1EF1A

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MOESIN
total genus 89
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ef1A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ef1A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef1A01
1P98A 3R7RA 3HM6X 3K9PB 3V6CB 4G0NB 2I1KA 4KV2A 1G6JA 4HAVB 2Z0EB 2K6DB 3ZW3A 4TKNA 2N0YA 1V6EA 3V5WA 2ZVNA 2K2UA 4P7IA 4BVUC 2RR9A 2D11A 1N3HA 2YT1A 1YX5B 1S1QB 2KNBA 3DBSA 3F0WA 2ROZB 3N7CA 2KFKB 5J3QA 3MDBC 2KHWB 3CSTA 4NAWB 3SU8X 3ZDTA 1DDWA 1Z87A 2C7HA 1E7VA 1U29A 2I5FA 4YONA 4EMOA 1U4AA 2L0TA 1BWNA 1PLSA 3M1IB 4KZ0A 5L95C 1U5EA 5C23A 3KW5B 3QQ8B 1FGZA 3DBLI 2AYOB 1XD3B 3T8MA 1TTNA 2KMAA 3SUZA 2L8JA 2KTRB 2CRFA 2DYMA 4J6IA 3H7PB 1V88A 3QWMA 3SO6A 3ENEA 4E74A 1WYWB 5EFXA 1IP9A 3H6NA 2J7QB 3AXCA 2HTHB 1BAKA 2ZPYA 2D4QA 1AQCA 2CHXA 3RULA 2LGYA 2KCJA 3HK0A 2MX2A 5HE2A 2G3QB 4GGQA 3VTVA 2HD5B 3KUDB 3AULA 2MBEA 3DVNU 3PVUA 2G4SA 5DHFB 2HJ8A 2XEWA 3WANA 2JXXA 3A9KA 2X18A 2NR2A 3MHSD 1DROA 3KRXA 3PVWA 4CHKA 3C0RB 5LOPB 3VIAA 4ZDVA 4WJNA 2HRJA 2Z0PA 3VAWA 1GNUA 2ZCBA 5CX3A 2LVQA 2FDQA 3ML9A 4KIKA 4DWFA 4HAZB 4WSFA 2Y8GA 3B08A 4ANXA 2XBBC 1ACAA 1J19A 1UNPA 3IBEA 1MK7B 3TO1A 2KJ6A 4IWPA 1FOEA 4AOFA 2LXCA 3KZ1A 3BINA 1LFDA 1M94A 1K8RB 2YSZA 5JHHA 1OQYA 2RGFA 3N32A 1D3ZA 2FJLA 2DHIA 1U27A 5HE3A 1F9JA 1LQBA 1WGUA 2JT4B 2A5UA 4GPTB 4OVUA 4F8CB 2KDEB 1ZKHA 4MELA 4MSQB 2ZJDA 1I42A 1EVHA 3DCGA 3DVGY 4BBNF 1HB8A 5KCVA 1WJ4A 2HE7A 2KANA 2L05A 4GB9A 4ICUA 3EFUA 2O2VA 1KOTA 2DHKA 1KM7A 2DZJA 5DH9B 3M95A 4RM9A 2YS5A 3VVWB 4DHZE 4WAAA 4BKGA 5JHGA 3O65B 4HAXB 3QAQA 4TQ1A 2GCJA 4NJ7A 1EUVB 1WX9A 2LRWA 4GSWA 2DYBA 1RJ2A 5LONB 2BYFA 2WH5A 1JRUA 1UNQA 4HATB 1X86A 3KY9A 2BGFA 2N4FA 2ZCCA 3P6AA 3OJ3A 1V89A 4K17A 4AJWA 4IAPA 2ABDA 3PRZA 1MKEA 4IM3A 1T0YA 4PS3A 2NPTA 1IYFA 3S2AA 1DYNA 1X11A 2FCNA 2KDIA 4NQLB 3A98B 3A9JA 3PTFC 4HAUB 2M17A 2DHJA 1NTVA 2LD9A 3NOBA 1OMWA 3D8EA 1WH3A 4DXAB 2KC1A 4KVGB 3QK0A 2BYEA 3RZFA 1HBKA 3AU4A 1FAOA 3TW1A 1P1AA 5DCNA 5TR5A 2QKLA 3TFMA 1RRPB 3ULBA 2G4DB 2O6VB 1IPGA 1FHWA 4IW0A 3JW0X 4FHJA 3SHQA 1E5WA 1GC6A 1UPQA 3DXEA 4GDKB 3WAOA 5DPWA 1J0GA 3KYDD 1BTKA 5DI9B 1SIFA 4MJSA 3GYPA 3HHMA 3WIMA 5IAAC 4HCPB 5DHAB 1I2HA 2E2XA 2L1CA 5D3WA 1KZGA 1MG8A 4WWOA 4IC7B 3B1LX 4II2B 5J18A 4EKUA 2PE6B 3JSVA 5BO4B 2D9VA 2REXA 2FNJB 3N3KB 2J0KA 3VH3B 4CHJA 4JQWC 5DPTA 2J0JA 2CKHB 2DENB 2PJHA 2BYVE 4ANWA 2D9ZA 4G3XB 1BTNA 2KX3A 4FJZA 3G9WA 4PS8A 3W1YA 3PLVA 4W9JA 4EUTA 3EPYA 4F7ZA 1Q5WB 1YX6B 4HCNB 1TXDA 1VD2A 5D3XA 2M14A 3TVVA 5D3YA 2FJ9A 2ASQA 3ML4A 1KLVA 2BF8B 4NNJB 4XZ4A 4BKTA 4EEWA 3VUWA 4IWQA 3B0AA 3ZVRA 3ALBA 5AEKB 4W9HA 1V81A 2C9WB 2DZMA 3W1SC 2OQBA 1E90A 1V80A 3DXDA 3L10B 4DX90 3M3JA 4LJPB 3KYCD 3A9KB 4W9IA 3SNHA 4JGHB 4WWNA 5HE1A 5KHOA 3A4RA 1WZ0A 2MWNB 3FEHA 2NBVB 4WWPA 1MIZB 4EOYA 1GJZA 1K5DB 1NU2A 2IYBA 4MY6A 4G11A 2L3ZA 4MEMA 3T06A 2BWES 5E6OA 3LJUX 4CHMA 3L17A 1UBIA 1AWEA 2RLOA 3OAWA 1DDVA 1OEYJ 2KQ7A 2N1WA 3PREA 1OTRB 2Z0DB 2DX5B 2W2XD 2LOXA 3P7ZA 3NS8A 3PP2A 2Z0QA 2IO2B 3HIZA 5GMVA 3KUZA 4NSWA 3RCPA 4BBNC 4AP4C 1NI2A 5D27A 1S3SG 2VRRB 2NZ8B 3ULCA 1U5GA 3QBVB 4DBBA 3PEGA 3VUYA 1Y5OA 2GCLA 2PE9A 3VHTC 2KKCA 5J3TA 1FHXA 5C5BA 3UF8A 2I5CA 3W1SA 2K00A 2ELAA 4GMVA 5JHAA 4A20A 2LYDA 2RNRB 2KLCA 4IFSA 2K8CA 2COPA 2L76A 3PZDA 1M7RA 2DX5A 2D2QA 1M7EA 4B6HA 2AWTA 2DZKA 2KLGA 4W9LA 4AJYB 4KHOA 3TMPB 4ICVA 2LJ5A 2WYQA 3CXBB 4PS7A 4BOSC 5D3VA 3DXCA 2NBWB 4DDID 3U7DA 2LXAA 2N9EB 2P0FA 3QC8B 2MP2A 4A6HA 2KTRA 3SDLC 4W9DA 3HW2B 1WJ6A 5HE0A 3EECA 4KDLB 3X0WA 3ZTCA 3DDCB 3A1QA 1LB1A 4DHJB 3M63B 2NMBA 4WVFB 2P0HA 2DAJA 2ZZPB 3DVGX 4I6NB 4F7GA 2MFQA 2R0DA 2MBBB 4GDKA 4A5KA 4W9FA 4EZLA 2DA0A 3U8ZA 4GZUA 2YS3A 3V61A 1EF5A 1XQQA 5J2RA 1IRSA 1X1GA 2KWVB 5D2MB 2UYZB 3V60A 5IJMA 1YIWA 2H7EA 1BT0A 2OTXA 4F7UP 1UGMA 2ELBA 3QIJA 1PQSA 4W9CA 1C1YB 2C60A 4MSMB 1HB6A 3UIPB 4Z2MB 3X23A 2FUHB 2MLBA 3IFWB 4II3B 4Y94A 1R4MI 3VUXA 5HKHA 4BKSD 2L7RA 2K8BA 2D9YA 1K5GB 3BY4B 5C79A 1SHCA 2VKIA 2W2XC 2D07B 2IO1B 2XQNM 4MGKE 2FIFA 3NHEB 1ZC3B 2UVMA 1AARA 4NQKE 4XX5A 4M8NA 1GC7A 2J0MA 2D9WA 3FSSA 3BJIA 5JP4A 1RRBA 4GXBA 2QHOA 3QHTA 5DPRA 2D9XA 2W2WA 2MQJA 2O2VB 2MWSB 2PPHA 1QZEA 4PQ0A 2OOBB 2DZIA 4W9KA 2IY1B 2JUOA 2P8VA 2NPTB 2AL6A 2LVOA 4LJOB 3ZNHB 2K6QA 3NY5A 2LGXA 3KUCB 1W1DA 3DBHI 5KHQA 2MRPA 1P3QU 3A33B 4A3OA 3RD2A 4HPLB 2K1FA 2MW5A 1LXDA 3FM8C 2LI5A 3DPDA 4WQOB 4DK5A 3PV1A 1OEYA 3HQCA 2W9NA 1E8XA 4PYUA 4LCDE 3A8QA 3PPAA 2YLMA 5LXHA 2FAZA 3TL5A 3WAMA 1XR0B 1DDMA 2LG1A 1LM8B 2DYNA 1E8ZA 1YD8U 2JRHA 1MIXA 2CQUA 2IY0B 5GOWB 3ODOA 3JYUA 2EC1A 3ONSA 2FCSA 1E8WA 1CMXB 1WJNA 5CLLB 3CF6E 3LDZE 1KZ7A 3KSYA 1YQBA 3IVFA 4F1SA 2DYOA 1C3TA 1P6SA 3RYTA 4W9EA 2WWZA 2CY4A 2JZZA 1TGZB 3PRMB 3RCZA 5IA7A 3L54A 3OLMD 1QQGA 2ZEQA 1MAIA 2MCNB 3TBLD 3PHXB 4EFOA 3JSVB 3V6EB 2FCQA 1X05A 1RLFA 4A6KA 1WFYA 5D94A 1ZSQA 2KWCA 3PT2B 3Q3JA 2R2QA 3L0WB 2BKRB 2MKRA 4MK0A 2K39A 1H8CA 3ZUNA 3UQBA 4FJVB 4HB4B 4EJNA 4KHBB 1V49A 4BFRA 2MDXA 3V62A 4D0NB 2XK5B 1ZM0A 2L2IA 3KRWA 1V5OA 2CS4A 2KMCA 2LBBA 4TYZA 3OJ4B 3PSEB 3I3TB 5FI1A 5G2NA 3ZTDA 2GS0A 4ANUA 4IM0A 3F5RA 3GZNI 2K25A 2JVCA 2G45B 2EMTA 3L08A 2MBHA 2WDTB 1XODA 1Z2MA 2JRIB 1E7UA 3KVFB 4GU2A 4IWOA 2YT0A 1WM2A 4K1RB 2RUKB 3NZSA 3A8PA 4E3CA 2N7DA 4MGZE 3HM3A 2RGNB 3ML8A 2HTHA 1WX8A 3M62B 4BBKA 3T9LA 2DX1A 2LWPA 3UGBB 4PYZA 2AL3A 4A3PA 1PMSA 3VQIA 4OVVA 4K2OA 4H8SA 2Q13A 3GOEA 3LJ3A 3R66C 1KJTA 1WXAA 3AI5A 3CMMB 3UQAA 2QKMA 2JY6A 3QCAA 1V86A 2GOWA 2KJHB 4ANVA 4DHZB 3DVNV 1TQZA 1UPRA 1P5TA 2LULA 2JF5A 4MGIE 2MSED 3H1UA 1WGRA 3TJPA 2Z59B 1WGHA 4FBJB 1WXVA 4EZJA 1XT9B 2KQSA 3D8DA 2R09A 2NCNA 2C7MB 1XCGA 2KTFA 5C5BB 1TJ6A 2RSUA 4HJKA 4JL9A 5CHFA 4CO7A 2K8HA 1WXMA 2MBQA 3ZVVA 1UBQA 2KDFB 5CLQB 4YL8A 3A9JB 1SE9A 2CHWA 2IYDB 4ZRJA 4ZRIA 2P0DA 1WXSA 1WZ3A 4I6PA 3MPXA 5E6NA 5JHBA 4KHAA 2I1JA 2Y8FA 2KOXA 2V3SA 4HPMB 3TCAA 1UD7A 4LDTD 3VXWA 1NVLA 1W1HA 4GDLB 3EC8A 2KUPA 4HB3B 1WE7A 1WR6E 1I35A 2M38A 3ZKJC 2JP2A 2AEHA 1ZGUB 2J59M 3A1QB 3SD5A 1X1MA 2GBJA 2KX0A 5DPSA 3ODWA 3ZRCA 5J3YA 2GBRA 4KAXB 2NVUI 3GYOA 3VTUA 1QC6A 3CSFA 2MA9B 4JIOU 2H7DA 1I7AA 1EO6A 1UELA 2DKPA 5L81A 1RAXA 2LASA 4GOCA 1V61A 4CYEA 1L7YA 2KK8A 4M0WB 3WAPA 4GDLA 3PG7A 3RUIB 1PFJA 1ZVRA 3VH4B 2Y7BA 1X1FA 1WG7A 1FXTB 1V9JA 2A4ZA 2DHZA 2RD0A 3A4SC 4K81A 2B3AA 4HK2A 3ZNGC 2BCJA 2OJRA 1DBHA 1V5MA 1WJMA 5JLJB 4FULA 4I6LB 4FN2A 2DFKA 2N7EA 2IZVB 5CHVC 4BKSA 4DX8A 4RM8A 4MT7A 2KZRA 2D10A 2LOZA 1V5TA 5KQ4A 5KQ1A 2DN6A 3ECIA 4NAWA 4KSLC 3QX1A 5CTRC 1J0WA 3PGEA 2CAYA 2KD0A 3VFKA 1WE6A 2CU1A 3K9OB 4ZYNA 4ASWC 3PLUA 3CIKA 2KDBA 2WX0A 3ZIMA 2KXJA 2M4NA 3PRPB 2DLWA 3H9DA 4MDKE 1TZ1A 1UEFA 1XX0A 3H7PA 3UINB 1EAZA 1NDDA 5FI0A 2M8SA 2DKQA 2D3GA 4RMAA 2N9XA 5JH5C 1V2YA 2BWFA 2GJYA 2V76A 5L83A 2YVCA 1KI1B 2JZ3B 2RPQA 1WRDB 2KC2A 4WJ7A 3KH0A 4N9F4 4DDGD 1WMHB 3WA0A 2C5LC 1MPHA 4A6FB 3QARA 3PSCA 1Q67A 1P3RA 2VSZA 2ZNVC 4JLCA 3ZRFA 4EZKA 3PS6A 4HHVA 4BOZB 4E71A 2RVBB 1V5UA 4B95A 1WIAA 3IG3A 4G50A 5AZFA 3DBRI 2LKOA 2MBOA 4NY0A 4IM2A 2WX1A 4FA6A 1UH6A 1WJ1A 4HDQA 2FIDA 4NPNA 2BKFA 1V5PA 3DQVA 2DYQA 4KIKB 1J8CA 4FLHA 1Z5SB 2UZRA 2ADZA 2CB8A 4XC2A 5EDSA 5J17A 2KJRA 1B55A 1A5RA 3NSUA 4A6FA 1RFAA 1P9DU 3DOWA 4WJQA 4HAWB 3MJWA 1H10A 2KO3A 3D8FA 3P2BA 1Q0WB 1H4RA 1WR1A 4FHKA 1E8YA 5G55A 4B9KA 4M8MA 1P0RA 3MTNB 1HE8A 4TQ0A 1UNRA 3UZTA 2M0XA 4LDTB 1WGDA 1WVHA 4K7WA 4GIVA 3FP5A 1WI0A 2M1MA 5C6RA 2LUEA 2ZPNA 1XKEA 2LVPA 4KSKC 1U5FA 2COAA 2ZNVB 3ZDMC 2LGDA 3R3MA 1WI1A 2LRUA 4B6WA 3JVZX 1NTIA 1EGXA 1ZW7A 3VOQA 2YRYA 2KN5A 1NTYA 4GN1A 1LW3A 1WGGA 5LLIA 2VRWB 4FADA 2YS1A 4HAYB 1UZXB 3AJ4A 1WM3A 4GMXB 2BPSA 2O6VA 4HXDA 4DHJD 4K2PA 1W1GA 3SV1A 4NJ6A 5C16A 2FCMA 3N30A 4HB0B 3D32A 3QWZB 5C1ZA 1U2BA 2CODA 3SYXA 3UIOB 4ZRKA 4X57B 3FLVA 1U5DA 4AUQC 1OGWA 3QA8A 2V1YA 1GG3A 4C0AA 4Z2NA 1YJ1A 2IBIB 3EHVA 3L16A 3ZO5B 1R4NI 2C7NB 2V4LA 2COCA 1NBFC 4HWIB 3RZWC 2N1VA 1ISNA 3O96A 2KGXB 2NBUA 5AZGA 2ZVOA 5LXIB 2EMSA 1FHOA 4L6EA 4KDIC 4DBGA 1FB8A 3AU5A 1GUAB 1TBEA 2GBMA 3WYFB 2GMIC 2L00B 3APFA 5AZHA 3RT3B 2PZ1A 2IO3B 2UWQA 2CHZA 2GBKA 4HDOA 3R7QA 4WJOA 3IHPC 3PHWB 3ODXA 4HB2B 3NZUA 2KFKA 2JPHA 4IG7B 2ROVA 2RSGA 2R2OA 5E6PA 2RQ1A 1OQNA 1WJUA 2UZSA 1WMHA 1Y8RC 3APCA 2N23A 1WF9A 2CY5A 4FJYA 2G35A 4MJSB 5D6JB 2YF0A 5D7GA 4K7UA 4MM3A 2GBNA 4HVBA 1MK9B 4KZCA 4TV3A 1L2NA 4IOYX 2CR5A 4IUMB 2IO0B 2L0FA 3QJZA 2JWZA 4XWXA 3WALA 4PNKA 2Y5BB 4HLEA 5JZEB 2EKEC 2K2JA 3L13A 3Q3FA 2LZ6A 4URKA 3U30A 2MP2B 1Y19B 2DTCA 1Q1OA 1WY8A 2KWUB 1WX7A 2NS5A 2COFA 4MH0E 1WGQA 2N9PC 4WJPA 5CHWA 3ZLZA 3OANA 3ZNID 1SGHA 4AWJA 1OY2A 2XK5A 3APDA 3VDZA 1ST7A 1XD4A 4F7HA 3VTWA 3ZNZB 1FGYA 5DIFB 1EF1A 4TUUA 3PVLA 2KVRA 2O6VD 2PEAA 4K7SA 4W9GA 1VCBA 2KFJA 2EJ8A 3H7SA 2DAFA 5FR6A 1ZC4B 3TIXA 1WGYA 2IFSA 2Z0OA 4MGYE
chains in the Genus database with same CATH superfamily
4US9A 3R7RA 4YTMB 2I2YA 4CQNA 4KV2A 4GNKB 4YSYB 3RI7C 4TKNA 1V8CA 2KNBA 1BUIC 3NJTA 3N7CA 5J3QA 1MHHE 2M0AA 2INPE 1Z87A 5LG4B 2WXQA 4XE0A 4YONA 4EMOA 1PLSA 4KZ0A 5L95C 3LXFA 2Q5WD 2L8JA 2CRFA 3ENEA 1IP9A 2D4QA 3RULA 1PDXA 4WWMA 3HK0A 3FAHA 1HXYD 5HE2A 2G3QB 4GGQA 3RNBC 2HD5B 3KUDB 4ZHOA 2MBEA 1I7HA 3DVNU 3PVUA 5DHFB 2HJ8A 3WANA 2JXXA 2R82A 3OG5A 2NR2A 1QOAA 4N58A 1HTOA 4R3DA 1XLOA 3PZ8A 4C80A 3ML9A 4RH6A 4DIXA 1ACAA 1J19A 3TO1A 2LGIA 1F77A 3BINA 1LFDA 1K8RB 1EWCA 2RGFA 2V9HA 2A5UA 1T6BX 4OVUA 2EKIA 1HB8A 5KCVA 2L83A 3EFUA 1KOTA 3VVWB 2YS5A 4WAAA 2GCJA 4NJ7A 3B9JA 3IBEA 2WH5A 1JRUA 1UNQA 1X86A 2BGFA 4K17A 1EU4A 4IAPA 1T0YA 2VH2A 1DYNA 1N60A 2KDIA 4NQLB 1JWUD 1WXQA 4D2KA 2LD9A 3D8EA 5HFYA 5IP4D 4DXAB 2KC1A 3QK0A 4Q2JA 5DCNA 5TR5A 2N9LA 2QKLA 1B1ZA 2KMMA 1JDEA 2K0PA 3LB8C 4IW0A 4LTUA 3MP9A 1FXAA 1SIFA 4HCPB 3N1XC 2L1CA 1MG8A 4IC7B 3JSVA 5BO4B 2FNJB 4JQWC 2BVCA 5FR3A 2PJHA 4A9AA 2D9ZA 5IO9A 4PS8A 3W1YA 3DBLB 3ZXRA 4EUTA 1AYFA 1VD2A 5D3YA 4NNJB 4BKTA 4EEWA 3AE6B 1P7FA 3ETRA 3B0AA 3ZVRA 3ALBA 2C9WB 2L1AA 3WIMA 2JYTA 4JGHB 4WWNA 2V3PA 3LJUX 3OAWA 1DDVA 3PREA 2LOXA 2Z0QA 2IO2B 3RCPA 3Q8FA 2JXTA 1NI2A 3H8HA 3VR8B 3BWUD 3R8BA 3PEGA 1Y5OA 3R2IA 2GCLA 2MHJA 3UF8A 5C5BA 3NVVA 2I5CA 3W1SA 4GMVA 1GAQB 3Q69A 2COPA 3GS2A 3IAM1 2DZKA 4AJYB 4B6HA 2KIEA 3TEZA 3CXBB 4PS7A 1IBXB 2WXRA 2NBWB 3U7DA 2N9EB 3SDLC 2KTRA 1CJEA 3EECA 3J9CA 1N6ZA 1LB1A 4B0EA 5JXVA 4GDKA 4UDUC 1EF5A 1AWDA 2UYZB 1YIWA 3W5UB 1BT0A 4F7UP 3QIJA 1PQSA 1C1YB 4MSMB 4JWUC 3U12A 1XCQL 2VKIA 2IO1B 2K5PA 4MGKE 2LJIA 2UVMA 4LNOA 4XX5A 2D9WA 3QHTA 3ZJUA 1QZEA 2INNE 2IY1B 3ZNHB 2LVOA 3AH7A 5KHQA 5JVLA 4LNFA 1TKGA 1JWMD 2LFIA 3A8QA 2YLMA 3P1MA 5LXHA 1XR0B 2O2VA 1YD8U 1MIXA 2Y3AA 1E8WA 1CMXB 1WJNA 2BS4B 3IVFA 4F1SA 1TT5B 4RGOS 2DYOA 1P6SA 1R4NB 3AEBB 2WWZA 1HTQA 3RCZA 5IA7A 1QQGA 3AE3B 4HSIA 3BVMA 1WFYA 4A6KA 3Q3JA 3L0WB 2BKRB 2WXMA 4YSXB 4EJNA 4KHBB 1PGBA 3DBRB 2CS4A 3RD2A 4B6WA 2GI9A 5FI1A 2WDVB 3NWFA 3GZNI 4ITKA 2G45B 2EMTA 2WDTB 1Z2MA 3KVFB 1FCCC 3PO0A 3NZSA 4MGZE 2Z4DA 2HTHA 3M62B 1E10A 1PMSA 4OVVA 4K2OA 2MH7A 3GOEA 2G9HD 1KJTA 1WXAA 2AQ3B 3DBHB 2DBYA 3QCAA 5IRSA 4DHZB 1TQZA 1UPRA 2LULA 1FEHA 4MGIE 3BK1A 1WGHA 4FBJB 2BS3B 2KQSA 3D8DA 4JL9A 2RSUA 1STEA 2K8HA 1FO4A 1XLQA 1WXMA 2KDFB 4QXAB 1WXSA 2QMTA 3MPXA 5JHBA 3ZQ4A 3E9LA 2KOXA 2XN9C 3RN9C 3VXWA 1KF6B 3RNAC 1K52A 4HB3B 1WE7A 1D6EC 4XWWA 2JP2A 3A1QB 3SD5A 2J59M 2ONQA 1GGOA 5AUIA 3ZRCA 2QSDA 2GBRA 4KAXB 3CSFA 4HRSA 1EO6A 2XNAC 4HEA1 1KTKA 1RAXA 3WAPA 4GDLA 1PFJA 1ZVRA 1I4XA 1WG7A 2B3AA 4HK2A 2BCJA 1HQRD 1RYJA 4FULA 3SBTA 2CU3A 2DWQA 1DOXA 2DFKA 3HVZA 2IZVB 4P16A 5CHVC 1FRDA 2LOZA 5KQ1A 1CZPA 2WU2B 4NAWA 3AEAB 5CTRC 3VFKA 3MC8A 4ZYNA 3DCXA 4ASWC 1VBHA 3B77A 3ZIMA 2K49A 1SEBD 2PVOD 2QIEB 1TZ1A 3UINB 2DKQA 2N9XA 2GJYA 3BYTB 1ZE3D 2JZ3B 1FMAD 2KC2A 1YN5A 3WA0A 2MEKA 1VR9A 2PVGC 3PSCA 1MVKA 3AEDB 3IG3A 3DHHC 4OZBA 2MBOA 1FCLA 1OQRA 2WX1A 4FA6A 1WJ1A 4HDQA 4NPNA 1TY0A 4XC2A 5EDSA 1VBGA 2ADZA 5BYQA 1B55A 3NSUA 4N59A 3DOWA 1TS5A 3ZXVA 3P2BA 3D8FA 4FHKA 1WR1A 1E8YA 5G55A 4B9KA 1RWSA 1SB3C 4M8MA 4TQ0A 1QILA 4K7WA 1WI0A 2LUEA 1NENB 1XKEA 1T5XD 2ZPNA 1U5FA 2COAA 2ZNVB 3AB5A 2V0GA 1JQ4A 2LGSA 1NTIA 1EGXA 1FNVA 2KN5A 1NTYA 4GN1A 1LW3A 2VRWB 2J53A 1UZXB 1WM3A 2BPSA 3BIID 2WXFA 4K2PA 1W1GA 3NW8A 3N30A 4HB0B 3D32A 2QJLA 1SSNA 3QA8A 2V1YA 1TS3A 2C7NB 2RDHA 2COCA 3ABVB 3RZWC 2N1VA 5AZGA 1FB8A 4O1NA 2GMIC 5IN7A 2PZ1A 2GBKA 3IAS1 2TSSA 3NZUA 1M4VA 1WJUA 2G35A 2ZW0A 5D6JB 4K7UA 4HVBA 3C8YA 1MK9B 4TV3A 1L2NA 4IOYX 2IO0B 2L0FA 4XWXA 2Y5BB 2BTEA 3L13A 5MPOA 2DTCA 4MH0E 2KWUB 2COFA 3ZNID 2N9PC 3VDZA 1JCKB 1BMLC 3PVLA 1VCBA 2L52A 3H7SA 1UNSA 4QJ5B 4G0NB 3V6CB 3TUOA 4HAVB 3ZW3A 1QOBA 1SF0A 4A90A 1V6EA 4P7IA 2RR9A 4L1BA 2SAKA 2RDGA 3DBSA 4JKFA 1YJIA 3U7ZA 2ROZB 3SU8X 3AM9A 4NAWB 3MDBC 1U29A 2Y5CA 2L0TA 3M1IB 5C23A 2FUG1 3QQ8B 1FGZA 2K9XA 3HRDD 1L5PA 2IGDA 3AXCA 1BAKA 2CHXA 2GUMA 2KCJA 2MX2A 2NMQA 2R2YA 3A9KA 1YOVB 3PVWA 2Z0PA 1GNUA 1VJKA 5CX3A 1SXTA 4DWFA 1T0RC 2WXIA 4ILJA 3AMZA 1G6JA 4AOFA 2KQ4X 2MJEA 5BYRA 1M94A 3N32A 1F9JA 2KR0A 2JT4B 3RNCC 2KDEB 1ZKHA 4MSQB 2WLBA 2ZJDA 1I42A 3DCGA 3DVGY 1WJ4A 4GB9A 2KANA 1FIQA 3IT6B 2DZJA 4RM9A 4DHZE 5G5HA 2WS3B 1RM6C 4A8XC 3O65B 4HAXB 4TQ1A 1FD6A 1EUVB 2LRWA 4GSWA 2DYBA 2M56B 2BYFA 4FJZA 3KY9A 1I4QA 1DOYA 2IGHA 5EE1A 2BB5A 1IYFA 3WCQA 3I5JC 1C76A 3A9JA 4L23A 4JX1C 3Q8BA 3P4SB 1NTVA 1OMWA 1J7BA 2GB1A 3Q6BA 3RZFA 2G4DB 3TFMA 1RRPB 4XDCA 1IPGA 1QT9A 1PGAA 4JKBA 3DXEA 1GC6A 1UPQA 5DI9B 2WXNA 5IAAC 5DHAB 5D3WA 3E9SA 4WWOA 4II2B 5J18A 1UGJA 4KX6B 2PE6B 2D9VA 2J0KA 3L4PA 5DPTA 2BYVE 3VRBB 3PLVA 3EPYA 1LO5D 1Q5WB 1YX6B 1TKYA 1DIKA 2ZKMX 2BF8B 4C4VA 4J3OD 2PMVA 3PZ7A 4W9HA 1E90A 4W9IA 3MHZA 5HE1A 2MWNB 4WWPA 1SE4A 4MEMA 5E6OA 3NVWA 4QJ3B 1UBIA 3L17A 2JWUA 2Z0DB 1VRAB 2W2XD 3HUIA 2AQ2B 3MFGA 3T3OA 3TEWA 2VRRB 3ULCA 5EE0A 1U5GA 3QBVB 4DBBA 3VRAB 2PE9A 2H88B 5J3TA 2JSVX 3O13A 4A20A 2LYDA 2WXPA 4IFSA 2K8CA 1UUPA 1M7RA 1M7EA 5I2MA 2QILA 4ICVA 4BOSC 5D3VA 2V4IB 3QC8B 1WJ6A 3P4RB 3M63B 2NMBA 2ZZPB 2P0HA 1GOZA 3DVGX 4F7GA 2R0DA 2MBBB 4A5KA 2DA0A 5J2RA 2KWVB 5D2MB 2H7EA 2OTXA 1FNWA 1EWYC 1L0XB 2LHDA 3IFWB 3VUXA 2L7RA 2QEJC 3BY4B 1SHCA 2BYTA 2XQNM 1ZC3B 5E6JA 2WXHA 4NQKE 1B9RA 1GC7A 3BJIA 3FSSA 2QHOA 5IKCM 2D9XA 2MQJA 1AW7A 4YXDB 2Z59A 1YMHE 2DZIA 4CO7A 2NPTB 2P8VA 2K6QA 2W55A 3NY5A 1SJHD 2K8EA 2WGSA 4K3BA 4JWSC 1LXDA 3DPDA 4WQOB 3HQCA 2W9NA 3E9OA 2FAZA 3AE2B 2LG1A 1LM8B 5C2TB 4GLSC 1D5XC 1C79A 4WURA 3JYUA 2FCSA 2OHFA 3CF6E 5CLLB 1KZ7A 1YQBA 1C9FA 2J4XA 2J42A 1MJDA 1JWBD 5H8YE 3L54A 2CJOA 2ZEQA 1KRHA 1E7PB 4EFOA 1RLFA 2KWCA 3PT2B 3ZJTA 1SJED 4MK0A 3UQBA 4FJVB 2MDXA 3V62A 2L2IA 2KMCA 2RRFA 2LBBA 1T0SC 1TS2A 2GS0A 2YT0A 1WM2A 1YNTE 3E9PA 2I38A 2RGNB 1GPXA 1YQ4B 2LWPA 3UGBB 4H8SA 3LJ3A 5I2SA 3Q8EA 3CMMB 1C77A 3FILA 3UQAA 2QKMA 1V86A 2KJHB 4ANVA 2RDBC 1MI0A 3OWEB 2JF5A 2MSED 1WGRA 4EZJA 1NI3A 1ZOYB 2R09A 1XCGA 5CHFA 3HIEA 3A9JB 4LK0M 2IYDB 4ZRIA 5E6NA 4I6PA 2V3SA 3Q3MC 4LDTD 1W1HA 4GDLB 2KUPA 1MPEA 2AEHA 5DPSA 3ODWA 5J3YA 3VTUA 5I4DA 3FVCA 1QC6A 3RNGC 1KC7A 2LASA 4CYEA 2KK8A 4M0WB 3RUIB 2Y7BA 1X1FA 4FXCA 3ZNGC 4C00A 3SBGA 3A4SC 3IT4B 3BZDB 2OJRA 1V5MA 5JLJB 4I6LB 2PKOA 1YQ3B 3RFZB 4BKSA 1YJJA 5GXGB 1V5TA 2KYWA 1C78A 2DN6A 1OQQA 3AEEB 2FJUB 2K22A 3QX1A 1J0WA 3AV8A 2CAYA 1WE6A 4PT5A 2M4NA 3PRPB 4MDKE 1UEFA 1XX0A 1PYWD 4RMAA 1V2YA 3KH0A 2C5LC 2B76B 3BVGA 3BVZA 4A6FB 4EZKA 4JLCA 1OFFA 1V5UA 2NTTA 4C56C 4NY0A 1QOGA 2FIDA 2WDRB 1V5PA 2IGGA 3DQVA 3MC0B 4L1RA 1R4MB 1Z5SB 5BMHA 1A5RA 1P9DU 2VZKD 4WJQA 4BZAA 1GB4A 1H10A 2KO3A 4RGMA 1H4RA 2BW2A 3MTNB 1HE8A 3TEXA 3HSAA 2AX5A 1UNRA 3UZTA 3AN1A 4LDTB 1WVHA 5C6RA 2LVPA 2LGDA 3R3MA 2LRUA 2WDQB 1FRRA 4XWTA 1XEEA 1ENFA 2D5GA 3VOQA 5LLIA 4FADA 2YS1A 4RF0A 3P4QB 3AJ4A 4TMAB 3C19A 5C16A 2FCMA 3QWZB 3V3XA 2KN4A 4S0RA 1U2BA 2CODA 4Z2NA 2IBIB 2E6XA 1R4NI 3Q8AA 3O96A 3DHGC 2NBUA 1FHOA 1QLBB 1GUAB 3RT3B 5AZHA 2IO3B 2UWQA 3IXSA 1ZYIA 1I4PA 3ODXA 4HB2B 2RSGA 2R2OA 5E6PA 2Y5PA 1OQNA 2UZSA 1FXIA 2N23A 1XLPA 4FJYA 4MM3A 2WQYB 1V97A 2LHEA 2BQQA 2CR5A 3QJZA 3WALA 4RCOA 4ZRQA 4URKA 1PFDA 2LZ6A 2W3RA 4D6WA 3U30A 2MP2B 3SFEB 2V3NA 1WGQA 4WJPA 3KWLA 3OANA 3APDA 4F7HA 1HZ5A 3ZNZB 1FGYA 4KGSA 2O6VD 2KFJA 3GP7A 3TIXA 1WGYA 2IFSA 2Z0OA 3Q3OC 3K9PB 4IDIA 2X0SA 2N0YA 2ZVNA 2K2UA 3ZGZA 2YT1A 1S1QB 3NWAA 1LGRA 2I5FA 1U5EA 3KW5B 2AYOB 1TTNA 4LLGM 3SUZA 2GLSA 2DYMA 2KTRB 2WXGA 3H7PB 1V88A 3DWMA 3CIRB 1WYWB 5EFXA 2PIAA 2J7QB 4US8A 3RNEC 3AULA 4K3CA 2G4SA 2XEWA 2WXKA 1MHXA 3MHSD 3KRXA 3AE7B 4YTNB 3C0RB 3RPFC 2HRJA 2LVQA 2FDQA 4HAZB 4WSFA 4RGNA 1IUEA 1QOFA 1MK7B 1NYRA 2KJ6A 1FOEA 1SBBB 3B2FA 1OQYA 2YSZA 5JHHA 1D3ZA 2FJLA 2DHIA 1U27A 5HE3A 1LQBA 4C7YA 1WGUA 3Q8CA 4GPTB 4MELA 1JROA 1EVHA 4BBNF 2HE7A 3AEFB 4ICUA 2DHKA 1KM7A 5DH9B 3AE4B 2JX5A 5JHGA 3QAQA 1D4BA 1WX9A 3RMKC 1RJ2A 2N4FA 2ZCCA 3P6AA 4IM3A 3NUHB 1MKEA 3PRZA 2NPTA 3S2AA 1X11A 3A98B 4HAUB 4HKZE 1KBLA 1EM7A 1XCTL 4ARCA 1A70A 3NOBA 1JRPA 3AU4A 1T77A 1P1AA 2N9KA 3EGRA 4KGTA 4HJGE 1TKEA 2O6VB 4MT5A 2N0SB 3EFCA 2KWDA 1E5WA 5DPWA 1BTKA 2E2XA 3ZYYX 4M0WA 3N3KB 1TZOA 3VH3B 4CHJA 2J0JA 2CKHB 4H2AA 1BTNA 2DIKA 1VZ6A 4W9JA 1T3QA 1ZUD2 3TVVA 2FJ9A 2ASQA 2KIGA 3ML4A 3VUWA 1K51A 1ESFA 1V81A 2BT6A 4LJPB 3KYCD 3A9KB 3SNHA 3AE1B 2CJNA 3A4RA 1WZ0A 3FEHA 2NBVB 2BWES 4CHMA 3TEYA 1OEYJ 2KQ7A 2INDC 2N1WA 2KUQA 1OTRB 4P6VF 2WXJA 1FM0D 3P7ZA 3NS8A 3PP2A 2JU6X 3NS1A 2LEKA 4M02A 2NZ8B 2HTME 3VUYA 4KHBA 2KKCA 1FHXA 2K00A 4OHJA 5JHAA 2RNRB 1N5WA 3PZDA 2DX5A 2DNFA 4W9LA 3TMPB 2LJ5A 2WYQA 4JKHA 3N1YC 3V05A 3DXCA 2K3UA 2KAJA 2LXAA 2P0FA 4A6HA 5HHDG 4W9DA 4KDLB 3ZTCA 3DDCB 4WVFB 4I6NB 2DAJA 1L4ZB 4EZLA 3U8ZA 3V61A 1BXTA 1IRSA 1X1GA 1E6EB 3N9YC 5LNK1 1F2RC 2ELBA 4W9CA 3UIPB 1HB6A 4II3B 2FUHB 4Y94A 1R4MI 4BKSD 5M4YB 2K8BA 2D9YA 1K5GB 5C79A 3AE5B 2D07B 1AARA 4M8NA 2MJ3A 2J0MA 5JP4A 4JK7A 1RRBA 5DPRA 4NAMA 2FE8A 3I63C 4YTPB 2O2VB 3GE3C 2OOBB 2JUOA 2AL6A 3DBHI 2MRPA 4A3OA 2MW5A 5T8IA 4DK5A 3PV1A 1OEYA 1GB1A 1E8XA 1DGJA 4PYUA 3TL5A 3N1ZC 3WAMA 2JRHA 1DDMA 2DYNA 5GOWB 3ODOA 4KKJA 2WHIA 3ONSA 3LDZE 3KSYA 4PK1A 1C3TA 1V1PB 3RYTA 4A55A 2JZZA 3PRMB 3OLMD 4MM3B 2MCNB 3TBLD 3PHXB 3JSVB 3V6EB 2FCQA 5D94A 3DWGC 2R2QA 2N7JA 1YN4A 1E0ZA 2K39A 1H8CA 1J7AA 1V49A 4D0NB 3NG0A 2INCC 3PSEB 3KRWA 3I3TB 2PLPA 4S17A 4ANUA 2JVCA 1QQRA 3L08A 2JRIB 1TYGB 1E7UA 1Y56A 4GU2A 3KQ4A 4E3CA 2N7DA 3AE9B 1ZPSA 2WXLA 1WX8A 2DX1A 2LMCA 2AL3A 2JYEA 3E56A 2RMMA 2BS2B 3AI5A 2JY6A 2R61A 1C4AA 2GOWA 1FFUA 3DVNV 3H1UA 3TJPA 3VR9B 2KT7A 1WXVA 1ZDXA 2IJ0A 2NCNA 4HJKA 1UBQA 5CLQB 4YL8A 1SE9A 3I57A 2W3SA 4KHAA 4HPMB 1HZ6A 3TCAA 4ACFA 2ZW1A 1NVLA 1XF5L 4ZYSA 2KVZA 4USAA 1WR6E 3ZKJC 4JKEA 4YWGG 1X1MA 2KX0A 4JIOU 2MA9B 1SIJA 2H7DA 1I7AA 1UELA 5L81A 1SE2A 4GOCA 4HKQA 3SEBA 3PG7A 2BB6A 4F8CB 2DHZA 1DBHA 1WJMA 4FN2A 2N7EA 4DX8A 4MT7A 3ECIA 1TJEA 4KSLC 3PGEA 2KD0A 3CIKA 2KDBA 2DLWA 3H9DA 4WH4A 3H7PA 5FI0A 2M8SA 2D3GA 2QCZA 5JH5C 2RPQA 4WJ7A 4N9F4 4DDGD 1WMHB 1P3RA 2VSZA 3PS6A 4E71A 4BOZB 2RVBB 3LYYA 4G50A 1KFYB 1UH6A 3BK2A 2BKFA 1XXGA 4LNIA 2ACZB 2M19A 4A6FA 1RFAA 1UF0A 3KLSX 1J0GA 1Q0WB 1P0RA 3NVZA 4L2YA 3W9CB 1WGDA 1F2RI 2M1MA 4KSKC 1F0ZA 3ZDMC 4AQ7A 1R7SA 1WI1A 4IOIE 3JVZX 1RFKA 1ZW7A 4ZOHC 2YRYA 1WGGA 4AS1A 1L6UA 4GMXB 2O6VA 4HXDA 4DHJD 1IGCA 4NJ6A 4JKDA 3SYXA 1SE3A 4X57B 4AUQC 1FPYA 1OGWA 1GG3A 3EHVA 1ISNA 2KGXB 2ZVOA 5LXIB 4KDIC 4DBGA 1ZDVA 3BYYB 1TBEA 2GBMA 3WYFB 2L00B 3APFA 3EA6A 2CHZA 2X38A 3MJ5A 3PHWB 2KFKA 2JPHA 4IG7B 2RQ1A 1Y8RC 1WF9A 4MJSB 2YF0A 2WU5B 4KZCA 4PNKA 3U52E 2EKEC 1Y19B 1WY8A 1J8CA 1WX7A 3ZLZA 2XK5A 1NEKB 1XD4A 4TUUA 1EF1A 2KVRA 4W9GA 2FBWB 4K7SA 4M00A 2Z8LA 4OW0A 2DAFA 1MFWA 1D5ZC 4AP4C 1P98A 2JZPA 3HM6X 4C7ZA 4JK9A 2I1KA 2Z0EB 2K6DB 2YT2A 3V5WA 4BVUC 5D3DA 2D11A 1N3HA 5TSSA 1YX5B 4OZAA 3F0WA 2KFKB 1CK1A 3CSTA 2KHWB 1K50A 3ZDTA 1DDWA 2C7HA 4XDDA 1E7VA 1U4AA 3NRZA 5EE9A 1BWNA 1IBXA 3I9V1 1UWMA 3DBLI 3T8MA 1XD3B 2KMAA 2LUMA 4J6IA 1WWTA 1HA5A 2DLBA 3QWMA 3SO6A 4E74A 2X8XX 5AUKA 3GZNB 3H6NA 3NZ3A 4ILGB 2HTHB 2ZPYA 1AQCA 2LGYA 1TIFA 3VTVA 3E66A 4RNAA 2MJDA 5IOIA 2ICIA 1JWSD 2X18A 2KDMA 1F52A 4CHKA 1DROA 4ZDVA 5LOPB 3VIAA 4WJNA 2ZCBA 2IPKD 4KIKA 2Y8GA 3B08A 4JKCA 4ANXA 3RNFC 2XBBC 4IWPA 1UNPA 4YSZB 4JK8A 3AEGB 2LXCA 3KZ1A 1CQVA 4CSQA 1F1HA 3P42A 1JW9D 2L05A 4OVZA 2J52A 3M95A 1ZXIA 4BKGA 1UWXA 2D3BA 4JPSA 5LONB 1VLBA 4HATB 3OJ3A 4AJWA 1V89A 2ABDA 4PS3A 2BBCA 4MH8A 2FCNA 3PTFC 2M17A 3AECB 2DHJA 1VZ8A 3NWDA 1JMLA 2OEDA 1WH3A 4KVGB 1FNUA 2BYEA 1HBKA 3TW1A 1FAOA 2G1EA 3ULBA 1FHWA 1I4HA 3JW0X 4FHJA 3SHQA 4OSNA 1HEZE 3WAOA 2EELA 4GDKB 3KYDD 4MJSA 3GYPA 3HHMA 1I2HA 1KLUD 1KZGA 4A6QA 3B1LX 4EKUA 4WAFA 2REXA 3A58A 2DENB 1WYGA 4ANWA 2KX3A 4JKGA 3G9WA 1FFVA 4F7ZA 4HCNB 1MI1A 1TXDA 5D3XA 2M14A 4P1CC 1P7EA 1KLVA 4XZ4A 5C3JB 5AEKB 4IWQA 4QAYA 3FC4A 1ET9A 2DZMA 3W1SC 2OQBA 1V80A 3L10B 3DXDA 4EOYA 4DX90 3M3JA 3N20C 5KHOA 1N62A 5BYSA 2VH1A 1GJZA 1MIZB 1K5DB 1NU2A 2IYBA 4MY6A 2YEPB 2L3ZA 4G11A 3T06A 1VDVA 3R2TA 4LNNA 1AWEA 2RLOA 5BMGA 4HROA 2DX5B 2D3CA 1L4DB 1WSPA 3HIZA 5GMVA 3KUZA 4NSWA 4BBNC 1TY2A 1S3SG 5D27A 2H89B 2GRIA 3VHTC 3NVYA 2ELAA 2KLCA 1VZ7A 2Z13A 2AWTA 2KLGA 2D2QA 2L76A 2E3TA 4KHOA 4HPPA 2YEPF 4DDID 2MP2A 3HW2B 5HE0A 3X0WA 3SFDB 2NBVA 3A1QA 4DHJB 2MFQA 4W9FA 3W2DA 3P63A 4GZUA 2YS3A 1TS4A 1XQQA 1I4RA 5IJMA 1N5XA 1UGMA 3EUB2 2C60A 4Z2MB 3X23A 2MLBA 4WQMA 3MC9A 3OHMB 2W2XC 1NYQA 2FIFA 4RF1A 3NHEB 1JWAD 5FK9C 4GXBA 2W2WA 2MWSB 1T0QC 3UI3A 2PPHA 5FKAC 4PQ0A 1XO3A 4W9KA 4LJOB 2QDFA 2LGXA 3KUCB 1W1DA 1P3QU 3A33B 1V1PA 4HPLB 2K1FA 3CWIA 2JQRB 3FM8C 2LI5A 1ZXHA 2OJWA 1DYQA 4LCDE 3PPAA 4OZCA 1PGXA 1I4GA 1E8ZA 1ZP0B 1JALA 2CQUA 2IY0B 4ARIA 4XGAB 2EC1A 4QJ4B 1WGKA 4W9EA 2CY4A 4ILHA 1TGZB 3HVDA 1MAIA 1XLNA 1X05A 1ZSQA 2MKRA 2WXOA 3ZUNA 4HB4B 4BFRA 4KGRA 2XK5B 1ZM0A 3OJ4B 1V5OA 5G2NA 3ZTDA 4TYZA 5EE3A 4DXGA 3FKYA 4IM0A 3F5RA 2K25A 2MBHA 1XODA 1L0YB 4IWOA 4K1RB 2RUKB 3A8PA 1N61A 3HM3A 3ML8A 4BBKA 3T9LA 4PYZA 4JKGB 4RFBA 4A3PA 4JKAA 3SR6A 3VQIA 3R66C 2Q13A 4P1BC 4TSSA 2QC8A 1ROEA 1P5TA 3DHIC 4NJCA 2Z59B 1YN3A 1XT9B 5HKHA 2C7MB 2WNMA 2KTFA 5C5BB 1TJ6A 3ENBA 2MBQA 3ZVVA 3Q2AC 2CHWA 3T3NA 4ZRJA 1WZ3A 2P0DA 2I1JA 2Y8FA 1UD7A 2AQ1B 3EC8A 4YT0B 2ON8A 4JE3B 1I35A 2M38A 1C4PA 1ZGUB 4M01A 4EE2A 2GBJA 3GE8C 1EU3A 2NVUI 3GYOA 2DKPA 1V61A 1L7YA 5HI1A 3U2SC 3VH4B 1FXTB 2A4ZA 4NZLB 1V9JA 1K53A 3V60A 2RD0A 3ZRFA 4K81A 3Q14C 3KWVA 1AN8A 4RM8A 2KZRA 2D10A 5KQ4A 2CU1A 3K9OB 4C4VB 3PLUA 2WX0A 4BAXA 1NVID 2KXJA 1WRIA 1EAZA 1NDDA 1Q10A 1E9MA 2BWFA 1DOIA 2V76A 4XYCA 5L83A 2YVCA 1KI1B 1WRDB 3FILB 2VZKB 3P4PB 4N6EB 1MPHA 5HG2A 3QARA 1Q67A 2ZNVC 4ZHPA 4HHVA 4B95A 2PTLA 1WIAA 5AZFA 3DBRI 2LKOA 2WP9B 4IM2A 2IDYA 4IKGA 1C4CA 2DYQA 2RPVA 4KIKB 1V1OA 5H92C 4FLHA 2UZRA 5J17A 2CB8A 2L32A 2KJRA 4OT1A 4LNKA 4HAWB 1ET6A 3MJWA 4G3XB 4ZRPA 1L6VA 4GOUA 4DQOC 5G5GA 4DXFA 1QF6A 2M0XA 2W82A 1KLGD 1L0VB 2HJ1A 2W54A 4GIVA 3FP5A 3URYA 3Q3NC 1N63A 1KH0A 3ZJVA 4HAYB 3SV1A 5C1ZA 1IGDA 3W5VB 3GB1A 5BMIA 1J7CA 3UIOB 4ZRKA 3FLVA 1U5DA 3AE8B 4C0AA 1YJ1A 4RGTA 3ZO5B 4B0MA 3L16A 2V4LA 4HWIB 1NBFC 2Z14A 2EMSA 4L6EA 3AU5A 4MACA 4REZA 3U4EG 4HDOA 3R7QA 4WJOA 3IHPC 2KACA 2ROVA 1WMHA 3APCA 4KKIA 5D7GA 2CY5A 1MG4A 2PW9A 2GBNA 2SEBD 5D3IB 3TSSA 4IUMB 4HLEA 2HDEA 2JWZA 5JZEB 3Q3FA 2K2JA 1D5MC 2D3AA 1PUTA 1Q1OA 2NS5A 3VAWA 5CHWA 2NTSA 1SGHA 1ACCA 1OY2A 4AWJA 3VTWA 1ST7A 1QKZA 5DIFB 2PEAA 2UU7A 2EJ8A 3B2GA 5FR6A 4WIPA 1ZC4B 4MGYE
chains in the Genus database with same CATH topology
3R7RA 4KV2A 4TKNA 2KNBA 3N7CA 5J3QA 1Z87A 4YONA 4EMOA 1PLSA 4KZ0A 5L95C 2L8JA 2CRFA 3ENEA 1IP9A 2D4QA 3RULA 3HK0A 5HE2A 2G3QB 4GGQA 2HD5B 3KUDB 2MBEA 3DVNU 3PVUA 5DHFB 2HJ8A 3WANA 2JXXA 2R82A 2NR2A 3ML9A 1ACAA 1J19A 3TO1A 3BINA 1LFDA 1K8RB 2RGFA 2A5UA 4OVUA 1HB8A 5KCVA 3EFUA 1KOTA 3VVWB 2YS5A 4WAAA 2GCJA 4NJ7A 3IBEA 2WH5A 1JRUA 1UNQA 1X86A 2BGFA 4K17A 4IAPA 1T0YA 1DYNA 2KDIA 4NQLB 2LD9A 3D8EA 4DXAB 2KC1A 3QK0A 5DCNA 5TR5A 2QKLA 1JDEA 4IW0A 1SIFA 4HCPB 2L1CA 1MG8A 4IC7B 3JSVA 5BO4B 2FNJB 4JQWC 2PJHA 2D9ZA 4PS8A 3W1YA 4EUTA 1VD2A 5D3YA 4NNJB 4BKTA 4EEWA 3B0AA 3ZVRA 3ALBA 2C9WB 3WIMA 4JGHB 4WWNA 3LJUX 3OAWA 1DDVA 3PREA 2LOXA 2Z0QA 2IO2B 3RCPA 1NI2A 3PEGA 1Y5OA 2GCLA 3UF8A 5C5BA 2I5CA 3W1SA 4GMVA 2COPA 2DZKA 4AJYB 4B6HA 3CXBB 4PS7A 2NBWB 3U7DA 2N9EB 3SDLC 2KTRA 3EECA 1LB1A 4GDKA 1EF5A 2UYZB 1YIWA 1BT0A 4F7UP 3QIJA 1PQSA 1C1YB 4MSMB 2VKIA 2IO1B 4MGKE 2UVMA 4XX5A 2D9WA 3QHTA 1QZEA 2IY1B 3ZNHB 2LVOA 5KHQA 5JVLA 3A8QA 2YLMA 5LXHA 1XR0B 2O2VA 1YD8U 1MIXA 1E8WA 1CMXB 1WJNA 3IVFA 4F1SA 2DYOA 1P6SA 2WWZA 3RCZA 5IA7A 1QQGA 1WFYA 4A6KA 3Q3JA 3L0WB 2BKRB 4EJNA 4KHBB 3RD2A 2CS4A 4B6WA 5FI1A 3GZNI 2G45B 2EMTA 2WDTB 1Z2MA 3KVFB 3NZSA 4MGZE 2HTHA 3M62B 1PMSA 4OVVA 4K2OA 3GOEA 1KJTA 1WXAA 3QCAA 4DHZB 1TQZA 1UPRA 2LULA 4MGIE 1WGHA 4FBJB 2KQSA 3D8DA 4JL9A 2RSUA 2K8HA 1WXMA 2KDFB 1WXSA 3MPXA 5JHBA 3E9LA 2KOXA 3VXWA 4HB3B 1WE7A 2JP2A 3A1QB 3SD5A 2J59M 1GGOA 3ZRCA 2GBRA 4KAXB 3CSFA 1EO6A 1RAXA 3WAPA 4GDLA 1PFJA 1ZVRA 1WG7A 2B3AA 4HK2A 2BCJA 4FULA 3SBTA 2DFKA 5CHVC 2IZVB 2LOZA 5KQ1A 4NAWA 5CTRC 3VFKA 4ZYNA 4ASWC 1VBHA 3ZIMA 1TZ1A 3UINB 2DKQA 2N9XA 2GJYA 2JZ3B 2KC2A 3WA0A 3PSCA 3IG3A 2MBOA 2WX1A 4FA6A 1WJ1A 4HDQA 4NPNA 4XC2A 5EDSA 1VBGA 2ADZA 1B55A 3NSUA 3DOWA 3P2BA 3D8FA 4FHKA 1WR1A 1E8YA 5G55A 4B9KA 4M8MA 4TQ0A 4K7WA 1WI0A 2LUEA 2ZPNA 1XKEA 1U5FA 2COAA 2ZNVB 1NTIA 1EGXA 2KN5A 1NTYA 4GN1A 1LW3A 2VRWB 1UZXB 1WM3A 2BPSA 4K2PA 1W1GA 3N30A 4HB0B 3D32A 3QA8A 2V1YA 2C7NB 3RZWC 2COCA 2N1VA 5AZGA 1FB8A 2GMIC 2PZ1A 2GBKA 3NZUA 1WJUA 2G35A 5D6JB 4K7UA 4HVBA 1MK9B 4TV3A 1L2NA 4IOYX 2IO0B 2L0FA 4XWXA 2Y5BB 3L13A 2DTCA 4MH0E 2KWUB 2COFA 3ZNID 2N9PC 3VDZA 3PVLA 1VCBA 3H7SA 3V6CB 4G0NB 4HAVB 3ZW3A 1V6EA 4P7IA 2RR9A 3DBSA 4JKFA 2ROZB 3SU8X 4NAWB 3MDBC 1U29A 2L0TA 3M1IB 5C23A 3QQ8B 1FGZA 3AXCA 1BAKA 2CHXA 2KCJA 2MX2A 3A9KA 3PVWA 2Z0PA 1GNUA 5CX3A 4DWFA 4ILJA 1G6JA 4AOFA 1M94A 3N32A 1F9JA 2JT4B 2KDEB 1ZKHA 4MSQB 2ZJDA 1I42A 3DCGA 3DVGY 1WJ4A 4GB9A 2KANA 2DZJA 4RM9A 4DHZE 3O65B 4HAXB 4TQ1A 1EUVB 2LRWA 4GSWA 2DYBA 2BYFA 4FJZA 3KY9A 1IYFA 3A9JA 1NTVA 1OMWA 3RZFA 2G4DB 3TFMA 1RRPB 1IPGA 4JKBA 3DXEA 1GC6A 1UPQA 5DI9B 5IAAC 5DHAB 5D3WA 4WWOA 4II2B 5J18A 2PE6B 2D9VA 2J0KA 5DPTA 2BYVE 3PLVA 3EPYA 1Q5WB 1YX6B 1DIKA 2BF8B 4W9HA 1E90A 4W9IA 5HE1A 2MWNB 4WWPA 4MEMA 5E6OA 3L17A 1UBIA 2Z0DB 2W2XD 2VRRB 3ULCA 1U5GA 3QBVB 4DBBA 2PE9A 5J3TA 4A20A 2LYDA 4IFSA 2K8CA 1M7RA 1M7EA 4ICVA 4BOSC 5D3VA 3QC8B 1WJ6A 3M63B 2NMBA 2ZZPB 2P0HA 3DVGX 4F7GA 2R0DA 2MBBB 4A5KA 2DA0A 5J2RA 2KWVB 5D2MB 2H7EA 2OTXA 3IFWB 3VUXA 2L7RA 3BY4B 1SHCA 2XQNM 1ZC3B 4NQKE 1GC7A 3BJIA 3FSSA 2QHOA 2D9XA 2MQJA 2DZIA 4CO7A 2NPTB 2P8VA 2K6QA 3NY5A 1LXDA 3DPDA 4WQOB 3HQCA 2W9NA 3E9OA 2FAZA 2LG1A 1LM8B 3JYUA 2FCSA 3CF6E 5CLLB 1KZ7A 1YQBA 3L54A 2ZEQA 4EFOA 1RLFA 2KWCA 3PT2B 4MK0A 3UQBA 4FJVB 2MDXA 3V62A 2L2IA 2KMCA 2LBBA 2GS0A 2YT0A 1WM2A 3E9PA 2RGNB 2LWPA 3UGBB 4H8SA 3LJ3A 3CMMB 3UQAA 2QKMA 1V86A 2KJHB 4ANVA 2JF5A 2MSED 1WGRA 4EZJA 2R09A 1XCGA 5CHFA 3A9JB 2IYDB 4ZRIA 5E6NA 4I6PA 2V3SA 4LDTD 1W1HA 4GDLB 2KUPA 2AEHA 5DPSA 3ODWA 5J3YA 3VTUA 1QC6A 1KC7A 2LASA 4CYEA 2KK8A 4M0WB 3RUIB 2Y7BA 1X1FA 3ZNGC 3SBGA 3A4SC 2OJRA 1V5MA 5JLJB 4I6LB 4BKSA 1V5TA 2DN6A 3QX1A 1J0WA 2CAYA 1WE6A 2M4NA 3PRPB 4MDKE 1UEFA 1XX0A 4RMAA 1V2YA 3KH0A 2C5LC 4A6FB 4EZKA 4JLCA 1V5UA 4NY0A 2FIDA 1V5PA 3DQVA 1Z5SB 1A5RA 1P9DU 4WJQA 1H10A 2KO3A 1H4RA 3MTNB 1HE8A 1UNRA 3UZTA 4LDTB 1WVHA 5C6RA 2LVPA 2LGDA 3R3MA 2LRUA 3VOQA 5LLIA 4FADA 2YS1A 3AJ4A 5C16A 2FCMA 3QWZB 1U2BA 2CODA 4Z2NA 2IBIB 1R4NI 3O96A 2NBUA 1FHOA 1GUAB 3RT3B 5AZHA 2IO3B 2UWQA 3ODXA 4HB2B 2RSGA 2R2OA 5E6PA 1OQNA 2UZSA 2N23A 4FJYA 4MM3A 2CR5A 3QJZA 3WALA 4URKA 2LZ6A 3U30A 2MP2B 1WGQA 4WJPA 3OANA 3APDA 4F7HA 3ZNZB 1FGYA 2O6VD 2KFJA 3TIXA 1WGYA 2IFSA 2Z0OA 3K9PB 2X0SA 2N0YA 2ZVNA 2K2UA 2YT1A 1S1QB 2I5FA 1U5EA 3KW5B 2AYOB 1TTNA 3SUZA 2KTRB 2DYMA 3H7PB 1V88A 1WYWB 5EFXA 2J7QB 3AULA 2G4SA 2XEWA 3MHSD 3KRXA 3C0RB 2HRJA 2LVQA 2FDQA 4HAZB 4WSFA 1MK7B 2KJ6A 1FOEA 1OQYA 2YSZA 5JHHA 1D3ZA 2FJLA 2DHIA 1U27A 5HE3A 1LQBA 1WGUA 4GPTB 4MELA 1EVHA 4BBNF 2HE7A 4ICUA 2DHKA 1KM7A 5DH9B 5JHGA 3QAQA 1WX9A 1RJ2A 2N4FA 2ZCCA 3P6AA 4IM3A 3PRZA 1MKEA 2NPTA 3S2AA 1X11A 3A98B 4HAUB 1KBLA 3NOBA 3AU4A 1P1AA 2O6VB 1E5WA 5DPWA 1BTKA 2E2XA 3N3KB 3VH3B 4CHJA 2J0JA 2CKHB 1BTNA 2DIKA 4W9JA 3TVVA 2FJ9A 2ASQA 3ML4A 3VUWA 1V81A 4LJPB 3KYCD 3A9KB 3SNHA 3A4RA 1WZ0A 3FEHA 2NBVB 2BWES 4CHMA 1OEYJ 2KQ7A 2N1WA 1OTRB 3P7ZA 3NS8A 3PP2A 2NZ8B 3VUYA 2KKCA 1FHXA 2K00A 5JHAA 2RNRB 3PZDA 2DX5A 4W9LA 3TMPB 2LJ5A 2WYQA 4JKHA 3DXCA 2LXAA 2P0FA 4A6HA 4W9DA 4KDLB 3ZTCA 3DDCB 4WVFB 4I6NB 2DAJA 4EZLA 3U8ZA 3V61A 1IRSA 1X1GA 2ELBA 4W9CA 3UIPB 1HB6A 4II3B 2FUHB 4Y94A 1R4MI 4BKSD 2K8BA 2D9YA 1K5GB 5C79A 2D07B 1AARA 4M8NA 2J0MA 5JP4A 4JK7A 1RRBA 5DPRA 2O2VB 2OOBB 2JUOA 2AL6A 3DBHI 2MRPA 4A3OA 2MW5A 4DK5A 3PV1A 1OEYA 1E8XA 4PYUA 3TL5A 3WAMA 1DDMA 2JRHA 2DYNA 5GOWB 3ODOA 3ONSA 3LDZE 3KSYA 1C3TA 3RYTA 2JZZA 3PRMB 3OLMD 2MCNB 3TBLD 3PHXB 3JSVB 3V6EB 2FCQA 5D94A 2R2QA 2K39A 1H8CA 1V49A 4D0NB 3PSEB 3KRWA 3I3TB 4ANUA 2JVCA 3L08A 2JRIB 4GU2A 1E7UA 4E3CA 2N7DA 1WX8A 2DX1A 2AL3A 3AI5A 2JY6A 2GOWA 3DVNV 3H1UA 3TJPA 1WXVA 2NCNA 4HJKA 1UBQA 5CLQB 4YL8A 1SE9A 4KHAA 4HPMB 3TCAA 1NVLA 1WR6E 3ZKJC 4JKEA 1X1MA 2KX0A 4JIOU 2MA9B 2H7DA 1I7AA 1UELA 5L81A 4GOCA 3PG7A 4F8CB 2DHZA 1DBHA 1WJMA 4FN2A 2N7EA 4DX8A 4MT7A 3ECIA 4KSLC 3PGEA 2KD0A 3CIKA 2KDBA 2DLWA 3H9DA 3H7PA 5FI0A 2M8SA 2D3GA 5JH5C 2RPQA 4WJ7A 4N9F4 4DDGD 1WMHB 1P3RA 2VSZA 3PS6A 4E71A 4BOZB 2RVBB 4G50A 1UH6A 2BKFA 4A6FA 1RFAA 1J0GA 1Q0WB 1P0RA 1WGDA 2M1MA 4KSKC 3ZDMC 1WI1A 3JVZX 1ZW7A 2YRYA 1WGGA 4GMXB 2O6VA 4HXDA 4DHJD 4NJ6A 4JKDA 3SYXA 4X57B 4AUQC 1OGWA 1GG3A 3EHVA 1ISNA 2KGXB 2ZVOA 5LXIB 4KDIC 4DBGA 1TBEA 2GBMA 3WYFB 2L00B 3APFA 2CHZA 3PHWB 2KFKA 2JPHA 4IG7B 2RQ1A 1Y8RC 1WF9A 4MJSB 2YF0A 4KZCA 4PNKA 2EKEC 1Y19B 1J8CA 1WY8A 1WX7A 3ZLZA 2XK5A 1XD4A 4TUUA 1EF1A 2KVRA 4W9GA 4K7SA 2DAFA 4AP4C 1P98A 3HM6X 4JK9A 2I1KA 2Z0EB 2K6DB 3V5WA 4BVUC 2D11A 1N3HA 1YX5B 3F0WA 2KFKB 3CSTA 2KHWB 3ZDTA 1DDWA 2C7HA 1E7VA 1U4AA 1BWNA 3T8MA 3DBLI 1XD3B 2KMAA 4J6IA 3QWMA 3SO6A 4E74A 3H6NA 4ILGB 2HTHB 2ZPYA 1AQCA 2LGYA 3VTVA 3E66A 2X18A 4CHKA 1DROA 4ZDVA 5LOPB 3VIAA 4WJNA 2ZCBA 4KIKA 2Y8GA 3B08A 4JKCA 4ANXA 2XBBC 4IWPA 1UNPA 4JK8A 2LXCA 3KZ1A 2L05A 3M95A 4BKGA 5LONB 4HATB 3OJ3A 4AJWA 1V89A 2ABDA 4PS3A 2FCNA 3PTFC 2M17A 2DHJA 1WH3A 4KVGB 2BYEA 1HBKA 3TW1A 1FAOA 3ULBA 1FHWA 3JW0X 4FHJA 3SHQA 3WAOA 4GDKB 3KYDD 4MJSA 3GYPA 3HHMA 1I2HA 1KZGA 3B1LX 4EKUA 2REXA 2DENB 4ANWA 2KX3A 4JKGA 3G9WA 4F7ZA 4HCNB 1TXDA 5D3XA 2M14A 1KLVA 4XZ4A 5AEKB 4IWQA 2DZMA 3W1SC 2OQBA 1V80A 3L10B 3DXDA 4EOYA 4DX90 3M3JA 5KHOA 1GJZA 1MIZB 1K5DB 1NU2A 2IYBA 4MY6A 4G11A 2L3ZA 3T06A 1AWEA 2RLOA 2DX5B 3HIZA 5GMVA 3KUZA 4NSWA 4BBNC 1S3SG 5D27A 3VHTC 2ELAA 2KLCA 2L76A 2AWTA 2KLGA 2D2QA 4KHOA 4DDID 2MP2A 3HW2B 5HE0A 3X0WA 3A1QA 4DHJB 2MFQA 4W9FA 4GZUA 2YS3A 1XQQA 5IJMA 1UGMA 2C60A 4Z2MB 3X23A 2MLBA 2W2XC 2FIFA 3NHEB 4GXBA 2W2WA 2MWSB 2PPHA 4PQ0A 4W9KA 4LJOB 2LGXA 3KUCB 1W1DA 1P3QU 3A33B 4HPLB 2K1FA 3FM8C 2LI5A 4LCDE 3PPAA 1E8ZA 2CQUA 2IY0B 2EC1A 4W9EA 2CY4A 4ILHA 1TGZB 1MAIA 1X05A 1ZSQA 2MKRA 3ZUNA 4HB4B 4BFRA 2XK5B 1ZM0A 3OJ4B 1V5OA 5G2NA 3ZTDA 4TYZA 4IM0A 3F5RA 2K25A 2MBHA 1XODA 4IWOA 4K1RB 2RUKB 3A8PA 3HM3A 3ML8A 4BBKA 3T9LA 4PYZA 4JKGB 4A3PA 4JKAA 3VQIA 3R66C 2Q13A 1P5TA 2Z59B 1XT9B 5HKHA 2C7MB 2KTFA 5C5BB 1TJ6A 3ENBA 2MBQA 3ZVVA 2CHWA 4ZRJA 1WZ3A 2P0DA 2I1JA 2Y8FA 1UD7A 3EC8A 1I35A 2M38A 1ZGUB 2GBJA 2NVUI 3GYOA 2DKPA 1V61A 1L7YA 3VH4B 3V60A 1FXTB 2A4ZA 1V9JA 3ZRFA 2RD0A 4K81A 4RM8A 2KZRA 2D10A 5KQ4A 2CU1A 3K9OB 3PLUA 2WX0A 2KXJA 1EAZA 1NDDA 2BWFA 2V76A 5L83A 2YVCA 1KI1B 1WRDB 1MPHA 3QARA 1Q67A 2ZNVC 4HHVA 4B95A 1WIAA 5AZFA 3DBRI 2LKOA 4IM2A 2DYQA 4KIKB 4FLHA 2UZRA 5J17A 2CB8A 2KJRA 4HAWB 4G3XB 3MJWA 2M0XA 4GIVA 3FP5A 4HAYB 3SV1A 5C1ZA 3UIOB 4ZRKA 3FLVA 1U5DA 4C0AA 1YJ1A 3ZO5B 3L16A 2V4LA 4HWIB 1NBFC 2EMSA 4L6EA 3AU5A 4HDOA 3R7QA 4WJOA 3IHPC 2ROVA 1WMHA 3APCA 5D7GA 2CY5A 2GBNA 4IUMB 4HLEA 2JWZA 5JZEB 3Q3FA 2K2JA 3VAWA 1Q1OA 2NS5A 5CHWA 1SGHA 4AWJA 1OY2A 3VTWA 1ST7A 5DIFB 2PEAA 2EJ8A 5FR6A 1ZC4B 4MGYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P98 A;  3R7R A;  3HM6 X;  3K9P B;  3V6C B;  4G0N B;  2I1K A;  4KV2 A;  1G6J A;  4HAV B;  2Z0E B;  2K6D B;  3ZW3 A;  4TKN A;  2N0Y A;  1V6E A;  3V5W A;  2ZVN A;  2K2U A;  4P7I A;  4BVU C;  2RR9 A;  2D11 A;  1N3H A;  2YT1 A;  1YX5 B;  1S1Q B;  2KNB A;  3DBS A;  3F0W A;  2ROZ B;  3N7C A;  2KFK B;  5J3Q A;  3MDB C;  2KHW B;  3CST A;  4NAW B;  3SU8 X;  3ZDT A;  1DDW A;  1Z87 A;  2C7H A;  1E7V A;  1U29 A;  2I5F A;  4YON A;  4EMO A;  1U4A A;  2L0T A;  1BWN A;  1PLS A;  3M1I B;  4KZ0 A;  5L95 C;  1U5E A;  5C23 A;  3KW5 B;  3QQ8 B;  1FGZ A;  3DBL I;  2AYO B;  1XD3 B;  3T8M A;  1TTN A;  2KMA A;  3SUZ A;  2L8J A;  2KTR B;  2CRF A;  2DYM A;  4J6I A;  3H7P B;  1V88 A;  3QWM A;  3SO6 A;  3ENE A;  4E74 A;  1WYW B;  5EFX A;  1IP9 A;  3H6N A;  2J7Q B;  3AXC A;  2HTH B;  1BAK A;  2ZPY A;  2D4Q A;  1AQC A;  2CHX A;  3RUL A;  2LGY A;  2KCJ A;  3HK0 A;  2MX2 A;  5HE2 A;  2G3Q B;  4GGQ A;  3VTV A;  2HD5 B;  3KUD B;  3AUL A;  2MBE A;  3DVN U;  3PVU A;  2G4S A;  5DHF B;  2HJ8 A;  2XEW A;  3WAN A;  2JXX A;  3A9K A;  2X18 A;  2NR2 A;  3MHS D;  1DRO A;  3KRX A;  3PVW A;  4CHK A;  3C0R B;  5LOP B;  3VIA A;  4ZDV A;  4WJN A;  2HRJ A;  2Z0P A;  3VAW A;  1GNU A;  2ZCB A;  5CX3 A;  2LVQ A;  2FDQ A;  3ML9 A;  4KIK A;  4DWF A;  4HAZ B;  4WSF A;  2Y8G A;  3B08 A;  4ANX A;  2XBB C;  1ACA A;  1J19 A;  1UNP A;  3IBE A;  1MK7 B;  3TO1 A;  2KJ6 A;  4IWP A;  1FOE A;  4AOF A;  2LXC A;  3KZ1 A;  3BIN A;  1LFD A;  1M94 A;  1K8R B;  2YSZ A;  5JHH A;  1OQY A;  2RGF A;  3N32 A;  1D3Z A;  2FJL A;  2DHI A;  1U27 A;  5HE3 A;  1F9J A;  1LQB A;  1WGU A;  2JT4 B;  2A5U A;  4GPT B;  4OVU A;  4F8C B;  2KDE B;  1ZKH A;  4MEL A;  4MSQ B;  2ZJD A;  1I42 A;  1EVH A;  3DCG A;  3DVG Y;  4BBN F;  1HB8 A;  5KCV A;  1WJ4 A;  2HE7 A;  2KAN A;  2L05 A;  4GB9 A;  4ICU A;  3EFU A;  2O2V A;  1KOT A;  2DHK A;  1KM7 A;  2DZJ A;  5DH9 B;  3M95 A;  4RM9 A;  2YS5 A;  3VVW B;  4DHZ E;  4WAA A;  4BKG A;  5JHG A;  3O65 B;  4HAX B;  3QAQ A;  4TQ1 A;  2GCJ A;  4NJ7 A;  1EUV B;  1WX9 A;  2LRW A;  4GSW A;  2DYB A;  1RJ2 A;  5LON B;  2BYF A;  2WH5 A;  1JRU A;  1UNQ A;  4HAT B;  1X86 A;  3KY9 A;  2BGF A;  2N4F A;  2ZCC A;  3P6A A;  3OJ3 A;  1V89 A;  4K17 A;  4AJW A;  4IAP A;  2ABD A;  3PRZ A;  1MKE A;  4IM3 A;  1T0Y A;  4PS3 A;  2NPT A;  1IYF A;  3S2A A;  1DYN A;  1X11 A;  2FCN A;  2KDI A;  4NQL B;  3A98 B;  3A9J A;  3PTF C;  4HAU B;  2M17 A;  2DHJ A;  1NTV A;  2LD9 A;  3NOB A;  1OMW A;  3D8E A;  1WH3 A;  4DXA B;  2KC1 A;  4KVG B;  3QK0 A;  2BYE A;  3RZF A;  1HBK A;  3AU4 A;  1FAO A;  3TW1 A;  1P1A A;  5DCN A;  5TR5 A;  2QKL A;  3TFM A;  1RRP B;  3ULB A;  2G4D B;  2O6V B;  1IPG A;  1FHW A;  4IW0 A;  3JW0 X;  4FHJ A;  3SHQ A;  1E5W A;  1GC6 A;  1UPQ A;  3DXE A;  4GDK B;  3WAO A;  5DPW A;  1J0G A;  3KYD D;  1BTK A;  5DI9 B;  1SIF A;  4MJS A;  3GYP A;  3HHM A;  3WIM A;  5IAA C;  4HCP B;  5DHA B;  1I2H A;  2E2X A;  2L1C A;  5D3W A;  1KZG A;  1MG8 A;  4WWO A;  4IC7 B;  3B1L X;  4II2 B;  5J18 A;  4EKU A;  2PE6 B;  3JSV A;  5BO4 B;  2D9V A;  2REX A;  2FNJ B;  3N3K B;  2J0K A;  3VH3 B;  4CHJ A;  4JQW C;  5DPT A;  2J0J A;  2CKH B;  2DEN B;  2PJH A;  2BYV E;  4ANW A;  2D9Z A;  4G3X B;  1BTN A;  2KX3 A;  4FJZ A;  3G9W A;  4PS8 A;  3W1Y A;  3PLV A;  4W9J A;  4EUT A;  3EPY A;  4F7Z A;  1Q5W B;  1YX6 B;  4HCN B;  1TXD A;  1VD2 A;  5D3X A;  2M14 A;  3TVV A;  5D3Y A;  2FJ9 A;  2ASQ A;  3ML4 A;  1KLV A;  2BF8 B;  4NNJ B;  4XZ4 A;  4BKT A;  4EEW A;  3VUW A;  4IWQ A;  3B0A A;  3ZVR A;  3ALB A;  5AEK B;  4W9H A;  1V81 A;  2C9W B;  2DZM A;  3W1S C;  2OQB A;  1E90 A;  1V80 A;  3DXD A;  3L10 B;  4DX9 0;  3M3J A;  4LJP B;  3KYC D;  3A9K B;  4W9I A;  3SNH A;  4JGH B;  4WWN A;  5HE1 A;  5KHO A;  3A4R A;  1WZ0 A;  2MWN B;  3FEH A;  2NBV B;  4WWP A;  1MIZ B;  4EOY A;  1GJZ A;  1K5D B;  1NU2 A;  2IYB A;  4MY6 A;  4G11 A;  2L3Z A;  4MEM A;  3T06 A;  2BWE S;  5E6O A;  3LJU X;  4CHM A;  3L17 A;  1UBI A;  1AWE A;  2RLO A;  3OAW A;  1DDV A;  1OEY J;  2KQ7 A;  2N1W A;  3PRE A;  1OTR B;  2Z0D B;  2DX5 B;  2W2X D;  2LOX A;  3P7Z A;  3NS8 A;  3PP2 A;  2Z0Q A;  2IO2 B;  3HIZ A;  5GMV A;  3KUZ A;  4NSW A;  3RCP A;  4BBN C;  4AP4 C;  1NI2 A;  5D27 A;  1S3S G;  2VRR B;  2NZ8 B;  3ULC A;  1U5G A;  3QBV B;  4DBB A;  3PEG A;  3VUY A;  1Y5O A;  2GCL A;  2PE9 A;  3VHT C;  2KKC A;  5J3T A;  1FHX A;  5C5B A;  3UF8 A;  2I5C A;  3W1S A;  2K00 A;  2ELA A;  4GMV A;  5JHA A;  4A20 A;  2LYD A;  2RNR B;  2KLC A;  4IFS A;  2K8C A;  2COP A;  2L76 A;  3PZD A;  1M7R A;  2DX5 A;  2D2Q A;  1M7E A;  4B6H A;  2AWT A;  2DZK A;  2KLG A;  4W9L A;  4AJY B;  4KHO A;  3TMP B;  4ICV A;  2LJ5 A;  2WYQ A;  3CXB B;  4PS7 A;  4BOS C;  5D3V A;  3DXC A;  2NBW B;  4DDI D;  3U7D A;  2LXA A;  2N9E B;  2P0F A;  3QC8 B;  2MP2 A;  4A6H A;  2KTR A;  3SDL C;  4W9D A;  3HW2 B;  1WJ6 A;  5HE0 A;  3EEC A;  4KDL B;  3X0W A;  3ZTC A;  3DDC B;  3A1Q A;  1LB1 A;  4DHJ B;  3M63 B;  2NMB A;  4WVF B;  2P0H A;  2DAJ A;  2ZZP B;  3DVG X;  4I6N B;  4F7G A;  2MFQ A;  2R0D A;  2MBB B;  4GDK A;  4A5K A;  4W9F A;  4EZL A;  2DA0 A;  3U8Z A;  4GZU A;  2YS3 A;  3V61 A;  1EF5 A;  1XQQ A;  5J2R A;  1IRS A;  1X1G A;  2KWV B;  5D2M B;  2UYZ B;  3V60 A;  5IJM A;  1YIW A;  2H7E A;  1BT0 A;  2OTX A;  4F7U P;  1UGM A;  2ELB A;  3QIJ A;  1PQS A;  4W9C A;  1C1Y B;  2C60 A;  4MSM B;  1HB6 A;  3UIP B;  4Z2M B;  3X23 A;  2FUH B;  2MLB A;  3IFW B;  4II3 B;  4Y94 A;  1R4M I;  3VUX A;  5HKH A;  4BKS D;  2L7R A;  2K8B A;  2D9Y A;  1K5G B;  3BY4 B;  5C79 A;  1SHC A;  2VKI A;  2W2X C;  2D07 B;  2IO1 B;  2XQN M;  4MGK E;  2FIF A;  3NHE B;  1ZC3 B;  2UVM A;  1AAR A;  4NQK E;  4XX5 A;  4M8N A;  1GC7 A;  2J0M A;  2D9W A;  3FSS A;  3BJI A;  5JP4 A;  1RRB A;  4GXB A;  2QHO A;  3QHT A;  5DPR A;  2D9X A;  2W2W A;  2MQJ A;  2O2V B;  2MWS B;  2PPH A;  1QZE A;  4PQ0 A;  2OOB B;  2DZI A;  4W9K A;  2IY1 B;  2JUO A;  2P8V A;  2NPT B;  2AL6 A;  2LVO A;  4LJO B;  3ZNH B;  2K6Q A;  3NY5 A;  2LGX A;  3KUC B;  1W1D A;  3DBH I;  5KHQ A;  2MRP A;  1P3Q U;  3A33 B;  4A3O A;  3RD2 A;  4HPL B;  2K1F A;  2MW5 A;  1LXD A;  3FM8 C;  2LI5 A;  3DPD A;  4WQO B;  4DK5 A;  3PV1 A;  1OEY A;  3HQC A;  2W9N A;  1E8X A;  4PYU A;  4LCD E;  3A8Q A;  3PPA A;  2YLM A;  5LXH A;  2FAZ A;  3TL5 A;  3WAM A;  1XR0 B;  1DDM A;  2LG1 A;  1LM8 B;  2DYN A;  1E8Z A;  1YD8 U;  2JRH A;  1MIX A;  2CQU A;  2IY0 B;  5GOW B;  3ODO A;  3JYU A;  2EC1 A;  3ONS A;  2FCS A;  1E8W A;  1CMX B;  1WJN A;  5CLL B;  3CF6 E;  3LDZ E;  1KZ7 A;  3KSY A;  1YQB A;  3IVF A;  4F1S A;  2DYO A;  1C3T A;  1P6S A;  3RYT A;  4W9E A;  2WWZ A;  2CY4 A;  2JZZ A;  1TGZ B;  3PRM B;  3RCZ A;  5IA7 A;  3L54 A;  3OLM D;  1QQG A;  2ZEQ A;  1MAI A;  2MCN B;  3TBL D;  3PHX B;  4EFO A;  3JSV B;  3V6E B;  2FCQ A;  1X05 A;  1RLF A;  4A6K A;  1WFY A;  5D94 A;  1ZSQ A;  2KWC A;  3PT2 B;  3Q3J A;  2R2Q A;  3L0W B;  2BKR B;  2MKR A;  4MK0 A;  2K39 A;  1H8C A;  3ZUN A;  3UQB A;  4FJV B;  4HB4 B;  4EJN A;  4KHB B;  1V49 A;  4BFR A;  2MDX A;  3V62 A;  4D0N B;  2XK5 B;  1ZM0 A;  2L2I A;  3KRW A;  1V5O A;  2CS4 A;  2KMC A;  2LBB A;  4TYZ A;  3OJ4 B;  3PSE B;  3I3T B;  5FI1 A;  5G2N A;  3ZTD A;  2GS0 A;  4ANU A;  4IM0 A;  3F5R A;  3GZN I;  2K25 A;  2JVC A;  2G45 B;  2EMT A;  3L08 A;  2MBH A;  2WDT B;  1XOD A;  1Z2M A;  2JRI B;  1E7U A;  3KVF B;  4GU2 A;  4IWO A;  2YT0 A;  1WM2 A;  4K1R B;  2RUK B;  3NZS A;  3A8P A;  4E3C A;  2N7D A;  4MGZ E;  3HM3 A;  2RGN B;  3ML8 A;  2HTH A;  1WX8 A;  3M62 B;  4BBK A;  3T9L A;  2DX1 A;  2LWP A;  3UGB B;  4PYZ A;  2AL3 A;  4A3P A;  1PMS A;  3VQI A;  4OVV A;  4K2O A;  4H8S A;  2Q13 A;  3GOE A;  3LJ3 A;  3R66 C;  1KJT A;  1WXA A;  3AI5 A;  3CMM B;  3UQA A;  2QKM A;  2JY6 A;  3QCA A;  1V86 A;  2GOW A;  2KJH B;  4ANV A;  4DHZ B;  3DVN V;  1TQZ A;  1UPR A;  1P5T A;  2LUL A;  2JF5 A;  4MGI E;  2MSE D;  3H1U A;  1WGR A;  3TJP A;  2Z59 B;  1WGH A;  4FBJ B;  1WXV A;  4EZJ A;  1XT9 B;  2KQS A;  3D8D A;  2R09 A;  2NCN A;  2C7M B;  1XCG A;  2KTF A;  5C5B B;  1TJ6 A;  2RSU A;  4HJK A;  4JL9 A;  5CHF A;  4CO7 A;  2K8H A;  1WXM A;  2MBQ A;  3ZVV A;  1UBQ A;  2KDF B;  5CLQ B;  4YL8 A;  3A9J B;  1SE9 A;  2CHW A;  2IYD B;  4ZRJ A;  4ZRI A;  2P0D A;  1WXS A;  1WZ3 A;  4I6P A;  3MPX A;  5E6N A;  5JHB A;  4KHA A;  2I1J A;  2Y8F A;  2KOX A;  2V3S A;  4HPM B;  3TCA A;  1UD7 A;  4LDT D;  3VXW A;  1NVL A;  1W1H A;  4GDL B;  3EC8 A;  2KUP A;  4HB3 B;  1WE7 A;  1WR6 E;  1I35 A;  2M38 A;  3ZKJ C;  2JP2 A;  2AEH A;  1ZGU B;  2J59 M;  3A1Q B;  3SD5 A;  1X1M A;  2GBJ A;  2KX0 A;  5DPS A;  3ODW A;  3ZRC A;  5J3Y A;  2GBR A;  4KAX B;  2NVU I;  3GYO A;  3VTU A;  1QC6 A;  3CSF A;  2MA9 B;  4JIO U;  2H7D A;  1I7A A;  1EO6 A;  1UEL A;  2DKP A;  5L81 A;  1RAX A;  2LAS A;  4GOC A;  1V61 A;  4CYE A;  1L7Y A;  2KK8 A;  4M0W B;  3WAP A;  4GDL A;  3PG7 A;  3RUI B;  1PFJ A;  1ZVR A;  3VH4 B;  2Y7B A;  1X1F A;  1WG7 A;  1FXT B;  1V9J A;  2A4Z A;  2DHZ A;  2RD0 A;  3A4S C;  4K81 A;  2B3A A;  4HK2 A;  3ZNG C;  2BCJ A;  2OJR A;  1DBH A;  1V5M A;  1WJM A;  5JLJ B;  4FUL A;  4I6L B;  4FN2 A;  2DFK A;  2N7E A;  2IZV B;  5CHV C;  4BKS A;  4DX8 A;  4RM8 A;  4MT7 A;  2KZR A;  2D10 A;  2LOZ A;  1V5T A;  5KQ4 A;  5KQ1 A;  2DN6 A;  3ECI A;  4NAW A;  4KSL C;  3QX1 A;  5CTR C;  1J0W A;  3PGE A;  2CAY A;  2KD0 A;  3VFK A;  1WE6 A;  2CU1 A;  3K9O B;  4ZYN A;  4ASW C;  3PLU A;  3CIK A;  2KDB A;  2WX0 A;  3ZIM A;  2KXJ A;  2M4N A;  3PRP B;  2DLW A;  3H9D A;  4MDK E;  1TZ1 A;  1UEF A;  1XX0 A;  3H7P A;  3UIN B;  1EAZ A;  1NDD A;  5FI0 A;  2M8S A;  2DKQ A;  2D3G A;  4RMA A;  2N9X A;  5JH5 C;  1V2Y A;  2BWF A;  2GJY A;  2V76 A;  5L83 A;  2YVC A;  1KI1 B;  2JZ3 B;  2RPQ A;  1WRD B;  2KC2 A;  4WJ7 A;  3KH0 A;  4N9F 4;  4DDG D;  1WMH B;  3WA0 A;  2C5L C;  1MPH A;  4A6F B;  3QAR A;  3PSC A;  1Q67 A;  1P3R A;  2VSZ A;  2ZNV C;  4JLC A;  3ZRF A;  4EZK A;  3PS6 A;  4HHV A;  4BOZ B;  4E71 A;  2RVB B;  1V5U A;  4B95 A;  1WIA A;  3IG3 A;  4G50 A;  5AZF A;  3DBR I;  2LKO A;  2MBO A;  4NY0 A;  4IM2 A;  2WX1 A;  4FA6 A;  1UH6 A;  1WJ1 A;  4HDQ A;  2FID A;  4NPN A;  2BKF A;  1V5P A;  3DQV A;  2DYQ A;  4KIK B;  1J8C A;  4FLH A;  1Z5S B;  2UZR A;  2ADZ A;  2CB8 A;  4XC2 A;  5EDS A;  5J17 A;  2KJR A;  1B55 A;  1A5R A;  3NSU A;  4A6F A;  1RFA A;  1P9D U;  3DOW A;  4WJQ A;  4HAW B;  3MJW A;  1H10 A;  2KO3 A;  3D8F A;  3P2B A;  1Q0W B;  1H4R A;  1WR1 A;  4FHK A;  1E8Y A;  5G55 A;  4B9K A;  4M8M A;  1P0R A;  3MTN B;  1HE8 A;  4TQ0 A;  1UNR A;  3UZT A;  2M0X A;  4LDT B;  1WGD A;  1WVH A;  4K7W A;  4GIV A;  3FP5 A;  1WI0 A;  2M1M A;  5C6R A;  2LUE A;  2ZPN A;  1XKE A;  2LVP A;  4KSK C;  1U5F A;  2COA A;  2ZNV B;  3ZDM C;  2LGD A;  3R3M A;  1WI1 A;  2LRU A;  4B6W A;  3JVZ X;  1NTI A;  1EGX A;  1ZW7 A;  3VOQ A;  2YRY A;  2KN5 A;  1NTY A;  4GN1 A;  1LW3 A;  1WGG A;  5LLI A;  2VRW B;  4FAD A;  2YS1 A;  4HAY B;  1UZX B;  3AJ4 A;  1WM3 A;  4GMX B;  2BPS A;  2O6V A;  4HXD A;  4DHJ D;  4K2P A;  1W1G A;  3SV1 A;  4NJ6 A;  5C16 A;  2FCM A;  3N30 A;  4HB0 B;  3D32 A;  3QWZ B;  5C1Z A;  1U2B A;  2COD A;  3SYX A;  3UIO B;  4ZRK A;  4X57 B;  3FLV A;  1U5D A;  4AUQ C;  1OGW A;  3QA8 A;  2V1Y A;  1GG3 A;  4C0A A;  4Z2N A;  1YJ1 A;  2IBI B;  3EHV A;  3L16 A;  3ZO5 B;  1R4N I;  2C7N B;  2V4L A;  2COC A;  1NBF C;  4HWI B;  3RZW C;  2N1V A;  1ISN A;  3O96 A;  2KGX B;  2NBU A;  5AZG A;  2ZVO A;  5LXI B;  2EMS A;  1FHO A;  4L6E A;  4KDI C;  4DBG A;  1FB8 A;  3AU5 A;  1GUA B;  1TBE A;  2GBM A;  3WYF B;  2GMI C;  2L00 B;  3APF A;  5AZH A;  3RT3 B;  2PZ1 A;  2IO3 B;  2UWQ A;  2CHZ A;  2GBK A;  4HDO A;  3R7Q A;  4WJO A;  3IHP C;  3PHW B;  3ODX A;  4HB2 B;  3NZU A;  2KFK A;  2JPH A;  4IG7 B;  2ROV A;  2RSG A;  2R2O A;  5E6P A;  2RQ1 A;  1OQN A;  1WJU A;  2UZS A;  1WMH A;  1Y8R C;  3APC A;  2N23 A;  1WF9 A;  2CY5 A;  4FJY A;  2G35 A;  4MJS B;  5D6J B;  2YF0 A;  5D7G A;  4K7U A;  4MM3 A;  2GBN A;  4HVB A;  1MK9 B;  4KZC A;  4TV3 A;  1L2N A;  4IOY X;  2CR5 A;  4IUM B;  2IO0 B;  2L0F A;  3QJZ A;  2JWZ A;  4XWX A;  3WAL A;  4PNK A;  2Y5B B;  4HLE A;  5JZE B;  2EKE C;  2K2J A;  3L13 A;  3Q3F A;  2LZ6 A;  4URK A;  3U30 A;  2MP2 B;  1Y19 B;  2DTC A;  1Q1O A;  1WY8 A;  2KWU B;  1WX7 A;  2NS5 A;  2COF A;  4MH0 E;  1WGQ A;  2N9P C;  4WJP A;  5CHW A;  3ZLZ A;  3OAN A;  3ZNI D;  1SGH A;  4AWJ A;  1OY2 A;  2XK5 A;  3APD A;  3VDZ A;  1ST7 A;  1XD4 A;  4F7H A;  3VTW A;  3ZNZ B;  1FGY A;  5DIF B;  1EF1 A;  4TUU A;  3PVL A;  2KVR A;  2O6V D;  2PEA A;  4K7S A;  4W9G A;  1VCB A;  2KFJ A;  2EJ8 A;  3H7S A;  2DAF A;  5FR6 A;  1ZC4 B;  3TIX A;  1WGY A;  2IFS A;  2Z0O A;  4MGY E; 
#chains in the Genus database with same CATH topology
 4US9 A;  3R7R A;  4YTM B;  2I2Y A;  4CQN A;  4KV2 A;  4GNK B;  4YSY B;  3RI7 C;  4TKN A;  1V8C A;  2KNB A;  1BUI C;  3NJT A;  3N7C A;  5J3Q A;  1MHH E;  2M0A A;  2INP E;  1Z87 A;  5LG4 B;  2WXQ A;  4XE0 A;  4YON A;  4EMO A;  1PLS A;  4KZ0 A;  5L95 C;  3LXF A;  2Q5W D;  2L8J A;  2CRF A;  3ENE A;  1IP9 A;  2D4Q A;  3RUL A;  1PDX A;  4WWM A;  3HK0 A;  3FAH A;  1HXY D;  5HE2 A;  2G3Q B;  4GGQ A;  3RNB C;  2HD5 B;  3KUD B;  4ZHO A;  2MBE A;  1I7H A;  3DVN U;  3PVU A;  5DHF B;  2HJ8 A;  3WAN A;  2JXX A;  2R82 A;  3OG5 A;  2NR2 A;  1QOA A;  4N58 A;  1HTO A;  4R3D A;  1XLO A;  3PZ8 A;  4C80 A;  3ML9 A;  4RH6 A;  4DIX A;  1ACA A;  1J19 A;  3TO1 A;  2LGI A;  1F77 A;  3BIN A;  1LFD A;  1K8R B;  1EWC A;  2RGF A;  2V9H A;  2A5U A;  1T6B X;  4OVU A;  2EKI A;  1HB8 A;  5KCV A;  2L83 A;  3EFU A;  1KOT A;  3VVW B;  2YS5 A;  4WAA A;  2GCJ A;  4NJ7 A;  3B9J A;  3IBE A;  2WH5 A;  1JRU A;  1UNQ A;  1X86 A;  2BGF A;  4K17 A;  1EU4 A;  4IAP A;  1T0Y A;  2VH2 A;  1DYN A;  1N60 A;  2KDI A;  4NQL B;  1JWU D;  1WXQ A;  4D2K A;  2LD9 A;  3D8E A;  5HFY A;  5IP4 D;  4DXA B;  2KC1 A;  3QK0 A;  4Q2J A;  5DCN A;  5TR5 A;  2N9L A;  2QKL A;  1B1Z A;  2KMM A;  1JDE A;  2K0P A;  3LB8 C;  4IW0 A;  4LTU A;  3MP9 A;  1FXA A;  1SIF A;  4HCP B;  3N1X C;  2L1C A;  1MG8 A;  4IC7 B;  3JSV A;  5BO4 B;  2FNJ B;  4JQW C;  2BVC A;  5FR3 A;  2PJH A;  4A9A A;  2D9Z A;  5IO9 A;  4PS8 A;  3W1Y A;  3DBL B;  3ZXR A;  4EUT A;  1AYF A;  1VD2 A;  5D3Y A;  4NNJ B;  4BKT A;  4EEW A;  3AE6 B;  1P7F A;  3ETR A;  3B0A A;  3ZVR A;  3ALB A;  2C9W B;  2L1A A;  3WIM A;  2JYT A;  4JGH B;  4WWN A;  2V3P A;  3LJU X;  3OAW A;  1DDV A;  3PRE A;  2LOX A;  2Z0Q A;  2IO2 B;  3RCP A;  3Q8F A;  2JXT A;  1NI2 A;  3H8H A;  3VR8 B;  3BWU D;  3R8B A;  3PEG A;  1Y5O A;  3R2I A;  2GCL A;  2MHJ A;  3UF8 A;  5C5B A;  3NVV A;  2I5C A;  3W1S A;  4GMV A;  1GAQ B;  3Q69 A;  2COP A;  3GS2 A;  3IAM 1;  2DZK A;  4AJY B;  4B6H A;  2KIE A;  3TEZ A;  3CXB B;  4PS7 A;  1IBX B;  2WXR A;  2NBW B;  3U7D A;  2N9E B;  3SDL C;  2KTR A;  1CJE A;  3EEC A;  3J9C A;  1N6Z A;  1LB1 A;  4B0E A;  5JXV A;  4GDK A;  4UDU C;  1EF5 A;  1AWD A;  2UYZ B;  1YIW A;  3W5U B;  1BT0 A;  4F7U P;  3QIJ A;  1PQS A;  1C1Y B;  4MSM B;  4JWU C;  3U12 A;  1XCQ L;  2VKI A;  2IO1 B;  2K5P A;  4MGK E;  2LJI A;  2UVM A;  4LNO A;  4XX5 A;  2D9W A;  3QHT A;  3ZJU A;  1QZE A;  2INN E;  2IY1 B;  3ZNH B;  2LVO A;  3AH7 A;  5KHQ A;  5JVL A;  4LNF A;  1TKG A;  1JWM D;  2LFI A;  3A8Q A;  2YLM A;  3P1M A;  5LXH A;  1XR0 B;  2O2V A;  1YD8 U;  1MIX A;  2Y3A A;  1E8W A;  1CMX B;  1WJN A;  2BS4 B;  3IVF A;  4F1S A;  1TT5 B;  4RGO S;  2DYO A;  1P6S A;  1R4N B;  3AEB B;  2WWZ A;  1HTQ A;  3RCZ A;  5IA7 A;  1QQG A;  3AE3 B;  4HSI A;  3BVM A;  1WFY A;  4A6K A;  3Q3J A;  3L0W B;  2BKR B;  2WXM A;  4YSX B;  4EJN A;  4KHB B;  1PGB A;  3DBR B;  2CS4 A;  3RD2 A;  4B6W A;  2GI9 A;  5FI1 A;  2WDV B;  3NWF A;  3GZN I;  4ITK A;  2G45 B;  2EMT A;  2WDT B;  1Z2M A;  3KVF B;  1FCC C;  3PO0 A;  3NZS A;  4MGZ E;  2Z4D A;  2HTH A;  3M62 B;  1E10 A;  1PMS A;  4OVV A;  4K2O A;  2MH7 A;  3GOE A;  2G9H D;  1KJT A;  1WXA A;  2AQ3 B;  3DBH B;  2DBY A;  3QCA A;  5IRS A;  4DHZ B;  1TQZ A;  1UPR A;  2LUL A;  1FEH A;  4MGI E;  3BK1 A;  1WGH A;  4FBJ B;  2BS3 B;  2KQS A;  3D8D A;  4JL9 A;  2RSU A;  1STE A;  2K8H A;  1FO4 A;  1XLQ A;  1WXM A;  2KDF B;  4QXA B;  1WXS A;  2QMT A;  3MPX A;  5JHB A;  3ZQ4 A;  3E9L A;  2KOX A;  2XN9 C;  3RN9 C;  3VXW A;  1KF6 B;  3RNA C;  1K52 A;  4HB3 B;  1WE7 A;  1D6E C;  4XWW A;  2JP2 A;  3A1Q B;  3SD5 A;  2J59 M;  2ONQ A;  1GGO A;  5AUI A;  3ZRC A;  2QSD A;  2GBR A;  4KAX B;  3CSF A;  4HRS A;  1EO6 A;  2XNA C;  4HEA 1;  1KTK A;  1RAX A;  3WAP A;  4GDL A;  1PFJ A;  1ZVR A;  1I4X A;  1WG7 A;  2B3A A;  4HK2 A;  2BCJ A;  1HQR D;  1RYJ A;  4FUL A;  3SBT A;  2CU3 A;  2DWQ A;  1DOX A;  2DFK A;  3HVZ A;  2IZV B;  4P16 A;  5CHV C;  1FRD A;  2LOZ A;  5KQ1 A;  1CZP A;  2WU2 B;  4NAW A;  3AEA B;  5CTR C;  3VFK A;  3MC8 A;  4ZYN A;  3DCX A;  4ASW C;  1VBH A;  3B77 A;  3ZIM A;  2K49 A;  1SEB D;  2PVO D;  2QIE B;  1TZ1 A;  3UIN B;  2DKQ A;  2N9X A;  2GJY A;  3BYT B;  1ZE3 D;  2JZ3 B;  1FMA D;  2KC2 A;  1YN5 A;  3WA0 A;  2MEK A;  1VR9 A;  2PVG C;  3PSC A;  1MVK A;  3AED B;  3IG3 A;  3DHH C;  4OZB A;  2MBO A;  1FCL A;  1OQR A;  2WX1 A;  4FA6 A;  1WJ1 A;  4HDQ A;  4NPN A;  1TY0 A;  4XC2 A;  5EDS A;  1VBG A;  2ADZ A;  5BYQ A;  1B55 A;  3NSU A;  4N59 A;  3DOW A;  1TS5 A;  3ZXV A;  3P2B A;  3D8F A;  4FHK A;  1WR1 A;  1E8Y A;  5G55 A;  4B9K A;  1RWS A;  1SB3 C;  4M8M A;  4TQ0 A;  1QIL A;  4K7W A;  1WI0 A;  2LUE A;  1NEN B;  1XKE A;  1T5X D;  2ZPN A;  1U5F A;  2COA A;  2ZNV B;  3AB5 A;  2V0G A;  1JQ4 A;  2LGS A;  1NTI A;  1EGX A;  1FNV A;  2KN5 A;  1NTY A;  4GN1 A;  1LW3 A;  2VRW B;  2J53 A;  1UZX B;  1WM3 A;  2BPS A;  3BII D;  2WXF A;  4K2P A;  1W1G A;  3NW8 A;  3N30 A;  4HB0 B;  3D32 A;  2QJL A;  1SSN A;  3QA8 A;  2V1Y A;  1TS3 A;  2C7N B;  2RDH A;  2COC A;  3ABV B;  3RZW C;  2N1V A;  5AZG A;  1FB8 A;  4O1N A;  2GMI C;  5IN7 A;  2PZ1 A;  2GBK A;  3IAS 1;  2TSS A;  3NZU A;  1M4V A;  1WJU A;  2G35 A;  2ZW0 A;  5D6J B;  4K7U A;  4HVB A;  3C8Y A;  1MK9 B;  4TV3 A;  1L2N A;  4IOY X;  2IO0 B;  2L0F A;  4XWX A;  2Y5B B;  2BTE A;  3L13 A;  5MPO A;  2DTC A;  4MH0 E;  2KWU B;  2COF A;  3ZNI D;  2N9P C;  3VDZ A;  1JCK B;  1BML C;  3PVL A;  1VCB A;  2L52 A;  3H7S A;  1UNS A;  4QJ5 B;  4G0N B;  3V6C B;  3TUO A;  4HAV B;  3ZW3 A;  1QOB A;  1SF0 A;  4A90 A;  1V6E A;  4P7I A;  2RR9 A;  4L1B A;  2SAK A;  2RDG A;  3DBS A;  4JKF A;  1YJI A;  3U7Z A;  2ROZ B;  3SU8 X;  3AM9 A;  4NAW B;  3MDB C;  1U29 A;  2Y5C A;  2L0T A;  3M1I B;  5C23 A;  2FUG 1;  3QQ8 B;  1FGZ A;  2K9X A;  3HRD D;  1L5P A;  2IGD A;  3AXC A;  1BAK A;  2CHX A;  2GUM A;  2KCJ A;  2MX2 A;  2NMQ A;  2R2Y A;  3A9K A;  1YOV B;  3PVW A;  2Z0P A;  1GNU A;  1VJK A;  5CX3 A;  1SXT A;  4DWF A;  1T0R C;  2WXI A;  4ILJ A;  3AMZ A;  1G6J A;  4AOF A;  2KQ4 X;  2MJE A;  5BYR A;  1M94 A;  3N32 A;  1F9J A;  2KR0 A;  2JT4 B;  3RNC C;  2KDE B;  1ZKH A;  4MSQ B;  2WLB A;  2ZJD A;  1I42 A;  3DCG A;  3DVG Y;  1WJ4 A;  4GB9 A;  2KAN A;  1FIQ A;  3IT6 B;  2DZJ A;  4RM9 A;  4DHZ E;  5G5H A;  2WS3 B;  1RM6 C;  4A8X C;  3O65 B;  4HAX B;  4TQ1 A;  1FD6 A;  1EUV B;  2LRW A;  4GSW A;  2DYB A;  2M56 B;  2BYF A;  4FJZ A;  3KY9 A;  1I4Q A;  1DOY A;  2IGH A;  5EE1 A;  2BB5 A;  1IYF A;  3WCQ A;  3I5J C;  1C76 A;  3A9J A;  4L23 A;  4JX1 C;  3Q8B A;  3P4S B;  1NTV A;  1OMW A;  1J7B A;  2GB1 A;  3Q6B A;  3RZF A;  2G4D B;  3TFM A;  1RRP B;  4XDC A;  1IPG A;  1QT9 A;  1PGA A;  4JKB A;  3DXE A;  1GC6 A;  1UPQ A;  5DI9 B;  2WXN A;  5IAA C;  5DHA B;  5D3W A;  3E9S A;  4WWO A;  4II2 B;  5J18 A;  1UGJ A;  4KX6 B;  2PE6 B;  2D9V A;  2J0K A;  3L4P A;  5DPT A;  2BYV E;  3VRB B;  3PLV A;  3EPY A;  1LO5 D;  1Q5W B;  1YX6 B;  1TKY A;  1DIK A;  2ZKM X;  2BF8 B;  4C4V A;  4J3O D;  2PMV A;  3PZ7 A;  4W9H A;  1E90 A;  4W9I A;  3MHZ A;  5HE1 A;  2MWN B;  4WWP A;  1SE4 A;  4MEM A;  5E6O A;  3NVW A;  4QJ3 B;  1UBI A;  3L17 A;  2JWU A;  2Z0D B;  1VRA B;  2W2X D;  3HUI A;  2AQ2 B;  3MFG A;  3T3O A;  3TEW A;  2VRR B;  3ULC A;  5EE0 A;  1U5G A;  3QBV B;  4DBB A;  3VRA B;  2PE9 A;  2H88 B;  5J3T A;  2JSV X;  3O13 A;  4A20 A;  2LYD A;  2WXP A;  4IFS A;  2K8C A;  1UUP A;  1M7R A;  1M7E A;  5I2M A;  2QIL A;  4ICV A;  4BOS C;  5D3V A;  2V4I B;  3QC8 B;  1WJ6 A;  3P4R B;  3M63 B;  2NMB A;  2ZZP B;  2P0H A;  1GOZ A;  3DVG X;  4F7G A;  2R0D A;  2MBB B;  4A5K A;  2DA0 A;  5J2R A;  2KWV B;  5D2M B;  2H7E A;  2OTX A;  1FNW A;  1EWY C;  1L0X B;  2LHD A;  3IFW B;  3VUX A;  2L7R A;  2QEJ C;  3BY4 B;  1SHC A;  2BYT A;  2XQN M;  1ZC3 B;  5E6J A;  2WXH A;  4NQK E;  1B9R A;  1GC7 A;  3BJI A;  3FSS A;  2QHO A;  5IKC M;  2D9X A;  2MQJ A;  1AW7 A;  4YXD B;  2Z59 A;  1YMH E;  2DZI A;  4CO7 A;  2NPT B;  2P8V A;  2K6Q A;  2W55 A;  3NY5 A;  1SJH D;  2K8E A;  2WGS A;  4K3B A;  4JWS C;  1LXD A;  3DPD A;  4WQO B;  3HQC A;  2W9N A;  3E9O A;  2FAZ A;  3AE2 B;  2LG1 A;  1LM8 B;  5C2T B;  4GLS C;  1D5X C;  1C79 A;  4WUR A;  3JYU A;  2FCS A;  2OHF A;  3CF6 E;  5CLL B;  1KZ7 A;  1YQB A;  1C9F A;  2J4X A;  2J42 A;  1MJD A;  1JWB D;  5H8Y E;  3L54 A;  2CJO A;  2ZEQ A;  1KRH A;  1E7P B;  4EFO A;  1RLF A;  2KWC A;  3PT2 B;  3ZJT A;  1SJE D;  4MK0 A;  3UQB A;  4FJV B;  2MDX A;  3V62 A;  2L2I A;  2KMC A;  2RRF A;  2LBB A;  1T0S C;  1TS2 A;  2GS0 A;  2YT0 A;  1WM2 A;  1YNT E;  3E9P A;  2I38 A;  2RGN B;  1GPX A;  1YQ4 B;  2LWP A;  3UGB B;  4H8S A;  3LJ3 A;  5I2S A;  3Q8E A;  3CMM B;  1C77 A;  3FIL A;  3UQA A;  2QKM A;  1V86 A;  2KJH B;  4ANV A;  2RDB C;  1MI0 A;  3OWE B;  2JF5 A;  2MSE D;  1WGR A;  4EZJ A;  1NI3 A;  1ZOY B;  2R09 A;  1XCG A;  5CHF A;  3HIE A;  3A9J B;  4LK0 M;  2IYD B;  4ZRI A;  5E6N A;  4I6P A;  2V3S A;  3Q3M C;  4LDT D;  1W1H A;  4GDL B;  2KUP A;  1MPE A;  2AEH A;  5DPS A;  3ODW A;  5J3Y A;  3VTU A;  5I4D A;  3FVC A;  1QC6 A;  3RNG C;  1KC7 A;  2LAS A;  4CYE A;  2KK8 A;  4M0W B;  3RUI B;  2Y7B A;  1X1F A;  4FXC A;  3ZNG C;  4C00 A;  3SBG A;  3A4S C;  3IT4 B;  3BZD B;  2OJR A;  1V5M A;  5JLJ B;  4I6L B;  2PKO A;  1YQ3 B;  3RFZ B;  4BKS A;  1YJJ A;  5GXG B;  1V5T A;  2KYW A;  1C78 A;  2DN6 A;  1OQQ A;  3AEE B;  2FJU B;  2K22 A;  3QX1 A;  1J0W A;  3AV8 A;  2CAY A;  1WE6 A;  4PT5 A;  2M4N A;  3PRP B;  4MDK E;  1UEF A;  1XX0 A;  1PYW D;  4RMA A;  1V2Y A;  3KH0 A;  2C5L C;  2B76 B;  3BVG A;  3BVZ A;  4A6F B;  4EZK A;  4JLC A;  1OFF A;  1V5U A;  2NTT A;  4C56 C;  4NY0 A;  1QOG A;  2FID A;  2WDR B;  1V5P A;  2IGG A;  3DQV A;  3MC0 B;  4L1R A;  1R4M B;  1Z5S B;  5BMH A;  1A5R A;  1P9D U;  2VZK D;  4WJQ A;  4BZA A;  1GB4 A;  1H10 A;  2KO3 A;  4RGM A;  1H4R A;  2BW2 A;  3MTN B;  1HE8 A;  3TEX A;  3HSA A;  2AX5 A;  1UNR A;  3UZT A;  3AN1 A;  4LDT B;  1WVH A;  5C6R A;  2LVP A;  2LGD A;  3R3M A;  2LRU A;  2WDQ B;  1FRR A;  4XWT A;  1XEE A;  1ENF A;  2D5G A;  3VOQ A;  5LLI A;  4FAD A;  2YS1 A;  4RF0 A;  3P4Q B;  3AJ4 A;  4TMA B;  3C19 A;  5C16 A;  2FCM A;  3QWZ B;  3V3X A;  2KN4 A;  4S0R A;  1U2B A;  2COD A;  4Z2N A;  2IBI B;  2E6X A;  1R4N I;  3Q8A A;  3O96 A;  3DHG C;  2NBU A;  1FHO A;  1QLB B;  1GUA B;  3RT3 B;  5AZH A;  2IO3 B;  2UWQ A;  3IXS A;  1ZYI A;  1I4P A;  3ODX A;  4HB2 B;  2RSG A;  2R2O A;  5E6P A;  2Y5P A;  1OQN A;  2UZS A;  1FXI A;  2N23 A;  1XLP A;  4FJY A;  4MM3 A;  2WQY B;  1V97 A;  2LHE A;  2BQQ A;  2CR5 A;  3QJZ A;  3WAL A;  4RCO A;  4ZRQ A;  4URK A;  1PFD A;  2LZ6 A;  2W3R A;  4D6W A;  3U30 A;  2MP2 B;  3SFE B;  2V3N A;  1WGQ A;  4WJP A;  3KWL A;  3OAN A;  3APD A;  4F7H A;  1HZ5 A;  3ZNZ B;  1FGY A;  4KGS A;  2O6V D;  2KFJ A;  3GP7 A;  3TIX A;  1WGY A;  2IFS A;  2Z0O A;  3Q3O C;  3K9P B;  4IDI A;  2X0S A;  2N0Y A;  2ZVN A;  2K2U A;  3ZGZ A;  2YT1 A;  1S1Q B;  3NWA A;  1LGR A;  2I5F A;  1U5E A;  3KW5 B;  2AYO B;  1TTN A;  4LLG M;  3SUZ A;  2GLS A;  2DYM A;  2KTR B;  2WXG A;  3H7P B;  1V88 A;  3DWM A;  3CIR B;  1WYW B;  5EFX A;  2PIA A;  2J7Q B;  4US8 A;  3RNE C;  3AUL A;  4K3C A;  2G4S A;  2XEW A;  2WXK A;  1MHX A;  3MHS D;  3KRX A;  3AE7 B;  4YTN B;  3C0R B;  3RPF C;  2HRJ A;  2LVQ A;  2FDQ A;  4HAZ B;  4WSF A;  4RGN A;  1IUE A;  1QOF A;  1MK7 B;  1NYR A;  2KJ6 A;  1FOE A;  1SBB B;  3B2F A;  1OQY A;  2YSZ A;  5JHH A;  1D3Z A;  2FJL A;  2DHI A;  1U27 A;  5HE3 A;  1LQB A;  4C7Y A;  1WGU A;  3Q8C A;  4GPT B;  4MEL A;  1JRO A;  1EVH A;  4BBN F;  2HE7 A;  3AEF B;  4ICU A;  2DHK A;  1KM7 A;  5DH9 B;  3AE4 B;  2JX5 A;  5JHG A;  3QAQ A;  1D4B A;  1WX9 A;  3RMK C;  1RJ2 A;  2N4F A;  2ZCC A;  3P6A A;  4IM3 A;  3NUH B;  1MKE A;  3PRZ A;  2NPT A;  3S2A A;  1X11 A;  3A98 B;  4HAU B;  4HKZ E;  1KBL A;  1EM7 A;  1XCT L;  4ARC A;  1A70 A;  3NOB A;  1JRP A;  3AU4 A;  1T77 A;  1P1A A;  2N9K A;  3EGR A;  4KGT A;  4HJG E;  1TKE A;  2O6V B;  4MT5 A;  2N0S B;  3EFC A;  2KWD A;  1E5W A;  5DPW A;  1BTK A;  2E2X A;  3ZYY X;  4M0W A;  3N3K B;  1TZO A;  3VH3 B;  4CHJ A;  2J0J A;  2CKH B;  4H2A A;  1BTN A;  2DIK A;  1VZ6 A;  4W9J A;  1T3Q A;  1ZUD 2;  3TVV A;  2FJ9 A;  2ASQ A;  2KIG A;  3ML4 A;  3VUW A;  1K51 A;  1ESF A;  1V81 A;  2BT6 A;  4LJP B;  3KYC D;  3A9K B;  3SNH A;  3AE1 B;  2CJN A;  3A4R A;  1WZ0 A;  3FEH A;  2NBV B;  2BWE S;  4CHM A;  3TEY A;  1OEY J;  2KQ7 A;  2IND C;  2N1W A;  2KUQ A;  1OTR B;  4P6V F;  2WXJ A;  1FM0 D;  3P7Z A;  3NS8 A;  3PP2 A;  2JU6 X;  3NS1 A;  2LEK A;  4M02 A;  2NZ8 B;  2HTM E;  3VUY A;  4KHB A;  2KKC A;  1FHX A;  2K00 A;  4OHJ A;  5JHA A;  2RNR B;  1N5W A;  3PZD A;  2DX5 A;  2DNF A;  4W9L A;  3TMP B;  2LJ5 A;  2WYQ A;  4JKH A;  3N1Y C;  3V05 A;  3DXC A;  2K3U A;  2KAJ A;  2LXA A;  2P0F A;  4A6H A;  5HHD G;  4W9D A;  4KDL B;  3ZTC A;  3DDC B;  4WVF B;  4I6N B;  2DAJ A;  1L4Z B;  4EZL A;  3U8Z A;  3V61 A;  1BXT A;  1IRS A;  1X1G A;  1E6E B;  3N9Y C;  5LNK 1;  1F2R C;  2ELB A;  4W9C A;  3UIP B;  1HB6 A;  4II3 B;  2FUH B;  4Y94 A;  1R4M I;  4BKS D;  5M4Y B;  2K8B A;  2D9Y A;  1K5G B;  5C79 A;  3AE5 B;  2D07 B;  1AAR A;  4M8N A;  2MJ3 A;  2J0M A;  5JP4 A;  4JK7 A;  1RRB A;  5DPR A;  4NAM A;  2FE8 A;  3I63 C;  4YTP B;  2O2V B;  3GE3 C;  2OOB B;  2JUO A;  2AL6 A;  3DBH I;  2MRP A;  4A3O A;  2MW5 A;  5T8I A;  4DK5 A;  3PV1 A;  1OEY A;  1GB1 A;  1E8X A;  1DGJ A;  4PYU A;  3TL5 A;  3N1Z C;  3WAM A;  2JRH A;  1DDM A;  2DYN A;  5GOW B;  3ODO A;  4KKJ A;  2WHI A;  3ONS A;  3LDZ E;  3KSY A;  4PK1 A;  1C3T A;  1V1P B;  3RYT A;  4A55 A;  2JZZ A;  3PRM B;  3OLM D;  4MM3 B;  2MCN B;  3TBL D;  3PHX B;  3JSV B;  3V6E B;  2FCQ A;  5D94 A;  3DWG C;  2R2Q A;  2N7J A;  1YN4 A;  1E0Z A;  2K39 A;  1H8C A;  1J7A A;  1V49 A;  4D0N B;  3NG0 A;  2INC C;  3PSE B;  3KRW A;  3I3T B;  2PLP A;  4S17 A;  4ANU A;  2JVC A;  1QQR A;  3L08 A;  2JRI B;  1TYG B;  1E7U A;  1Y56 A;  4GU2 A;  3KQ4 A;  4E3C A;  2N7D A;  3AE9 B;  1ZPS A;  2WXL A;  1WX8 A;  2DX1 A;  2LMC A;  2AL3 A;  2JYE A;  3E56 A;  2RMM A;  2BS2 B;  3AI5 A;  2JY6 A;  2R61 A;  1C4A A;  2GOW A;  1FFU A;  3DVN V;  3H1U A;  3TJP A;  3VR9 B;  2KT7 A;  1WXV A;  1ZDX A;  2IJ0 A;  2NCN A;  4HJK A;  1UBQ A;  5CLQ B;  4YL8 A;  1SE9 A;  3I57 A;  2W3S A;  4KHA A;  4HPM B;  1HZ6 A;  3TCA A;  4ACF A;  2ZW1 A;  1NVL A;  1XF5 L;  4ZYS A;  2KVZ A;  4USA A;  1WR6 E;  3ZKJ C;  4JKE A;  4YWG G;  1X1M A;  2KX0 A;  4JIO U;  2MA9 B;  1SIJ A;  2H7D A;  1I7A A;  1UEL A;  5L81 A;  1SE2 A;  4GOC A;  4HKQ A;  3SEB A;  3PG7 A;  2BB6 A;  4F8C B;  2DHZ A;  1DBH A;  1WJM A;  4FN2 A;  2N7E A;  4DX8 A;  4MT7 A;  3ECI A;  1TJE A;  4KSL C;  3PGE A;  2KD0 A;  3CIK A;  2KDB A;  2DLW A;  3H9D A;  4WH4 A;  3H7P A;  5FI0 A;  2M8S A;  2D3G A;  2QCZ A;  5JH5 C;  2RPQ A;  4WJ7 A;  4N9F 4;  4DDG D;  1WMH B;  1P3R A;  2VSZ A;  3PS6 A;  4E71 A;  4BOZ B;  2RVB B;  3LYY A;  4G50 A;  1KFY B;  1UH6 A;  3BK2 A;  2BKF A;  1XXG A;  4LNI A;  2ACZ B;  2M19 A;  4A6F A;  1RFA A;  1UF0 A;  3KLS X;  1J0G A;  1Q0W B;  1P0R A;  3NVZ A;  4L2Y A;  3W9C B;  1WGD A;  1F2R I;  2M1M A;  4KSK C;  1F0Z A;  3ZDM C;  4AQ7 A;  1R7S A;  1WI1 A;  4IOI E;  3JVZ X;  1RFK A;  1ZW7 A;  4ZOH C;  2YRY A;  1WGG A;  4AS1 A;  1L6U A;  4GMX B;  2O6V A;  4HXD A;  4DHJ D;  1IGC A;  4NJ6 A;  4JKD A;  3SYX A;  1SE3 A;  4X57 B;  4AUQ C;  1FPY A;  1OGW A;  1GG3 A;  3EHV A;  1ISN A;  2KGX B;  2ZVO A;  5LXI B;  4KDI C;  4DBG A;  1ZDV A;  3BYY B;  1TBE A;  2GBM A;  3WYF B;  2L00 B;  3APF A;  3EA6 A;  2CHZ A;  2X38 A;  3MJ5 A;  3PHW B;  2KFK A;  2JPH A;  4IG7 B;  2RQ1 A;  1Y8R C;  1WF9 A;  4MJS B;  2YF0 A;  2WU5 B;  4KZC A;  4PNK A;  3U52 E;  2EKE C;  1Y19 B;  1WY8 A;  1J8C A;  1WX7 A;  3ZLZ A;  2XK5 A;  1NEK B;  1XD4 A;  4TUU A;  1EF1 A;  2KVR A;  4W9G A;  2FBW B;  4K7S A;  4M00 A;  2Z8L A;  4OW0 A;  2DAF A;  1MFW A;  1D5Z C;  4AP4 C;  1P98 A;  2JZP A;  3HM6 X;  4C7Z A;  4JK9 A;  2I1K A;  2Z0E B;  2K6D B;  2YT2 A;  3V5W A;  4BVU C;  5D3D A;  2D11 A;  1N3H A;  5TSS A;  1YX5 B;  4OZA A;  3F0W A;  2KFK B;  1CK1 A;  3CST A;  2KHW B;  1K50 A;  3ZDT A;  1DDW A;  2C7H A;  4XDD A;  1E7V A;  1U4A A;  3NRZ A;  5EE9 A;  1BWN A;  1IBX A;  3I9V 1;  1UWM A;  3DBL I;  3T8M A;  1XD3 B;  2KMA A;  2LUM A;  4J6I A;  1WWT A;  1HA5 A;  2DLB A;  3QWM A;  3SO6 A;  4E74 A;  2X8X X;  5AUK A;  3GZN B;  3H6N A;  3NZ3 A;  4ILG B;  2HTH B;  2ZPY A;  1AQC A;  2LGY A;  1TIF A;  3VTV A;  3E66 A;  4RNA A;  2MJD A;  5IOI A;  2ICI A;  1JWS D;  2X18 A;  2KDM A;  1F52 A;  4CHK A;  1DRO A;  4ZDV A;  5LOP B;  3VIA A;  4WJN A;  2ZCB A;  2IPK D;  4KIK A;  2Y8G A;  3B08 A;  4JKC A;  4ANX A;  3RNF C;  2XBB C;  4IWP A;  1UNP A;  4YSZ B;  4JK8 A;  3AEG B;  2LXC A;  3KZ1 A;  1CQV A;  4CSQ A;  1F1H A;  3P42 A;  1JW9 D;  2L05 A;  4OVZ A;  2J52 A;  3M95 A;  1ZXI A;  4BKG A;  1UWX A;  2D3B A;  4JPS A;  5LON B;  1VLB A;  4HAT B;  3OJ3 A;  4AJW A;  1V89 A;  2ABD A;  4PS3 A;  2BBC A;  4MH8 A;  2FCN A;  3PTF C;  2M17 A;  3AEC B;  2DHJ A;  1VZ8 A;  3NWD A;  1JML A;  2OED A;  1WH3 A;  4KVG B;  1FNU A;  2BYE A;  1HBK A;  3TW1 A;  1FAO A;  2G1E A;  3ULB A;  1FHW A;  1I4H A;  3JW0 X;  4FHJ A;  3SHQ A;  4OSN A;  1HEZ E;  3WAO A;  2EEL A;  4GDK B;  3KYD D;  4MJS A;  3GYP A;  3HHM A;  1I2H A;  1KLU D;  1KZG A;  4A6Q A;  3B1L X;  4EKU A;  4WAF A;  2REX A;  3A58 A;  2DEN B;  1WYG A;  4ANW A;  2KX3 A;  4JKG A;  3G9W A;  1FFV A;  4F7Z A;  4HCN B;  1MI1 A;  1TXD A;  5D3X A;  2M14 A;  4P1C C;  1P7E A;  1KLV A;  4XZ4 A;  5C3J B;  5AEK B;  4IWQ A;  4QAY A;  3FC4 A;  1ET9 A;  2DZM A;  3W1S C;  2OQB A;  1V80 A;  3L10 B;  3DXD A;  4EOY A;  4DX9 0;  3M3J A;  3N20 C;  5KHO A;  1N62 A;  5BYS A;  2VH1 A;  1GJZ A;  1MIZ B;  1K5D B;  1NU2 A;  2IYB A;  4MY6 A;  2YEP B;  2L3Z A;  4G11 A;  3T06 A;  1VDV A;  3R2T A;  4LNN A;  1AWE A;  2RLO A;  5BMG A;  4HRO A;  2DX5 B;  2D3C A;  1L4D B;  1WSP A;  3HIZ A;  5GMV A;  3KUZ A;  4NSW A;  4BBN C;  1TY2 A;  1S3S G;  5D27 A;  2H89 B;  2GRI A;  3VHT C;  3NVY A;  2ELA A;  2KLC A;  1VZ7 A;  2Z13 A;  2AWT A;  2KLG A;  2D2Q A;  2L76 A;  2E3T A;  4KHO A;  4HPP A;  2YEP F;  4DDI D;  2MP2 A;  3HW2 B;  5HE0 A;  3X0W A;  3SFD B;  2NBV A;  3A1Q A;  4DHJ B;  2MFQ A;  4W9F A;  3W2D A;  3P63 A;  4GZU A;  2YS3 A;  1TS4 A;  1XQQ A;  1I4R A;  5IJM A;  1N5X A;  1UGM A;  3EUB 2;  2C60 A;  4Z2M B;  3X23 A;  2MLB A;  4WQM A;  3MC9 A;  3OHM B;  2W2X C;  1NYQ A;  2FIF A;  4RF1 A;  3NHE B;  1JWA D;  5FK9 C;  4GXB A;  2W2W A;  2MWS B;  1T0Q C;  3UI3 A;  2PPH A;  5FKA C;  4PQ0 A;  1XO3 A;  4W9K A;  4LJO B;  2QDF A;  2LGX A;  3KUC B;  1W1D A;  1P3Q U;  3A33 B;  1V1P A;  4HPL B;  2K1F A;  3CWI A;  2JQR B;  3FM8 C;  2LI5 A;  1ZXH A;  2OJW A;  1DYQ A;  4LCD E;  3PPA A;  4OZC A;  1PGX A;  1I4G A;  1E8Z A;  1ZP0 B;  1JAL A;  2CQU A;  2IY0 B;  4ARI A;  4XGA B;  2EC1 A;  4QJ4 B;  1WGK A;  4W9E A;  2CY4 A;  4ILH A;  1TGZ B;  3HVD A;  1MAI A;  1XLN A;  1X05 A;  1ZSQ A;  2MKR A;  2WXO A;  3ZUN A;  4HB4 B;  4BFR A;  4KGR A;  2XK5 B;  1ZM0 A;  3OJ4 B;  1V5O A;  5G2N A;  3ZTD A;  4TYZ A;  5EE3 A;  4DXG A;  3FKY A;  4IM0 A;  3F5R A;  2K25 A;  2MBH A;  1XOD A;  1L0Y B;  4IWO A;  4K1R B;  2RUK B;  3A8P A;  1N61 A;  3HM3 A;  3ML8 A;  4BBK A;  3T9L A;  4PYZ A;  4JKG B;  4RFB A;  4A3P A;  4JKA A;  3SR6 A;  3VQI A;  3R66 C;  2Q13 A;  4P1B C;  4TSS A;  2QC8 A;  1ROE A;  1P5T A;  3DHI C;  4NJC A;  2Z59 B;  1YN3 A;  1XT9 B;  5HKH A;  2C7M B;  2WNM A;  2KTF A;  5C5B B;  1TJ6 A;  3ENB A;  2MBQ A;  3ZVV A;  3Q2A C;  2CHW A;  3T3N A;  4ZRJ A;  1WZ3 A;  2P0D A;  2I1J A;  2Y8F A;  1UD7 A;  2AQ1 B;  3EC8 A;  4YT0 B;  2ON8 A;  4JE3 B;  1I35 A;  2M38 A;  1C4P A;  1ZGU B;  4M01 A;  4EE2 A;  2GBJ A;  3GE8 C;  1EU3 A;  2NVU I;  3GYO A;  2DKP A;  1V61 A;  1L7Y A;  5HI1 A;  3U2S C;  3VH4 B;  1FXT B;  2A4Z A;  4NZL B;  1V9J A;  1K53 A;  3V60 A;  2RD0 A;  3ZRF A;  4K81 A;  3Q14 C;  3KWV A;  1AN8 A;  4RM8 A;  2KZR A;  2D10 A;  5KQ4 A;  2CU1 A;  3K9O B;  4C4V B;  3PLU A;  2WX0 A;  4BAX A;  1NVI D;  2KXJ A;  1WRI A;  1EAZ A;  1NDD A;  1Q10 A;  1E9M A;  2BWF A;  1DOI A;  2V76 A;  4XYC A;  5L83 A;  2YVC A;  1KI1 B;  1WRD B;  3FIL B;  2VZK B;  3P4P B;  4N6E B;  1MPH A;  5HG2 A;  3QAR A;  1Q67 A;  2ZNV C;  4ZHP A;  4HHV A;  4B95 A;  2PTL A;  1WIA A;  5AZF A;  3DBR I;  2LKO A;  2WP9 B;  4IM2 A;  2IDY A;  4IKG A;  1C4C A;  2DYQ A;  2RPV A;  4KIK B;  1V1O A;  5H92 C;  4FLH A;  2UZR A;  5J17 A;  2CB8 A;  2L32 A;  2KJR A;  4OT1 A;  4LNK A;  4HAW B;  1ET6 A;  3MJW A;  4G3X B;  4ZRP A;  1L6V A;  4GOU A;  4DQO C;  5G5G A;  4DXF A;  1QF6 A;  2M0X A;  2W82 A;  1KLG D;  1L0V B;  2HJ1 A;  2W54 A;  4GIV A;  3FP5 A;  3URY A;  3Q3N C;  1N63 A;  1KH0 A;  3ZJV A;  4HAY B;  3SV1 A;  5C1Z A;  1IGD A;  3W5V B;  3GB1 A;  5BMI A;  1J7C A;  3UIO B;  4ZRK A;  3FLV A;  1U5D A;  3AE8 B;  4C0A A;  1YJ1 A;  4RGT A;  3ZO5 B;  4B0M A;  3L16 A;  2V4L A;  4HWI B;  1NBF C;  2Z14 A;  2EMS A;  4L6E A;  3AU5 A;  4MAC A;  4REZ A;  3U4E G;  4HDO A;  3R7Q A;  4WJO A;  3IHP C;  2KAC A;  2ROV A;  1WMH A;  3APC A;  4KKI A;  5D7G A;  2CY5 A;  1MG4 A;  2PW9 A;  2GBN A;  2SEB D;  5D3I B;  3TSS A;  4IUM B;  4HLE A;  2HDE A;  2JWZ A;  5JZE B;  3Q3F A;  2K2J A;  1D5M C;  2D3A A;  1PUT A;  1Q1O A;  2NS5 A;  3VAW A;  5CHW A;  2NTS A;  1SGH A;  1ACC A;  1OY2 A;  4AWJ A;  3VTW A;  1ST7 A;  1QKZ A;  5DIF B;  2PEA A;  2UU7 A;  2EJ8 A;  3B2G A;  5FR6 A;  4WIP A;  1ZC4 B;  4MGY E; 
#chains in the Genus database with same CATH homology
 3R7R A;  4KV2 A;  4TKN A;  2KNB A;  3N7C A;  5J3Q A;  1Z87 A;  4YON A;  4EMO A;  1PLS A;  4KZ0 A;  5L95 C;  2L8J A;  2CRF A;  3ENE A;  1IP9 A;  2D4Q A;  3RUL A;  3HK0 A;  5HE2 A;  2G3Q B;  4GGQ A;  2HD5 B;  3KUD B;  2MBE A;  3DVN U;  3PVU A;  5DHF B;  2HJ8 A;  3WAN A;  2JXX A;  2R82 A;  2NR2 A;  3ML9 A;  1ACA A;  1J19 A;  3TO1 A;  3BIN A;  1LFD A;  1K8R B;  2RGF A;  2A5U A;  4OVU A;  1HB8 A;  5KCV A;  3EFU A;  1KOT A;  3VVW B;  2YS5 A;  4WAA A;  2GCJ A;  4NJ7 A;  3IBE A;  2WH5 A;  1JRU A;  1UNQ A;  1X86 A;  2BGF A;  4K17 A;  4IAP A;  1T0Y A;  1DYN A;  2KDI A;  4NQL B;  2LD9 A;  3D8E A;  4DXA B;  2KC1 A;  3QK0 A;  5DCN A;  5TR5 A;  2QKL A;  1JDE A;  4IW0 A;  1SIF A;  4HCP B;  2L1C A;  1MG8 A;  4IC7 B;  3JSV A;  5BO4 B;  2FNJ B;  4JQW C;  2PJH A;  2D9Z A;  4PS8 A;  3W1Y A;  4EUT A;  1VD2 A;  5D3Y A;  4NNJ B;  4BKT A;  4EEW A;  3B0A A;  3ZVR A;  3ALB A;  2C9W B;  3WIM A;  4JGH B;  4WWN A;  3LJU X;  3OAW A;  1DDV A;  3PRE A;  2LOX A;  2Z0Q A;  2IO2 B;  3RCP A;  1NI2 A;  3PEG A;  1Y5O A;  2GCL A;  3UF8 A;  5C5B A;  2I5C A;  3W1S A;  4GMV A;  2COP A;  2DZK A;  4AJY B;  4B6H A;  3CXB B;  4PS7 A;  2NBW B;  3U7D A;  2N9E B;  3SDL C;  2KTR A;  3EEC A;  1LB1 A;  4GDK A;  1EF5 A;  2UYZ B;  1YIW A;  1BT0 A;  4F7U P;  3QIJ A;  1PQS A;  1C1Y B;  4MSM B;  2VKI A;  2IO1 B;  4MGK E;  2UVM A;  4XX5 A;  2D9W A;  3QHT A;  1QZE A;  2IY1 B;  3ZNH B;  2LVO A;  5KHQ A;  5JVL A;  3A8Q A;  2YLM A;  5LXH A;  1XR0 B;  2O2V A;  1YD8 U;  1MIX A;  1E8W A;  1CMX B;  1WJN A;  3IVF A;  4F1S A;  2DYO A;  1P6S A;  2WWZ A;  3RCZ A;  5IA7 A;  1QQG A;  1WFY A;  4A6K A;  3Q3J A;  3L0W B;  2BKR B;  4EJN A;  4KHB B;  3RD2 A;  2CS4 A;  4B6W A;  5FI1 A;  3GZN I;  2G45 B;  2EMT A;  2WDT B;  1Z2M A;  3KVF B;  3NZS A;  4MGZ E;  2HTH A;  3M62 B;  1PMS A;  4OVV A;  4K2O A;  3GOE A;  1KJT A;  1WXA A;  3QCA A;  4DHZ B;  1TQZ A;  1UPR A;  2LUL A;  4MGI E;  1WGH A;  4FBJ B;  2KQS A;  3D8D A;  4JL9 A;  2RSU A;  2K8H A;  1WXM A;  2KDF B;  1WXS A;  3MPX A;  5JHB A;  3E9L A;  2KOX A;  3VXW A;  4HB3 B;  1WE7 A;  2JP2 A;  3A1Q B;  3SD5 A;  2J59 M;  1GGO A;  3ZRC A;  2GBR A;  4KAX B;  3CSF A;  1EO6 A;  1RAX A;  3WAP A;  4GDL A;  1PFJ A;  1ZVR A;  1WG7 A;  2B3A A;  4HK2 A;  2BCJ A;  4FUL A;  3SBT A;  2DFK A;  5CHV C;  2IZV B;  2LOZ A;  5KQ1 A;  4NAW A;  5CTR C;  3VFK A;  4ZYN A;  4ASW C;  1VBH A;  3ZIM A;  1TZ1 A;  3UIN B;  2DKQ A;  2N9X A;  2GJY A;  2JZ3 B;  2KC2 A;  3WA0 A;  3PSC A;  3IG3 A;  2MBO A;  2WX1 A;  4FA6 A;  1WJ1 A;  4HDQ A;  4NPN A;  4XC2 A;  5EDS A;  1VBG A;  2ADZ A;  1B55 A;  3NSU A;  3DOW A;  3P2B A;  3D8F A;  4FHK A;  1WR1 A;  1E8Y A;  5G55 A;  4B9K A;  4M8M A;  4TQ0 A;  4K7W A;  1WI0 A;  2LUE A;  2ZPN A;  1XKE A;  1U5F A;  2COA A;  2ZNV B;  1NTI A;  1EGX A;  2KN5 A;  1NTY A;  4GN1 A;  1LW3 A;  2VRW B;  1UZX B;  1WM3 A;  2BPS A;  4K2P A;  1W1G A;  3N30 A;  4HB0 B;  3D32 A;  3QA8 A;  2V1Y A;  2C7N B;  3RZW C;  2COC A;  2N1V A;  5AZG A;  1FB8 A;  2GMI C;  2PZ1 A;  2GBK A;  3NZU A;  1WJU A;  2G35 A;  5D6J B;  4K7U A;  4HVB A;  1MK9 B;  4TV3 A;  1L2N A;  4IOY X;  2IO0 B;  2L0F A;  4XWX A;  2Y5B B;  3L13 A;  2DTC A;  4MH0 E;  2KWU B;  2COF A;  3ZNI D;  2N9P C;  3VDZ A;  3PVL A;  1VCB A;  3H7S A;  3V6C B;  4G0N B;  4HAV B;  3ZW3 A;  1V6E A;  4P7I A;  2RR9 A;  3DBS A;  4JKF A;  2ROZ B;  3SU8 X;  4NAW B;  3MDB C;  1U29 A;  2L0T A;  3M1I B;  5C23 A;  3QQ8 B;  1FGZ A;  3AXC A;  1BAK A;  2CHX A;  2KCJ A;  2MX2 A;  3A9K A;  3PVW A;  2Z0P A;  1GNU A;  5CX3 A;  4DWF A;  4ILJ A;  1G6J A;  4AOF A;  1M94 A;  3N32 A;  1F9J A;  2JT4 B;  2KDE B;  1ZKH A;  4MSQ B;  2ZJD A;  1I42 A;  3DCG A;  3DVG Y;  1WJ4 A;  4GB9 A;  2KAN A;  2DZJ A;  4RM9 A;  4DHZ E;  3O65 B;  4HAX B;  4TQ1 A;  1EUV B;  2LRW A;  4GSW A;  2DYB A;  2BYF A;  4FJZ A;  3KY9 A;  1IYF A;  3A9J A;  1NTV A;  1OMW A;  3RZF A;  2G4D B;  3TFM A;  1RRP B;  1IPG A;  4JKB A;  3DXE A;  1GC6 A;  1UPQ A;  5DI9 B;  5IAA C;  5DHA B;  5D3W A;  4WWO A;  4II2 B;  5J18 A;  2PE6 B;  2D9V A;  2J0K A;  5DPT A;  2BYV E;  3PLV A;  3EPY A;  1Q5W B;  1YX6 B;  1DIK A;  2BF8 B;  4W9H A;  1E90 A;  4W9I A;  5HE1 A;  2MWN B;  4WWP A;  4MEM A;  5E6O A;  3L17 A;  1UBI A;  2Z0D B;  2W2X D;  2VRR B;  3ULC A;  1U5G A;  3QBV B;  4DBB A;  2PE9 A;  5J3T A;  4A20 A;  2LYD A;  4IFS A;  2K8C A;  1M7R A;  1M7E A;  4ICV A;  4BOS C;  5D3V A;  3QC8 B;  1WJ6 A;  3M63 B;  2NMB A;  2ZZP B;  2P0H A;  3DVG X;  4F7G A;  2R0D A;  2MBB B;  4A5K A;  2DA0 A;  5J2R A;  2KWV B;  5D2M B;  2H7E A;  2OTX A;  3IFW B;  3VUX A;  2L7R A;  3BY4 B;  1SHC A;  2XQN M;  1ZC3 B;  4NQK E;  1GC7 A;  3BJI A;  3FSS A;  2QHO A;  2D9X A;  2MQJ A;  2DZI A;  4CO7 A;  2NPT B;  2P8V A;  2K6Q A;  3NY5 A;  1LXD A;  3DPD A;  4WQO B;  3HQC A;  2W9N A;  3E9O A;  2FAZ A;  2LG1 A;  1LM8 B;  3JYU A;  2FCS A;  3CF6 E;  5CLL B;  1KZ7 A;  1YQB A;  3L54 A;  2ZEQ A;  4EFO A;  1RLF A;  2KWC A;  3PT2 B;  4MK0 A;  3UQB A;  4FJV B;  2MDX A;  3V62 A;  2L2I A;  2KMC A;  2LBB A;  2GS0 A;  2YT0 A;  1WM2 A;  3E9P A;  2RGN B;  2LWP A;  3UGB B;  4H8S A;  3LJ3 A;  3CMM B;  3UQA A;  2QKM A;  1V86 A;  2KJH B;  4ANV A;  2JF5 A;  2MSE D;  1WGR A;  4EZJ A;  2R09 A;  1XCG A;  5CHF A;  3A9J B;  2IYD B;  4ZRI A;  5E6N A;  4I6P A;  2V3S A;  4LDT D;  1W1H A;  4GDL B;  2KUP A;  2AEH A;  5DPS A;  3ODW A;  5J3Y A;  3VTU A;  1QC6 A;  1KC7 A;  2LAS A;  4CYE A;  2KK8 A;  4M0W B;  3RUI B;  2Y7B A;  1X1F A;  3ZNG C;  3SBG A;  3A4S C;  2OJR A;  1V5M A;  5JLJ B;  4I6L B;  4BKS A;  1V5T A;  2DN6 A;  3QX1 A;  1J0W A;  2CAY A;  1WE6 A;  2M4N A;  3PRP B;  4MDK E;  1UEF A;  1XX0 A;  4RMA A;  1V2Y A;  3KH0 A;  2C5L C;  4A6F B;  4EZK A;  4JLC A;  1V5U A;  4NY0 A;  2FID A;  1V5P A;  3DQV A;  1Z5S B;  1A5R A;  1P9D U;  4WJQ A;  1H10 A;  2KO3 A;  1H4R A;  3MTN B;  1HE8 A;  1UNR A;  3UZT A;  4LDT B;  1WVH A;  5C6R A;  2LVP A;  2LGD A;  3R3M A;  2LRU A;  3VOQ A;  5LLI A;  4FAD A;  2YS1 A;  3AJ4 A;  5C16 A;  2FCM A;  3QWZ B;  1U2B A;  2COD A;  4Z2N A;  2IBI B;  1R4N I;  3O96 A;  2NBU A;  1FHO A;  1GUA B;  3RT3 B;  5AZH A;  2IO3 B;  2UWQ A;  3ODX A;  4HB2 B;  2RSG A;  2R2O A;  5E6P A;  1OQN A;  2UZS A;  2N23 A;  4FJY A;  4MM3 A;  2CR5 A;  3QJZ A;  3WAL A;  4URK A;  2LZ6 A;  3U30 A;  2MP2 B;  1WGQ A;  4WJP A;  3OAN A;  3APD A;  4F7H A;  3ZNZ B;  1FGY A;  2O6V D;  2KFJ A;  3TIX A;  1WGY A;  2IFS A;  2Z0O A;  3K9P B;  2X0S A;  2N0Y A;  2ZVN A;  2K2U A;  2YT1 A;  1S1Q B;  2I5F A;  1U5E A;  3KW5 B;  2AYO B;  1TTN A;  3SUZ A;  2KTR B;  2DYM A;  3H7P B;  1V88 A;  1WYW B;  5EFX A;  2J7Q B;  3AUL A;  2G4S A;  2XEW A;  3MHS D;  3KRX A;  3C0R B;  2HRJ A;  2LVQ A;  2FDQ A;  4HAZ B;  4WSF A;  1MK7 B;  2KJ6 A;  1FOE A;  1OQY A;  2YSZ A;  5JHH A;  1D3Z A;  2FJL A;  2DHI A;  1U27 A;  5HE3 A;  1LQB A;  1WGU A;  4GPT B;  4MEL A;  1EVH A;  4BBN F;  2HE7 A;  4ICU A;  2DHK A;  1KM7 A;  5DH9 B;  5JHG A;  3QAQ A;  1WX9 A;  1RJ2 A;  2N4F A;  2ZCC A;  3P6A A;  4IM3 A;  3PRZ A;  1MKE A;  2NPT A;  3S2A A;  1X11 A;  3A98 B;  4HAU B;  1KBL A;  3NOB A;  3AU4 A;  1P1A A;  2O6V B;  1E5W A;  5DPW A;  1BTK A;  2E2X A;  3N3K B;  3VH3 B;  4CHJ A;  2J0J A;  2CKH B;  1BTN A;  2DIK A;  4W9J A;  3TVV A;  2FJ9 A;  2ASQ A;  3ML4 A;  3VUW A;  1V81 A;  4LJP B;  3KYC D;  3A9K B;  3SNH A;  3A4R A;  1WZ0 A;  3FEH A;  2NBV B;  2BWE S;  4CHM A;  1OEY J;  2KQ7 A;  2N1W A;  1OTR B;  3P7Z A;  3NS8 A;  3PP2 A;  2NZ8 B;  3VUY A;  2KKC A;  1FHX A;  2K00 A;  5JHA A;  2RNR B;  3PZD A;  2DX5 A;  4W9L A;  3TMP B;  2LJ5 A;  2WYQ A;  4JKH A;  3DXC A;  2LXA A;  2P0F A;  4A6H A;  4W9D A;  4KDL B;  3ZTC A;  3DDC B;  4WVF B;  4I6N B;  2DAJ A;  4EZL A;  3U8Z A;  3V61 A;  1IRS A;  1X1G A;  2ELB A;  4W9C A;  3UIP B;  1HB6 A;  4II3 B;  2FUH B;  4Y94 A;  1R4M I;  4BKS D;  2K8B A;  2D9Y A;  1K5G B;  5C79 A;  2D07 B;  1AAR A;  4M8N A;  2J0M A;  5JP4 A;  4JK7 A;  1RRB A;  5DPR A;  2O2V B;  2OOB B;  2JUO A;  2AL6 A;  3DBH I;  2MRP A;  4A3O A;  2MW5 A;  4DK5 A;  3PV1 A;  1OEY A;  1E8X A;  4PYU A;  3TL5 A;  3WAM A;  1DDM A;  2JRH A;  2DYN A;  5GOW B;  3ODO A;  3ONS A;  3LDZ E;  3KSY A;  1C3T A;  3RYT A;  2JZZ A;  3PRM B;  3OLM D;  2MCN B;  3TBL D;  3PHX B;  3JSV B;  3V6E B;  2FCQ A;  5D94 A;  2R2Q A;  2K39 A;  1H8C A;  1V49 A;  4D0N B;  3PSE B;  3KRW A;  3I3T B;  4ANU A;  2JVC A;  3L08 A;  2JRI B;  4GU2 A;  1E7U A;  4E3C A;  2N7D A;  1WX8 A;  2DX1 A;  2AL3 A;  3AI5 A;  2JY6 A;  2GOW A;  3DVN V;  3H1U A;  3TJP A;  1WXV A;  2NCN A;  4HJK A;  1UBQ A;  5CLQ B;  4YL8 A;  1SE9 A;  4KHA A;  4HPM B;  3TCA A;  1NVL A;  1WR6 E;  3ZKJ C;  4JKE A;  1X1M A;  2KX0 A;  4JIO U;  2MA9 B;  2H7D A;  1I7A A;  1UEL A;  5L81 A;  4GOC A;  3PG7 A;  4F8C B;  2DHZ A;  1DBH A;  1WJM A;  4FN2 A;  2N7E A;  4DX8 A;  4MT7 A;  3ECI A;  4KSL C;  3PGE A;  2KD0 A;  3CIK A;  2KDB A;  2DLW A;  3H9D A;  3H7P A;  5FI0 A;  2M8S A;  2D3G A;  5JH5 C;  2RPQ A;  4WJ7 A;  4N9F 4;  4DDG D;  1WMH B;  1P3R A;  2VSZ A;  3PS6 A;  4E71 A;  4BOZ B;  2RVB B;  4G50 A;  1UH6 A;  2BKF A;  4A6F A;  1RFA A;  1J0G A;  1Q0W B;  1P0R A;  1WGD A;  2M1M A;  4KSK C;  3ZDM C;  1WI1 A;  3JVZ X;  1ZW7 A;  2YRY A;  1WGG A;  4GMX B;  2O6V A;  4HXD A;  4DHJ D;  4NJ6 A;  4JKD A;  3SYX A;  4X57 B;  4AUQ C;  1OGW A;  1GG3 A;  3EHV A;  1ISN A;  2KGX B;  2ZVO A;  5LXI B;  4KDI C;  4DBG A;  1TBE A;  2GBM A;  3WYF B;  2L00 B;  3APF A;  2CHZ A;  3PHW B;  2KFK A;  2JPH A;  4IG7 B;  2RQ1 A;  1Y8R C;  1WF9 A;  4MJS B;  2YF0 A;  4KZC A;  4PNK A;  2EKE C;  1Y19 B;  1J8C A;  1WY8 A;  1WX7 A;  3ZLZ A;  2XK5 A;  1XD4 A;  4TUU A;  1EF1 A;  2KVR A;  4W9G A;  4K7S A;  2DAF A;  4AP4 C;  1P98 A;  3HM6 X;  4JK9 A;  2I1K A;  2Z0E B;  2K6D B;  3V5W A;  4BVU C;  2D11 A;  1N3H A;  1YX5 B;  3F0W A;  2KFK B;  3CST A;  2KHW B;  3ZDT A;  1DDW A;  2C7H A;  1E7V A;  1U4A A;  1BWN A;  3T8M A;  3DBL I;  1XD3 B;  2KMA A;  4J6I A;  3QWM A;  3SO6 A;  4E74 A;  3H6N A;  4ILG B;  2HTH B;  2ZPY A;  1AQC A;  2LGY A;  3VTV A;  3E66 A;  2X18 A;  4CHK A;  1DRO A;  4ZDV A;  5LOP B;  3VIA A;  4WJN A;  2ZCB A;  4KIK A;  2Y8G A;  3B08 A;  4JKC A;  4ANX A;  2XBB C;  4IWP A;  1UNP A;  4JK8 A;  2LXC A;  3KZ1 A;  2L05 A;  3M95 A;  4BKG A;  5LON B;  4HAT B;  3OJ3 A;  4AJW A;  1V89 A;  2ABD A;  4PS3 A;  2FCN A;  3PTF C;  2M17 A;  2DHJ A;  1WH3 A;  4KVG B;  2BYE A;  1HBK A;  3TW1 A;  1FAO A;  3ULB A;  1FHW A;  3JW0 X;  4FHJ A;  3SHQ A;  3WAO A;  4GDK B;  3KYD D;  4MJS A;  3GYP A;  3HHM A;  1I2H A;  1KZG A;  3B1L X;  4EKU A;  2REX A;  2DEN B;  4ANW A;  2KX3 A;  4JKG A;  3G9W A;  4F7Z A;  4HCN B;  1TXD A;  5D3X A;  2M14 A;  1KLV A;  4XZ4 A;  5AEK B;  4IWQ A;  2DZM A;  3W1S C;  2OQB A;  1V80 A;  3L10 B;  3DXD A;  4EOY A;  4DX9 0;  3M3J A;  5KHO A;  1GJZ A;  1MIZ B;  1K5D B;  1NU2 A;  2IYB A;  4MY6 A;  4G11 A;  2L3Z A;  3T06 A;  1AWE A;  2RLO A;  2DX5 B;  3HIZ A;  5GMV A;  3KUZ A;  4NSW A;  4BBN C;  1S3S G;  5D27 A;  3VHT C;  2ELA A;  2KLC A;  2L76 A;  2AWT A;  2KLG A;  2D2Q A;  4KHO A;  4DDI D;  2MP2 A;  3HW2 B;  5HE0 A;  3X0W A;  3A1Q A;  4DHJ B;  2MFQ A;  4W9F A;  4GZU A;  2YS3 A;  1XQQ A;  5IJM A;  1UGM A;  2C60 A;  4Z2M B;  3X23 A;  2MLB A;  2W2X C;  2FIF A;  3NHE B;  4GXB A;  2W2W A;  2MWS B;  2PPH A;  4PQ0 A;  4W9K A;  4LJO B;  2LGX A;  3KUC B;  1W1D A;  1P3Q U;  3A33 B;  4HPL B;  2K1F A;  3FM8 C;  2LI5 A;  4LCD E;  3PPA A;  1E8Z A;  2CQU A;  2IY0 B;  2EC1 A;  4W9E A;  2CY4 A;  4ILH A;  1TGZ B;  1MAI A;  1X05 A;  1ZSQ A;  2MKR A;  3ZUN A;  4HB4 B;  4BFR A;  2XK5 B;  1ZM0 A;  3OJ4 B;  1V5O A;  5G2N A;  3ZTD A;  4TYZ A;  4IM0 A;  3F5R A;  2K25 A;  2MBH A;  1XOD A;  4IWO A;  4K1R B;  2RUK B;  3A8P A;  3HM3 A;  3ML8 A;  4BBK A;  3T9L A;  4PYZ A;  4JKG B;  4A3P A;  4JKA A;  3VQI A;  3R66 C;  2Q13 A;  1P5T A;  2Z59 B;  1XT9 B;  5HKH A;  2C7M B;  2KTF A;  5C5B B;  1TJ6 A;  3ENB A;  2MBQ A;  3ZVV A;  2CHW A;  4ZRJ A;  1WZ3 A;  2P0D A;  2I1J A;  2Y8F A;  1UD7 A;  3EC8 A;  1I35 A;  2M38 A;  1ZGU B;  2GBJ A;  2NVU I;  3GYO A;  2DKP A;  1V61 A;  1L7Y A;  3VH4 B;  3V60 A;  1FXT B;  2A4Z A;  1V9J A;  3ZRF A;  2RD0 A;  4K81 A;  4RM8 A;  2KZR A;  2D10 A;  5KQ4 A;  2CU1 A;  3K9O B;  3PLU A;  2WX0 A;  2KXJ A;  1EAZ A;  1NDD A;  2BWF A;  2V76 A;  5L83 A;  2YVC A;  1KI1 B;  1WRD B;  1MPH A;  3QAR A;  1Q67 A;  2ZNV C;  4HHV A;  4B95 A;  1WIA A;  5AZF A;  3DBR I;  2LKO A;  4IM2 A;  2DYQ A;  4KIK B;  4FLH A;  2UZR A;  5J17 A;  2CB8 A;  2KJR A;  4HAW B;  4G3X B;  3MJW A;  2M0X A;  4GIV A;  3FP5 A;  4HAY B;  3SV1 A;  5C1Z A;  3UIO B;  4ZRK A;  3FLV A;  1U5D A;  4C0A A;  1YJ1 A;  3ZO5 B;  3L16 A;  2V4L A;  4HWI B;  1NBF C;  2EMS A;  4L6E A;  3AU5 A;  4HDO A;  3R7Q A;  4WJO A;  3IHP C;  2ROV A;  1WMH A;  3APC A;  5D7G A;  2CY5 A;  2GBN A;  4IUM B;  4HLE A;  2JWZ A;  5JZE B;  3Q3F A;  2K2J A;  3VAW A;  1Q1O A;  2NS5 A;  5CHW A;  1SGH A;  4AWJ A;  1OY2 A;  3VTW A;  1ST7 A;  5DIF B;  2PEA A;  2EJ8 A;  5FR6 A;  1ZC4 B;  4MGY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...