1EF1A

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MOESIN
total genus 89
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ef1A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ef1A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef1A01
4PYUA 2KUPA 2K1FA 1RRBA 1EAZA 1BT0A 3PS6A 3A8QA 3IG3A 1DDVA 2P8VA 2LRUA 4FA6A 5AZHA 3R3MA 3PSEB 5BO4B 5JH5C 4XX5A 3CSTA 2VKIA 3QC8B 4FJZA 1UBIA 4IC7B 1WG7A 2KHWB 4EZKA 1J19A 2CHZA 1W1GA 2COAA 2ROZB 1V81A 1ZGUB 2RSUA 3A9KA 4NJ6A 2JRHA 3OANA 4OVVA 5FR6A 2ZZPB 1Y19B 5J3QA 4YL8A 3PZDA 4PS8A 1LB1A 4DX8A 2N23A 5JHHA 1DROA 2GBJA 4IG7B 4BOZB 4D0NB 2JVCA 1JRUA 1WJ4A 2MCNB 1HE8A 3U7DA 4WJNA 3F0WA 2BYVE 1E8WA 3PG7A 1U29A 2ELAA 2IO2B 1KOTA 1Z2MA 1ZM0A 2PJHA 1HB6A 3CMMB 3DBRI 2EJ8A 4MGZE 2COCA 1QQGA 3PV1A 1LQBA 2MWSB 3HM6X 5E6PA 1RFAA 1U5EA 5LXIB 3ML8A 2Z0PA 3ZW3A 3X23A 2UVMA 3H1UA 3MJWA 4IWOA 2LRWA 2E2XA 2L0TA 2XK5A 1QZEA 4AJYB 1DYNA 4K1RB 2BPSA 2MBQA 3DXDA 4G0NB 5JHBA 3KSYA 3KZ1A 3ZNGC 1YJ1A 5AZFA 3ZKJC 4GSWA 5L83A 4WWOA 4NPNA 3ZTDA 5CHFA 2VRWB 3UIOB 1FGYA 3QWMA 3B1LX 4LJOB 1U2BA 2P0FA 2L76A 4IM2A 2C7NB 3NZSA 4JGHB 2KTRA 4PNKA 4DDID 5CX3A 2KDBA 3PP2A 3DDCB 1ZKHA 4E74A 2CRFA 3MTNB 2FJ9A 1E8YA 3SHQA 4M0WB 3VUWA 4HLEA 2M14A 2MA9B 4W9FA 4GDLA 5C1ZA 3AU4A 2R0DA 1GUAB 2V76A 4HPLB 2Z0EB 2KCJA 3HQCA 1V9JA 2MSED 4MGIE 2DTCA 1IRSA 1Z5SB 3QX1A 2NCNA 4MH0E 3PT2B 4BKSD 1I42A 2YS1A 5DI9B 1WR1A 1U5GA 2DYNA 2BYFA 3OJ4B 1Z87A 4FHKA 1ZSQA 4GXBA 1UNPA 1IPGA 4KIKB 3ZDMC 4TQ0A 5AEKB 5DPWA 3TW1A 4TQ1A 1P3RA 3N32A 3SD5A 4HXDA 1X11A 3KRXA 2IO0B 3SV1A 4W9EA 2DZJA 2FCSA 4MJSA 2J59M 5D2MB 3V6CB 2MP2B 4BFRA 2LVOA 1TQZA 5JHGA 1K5GB 3P2BA 5C16A 4EJNA 4IW0A 3VUYA 3M63B 1WE7A 4K7UA 4HVBA 4HAWB 2JWZA 3R7RA 2DHJA 4II3B 1MIZB 2Z0OA 3U8ZA 1WY8A 3K9OB 1E8ZA 2A4ZA 1M94A 4CHKA 2DYOA 3L08A 3TJPA 2YRYA 1P0RA 3H7PB 4YONA 3P7ZA 2CU1A 3RUIB 4AUQC 1YX5B 2HTHB 2XBBC 2KMAA 4A3PA 1M7RA 1MPHA 1V61A 2Y5BB 4PS3A 2IFSA 4LDTB 2Z0DB 5TR5A 3V60A 1ZC4B 4DHZB 3G9WA 3RT3B 2RGNB 3HK0A 2GS0A 5KQ1A 3UIPB 4BBKA 3KYCD 2MX2A 2MBBB 3FSSA 2RGFA 2YLMA 4W9IA 4B6WA 4BOSC 4MM3A 3V61A 3A1QA 4I6NB 1V86A 1WJUA 2N1VA 4X57B 4RM9A 4ZDVA 2KJRA 1UNRA 2W2WA 3D8DA 2MBHA 4XC2A 1ACAA 1WR6E 1I2HA 4DDGD 5KCVA 3LJUX 2ZPYA 2RPQA 1WGUA 3VUXA 4GIVA 3NSUA 4DHJD 1Y5OA 1UNQA 5LOPB 2EC1A 3ENEA 2UWQA 3UGBB 1TTNA 1WJ6A 2HE7A 3VTVA 3CIKA 3APFA 4B9KA 2DAFA 1X86A 4G50A 3VIAA 2FIFA 3VH4B 1VD2A 2PE6B 1FB8A 1UD7A 2IZVB 5E6NA 1X1GA 4AOFA 1WRDB 4EOYA 1E8XA 5D27A 2K2JA 2ASQA 2CR5A 1IP9A 2FAZA 1WJMA 2D9WA 2CB8A 1P3QU 4HK2A 2HD5B 3L54A 2Z0QA 2KFKB 4PQ0A 2L2IA 4F7HA 2Y7BA 2D2QA 1V80A 1XD3B 2G4DB 3PLVA 4FADA 4HDQA 3VDZA 3KH0A 3NZUA 3KUCB 1R4NI 1NTVA 2RVBB 4MGYE 1H8CA 2NR2A 1V2YA 1GC6A 3EPYA 3WAOA 2ZNVB 2BWES 2LXCA 1V49A 2NPTB 4MSMB 2DKQA 4WWPA 4ANXA 3TIXA 2LGYA 4JL9A 4G3XB 4KIKA 2KWUB 3A4RA 1PQSA 3VQIA 3ZRCA 2KANA 5CLLB 1HBKA 1Q0WB 4LDTD 4WJQA 5JHAA 2FCNA 1U5FA 2DX1A 5JP4A 1NBFC 2K39A 2NS5A 3A33B 4GMXB 4AP4C 3RZFA 2LBBA 1LW3A 2ZCBA 2ABDA 2Y8GA 4WVFB 3QWZB 3A1QB 1GC7A 1XKEA 3AXCA 2CY4A 2GJYA 4K2PA 2DYMA 2RQ1A 2MFQA 3ODWA 2D9ZA 2C7HA 2OJRA 4DHJB 1FHOA 3DBLI 3NOBA 2DLWA 1X1FA 2AL3A 3D8FA 2CHXA 2KJ6A 2C60A 2FDQA 1WZ0A 3EECA 1ST7A 5L95C 2VRRB 3WALA 2LD9A 5KQ4A 4B6HA 5GOWB 5DHAB 1YQBA 3QARA 3P6AA 1UGMA 2DHIA 2I1KA 3AU5A 2LULA 5D3VA 5JLJB 1RAXA 1L7YA 1V5MA 1U4AA 1V6EA 2C5LC 2FIDA 4II2B 1K5DB 4Z2NA 1WI0A 2KLGA 1WXAA 2BF8B 2N7EA 1WH3A 2JT4B 2XK5B 3ZRFA 3A8PA 2KWCA 2N0YA 3QQ8B 2KVRA 1MK9B 2D9VA 2FCMA 1EF1A 1DBHA 1PLSA 4BKTA 2ROVA 3IBEA 3CSFA 4IWPA 3EC8A 2JUOA 2NZ8B 1NI2A 2R09A 1KM7A 2H7EA 3HW2B 1NDDA 2L3ZA 4HB0B 2O2VA 1XD4A 3PVWA 4P7IA 1BWNA 5D3XA 3PLUA 5D6JB 1GNUA 3VVWB 2WX1A 2PE9A 1L2NA 3IVFA 4DHZE 3ZO5B 1ISNA 3ULBA 4JLCA 2D4QA 3DCGA 1V5UA 2L1CA 3M62B 3V62A 2LXAA 2M17A 4KDIC 1UZXB 3CF6E 3ULCA 2REXA 4NQKE 1XX0A 2IY1B 4XZ4A 3VFKA 3W1SC 4GDLB 2EMTA 3O65B 4F8CB 2K6DB 3PRPB 5J3YA 2DAJA 2H7DA 4NNJB 3SYXA 3ZTCA 4MEMA 3FM8C 5HE1A 2L0FA 2YVCA 3OAWA 4EUTA 1C1YB 2Z59B 4JIOU 2J0JA 2PEAA 4E3CA 3QBVB 2R2QA 2G4SA 1WM2A 3ZNID 2K6QA 2DHKA 1S1QB 3ALBA 3DVNU 3HHMA 2CS4A 3NHEB 5EDSA 4G11A 2OQBA 3TFMA 2V1YA 1X05A 3KYDD 2KJHB 2N9EB 2D3GA 2KO3A 2CQUA 3ZDTA 3M95A 1WGDA 2WDTB 2GCJA 2I1JA 2N7DA 2FJLA 3V6EB 1WI1A 2YT0A 1Q67A 4JQWC 2ZEQA 5DHFB 1E90A 3UZTA 4KHOA 3B0AA 4IFSA 4ICUA 3DBSA 2Q13A 1WX9A 3H7SA 4NQLB 3RD2A 2J7QB 4W9KA 2N9PC 2NPTA 2KX3A 1KJTA 4WQOB 2CODA 4BKSA 4F1SA 5DPTA 2C7MB 1A5RA 1VCBA 2ZVNA 5DCNA 2HTHA 3KVFB 2O6VD 4E71A 2YF0A 2KDEB 1X1MA 1WGYA 2KK8A 3FP5A 1WZ3A 1MKEA 3PRZA 3A9JA 2KFKA 1TBEA 3WAMA 5LXHA 2LVQA 4M8MA 4KDLB 3D8EA 1QC6A 3V5WA 2GBKA 2CKHB 3DBHI 2RNRB 1WXMA 2MRPA 4ASWC 1C3TA 1CMXB 3KW5B 1HB8A 1B55A 1AWEA 4MK0A 5D3WA 2V3SA 4KSKC 1WGQA 2IYDB 1WXSA 3C0RB 2DZIA 4W9DA 1M7EA 2G3QB 4F7ZA 2KN5A 2CHWA 2XQNM 4GU2A 3ZNHB 2WH5A 1MK7B 4Z2MB 2I5FA 2WX0A 4IM0A 3GYPA 4GPTB 4NY0A 2MQJA 2O2VB 3MHSD 4OVUA 2J0KA 1BTNA 4HATB 4K17A 5HE2A 3VXWA 4EEWA 4KHAA 1D3ZA 4FJVB 3QK0A 3TL5A 3F5RA 4TYZA 3QCAA 3ZUNA 2HRJA 3TVVA 2BKFA 1FOEA 2GBMA 4WAAA 4GGQA 1WGRA 3UF8A 4HAXB 3T9LA 3DPDA 4HAVB 1WJNA 2LWPA 2BGFA 1MIXA 2KC2A 2UZRA 5G2NA 1WJ1A 2KTRB 3DXCA 5J18A 2C9WB 1NU2A 3FEHA 2MW5A 3A9KB 3MPXA 4HB2B 3KUZA 3DVNV 2L05A 2AL6A 1NVLA 3L13A 2LUEA 5CHWA 1RJ2A 4KZ0A 2KQ7A 5G55A 1GG3A 1P6SA 4AWJA 1J0GA 1EF5A 2G45B 1OEYJ 1ZVRA 4A6KA 4TV3A 2MBOA 3H7PA 2YSZA 3H6NA 5CLQB 4I6PA 4WJOA 3RULA 2AEHA 1F9JA 2KFJA 1RLFA 4BVUC 4WSFA 4HDOA 4KAXB 1BAKA 2IO3B 2JF5A 4CO7A 3VTWA 4EFOA 1V5PA 1WMHA 3W1SA 1XCGA 4K81A 4J6IA 2BCJA 4DBBA 3VOQA 4FLHA 4EKUA 4W9HA 2D11A 5DIFB 2LYDA 3KRWA 2A5UA 1BTKA 3H9DA 4GMVA 1WVHA 4CYEA 1UH6A 2UYZB 3QJZA 2DA0A 2D9XA 4DX90 2DYBA 1OGWA 2M8SA 2LOZA 4DXAB 5KHOA 2LJ5A 5C23A 3ECIA 4FBJB 2KDIA 1PMSA 3ML4A 5DH9B 1XQQA 3X0WA 3JYUA 1MG8A 2K8BA 3SDLC 1WIAA 2RR9A 2NBWB 1WYWB 2K8CA 2KQSA 3PEGA 2KKCA 2WYQA 4FJYA 1W1HA 4N9F4 2ZVOA 1FHWA 4TUUA 3ODXA 1OEYA 3UQBA 2DKPA 2XEWA 2K8HA 4XWXA 5J17A 2M1MA 3LJ3A 4ZRJA 1KZ7A 2COFA 3N7CA 4FULA 2G35A 3RCPA 3TCAA 4K7WA 3WANA 1UEFA 2ELBA 1UBQA 2IYBA 1WF9A 3R7QA 3JW0X 3O96A 3PREA 4A20A 4AJWA 2K00A 2K2UA 2LOXA 2M0XA 2W9NA 4HAUB 4IWQA 1SHCA 2COPA 4M8NA 3APDA 2N9XA 1V88A 3KUDB 1E5WA 1YIWA 4KZCA 2JY6A 2PZ1A 2D07B 3ZLZA 5IJMA 3GYOA 3ZVRA 1H4RA 1OTRB 1P9DU 2GBNA 5J3TA 5D94A 1FHXA 2P0HA 2KDFB 4ICVA 4DBGA 2PPHA 4KSLC 1SIFA 3JVZX 3SU8X 1E7VA 4WJPA 5C5BB 4GDKB 4URKA 1OQYA 5IAAC 4HAZB 1LFDA 3GOEA 1N3HA 3T06A 1LXDA 4KV2A 2V4LA 4ZYNA 1V5OA 1UPRA 3HIZA 3RYTA 5HKHA 1EVHA 2YS5A 1V89A 2KXJA 4EZJA 2NBUA 2NBVB 3PTFC 3L0WB 1P98A 1T0YA 3TO1A 1EO6A 2IBIB 2N4FA 4DK5A 2VSZA 3WIMA 5KHQA 2KC1A 3IFWB 2AYOB 2ZCCA 4PYZA 2Y8FA 2B3AA 2L8JA 4RMAA 1R4MI 1U5DA 4B95A 3ZNZB 2KNBA 4W9JA 3PGEA 3JSVA 3PPAA 2MP2A 4GZUA 5E6OA 4MJSB 2R2OA 2W2XD 2ZNVC 3TMPB 2LI5A 2JXXA 4NJ7A 1TZ1A 3UQAA 4PS7A 2ZPNA 3AI5A 1YD8U 5D7GA 2DYQA 1V5TA 2OOBB 4KVGB 1SGHA 1MAIA 3WA0A 3BJIA 2UZSA 1AARA 2BWFA 2DZKA 2YT1A 4C0AA 2JP2A 2X18A 3K9PB 4RM8A 2KD0A 3ZVVA 3BY4B 1DDWA 3JSVB 2L7RA 3EHVA 5C6RA 2FNJB 3L16A 3M3JA 2KX0A 3PHWB 4A5KA 4KHBB 5D3YA 4ANWA 2LKOA 4Y94A 1EGXA 2DENB 2LG1A 3GZNI 3SUZA 3PRMB 2MKRA 3Q3JA 1S3SG 4GN1A 3UINB 3KY9A 2LASA 5GMVA 3R66C 5FI0A 4F7UP 3N3KB 4MELA 3ZIMA 4ZRKA 5HE0A 2FCQA 4NAWB 2EMSA 3M1IB 2NVUI 3PVUA 3ML9A 4IM3A 2LZ6A 4MGKE 3ODOA 3RCZA 3VTUA 2DFKA 3S2AA 3EFUA 4W9GA 2QKMA 4NSWA 5HE3A 3DVGY 1NTYA 2M4NA 3DQVA 4MSQB 3L17A 3PHXB 3BINA 1I7AA 2CY5A 4H8SA 2KLCA 2LGXA 2GCLA 2QHOA 3T8MA 5C5BA 4GDKA 4K2OA 3PVLA 1XT9B 4GB9A 4F7GA 4MT7A 1TJ6A 2JZZA 4MDKE 1TXDA 2M38A 3Q3FA 5J2RA 3OLMD 1WX8A 1P1AA 3NY5A 4HWIB 3SO6A 2ZJDA 4K7SA 2FUHB 2RUKB 3QIJA 1KLVA 1W1DA 3D32A 4HPMB 2RSGA 1WGHA 4IAPA 3DOWA 4I6LB 3ONSA 2I5CA 4BBNF 1FAOA 3MDBC 3APCA 4HCNB 3VH3B 1NTIA 4ANUA 1YX6B 2MDXA 2O6VB 4ANVA 4CHJA 2DX5B 5JZEB 1EUVB 1OQNA 2BKRB 4LJPB 3L10B 4IUMB 4MY6A 1WE6A 2JRIB 2LVPA 3W1YA 1J0WA 2EKEC 4W9CA 3TBLD 1E7UA 3A98B 4EZLA 1KZGA 2IO1B 4ZRIA 2RLOA 1RRPB 1UPQA 4FHJA 3QHTA 2JZ3B 1FXTB 1Y8RC 2O6VA 2P0DA 2KWVB 2CAYA 3WYFB 1ZW7A 2KOXA 2J0MA 3AJ4A 1XR0B 3DXEA 4EMOA 2JPHA 2GBRA 2L00B 1IYFA 1WXVA 3OJ3A 1UELA 4GOCA 5LLIA 3LDZE 1ZC3B 3AULA 2D9YA 4A6FB 3A9JB 1P5TA 4BBNC 2KMCA 5AZGA 5IA7A 1G6JA 1J8CA 2MBEA 4WJ7A 1U27A 5FI1A 2N1WA 4HAYB 5CTRC 5DPRA 2KTFA 1OY2A 3NS8A 4L6EA 3PSCA 1WFYA 2WWZA 2W2XC 1WX7A 2AWTA 2DN6A 2RD0A 4WWNA 4HB3B 2HJ8A 2NMBA 5EFXA 3CXBB 2IY0B 1WGGA 1GJZA 2MWNB 3QAQA 2DHZA 4A6HA 4HCPB 4BKGA 1FGZA 2LGDA 4W9LA 2KGXB 4NAWA 2DX5A 3FLVA 1Q1OA 1K8RB 3A4SC 4HB4B 3IHPC 4LCDE 1WM3A 1KI1B 4HHVA 1I35A 2ADZA 1TGZB 4DWFA 2DZMA 2GOWA 2BYEA 2MLBA 3B08A 1AQCA 1PFJA 2YS3A 1DDMA 4A3OA 4HJKA 2D10A 1OMWA 5C79A 1Q5WB 3DVGX 3WAPA 3N30A 2GMIC 2QKLA 4IOYX 1SE9A 5L81A 4CHMA 3HM3A 5DPSA 3SNHA 1XODA 5CHVC 3QA8A 1LM8B 3RZWC 1H10A 4FN2A 2OTXA 4TKNA 3I3TB 1WMHB 2K25A 3VHTC 3U30A 2KZRA 4A6FA 5LONB 3VAWA
chains in the Genus database with same CATH superfamily
3NVYA 4PYUA 1D5XC 1FD6A 3PS6A 2P8VA 1TYGB 3PSEB 5JH5C 4XX5A 1UBIA 4EZKA 2K49A 2CHZA 2ROZB 1ZGUB 4KKIA 4RF0A 2ZZPB 5J3QA 3O13A 2GBJA 3GE8C 5JHHA 3AEDB 4D0NB 1VZ8A 4WJNA 3F0WA 1KOTA 3CMMB 4MGZE 2RDHA 3PV1A 2W3RA 4M02A 1RFAA 4OVZA 3H1UA 3H8HA 4K1RB 3PZ8A 4G0NB 5JHBA 1J7BA 5GXGB 1R4MB 1T5XD 1R4NB 3ETRA 4QXAB 1L0VB 2WXMA 4ZHPA 3EUB2 4HSIA 4IM2A 1CZPA 2CRFA 2FJ9A 1E8YA 3SHQA 4M0WB 3LYYA 4A90A 1UNSA 1YN5A 4HLEA 2MA9B 5C1ZA 2WXPA 3AU4A 4HPLB 2WLBA 1V9JA 2NCNA 4JKFA 3PT2B 5DI9B 4BOZB 4ILJA 4TQ1A 3HIEA 1P3RA 2IO0B 4W9EA 3SR6A 2DZJA 1ZPSA 3AEBB 5C16A 4WURA 2JWZA 3R7RA 1UUPA 1PGXA 3K9OB 1GAQB 4AUQC 2XBBC 1MPHA 1V61A 4LDTB 1AN8A 4DHZB 5JVLA 1KBLA 2JQRB 2WXKA 3IXSA 4BBKA 3KYCD 4MM3A 1N6ZA 3L4PA 1UWMA 4X57B 4ZDVA 4O1NA 1UNRA 3RNEC 1D5MC 1L4ZB 2ZPYA 2WXLA 4GIVA 2SAKA 3ZQ4A 2LMCA 1TTNA 1FMAD 3VTVA 3APFA 1X86A 3VIAA 3AE9B 2PE6B 4HJGE 1FB8A 2JU6X 1X1GA 4AOFA 4RGTA 3GS2A 1E8XA 2D9WA 2KIGA 3HVDA 2HD5B 2Z0QA 1Q10A 5HFYA 1XD3B 3PLVA 2EELA 4HDQA 3NZUA 3KUCB 4MGYE 3GP7A 1H8CA 4N59A 1FRDA 1SJHD 4WWPA 3TIXA 2KWUB 3A4RA 1UGJA 2LFIA 5JP4A 1HQRD 1I4PA 4AP4C 3T3NA 2ABDA 4WVFB 1V8CA 4UDUC 1GC7A 1XKEA 3AXCA 5G5GA 3AV8A 2RQ1A 3ODWA 2C7HA 2MEKA 1FHOA 3DBLI 2AL3A 3EECA 1WZ0A 3WALA 2FUG1 3IAS1 2KT7A 1KFYB 3OG5A 1UGMA 3NWFA 4CSQA 2LULA 3AU5A 5JLJB 1LGRA 1VZ7A 1V5MA 2IGHA 3BZDB 2N7EA 1EWCA 2KWCA 3QQ8B 2E6XA 3RNGC 3E66A 2JUOA 2R09A 3M62B 4HB0B 1XD4A 2WXHA 4P7IA 5HHDG 3VVWB 1ISNA 4XWWA 1BUIC 2M17A 1VJKA 2R61A 2I2YA 1UZXB 3P63A 3VFKA 4NJCA 4AQ7A 3PRPB 2H7DA 3GB1A 2OJWA 3FM8C 1JROA 3OAWA 4L1BA 4C80A 2G4SA 4HROA 2DHKA 3ALBA 1N62A 3DVNU 3HHMA 2CS4A 4G11A 3TFMA 1EU4A 2V4IB 2KJHB 1BMLC 4ZOHC 1L0YB 2N7DA 2FJLA 3UZTA 4ICUA 3RD2A 4C7YA 2Q13A 3H7SA 4JPSA 1XLPA 4W9KA 4ZRPA 2L52A 2KX3A 4WQOB 4BKSA 4F1SA 2K22A 2Y3AA 4HEA1 2C7MB 3SBGA 2BS2B 1VCBA 4TMAB 2KK8A 1WZ3A 4TSSA 2KFKA 1ZXHA 3WAMA 4M8MA 1DGJA 3MP9A 3DBHI 1WXMA 3KW5B 1HB8A 1AWEA 4MK0A 2BW2A 2IYDB 3C0RB 3N1ZC 1M7EA 2CHWA 1GPXA 3MC0B 2KIEA 3E9SA 5G5HA 4Q2JA 3GYPA 4GPTB 2MQJA 3MHSD 4AS1A 4LNKA 1BTNA 1F52A 2BT6A 3AEAB 4WAAA 2BKFA 1FOEA 5JXVA 1TY0A 1C4PA 3DPDA 1V1PB 3MPXA 2L05A 2AL6A 5EE3A 2RPVA 4AWJA 5G55A 1GG3A 1EF5A 2G45B 1ZVRA 4TV3A 4JWUC 1KC7A 4WSFA 2IO3B 4CO7A 3VTWA 2JYTA 4DBBA 4W9HA 1BTKA 4GMVA 1UH6A 3QJZA 2D9XA 2DYBA 4DXAB 4YTPB 4FBJB 5C23A 1PGBA 2R2YA 3BK2A 1YOVB 1XQQA 3X0WA 3JYUA 5MPOA 2RR9A 2WYQA 1AWDA 3ODXA 1ROEA 1R7SA 3OWEB 4XWXA 2M1MA 3TEZA 3LJ3A 2G35A 3TCAA 4JKAA 1UBQA 3JW0X 3PREA 2VH1A 2K2UA 2W9NA 3OHMB 3ENBA 3B9JA 1MI0A 4M8NA 1E5WA 4JX1C 2JY6A 1STEA 3GYOA 2GBNA 1QOBA 2P0HA 4KSLC 3JVZX 4LNNA 4URKA 4HAZB 1LFDA 1LXDA 4KV2A 2V4LA 5HKHA 2YS5A 1V89A 1E7PB 4EZJA 3L0WB 3TO1A 1EO6A 1TS5A 2VSZA 1C77A 3WIMA 4C7ZA 2ZCCA 1N61A 5HG2A 2GLSA 4B95A 3FAHA 4JE3B 2MP2A 5E6OA 2ZNVC 3TMPB 2LI5A 5D7GA 1K53A 1SGHA 1MAIA 1MHHE 3BY4B 3KQ4A 1DDWA 2WXJA 2MCNB 1ZP0B 3N20C 2LKOA 1TS3A 2LG1A 3GZNI 4ZYSA 4F7UP 2K3UA 1T0RC 4MELA 2NBVA 3M1IB 2NVUI 2LZ6A 3ODOA 4W9GA 2QKMA 4YT0B 1MG4A 1I7AA 4H8SA 2ZKMX 2GCLA 2QHOA 4GB9A 4K2OA 4F7GA 3T3OA 1UWXA 4YXDB 4HWIB 3SO6A 2ZJDA 4ACFA 3Q3NC 3I63C 2LHDA 1KLVA 2RSGA 3VH3B 2RDGA 4ANVA 2EKIA 4CHJA 1WSPA 1NVID 4P6VF 1EUVB 3L10B 2BS3B 5FR3A 2JRIB 2LVPA 1J0WA 2NTTA 1ET6A 2RLOA 2IGDA 2O6VA 2KOXA 3WYFB 4EMOA 2JPHA 1PFDA 2GBRA 1IYFA 2KMMA 3OJ3A 2QC8A 1ZC3B 1G6JA 3A9JB 5IA7A 2QEJC 3Q8CA 1J8CA 4WJ7A 4JKHA 1OY2A 4CQNA 2YEPB 1WX7A 3DCXA 4ILGB 4HB3B 4GNKB 5EFXA 5H92C 3P4QB 1GJZA 2DHZA 4A6HA 2JXTA 4HCPB 1FGZA 1YJIA 2DX5A 3FLVA 3NVWA 1K8RB 3Q8EA 2CU3A 1WM3A 1KI1B 2DZMA 1KRHA 4A3OA 1Q5WB 2QKLA 1LM8B 1I4QA 1H10A 1HTOA 3VHTC 1ESFA 1WMHB 2OOBB 5LONB 3VAWA 4KGSA 1WYGA 2K1FA 1EAZA 1BT0A 3A8QA 3IG3A 3KLSX 2LRUA 4FA6A 5AZHA 3AE4B 1VR9A 3CSTA 3DBHB 1TS4A 3NUHB 5M4YB 2RSUA 1V81A 5FR6A 3OANA 3PZDA 1T6BX 3Q14C 4PS8A 1I4XA 4C4VB 1LB1A 1I7HA 1L0XB 1I4HA 1WJ4A 4XE0A 3TEXA 3PG7A 2ELAA 1Z2MA 4RGMA 1QQGA 3HM6X 5E6PA 4QAYA 2Z0PA 4RCOA 3TUOA 2XK5A 3DXDA 1HA5A 3ZNGC 2BQQA 3ZKJC 2FBWB 4L23A 3B1LX 1JALA 1U2BA 2L76A 4PNKA 5CX3A 2KDBA 3DDCB 1M4VA 3VUWA 2M14A 4W9FA 2AQ3B 2INPE 4KHBA 4MGIE 2KCJA 2MSED 3QX1A 2Y5CA 1TS2A 3OJ4B 3RNAC 2XN9C 4FHKA 4KIKB 4N58A 1IPGA 3TW1A 1X11A 3KRXA 3P4SB 2FCSA 4MJSA 2ON8A 2MP2B 1TQZA 5JHGA 1K5GB 4B0MA 1WE7A 2Q5WD 4HAWB 3W9CB 2JSVX 2Z0OA 2A4ZA 3L08A 4NAMA 2YRYA 1ZOYB 1SEBD 3TJPA 3P7ZA 2ZW1A 1YX5B 2HTHB 4IKGA 1ZC4B 3KWLA 3RT3B 3CWIA 2MX2A 2D3CA 2YLMA 4W9IA 3RNBC 4B6WA 2N1VA 1OQQA 2KJRA 2MBHA 5BMHA 4XC2A 1WR6E 2RPQA 1WGUA 3UGBB 3ENEA 1V1OA 2MJDA 2M56B 4B9KA 2DAFA 3BVMA 2JZPA 3AMZA 5E6NA 2WDRB 5D27A 1N60A 2CR5A 1QOGA 1JWBD 2J4XA 3BYTB 2L2IA 2Y7BA 2Y5PA 1R4NI 2RVBB 2FE8A 2NR2A 4WIPA 2BWES 1I4GA 1J7CA 2NPTB 1PQSA 3VQIA 2KANA 2FCNA 2K39A 1NBFC 2NS5A 3A33B 4LTUA 3RZFA 2LBBA 1T3QA 3A1QB 1L6VA 2RRFA 2D9ZA 1X1FA 3D8FA 2KJ6A 2V3NA 2C60A 3AE1B 1ST7A 5L95C 4YSXB 5FKAC 1ZYIA 3TSSA 2FIDA 1JRPA 1V6EA 2C5LC 4YTNB 1K5DB 1KLGD 1WH3A 3DWGC 5AUIA 3VR8B 2FCMA 1DBHA 2PLPA 2ROVA 4IWPA 4A20A 1KM7A 1NI2A 1NDDA 3HW2B 2O2VA 1BWNA 1NYRA 1GNUA 2WX1A 2MJEA 2E3TA 2PE9A 3ULBA 2L1CA 1SBBB 2Z59A 1EU3A 4MH8A 3E9LA 3CF6E 3ULCA 2REXA 4YSYB 4NQKE 1XX0A 4RNAA 4F8CB 3ZTCA 1UF0A 4MEMA 4EUTA 5LNK1 2YVCA 1C1YB 2J0JA 2PEAA 3QBVB 2IJ0A 3ZNID 1C4CA 3NHEB 2IGGA 3U7ZA 1FO4A 2OQBA 1X05A 2N9EB 2D3GA 4USAA 3M95A 2WDTB 2GCJA 2I1JA 3V6EB 1WI1A 2YT0A 1Q67A 4JQWC 2ZEQA 5DHFB 3B0AA 4KHOA 2WNMA 3DHHC 3DBSA 2LEKA 2J7QB 3AH7A 1KJTA 4L2YA 5DPTA 1PUTA 2ZVNA 5DCNA 1TBEA 4KDLB 4M00A 2RNRB 2MRPA 1YQ4B 2N0SB 4ASWC 1C3TA 1B55A 2V3SA 5D3WA 2BTEA 2DBYA 4F7ZA 2KN5A 1F2RI 3HRDD 4GU2A 1MK7B 2I5FA 1SE2A 2WDQB 2Z8LA 4IM0A 4NY0A 2O2VB 4HATB 1HZ5A 2K5PA 2WXIA 3VXWA 2HTME 3DBRB 4EEWA 1D3ZA 3F5RA 4TYZA 4RGNA 3VRAB 1EWYC 1JWMD 4HAXB 4YWGG 3Q8AA 4JKDA 2LWPA 4US9A 5G2NA 1WJ1A 5J18A 2C9WB 4HB2B 4A55A 2LUEA 2DNFA 1P6SA 1J0GA 2MBOA 3H6NA 5CLQB 3RULA 5IO9A 2KFJA 4BVUC 4HDOA 1V5PA 1WMHA 3W1SA 1XCGA 2BCJA 1SB3C 1T0SC 2D11A 2V0GA 3KRWA 3H9DA 2UYZB 4CYEA 4XDDA 4DX90 1IBXB 1OGWA 4BAXA 2K8BA 1WYWB 3AEEB 1W1HA 2JX5A 1JQ4A 1OEYA 3BK1A 4ARIA 1VRAB 4OSNA 1FNWA 3N7CA 3U2SC 3WANA 3RCPA 3R7QA 3RNFC 2IYBA 3ZYYX 1KTKA 4AJWA 2K00A 4IWQA 3BYYB 4HAUB 1E9MA 2LUMA 3APDA 2D07B 5IJMA 3ZVRA 1RFKA 1OTRB 1FHXA 2KDFB 1SF0A 3SU8X 4WJPA 1OQYA 2KUQA 1N3HA 4HKZE 2ZW0A 1ENFA 1V5OA 1C76A 3HIZA 3RYTA 1EVHA 1FFUA 1MI1A 2KXJA 2X8XX 2NBVB 3ZJUA 3PTFC 1P98A 2V3PA 4LNIA 1FFVA 3BIID 5KHQA 3SEBA 2L8JA 4MACA 1U5DA 2KR0A 1C4AA 4W9JA 3PGEA 4GZUA 4MJSB 4NJ7A 1TZ1A 3AI5A 1YD8U 4GLSC 4A6QA 2DYQA 4KVGB 3E56A 3BJIA 5AZGA 2YT1A 4C0AA 2JP2A 2X18A 1SJED 3K9PB 5EE9A 2L7RA 5C6RA 4A5KA 5D3YA 5I4DA 4ANWA 4Y94A 1EGXA 2R82A 3Q3JA 2MKRA 2H89B 3AE2B 1S3SG 3UINB 3KY9A 4QJ3B 2LASA 5FI0A 4LNOA 4ZRKA 1B9RA 4NAWB 1E0ZA 2EMSA 4IM3A 5IP4D 3VTUA 3DQVA 4MSQB 1RYJA 3PHXB 3VR9B 3T8MA 1GB1A 2JZZA 5J2RA 3Q3FA 3OLMD 3A58A 1WX8A 3NY5A 2ICIA 1D4BA 1JCKB 2FUHB 1E10A 2RUKB 3QIJA 4LK0M 3ONSA 2I5CA 3V05A 1FAOA 3MDBC 2CJOA 1YX6B 3BVGA 1Y56A 2L32A 4LJPB 4MY6A 3W1YA 2EKEC 4W9CA 1E7UA 2Z14A 1ACCA 2IO1B 4ZRIA 1RRPB 3QHTA 4REZA 3WCQA 2P0DA 2KWVB 2FJUB 2J0MA 3AJ4A 3DXEA 3URYA 2L00B 1WXVA 4GOCA 1T0QC 3LDZE 1P5TA 4BBNC 2KMCA 1C9FA 2MBEA 5FI1A 1U27A 4H2AA 4HAYB 5CTRC 4DIXA 3NS8A 3R8BA 1WFYA 3PSCA 2WWZA 1FNVA 3ABVB 2RD0A 4WWNA 2BB5A 2NMBA 1XXGA 4DXFA 2MWNB 4BKGA 2K0PA 1F2RC 4W9LA 2KGXB 5IRSA 3NVVA 4J3OD 1JWSD 4HHVA 4DWFA 3B08A 3RMKC 2KAJA 3Q69A 3WAPA 3N30A 2KYWA 5D3IB 3HM3A 1P7FA 5TSSA 5CHVC 5C2TB 2INDC 2OTXA 3U30A 4A6FA 2KUPA 1TJEA 2PVGC 4PK1A 1DDVA 2RDBC 3DHGC 3R3MA 2BS4B 4FXCA 1FCLA 5BO4B 2VKIA 4IC7B 4JKGB 4WQMA 2UU7A 2COAA 3A9KA 4OVVA 4NJ6A 2JRHA 1Y19B 2W54A 2N23A 1DROA 4IG7B 1PDXA 3NRZA 2JVCA 1JRUA 3P4RB 3U7DA 2BYVE 2IO2B 1U29A 2PJHA 1ZM0A 3DBRI 1NEKB 2EJ8A 2MWSB 1K51A 4BZAA 5LXIB 3ML8A 3ZW3A 3MJWA 2LRWA 2L0TA 4OZCA 1FEHA 4AJYB 2BBCA 5IN7A 2MBQA 3KSYA 4WWOA 3ZTDA 2VRWB 4LJOB 2C7NB 1N63A 4DDID 1ZKHA 4E74A 3MTNB 4RH6A 4GDLA 2R0DA 1GUAB 2V76A 3HQCA 2DTCA 2LHEA 2YT2A 1I42A 1WR1A 1U5GA 2BYFA 2VH2A 4GXBA 5DPWA 1IGDA 1JWUD 2HJ1A 3N32A 2PMVA 2LJIA 3HUIA 5EE0A 5D2MB 2J59M 1XO3A 4IW0A 3P2BA 2V9HA 4K7UA 1ZDVA 3R2IA 2DHJA 1KLUD 1MIZB 4CHKA 1M94A 1DOYA 4JK8A 3H7PB 4YONA 2CU1A 3C19A 3B2FA 2XNAC 4JKEA 2KMAA 2M0AA 2Z0DB 5TR5A 2AQ2B 1HXYD 3V60A 3G9WA 2RGNB 2GS0A 5KQ1A 4BOSC 3V61A 2G1EA 1A70A 4I6NB 1WJUA 4JKCA 3D8DA 1MFWA 4DDGD 1I2HA 5KCVA 3LJUX 3VUXA 3NSUA 3FILA 1XLOA 1WJ6A 3GE3C 3CIKA 1XCTL 2FIFA 3VH4B 1VD2A 2DLBA 2IZVB 1UD7A 4A9AA 5IKCM 1WRDB 1VZ6A 1IP9A 2FAZA 2CB8A 1P3QU 3AM9A 3L54A 2KFKB 4PQ0A 4F7HA 1D5ZC 3HSAA 2D2QA 2H88B 1WWTA 3VDZA 3KH0A 5C3JB 1B1ZA 1GC6A 3EPYA 3WAOA 2ZNVB 5EE1A 2LXCA 2MJ3A 4ANXA 4JL9A 4G3XB 4KIKA 3ZRCA 4US8A 1Q0WB 3KWVA 4WJQA 1U5FA 2DX1A 1LW3A 2ZCBA 2Y8GA 1IUEA 4M0WA 2MHJA 3QWZB 2GJYA 2Z4DA 2DYMA 2OJRA 2X0SA 2ONQA 2DLWA 3NOBA 2K9XA 4HKQA 2LD9A 5GOWB 3RN9C 1YQBA 3P6AA 2DHIA 2I1KA 5D3VA 1RAXA 1FNUA 1L7YA 1WI0A 1WXAA 2JT4B 1YN3A 2XK5B 1MK9B 2D9VA 4BKTA 1EF1A 4QJ4B 2L3ZA 2NZ8B 4NZLB 2H7EA 3PVWA 5D3XA 1L2NA 4DQOC 3PLUA 2DIKA 4S17A 3IVFA 4OZBA 5BMIA 4DHZE 2W82A 3MHZA 2D4QA 3DCGA 1V5UA 1TZOA 5E6JA 4C4VA 1DIKA 1I4RA 2IY1B 3O65B 2K6DB 5J3YA 4NNJB 5HE1A 2L0FA 1GOZA 4E3CA 2R2QA 1WM2A 3P4PB 4XYCA 4P16A 3N9YC 2CQUA 4ITKA 1WGDA 4OZAA 2K8EA 1BXTA 1D6EC 2D3BA 1E90A 4IFSA 4NQLB 1WX9A 1ET9A 2KVZA 3NW8A 1F77A 2N9PC 3PO0A 2BVCA 2WXOA 2O6VD 2KDEB 1X1MA 4R3DA 3PRZA 1MKEA 2D3AA 2MH7A 5LXHA 2LVQA 3Q2AC 1HZ6A 1QC6A 2CKHB 1FCCC 4JKGA 1CMXB 2N9LA 4KSKC 1WGQA 2DZIA 1SIJA 2XQNM 4RF1A 2WH5A 1YJJA 3FILB 3NVZA 5HE2A 4K17A 3ZJVA 3ZUNA 3QCAA 1VDVA 2GBMA 3IT4B 4GGQA 1WGRA 3AN1A 4MM3B 3T9LA 4HAVB 1I35A 2BGFA 1MIXA 1TIFA 2UZRA 2KC2A 4ARCA 2INNE 2MW5A 4ILHA 1NVLA 3L13A 4KZ0A 1OEYJ 2YSZA 2AEHA 1RLFA 3U52E 1BAKA 4EFOA 1VLBA 2QMTA 1ZXIA 1HTQA 3VOQA 4FLHA 5DIFB 2LYDA 2DA0A 1CK1A 5KHOA 2LOZA 1PGAA 3ECIA 1YQ3B 1C79A 1JW9D 2KDIA 1MG8A 3SDLC 3Q6BA 3PEGA 2KKCA 4FJYA 1FHWA 4KGRA 1JMLA 2KWDA 2XEWA 2K8HA 5J17A 1T77A 4FULA 3VRBB 4B0EA 1UEFA 2ELBA 1WF9A 2GI9A 2M0XA 1QF6A 2COPA 3DWMA 1V88A 3KUDB 4KZCA 3ZLZA 1H4RA 1OQRA 1NYQA 1P9DU 2ACZB 2NMQA 4L1RA 2PPHA 3U4EG 5C5BB 4GDKB 1K52A 3GOEA 4OT1A 1UPRA 3HVZA 4XDCA 2NBUA 3NWDA 4N6EB 3CIRB 2NTSA 1T0YA 2IBIB 4DK5A 2KC1A 2AYOB 1QQRA 2Y8FA 2B3AA 2CJNA 1MVKA 1WGKA 3ZNZB 3JSVA 1HEZE 3V3XA 2R2OA 2W2XD 2JXXA 3UQAA 4PS7A 2INCC 4HRSA 1ZDXA 2WXNA 2UZSA 3ZVVA 4RM8A 1AYFA 3ZXVA 1P7EA 3M3JA 2FNJB 1NENB 1XLNA 4KHBB 3SUZA 1N5XA 1RWSA 4GN1A 3R66C 2L1AA 3N3KB 2FCQA 3ML9A 3PVUA 2KACA 3RCZA 3EFUA 4NSWA 5HE3A 1L4DB 1NTYA 3U12A 2J53A 2M4NA 2VZKB 1V97A 1IBXA 3W5VB 1YN4A 5BYQA 2KLCA 1EM7A 2LGXA 1SE4A 4MT7A 1GB4A 1TJ6A 2BYTA 2M38A 3B2GA 1DOIA 1W1DA 4HPMB 2PKOA 4I6LB 4BBNF 1FIQA 1NTIA 4ANUA 2MDXA 2DX5B 2PTLA 5JZEB 1LO5D 4IUMB 3TBLD 4EZLA 1KZGA 2WS3B 1UPQA 1FXTB 2TSSA 1F0ZA 4P1CC 2Y5BB 1XR0B 1TY2A 1UELA 4JWSC 2D9YA 4A6FB 1C78A 1VBGA 2QSDA 5DPRA 2KTFA 1QILA 2DN6A 2WXQA 2WDVB 2IY0B 4KGTA 1WGGA 4HPPA 3QAQA 1MHXA 4NAWA 2LGSA 3A4SC 4HB4B 3IHPC 1JDEA 1KF6B 3FC4A 2ADZA 2BYEA 1AQCA 1PFJA 1DDMA 4LNFA 1QKZA 3BWUD 4HJKA 3DVGX 5C79A 1QOAA 4IOYX 1SE9A 5L81A 5DPSA 3SNHA 1F1HA 3QA8A 3RZWC 3TEWA 3I3TB 2KZRA 1ZE3D 1FRRA 3EGRA 2AQ1B 1RRBA 2AX5A 1FXIA 4FJZA 3QC8B 3RI7C 5FK9C 1WG7A 2KHWB 1J19A 1W1GA 1V1PA 2GB1A 4YL8A 4DX8A 1FM0D 1IGCA 1HE8A 2GUMA 2QJLA 1E8WA 2X38A 1HB6A 3LXFA 2COCA 1LQBA 3N1XC 2PW9A 1U5EA 3X23A 2UVMA 4IWOA 2E2XA 1QZEA 1DYNA 2IPKD 1ZUD2 2BPSA 3KZ1A 3W5UB 2PIAA 1YJ1A 2QILA 5AZFA 5L83A 4GSWA 4NPNA 5CHFA 3UIOB 1FGYA 3QWMA 2P0FA 2J42A 3MFGA 3NZSA 4JGHB 2KTRA 3J9CA 2SEBD 3PP2A 4OHJA 2L83A 2W55A 4WWMA 3N1YC 3Q8FA 2Z0EB 1IRSA 1DYQA 1Z5SB 4BKSD 2YS1A 2KQ4X 2DYNA 2BB6A 3ZDMC 1Z87A 1ZSQA 1UNPA 5AEKB 3RPFC 3IT6B 3SD5A 4HXDA 4RFBA 4C56C 3SV1A 3ZJTA 3V6CB 4BFRA 2LVOA 3VUYA 4EJNA 3M63B 4HVBA 4JKBA 1FXAA 4ZRQA 4II3B 1WY8A 3U8ZA 1E8ZA 2DYOA 3RUIB 1P0RA 2W3SA 3AE5B 4A3PA 1M7RA 3FKYA 4PS3A 2IFSA 1L6UA 2YEPF 3HK0A 3UIPB 2MBBB 3FSSA 2RGFA 3C8YA 4JK7A 3A1QA 1V86A 4RM9A 2W2WA 1VBHA 3TEYA 1ACAA 1NI3A 4DHJD 1Y5OA 1UNQA 5LOPB 3E9PA 2EC1A 2WXRA 2UWQA 5D3DA 2HE7A 4ZHOA 3EA6A 4G50A 1TKYA 4P1BC 4EOYA 4C00A 2K2JA 1XEEA 2ASQA 1GGOA 1WJMA 4HK2A 3AE3B 1MJDA 4FADA 1V80A 2G4DB 5AUKA 1NTVA 3EFCA 1CJEA 1V2YA 1WRIA 5BYRA 2Z13A 1V49A 1K50A 4MSMB 2DKQA 3MJ5A 2LGYA 2WU5B 4K3BA 5CLLB 1HBKA 2OHFA 4LDTD 5JHAA 2WU2B 2WXFA 4GMXB 3BVZA 2CY4A 4K2PA 2MFQA 4DHJB 2CHXA 2FDQA 2B76B 2VRRB 5KQ4A 4B6HA 5DHAB 4PT5A 4RGOS 1OFFA 3QARA 1U4AA 4JK9A 2MLBA 2GRIA 4KKJA 4II2B 3LB8C 4Z2NA 2KLGA 2BF8B 3ZRFA 3A8PA 2N0YA 2KVRA 1PLSA 3IBEA 3CSFA 4EE2A 3EC8A 3E9OA 4RMAA 3ZGZA 5D6JB 3ZO5B 4JLCA 5BYSA 3V62A 2LXAA 4KDIC 4OW0A 4XZ4A 3W1SC 4YSZB 4GDLB 2EMTA 3GZNB 2DAJA 3SYXA 2WQYB 2Z59B 4JIOU 4M01A 2K6QA 1S1QB 5EDSA 2WP9B 2V1YA 5LG4B 3KYDD 3AE7B 2KO3A 3ZDTA 4WAFA 1QLBB 1MPEA 4WH4A 2N7JA 2NPTA 3AB5A 2CODA 3AE6B 1A5RA 2HTHA 3KVFB 3AEFB 4E71A 2YF0A 1WGYA 3FP5A 2RMMA 1TT5B 3D8EA 3V5WA 2JWUA 2GBKA 3NWAA 3AECB 4MH0E 4W9DA 1WXSA 4IOIE 2G3QB 3ZNHB 4Z2MB 2WX0A 2D5GA 4OVUA 2J0KA 3NJTA 4KHAA 3UI3A 4FJVB 3QK0A 3TL5A 3Q8BA 4S0RA 2HRJA 3TVVA 2QDFA 3UF8A 1QT9A 3PZ7A 1WJNA 4MT5A 2KTRB 3DXCA 1XF5L 1NU2A 3FEHA 3A9KB 3KUZA 3DVNV 5CHWA 1RJ2A 2KQ7A 4A6KA 3H7PA 1PYWD 4I6PA 4WJOA 1F9JA 4QJ5B 4KAXB 2JF5A 3AEGB 4YTMB 1CQVA 4K81A 3SFEB 4J6IA 1SXTA 4EKUA 1WXQA 2A5UA 1WVHA 2I38A 2M8SA 2LJ5A 1DOXA 1PMSA 3ML4A 5DH9B 1WIAA 2NBWB 2K8CA 2KQSA 4N9F4 2ZVOA 2QIEB 4TUUA 3UQBA 2DKPA 4ZRJA 1KZ7A 2COFA 4K7WA 5HI1A 3IAM1 4K3CA 3AE8B 3O96A 2M19A 2LOXA 3MC8A 1SHCA 2PVOD 2N9XA 1YIWA 2PZ1A 4KX6B 5J3TA 5D94A 4ICVA 4DBGA 4XGAB 1SIFA 1E7VA 1TKEA 5IAAC 4GOUA 1TKGA 1J7AA 3T06A 4ZYNA 1N5WA 1AW7A 1JWAD 1YNTE 2N4FA 2OEDA 4D6WA 3IFWB 3P1MA 1QOFA 4PYZA 1R4MI 3SBTA 5I2SA 2KNBA 5T8IA 3W2DA 3PPAA 1FPYA 4LLGM 3RNCC 3ZXRA 2ZPNA 1V5TA 3WA0A 2BWFA 1AARA 2DZKA 2KD0A 2LGIA 3JSVB 3EHVA 3PHWB 3L16A 2KX0A 3PRMB 2DENB 1SE3A 1L5PA 5GMVA 3ZIMA 1XCQL 2HDEA 5HE0A 3MC9A 3DHIC 4MGKE 2QCZA 2DFKA 3S2AA 3DVGY 2VZKD 3L17A 2JYEA 3BINA 2CY5A 2G9HD 4TQ0A 3I57A 5C5BA 4GDKA 3PVLA 1XT9B 2KDMA 4MDKE 1TXDA 3R2TA 3NZ3A 3I5JC 1P1AA 4K7SA 3P42A 3D32A 1WGHA 4IAPA 3DOWA 4HCNB 3APCA 2O6VB 3Q3OC 1OQNA 2BKRB 3DBLB 1WE6A 3A98B 4DXGA 3B77A 4FHJA 4A8XC 1RM6C 2JZ3B 1Y8RC 2CAYA 1ZW7A 3FVCA 5LLIA 2DWQA 3AULA 2IDYA 5I2MA 2N1WA 2N9KA 4L6EA 2W2XC 1SSNA 2AWTA 2WGSA 4XWTA 3Q3MC 2HJ8A 3NS1A 2KN4A 3CXBB 2J52A 3SFDB 2LGDA 1E6EB 1Q1OA 1XLQA 1KH0A 4IDIA 4LCDE 1TGZB 2GOWA 3RFZB 3NG0A 2YS3A 5H8YE 2WHIA 2D10A 1OMWA 4D2KA 2GMIC 5BMGA 3I9V1 4CHMA 1XODA 5IOIA 4FN2A 4TKNA 2WXGA 2K25A 3A9JA 1YMHE
chains in the Genus database with same CATH topology
4PYUA 3PS6A 2P8VA 3PSEB 5JH5C 4XX5A 1UBIA 4EZKA 2CHZA 2ROZB 1ZGUB 2ZZPB 5J3QA 2GBJA 5JHHA 4D0NB 4WJNA 3F0WA 1KOTA 3CMMB 4MGZE 3PV1A 1RFAA 3H1UA 4K1RB 4G0NB 5JHBA 4IM2A 2CRFA 2FJ9A 1E8YA 3SHQA 4M0WB 4HLEA 2MA9B 5C1ZA 3AU4A 4HPLB 1V9JA 2NCNA 4JKFA 3PT2B 4BOZB 5DI9B 4ILJA 4TQ1A 1P3RA 2IO0B 4W9EA 2DZJA 5C16A 2JWZA 3R7RA 3K9OB 4AUQC 2XBBC 1MPHA 1V61A 4LDTB 4DHZB 5JVLA 1KBLA 4BBKA 3KYCD 4MM3A 4X57B 4ZDVA 1UNRA 2ZPYA 4GIVA 1TTNA 3VTVA 3APFA 1X86A 3VIAA 2PE6B 1FB8A 1X1GA 4AOFA 1E8XA 2D9WA 2HD5B 2Z0QA 1XD3B 3PLVA 4HDQA 3NZUA 3KUCB 4MGYE 1H8CA 4WWPA 3TIXA 2KWUB 3A4RA 5JP4A 4AP4C 2ABDA 4WVFB 1GC7A 1XKEA 3AXCA 2RQ1A 3ODWA 2C7HA 1FHOA 3DBLI 2AL3A 3EECA 1WZ0A 3WALA 1UGMA 2LULA 3AU5A 5JLJB 1V5MA 2N7EA 2KWCA 3QQ8B 3E66A 2JUOA 2R09A 3M62B 4HB0B 1XD4A 4P7IA 3VVWB 1ISNA 2M17A 1UZXB 3VFKA 3PRPB 2H7DA 3FM8C 3OAWA 2G4SA 2DHKA 3ALBA 3DVNU 3HHMA 2CS4A 4G11A 3TFMA 2KJHB 2N7DA 2FJLA 3UZTA 4ICUA 3RD2A 2Q13A 3H7SA 4W9KA 2KX3A 4WQOB 4BKSA 4F1SA 2C7MB 3SBGA 1VCBA 2KK8A 1WZ3A 2KFKA 3WAMA 4M8MA 3DBHI 1WXMA 3KW5B 1HB8A 1AWEA 4MK0A 2IYDB 3C0RB 1M7EA 2CHWA 3GYPA 4GPTB 2MQJA 3MHSD 1BTNA 4WAAA 2BKFA 1FOEA 3DPDA 3MPXA 2L05A 2AL6A 4AWJA 5G55A 1GG3A 1EF5A 2G45B 1ZVRA 4TV3A 1KC7A 4WSFA 2IO3B 4CO7A 3VTWA 4DBBA 4W9HA 1BTKA 4GMVA 1UH6A 3QJZA 2D9XA 2DYBA 4DXAB 4FBJB 5C23A 1XQQA 3X0WA 3JYUA 2RR9A 2WYQA 3ODXA 4XWXA 2M1MA 3LJ3A 2G35A 3TCAA 4JKAA 1UBQA 3JW0X 3PREA 2K2UA 2W9NA 3ENBA 4M8NA 1E5WA 2JY6A 3GYOA 2GBNA 2P0HA 4KSLC 3JVZX 4URKA 4HAZB 1LFDA 1LXDA 4KV2A 2V4LA 5HKHA 2YS5A 1V89A 4EZJA 3L0WB 3TO1A 1EO6A 2VSZA 3WIMA 2ZCCA 4B95A 2MP2A 5E6OA 2ZNVC 3TMPB 2LI5A 5D7GA 1SGHA 1MAIA 3BY4B 1DDWA 2MCNB 2LKOA 2LG1A 3GZNI 4F7UP 4MELA 3M1IB 2NVUI 2LZ6A 3ODOA 4W9GA 2QKMA 1I7AA 4H8SA 2GCLA 2QHOA 4GB9A 4K2OA 4F7GA 4HWIB 3SO6A 2ZJDA 1KLVA 2RSGA 3VH3B 4ANVA 4CHJA 1EUVB 3L10B 2JRIB 2LVPA 1J0WA 2RLOA 2O6VA 3WYFB 2KOXA 4EMOA 2JPHA 2GBRA 1IYFA 3OJ3A 1ZC3B 1G6JA 3A9JB 5IA7A 1J8CA 4WJ7A 4JKHA 1OY2A 1WX7A 4ILGB 4HB3B 5EFXA 1GJZA 2DHZA 4A6HA 4HCPB 1FGZA 2DX5A 3FLVA 1K8RB 1WM3A 1KI1B 2DZMA 4A3OA 1Q5WB 2QKLA 1LM8B 1H10A 3VHTC 1WMHB 2OOBB 5LONB 3VAWA 2K1FA 1EAZA 1BT0A 3A8QA 3IG3A 4FA6A 2LRUA 5AZHA 3CSTA 2RSUA 1V81A 5FR6A 3OANA 3PZDA 4PS8A 1LB1A 1WJ4A 3PG7A 2ELAA 1Z2MA 1QQGA 3HM6X 5E6PA 2Z0PA 2XK5A 3DXDA 3ZNGC 3ZKJC 3B1LX 1U2BA 2L76A 4PNKA 5CX3A 2KDBA 3DDCB 3VUWA 2M14A 4W9FA 4MGIE 2KCJA 2MSED 3QX1A 3OJ4B 4FHKA 4KIKB 1IPGA 3TW1A 1X11A 3KRXA 2FCSA 4MJSA 2MP2B 1TQZA 5JHGA 1K5GB 1WE7A 4HAWB 2Z0OA 2A4ZA 3L08A 3TJPA 2YRYA 3P7ZA 1YX5B 2HTHB 1ZC4B 3RT3B 2MX2A 2YLMA 4W9IA 4B6WA 2N1VA 2KJRA 2MBHA 4XC2A 1WR6E 2RPQA 1WGUA 3UGBB 3ENEA 4B9KA 2DAFA 5E6NA 5D27A 2CR5A 2L2IA 2Y7BA 1R4NI 2RVBB 2NR2A 2BWES 2NPTB 1PQSA 3VQIA 2KANA 2FCNA 2K39A 1NBFC 2NS5A 3A33B 3RZFA 2LBBA 3A1QB 2D9ZA 1X1FA 3D8FA 2KJ6A 2C60A 1ST7A 5L95C 2FIDA 1V6EA 2C5LC 1K5DB 1WH3A 2FCMA 1DBHA 2ROVA 4IWPA 4A20A 1KM7A 1NI2A 1NDDA 3HW2B 2O2VA 1BWNA 1GNUA 2WX1A 2PE9A 3ULBA 2L1CA 3E9LA 3CF6E 3ULCA 2REXA 4NQKE 1XX0A 4F8CB 3ZTCA 4MEMA 4EUTA 2YVCA 1C1YB 2J0JA 2PEAA 3QBVB 3ZNID 3NHEB 2OQBA 1X05A 2N9EB 2D3GA 3M95A 2WDTB 2GCJA 2I1JA 3V6EB 1WI1A 2YT0A 1Q67A 4JQWC 2ZEQA 5DHFB 3B0AA 4KHOA 3DBSA 2J7QB 1KJTA 5DPTA 5DCNA 2ZVNA 1TBEA 4KDLB 2RNRB 2MRPA 4ASWC 1C3TA 1B55A 2V3SA 5D3WA 4F7ZA 2KN5A 4GU2A 1MK7B 2I5FA 4IM0A 4NY0A 2O2VB 4HATB 4EEWA 3VXWA 1D3ZA 3F5RA 4TYZA 4HAXB 4JKDA 2LWPA 5G2NA 1WJ1A 5J18A 2C9WB 4HB2B 2LUEA 1P6SA 1J0GA 2MBOA 3H6NA 5CLQB 3RULA 2KFJA 4BVUC 4HDOA 1V5PA 1WMHA 3W1SA 1XCGA 2BCJA 2D11A 3KRWA 3H9DA 2UYZB 4CYEA 4DX90 1OGWA 2K8BA 1WYWB 1W1HA 1OEYA 3N7CA 3WANA 3RCPA 3R7QA 2IYBA 4AJWA 2K00A 4IWQA 4HAUB 3APDA 2D07B 5IJMA 3ZVRA 1OTRB 1FHXA 2KDFB 3SU8X 4WJPA 1OQYA 1N3HA 1V5OA 3HIZA 3RYTA 1EVHA 2KXJA 2NBVB 3PTFC 1P98A 5KHQA 2L8JA 1U5DA 4W9JA 3PGEA 4GZUA 4MJSB 4NJ7A 1TZ1A 3AI5A 1YD8U 2DYQA 4KVGB 3BJIA 5AZGA 2YT1A 4C0AA 2JP2A 2X18A 3K9PB 2L7RA 5C6RA 4A5KA 5D3YA 4ANWA 4Y94A 1EGXA 2R82A 3Q3JA 2MKRA 1S3SG 3UINB 3KY9A 2LASA 5FI0A 4ZRKA 4NAWB 2EMSA 4IM3A 3VTUA 3DQVA 4MSQB 3PHXB 3T8MA 2JZZA 5J2RA 3Q3FA 3OLMD 1WX8A 3NY5A 2FUHB 2RUKB 3QIJA 3ONSA 2I5CA 1FAOA 3MDBC 1YX6B 4LJPB 4MY6A 3W1YA 2EKEC 4W9CA 1E7UA 2IO1B 4ZRIA 1RRPB 3QHTA 2P0DA 2KWVB 2J0MA 3AJ4A 3DXEA 2L00B 1WXVA 4GOCA 3LDZE 1P5TA 4BBNC 2KMCA 2MBEA 5FI1A 1U27A 4HAYB 5CTRC 3NS8A 1WFYA 3PSCA 2WWZA 2RD0A 4WWNA 2NMBA 2MWNB 4BKGA 4W9LA 2KGXB 4HHVA 4DWFA 3B08A 3WAPA 3N30A 3HM3A 5CHVC 2OTXA 3U30A 4A6FA 2KUPA 1DDVA 3R3MA 5BO4B 2VKIA 4IC7B 4JKGB 2COAA 3A9KA 4OVVA 4NJ6A 2JRHA 1Y19B 2N23A 1DROA 4IG7B 2JVCA 1JRUA 3U7DA 2BYVE 2IO2B 1U29A 2PJHA 1ZM0A 3DBRI 2EJ8A 2MWSB 5LXIB 3ML8A 3ZW3A 3MJWA 2LRWA 2L0TA 4AJYB 2MBQA 3KSYA 4WWOA 3ZTDA 2VRWB 4LJOB 2C7NB 4DDID 1ZKHA 4E74A 3MTNB 4GDLA 2R0DA 1GUAB 2V76A 3HQCA 2DTCA 1I42A 1WR1A 1U5GA 2BYFA 4GXBA 5DPWA 3N32A 5D2MB 2J59M 4IW0A 3P2BA 4K7UA 2DHJA 1MIZB 4CHKA 1M94A 4JK8A 3H7PB 4YONA 2CU1A 4JKEA 2KMAA 2Z0DB 5TR5A 3V60A 3G9WA 2RGNB 2GS0A 5KQ1A 4BOSC 3V61A 4I6NB 1WJUA 4JKCA 3D8DA 4DDGD 1I2HA 5KCVA 3LJUX 3VUXA 3NSUA 1WJ6A 3CIKA 2FIFA 3VH4B 1VD2A 2IZVB 1UD7A 1WRDB 1IP9A 2FAZA 2CB8A 1P3QU 3L54A 2KFKB 4PQ0A 4F7HA 2D2QA 3VDZA 3KH0A 1GC6A 3EPYA 3WAOA 2ZNVB 2LXCA 4ANXA 4JL9A 4G3XB 4KIKA 3ZRCA 1Q0WB 4WJQA 1U5FA 2DX1A 1LW3A 2ZCBA 2Y8GA 3QWZB 2GJYA 2DYMA 2OJRA 2X0SA 3NOBA 2DLWA 2LD9A 5GOWB 1YQBA 3P6AA 2DHIA 2I1KA 5D3VA 1RAXA 1L7YA 1WI0A 1WXAA 2JT4B 2XK5B 1MK9B 2D9VA 4BKTA 1EF1A 2L3ZA 2NZ8B 2H7EA 3PVWA 5D3XA 1L2NA 3PLUA 2DIKA 3IVFA 4DHZE 2D4QA 3DCGA 1V5UA 1DIKA 2IY1B 3O65B 2K6DB 5J3YA 4NNJB 5HE1A 2L0FA 4E3CA 2R2QA 1WM2A 2CQUA 1WGDA 1E90A 4IFSA 4NQLB 1WX9A 2N9PC 2O6VD 2KDEB 1X1MA 3PRZA 1MKEA 5LXHA 2LVQA 1QC6A 2CKHB 4JKGA 1CMXB 4KSKC 1WGQA 2DZIA 2XQNM 2WH5A 5HE2A 4K17A 3ZUNA 3QCAA 2GBMA 4GGQA 1WGRA 3T9LA 4HAVB 1I35A 2BGFA 1MIXA 2KC2A 2UZRA 2MW5A 4ILHA 1NVLA 3L13A 4KZ0A 1OEYJ 2YSZA 2AEHA 1RLFA 1BAKA 4EFOA 3VOQA 4FLHA 5DIFB 2LYDA 2DA0A 5KHOA 2LOZA 3ECIA 2KDIA 1MG8A 3SDLC 3PEGA 2KKCA 4FJYA 1FHWA 2XEWA 2K8HA 5J17A 4FULA 1UEFA 2ELBA 1WF9A 2M0XA 2COPA 1V88A 3KUDB 4KZCA 3ZLZA 1H4RA 1P9DU 2PPHA 5C5BB 4GDKB 3GOEA 1UPRA 2NBUA 1T0YA 2IBIB 4DK5A 2KC1A 2AYOB 2Y8FA 2B3AA 3ZNZB 3JSVA 2R2OA 2W2XD 2JXXA 3UQAA 4PS7A 2UZSA 3ZVVA 4RM8A 3M3JA 2FNJB 4KHBB 3SUZA 4GN1A 3R66C 3N3KB 2FCQA 3ML9A 3PVUA 3RCZA 3EFUA 4NSWA 5HE3A 1NTYA 2M4NA 2KLCA 2LGXA 4MT7A 1TJ6A 2M38A 1W1DA 4HPMB 4I6LB 4BBNF 1NTIA 4ANUA 2MDXA 2DX5B 5JZEB 4IUMB 3TBLD 4EZLA 1KZGA 1UPQA 1FXTB 2Y5BB 1XR0B 1UELA 2D9YA 4A6FB 1VBGA 5DPRA 2KTFA 2DN6A 2IY0B 1WGGA 3QAQA 4NAWA 3A4SC 4HB4B 3IHPC 1JDEA 2ADZA 2BYEA 1AQCA 1PFJA 1DDMA 4HJKA 3DVGX 5C79A 4IOYX 1SE9A 5L81A 5DPSA 3SNHA 3QA8A 3RZWC 3I3TB 2KZRA 1RRBA 4FJZA 3QC8B 1WG7A 2KHWB 1J19A 1W1GA 4YL8A 4DX8A 1HE8A 1E8WA 1HB6A 2COCA 1LQBA 1U5EA 3X23A 2UVMA 4IWOA 2E2XA 1QZEA 1DYNA 2BPSA 3KZ1A 1YJ1A 5AZFA 5L83A 4GSWA 4NPNA 5CHFA 3UIOB 1FGYA 3QWMA 2P0FA 3NZSA 4JGHB 2KTRA 3PP2A 2Z0EB 1IRSA 1Z5SB 4BKSD 2YS1A 2DYNA 3ZDMC 1Z87A 1ZSQA 1UNPA 5AEKB 3SD5A 4HXDA 3SV1A 3V6CB 4BFRA 2LVOA 3VUYA 4EJNA 3M63B 4HVBA 4JKBA 4II3B 1WY8A 3U8ZA 1E8ZA 2DYOA 3RUIB 1P0RA 4A3PA 1M7RA 4PS3A 2IFSA 3HK0A 3UIPB 2MBBB 3FSSA 2RGFA 4JK7A 3A1QA 1V86A 4RM9A 2W2WA 1VBHA 1ACAA 4DHJD 1Y5OA 1UNQA 5LOPB 3E9PA 2EC1A 2UWQA 2HE7A 4G50A 4EOYA 2K2JA 2ASQA 1GGOA 1WJMA 4HK2A 4FADA 1V80A 2G4DB 1NTVA 1V2YA 1V49A 4MSMB 2DKQA 2LGYA 5CLLB 1HBKA 4LDTD 5JHAA 4GMXB 2CY4A 4K2PA 2MFQA 4DHJB 2CHXA 2FDQA 2VRRB 5KQ4A 4B6HA 5DHAB 3QARA 1U4AA 4JK9A 2MLBA 4II2B 4Z2NA 2KLGA 2BF8B 3ZRFA 3A8PA 2N0YA 2KVRA 1PLSA 3IBEA 3CSFA 3EC8A 3E9OA 4RMAA 5D6JB 3ZO5B 4JLCA 3V62A 2LXAA 4KDIC 4XZ4A 3W1SC 4GDLB 2EMTA 2DAJA 3SYXA 2Z59B 4JIOU 2K6QA 1S1QB 5EDSA 2V1YA 3KYDD 2KO3A 3ZDTA 2NPTA 2CODA 1A5RA 2HTHA 3KVFB 4E71A 2YF0A 1WGYA 3FP5A 3D8EA 3V5WA 2GBKA 4MH0E 4W9DA 1WXSA 2G3QB 3ZNHB 4Z2MB 2WX0A 4OVUA 2J0KA 4KHAA 4FJVB 3QK0A 3TL5A 2HRJA 3TVVA 3UF8A 1WJNA 2KTRB 3DXCA 1NU2A 3FEHA 3A9KB 3KUZA 3DVNV 5CHWA 1RJ2A 2KQ7A 4A6KA 3H7PA 4I6PA 4WJOA 1F9JA 4KAXB 2JF5A 4K81A 4J6IA 4EKUA 2A5UA 1WVHA 2M8SA 2LJ5A 1PMSA 3ML4A 5DH9B 1WIAA 2NBWB 2K8CA 2KQSA 4N9F4 2ZVOA 4TUUA 3UQBA 2DKPA 4ZRJA 1KZ7A 2COFA 4K7WA 3O96A 2LOXA 1SHCA 2N9XA 1YIWA 2PZ1A 5J3TA 5D94A 4ICVA 4DBGA 1SIFA 1E7VA 5IAAC 3T06A 4ZYNA 2N4FA 3IFWB 4PYZA 1R4MI 3SBTA 2KNBA 3PPAA 2ZPNA 1V5TA 3WA0A 2BWFA 1AARA 2DZKA 2KD0A 3JSVB 3EHVA 3PHWB 3L16A 2KX0A 3PRMB 2DENB 5GMVA 3ZIMA 5HE0A 4MGKE 2DFKA 3S2AA 3DVGY 3L17A 4TQ0A 3BINA 2CY5A 5C5BA 4GDKA 3PVLA 1XT9B 4MDKE 1TXDA 1P1AA 4K7SA 3D32A 1WGHA 4IAPA 3DOWA 4HCNB 3APCA 2O6VB 1OQNA 2BKRB 1WE6A 3A98B 4FHJA 2JZ3B 1Y8RC 2CAYA 1ZW7A 5LLIA 3AULA 2N1WA 4L6EA 2W2XC 2AWTA 2HJ8A 3CXBB 2LGDA 1Q1OA 4LCDE 1TGZB 2GOWA 2YS3A 2D10A 1OMWA 2GMIC 4CHMA 1XODA 4FN2A 4TKNA 2K25A 3A9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYU A;  2KUP A;  2K1F A;  1RRB A;  1EAZ A;  1BT0 A;  3PS6 A;  3A8Q A;  3IG3 A;  1DDV A;  2P8V A;  2LRU A;  4FA6 A;  5AZH A;  3R3M A;  3PSE B;  5BO4 B;  5JH5 C;  4XX5 A;  3CST A;  2VKI A;  3QC8 B;  4FJZ A;  1UBI A;  4IC7 B;  1WG7 A;  2KHW B;  4EZK A;  1J19 A;  2CHZ A;  1W1G A;  2COA A;  2ROZ B;  1V81 A;  1ZGU B;  2RSU A;  3A9K A;  4NJ6 A;  2JRH A;  3OAN A;  4OVV A;  5FR6 A;  2ZZP B;  1Y19 B;  5J3Q A;  4YL8 A;  3PZD A;  4PS8 A;  1LB1 A;  4DX8 A;  2N23 A;  5JHH A;  1DRO A;  2GBJ A;  4IG7 B;  4BOZ B;  4D0N B;  2JVC A;  1JRU A;  1WJ4 A;  2MCN B;  1HE8 A;  3U7D A;  4WJN A;  3F0W A;  2BYV E;  1E8W A;  3PG7 A;  1U29 A;  2ELA A;  2IO2 B;  1KOT A;  1Z2M A;  1ZM0 A;  2PJH A;  1HB6 A;  3CMM B;  3DBR I;  2EJ8 A;  4MGZ E;  2COC A;  1QQG A;  3PV1 A;  1LQB A;  2MWS B;  3HM6 X;  5E6P A;  1RFA A;  1U5E A;  5LXI B;  3ML8 A;  2Z0P A;  3ZW3 A;  3X23 A;  2UVM A;  3H1U A;  3MJW A;  4IWO A;  2LRW A;  2E2X A;  2L0T A;  2XK5 A;  1QZE A;  4AJY B;  1DYN A;  4K1R B;  2BPS A;  2MBQ A;  3DXD A;  4G0N B;  5JHB A;  3KSY A;  3KZ1 A;  3ZNG C;  1YJ1 A;  5AZF A;  3ZKJ C;  4GSW A;  5L83 A;  4WWO A;  4NPN A;  3ZTD A;  5CHF A;  2VRW B;  3UIO B;  1FGY A;  3QWM A;  3B1L X;  4LJO B;  1U2B A;  2P0F A;  2L76 A;  4IM2 A;  2C7N B;  3NZS A;  4JGH B;  2KTR A;  4PNK A;  4DDI D;  5CX3 A;  2KDB A;  3PP2 A;  3DDC B;  1ZKH A;  4E74 A;  2CRF A;  3MTN B;  2FJ9 A;  1E8Y A;  3SHQ A;  4M0W B;  3VUW A;  4HLE A;  2M14 A;  2MA9 B;  4W9F A;  4GDL A;  5C1Z A;  3AU4 A;  2R0D A;  1GUA B;  2V76 A;  4HPL B;  2Z0E B;  2KCJ A;  3HQC A;  1V9J A;  2MSE D;  4MGI E;  2DTC A;  1IRS A;  1Z5S B;  3QX1 A;  2NCN A;  4MH0 E;  3PT2 B;  4BKS D;  1I42 A;  2YS1 A;  5DI9 B;  1WR1 A;  1U5G A;  2DYN A;  2BYF A;  3OJ4 B;  1Z87 A;  4FHK A;  1ZSQ A;  4GXB A;  1UNP A;  1IPG A;  4KIK B;  3ZDM C;  4TQ0 A;  5AEK B;  5DPW A;  3TW1 A;  4TQ1 A;  1P3R A;  3N32 A;  3SD5 A;  4HXD A;  1X11 A;  3KRX A;  2IO0 B;  3SV1 A;  4W9E A;  2DZJ A;  2FCS A;  4MJS A;  2J59 M;  5D2M B;  3V6C B;  2MP2 B;  4BFR A;  2LVO A;  1TQZ A;  5JHG A;  1K5G B;  3P2B A;  5C16 A;  4EJN A;  4IW0 A;  3VUY A;  3M63 B;  1WE7 A;  4K7U A;  4HVB A;  4HAW B;  2JWZ A;  3R7R A;  2DHJ A;  4II3 B;  1MIZ B;  2Z0O A;  3U8Z A;  1WY8 A;  3K9O B;  1E8Z A;  2A4Z A;  1M94 A;  4CHK A;  2DYO A;  3L08 A;  3TJP A;  2YRY A;  1P0R A;  3H7P B;  4YON A;  3P7Z A;  2CU1 A;  3RUI B;  4AUQ C;  1YX5 B;  2HTH B;  2XBB C;  2KMA A;  4A3P A;  1M7R A;  1MPH A;  1V61 A;  2Y5B B;  4PS3 A;  2IFS A;  4LDT B;  2Z0D B;  5TR5 A;  3V60 A;  1ZC4 B;  4DHZ B;  3G9W A;  3RT3 B;  2RGN B;  3HK0 A;  2GS0 A;  5KQ1 A;  3UIP B;  4BBK A;  3KYC D;  2MX2 A;  2MBB B;  3FSS A;  2RGF A;  2YLM A;  4W9I A;  4B6W A;  4BOS C;  4MM3 A;  3V61 A;  3A1Q A;  4I6N B;  1V86 A;  1WJU A;  2N1V A;  4X57 B;  4RM9 A;  4ZDV A;  2KJR A;  1UNR A;  2W2W A;  3D8D A;  2MBH A;  4XC2 A;  1ACA A;  1WR6 E;  1I2H A;  4DDG D;  5KCV A;  3LJU X;  2ZPY A;  2RPQ A;  1WGU A;  3VUX A;  4GIV A;  3NSU A;  4DHJ D;  1Y5O A;  1UNQ A;  5LOP B;  2EC1 A;  3ENE A;  2UWQ A;  3UGB B;  1TTN A;  1WJ6 A;  2HE7 A;  3VTV A;  3CIK A;  3APF A;  4B9K A;  2DAF A;  1X86 A;  4G50 A;  3VIA A;  2FIF A;  3VH4 B;  1VD2 A;  2PE6 B;  1FB8 A;  1UD7 A;  2IZV B;  5E6N A;  1X1G A;  4AOF A;  1WRD B;  4EOY A;  1E8X A;  5D27 A;  2K2J A;  2ASQ A;  2CR5 A;  1IP9 A;  2FAZ A;  1WJM A;  2D9W A;  2CB8 A;  1P3Q U;  4HK2 A;  2HD5 B;  3L54 A;  2Z0Q A;  2KFK B;  4PQ0 A;  2L2I A;  4F7H A;  2Y7B A;  2D2Q A;  1V80 A;  1XD3 B;  2G4D B;  3PLV A;  4FAD A;  4HDQ A;  3VDZ A;  3KH0 A;  3NZU A;  3KUC B;  1R4N I;  1NTV A;  2RVB B;  4MGY E;  1H8C A;  2NR2 A;  1V2Y A;  1GC6 A;  3EPY A;  3WAO A;  2ZNV B;  2BWE S;  2LXC A;  1V49 A;  2NPT B;  4MSM B;  2DKQ A;  4WWP A;  4ANX A;  3TIX A;  2LGY A;  4JL9 A;  4G3X B;  4KIK A;  2KWU B;  3A4R A;  1PQS A;  3VQI A;  3ZRC A;  2KAN A;  5CLL B;  1HBK A;  1Q0W B;  4LDT D;  4WJQ A;  5JHA A;  2FCN A;  1U5F A;  2DX1 A;  5JP4 A;  1NBF C;  2K39 A;  2NS5 A;  3A33 B;  4GMX B;  4AP4 C;  3RZF A;  2LBB A;  1LW3 A;  2ZCB A;  2ABD A;  2Y8G A;  4WVF B;  3QWZ B;  3A1Q B;  1GC7 A;  1XKE A;  3AXC A;  2CY4 A;  2GJY A;  4K2P A;  2DYM A;  2RQ1 A;  2MFQ A;  3ODW A;  2D9Z A;  2C7H A;  2OJR A;  4DHJ B;  1FHO A;  3DBL I;  3NOB A;  2DLW A;  1X1F A;  2AL3 A;  3D8F A;  2CHX A;  2KJ6 A;  2C60 A;  2FDQ A;  1WZ0 A;  3EEC A;  1ST7 A;  5L95 C;  2VRR B;  3WAL A;  2LD9 A;  5KQ4 A;  4B6H A;  5GOW B;  5DHA B;  1YQB A;  3QAR A;  3P6A A;  1UGM A;  2DHI A;  2I1K A;  3AU5 A;  2LUL A;  5D3V A;  5JLJ B;  1RAX A;  1L7Y A;  1V5M A;  1U4A A;  1V6E A;  2C5L C;  2FID A;  4II2 B;  1K5D B;  4Z2N A;  1WI0 A;  2KLG A;  1WXA A;  2BF8 B;  2N7E A;  1WH3 A;  2JT4 B;  2XK5 B;  3ZRF A;  3A8P A;  2KWC A;  2N0Y A;  3QQ8 B;  2KVR A;  1MK9 B;  2D9V A;  2FCM A;  1EF1 A;  1DBH A;  1PLS A;  4BKT A;  2ROV A;  3IBE A;  3CSF A;  4IWP A;  3EC8 A;  2JUO A;  2NZ8 B;  1NI2 A;  2R09 A;  1KM7 A;  2H7E A;  3HW2 B;  1NDD A;  2L3Z A;  4HB0 B;  2O2V A;  1XD4 A;  3PVW A;  4P7I A;  1BWN A;  5D3X A;  3PLU A;  5D6J B;  1GNU A;  3VVW B;  2WX1 A;  2PE9 A;  1L2N A;  3IVF A;  4DHZ E;  3ZO5 B;  1ISN A;  3ULB A;  4JLC A;  2D4Q A;  3DCG A;  1V5U A;  2L1C A;  3M62 B;  3V62 A;  2LXA A;  2M17 A;  4KDI C;  1UZX B;  3CF6 E;  3ULC A;  2REX A;  4NQK E;  1XX0 A;  2IY1 B;  4XZ4 A;  3VFK A;  3W1S C;  4GDL B;  2EMT A;  3O65 B;  4F8C B;  2K6D B;  3PRP B;  5J3Y A;  2DAJ A;  2H7D A;  4NNJ B;  3SYX A;  3ZTC A;  4MEM A;  3FM8 C;  5HE1 A;  2L0F A;  2YVC A;  3OAW A;  4EUT A;  1C1Y B;  2Z59 B;  4JIO U;  2J0J A;  2PEA A;  4E3C A;  3QBV B;  2R2Q A;  2G4S A;  1WM2 A;  3ZNI D;  2K6Q A;  2DHK A;  1S1Q B;  3ALB A;  3DVN U;  3HHM A;  2CS4 A;  3NHE B;  5EDS A;  4G11 A;  2OQB A;  3TFM A;  2V1Y A;  1X05 A;  3KYD D;  2KJH B;  2N9E B;  2D3G A;  2KO3 A;  2CQU A;  3ZDT A;  3M95 A;  1WGD A;  2WDT B;  2GCJ A;  2I1J A;  2N7D A;  2FJL A;  3V6E B;  1WI1 A;  2YT0 A;  1Q67 A;  4JQW C;  2ZEQ A;  5DHF B;  1E90 A;  3UZT A;  4KHO A;  3B0A A;  4IFS A;  4ICU A;  3DBS A;  2Q13 A;  1WX9 A;  3H7S A;  4NQL B;  3RD2 A;  2J7Q B;  4W9K A;  2N9P C;  2NPT A;  2KX3 A;  1KJT A;  4WQO B;  2COD A;  4BKS A;  4F1S A;  5DPT A;  2C7M B;  1A5R A;  1VCB A;  2ZVN A;  5DCN A;  2HTH A;  3KVF B;  2O6V D;  4E71 A;  2YF0 A;  2KDE B;  1X1M A;  1WGY A;  2KK8 A;  3FP5 A;  1WZ3 A;  1MKE A;  3PRZ A;  3A9J A;  2KFK A;  1TBE A;  3WAM A;  5LXH A;  2LVQ A;  4M8M A;  4KDL B;  3D8E A;  1QC6 A;  3V5W A;  2GBK A;  2CKH B;  3DBH I;  2RNR B;  1WXM A;  2MRP A;  4ASW C;  1C3T A;  1CMX B;  3KW5 B;  1HB8 A;  1B55 A;  1AWE A;  4MK0 A;  5D3W A;  2V3S A;  4KSK C;  1WGQ A;  2IYD B;  1WXS A;  3C0R B;  2DZI A;  4W9D A;  1M7E A;  2G3Q B;  4F7Z A;  2KN5 A;  2CHW A;  2XQN M;  4GU2 A;  3ZNH B;  2WH5 A;  1MK7 B;  4Z2M B;  2I5F A;  2WX0 A;  4IM0 A;  3GYP A;  4GPT B;  4NY0 A;  2MQJ A;  2O2V B;  3MHS D;  4OVU A;  2J0K A;  1BTN A;  4HAT B;  4K17 A;  5HE2 A;  3VXW A;  4EEW A;  4KHA A;  1D3Z A;  4FJV B;  3QK0 A;  3TL5 A;  3F5R A;  4TYZ A;  3QCA A;  3ZUN A;  2HRJ A;  3TVV A;  2BKF A;  1FOE A;  2GBM A;  4WAA A;  4GGQ A;  1WGR A;  3UF8 A;  4HAX B;  3T9L A;  3DPD A;  4HAV B;  1WJN A;  2LWP A;  2BGF A;  1MIX A;  2KC2 A;  2UZR A;  5G2N A;  1WJ1 A;  2KTR B;  3DXC A;  5J18 A;  2C9W B;  1NU2 A;  3FEH A;  2MW5 A;  3A9K B;  3MPX A;  4HB2 B;  3KUZ A;  3DVN V;  2L05 A;  2AL6 A;  1NVL A;  3L13 A;  2LUE A;  5CHW A;  1RJ2 A;  4KZ0 A;  2KQ7 A;  5G55 A;  1GG3 A;  1P6S A;  4AWJ A;  1J0G A;  1EF5 A;  2G45 B;  1OEY J;  1ZVR A;  4A6K A;  4TV3 A;  2MBO A;  3H7P A;  2YSZ A;  3H6N A;  5CLQ B;  4I6P A;  4WJO A;  3RUL A;  2AEH A;  1F9J A;  2KFJ A;  1RLF A;  4BVU C;  4WSF A;  4HDO A;  4KAX B;  1BAK A;  2IO3 B;  2JF5 A;  4CO7 A;  3VTW A;  4EFO A;  1V5P A;  1WMH A;  3W1S A;  1XCG A;  4K81 A;  4J6I A;  2BCJ A;  4DBB A;  3VOQ A;  4FLH A;  4EKU A;  4W9H A;  2D11 A;  5DIF B;  2LYD A;  3KRW A;  2A5U A;  1BTK A;  3H9D A;  4GMV A;  1WVH A;  4CYE A;  1UH6 A;  2UYZ B;  3QJZ A;  2DA0 A;  2D9X A;  4DX9 0;  2DYB A;  1OGW A;  2M8S A;  2LOZ A;  4DXA B;  5KHO A;  2LJ5 A;  5C23 A;  3ECI A;  4FBJ B;  2KDI A;  1PMS A;  3ML4 A;  5DH9 B;  1XQQ A;  3X0W A;  3JYU A;  1MG8 A;  2K8B A;  3SDL C;  1WIA A;  2RR9 A;  2NBW B;  1WYW B;  2K8C A;  2KQS A;  3PEG A;  2KKC A;  2WYQ A;  4FJY A;  1W1H A;  4N9F 4;  2ZVO A;  1FHW A;  4TUU A;  3ODX A;  1OEY A;  3UQB A;  2DKP A;  2XEW A;  2K8H A;  4XWX A;  5J17 A;  2M1M A;  3LJ3 A;  4ZRJ A;  1KZ7 A;  2COF A;  3N7C A;  4FUL A;  2G35 A;  3RCP A;  3TCA A;  4K7W A;  3WAN A;  1UEF A;  2ELB A;  1UBQ A;  2IYB A;  1WF9 A;  3R7Q A;  3JW0 X;  3O96 A;  3PRE A;  4A20 A;  4AJW A;  2K00 A;  2K2U A;  2LOX A;  2M0X A;  2W9N A;  4HAU B;  4IWQ A;  1SHC A;  2COP A;  4M8N A;  3APD A;  2N9X A;  1V88 A;  3KUD B;  1E5W A;  1YIW A;  4KZC A;  2JY6 A;  2PZ1 A;  2D07 B;  3ZLZ A;  5IJM A;  3GYO A;  3ZVR A;  1H4R A;  1OTR B;  1P9D U;  2GBN A;  5J3T A;  5D94 A;  1FHX A;  2P0H A;  2KDF B;  4ICV A;  4DBG A;  2PPH A;  4KSL C;  1SIF A;  3JVZ X;  3SU8 X;  1E7V A;  4WJP A;  5C5B B;  4GDK B;  4URK A;  1OQY A;  5IAA C;  4HAZ B;  1LFD A;  3GOE A;  1N3H A;  3T06 A;  1LXD A;  4KV2 A;  2V4L A;  4ZYN A;  1V5O A;  1UPR A;  3HIZ A;  3RYT A;  5HKH A;  1EVH A;  2YS5 A;  1V89 A;  2KXJ A;  4EZJ A;  2NBU A;  2NBV B;  3PTF C;  3L0W B;  1P98 A;  1T0Y A;  3TO1 A;  1EO6 A;  2IBI B;  2N4F A;  4DK5 A;  2VSZ A;  3WIM A;  5KHQ A;  2KC1 A;  3IFW B;  2AYO B;  2ZCC A;  4PYZ A;  2Y8F A;  2B3A A;  2L8J A;  4RMA A;  1R4M I;  1U5D A;  4B95 A;  3ZNZ B;  2KNB A;  4W9J A;  3PGE A;  3JSV A;  3PPA A;  2MP2 A;  4GZU A;  5E6O A;  4MJS B;  2R2O A;  2W2X D;  2ZNV C;  3TMP B;  2LI5 A;  2JXX A;  4NJ7 A;  1TZ1 A;  3UQA A;  4PS7 A;  2ZPN A;  3AI5 A;  1YD8 U;  5D7G A;  2DYQ A;  1V5T A;  2OOB B;  4KVG B;  1SGH A;  1MAI A;  3WA0 A;  3BJI A;  2UZS A;  1AAR A;  2BWF A;  2DZK A;  2YT1 A;  4C0A A;  2JP2 A;  2X18 A;  3K9P B;  4RM8 A;  2KD0 A;  3ZVV A;  3BY4 B;  1DDW A;  3JSV B;  2L7R A;  3EHV A;  5C6R A;  2FNJ B;  3L16 A;  3M3J A;  2KX0 A;  3PHW B;  4A5K A;  4KHB B;  5D3Y A;  4ANW A;  2LKO A;  4Y94 A;  1EGX A;  2DEN B;  2LG1 A;  3GZN I;  3SUZ A;  3PRM B;  2MKR A;  3Q3J A;  1S3S G;  4GN1 A;  3UIN B;  3KY9 A;  2LAS A;  5GMV A;  3R66 C;  5FI0 A;  4F7U P;  3N3K B;  4MEL A;  3ZIM A;  4ZRK A;  5HE0 A;  2FCQ A;  4NAW B;  2EMS A;  3M1I B;  2NVU I;  3PVU A;  3ML9 A;  4IM3 A;  2LZ6 A;  4MGK E;  3ODO A;  3RCZ A;  3VTU A;  2DFK A;  3S2A A;  3EFU A;  4W9G A;  2QKM A;  4NSW A;  5HE3 A;  3DVG Y;  1NTY A;  2M4N A;  3DQV A;  4MSQ B;  3L17 A;  3PHX B;  3BIN A;  1I7A A;  2CY5 A;  4H8S A;  2KLC A;  2LGX A;  2GCL A;  2QHO A;  3T8M A;  5C5B A;  4GDK A;  4K2O A;  3PVL A;  1XT9 B;  4GB9 A;  4F7G A;  4MT7 A;  1TJ6 A;  2JZZ A;  4MDK E;  1TXD A;  2M38 A;  3Q3F A;  5J2R A;  3OLM D;  1WX8 A;  1P1A A;  3NY5 A;  4HWI B;  3SO6 A;  2ZJD A;  4K7S A;  2FUH B;  2RUK B;  3QIJ A;  1KLV A;  1W1D A;  3D32 A;  4HPM B;  2RSG A;  1WGH A;  4IAP A;  3DOW A;  4I6L B;  3ONS A;  2I5C A;  4BBN F;  1FAO A;  3MDB C;  3APC A;  4HCN B;  3VH3 B;  1NTI A;  4ANU A;  1YX6 B;  2MDX A;  2O6V B;  4ANV A;  4CHJ A;  2DX5 B;  5JZE B;  1EUV B;  1OQN A;  2BKR B;  4LJP B;  3L10 B;  4IUM B;  4MY6 A;  1WE6 A;  2JRI B;  2LVP A;  3W1Y A;  1J0W A;  2EKE C;  4W9C A;  3TBL D;  1E7U A;  3A98 B;  4EZL A;  1KZG A;  2IO1 B;  4ZRI A;  2RLO A;  1RRP B;  1UPQ A;  4FHJ A;  3QHT A;  2JZ3 B;  1FXT B;  1Y8R C;  2O6V A;  2P0D A;  2KWV B;  2CAY A;  3WYF B;  1ZW7 A;  2KOX A;  2J0M A;  3AJ4 A;  1XR0 B;  3DXE A;  4EMO A;  2JPH A;  2GBR A;  2L00 B;  1IYF A;  1WXV A;  3OJ3 A;  1UEL A;  4GOC A;  5LLI A;  3LDZ E;  1ZC3 B;  3AUL A;  2D9Y A;  4A6F B;  3A9J B;  1P5T A;  4BBN C;  2KMC A;  5AZG A;  5IA7 A;  1G6J A;  1J8C A;  2MBE A;  4WJ7 A;  1U27 A;  5FI1 A;  2N1W A;  4HAY B;  5CTR C;  5DPR A;  2KTF A;  1OY2 A;  3NS8 A;  4L6E A;  3PSC A;  1WFY A;  2WWZ A;  2W2X C;  1WX7 A;  2AWT A;  2DN6 A;  2RD0 A;  4WWN A;  4HB3 B;  2HJ8 A;  2NMB A;  5EFX A;  3CXB B;  2IY0 B;  1WGG A;  1GJZ A;  2MWN B;  3QAQ A;  2DHZ A;  4A6H A;  4HCP B;  4BKG A;  1FGZ A;  2LGD A;  4W9L A;  2KGX B;  4NAW A;  2DX5 A;  3FLV A;  1Q1O A;  1K8R B;  3A4S C;  4HB4 B;  3IHP C;  4LCD E;  1WM3 A;  1KI1 B;  4HHV A;  1I35 A;  2ADZ A;  1TGZ B;  4DWF A;  2DZM A;  2GOW A;  2BYE A;  2MLB A;  3B08 A;  1AQC A;  1PFJ A;  2YS3 A;  1DDM A;  4A3O A;  4HJK A;  2D10 A;  1OMW A;  5C79 A;  1Q5W B;  3DVG X;  3WAP A;  3N30 A;  2GMI C;  2QKL A;  4IOY X;  1SE9 A;  5L81 A;  4CHM A;  3HM3 A;  5DPS A;  3SNH A;  1XOD A;  5CHV C;  3QA8 A;  1LM8 B;  3RZW C;  1H10 A;  4FN2 A;  2OTX A;  4TKN A;  3I3T B;  1WMH B;  2K25 A;  3VHT C;  3U30 A;  2KZR A;  4A6F A;  5LON B;  3VAW A; 
#chains in the Genus database with same CATH topology
 3NVY A;  4PYU A;  1D5X C;  1FD6 A;  3PS6 A;  2P8V A;  1TYG B;  3PSE B;  5JH5 C;  4XX5 A;  1UBI A;  4EZK A;  2K49 A;  2CHZ A;  2ROZ B;  1ZGU B;  4KKI A;  4RF0 A;  2ZZP B;  5J3Q A;  3O13 A;  2GBJ A;  3GE8 C;  5JHH A;  3AED B;  4D0N B;  1VZ8 A;  4WJN A;  3F0W A;  1KOT A;  3CMM B;  4MGZ E;  2RDH A;  3PV1 A;  2W3R A;  4M02 A;  1RFA A;  4OVZ A;  3H1U A;  3H8H A;  4K1R B;  3PZ8 A;  4G0N B;  5JHB A;  1J7B A;  5GXG B;  1R4M B;  1T5X D;  1R4N B;  3ETR A;  4QXA B;  1L0V B;  2WXM A;  4ZHP A;  3EUB 2;  4HSI A;  4IM2 A;  1CZP A;  2CRF A;  2FJ9 A;  1E8Y A;  3SHQ A;  4M0W B;  3LYY A;  4A90 A;  1UNS A;  1YN5 A;  4HLE A;  2MA9 B;  5C1Z A;  2WXP A;  3AU4 A;  4HPL B;  2WLB A;  1V9J A;  2NCN A;  4JKF A;  3PT2 B;  5DI9 B;  4BOZ B;  4ILJ A;  4TQ1 A;  3HIE A;  1P3R A;  2IO0 B;  4W9E A;  3SR6 A;  2DZJ A;  1ZPS A;  3AEB B;  5C16 A;  4WUR A;  2JWZ A;  3R7R A;  1UUP A;  1PGX A;  3K9O B;  1GAQ B;  4AUQ C;  2XBB C;  1MPH A;  1V61 A;  4LDT B;  1AN8 A;  4DHZ B;  5JVL A;  1KBL A;  2JQR B;  2WXK A;  3IXS A;  4BBK A;  3KYC D;  4MM3 A;  1N6Z A;  3L4P A;  1UWM A;  4X57 B;  4ZDV A;  4O1N A;  1UNR A;  3RNE C;  1D5M C;  1L4Z B;  2ZPY A;  2WXL A;  4GIV A;  2SAK A;  3ZQ4 A;  2LMC A;  1TTN A;  1FMA D;  3VTV A;  3APF A;  1X86 A;  3VIA A;  3AE9 B;  2PE6 B;  4HJG E;  1FB8 A;  2JU6 X;  1X1G A;  4AOF A;  4RGT A;  3GS2 A;  1E8X A;  2D9W A;  2KIG A;  3HVD A;  2HD5 B;  2Z0Q A;  1Q10 A;  5HFY A;  1XD3 B;  3PLV A;  2EEL A;  4HDQ A;  3NZU A;  3KUC B;  4MGY E;  3GP7 A;  1H8C A;  4N59 A;  1FRD A;  1SJH D;  4WWP A;  3TIX A;  2KWU B;  3A4R A;  1UGJ A;  2LFI A;  5JP4 A;  1HQR D;  1I4P A;  4AP4 C;  3T3N A;  2ABD A;  4WVF B;  1V8C A;  4UDU C;  1GC7 A;  1XKE A;  3AXC A;  5G5G A;  3AV8 A;  2RQ1 A;  3ODW A;  2C7H A;  2MEK A;  1FHO A;  3DBL I;  2AL3 A;  3EEC A;  1WZ0 A;  3WAL A;  2FUG 1;  3IAS 1;  2KT7 A;  1KFY B;  3OG5 A;  1UGM A;  3NWF A;  4CSQ A;  2LUL A;  3AU5 A;  5JLJ B;  1LGR A;  1VZ7 A;  1V5M A;  2IGH A;  3BZD B;  2N7E A;  1EWC A;  2KWC A;  3QQ8 B;  2E6X A;  3RNG C;  3E66 A;  2JUO A;  2R09 A;  3M62 B;  4HB0 B;  1XD4 A;  2WXH A;  4P7I A;  5HHD G;  3VVW B;  1ISN A;  4XWW A;  1BUI C;  2M17 A;  1VJK A;  2R61 A;  2I2Y A;  1UZX B;  3P63 A;  3VFK A;  4NJC A;  4AQ7 A;  3PRP B;  2H7D A;  3GB1 A;  2OJW A;  3FM8 C;  1JRO A;  3OAW A;  4L1B A;  4C80 A;  2G4S A;  4HRO A;  2DHK A;  3ALB A;  1N62 A;  3DVN U;  3HHM A;  2CS4 A;  4G11 A;  3TFM A;  1EU4 A;  2V4I B;  2KJH B;  1BML C;  4ZOH C;  1L0Y B;  2N7D A;  2FJL A;  3UZT A;  4ICU A;  3RD2 A;  4C7Y A;  2Q13 A;  3H7S A;  4JPS A;  1XLP A;  4W9K A;  4ZRP A;  2L52 A;  2KX3 A;  4WQO B;  4BKS A;  4F1S A;  2K22 A;  2Y3A A;  4HEA 1;  2C7M B;  3SBG A;  2BS2 B;  1VCB A;  4TMA B;  2KK8 A;  1WZ3 A;  4TSS A;  2KFK A;  1ZXH A;  3WAM A;  4M8M A;  1DGJ A;  3MP9 A;  3DBH I;  1WXM A;  3KW5 B;  1HB8 A;  1AWE A;  4MK0 A;  2BW2 A;  2IYD B;  3C0R B;  3N1Z C;  1M7E A;  2CHW A;  1GPX A;  3MC0 B;  2KIE A;  3E9S A;  5G5H A;  4Q2J A;  3GYP A;  4GPT B;  2MQJ A;  3MHS D;  4AS1 A;  4LNK A;  1BTN A;  1F52 A;  2BT6 A;  3AEA B;  4WAA A;  2BKF A;  1FOE A;  5JXV A;  1TY0 A;  1C4P A;  3DPD A;  1V1P B;  3MPX A;  2L05 A;  2AL6 A;  5EE3 A;  2RPV A;  4AWJ A;  5G55 A;  1GG3 A;  1EF5 A;  2G45 B;  1ZVR A;  4TV3 A;  4JWU C;  1KC7 A;  4WSF A;  2IO3 B;  4CO7 A;  3VTW A;  2JYT A;  4DBB A;  4W9H A;  1BTK A;  4GMV A;  1UH6 A;  3QJZ A;  2D9X A;  2DYB A;  4DXA B;  4YTP B;  4FBJ B;  5C23 A;  1PGB A;  2R2Y A;  3BK2 A;  1YOV B;  1XQQ A;  3X0W A;  3JYU A;  5MPO A;  2RR9 A;  2WYQ A;  1AWD A;  3ODX A;  1ROE A;  1R7S A;  3OWE B;  4XWX A;  2M1M A;  3TEZ A;  3LJ3 A;  2G35 A;  3TCA A;  4JKA A;  1UBQ A;  3JW0 X;  3PRE A;  2VH1 A;  2K2U A;  2W9N A;  3OHM B;  3ENB A;  3B9J A;  1MI0 A;  4M8N A;  1E5W A;  4JX1 C;  2JY6 A;  1STE A;  3GYO A;  2GBN A;  1QOB A;  2P0H A;  4KSL C;  3JVZ X;  4LNN A;  4URK A;  4HAZ B;  1LFD A;  1LXD A;  4KV2 A;  2V4L A;  5HKH A;  2YS5 A;  1V89 A;  1E7P B;  4EZJ A;  3L0W B;  3TO1 A;  1EO6 A;  1TS5 A;  2VSZ A;  1C77 A;  3WIM A;  4C7Z A;  2ZCC A;  1N61 A;  5HG2 A;  2GLS A;  4B95 A;  3FAH A;  4JE3 B;  2MP2 A;  5E6O A;  2ZNV C;  3TMP B;  2LI5 A;  5D7G A;  1K53 A;  1SGH A;  1MAI A;  1MHH E;  3BY4 B;  3KQ4 A;  1DDW A;  2WXJ A;  2MCN B;  1ZP0 B;  3N20 C;  2LKO A;  1TS3 A;  2LG1 A;  3GZN I;  4ZYS A;  4F7U P;  2K3U A;  1T0R C;  4MEL A;  2NBV A;  3M1I B;  2NVU I;  2LZ6 A;  3ODO A;  4W9G A;  2QKM A;  4YT0 B;  1MG4 A;  1I7A A;  4H8S A;  2ZKM X;  2GCL A;  2QHO A;  4GB9 A;  4K2O A;  4F7G A;  3T3O A;  1UWX A;  4YXD B;  4HWI B;  3SO6 A;  2ZJD A;  4ACF A;  3Q3N C;  3I63 C;  2LHD A;  1KLV A;  2RSG A;  3VH3 B;  2RDG A;  4ANV A;  2EKI A;  4CHJ A;  1WSP A;  1NVI D;  4P6V F;  1EUV B;  3L10 B;  2BS3 B;  5FR3 A;  2JRI B;  2LVP A;  1J0W A;  2NTT A;  1ET6 A;  2RLO A;  2IGD A;  2O6V A;  2KOX A;  3WYF B;  4EMO A;  2JPH A;  1PFD A;  2GBR A;  1IYF A;  2KMM A;  3OJ3 A;  2QC8 A;  1ZC3 B;  1G6J A;  3A9J B;  5IA7 A;  2QEJ C;  3Q8C A;  1J8C A;  4WJ7 A;  4JKH A;  1OY2 A;  4CQN A;  2YEP B;  1WX7 A;  3DCX A;  4ILG B;  4HB3 B;  4GNK B;  5EFX A;  5H92 C;  3P4Q B;  1GJZ A;  2DHZ A;  4A6H A;  2JXT A;  4HCP B;  1FGZ A;  1YJI A;  2DX5 A;  3FLV A;  3NVW A;  1K8R B;  3Q8E A;  2CU3 A;  1WM3 A;  1KI1 B;  2DZM A;  1KRH A;  4A3O A;  1Q5W B;  2QKL A;  1LM8 B;  1I4Q A;  1H10 A;  1HTO A;  3VHT C;  1ESF A;  1WMH B;  2OOB B;  5LON B;  3VAW A;  4KGS A;  1WYG A;  2K1F A;  1EAZ A;  1BT0 A;  3A8Q A;  3IG3 A;  3KLS X;  2LRU A;  4FA6 A;  5AZH A;  3AE4 B;  1VR9 A;  3CST A;  3DBH B;  1TS4 A;  3NUH B;  5M4Y B;  2RSU A;  1V81 A;  5FR6 A;  3OAN A;  3PZD A;  1T6B X;  3Q14 C;  4PS8 A;  1I4X A;  4C4V B;  1LB1 A;  1I7H A;  1L0X B;  1I4H A;  1WJ4 A;  4XE0 A;  3TEX A;  3PG7 A;  2ELA A;  1Z2M A;  4RGM A;  1QQG A;  3HM6 X;  5E6P A;  4QAY A;  2Z0P A;  4RCO A;  3TUO A;  2XK5 A;  3DXD A;  1HA5 A;  3ZNG C;  2BQQ A;  3ZKJ C;  2FBW B;  4L23 A;  3B1L X;  1JAL A;  1U2B A;  2L76 A;  4PNK A;  5CX3 A;  2KDB A;  3DDC B;  1M4V A;  3VUW A;  2M14 A;  4W9F A;  2AQ3 B;  2INP E;  4KHB A;  4MGI E;  2KCJ A;  2MSE D;  3QX1 A;  2Y5C A;  1TS2 A;  3OJ4 B;  3RNA C;  2XN9 C;  4FHK A;  4KIK B;  4N58 A;  1IPG A;  3TW1 A;  1X11 A;  3KRX A;  3P4S B;  2FCS A;  4MJS A;  2ON8 A;  2MP2 B;  1TQZ A;  5JHG A;  1K5G B;  4B0M A;  1WE7 A;  2Q5W D;  4HAW B;  3W9C B;  2JSV X;  2Z0O A;  2A4Z A;  3L08 A;  4NAM A;  2YRY A;  1ZOY B;  1SEB D;  3TJP A;  3P7Z A;  2ZW1 A;  1YX5 B;  2HTH B;  4IKG A;  1ZC4 B;  3KWL A;  3RT3 B;  3CWI A;  2MX2 A;  2D3C A;  2YLM A;  4W9I A;  3RNB C;  4B6W A;  2N1V A;  1OQQ A;  2KJR A;  2MBH A;  5BMH A;  4XC2 A;  1WR6 E;  2RPQ A;  1WGU A;  3UGB B;  3ENE A;  1V1O A;  2MJD A;  2M56 B;  4B9K A;  2DAF A;  3BVM A;  2JZP A;  3AMZ A;  5E6N A;  2WDR B;  5D27 A;  1N60 A;  2CR5 A;  1QOG A;  1JWB D;  2J4X A;  3BYT B;  2L2I A;  2Y7B A;  2Y5P A;  1R4N I;  2RVB B;  2FE8 A;  2NR2 A;  4WIP A;  2BWE S;  1I4G A;  1J7C A;  2NPT B;  1PQS A;  3VQI A;  2KAN A;  2FCN A;  2K39 A;  1NBF C;  2NS5 A;  3A33 B;  4LTU A;  3RZF A;  2LBB A;  1T3Q A;  3A1Q B;  1L6V A;  2RRF A;  2D9Z A;  1X1F A;  3D8F A;  2KJ6 A;  2V3N A;  2C60 A;  3AE1 B;  1ST7 A;  5L95 C;  4YSX B;  5FKA C;  1ZYI A;  3TSS A;  2FID A;  1JRP A;  1V6E A;  2C5L C;  4YTN B;  1K5D B;  1KLG D;  1WH3 A;  3DWG C;  5AUI A;  3VR8 B;  2FCM A;  1DBH A;  2PLP A;  2ROV A;  4IWP A;  4A20 A;  1KM7 A;  1NI2 A;  1NDD A;  3HW2 B;  2O2V A;  1BWN A;  1NYR A;  1GNU A;  2WX1 A;  2MJE A;  2E3T A;  2PE9 A;  3ULB A;  2L1C A;  1SBB B;  2Z59 A;  1EU3 A;  4MH8 A;  3E9L A;  3CF6 E;  3ULC A;  2REX A;  4YSY B;  4NQK E;  1XX0 A;  4RNA A;  4F8C B;  3ZTC A;  1UF0 A;  4MEM A;  4EUT A;  5LNK 1;  2YVC A;  1C1Y B;  2J0J A;  2PEA A;  3QBV B;  2IJ0 A;  3ZNI D;  1C4C A;  3NHE B;  2IGG A;  3U7Z A;  1FO4 A;  2OQB A;  1X05 A;  2N9E B;  2D3G A;  4USA A;  3M95 A;  2WDT B;  2GCJ A;  2I1J A;  3V6E B;  1WI1 A;  2YT0 A;  1Q67 A;  4JQW C;  2ZEQ A;  5DHF B;  3B0A A;  4KHO A;  2WNM A;  3DHH C;  3DBS A;  2LEK A;  2J7Q B;  3AH7 A;  1KJT A;  4L2Y A;  5DPT A;  1PUT A;  2ZVN A;  5DCN A;  1TBE A;  4KDL B;  4M00 A;  2RNR B;  2MRP A;  1YQ4 B;  2N0S B;  4ASW C;  1C3T A;  1B55 A;  2V3S A;  5D3W A;  2BTE A;  2DBY A;  4F7Z A;  2KN5 A;  1F2R I;  3HRD D;  4GU2 A;  1MK7 B;  2I5F A;  1SE2 A;  2WDQ B;  2Z8L A;  4IM0 A;  4NY0 A;  2O2V B;  4HAT B;  1HZ5 A;  2K5P A;  2WXI A;  3VXW A;  2HTM E;  3DBR B;  4EEW A;  1D3Z A;  3F5R A;  4TYZ A;  4RGN A;  3VRA B;  1EWY C;  1JWM D;  4HAX B;  4YWG G;  3Q8A A;  4JKD A;  2LWP A;  4US9 A;  5G2N A;  1WJ1 A;  5J18 A;  2C9W B;  4HB2 B;  4A55 A;  2LUE A;  2DNF A;  1P6S A;  1J0G A;  2MBO A;  3H6N A;  5CLQ B;  3RUL A;  5IO9 A;  2KFJ A;  4BVU C;  4HDO A;  1V5P A;  1WMH A;  3W1S A;  1XCG A;  2BCJ A;  1SB3 C;  1T0S C;  2D11 A;  2V0G A;  3KRW A;  3H9D A;  2UYZ B;  4CYE A;  4XDD A;  4DX9 0;  1IBX B;  1OGW A;  4BAX A;  2K8B A;  1WYW B;  3AEE B;  1W1H A;  2JX5 A;  1JQ4 A;  1OEY A;  3BK1 A;  4ARI A;  1VRA B;  4OSN A;  1FNW A;  3N7C A;  3U2S C;  3WAN A;  3RCP A;  3R7Q A;  3RNF C;  2IYB A;  3ZYY X;  1KTK A;  4AJW A;  2K00 A;  4IWQ A;  3BYY B;  4HAU B;  1E9M A;  2LUM A;  3APD A;  2D07 B;  5IJM A;  3ZVR A;  1RFK A;  1OTR B;  1FHX A;  2KDF B;  1SF0 A;  3SU8 X;  4WJP A;  1OQY A;  2KUQ A;  1N3H A;  4HKZ E;  2ZW0 A;  1ENF A;  1V5O A;  1C76 A;  3HIZ A;  3RYT A;  1EVH A;  1FFU A;  1MI1 A;  2KXJ A;  2X8X X;  2NBV B;  3ZJU A;  3PTF C;  1P98 A;  2V3P A;  4LNI A;  1FFV A;  3BII D;  5KHQ A;  3SEB A;  2L8J A;  4MAC A;  1U5D A;  2KR0 A;  1C4A A;  4W9J A;  3PGE A;  4GZU A;  4MJS B;  4NJ7 A;  1TZ1 A;  3AI5 A;  1YD8 U;  4GLS C;  4A6Q A;  2DYQ A;  4KVG B;  3E56 A;  3BJI A;  5AZG A;  2YT1 A;  4C0A A;  2JP2 A;  2X18 A;  1SJE D;  3K9P B;  5EE9 A;  2L7R A;  5C6R A;  4A5K A;  5D3Y A;  5I4D A;  4ANW A;  4Y94 A;  1EGX A;  2R82 A;  3Q3J A;  2MKR A;  2H89 B;  3AE2 B;  1S3S G;  3UIN B;  3KY9 A;  4QJ3 B;  2LAS A;  5FI0 A;  4LNO A;  4ZRK A;  1B9R A;  4NAW B;  1E0Z A;  2EMS A;  4IM3 A;  5IP4 D;  3VTU A;  3DQV A;  4MSQ B;  1RYJ A;  3PHX B;  3VR9 B;  3T8M A;  1GB1 A;  2JZZ A;  5J2R A;  3Q3F A;  3OLM D;  3A58 A;  1WX8 A;  3NY5 A;  2ICI A;  1D4B A;  1JCK B;  2FUH B;  1E10 A;  2RUK B;  3QIJ A;  4LK0 M;  3ONS A;  2I5C A;  3V05 A;  1FAO A;  3MDB C;  2CJO A;  1YX6 B;  3BVG A;  1Y56 A;  2L32 A;  4LJP B;  4MY6 A;  3W1Y A;  2EKE C;  4W9C A;  1E7U A;  2Z14 A;  1ACC A;  2IO1 B;  4ZRI A;  1RRP B;  3QHT A;  4REZ A;  3WCQ A;  2P0D A;  2KWV B;  2FJU B;  2J0M A;  3AJ4 A;  3DXE A;  3URY A;  2L00 B;  1WXV A;  4GOC A;  1T0Q C;  3LDZ E;  1P5T A;  4BBN C;  2KMC A;  1C9F A;  2MBE A;  5FI1 A;  1U27 A;  4H2A A;  4HAY B;  5CTR C;  4DIX A;  3NS8 A;  3R8B A;  1WFY A;  3PSC A;  2WWZ A;  1FNV A;  3ABV B;  2RD0 A;  4WWN A;  2BB5 A;  2NMB A;  1XXG A;  4DXF A;  2MWN B;  4BKG A;  2K0P A;  1F2R C;  4W9L A;  2KGX B;  5IRS A;  3NVV A;  4J3O D;  1JWS D;  4HHV A;  4DWF A;  3B08 A;  3RMK C;  2KAJ A;  3Q69 A;  3WAP A;  3N30 A;  2KYW A;  5D3I B;  3HM3 A;  1P7F A;  5TSS A;  5CHV C;  5C2T B;  2IND C;  2OTX A;  3U30 A;  4A6F A;  2KUP A;  1TJE A;  2PVG C;  4PK1 A;  1DDV A;  2RDB C;  3DHG C;  3R3M A;  2BS4 B;  4FXC A;  1FCL A;  5BO4 B;  2VKI A;  4IC7 B;  4JKG B;  4WQM A;  2UU7 A;  2COA A;  3A9K A;  4OVV A;  4NJ6 A;  2JRH A;  1Y19 B;  2W54 A;  2N23 A;  1DRO A;  4IG7 B;  1PDX A;  3NRZ A;  2JVC A;  1JRU A;  3P4R B;  3U7D A;  2BYV E;  2IO2 B;  1U29 A;  2PJH A;  1ZM0 A;  3DBR I;  1NEK B;  2EJ8 A;  2MWS B;  1K51 A;  4BZA A;  5LXI B;  3ML8 A;  3ZW3 A;  3MJW A;  2LRW A;  2L0T A;  4OZC A;  1FEH A;  4AJY B;  2BBC A;  5IN7 A;  2MBQ A;  3KSY A;  4WWO A;  3ZTD A;  2VRW B;  4LJO B;  2C7N B;  1N63 A;  4DDI D;  1ZKH A;  4E74 A;  3MTN B;  4RH6 A;  4GDL A;  2R0D A;  1GUA B;  2V76 A;  3HQC A;  2DTC A;  2LHE A;  2YT2 A;  1I42 A;  1WR1 A;  1U5G A;  2BYF A;  2VH2 A;  4GXB A;  5DPW A;  1IGD A;  1JWU D;  2HJ1 A;  3N32 A;  2PMV A;  2LJI A;  3HUI A;  5EE0 A;  5D2M B;  2J59 M;  1XO3 A;  4IW0 A;  3P2B A;  2V9H A;  4K7U A;  1ZDV A;  3R2I A;  2DHJ A;  1KLU D;  1MIZ B;  4CHK A;  1M94 A;  1DOY A;  4JK8 A;  3H7P B;  4YON A;  2CU1 A;  3C19 A;  3B2F A;  2XNA C;  4JKE A;  2KMA A;  2M0A A;  2Z0D B;  5TR5 A;  2AQ2 B;  1HXY D;  3V60 A;  3G9W A;  2RGN B;  2GS0 A;  5KQ1 A;  4BOS C;  3V61 A;  2G1E A;  1A70 A;  4I6N B;  1WJU A;  4JKC A;  3D8D A;  1MFW A;  4DDG D;  1I2H A;  5KCV A;  3LJU X;  3VUX A;  3NSU A;  3FIL A;  1XLO A;  1WJ6 A;  3GE3 C;  3CIK A;  1XCT L;  2FIF A;  3VH4 B;  1VD2 A;  2DLB A;  2IZV B;  1UD7 A;  4A9A A;  5IKC M;  1WRD B;  1VZ6 A;  1IP9 A;  2FAZ A;  2CB8 A;  1P3Q U;  3AM9 A;  3L54 A;  2KFK B;  4PQ0 A;  4F7H A;  1D5Z C;  3HSA A;  2D2Q A;  2H88 B;  1WWT A;  3VDZ A;  3KH0 A;  5C3J B;  1B1Z A;  1GC6 A;  3EPY A;  3WAO A;  2ZNV B;  5EE1 A;  2LXC A;  2MJ3 A;  4ANX A;  4JL9 A;  4G3X B;  4KIK A;  3ZRC A;  4US8 A;  1Q0W B;  3KWV A;  4WJQ A;  1U5F A;  2DX1 A;  1LW3 A;  2ZCB A;  2Y8G A;  1IUE A;  4M0W A;  2MHJ A;  3QWZ B;  2GJY A;  2Z4D A;  2DYM A;  2OJR A;  2X0S A;  2ONQ A;  2DLW A;  3NOB A;  2K9X A;  4HKQ A;  2LD9 A;  5GOW B;  3RN9 C;  1YQB A;  3P6A A;  2DHI A;  2I1K A;  5D3V A;  1RAX A;  1FNU A;  1L7Y A;  1WI0 A;  1WXA A;  2JT4 B;  1YN3 A;  2XK5 B;  1MK9 B;  2D9V A;  4BKT A;  1EF1 A;  4QJ4 B;  2L3Z A;  2NZ8 B;  4NZL B;  2H7E A;  3PVW A;  5D3X A;  1L2N A;  4DQO C;  3PLU A;  2DIK A;  4S17 A;  3IVF A;  4OZB A;  5BMI A;  4DHZ E;  2W82 A;  3MHZ A;  2D4Q A;  3DCG A;  1V5U A;  1TZO A;  5E6J A;  4C4V A;  1DIK A;  1I4R A;  2IY1 B;  3O65 B;  2K6D B;  5J3Y A;  4NNJ B;  5HE1 A;  2L0F A;  1GOZ A;  4E3C A;  2R2Q A;  1WM2 A;  3P4P B;  4XYC A;  4P16 A;  3N9Y C;  2CQU A;  4ITK A;  1WGD A;  4OZA A;  2K8E A;  1BXT A;  1D6E C;  2D3B A;  1E90 A;  4IFS A;  4NQL B;  1WX9 A;  1ET9 A;  2KVZ A;  3NW8 A;  1F77 A;  2N9P C;  3PO0 A;  2BVC A;  2WXO A;  2O6V D;  2KDE B;  1X1M A;  4R3D A;  3PRZ A;  1MKE A;  2D3A A;  2MH7 A;  5LXH A;  2LVQ A;  3Q2A C;  1HZ6 A;  1QC6 A;  2CKH B;  1FCC C;  4JKG A;  1CMX B;  2N9L A;  4KSK C;  1WGQ A;  2DZI A;  1SIJ A;  2XQN M;  4RF1 A;  2WH5 A;  1YJJ A;  3FIL B;  3NVZ A;  5HE2 A;  4K17 A;  3ZJV A;  3ZUN A;  3QCA A;  1VDV A;  2GBM A;  3IT4 B;  4GGQ A;  1WGR A;  3AN1 A;  4MM3 B;  3T9L A;  4HAV B;  1I35 A;  2BGF A;  1MIX A;  1TIF A;  2UZR A;  2KC2 A;  4ARC A;  2INN E;  2MW5 A;  4ILH A;  1NVL A;  3L13 A;  4KZ0 A;  1OEY J;  2YSZ A;  2AEH A;  1RLF A;  3U52 E;  1BAK A;  4EFO A;  1VLB A;  2QMT A;  1ZXI A;  1HTQ A;  3VOQ A;  4FLH A;  5DIF B;  2LYD A;  2DA0 A;  1CK1 A;  5KHO A;  2LOZ A;  1PGA A;  3ECI A;  1YQ3 B;  1C79 A;  1JW9 D;  2KDI A;  1MG8 A;  3SDL C;  3Q6B A;  3PEG A;  2KKC A;  4FJY A;  1FHW A;  4KGR A;  1JML A;  2KWD A;  2XEW A;  2K8H A;  5J17 A;  1T77 A;  4FUL A;  3VRB B;  4B0E A;  1UEF A;  2ELB A;  1WF9 A;  2GI9 A;  2M0X A;  1QF6 A;  2COP A;  3DWM A;  1V88 A;  3KUD B;  4KZC A;  3ZLZ A;  1H4R A;  1OQR A;  1NYQ A;  1P9D U;  2ACZ B;  2NMQ A;  4L1R A;  2PPH A;  3U4E G;  5C5B B;  4GDK B;  1K52 A;  3GOE A;  4OT1 A;  1UPR A;  3HVZ A;  4XDC A;  2NBU A;  3NWD A;  4N6E B;  3CIR B;  2NTS A;  1T0Y A;  2IBI B;  4DK5 A;  2KC1 A;  2AYO B;  1QQR A;  2Y8F A;  2B3A A;  2CJN A;  1MVK A;  1WGK A;  3ZNZ B;  3JSV A;  1HEZ E;  3V3X A;  2R2O A;  2W2X D;  2JXX A;  3UQA A;  4PS7 A;  2INC C;  4HRS A;  1ZDX A;  2WXN A;  2UZS A;  3ZVV A;  4RM8 A;  1AYF A;  3ZXV A;  1P7E A;  3M3J A;  2FNJ B;  1NEN B;  1XLN A;  4KHB B;  3SUZ A;  1N5X A;  1RWS A;  4GN1 A;  3R66 C;  2L1A A;  3N3K B;  2FCQ A;  3ML9 A;  3PVU A;  2KAC A;  3RCZ A;  3EFU A;  4NSW A;  5HE3 A;  1L4D B;  1NTY A;  3U12 A;  2J53 A;  2M4N A;  2VZK B;  1V97 A;  1IBX A;  3W5V B;  1YN4 A;  5BYQ A;  2KLC A;  1EM7 A;  2LGX A;  1SE4 A;  4MT7 A;  1GB4 A;  1TJ6 A;  2BYT A;  2M38 A;  3B2G A;  1DOI A;  1W1D A;  4HPM B;  2PKO A;  4I6L B;  4BBN F;  1FIQ A;  1NTI A;  4ANU A;  2MDX A;  2DX5 B;  2PTL A;  5JZE B;  1LO5 D;  4IUM B;  3TBL D;  4EZL A;  1KZG A;  2WS3 B;  1UPQ A;  1FXT B;  2TSS A;  1F0Z A;  4P1C C;  2Y5B B;  1XR0 B;  1TY2 A;  1UEL A;  4JWS C;  2D9Y A;  4A6F B;  1C78 A;  1VBG A;  2QSD A;  5DPR A;  2KTF A;  1QIL A;  2DN6 A;  2WXQ A;  2WDV B;  2IY0 B;  4KGT A;  1WGG A;  4HPP A;  3QAQ A;  1MHX A;  4NAW A;  2LGS A;  3A4S C;  4HB4 B;  3IHP C;  1JDE A;  1KF6 B;  3FC4 A;  2ADZ A;  2BYE A;  1AQC A;  1PFJ A;  1DDM A;  4LNF A;  1QKZ A;  3BWU D;  4HJK A;  3DVG X;  5C79 A;  1QOA A;  4IOY X;  1SE9 A;  5L81 A;  5DPS A;  3SNH A;  1F1H A;  3QA8 A;  3RZW C;  3TEW A;  3I3T B;  2KZR A;  1ZE3 D;  1FRR A;  3EGR A;  2AQ1 B;  1RRB A;  2AX5 A;  1FXI A;  4FJZ A;  3QC8 B;  3RI7 C;  5FK9 C;  1WG7 A;  2KHW B;  1J19 A;  1W1G A;  1V1P A;  2GB1 A;  4YL8 A;  4DX8 A;  1FM0 D;  1IGC A;  1HE8 A;  2GUM A;  2QJL A;  1E8W A;  2X38 A;  1HB6 A;  3LXF A;  2COC A;  1LQB A;  3N1X C;  2PW9 A;  1U5E A;  3X23 A;  2UVM A;  4IWO A;  2E2X A;  1QZE A;  1DYN A;  2IPK D;  1ZUD 2;  2BPS A;  3KZ1 A;  3W5U B;  2PIA A;  1YJ1 A;  2QIL A;  5AZF A;  5L83 A;  4GSW A;  4NPN A;  5CHF A;  3UIO B;  1FGY A;  3QWM A;  2P0F A;  2J42 A;  3MFG A;  3NZS A;  4JGH B;  2KTR A;  3J9C A;  2SEB D;  3PP2 A;  4OHJ A;  2L83 A;  2W55 A;  4WWM A;  3N1Y C;  3Q8F A;  2Z0E B;  1IRS A;  1DYQ A;  1Z5S B;  4BKS D;  2YS1 A;  2KQ4 X;  2DYN A;  2BB6 A;  3ZDM C;  1Z87 A;  1ZSQ A;  1UNP A;  5AEK B;  3RPF C;  3IT6 B;  3SD5 A;  4HXD A;  4RFB A;  4C56 C;  3SV1 A;  3ZJT A;  3V6C B;  4BFR A;  2LVO A;  3VUY A;  4EJN A;  3M63 B;  4HVB A;  4JKB A;  1FXA A;  4ZRQ A;  4II3 B;  1WY8 A;  3U8Z A;  1E8Z A;  2DYO A;  3RUI B;  1P0R A;  2W3S A;  3AE5 B;  4A3P A;  1M7R A;  3FKY A;  4PS3 A;  2IFS A;  1L6U A;  2YEP F;  3HK0 A;  3UIP B;  2MBB B;  3FSS A;  2RGF A;  3C8Y A;  4JK7 A;  3A1Q A;  1V86 A;  4RM9 A;  2W2W A;  1VBH A;  3TEY A;  1ACA A;  1NI3 A;  4DHJ D;  1Y5O A;  1UNQ A;  5LOP B;  3E9P A;  2EC1 A;  2WXR A;  2UWQ A;  5D3D A;  2HE7 A;  4ZHO A;  3EA6 A;  4G50 A;  1TKY A;  4P1B C;  4EOY A;  4C00 A;  2K2J A;  1XEE A;  2ASQ A;  1GGO A;  1WJM A;  4HK2 A;  3AE3 B;  1MJD A;  4FAD A;  1V80 A;  2G4D B;  5AUK A;  1NTV A;  3EFC A;  1CJE A;  1V2Y A;  1WRI A;  5BYR A;  2Z13 A;  1V49 A;  1K50 A;  4MSM B;  2DKQ A;  3MJ5 A;  2LGY A;  2WU5 B;  4K3B A;  5CLL B;  1HBK A;  2OHF A;  4LDT D;  5JHA A;  2WU2 B;  2WXF A;  4GMX B;  3BVZ A;  2CY4 A;  4K2P A;  2MFQ A;  4DHJ B;  2CHX A;  2FDQ A;  2B76 B;  2VRR B;  5KQ4 A;  4B6H A;  5DHA B;  4PT5 A;  4RGO S;  1OFF A;  3QAR A;  1U4A A;  4JK9 A;  2MLB A;  2GRI A;  4KKJ A;  4II2 B;  3LB8 C;  4Z2N A;  2KLG A;  2BF8 B;  3ZRF A;  3A8P A;  2N0Y A;  2KVR A;  1PLS A;  3IBE A;  3CSF A;  4EE2 A;  3EC8 A;  3E9O A;  4RMA A;  3ZGZ A;  5D6J B;  3ZO5 B;  4JLC A;  5BYS A;  3V62 A;  2LXA A;  4KDI C;  4OW0 A;  4XZ4 A;  3W1S C;  4YSZ B;  4GDL B;  2EMT A;  3GZN B;  2DAJ A;  3SYX A;  2WQY B;  2Z59 B;  4JIO U;  4M01 A;  2K6Q A;  1S1Q B;  5EDS A;  2WP9 B;  2V1Y A;  5LG4 B;  3KYD D;  3AE7 B;  2KO3 A;  3ZDT A;  4WAF A;  1QLB B;  1MPE A;  4WH4 A;  2N7J A;  2NPT A;  3AB5 A;  2COD A;  3AE6 B;  1A5R A;  2HTH A;  3KVF B;  3AEF B;  4E71 A;  2YF0 A;  1WGY A;  3FP5 A;  2RMM A;  1TT5 B;  3D8E A;  3V5W A;  2JWU A;  2GBK A;  3NWA A;  3AEC B;  4MH0 E;  4W9D A;  1WXS A;  4IOI E;  2G3Q B;  3ZNH B;  4Z2M B;  2WX0 A;  2D5G A;  4OVU A;  2J0K A;  3NJT A;  4KHA A;  3UI3 A;  4FJV B;  3QK0 A;  3TL5 A;  3Q8B A;  4S0R A;  2HRJ A;  3TVV A;  2QDF A;  3UF8 A;  1QT9 A;  3PZ7 A;  1WJN A;  4MT5 A;  2KTR B;  3DXC A;  1XF5 L;  1NU2 A;  3FEH A;  3A9K B;  3KUZ A;  3DVN V;  5CHW A;  1RJ2 A;  2KQ7 A;  4A6K A;  3H7P A;  1PYW D;  4I6P A;  4WJO A;  1F9J A;  4QJ5 B;  4KAX B;  2JF5 A;  3AEG B;  4YTM B;  1CQV A;  4K81 A;  3SFE B;  4J6I A;  1SXT A;  4EKU A;  1WXQ A;  2A5U A;  1WVH A;  2I38 A;  2M8S A;  2LJ5 A;  1DOX A;  1PMS A;  3ML4 A;  5DH9 B;  1WIA A;  2NBW B;  2K8C A;  2KQS A;  4N9F 4;  2ZVO A;  2QIE B;  4TUU A;  3UQB A;  2DKP A;  4ZRJ A;  1KZ7 A;  2COF A;  4K7W A;  5HI1 A;  3IAM 1;  4K3C A;  3AE8 B;  3O96 A;  2M19 A;  2LOX A;  3MC8 A;  1SHC A;  2PVO D;  2N9X A;  1YIW A;  2PZ1 A;  4KX6 B;  5J3T A;  5D94 A;  4ICV A;  4DBG A;  4XGA B;  1SIF A;  1E7V A;  1TKE A;  5IAA C;  4GOU A;  1TKG A;  1J7A A;  3T06 A;  4ZYN A;  1N5W A;  1AW7 A;  1JWA D;  1YNT E;  2N4F A;  2OED A;  4D6W A;  3IFW B;  3P1M A;  1QOF A;  4PYZ A;  1R4M I;  3SBT A;  5I2S A;  2KNB A;  5T8I A;  3W2D A;  3PPA A;  1FPY A;  4LLG M;  3RNC C;  3ZXR A;  2ZPN A;  1V5T A;  3WA0 A;  2BWF A;  1AAR A;  2DZK A;  2KD0 A;  2LGI A;  3JSV B;  3EHV A;  3PHW B;  3L16 A;  2KX0 A;  3PRM B;  2DEN B;  1SE3 A;  1L5P A;  5GMV A;  3ZIM A;  1XCQ L;  2HDE A;  5HE0 A;  3MC9 A;  3DHI C;  4MGK E;  2QCZ A;  2DFK A;  3S2A A;  3DVG Y;  2VZK D;  3L17 A;  2JYE A;  3BIN A;  2CY5 A;  2G9H D;  4TQ0 A;  3I57 A;  5C5B A;  4GDK A;  3PVL A;  1XT9 B;  2KDM A;  4MDK E;  1TXD A;  3R2T A;  3NZ3 A;  3I5J C;  1P1A A;  4K7S A;  3P42 A;  3D32 A;  1WGH A;  4IAP A;  3DOW A;  4HCN B;  3APC A;  2O6V B;  3Q3O C;  1OQN A;  2BKR B;  3DBL B;  1WE6 A;  3A98 B;  4DXG A;  3B77 A;  4FHJ A;  4A8X C;  1RM6 C;  2JZ3 B;  1Y8R C;  2CAY A;  1ZW7 A;  3FVC A;  5LLI A;  2DWQ A;  3AUL A;  2IDY A;  5I2M A;  2N1W A;  2N9K A;  4L6E A;  2W2X C;  1SSN A;  2AWT A;  2WGS A;  4XWT A;  3Q3M C;  2HJ8 A;  3NS1 A;  2KN4 A;  3CXB B;  2J52 A;  3SFD B;  2LGD A;  1E6E B;  1Q1O A;  1XLQ A;  1KH0 A;  4IDI A;  4LCD E;  1TGZ B;  2GOW A;  3RFZ B;  3NG0 A;  2YS3 A;  5H8Y E;  2WHI A;  2D10 A;  1OMW A;  4D2K A;  2GMI C;  5BMG A;  3I9V 1;  4CHM A;  1XOD A;  5IOI A;  4FN2 A;  4TKN A;  2WXG A;  2K25 A;  3A9J A;  1YMH E; 
#chains in the Genus database with same CATH homology
 4PYU A;  3PS6 A;  2P8V A;  3PSE B;  5JH5 C;  4XX5 A;  1UBI A;  4EZK A;  2CHZ A;  2ROZ B;  1ZGU B;  2ZZP B;  5J3Q A;  2GBJ A;  5JHH A;  4D0N B;  4WJN A;  3F0W A;  1KOT A;  3CMM B;  4MGZ E;  3PV1 A;  1RFA A;  3H1U A;  4K1R B;  4G0N B;  5JHB A;  4IM2 A;  2CRF A;  2FJ9 A;  1E8Y A;  3SHQ A;  4M0W B;  4HLE A;  2MA9 B;  5C1Z A;  3AU4 A;  4HPL B;  1V9J A;  2NCN A;  4JKF A;  3PT2 B;  4BOZ B;  5DI9 B;  4ILJ A;  4TQ1 A;  1P3R A;  2IO0 B;  4W9E A;  2DZJ A;  5C16 A;  2JWZ A;  3R7R A;  3K9O B;  4AUQ C;  2XBB C;  1MPH A;  1V61 A;  4LDT B;  4DHZ B;  5JVL A;  1KBL A;  4BBK A;  3KYC D;  4MM3 A;  4X57 B;  4ZDV A;  1UNR A;  2ZPY A;  4GIV A;  1TTN A;  3VTV A;  3APF A;  1X86 A;  3VIA A;  2PE6 B;  1FB8 A;  1X1G A;  4AOF A;  1E8X A;  2D9W A;  2HD5 B;  2Z0Q A;  1XD3 B;  3PLV A;  4HDQ A;  3NZU A;  3KUC B;  4MGY E;  1H8C A;  4WWP A;  3TIX A;  2KWU B;  3A4R A;  5JP4 A;  4AP4 C;  2ABD A;  4WVF B;  1GC7 A;  1XKE A;  3AXC A;  2RQ1 A;  3ODW A;  2C7H A;  1FHO A;  3DBL I;  2AL3 A;  3EEC A;  1WZ0 A;  3WAL A;  1UGM A;  2LUL A;  3AU5 A;  5JLJ B;  1V5M A;  2N7E A;  2KWC A;  3QQ8 B;  3E66 A;  2JUO A;  2R09 A;  3M62 B;  4HB0 B;  1XD4 A;  4P7I A;  3VVW B;  1ISN A;  2M17 A;  1UZX B;  3VFK A;  3PRP B;  2H7D A;  3FM8 C;  3OAW A;  2G4S A;  2DHK A;  3ALB A;  3DVN U;  3HHM A;  2CS4 A;  4G11 A;  3TFM A;  2KJH B;  2N7D A;  2FJL A;  3UZT A;  4ICU A;  3RD2 A;  2Q13 A;  3H7S A;  4W9K A;  2KX3 A;  4WQO B;  4BKS A;  4F1S A;  2C7M B;  3SBG A;  1VCB A;  2KK8 A;  1WZ3 A;  2KFK A;  3WAM A;  4M8M A;  3DBH I;  1WXM A;  3KW5 B;  1HB8 A;  1AWE A;  4MK0 A;  2IYD B;  3C0R B;  1M7E A;  2CHW A;  3GYP A;  4GPT B;  2MQJ A;  3MHS D;  1BTN A;  4WAA A;  2BKF A;  1FOE A;  3DPD A;  3MPX A;  2L05 A;  2AL6 A;  4AWJ A;  5G55 A;  1GG3 A;  1EF5 A;  2G45 B;  1ZVR A;  4TV3 A;  1KC7 A;  4WSF A;  2IO3 B;  4CO7 A;  3VTW A;  4DBB A;  4W9H A;  1BTK A;  4GMV A;  1UH6 A;  3QJZ A;  2D9X A;  2DYB A;  4DXA B;  4FBJ B;  5C23 A;  1XQQ A;  3X0W A;  3JYU A;  2RR9 A;  2WYQ A;  3ODX A;  4XWX A;  2M1M A;  3LJ3 A;  2G35 A;  3TCA A;  4JKA A;  1UBQ A;  3JW0 X;  3PRE A;  2K2U A;  2W9N A;  3ENB A;  4M8N A;  1E5W A;  2JY6 A;  3GYO A;  2GBN A;  2P0H A;  4KSL C;  3JVZ X;  4URK A;  4HAZ B;  1LFD A;  1LXD A;  4KV2 A;  2V4L A;  5HKH A;  2YS5 A;  1V89 A;  4EZJ A;  3L0W B;  3TO1 A;  1EO6 A;  2VSZ A;  3WIM A;  2ZCC A;  4B95 A;  2MP2 A;  5E6O A;  2ZNV C;  3TMP B;  2LI5 A;  5D7G A;  1SGH A;  1MAI A;  3BY4 B;  1DDW A;  2MCN B;  2LKO A;  2LG1 A;  3GZN I;  4F7U P;  4MEL A;  3M1I B;  2NVU I;  2LZ6 A;  3ODO A;  4W9G A;  2QKM A;  1I7A A;  4H8S A;  2GCL A;  2QHO A;  4GB9 A;  4K2O A;  4F7G A;  4HWI B;  3SO6 A;  2ZJD A;  1KLV A;  2RSG A;  3VH3 B;  4ANV A;  4CHJ A;  1EUV B;  3L10 B;  2JRI B;  2LVP A;  1J0W A;  2RLO A;  2O6V A;  3WYF B;  2KOX A;  4EMO A;  2JPH A;  2GBR A;  1IYF A;  3OJ3 A;  1ZC3 B;  1G6J A;  3A9J B;  5IA7 A;  1J8C A;  4WJ7 A;  4JKH A;  1OY2 A;  1WX7 A;  4ILG B;  4HB3 B;  5EFX A;  1GJZ A;  2DHZ A;  4A6H A;  4HCP B;  1FGZ A;  2DX5 A;  3FLV A;  1K8R B;  1WM3 A;  1KI1 B;  2DZM A;  4A3O A;  1Q5W B;  2QKL A;  1LM8 B;  1H10 A;  3VHT C;  1WMH B;  2OOB B;  5LON B;  3VAW A;  2K1F A;  1EAZ A;  1BT0 A;  3A8Q A;  3IG3 A;  4FA6 A;  2LRU A;  5AZH A;  3CST A;  2RSU A;  1V81 A;  5FR6 A;  3OAN A;  3PZD A;  4PS8 A;  1LB1 A;  1WJ4 A;  3PG7 A;  2ELA A;  1Z2M A;  1QQG A;  3HM6 X;  5E6P A;  2Z0P A;  2XK5 A;  3DXD A;  3ZNG C;  3ZKJ C;  3B1L X;  1U2B A;  2L76 A;  4PNK A;  5CX3 A;  2KDB A;  3DDC B;  3VUW A;  2M14 A;  4W9F A;  4MGI E;  2KCJ A;  2MSE D;  3QX1 A;  3OJ4 B;  4FHK A;  4KIK B;  1IPG A;  3TW1 A;  1X11 A;  3KRX A;  2FCS A;  4MJS A;  2MP2 B;  1TQZ A;  5JHG A;  1K5G B;  1WE7 A;  4HAW B;  2Z0O A;  2A4Z A;  3L08 A;  3TJP A;  2YRY A;  3P7Z A;  1YX5 B;  2HTH B;  1ZC4 B;  3RT3 B;  2MX2 A;  2YLM A;  4W9I A;  4B6W A;  2N1V A;  2KJR A;  2MBH A;  4XC2 A;  1WR6 E;  2RPQ A;  1WGU A;  3UGB B;  3ENE A;  4B9K A;  2DAF A;  5E6N A;  5D27 A;  2CR5 A;  2L2I A;  2Y7B A;  1R4N I;  2RVB B;  2NR2 A;  2BWE S;  2NPT B;  1PQS A;  3VQI A;  2KAN A;  2FCN A;  2K39 A;  1NBF C;  2NS5 A;  3A33 B;  3RZF A;  2LBB A;  3A1Q B;  2D9Z A;  1X1F A;  3D8F A;  2KJ6 A;  2C60 A;  1ST7 A;  5L95 C;  2FID A;  1V6E A;  2C5L C;  1K5D B;  1WH3 A;  2FCM A;  1DBH A;  2ROV A;  4IWP A;  4A20 A;  1KM7 A;  1NI2 A;  1NDD A;  3HW2 B;  2O2V A;  1BWN A;  1GNU A;  2WX1 A;  2PE9 A;  3ULB A;  2L1C A;  3E9L A;  3CF6 E;  3ULC A;  2REX A;  4NQK E;  1XX0 A;  4F8C B;  3ZTC A;  4MEM A;  4EUT A;  2YVC A;  1C1Y B;  2J0J A;  2PEA A;  3QBV B;  3ZNI D;  3NHE B;  2OQB A;  1X05 A;  2N9E B;  2D3G A;  3M95 A;  2WDT B;  2GCJ A;  2I1J A;  3V6E B;  1WI1 A;  2YT0 A;  1Q67 A;  4JQW C;  2ZEQ A;  5DHF B;  3B0A A;  4KHO A;  3DBS A;  2J7Q B;  1KJT A;  5DPT A;  5DCN A;  2ZVN A;  1TBE A;  4KDL B;  2RNR B;  2MRP A;  4ASW C;  1C3T A;  1B55 A;  2V3S A;  5D3W A;  4F7Z A;  2KN5 A;  4GU2 A;  1MK7 B;  2I5F A;  4IM0 A;  4NY0 A;  2O2V B;  4HAT B;  4EEW A;  3VXW A;  1D3Z A;  3F5R A;  4TYZ A;  4HAX B;  4JKD A;  2LWP A;  5G2N A;  1WJ1 A;  5J18 A;  2C9W B;  4HB2 B;  2LUE A;  1P6S A;  1J0G A;  2MBO A;  3H6N A;  5CLQ B;  3RUL A;  2KFJ A;  4BVU C;  4HDO A;  1V5P A;  1WMH A;  3W1S A;  1XCG A;  2BCJ A;  2D11 A;  3KRW A;  3H9D A;  2UYZ B;  4CYE A;  4DX9 0;  1OGW A;  2K8B A;  1WYW B;  1W1H A;  1OEY A;  3N7C A;  3WAN A;  3RCP A;  3R7Q A;  2IYB A;  4AJW A;  2K00 A;  4IWQ A;  4HAU B;  3APD A;  2D07 B;  5IJM A;  3ZVR A;  1OTR B;  1FHX A;  2KDF B;  3SU8 X;  4WJP A;  1OQY A;  1N3H A;  1V5O A;  3HIZ A;  3RYT A;  1EVH A;  2KXJ A;  2NBV B;  3PTF C;  1P98 A;  5KHQ A;  2L8J A;  1U5D A;  4W9J A;  3PGE A;  4GZU A;  4MJS B;  4NJ7 A;  1TZ1 A;  3AI5 A;  1YD8 U;  2DYQ A;  4KVG B;  3BJI A;  5AZG A;  2YT1 A;  4C0A A;  2JP2 A;  2X18 A;  3K9P B;  2L7R A;  5C6R A;  4A5K A;  5D3Y A;  4ANW A;  4Y94 A;  1EGX A;  2R82 A;  3Q3J A;  2MKR A;  1S3S G;  3UIN B;  3KY9 A;  2LAS A;  5FI0 A;  4ZRK A;  4NAW B;  2EMS A;  4IM3 A;  3VTU A;  3DQV A;  4MSQ B;  3PHX B;  3T8M A;  2JZZ A;  5J2R A;  3Q3F A;  3OLM D;  1WX8 A;  3NY5 A;  2FUH B;  2RUK B;  3QIJ A;  3ONS A;  2I5C A;  1FAO A;  3MDB C;  1YX6 B;  4LJP B;  4MY6 A;  3W1Y A;  2EKE C;  4W9C A;  1E7U A;  2IO1 B;  4ZRI A;  1RRP B;  3QHT A;  2P0D A;  2KWV B;  2J0M A;  3AJ4 A;  3DXE A;  2L00 B;  1WXV A;  4GOC A;  3LDZ E;  1P5T A;  4BBN C;  2KMC A;  2MBE A;  5FI1 A;  1U27 A;  4HAY B;  5CTR C;  3NS8 A;  1WFY A;  3PSC A;  2WWZ A;  2RD0 A;  4WWN A;  2NMB A;  2MWN B;  4BKG A;  4W9L A;  2KGX B;  4HHV A;  4DWF A;  3B08 A;  3WAP A;  3N30 A;  3HM3 A;  5CHV C;  2OTX A;  3U30 A;  4A6F A;  2KUP A;  1DDV A;  3R3M A;  5BO4 B;  2VKI A;  4IC7 B;  4JKG B;  2COA A;  3A9K A;  4OVV A;  4NJ6 A;  2JRH A;  1Y19 B;  2N23 A;  1DRO A;  4IG7 B;  2JVC A;  1JRU A;  3U7D A;  2BYV E;  2IO2 B;  1U29 A;  2PJH A;  1ZM0 A;  3DBR I;  2EJ8 A;  2MWS B;  5LXI B;  3ML8 A;  3ZW3 A;  3MJW A;  2LRW A;  2L0T A;  4AJY B;  2MBQ A;  3KSY A;  4WWO A;  3ZTD A;  2VRW B;  4LJO B;  2C7N B;  4DDI D;  1ZKH A;  4E74 A;  3MTN B;  4GDL A;  2R0D A;  1GUA B;  2V76 A;  3HQC A;  2DTC A;  1I42 A;  1WR1 A;  1U5G A;  2BYF A;  4GXB A;  5DPW A;  3N32 A;  5D2M B;  2J59 M;  4IW0 A;  3P2B A;  4K7U A;  2DHJ A;  1MIZ B;  4CHK A;  1M94 A;  4JK8 A;  3H7P B;  4YON A;  2CU1 A;  4JKE A;  2KMA A;  2Z0D B;  5TR5 A;  3V60 A;  3G9W A;  2RGN B;  2GS0 A;  5KQ1 A;  4BOS C;  3V61 A;  4I6N B;  1WJU A;  4JKC A;  3D8D A;  4DDG D;  1I2H A;  5KCV A;  3LJU X;  3VUX A;  3NSU A;  1WJ6 A;  3CIK A;  2FIF A;  3VH4 B;  1VD2 A;  2IZV B;  1UD7 A;  1WRD B;  1IP9 A;  2FAZ A;  2CB8 A;  1P3Q U;  3L54 A;  2KFK B;  4PQ0 A;  4F7H A;  2D2Q A;  3VDZ A;  3KH0 A;  1GC6 A;  3EPY A;  3WAO A;  2ZNV B;  2LXC A;  4ANX A;  4JL9 A;  4G3X B;  4KIK A;  3ZRC A;  1Q0W B;  4WJQ A;  1U5F A;  2DX1 A;  1LW3 A;  2ZCB A;  2Y8G A;  3QWZ B;  2GJY A;  2DYM A;  2OJR A;  2X0S A;  3NOB A;  2DLW A;  2LD9 A;  5GOW B;  1YQB A;  3P6A A;  2DHI A;  2I1K A;  5D3V A;  1RAX A;  1L7Y A;  1WI0 A;  1WXA A;  2JT4 B;  2XK5 B;  1MK9 B;  2D9V A;  4BKT A;  1EF1 A;  2L3Z A;  2NZ8 B;  2H7E A;  3PVW A;  5D3X A;  1L2N A;  3PLU A;  2DIK A;  3IVF A;  4DHZ E;  2D4Q A;  3DCG A;  1V5U A;  1DIK A;  2IY1 B;  3O65 B;  2K6D B;  5J3Y A;  4NNJ B;  5HE1 A;  2L0F A;  4E3C A;  2R2Q A;  1WM2 A;  2CQU A;  1WGD A;  1E90 A;  4IFS A;  4NQL B;  1WX9 A;  2N9P C;  2O6V D;  2KDE B;  1X1M A;  3PRZ A;  1MKE A;  5LXH A;  2LVQ A;  1QC6 A;  2CKH B;  4JKG A;  1CMX B;  4KSK C;  1WGQ A;  2DZI A;  2XQN M;  2WH5 A;  5HE2 A;  4K17 A;  3ZUN A;  3QCA A;  2GBM A;  4GGQ A;  1WGR A;  3T9L A;  4HAV B;  1I35 A;  2BGF A;  1MIX A;  2KC2 A;  2UZR A;  2MW5 A;  4ILH A;  1NVL A;  3L13 A;  4KZ0 A;  1OEY J;  2YSZ A;  2AEH A;  1RLF A;  1BAK A;  4EFO A;  3VOQ A;  4FLH A;  5DIF B;  2LYD A;  2DA0 A;  5KHO A;  2LOZ A;  3ECI A;  2KDI A;  1MG8 A;  3SDL C;  3PEG A;  2KKC A;  4FJY A;  1FHW A;  2XEW A;  2K8H A;  5J17 A;  4FUL A;  1UEF A;  2ELB A;  1WF9 A;  2M0X A;  2COP A;  1V88 A;  3KUD B;  4KZC A;  3ZLZ A;  1H4R A;  1P9D U;  2PPH A;  5C5B B;  4GDK B;  3GOE A;  1UPR A;  2NBU A;  1T0Y A;  2IBI B;  4DK5 A;  2KC1 A;  2AYO B;  2Y8F A;  2B3A A;  3ZNZ B;  3JSV A;  2R2O A;  2W2X D;  2JXX A;  3UQA A;  4PS7 A;  2UZS A;  3ZVV A;  4RM8 A;  3M3J A;  2FNJ B;  4KHB B;  3SUZ A;  4GN1 A;  3R66 C;  3N3K B;  2FCQ A;  3ML9 A;  3PVU A;  3RCZ A;  3EFU A;  4NSW A;  5HE3 A;  1NTY A;  2M4N A;  2KLC A;  2LGX A;  4MT7 A;  1TJ6 A;  2M38 A;  1W1D A;  4HPM B;  4I6L B;  4BBN F;  1NTI A;  4ANU A;  2MDX A;  2DX5 B;  5JZE B;  4IUM B;  3TBL D;  4EZL A;  1KZG A;  1UPQ A;  1FXT B;  2Y5B B;  1XR0 B;  1UEL A;  2D9Y A;  4A6F B;  1VBG A;  5DPR A;  2KTF A;  2DN6 A;  2IY0 B;  1WGG A;  3QAQ A;  4NAW A;  3A4S C;  4HB4 B;  3IHP C;  1JDE A;  2ADZ A;  2BYE A;  1AQC A;  1PFJ A;  1DDM A;  4HJK A;  3DVG X;  5C79 A;  4IOY X;  1SE9 A;  5L81 A;  5DPS A;  3SNH A;  3QA8 A;  3RZW C;  3I3T B;  2KZR A;  1RRB A;  4FJZ A;  3QC8 B;  1WG7 A;  2KHW B;  1J19 A;  1W1G A;  4YL8 A;  4DX8 A;  1HE8 A;  1E8W A;  1HB6 A;  2COC A;  1LQB A;  1U5E A;  3X23 A;  2UVM A;  4IWO A;  2E2X A;  1QZE A;  1DYN A;  2BPS A;  3KZ1 A;  1YJ1 A;  5AZF A;  5L83 A;  4GSW A;  4NPN A;  5CHF A;  3UIO B;  1FGY A;  3QWM A;  2P0F A;  3NZS A;  4JGH B;  2KTR A;  3PP2 A;  2Z0E B;  1IRS A;  1Z5S B;  4BKS D;  2YS1 A;  2DYN A;  3ZDM C;  1Z87 A;  1ZSQ A;  1UNP A;  5AEK B;  3SD5 A;  4HXD A;  3SV1 A;  3V6C B;  4BFR A;  2LVO A;  3VUY A;  4EJN A;  3M63 B;  4HVB A;  4JKB A;  4II3 B;  1WY8 A;  3U8Z A;  1E8Z A;  2DYO A;  3RUI B;  1P0R A;  4A3P A;  1M7R A;  4PS3 A;  2IFS A;  3HK0 A;  3UIP B;  2MBB B;  3FSS A;  2RGF A;  4JK7 A;  3A1Q A;  1V86 A;  4RM9 A;  2W2W A;  1VBH A;  1ACA A;  4DHJ D;  1Y5O A;  1UNQ A;  5LOP B;  3E9P A;  2EC1 A;  2UWQ A;  2HE7 A;  4G50 A;  4EOY A;  2K2J A;  2ASQ A;  1GGO A;  1WJM A;  4HK2 A;  4FAD A;  1V80 A;  2G4D B;  1NTV A;  1V2Y A;  1V49 A;  4MSM B;  2DKQ A;  2LGY A;  5CLL B;  1HBK A;  4LDT D;  5JHA A;  4GMX B;  2CY4 A;  4K2P A;  2MFQ A;  4DHJ B;  2CHX A;  2FDQ A;  2VRR B;  5KQ4 A;  4B6H A;  5DHA B;  3QAR A;  1U4A A;  4JK9 A;  2MLB A;  4II2 B;  4Z2N A;  2KLG A;  2BF8 B;  3ZRF A;  3A8P A;  2N0Y A;  2KVR A;  1PLS A;  3IBE A;  3CSF A;  3EC8 A;  3E9O A;  4RMA A;  5D6J B;  3ZO5 B;  4JLC A;  3V62 A;  2LXA A;  4KDI C;  4XZ4 A;  3W1S C;  4GDL B;  2EMT A;  2DAJ A;  3SYX A;  2Z59 B;  4JIO U;  2K6Q A;  1S1Q B;  5EDS A;  2V1Y A;  3KYD D;  2KO3 A;  3ZDT A;  2NPT A;  2COD A;  1A5R A;  2HTH A;  3KVF B;  4E71 A;  2YF0 A;  1WGY A;  3FP5 A;  3D8E A;  3V5W A;  2GBK A;  4MH0 E;  4W9D A;  1WXS A;  2G3Q B;  3ZNH B;  4Z2M B;  2WX0 A;  4OVU A;  2J0K A;  4KHA A;  4FJV B;  3QK0 A;  3TL5 A;  2HRJ A;  3TVV A;  3UF8 A;  1WJN A;  2KTR B;  3DXC A;  1NU2 A;  3FEH A;  3A9K B;  3KUZ A;  3DVN V;  5CHW A;  1RJ2 A;  2KQ7 A;  4A6K A;  3H7P A;  4I6P A;  4WJO A;  1F9J A;  4KAX B;  2JF5 A;  4K81 A;  4J6I A;  4EKU A;  2A5U A;  1WVH A;  2M8S A;  2LJ5 A;  1PMS A;  3ML4 A;  5DH9 B;  1WIA A;  2NBW B;  2K8C A;  2KQS A;  4N9F 4;  2ZVO A;  4TUU A;  3UQB A;  2DKP A;  4ZRJ A;  1KZ7 A;  2COF A;  4K7W A;  3O96 A;  2LOX A;  1SHC A;  2N9X A;  1YIW A;  2PZ1 A;  5J3T A;  5D94 A;  4ICV A;  4DBG A;  1SIF A;  1E7V A;  5IAA C;  3T06 A;  4ZYN A;  2N4F A;  3IFW B;  4PYZ A;  1R4M I;  3SBT A;  2KNB A;  3PPA A;  2ZPN A;  1V5T A;  3WA0 A;  2BWF A;  1AAR A;  2DZK A;  2KD0 A;  3JSV B;  3EHV A;  3PHW B;  3L16 A;  2KX0 A;  3PRM B;  2DEN B;  5GMV A;  3ZIM A;  5HE0 A;  4MGK E;  2DFK A;  3S2A A;  3DVG Y;  3L17 A;  4TQ0 A;  3BIN A;  2CY5 A;  5C5B A;  4GDK A;  3PVL A;  1XT9 B;  4MDK E;  1TXD A;  1P1A A;  4K7S A;  3D32 A;  1WGH A;  4IAP A;  3DOW A;  4HCN B;  3APC A;  2O6V B;  1OQN A;  2BKR B;  1WE6 A;  3A98 B;  4FHJ A;  2JZ3 B;  1Y8R C;  2CAY A;  1ZW7 A;  5LLI A;  3AUL A;  2N1W A;  4L6E A;  2W2X C;  2AWT A;  2HJ8 A;  3CXB B;  2LGD A;  1Q1O A;  4LCD E;  1TGZ B;  2GOW A;  2YS3 A;  2D10 A;  1OMW A;  2GMI C;  4CHM A;  1XOD A;  4FN2 A;  4TKN A;  2K25 A;  3A9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...