 A;  2FJL A;  2IGD A;  3AE9 B;  1SJH D;  2H88 B;  2QHO A;  3Q3O C;  1YD8 U;  2WNM A;  4WJO A;  1V1O A;  2MWS B;  2LAS A;  3AEE B;  1UNQ A;  3TUO A;  3B1L X;  3SEB A;  1BUI C;  3VDZ A;  4JKD A;  1FMA D;  2HTH B;  4IOI E;  1J19 A;  4M8N A;  2FNJ B;  4MGZ E;  3QK0 A;  4HAV B;  2W55 A;  2RUK B;  2G1E A;  1S3S G;  5L83 A;  4L6E A;  2JYT A;  4F7G A;  2WXN A;  2W2X C;  2Z0E B;  1P7E A;  4A6Q A;  2LHE A;  1FFU A;  1I4H A;  3B77 A;  4ILG B;  2CHX A;  3A4S C;  4AP4 C;  1T3Q A;  1MHX A;  2LEK A;  4TUU A;  3BYT B;  2PIA A;  4KSL C;  3HQC A;  3Q8A A;  2WP9 B;  3DDC B;  2ZVN A;  3VQI A;  3ODW A;  3ZO5 B;  3VRA B;  2Y7B A;  2KAJ A;  2W82 A;  4NZL B;  4HWI B;  3H7S A;  3VUY A;  2V3N A;  4LCD E;  1FRR A;  3A1Q A;  2GCL A;  4KZ0 A;  4ZOH C;  1YJ1 A;  1LM8 B;  1UEF A;  2INC C;  3R7R A;  1H10 A;  4M0W A;  5JHB A;  3PVW A;  1T0Y A;  4Q2J A;  2JF5 A;  3TMP B;  1LQB A;  2HRJ A;  4CHM A;  3D32 A;  2K49 A;  1WJU A;  2M0A A;  2HTH A;  1ACA A;  2M14 A;  2O6V A;  3H7P B;  4CYE A;  1ZGU B;  5C16 A;  1RM6 C;  2IO1 B;  3KH0 A;  4M0W B;  5FI0 A;  3BVG A;  4GDK A;  1WGG A;  3DOW A;  2ZVO A;  3GB1 A;  2SAK A;  2RDB C;  1HA5 A;  4II2 B;  2ONQ A;  5GXG B;  3P6A A;  1EU4 A;  1JWS D;  3PS6 A;  4USA A;  4C7Z A;  1DOY A;  1GPX A;  3P4S B;  1NVI D;  3AEB B;  2EEL A;  2LUE A;  1C3T A;  1HEZ E;  3QBV B;  3KUD B;  1FPY A;  5TSS A;  4MJS A;  1XO3 A;  3VIA A;  1R7S A;  2FUH B;  2IZV B;  1RFA A;  4K7W A;  2BKF A;  1VBG A;  1IRS A;  2GBJ A;  4YXD B;  1L4D B;  3DXC A;  3DBR B;  2DKP A;  1VLB A;  5I4D A;  2NMQ A;  1DYN A;  1P98 A;  1WR1 A;  1DRO A;  1WI1 A;  4MJS B;  1WI0 A;  1FIQ A;  1SIF A;  3R7Q A;  3R2T A;  4FJZ A;  4NJ6 A;  5G5G A;  2XEW A;  3MHS D;  4WJN A;  4WUR A;  3MPX A;  1W1H A;  5D6J B;  1PGB A;  1FOE A;  1KC7 A;  2E6X A;  3B08 A;  4TKN A;  2JZZ A;  4AWJ A;  2HJ8 A;  2JRI B;  1ZXI A;  1DBH A;  2WQY B;  1R4N I;  2Q5W D;  3HIZ A;  3ZXV A;  2KUQ A;  2BKR B;  4KGS A;  3NWD A;  4A6K A;  1WM2 A;  2QJL A;  3P42 A;  4HAW B;  1Y5O A;  5AUI A;  1GB1 A;  1WGD A;  3C19 A;  2BS2 B;  4BFR A;  4FHJ A;  2JPH A;  4FUL A;  3AJ4 A;  4GN1 A;  5D2M B;  3KWL A;  4BVU C;  3N7C A;  3CMM B;  4OT1 A;  3Q14 C;  4LNN A;  3QCA A;  1WJ1 A;  3J9C A;  2BS4 B;  2BWF A;  2FBW B;  3DBL I;  2LZ6 A;  2WH5 A;  5JXV A;  3O96 A;  3DBR I;  4A3O A;  1WJM A;  3EEC A;  4MSM B;  2RGN B;  5BO4 B;  3V3X A;  3VAW A;  1EAZ A;  5DPS A;  4W9J A;  2R2Q A;  2JY6 A;  1FAO A;  1XLP A;  2LGI A;  2E2X A;  1FXT B;  4EKU A;  4GXB A;  4DIX A;  1OQR A;  1XLQ A;  2WDV B;  4RCO A;  2LRW A;  2WLB A;  4ILJ A;  2K39 A;  3A33 B;  4M01 A;  3A9J A;  4WWP A;  1TKG A;  2KT7 A;  1C77 A;  3FEH A;  2VH1 A;  1WX8 A;  1ZYI A;  1QT9 A;  3DVN V;  3APC A;  2K8H A;  1U5D A;  2QSD A;  3UIO B;  2INP E;  3ENE A;  4ZHP A;  4O1N A;  2HE7 A;  2Q13 A;  4OZA A;  2JT4 B;  1WX7 A;  4W9E A;  1OQN A;  1UF0 A;  3ZNG C;  1KRH A;  2SEB D;  3N32 A;  3VR9 B;  4XX5 A;  4K7S A;  3DBH I;  2UZS A;  4EOY A;  2BCJ A;  4MH0 E;  4Z2N A;  2VH2 A;  2KKC A;  1TJ6 A;  2ACZ B;  2GS0 A;  1I4P A;  5AZG A;  4HJG E;  1YX6 B;  4KVG B;  4TQ1 A;  2N23 A;  3SYX A;  1GAQ B;  2L00 B;  1ZKH A;  2W54 A;  1QZE A;  2H7E A;  5IOI A;  4F7U P;  2WHI A;  2IGG A;  1U5F A;  1GNU A;  3TCA A;  4HKQ A;  5G55 A;  4MDK E;  2LRU A;  3I3T B;  2GBR A;  2IYB A;  3M63 B;  4GGQ A;  4GMV A;  1IGC A;  2CJN A;  4JK7 A;  3NUH B;  2Z13 A;  4AJY B;  5DHA B;  1V2Y A;  4HB3 B;  2KDE B;  5D3W A;  1UGJ A;  4HB0 B;  2IO0 B;  2L1A A;  2AWT A;  1OEY A;  1XX0 A;  3RZF A;  4FJY A;  1FO4 A;  4JL9 A;  3X23 A;  1BTN A;  2RVB B;  1MKE A;  2V1Y A;  4CO7 A;  1ZXH A;  1CJE A;  2D3B A;  1L0Y B;  4K17 A;  2WX0 A;  3PRZ A;  4NSW A;  4D0N B;  2PVG C;  1KTK A;  2M38 A;  3V60 A;  1OY2 A;  4EUT A;  1F2R I;  3SFE B;  3N1Y C;  1MK9 B;  1YN3 A;  1Y56 A;  3KW5 B;  4DHJ D;  3UI3 A;  5IKC M;  1TS4 A;  3SU8 X;  1WXQ A;  2NPT B;  3ZJU A;  3RYT A;  4RGO S;  1YJI A;  4H8S A;  2ROZ B;  4IKG A;  5D94 A;  1N62 A;  1KLV A;  1T77 A;  4C80 A;  2C9W B;  5HE3 A;  2RPV A;  3ONS A;  2V9H A;  4JKF A;  4EEW A;  2G35 A;  4GB9 A;  1F0Z A;  3R2I A;  5EFX A;  1MVK A;  3HM6 X;  1LXD A;  1C76 A;  2BVC A;  2FCS A;  4ANV A;  2PZ1 A;  1ET9 A;  4WWO A;  1GC6 A;  4B0E A;  2N0S B;  1YN4 A;  1U5E A;  2DHI A;  1FD6 A;  4I6N B;  3S2A A;  3L10 B;  4HCN B;  1PLS A;  2ABD A;  1P6S A;  2LXA A;  3UIN B;  4A8X C;  3ZXR A;  1HE8 A;  1ZDV A;  1TZO A;  3F5R A;  3Q69 A;  2ADZ A;  2JQR B;  4JE3 B;  3GE8 C;  2CY4 A;  2OOB B;  4KGR A;  1P1A A;  4QJ4 B;  2KFK A;  2K1F A;  2FAZ A;  1PFJ A;  3ZNH B;  2I2Y A;  3SNH A;  3TEW A;  4HLE A;  2NZ8 B;  2D3A A;  4A3P A;  1E6E B;  3F0W A;  1QC6 A;  3EUB 2;  4L23 A;  4RF1 A;  4ANX A;  4NQK E;  3SD5 A;  5DIF B;  4FXC A;  4KKI A;  1YIW A;  4J3O D;  3IT4 B;  1L0X B;  3A98 B;  1XCT L;  2CQU A;  3RNE C;  3ZQ4 A;  2GJY A;  1SB3 C;  2ZCB A;  1Y19 B;  5J3T A;  1OTR B;  2LUL A;  1FB8 A;  2RDG A;  1I4Q A;  2L32 A;  2N9E B;  4K2O A;  2ZEQ A;  4BBN F;  2DLW A;  4MY6 A;  1KZ7 A;  1RJ2 A;  1SIJ A;  1RRB A;  4B95 A;  2Y5P A;  4XZ4 A;  1YJJ A;  4XWX A;  1L5P A;  1OEY J;  2FE8 A;  2JYE A;  4KDL B;  2WX1 A;  1OGW A;  5FK9 C;  3AI5 A;  4WWM A;  1FNU A;  4HJK A;  4A20 A;  4QXA B;  4KHO A;  2Y8F A;  2CKH B;  3TBL D;  5JLJ B;  3EPY A;  2JU6 X;  1XD4 A;  1NU2 A;  2KOX A;  2COD A;  2C5L C;  3PPA A;  4WIP A;  2M4N A;  1F52 A;  4YTN B;  2CHZ A;  4BKS A;  2FJ9 A;  1N6Z A;  2LD9 A;  3HHM A;  2RLO A;  4KKJ A;  1Q1O A;  3MC9 A;  4ZYN A;  3IXS A;  1QLB B;  1OQQ A;  4IW0 A;  1HZ5 A;  4IG7 B;  4HHV A;  2UU7 A;  1M94 A;  2N9X A;  1WJ6 A;  3SUZ A;  2LG1 A;  2H89 B;  2Z14 A;  2YSZ A;  1M4V A;  2IPK D;  2O6V B;  1YN5 A;  1XQQ A;  2KTR B;  4URK A;  3EHV A;  1TKY A;  1UNP A;  3KUZ A;  1XF5 L;  3QAQ A;  3APF A;  4WJP A;  2KTF A;  4US9 A;  1AYF A;  2ELB A;  4FAD A;  1PUT A;  1XEE A;  3Q3M C;  2I1J A;  1NTY A;  3DBL B;  3AEA B;  4S0R A;  3RUI B;  4HEA 1;  1P3Q U;  1XD3 B;  3UZT A;  4PYZ A;  3CXB B;  1JDE A;  1KH0 A;  3NSU A;  1Q5W B;  4TV3 A;  3GYO A;  3IG3 A;  3Q6B A;  5HHD G;  1N63 A;  3LB8 C;  1N5W A;  5G2N A;  1RWS A;  4YTM B;  3W1S A;  4GOC A;  3BIN A;  1EM7 A;  5D3Y A;  5MPO A;  2PW9 A;  2XK5 B;  3ALB A;  2N1V A;  4WAA A;  4FBJ B;  4ZRI A;  4E3C A;  1UUP A;  3BJI A;  3Q8F A;  1KF6 B;  1EU3 A;  2V3P A;  2J59 M;  3O13 A;  1F77 A;  3VH4 B;  4EE2 A;  2GOW A;  1W1D A;  2D10 A;  3BK2 A;  4DXG A;  2DN6 A;  2JP2 A;  2MJE A;  1XLN A;  1YX5 B;  2RQ1 A;  4KGT A;  2K3U A;  1EGX A;  3AU4 A;  2KWU B;  5E6O A;  2N4F A;  2K22 A;  3UIP B;  3ZDM C;  2HDE A;  4KHB A;  4PQ0 A;  5BMH A;  4XWT A;  4MM3 A;  5DH9 B;  2KWD A;  3PRM B;  1ZOY B;  1Y8R C;  4KIK A;  2Z0P A;  3SO6 A;  4HRO A;  3V62 A;  3MC8 A;  4W9L A;  2ASQ A;  4WAF A;  1L2N A;  2AYO B;  3AH7 A;  1AWE A;  4KZC A;  2B76 B;  3SBT A;  2MSE D;  2CR5 A;  4ASW C;  1UPR A;  1MG8 A;  4ZYS A;  3PT2 B;  4IOY X;  3WAP A;  2KMM A;  2KAN A;  1E7V A;  3ML4 A;  1JWA D;  1FHO A;  2WDT B;  1EVH A;  3E9S A;  5C3J B;  2OHF A;  2EKI A;  2H7D A;  3WA0 A;  1V97 A;  4HSI A;  4IM0 A;  1TZ1 A;  1WXS A;  1WGK A;  2KHW B;  4GLS C;  4MEL A;  5FR6 A;  4YON A;  1V5P A;  2X8X X;  1NEK B;  1WMH B;  2K5P A;  3ZTD A;  3A58 A;  1XCQ L;  3NWF A;  4RM8 A;  3ZKJ C;  2C7N B;  4KAX B;  2M17 A;  2YEP B;  3C8Y A;  4YT0 B;  1QOG A;  3IBE A;  2B3A A;  4KSK C;  3ZRC A;  3G9W A;  1Z5S B;  2MHJ A;  3EFU A;  5CTR C;  4BKS D;  1KI1 B;  4HAZ B;  4DDI D;  4WWN A;  5GOW B;  4A5K A;  2BS3 B;  2KR0 A;  2J0J A;  2D5G A;  1T6B X;  2MQJ A;  2IYD B;  4YWG G;  2DYQ A;  4YL8 A;  1YQ3 B;  4ITK A;  1XCG A;  3PZD A;  3LYY A;  3NS8 A;  3ODO A;  1K5G B;  1YOV B;  4IWP A;  1QOB A;  1MPE A;  5C5B B;  3WAM A;  2FID A;  5IAA C;  4XC2 A;  3OG5 A;  1SJE D;  3TJP A;  3MDB C;  2W3S A;  1GG3 A;  3ZLZ A;  5JHA A;  1WYG A;  1V8C A;  4IUM B;  3ZVR A;  3NRZ A;  2BYT A;  4GMX B;  1J0W A;  5IP4 D;  2PEA A;  2DZM A;  1V5U A;  4JQW C;  1NTV A;  3B0A A;  1L6U A;  3OAN A;  1UNR A;  4GNK B;  5C5B A;  3HUI A;  1J0G A;  3Q2A C;  3Q8C A;  3N1X C;  4AOF A;  1L6V A;  3IHP C;  1VZ8 A;  2L1C A;  3HW2 B;  4HVB A;  1C4C A;  2K00 A;  2M19 A;  2LFI A;  4IM3 A;  4P7I A;  1HQR D;  4LJO B;  4NJC A;  1IYF A;  5CHV C;  2LOX A;  2ZW0 A;  2CS4 A;  5LLI A;  3VHT C;  2D3G A;  4NNJ B;  3JSV B;  1C79 A;  4JGH B;  1I35 A;  4JK9 A;  2D4Q A;  3L08 A;  2R09 A;  1TTN A;  1TS5 A;  5L95 C;  1KZG A;  2NVU I;  1BTK A;  2KDB A;  5M4Y B;  2BYV E;  2IGH A;  2N9P C;  1TT5 B;  2DZJ A;  1KLU D;  2VZK B;  4Y94 A;  1MFW A;  2L52 A;  3KRX A;  4EFO A;  4JKH A;  2MJD A;  2IO2 B;  1E9M A;  3GYP A;  1L7Y A;  3NWA A;  4UDU C;  3ZW3 A;  3AUL A;  3QQ8 B;  3ULB A;  2O6V D;  1V61 A;  2RMM A;  5AZH A;  2Y5B B;  2EJ8 A;  2GB1 A;  2DTC A;  1B1Z A;  1IGD A;  4LJP B;  2GRI A;  5T8I A;  1DGJ A;  1SE3 A;  2KYW A;  5FR3 A;  1AW7 A;  4LLG M;  1WRI A;  3FVC A;  2G4S A;  3I63 C;  1BML C;  3L0W B;  1U27 A;  2LYD A;  1X1F A;  2Z4D A;  2WU5 B;  3GP7 A;  3P2B A;  3EA6 A;  3JSV A;  1K8R B;  3ODX A;  4DX8 A;  3AEG B;  1VCB A;  1FHX A;  1WVH A;  2R61 A;  3SHQ A;  3KQ4 A;  4LK0 M;  2LGX A;  1JRU A;  1HXY D;  2JRH A;  4ZRP A;  3ABV B;  2DZK A;  2G9H D;  3NOB A;  4A90 A;  3HVZ A;  3AE4 B;  4AQ7 A;  2R82 A;  2ZPY A;  5EE3 A;  3X0W A;  5GMV A;  3V61 A;  1WWT A;  2IDY A;  1VZ7 A;  4HRS A;  1K5D B;  1SE9 A;  3KZ1 A;  2KCJ A;  1EUV B;  1MIX A;  3PLV A;  1E0Z A;  2LVQ A;  5AEK B;  2KGX B;  2QIL A;  1OQY A;  2KMC A;  3P7Z A;  1SEB D;  3H6N A;  2HJ1 A;  5DCN A;  3T3N A;  2D9Y A;  2DAJ A;  4LNI A;  1ZW7 A;  4ZRQ A;  3Q3F A;  2WDR B;  2LGD A;  1J7B A;  2QEJ C;  2V0G A;  4DX9 0;  1JW9 D;  3P63 A;  3I9V 1;  3ENB A;  3E66 A;  1EWY C;  1KFY B;  2P8V A;  1N5X A;  2DHZ A;  3ETR A;  1E8W A;  4PYU A;  1C9F A;  1RAX A;  3OHM B;  4M8M A;  4HPP A;  3KLS X;  4YTP B;  1Z87 A;  1WJN A;  2WXK A;  3H8H A;  3QX1 A;  2WDQ B;  3ULC A;  3TEY A;  2KK8 A;  2ZCC A;  1YMH E;  2WXR A;  2ZZP B;  1V80 A;  2ICI A;  3U52 E;  3HM3 A;  3A9K B;  2ZJD A;  3NY5 A;  3DPD A;  3FSS A;  1SGH A;  2LMC A;  2INN E;  3N9Y C;  1E10 A;  3T8M A;  2BT6 A;  1VR9 A;  4PS3 A;  4B0M A;  3M95 A;  3GZN I;  4HB2 B;  3RNG C;  3H1U A;  3U30 A;  1T0Q C;  1E8Y A;  3QWZ B;  3FKY A;  4K1R B;  3Q8E A;  4BOZ B;  5CLQ B;  1QQR A;  4P6V F;  4OHJ A;  1X1M A;  4RF0 A;  1ACC A;  1PFD A;  1A5R A;  1AQC A;  1ZM0 A;  3AEC B;  2ZNV B;  4MGY E;  2XK5 A;  1TIF A;  2LWP A;  4ICU A;  3RN9 C;  5J17 A;  4PNK A;  1UPQ A;  3BWU D;  2MBB B;  2A4Z A;  2JUO A;  1V1P A;  3W1Y A;  5IN7 A;  2MBO A;  1H4R A;  2Z59 B;  2PMV A;  3PO0 A;  5HE1 A;  3OJ3 A;  2MKR A;  2KJ6 A;  1UD7 A;  1FFV A;  2KFK B;  1GGO A;  2LVO A;  5LG4 B;  4QAY A;  3EC8 A;  4LTU A;  3PLU A;  4XWW A;  3A9K A;  1ISN A;  3B9J A;  2KNB A;  1U29 A;  3SBG A;  3E9P A;  2NCN A;  2K8C A;  3NJT A;  3C0R B;  3L16 A;  3L4P A;  1D4B A;  1FGY A;  2LJ5 A;  1F9J A;  5G5H A;  1LGR A;  4C7Y A;  1WE6 A;  1LFD A;  4AS1 A;  3DBH B;  1L4Z B;  4W9D A;  5J3Q A;  4W9C A;  2NBV A;  1MJD A;  3A8P A;  5I2M A;  3ZUN A;  2MDX A;  2FDQ A;  3LDZ E;  3R8B A;  5JHH A;  1JQ4 A;  2Y3A A;  1T5X D;  2W2X D;  2DZI A;  4DK5 A;  3M62 B;  3UGB B;  3PP2 A;  1ROE A;  2DYM A;  3AE7 B;  1V1P B;  2MH7 A;  1NYQ A;  4MT7 A;  4HKZ E;  2Z8L A;  5LXI B;  2MBH A;  2GCJ A;  4OVZ A;  1ZSQ A;  4I6P A;  1D6E C;  1ESF A;  2WXP A;  3MFG A;  1I7A A;  2YLM A;  3EGR A;  2N7D A;  5KCV A;  2MP2 B;  4RGN A;  4DHZ B;  1NI3 A;  1XT9 B;  3VR8 B;  4FA6 A;  2VKI A;  1X86 A;  1HTQ A;  2J42 A;  5KQ1 A;  4GDL A;  4N9F 4;  4BAX A;  1JML A;  2M56 B;  2K2U A;  5I2S A;  3IFW B;  1AWD A;  4E71 A;  2I5C A;  2YRY A;  1QOF A;  1ZUD 2;  3RNA C;  4D2K A;  5JZE B;  2N0Y A;  3U12 A;  1U4A A;  2WXM A;  5DPW A;  3A8Q A;  4EZK A;  4MM3 B;  5FI1 A;  3IVF A;  5D7G A;  4DXF A;  1HB8 A;  1UH6 A;  2XBB C;  4B9K A;  3MC0 B;  1VZ6 A;  2L0T A;  1NI2 A;  2KTR A;  4GU2 A;  3NVY A;  2CRF A;  2DA0 A;  4WH4 A;  4DWF A;  5EE0 A;  1XKE A;  1UWX A;  3PHW B;  2QMT A;  5D27 A;  1WXV A;  4PS7 A;  4IFS A;  3DVG Y;  1DOI A;  2EMS A;  5D3I B;  1ET6 A;  3LXF A;  1SE2 A;  3HRD D;  3HVD A;  5LON B;  3U8Z A;  3AE2 B;  3NZU A;  4CQN A;  2DBY A;  3A1Q B;  1TXD A;  2TSS A;  3LJU X;  1P7F A;  4OZB A;  2D2Q A;  2DYN A;  3ZRF A;  3DCX A;  1JWB D;  2KX3 A;  3SR6 A;  4GOU A;  2K8E A;  2FCM A;  3TEZ A;  2A5U A;  3WYF B;  5L81 A;  1MIZ B;  1LW3 A;  1T0S C;  3H9D A;  3PSC A;  1E5W A;  3DVN U;  1EWC A;  3L17 A;  4ARC A;  2NR2 A;  1WZ3 A;  3GZN B;  3R66 C;  4NAW B;  1GUA B;  2WXJ A;  2J7Q B;  4LNO A;  1J7A A;  3DQV A;  3VUX A;  3QIJ A;  3SDL C;  3V05 A;  2COC A;  3V5W A;  1C78 A;  4MEM A;  2YT2 A;  2D3C A;  4FHK A;  1E8Z A;  4KHB B;  2BGF A;  1N60 A;  1SF0 A;  5DPR A;  2LHD A;  1D5M C;  3P4P B;  4JKC A;  4OZC A;  1G6J A;  3A9J B;  2YT0 A;  2UYZ B;  1WFY A;  3CST A;  3I57 A;  2V76 A;  1XLO A;  2MRP A;  2WU2 B;  1E90 A;  2KO3 A;  5BYS A;  2DYO A;  3NZ3 A;  4LDT B;  4ZDV A;  1WIA A;  2PLP A;  1V5O A;  1N3H A;  1K51 A;  4OSN A;  5HE2 A;  4MH8 A;  2L0F A;  2I1K A;  2KFJ A;  3VRB B;  3N3K B;  5C1Z A;  2W9N A;  1X11 A;  4HAY B;  1MHH E;  3M3J A;  2K9X A;  4W9K A;  3AE3 B;  5JP4 A;  4NQL B;  1RLF A;  1PQS A;  2BB5 A;  3T9L A;  3A4R A;  1V5T A;  3HK0 A;  2BYF A;  3MJ5 A;  3RI7 C;  4HPL B;  2RR9 A;  1BXT A;  2V4L A;  5BMI A;  3R3M A;  2AX5 A;  3NVW A;  2JZ3 B;  2MFQ A;  1WY8 A;  1Q0W B;  3ML8 A;  4HAX B;  2BBC A;  1C4P A;  1I2H A;  4JIO U;  3VTW A;  2JVC A;  3TW1 A;  4JKB A;  2OJW A;  3NHE B;  1LB1 A;  2YF0 A;  3QA8 A;  4JPS A;  3NZS A;  4HDQ A;  5BMG A;  2KDM A;  2FCQ A;  2OTX A;  1WM3 A;  2WGS A;  3ECI A;  1VBH A;  4P1B C;  1KBL A;  3M1I B;  2N9K A;  2HTM E;  4H2A A;  4IDI A;  4WSF A;  4NY0 A;  2KX0 A;  1GJZ A;  3PV1 A;  3L13 A;  4W9G A;  1P5T A;  4ACF A;  2WS3 B;  3UQA A;  1KOT A;  2O2V B;  3V6E B;  1XOD A;  1MAI A;  3P4Q B;  2VZK D;  3DWG C;  3DHH C;  4ANW A;  3RMK C;  2MCN B;  1TBE A;  1J8C A;  2LBB A;  4TSS A;  3VVW B;  2MEK A;  2WXF A;  3VOQ A;  3W1S C;  1CK1 A;  2DEN B;  1HZ6 A;  3NG0 A;  1U5G A;  5EDS A;  4HDO A;  4CSQ A;  2KJR A;  1STE A;  4W9I A;  1ZDX A;  1GC7 A;  4GPT B;  2V4I B;  4K3C A;  2XNA C;  2X38 A;  4MT5 A;  3JYU A;  4RMA A;  3KYC D;  4L1B A;  4L1R A;  3AU5 A;  2L3Z A;  2QKM A;  3KRW A;  2DWQ A;  3PSE B;  1TY2 A;  3NVZ A;  4WJQ A;  1F2R C;  2G3Q B;  1WH3 A;  3U7Z A;  2K25 A;  1UEL A;  2QDF A;  4N58 A;  2YS5 A;  3HIE A;  4JKE A;  1YQB A;  2O2V A;  2COF A;  3LJ3 A;  2MLB A;  4DBG A;  1VJK A;  1S1Q B;  4NAM A;  3IAS 1;  1K52 A;  2K6D B;  1WJ4 A;  1QKZ A;  2DLB A;  2KXJ A;  2KD0 A;  3JVZ X;  3ZJT A;  1HTO A;  1V86 A;  2NS5 A;  3IT6 B;  2KJH B;  2KVR A;  1NVL A;  1FNV A;  3RFZ B;  1WGY A;  2DX5 A;  2BF8 B;  2X18 A;  1PMS A;  4CHJ A;  2YT1 A;  2KAC A;  4ICV A;  2KLG A;  3TL5 A;  1JWU D;  2M1M A;  3RCP A;  2OJR A;  3DWM A;  2OQB A;  1RYJ A;  3QJZ A;  3PVL A;  2G45 B;  1FCC C;  1SBB B;  2DIK A;  3GS2 A;  3RD2 A;  3KYD D;  4RH6 A;  3HSA A;  2OED A;  2BQQ A;  4C00 A;  2EKE C;  4KV2 A;  2PVO D;  1VDV A;  4EMO A;  2KQ7 A;  5KQ4 A;  3WIM A;  5D3X A;  3QWM A;  2HD5 B;  3BVZ A;  1LO5 D;  3DCG A;  4M02 A;  2UZR A;  3KY9 A;  1NBF C;  3CIR B;  3PGE A;  4TMA B;  2XN9 C;  1BWN A;  4FJV B;  2LXC A;  4DQO C;  3FAH A;  1KLG D;  2I38 A;  4GSW A;  4IWO A;  2QCZ A;  2MA9 B;  5C2T B;  3JW0 X;  1ZE3 D;  1I7H A;  1XXG A;  1ENF A;  1JAL A;  2MP2 A;  2Z0D B;  1WGR A;  4NJ7 A;  4IC7 B;  1WE7 A;  4GDL B;  3P1M A;  1D5Z C;  1UZX B;  2GBK A;  2KQ4 X;  5BYR A;  4TQ0 A;  4AJW A;  1Q10 A;  4R3D A;  2K8B A;  1MI1 A;  3VTV A;  1FXI A;  3Q8B A;  2AQ2 B;  4HPM B;  4S17 A;  3UQB A;  3E9O A;  5J3Y A;  2ZNV C;  2RD0 A;  4HB4 B;  2WXL A;  3AE8 B;  3L54 A;  2WXH A;  4HK2 A;  3TFM A;  3FLV A;  2KIE A;  3B2F A;  3AN1 A;  3MTN B;  3TSS A;  1UNS A;  4KDI C;  1WSP A;  4HXD A;  4C4V A;  1WXM A;  3GOE A;  1RFK A;  4B6W A;  2COA A;  3U4E G;  2NTS A;  3Q3N C;  1WYW B;  2D9Z A;  5KHQ A;  3BZD B;  1FRD A;  3APD A;  4EJN A;  1Z2M A;  3QHT A;  1TGZ B;  2D9V A;  1M7R A;  2NBU A;  1VRA B;  1V89 A;  2DX1 A;  1JRO A;  1CMX B;  2PE6 B;  4GZU A;  5D3D A;  3DXE A;  1NYR A;  4WVF B;  3DHI C;  2RDH A;  5H8Y E;  1IUE A;  5C6R A;  2JWU A;  2V3S A;  1GOZ A;  1E7P B;  2ZKM X;  1ZC4 B;  4F1S A;  5IRS A;  1CZP A;  1YNT E;  1HB6 A;  5DPT A;  3AE6 B;  3TEX A;  4RNA A;  2C7H A;  4IAP A;  1DDM A;  2NTT A;  3O65 B;  2EMT A;  2IY1 B;  2D9X A;  1NDD A;  2IO3 B;  1WXA A;  5EE1 A;  2VSZ A;  3VTU A;  2PPH A;  2JZP A;  2GI9 A;  1I4X A;  3AB5 A;  4F7Z A;  3DXD A;  1I4G A;  3PRE A;  3ML9 A;  3AED B;  3N1Z C;  3W5V B;  2CAY A;  1V81 A;  2BPS A;  2JXT A;  2AEH A;  3OAW A;  4FN2 A;  2MBE A;  2N1W A;  3WAO A;  1WGQ A;  3FM8 C;  3BYY B;  5C23 A;  3ZJV A;  4MAC A;  2QIE B;  1AN8 A;  2WXO A;  2Y5C A;  4ZRK A;  2CU1 A;  2LJI A;  3KUC B;  1MI0 A;  3KVF B;  5HFY A;  2D9W A;  1PGX A;  1K50 A;  2PE9 A;  4JKG A;  1WRD B;  3TO1 A;  4A55 A;  4YSX B;  2E3T A;  2CY5 A;  2NBV B;  3GE3 C;  2P0D A;  2W3R A;  1BT0 A;  4E74 A;  4XDC A;  2KN5 A;  2CU3 A;  4KIK B;  2ON8 A;  4A9A A;  2WXQ A;  3KSY A;  4W9H A;  2GUM A;  2KQS A;  4WJ7 A;  3CIK A;  1H8C A;  3CF6 E;  1Q67 A;  1SXT A;  4CHK A;  3BII D;  5CHW A;  3B2G A;  3D8F A;  4XGA B;  3RT3 B;  2C60 A;  2K2J A;  2KC2 A;  4G50 A;  3PVU A;  1ST7 A;  2BYE A;  3N30 A;  1DDW A;  2KMA A;  1A70 A;  4EZL A;  4ZHO A;  1V49 A;  5JH5 C;  4II3 B;  4OVV A;  1U2B A;  2LKO A;  1YQ4 B;  1IP9 A;  2MWN B;  3Q3J A;  4MSQ B;  1QQG A;  3ZIM A;  1DYQ A;  2IBI B;  3RUL A;  2AL3 A;  2L7R A;  2G4D B;  2C7M B;  4JKA A;  4C56 C;  3ZTC A;  2P0F A;  4WQM A;  1CQV A;  2BWE S;  4MGK E;  3T3O A;  1B55 A;  2LUM A;  3OJ4 B;  4TYZ A;  2J0M A;  1SE4 A;  3MP9 A;  4BOS C;  1WX9 A;  2RPQ A;  4DHJ B;  4YSZ B;  5E6P A;  2NMB A;  4ARI A;  1E7U A;  2X0S A;  5J2R A;  1FGZ A;  2MJ3 A;  4NPN A;  3RNC C;  2AQ1 B;  3H7P A;  4ZRJ A;  3VUW A;  4A6F B;  1N61 A;  3UF8 A;  2YS1 A;  3BVM A;  5E6N A;  3SV1 A;  4GDK B;  4M00 A;  5H92 C;  3PRP B;  2ZW1 A;  1C1Y B;  5JVL A;  1NEN B;  1R4M B;  3PEG A;  5AUK A;  4PK1 A;  1IBX B;  2W2W A;  3WAL A;  2GMI C;  5CLL B;  2PKO A;  2COP A;  4RM9 A;  1P9D U;  4BBN C;  4IWQ A;  3KWV A;  1UBQ A;  2WXI A;  4K7U A;  4XE0 A;  2XQN M;  4I6L B;  5C79 A;  2VRR B;  3IAM 1;  2PTL A;  2K6Q A;  3RNF C;  1TS2 A;  2JX5 A;  4PT5 A;  4KHA A;  4C0A A;  4WQO B;  3VXW A;  1TYG B;  3TIX A;  1QIL A;  1IBX A;  1X1G A;  1SSN A;  1JCK B;  1P0R A;  2CJO A;  3WAN A;  3VH3 B;  1DIK A;  1QF6 A;  1T0R C;  4RGT A;  4DBB A;  3U2S C;  3NS1 A;  4NAW A;  3ZNZ B;  2DFK A;  4X57 B;  3PHX B;  3PTF C;  4BZA A;  3MHZ A;  1RRP B;  2DX5 B;  2KDI A;  2J52 A;  2REX A;  1OFF A;  5KHO A;  2JSV X;  2QKL A;  1PDX A;  1GB4 A;  2DHJ A;  1DDV A;  3AV8 A;  2Y8G A;  3ZDT A;  2RRF A;  2Z0O A;  1TY0 A;  2ZPN A;  1B9R A;  4AUQ C;  3PZ7 A;  4PS8 A;  2I5F A;  5E6J A;  5IA7 A;  4G11 A;  4G3X B;  1WMH A;  2ROV A;  1UGM A;  2R2Y A;  2KWV B;  3ZYY X;  3QAR A;  4OW0 A;  4ANU A;  4LNK A;  1E8X A;  2UVM A;  4N59 A;  2P0H A;  1VD2 A;  3RCZ A;  5HKH A;  3SFD B;  2WYQ A;  1EO6 A;  1R4N B;  2L76 A;  4W9F A;  2FIF A;  4QJ5 B;  3OLM D;  3W2D A;  4DXA B;  2DHK A;  2GBM A;  1FCL A;  1TKE A;  5HE0 A;  4JWS C;  4EZJ A;  1DOX A;  1KM7 A;  2KDF B;  3PG7 A;  5DHF B;  1IPG A;  3CWI A;  2DNF A;  5JHG A;  2MBQ A;  4JLC A;  2KLC A;  2DKQ A;  3AE1 B;  4YSY B;  2UWQ A;  4DHZ E;  4F7H A;  2N7J A;  1MK7 B;  1QOA A;  1W1G A;  4K3B A;  3W5U B;  1MG4 A;  5J18 A;  1JRP A;  4REZ A;  3V6C B;  3T06 A;  4F8C B;  1PYW D;  3U7D A;  3D8E A;  2LOZ A;  2KVZ A;  1WGH A;  2GLS A;  3AE5 B;  2MW5 A; 
#chains in the Genus database with same CATH homology
 1WGU A;  3DVG X;  1R4M I;  1AAR A;  3ZNI D;  1TQZ A;  2L2I A;  1V5M A;  3K9P B;  1EF1 A;  4B6H A;  2RNR B;  2PJH A;  1P3R A;  1XR0 B;  2LGY A;  2YVC A;  2AL6 A;  4K81 A;  2R0D A;  3DBS A;  2JXX A;  3D8D A;  1BAK A;  1UBI A;  1WR6 E;  1I42 A;  4MK0 A;  2RSU A;  2YS3 A;  1V6E A;  3RZW C;  2DAF A;  4G0N B;  1NTI A;  4BBK A;  1SHC A;  1MPH A;  3ZVV A;  2IFS A;  2LI5 A;  4A6H A;  1M7E A;  2RGF A;  4ILH A;  5IJM A;  4MGI E;  2NBW B;  4K2P A;  1ZC3 B;  4BKT A;  2MX2 A;  4JK8 A;  1WF9 A;  2GBN A;  2L8J A;  2WWZ A;  4IM2 A;  3TVV A;  4JKG B;  4J6I A;  2M8S A;  2NPT A;  2JWZ A;  5DI9 B;  1OMW A;  2ELA A;  2D07 B;  3K9O B;  2CB8 A;  4LDT D;  5CHF A;  1V88 A;  2KUP A;  4BKG A;  4DDG D;  3MJW A;  1V9J A;  2VRW B;  1KJT A;  1D3Z A;  2FCN A;  2L05 A;  3AXC A;  4HCP B;  2M0X A;  1WG7 A;  3CSF A;  3VFK A;  2R2O A;  1FHW A;  1EF5 A;  4Z2M B;  2KZR A;  5CX3 A;  2D11 A;  3FP5 A;  5D3V A;  4HAT B;  1WZ0 A;  1X05 A;  2CHW A;  1ZVR A;  2KWC A;  1HBK A;  2J0K A;  2LVP A;  3E9L A;  3QC8 B;  2RSG A;  4HAU B;  3BY4 B;  5AZF A;  4FLH A;  2IY0 B;  4GIV A;  4OVU A;  4A6F A;  2KC1 A;  2DYB A;  2N7E A;  2EC1 A;  5LXH A;  5LOP B;  2Z0Q A;  5TR5 A;  2FJL A;  2QHO A;  1YD8 U;  4WJO A;  2MWS B;  2LAS A;  1UNQ A;  3B1L X;  3VDZ A;  4JKD A;  2HTH B;  1J19 A;  4M8N A;  2FNJ B;  4MGZ E;  3QK0 A;  4HAV B;  2RUK B;  1S3S G;  5L83 A;  4L6E A;  4F7G A;  2W2X C;  2Z0E B;  4ILG B;  2CHX A;  3A4S C;  4AP4 C;  4TUU A;  4KSL C;  3HQC A;  3DDC B;  2ZVN A;  3VQI A;  3ODW A;  3ZO5 B;  2Y7B A;  4HWI B;  3H7S A;  3VUY A;  4LCD E;  3A1Q A;  4KZ0 A;  2GCL A;  1YJ1 A;  1LM8 B;  1UEF A;  3R7R A;  1H10 A;  5JHB A;  3PVW A;  1T0Y A;  2JF5 A;  3TMP B;  1LQB A;  2HRJ A;  4CHM A;  3D32 A;  1WJU A;  2HTH A;  1ACA A;  2M14 A;  2O6V A;  3H7P B;  4CYE A;  1ZGU B;  5C16 A;  2IO1 B;  3KH0 A;  4M0W B;  5FI0 A;  4GDK A;  1WGG A;  3DOW A;  2ZVO A;  4II2 B;  3P6A A;  3PS6 A;  2LUE A;  1C3T A;  3QBV B;  3KUD B;  4MJS A;  3VIA A;  2FUH B;  2IZV B;  1RFA A;  4K7W A;  2BKF A;  1VBG A;  1IRS A;  2GBJ A;  3DXC A;  2DKP A;  1DYN A;  1P98 A;  1WR1 A;  1DRO A;  1WI1 A;  4MJS B;  1WI0 A;  1SIF A;  3R7Q A;  4NJ6 A;  4FJZ A;  2XEW A;  3MHS D;  4WJN A;  3MPX A;  1W1H A;  5D6J B;  1FOE A;  1KC7 A;  3B08 A;  4TKN A;  2JZZ A;  4AWJ A;  2HJ8 A;  2JRI B;  1DBH A;  1R4N I;  3HIZ A;  2BKR B;  4A6K A;  1WM2 A;  4HAW B;  1Y5O A;  1WGD A;  4BFR A;  4FHJ A;  2JPH A;  4FUL A;  3AJ4 A;  4GN1 A;  5D2M B;  4BVU C;  3N7C A;  3CMM B;  3QCA A;  1WJ1 A;  2BWF A;  3DBL I;  2LZ6 A;  2WH5 A;  3O96 A;  3DBR I;  4A3O A;  1WJM A;  3EEC A;  4MSM B;  2RGN B;  5BO4 B;  3VAW A;  5DPS A;  1EAZ A;  4W9J A;  2R2Q A;  2JY6 A;  1FAO A;  2E2X A;  1FXT B;  4EKU A;  4GXB A;  2LRW A;  4ILJ A;  2K39 A;  3A33 B;  3A9J A;  4WWP A;  3FEH A;  1WX8 A;  3DVN V;  3APC A;  2K8H A;  1U5D A;  3UIO B;  3ENE A;  2HE7 A;  2Q13 A;  2JT4 B;  1WX7 A;  4W9E A;  1OQN A;  3ZNG C;  3N32 A;  4XX5 A;  4K7S A;  3DBH I;  2UZS A;  4EOY A;  2BCJ A;  4MH0 E;  4Z2N A;  2KKC A;  1TJ6 A;  2GS0 A;  5AZG A;  1YX6 B;  4KVG B;  4TQ1 A;  2N23 A;  3SYX A;  2L00 B;  1ZKH A;  1QZE A;  2H7E A;  4F7U P;  1U5F A;  1GNU A;  3TCA A;  5G55 A;  4MDK E;  2LRU A;  3I3T B;  2GBR A;  2IYB A;  3M63 B;  4GGQ A;  4GMV A;  4JK7 A;  4AJY B;  5DHA B;  1V2Y A;  4HB3 B;  2KDE B;  5D3W A;  4HB0 B;  2IO0 B;  2AWT A;  1OEY A;  1XX0 A;  3RZF A;  4FJY A;  4JL9 A;  3X23 A;  1BTN A;  2RVB B;  1MKE A;  2V1Y A;  4CO7 A;  4K17 A;  2WX0 A;  3PRZ A;  4NSW A;  4D0N B;  2M38 A;  3V60 A;  1OY2 A;  4EUT A;  1MK9 B;  3KW5 B;  4DHJ D;  3SU8 X;  2NPT B;  3RYT A;  4H8S A;  2ROZ B;  5D94 A;  1KLV A;  2C9W B;  5HE3 A;  3ONS A;  4JKF A;  4EEW A;  2G35 A;  4GB9 A;  5EFX A;  3HM6 X;  1LXD A;  2FCS A;  4ANV A;  2PZ1 A;  4WWO A;  1GC6 A;  1U5E A;  2DHI A;  4I6N B;  3S2A A;  3L10 B;  4HCN B;  1PLS A;  2ABD A;  1P6S A;  2LXA A;  3UIN B;  1HE8 A;  3F5R A;  2ADZ A;  2CY4 A;  2OOB B;  1P1A A;  2KFK A;  2K1F A;  2FAZ A;  1PFJ A;  3ZNH B;  3SNH A;  4HLE A;  2NZ8 B;  4A3P A;  3F0W A;  1QC6 A;  4ANX A;  4NQK E;  3SD5 A;  5DIF B;  1YIW A;  3A98 B;  2CQU A;  2GJY A;  2ZCB A;  1Y19 B;  5J3T A;  1OTR B;  2LUL A;  1FB8 A;  2N9E B;  4K2O A;  4BBN F;  2ZEQ A;  2DLW A;  4MY6 A;  1KZ7 A;  1RJ2 A;  1RRB A;  4B95 A;  4XZ4 A;  4XWX A;  1OEY J;  4KDL B;  2WX1 A;  1OGW A;  3AI5 A;  4HJK A;  4A20 A;  4KHO A;  2Y8F A;  2CKH B;  3TBL D;  5JLJ B;  3EPY A;  1XD4 A;  1NU2 A;  2KOX A;  2COD A;  2C5L C;  3PPA A;  2M4N A;  2CHZ A;  4BKS A;  2FJ9 A;  2LD9 A;  3HHM A;  2RLO A;  1Q1O A;  4ZYN A;  4IW0 A;  4IG7 B;  4HHV A;  1M94 A;  2N9X A;  1WJ6 A;  3SUZ A;  2LG1 A;  2YSZ A;  2O6V B;  1XQQ A;  2KTR B;  4URK A;  3EHV A;  1UNP A;  3KUZ A;  3QAQ A;  3APF A;  4WJP A;  2KTF A;  2ELB A;  4FAD A;  2I1J A;  1NTY A;  3RUI B;  1P3Q U;  1XD3 B;  3UZT A;  4PYZ A;  3CXB B;  1JDE A;  3NSU A;  1Q5W B;  4TV3 A;  3GYO A;  3IG3 A;  5G2N A;  3W1S A;  4GOC A;  3BIN A;  5D3Y A;  2XK5 B;  3ALB A;  2N1V A;  4WAA A;  4FBJ B;  4ZRI A;  4E3C A;  3BJI A;  2J59 M;  3VH4 B;  2GOW A;  1W1D A;  2D10 A;  2DN6 A;  2JP2 A;  1YX5 B;  2RQ1 A;  1EGX A;  3AU4 A;  2KWU B;  5E6O A;  2N4F A;  3UIP B;  3ZDM C;  4PQ0 A;  4MM3 A;  5DH9 B;  3PRM B;  1Y8R C;  4KIK A;  2Z0P A;  3SO6 A;  3V62 A;  4W9L A;  2ASQ A;  1L2N A;  2AYO B;  1AWE A;  4KZC A;  3SBT A;  2MSE D;  2CR5 A;  4ASW C;  1UPR A;  1MG8 A;  3PT2 B;  4IOY X;  3WAP A;  2KAN A;  1E7V A;  3ML4 A;  1FHO A;  2WDT B;  1EVH A;  2H7D A;  3WA0 A;  4IM0 A;  1TZ1 A;  1WXS A;  2KHW B;  4MEL A;  5FR6 A;  4YON A;  1V5P A;  1WMH B;  3ZTD A;  4RM8 A;  3ZKJ C;  2C7N B;  4KAX B;  2M17 A;  3IBE A;  2B3A A;  4KSK C;  3ZRC A;  5CTR C;  3G9W A;  1Z5S B;  4DDI D;  3EFU A;  4BKS D;  1KI1 B;  4HAZ B;  4WWN A;  5GOW B;  4A5K A;  2J0J A;  2MQJ A;  2IYD B;  2DYQ A;  4YL8 A;  1XCG A;  3PZD A;  3NS8 A;  3ODO A;  1K5G B;  4IWP A;  5C5B B;  3WAM A;  2FID A;  5IAA C;  4XC2 A;  3TJP A;  3MDB C;  1GG3 A;  3ZLZ A;  5JHA A;  4IUM B;  3ZVR A;  4GMX B;  1J0W A;  2PEA A;  2DZM A;  1V5U A;  4JQW C;  1NTV A;  3B0A A;  3OAN A;  1UNR A;  5C5B A;  1J0G A;  4AOF A;  3IHP C;  2L1C A;  3HW2 B;  4HVB A;  2K00 A;  4IM3 A;  4P7I A;  4LJO B;  1IYF A;  5CHV C;  2LOX A;  2CS4 A;  5LLI A;  3VHT C;  2D3G A;  4NNJ B;  3JSV B;  4JGH B;  1I35 A;  4JK9 A;  2D4Q A;  3L08 A;  2R09 A;  1TTN A;  5L95 C;  1KZG A;  2NVU I;  1BTK A;  2KDB A;  2BYV E;  2N9P C;  2DZJ A;  4Y94 A;  3KRX A;  4EFO A;  4JKH A;  2IO2 B;  3GYP A;  1L7Y A;  3ZW3 A;  3AUL A;  3QQ8 B;  3ULB A;  2O6V D;  1V61 A;  5AZH A;  2Y5B B;  2EJ8 A;  2DTC A;  4LJP B;  2G4S A;  3L0W B;  1U27 A;  2LYD A;  1X1F A;  3P2B A;  3JSV A;  1K8R B;  3ODX A;  4DX8 A;  1VCB A;  1FHX A;  1WVH A;  3SHQ A;  2LGX A;  1JRU A;  2JRH A;  2DZK A;  3NOB A;  2R82 A;  2ZPY A;  3X0W A;  5GMV A;  3V61 A;  1K5D B;  1SE9 A;  3KZ1 A;  2KCJ A;  1EUV B;  1MIX A;  3PLV A;  2LVQ A;  5AEK B;  2KGX B;  1OQY A;  2KMC A;  3P7Z A;  3H6N A;  5DCN A;  2D9Y A;  2DAJ A;  1ZW7 A;  3Q3F A;  2LGD A;  4DX9 0;  3ENB A;  3E66 A;  2DHZ A;  2P8V A;  1E8W A;  4PYU A;  1RAX A;  4M8M A;  1Z87 A;  1WJN A;  3QX1 A;  3ULC A;  2KK8 A;  2ZCC A;  2ZZP B;  1V80 A;  3HM3 A;  3A9K B;  2ZJD A;  3NY5 A;  3DPD A;  3FSS A;  1SGH A;  3T8M A;  4PS3 A;  3M95 A;  3GZN I;  4HB2 B;  3H1U A;  3U30 A;  1E8Y A;  3QWZ B;  4K1R B;  4BOZ B;  5CLQ B;  1X1M A;  1A5R A;  1AQC A;  1ZM0 A;  2ZNV B;  4MGY E;  2XK5 A;  2LWP A;  4ICU A;  5J17 A;  4PNK A;  1UPQ A;  2MBB B;  2A4Z A;  2JUO A;  3W1Y A;  2MBO A;  1H4R A;  2Z59 B;  5HE1 A;  3OJ3 A;  2MKR A;  2KJ6 A;  1UD7 A;  2KFK B;  1GGO A;  2LVO A;  3EC8 A;  3PLU A;  3A9K A;  1ISN A;  2KNB A;  1U29 A;  3SBG A;  3E9P A;  2NCN A;  2K8C A;  3C0R B;  3L16 A;  1FGY A;  2LJ5 A;  1F9J A;  1WE6 A;  1LFD A;  4W9D A;  5J3Q A;  4W9C A;  3A8P A;  3ZUN A;  2MDX A;  2FDQ A;  3LDZ E;  5JHH A;  2W2X D;  2DZI A;  4DK5 A;  3M62 B;  3UGB B;  3PP2 A;  2DYM A;  4MT7 A;  5LXI B;  2MBH A;  2GCJ A;  1ZSQ A;  4I6P A;  1I7A A;  2YLM A;  2N7D A;  5KCV A;  2MP2 B;  4DHZ B;  1XT9 B;  4FA6 A;  2VKI A;  1X86 A;  5KQ1 A;  4GDL A;  4N9F 4;  2K2U A;  3IFW B;  4E71 A;  2I5C A;  2YRY A;  5JZE B;  2N0Y A;  1U4A A;  5DPW A;  3A8Q A;  4EZK A;  5FI1 A;  3IVF A;  5D7G A;  1HB8 A;  1UH6 A;  2XBB C;  4B9K A;  2L0T A;  1NI2 A;  2KTR A;  4GU2 A;  2CRF A;  2DA0 A;  4DWF A;  1XKE A;  3PHW B;  5D27 A;  1WXV A;  4PS7 A;  4IFS A;  3DVG Y;  2EMS A;  5LON B;  3U8Z A;  3NZU A;  3A1Q B;  1TXD A;  3LJU X;  2D2Q A;  2DYN A;  3ZRF A;  2KX3 A;  2FCM A;  2A5U A;  3WYF B;  5L81 A;  1MIZ B;  1LW3 A;  3H9D A;  3PSC A;  1E5W A;  3DVN U;  3L17 A;  2NR2 A;  1WZ3 A;  3R66 C;  4NAW B;  1GUA B;  2J7Q B;  3DQV A;  3VUX A;  3QIJ A;  3SDL C;  2COC A;  3V5W A;  4MEM A;  4FHK A;  1E8Z A;  4KHB B;  2BGF A;  5DPR A;  4JKC A;  1G6J A;  3A9J B;  2YT0 A;  2UYZ B;  1WFY A;  3CST A;  2V76 A;  2MRP A;  1E90 A;  2KO3 A;  2DYO A;  4LDT B;  4ZDV A;  1WIA A;  1V5O A;  1N3H A;  5HE2 A;  2L0F A;  2I1K A;  2KFJ A;  3N3K B;  5C1Z A;  2W9N A;  1X11 A;  4HAY B;  3M3J A;  4W9K A;  5JP4 A;  4NQL B;  1RLF A;  1PQS A;  3T9L A;  3A4R A;  1V5T A;  3HK0 A;  2BYF A;  4HPL B;  2RR9 A;  2V4L A;  3R3M A;  2JZ3 B;  2MFQ A;  1WY8 A;  1Q0W B;  3ML8 A;  4HAX B;  4JIO U;  1I2H A;  3VTW A;  3TW1 A;  2JVC A;  4JKB A;  3NHE B;  1LB1 A;  2YF0 A;  3QA8 A;  3NZS A;  4HDQ A;  2FCQ A;  2OTX A;  1WM3 A;  3ECI A;  1VBH A;  1KBL A;  3M1I B;  4WSF A;  4NY0 A;  2KX0 A;  1GJZ A;  3PV1 A;  3L13 A;  4W9G A;  1P5T A;  3UQA A;  1KOT A;  2O2V B;  3V6E B;  1XOD A;  1MAI A;  4ANW A;  2MCN B;  1TBE A;  1J8C A;  2LBB A;  3VVW B;  3VOQ A;  3W1S C;  2DEN B;  1U5G A;  5EDS A;  4HDO A;  2KJR A;  4W9I A;  1GC7 A;  4GPT B;  3JYU A;  4RMA A;  3KYC D;  3AU5 A;  2L3Z A;  2QKM A;  3KRW A;  3PSE B;  4WJQ A;  2G3Q B;  1WH3 A;  2K25 A;  1UEL A;  2YS5 A;  4JKE A;  1YQB A;  2O2V A;  2COF A;  3LJ3 A;  2MLB A;  4DBG A;  1S1Q B;  2K6D B;  1WJ4 A;  3JVZ X;  2KXJ A;  2KD0 A;  1V86 A;  2NS5 A;  2KJH B;  2KVR A;  1NVL A;  1WGY A;  2DX5 A;  2BF8 B;  2X18 A;  1PMS A;  4CHJ A;  2YT1 A;  4ICV A;  2KLG A;  3TL5 A;  2M1M A;  3RCP A;  2OJR A;  2OQB A;  3QJZ A;  3PVL A;  2G45 B;  2DIK A;  3RD2 A;  3KYD D;  2EKE C;  4KV2 A;  4EMO A;  2KQ7 A;  5KQ4 A;  3WIM A;  5D3X A;  3QWM A;  2HD5 B;  3DCG A;  2UZR A;  3KY9 A;  1NBF C;  3PGE A;  1BWN A;  4FJV B;  2LXC A;  4GSW A;  4IWO A;  2MA9 B;  3JW0 X;  2MP2 A;  2Z0D B;  1WGR A;  4NJ7 A;  4IC7 B;  1WE7 A;  4GDL B;  1UZX B;  2GBK A;  4TQ0 A;  4AJW A;  2K8B A;  3VTV A;  4HPM B;  3UQB A;  3E9O A;  5J3Y A;  2ZNV C;  2RD0 A;  4HB4 B;  3L54 A;  4HK2 A;  3TFM A;  3FLV A;  3MTN B;  4KDI C;  4HXD A;  1WXM A;  3GOE A;  4B6W A;  2COA A;  1WYW B;  2D9Z A;  5KHQ A;  3APD A;  4EJN A;  1Z2M A;  3QHT A;  1TGZ B;  2D9V A;  1M7R A;  2NBU A;  1V89 A;  2DX1 A;  2PE6 B;  1CMX B;  4GZU A;  3DXE A;  4WVF B;  5C6R A;  2V3S A;  1ZC4 B;  4F1S A;  5DPT A;  1HB6 A;  2C7H A;  4IAP A;  1DDM A;  3O65 B;  2EMT A;  2IY1 B;  2D9X A;  1NDD A;  2IO3 B;  1WXA A;  2VSZ A;  3VTU A;  2PPH A;  4F7Z A;  3DXD A;  3PRE A;  3ML9 A;  2CAY A;  1V81 A;  2BPS A;  2AEH A;  3OAW A;  4FN2 A;  2MBE A;  2N1W A;  3WAO A;  1WGQ A;  3FM8 C;  5C23 A;  4ZRK A;  2CU1 A;  3KUC B;  3KVF B;  2D9W A;  2PE9 A;  4JKG A;  1WRD B;  3TO1 A;  2CY5 A;  2NBV B;  2P0D A;  1BT0 A;  4E74 A;  2KN5 A;  4KIK B;  3KSY A;  4W9H A;  2KQS A;  4WJ7 A;  3CIK A;  1H8C A;  3CF6 E;  1Q67 A;  4CHK A;  5CHW A;  3D8F A;  3RT3 B;  2C60 A;  2K2J A;  2KC2 A;  4G50 A;  3PVU A;  1ST7 A;  2BYE A;  3N30 A;  1DDW A;  2KMA A;  4EZL A;  1V49 A;  5JH5 C;  4II3 B;  4OVV A;  1U2B A;  2LKO A;  1IP9 A;  2MWN B;  3Q3J A;  4MSQ B;  1QQG A;  3ZIM A;  2IBI B;  3RUL A;  2AL3 A;  2L7R A;  2G4D B;  2C7M B;  4JKA A;  3ZTC A;  2P0F A;  2BWE S;  4MGK E;  1B55 A;  3OJ4 B;  4TYZ A;  2J0M A;  4BOS C;  1WX9 A;  2RPQ A;  4DHJ B;  5E6P A;  2NMB A;  1E7U A;  2X0S A;  5J2R A;  1FGZ A;  4NPN A;  3H7P A;  4ZRJ A;  3VUW A;  4A6F B;  3UF8 A;  2YS1 A;  5E6N A;  3SV1 A;  4GDK B;  3PRP B;  1C1Y B;  5JVL A;  3PEG A;  2W2W A;  3WAL A;  2GMI C;  5CLL B;  2COP A;  4RM9 A;  1P9D U;  4BBN C;  4IWQ A;  1UBQ A;  4K7U A;  2XQN M;  4I6L B;  5C79 A;  2VRR B;  2K6Q A;  4KHA A;  4C0A A;  4WQO B;  3VXW A;  3TIX A;  1X1G A;  1P0R A;  3WAN A;  3VH3 B;  1DIK A;  4DBB A;  4NAW A;  3ZNZ B;  2DFK A;  4X57 B;  3PHX B;  3PTF C;  1RRP B;  2DX5 B;  2KDI A;  2REX A;  5KHO A;  2QKL A;  2DHJ A;  1DDV A;  2Y8G A;  3ZDT A;  2Z0O A;  2ZPN A;  4AUQ C;  4PS8 A;  2I5F A;  5IA7 A;  4G11 A;  4G3X B;  1WMH A;  2ROV A;  1UGM A;  2KWV B;  3QAR A;  4ANU A;  1E8X A;  2UVM A;  2P0H A;  1VD2 A;  3RCZ A;  5HKH A;  2WYQ A;  1EO6 A;  2L76 A;  4W9F A;  2FIF A;  3OLM D;  4DXA B;  2DHK A;  2GBM A;  5HE0 A;  4EZJ A;  1KM7 A;  2KDF B;  3PG7 A;  5DHF B;  1IPG A;  5JHG A;  2MBQ A;  4JLC A;  2KLC A;  2DKQ A;  2UWQ A;  4DHZ E;  4F7H A;  1MK7 B;  1W1G A;  5J18 A;  3V6C B;  3T06 A;  4F8C B;  3U7D A;  3D8E A;  2LOZ A;  1WGH A;  2MW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...