1EFHA

Crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
281
Chain Sequence
DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SULT2A3, human hydroxysteroid sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYSTEROID SULFOTRANSFERASE
total genus 98
structure length 281
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1efhA00
4H9GA 1ZM7A 4RY2A 4TQ9A 1QRAA 1KSJA 3U4QA 1ZD8A 1UBEA 1RZ3A 2A7QA 4ASUD 5EXTA 1WBDA 2ORVA 1NI3A 1XPRA 4Q9JA 1XTRA 1E96A 2XXAA 3CF0A 1KDTA 3TIFA 1Z6YA 3RNLA 1N3BA 2JDID 3I1FA 5EZ5A 4RKEA 5KSOA 3CRQA 1ZM9A 2C2HA 2EFEB 3BB1A 2QI9C 1VTKA 5FBLB 3T5DA 1E2FA 3CNOA 3K0AA 2REBA 4CEJA 4A9AA 2HYDA 2W2XA 1SXJE 2WWIA 1XJCA 3B1ZA 3WP1B 1FP7A 1XTJA 1KDOA 3NG1A 2G9NA 2ODEA 2FSHA 1N5LA 2JLQA 3DM5A 2P6UA 4LZZA 1W0JD 5E95A 3GLIE 2D4HA 3ZDQA 3LBHA 4CEJB 5F98A 1N2CE 4LHXA 4HDOB 4HSEA 4MRRA 2JAQA 2QL6A 1G3UA 2UZIR 2VHUA 4FMCB 5DI3B 4HB4A 2D62A 4MITA 3NVAA 5DN6D 1KO1A 2F9LA 4R7ZA 4W9MC 4IDQA 3QSYA 1KI3A 3VFDA 521PA 3VR1A 1KK1A 3DMNA 4PC3A 2W6ID 4JLMA 1ONBA 3QG1A 4WZ6A 3WP0A 2HDNB 2BMFA 1HT2E 4O2LA 2IWHA 2WJHA 1A82A 3E1SA 5JRJA 2F43A 3SC3A 2OO7A 1ZC3A 2WOJA 2OXCA 2XOKD 3BERA 2G77B 4QGAA 2ZE8A 4OJKA 1BH2A 3CUEF 5FBVB 1JJ7A 2YYZA 2WWXA 2C77A 3EWSA 2VHJA 4TYNA 2Z4RA 4AC9A 3A37A 1I2MA 1NN0A 4IDNA 4ON9A 1LV7A 1XMJA 4Z54A 1KYIA 3N2IA 5BXQC 2R9VA 1G16A 4Z51A 1G7CA 2BMEA 2DCUA 3E70C 5FOSA 4RFSA 4LBZA 4TL8A 1F3OA 1CP2A 2IW3A 5AUQA 4EPVA 1QDEA 3LXXA 3MJHA 5HPYB 2VQSA 5GJCA 2O8FA 2WWWA 4QG7A 4M4SA 1NIJA 2GJ9A 4P4TA 4GDFA 3TW4A 1G5TA 1NVUQ 1EK0A 4ZKEA 1X6VA 3B85A 4BZPA 3VX4A 2RGNA 3Q5EA 2R6GA 4ABYA 1K5DA 3OAAD 4IKEA 2FSGA 2WPDD 1RKBA 3B1WA 3CM0A 4LPSA 1OB2A 1LW7A 3B78A 2Q6TA 4B48A 3LX5A 3DZDA 3VNVA 3A58B 2ASEA 3QKRA 1G8PA 2RCNA 3GJ4A 2A78A 4I4LA 3R7WB 4M22A 1NMXA 3RSOA 1NVVQ 2H8KA 2WJYA 3KXKA 4QGFA 4PQRA 4ARZB 5KOYA 1ZNWA 4Q7MB 3I61A 1P61B 3GLGB 2ZANA 4Q1BA 2I1VB 4C2TA 1GG2A 2GETA 4YMVA 4FMDF 1YRBA 4EQ6B 5CB8A 2P5TB 4JL8A 2ZYUX 4HYYA 1B0UA 4RKFA 5FPKA 1XMIA 2JCSA 4PHTA 4PO8A 2FPMA 1X1SA 4NYJR 4ZDWA 3O47A 1UPTA 1SHZA 1FQKA 2WTUA 2V9PA 4F92B 2C04A 1TQDA 3OEED 1FUKA 1ZNZA 3KFVA 2ZRAA 2QPTA 4GOXA 3D31A 2I1QA 4LV8B 3RRMA 1OFTA 1E6CA 1PUJA 1W2HA 4LC1A 3FDIA 1Z8FA 1E4YA 2IYQA 3FMOB 5FOVA 3IGFA 1R2QA 2BJWA 4A6XA 2Z83A 4F91B 2N1BA 2CE2X 4YC7A 1W44A 4WXPA 3QVVA 2WWYA 4R2IA 4BE7B 1R0XA 1ZUHA 4JS0A 2V8OA 3KQUA 1VG8A 2DPXA 2QGZA 2W6IA 1NL3A 3GJXC 4M9ZA 4KODA 3A4NA 2HYIC 2QTFA 4OHZA 1ZRHA 2DWQA 2P5SA 1XMSA 2FPKA 2PBRA 3MFYA 3AVVA 2CXXA 3SFVA 4D0LB 2HF8A 1TADA 2GDJA 2P65A 3KUCA 2YOGA 1XTKA 1UKEA 3PEWA 4B6FA 4TMTA 4GOKA 1J7KA 4LYFA 4LJ7A 1E2HA 1EXMA 1TU3A 1OFHA 2P67A 3TQFA 3BS4A 4OI0A 4XD7D 1KZGB 5KNCA 5LD2C 2ZVQX 2FGKA 4KYIB 2FJUA 4JLNA 2IUUA 2BIFA 4LCBA 1MABB 1X1RA 2ZSDA 3SYNA 3UKDA 3GEEA 4JZKA 4B34A 2GXSA 1KAOA 3Q9LA 3OEEA 4DSNA 1NG9A 2QBYB 2J0VA 5HCNA 1P5ZB 4JVLA 4OI1A 1S3GA 2ZS7A 4UJ5A 1Z6TA 4TYPA 1CJMA 2ATXA 2XZOA 2VSFA 1N6RA 2CVFA 1KMQA 2EFHB 3EW9A 4DIDA 2BMDA 3P20A 4TLBA 5JRZA 5TDHA 2ZE7A 4JLBA 3FMPB 5EP2A 4ESVA 1SHKA 2V4ZA 2LKCA 3T1VA 2QE7D 1TMKA 5TVKA 2CEAA 5DLQC 2YWHA 3W6NA 2C99A 5KPDA 2VH5R 5B58C 2Z4SA 2ONJA 1G1MA 3SS8A 2BCJQ 2WWFA 3A1UA 1QG2A 1NLYA 1XFAA 2QRNA 3EZ2A 4H1UA 2DFNA 4PAOA 1U9IC 1XPUA 3OAAA 4AD8A 1EGAA 2WVJA 4GRAA 3PJRA 1DTSA 3MRSA 3P4YA 2BBTA 4F4CA 4D4JA 2WBLC 2FPLA 2R2AA 4QGHA 2NG1A 2BKEA 4PC1A 1R4AA 3SQXA 3HYTA 2A5GA 2QY9A 1XXHE 1UBCA 4URZR 2N42A 1TNDA 1XEWY 4NYMQ 2IUTA 2IK8A 1VIAA 2YWGA 1G3QA 1XEWX 4Q01A 2ZRPA 3CRMA 3RAPR 2XJ4A 4L9WA 2ZJOA 1IY0A 4X8MA 2GNOA 3TSWA 3ZVLA 4YQFA 3U6BA 4XSGA 1DAKA 4UQOA 3KQNA 5FOTA 2HV8A 1RW4A 1J90A 1VG9B 2CE7A 1Q20A 2H92A 2OZEA 3EC2A 4RFVA 2O0KA 1TPZA 2QN6A 3CPEA 3ONWA 4FMDB 1ETUA 4QFMA 2YWFA 3SZRA 3UMSA 2E87A 2P2LA 4Y0AA 5L3SB 3TR0A 4BWYA 1G8GA 2QGNA 1SVKA 3NHAA 4P33A 1CJTC 2XNSA 3AKYA 3DVLA 5EE3A 3G0HA 1S96A 1IJEA 1F2TB 1UEJA 4D80A 1ZCBA 2GAAA 2VIIA 2EFCB 4G1UC 1HYQA 1T8TA 2QM8A 4UNPA 1HUQA 3NDBB 5C4GB 2GAOA 1E9RA 4X8LA 1P6XA 2C5LA 3A6PC 1OYYA 1TUIA 1F2UA 3I4LA 2JIZD 5FOUA 3VU9A 3NIBA 1U99A 1D9ZA 5G53C 4EIWA 1I2DA 1FTNA 3KJGA 4V0LA 2L0XA 2XNDD 1L4UA 6Q21A 1AGPA 2FZ4A 1OXTA 1XMVA 4ZCLA 2Z43A 4NCIA 3WY9A 1MO4A 4Q02A 4C7OB 5LPNA 3S1AB 3PIRA 1IONA 3TAHA 3WBKA 2XAUA 1NSFA 3CB4A 3KKMA 4OQNA 1UAAA 1J99A 2BBWA 1JAIA 1Q1QA 2UVQA 3RS5A 2ZU0C 2XITA 2BKUA 2JDIA 3SBEA 3AF1A 2GK6A 3TW8B 1VECA 2YJTD 5A5GA 4C0KA 1N6IA 1JNYA 3A1VA 2ZJ8A 3ZZUA 1OFUX 4W5JA 3C5HA 4HAXA 1E94E 4KFUA 1PVOA 2QRZA 5KTYA 3K0SA 4C0AC 4ZIRA 2QMOA 2FSIA 3D6TB 4CIDA 3OIWA 5KDOA 1E98A 2FOLA 2BWJA 2RGNC 5JWRA 3C5CA 2MSCB 2GF0A 4NCHA 4BFXA 2OG2A 3GLGA 2HF9A 3U7FB 1DAMA 4DUGA 1DELA 3CR8A 4RD3A 1FFHA 2YWEA 4OKSA 3X1XA 5FPHA 2E1RA 3GEHA 3JZAA 2CBZA 4LHVA 2IEZA 1Q44A 1P60A 3L0OA 1JR6A 2PEZA 3FMFA 4FMCF 4IXNA 3CIOA 1M7GA 2ZRFA 1WF3A 4AK9A 3SHWA 4TLEA 3GJ8A 5CM9C 4MUAA 1AGRA 4URWR 4U5XA 3ADCA 4HAZA 4NL4H 1L8QA 1G17A 3K0AB 2IC5A 3I5XA 3KXLA 2HCJB 1ZINA 2O0JA 2IYWA 2RAPA 2ZSFA 1WXQA 1EWRA 4QBFA 3RS0A 1MV5A 3W8NA 1XCPA 1ZCAA 5JWHA 1II8A 3GLFE 3KJIA 4DSUA 2B6HA 1OKKD 1UJ2A 5LB4A 4WIAA 1E79D 1CJUC 4B6EA 2DFLA 4RVCA 3VQTA 3OEHD 1GIAA 2H5EA 1Q21A 2ZRKA 3AP2A 4AYXA 1AZTA 3PVSA 4HUTA 2HCBA 4MDEA 3PENA 1OKKA 4Z8XA 3LXRA 3ADKA 4LHZA 3QXHA 2DBYA 5FTMA 2QAGC 4DDWA 4A4DA 5CDFE 2KB0A 3OIUA 3KKPA 5DGXA 1MO6A 1U90A 3WYGA 1P7CA 1OIVA 2QQ0A 1QHNA 3RHFA 4MH0R 5TV2A 3NC0C 4JYCA 1GTVA 4TMKA 2XTZA 3OE7D 3W3AA 2GJSA 1G41A 2B92A 1R7RA 1X8KA 4MKFA 1Y63A 1K6MA 1XTQA 3HU2A 4MYTA 2ZEJA 2V6JA 2ZE6A 3GJ5A 2P0EA 1E1RD 1VIYA 2ZRDA 4Q9LA 2JLXA 3PEYA 3EAQA 3QPWA 1EFHA 1NN5A 5JJLA 2YINC 1XBTA 3FKQA 3EPLA 3NH9A 1W0KA 4TLDA 2P6NA 3LBIA 1G6HA 1XXHA 4JBXA 3T1OA 4IOMA 1KI4A 1KI6B 3TVTA 5JSZA 2QTVB 4OYHA 5KO2A 1WMSA 2GBLA 2VF8A 3CPHA 4WZAE 2XGJA 4HATA 2O8DB 2ZS8A 3ADBA 1TQ6A 3ZD6A 3GLIB 4NE2A 1P9WA 4OK5A 1XU4A 4M8NE 3I62A 4GMDA 1U98A 1ZIPA 2O8FB 2ZI6A 4KFSA 4TSFD 1TF5A 5CYOA 4TQUS 2CHVA 4Q4HB 1YR9A 2CHGA 1U9IA 2VTKA 2JLVA 2AFIE 1DO2A 1P2SA 2RGGA 1F2TA 2ZVPX 3K70C 1E1RA 4NCNA 1E4VA 3THXA 3QVUA 3NEJA 3EA5A 5J40A 5KU1A 3QUSA 2XNDA 2ERXA 1GKUB 2HLDD 1NKSA 4NYIR 4C2UA 1YHNA 3SBDA 4YMSA 4PX9A 5BWMA 1SGWA 3KKQA 4NDZA 2Z0MA 3CLVA 4PC2A 5K8TA 4PC7A 3VAAA 5CK5A 5JS8A 5L3SA 5GADl 4Q7KA 3FHOA 4JLJA 5FTNA 4Z1MA 2XEXA 1Z0AA 2O8BB 1G8HA 3R20A 3DO6A 2IBMA 3ASZA 5JMTA 4TZ0A 4TL9A 2BHRA 4PHHA 3UIEA 4JMPA 4O25A 1XTIA 1EESA 1PLKA 4BLOA 4QJ3A 3SE0A 2O8CB 1NBME 4CZ2A 2QUZA 3EIHA 3RS4A 3FKSA 1E1QA 1G4AE 4LWZA 2Q0HA 1RYFA 5FBWB 2O8EA 1IQPA 4DHEA 3ND9A 2ZRHA 1E79A 3PITA 1ANKA 3R8FA 1KY2A 5EP1A 1L7VC 1XEXA 5G40A 3VTKA 1AQYA 1GNRA 3GEIA 4ZPXA 5ANRB 5LD2B 1R0ZA 1TL7C 3SDZA 5L8VA 5F9HA 1ZYUA 1IY1A 1E9FA 1ESMA 1ZD9A 5EE0A 3SYKA 2OESA 1JECA 4PO9A 5D3QA 4AYWA 1XNJA 2EFGA 4JLAA 1TAGA 1D6JA 1GWNA 1WA5A 1DO0A 1OXSC 2OUKA 4IEIA 3ZQ6A 3RYTC 2F3TA 3LVQE 1E0AA 3K9NA 3VKWA 2WKPA 3CW2A 4JLPA 2G88A 3U61B 1UDWA 2ZYVX 1ZIOA 5JEDA 1AQUA 2W6JA 4M1OA 2IYSA 1KI7A 1ZUNB 3OIYA 4C0BA 2XX3A 3C14C 4AY2A 3KXIA 1OIWA 4D4LA 1CBUA 4V02A 5H70A 4Q9KA 2VP0A 3QXSA 4DEXA 2HUPA 3N2EA 5GJVC 3OHMA 3WMEA 4UNQA 1Z5ZA 1W36D 4IOJA 3U3JA 4LV6A 4BFUA 3BBPA 1G7RA 3RRYA 3L0IB 1KJYA 4A2PA 1AIPA 1U8AA 3WRYC 4JSYA 3IUYA 1SZPA 3DOFA 4HDQB 3NTUA 1YRAA 4Q03A 2CCJA 5LBIA 3Q72A 4OI2A 1AZSC 1E2PA 1Q3TA 3K9HA 5HTKA 1HURA 4Q4AB 3LDAA 4ILEA 5JFGA 3TUIC 2A5JA 2IS6A 3H4MA 4MGZR 2G0TA 1VCOA 4YXWD 3AVOA 2ZITA 4RZ2A 2PH1A 3EWAA 2ODWA 2P3SA 4OBEA 1QZXA 1RVDA 2QAGB 3L0PA 1W36C 1P62B 5JHHB 2WWGA 2WPDA 4KV9A 2OBNA 1G19A 2F1JA 2YVUA 3DL0A 4F38A 4LPKA 3KKOA 2ODBA 1OE0A 4FCVA 1H8EA 4FCWA 1J2JA 3D8BA 1RRGA 2VA8A 3CNNA 2QG6A 1JJVA 1OHHA 4RD0A 2FFHA 2KWIA 4CT5A 1SVWA 2WIAA 3P27A 2V54A 1G18A 1I4DD 1JR3E 2AXPA 1Q1EA 1E0KA 1JPJA 5B2ZA 2WSSA 4EDHA 2JLRA 1SQ5A 4TWZA 3TSZA 1OH6A 1VCMA 3EZ6A 4QBIA 4F93B 1DOAA 2JEOA 1NMZA 3K0EA 2ZUDA 2XZLA 2IHYA 2VP5A 4AKEA 3TUJC 1F48A 4BLTA 3FHCB 4RD4A 4XD7A 2GCOB 4XVRA 3LNCA 4HB2A 3I3SR 4G5GA 3ZLJA 3ICEA 1DPFA 4LDJA 3FYHA 5B30A 1R10A 2AWOA 3AQ4A 1KTVA 4PAQA 4XTRA 4A8JA 3SJBA 5FI0B 3R9IA 3AVUA 3AH8A 4A82A 1CIPA 2GCOA 4UXHA 3ZH9B 2UKDA 3MMPA 2YC2C 4TQAA 2ZI4A 2IHBA 2D3WA 4LBVA 1KKMA 4MQBA 4PPGA 4B3DA 4BRUA 1G3MA 1RC8A 1US8A 2IXGA 3CZPA 4B33A 2V1XA 4E22A 1G7SA 5DSZA 1UDXA 3QNUA 2CL7X 4LK2A 1XB2A 4IFBA 2A30A 1A2KC 1VKJA 2CJWA 2F1RA 4C7OA 4W5HA 3S1AA 5JSZB 5KNDA 4TMWA 4U7DA 1KO7A 4NP6A 3FKSD 3RDPA 2D06A 5J4YA 1JXMA 2V1UA 3GFOA 4KBFA 4V0OA 3CONA 3K53A 2EWVA 3WNBA 2QSZA 4QM7A 3THYA 1N5IA 2FFBA 1W49A 1VYVA 1G3IA 1E0SA 3AF3A 5EUMA 3UWKA 3THWB 3D7MA 3ZD7A 5D3MA 1GP2A 1YZLA 2KSQA 3X1WA 5C46F 1FTSA 1X8JA 3LW8A 3FWYA 2DB3A 1G291 2DY1A 4EFMA 2C96A 5J4KA 4MRNA 4A1FA 3WHKA 1VCIA 1NY6A 5FR2A 4GSYA 4AG6A 3MWLA 3EPKA 3IPYA 3QXJA 1GUAA 2PZGA 1E69A 1DBSA 4LV5B 2NO6A 3M6AA 3UK6A 2BM0A 3BAFA 1W47A 3TR5A 3B1XA 4B74A 2QQEA 1IOZA 2R6DA 5EP3A 2IYVA 3C15C 2BBOA 2ZRMA 3MJRA 4A15A 3NH6A 4RFSB 2AX4A 3W5JA 2NZ8A 2ZI7A 4HB0A 1XJQA 4JJZA 1SKYE 1TQ2A 2OAP1 3M1IA 4Q19A 3KB2A 4B3XA 2AK3A 3MLEA 1P9RA 2CLSA 4KSCA 4CYMA 4XJXA 2MSDB 5L3VA 1M2OB 2IA5A 1XD2A 5F3WB 3KX2A 2WV9A 3K9LA 3PCRB 4PZYA 2WWHA 1KDRA 3PV0A 5SZKB 2C8VA 4DVGA 2FZLA 4FW9A 4NKRA 3GFTA 2YOFA 2GZAA 4Q7LA 3ND8A 4BLRA 5AJXA 1SVIA 1TQ4A 4C0SA 5FL3A 1YJ5A 3QKRB 4XIGS 2AWNA 1DE0A 2OHFA 4HEJA 4KCGA 4QNRA 4A0FA 4D0GA 3R9WA 3IDQA 4K81B 1NSTA 1KK2A 2EYQA 3WBJA 4PTLA 1UKVY 1JQLB 3G82C 3QF4A 4ZO4A 3C7KA 3VR2A 4AG5A 4YDHB 5DHFA 5L3RA 8OHMA 5J4LA 1NG1A 2V7QD 3R9XA 2GVZC 1G64A 4WVFA 1Q12A 1W1WA 2REOA 1SXJB 3L8YA 5FUWA 4N3NA 2CLCX 2ERYA 2FMXA 3HPQA 1IN8A 3EASA 3NXSA 4E07A 1Z22A 4TTRA 2YOHA 3C41J 1AN0A 1S9HA 3K09A 1DADA 2CCKA 3LD9A 4G01B 3SHFA 4Q48A 3U4QB 1GRRA 5LB2A 3TQCA 3W8RA 2RH5A 4Q21A 1P72A 5IK2D 3AVPA 2ZJBA 4MKGA 5AJZA 1ZJ6A 2Q3HA 2OM2A 2VP2A 1C9KA 3GCGA 1SVMA 3U2QA 4FINA 3FE2A 3DOEA 4F4IA 2NPFA 1RJ9A 2AN9A 4MYCA 3V4FA 2GESA 1N6HA 4WOPA 2AL7A 3RS7A 2R6AA 3CX7A 2FEMA 5CIWA 4JVNA 1XD8A 4RD6A 1N6OA 1R5BA 1W46A 2ZYTX 4RJLA 4E09A 2ZREA 5FPYA 3AM1A 1JBKA 4B2PA 5CLLA 2NO0A 2D74A 1EFCA 5BYJA 5K8IA 2WMNB 5FTLA 4TSFA 4QRHA 1Q3HA 1MR3F 4HAYA 1N0WA 1GNQA 3K09C 3TMKA 3EPHA 2WZQA 3CKLA 1OF1A 4Q4HA 2PCLA 4PAMA 1CR2A 2IYLD 3RABA 1COWD 2QMEA 2YV5A 4IVPA 2QZ4A 4WXRA 4M1YA 4RCYA 4GL2A 3IO3A 5A4JA 4A8JB 4MGKR 2NTYC 4YONB 4A6PA 4Q4JB 1E2EA 3W3ZB 5FUVA 1DG3A 4DDUA 3EARA 2ZI9A 2ZRIA 4BFWA 3ICQB 1XEFA 2GRJA 2GXUA 3DPUA 2ZPTX 4Q4JA 1GM5A 1T3SA 1VHLA 3GLHE 2PJZA 3GJ0A 1KI6A 2IXFA 2NZJA 5KPJA 3THYB 2G1JA 1R5OA 2GA8A 2Q9AA 4HLUA 4BECA 4DDVA 1F5NA 3BE4A 3P32A 4A2QA 5CITA 4O2RA 1FOEB 2JJ1D 4DSOA 4B3GA 1U2RA 1B23P 3W6PA 1P2TA 1TUEA 3WNCA 1FNMA 4BFSA 4GBMA 2FG5A 2H17A 3CZQA 5EE1A 2R65A 2I3BA 2PCJA 4HLQB 4RSGA 2PLFA 1MKYA 4EUNA 4JT2A 1PLJA 5DIFA 1UKYA 2F6RA 3P26A 4M0LA 4AYTA 3TUZC 3TVDA 3I73A 2RGBA 4KHZA 3ADDA 2JA1A 1YZTA 3GJ7A 1EFUA 1H65A 1ZM3A 3CR7A 2C9CA 1KO5A 3SR0A 1XJ0A 2ZSAA 5FL7D 1YZUA 4QNMA 2MMGA 2JLWA 2VHQA 1W48A 3SN6A 2HXYA 5G3YA 5EXSA 5TB5A 1XZPA 1Z6AA 2W00A 3BRWD 3BH0A 1HH4A 1Q22A 4G5OA 4PSKA 1AS0A 4NHOA 1R5NA 4L16A 4XWKA 4QBHA 3VMFA 2NPIA 1N5JA 1W2GA 2DWPA 3AF2A 4PPQA 4ERNA 2IYUA 4DCUA 1BYUA 4L5BA 2OFXA 3RS3A 621PA 1SKQA 4BRWA 1FL9A 2GJ8A 2CDNA 5E7MA 5FBQB 1XF9A 4Q7JB 3X1DA 3A4MA 3ZGXA 3B1YA 4DB2A 1D2NA 1ZM2A 1D9XA 1Z07A 3AUYA 4HAWA 1LTQA 1AKEA 1KO4A 2WIBA 3U3MA 3BFXA 4IOLA 4US2R 1G8FA 1UBFA 3I72A 4Q9IA 3R7WA 1ESNA 2ZI5A 2W0MA 4ZCMA 3CWQA 3I8SA 2WM9B 1EFRD 1GKIA 3HP1A 4AI6A 1JALA 1FPMA 1OSNA 1ZMXA 2ZJ2A 3H86A 1OXXK 1N0UA 3AF0A 2QP3A 1M7HA 4U02A 1DG1G 4NTZA 4I1SA 4M1MA 1R8QA 1VYUA 5JCPA 4PPFA 5FR1A 1WDTA 2WKQA 4WA7A 4C4PA 4UNSA 1GZSA 4BGDA 4FIDA 1E9DA 1T4GA 2ZETA 1TF2A 3H84A 3FPAA 2GF9A 4DLWA 5TXGA 3CRRA 2VSOA 4IDPA 2XTMA 4BEBA 1RJ9B 1UF9A 1VHTA 1O3YA 1ZAKA 4QL3A 4S35A 4YMUA 1M7BA 3IHWA 1S0UA 3PFIA 3A36A 3BFVA 3L2OB 5AUOB 1DS6A 4P3YA 2B8WA 3DKPA 2QE7A 5H8WA 1IAQA 2VSXA 1E2DA 4PO1A 3VHXA 2P6RA 1AJEA 3I8XA 1XCMA 5EE9A 1Q1ZA 3OESA 4BLQA 3U44B 4A0GA 1N6PA 2RKOA 3W6OA 4KITB 3FFAA 1E2QA 1MRSA 2NOAA 1CKEA 1BYIA 1UADA 4A0HA 3KJEA 1KO8A 4M53A 4D26A 4TZ6A 3ZIAD 3KUDA 2KBEA 3EG5A 4ESHA 4XVUA 3WMGA 1Z29A 2FFQA 3VR5A 1D2MA 5ELXA 4GFDA 3KQKA 4KU4A 1NF3A 3UG7A 2ANBA 4EAQA 3MD0A 4JKYA 4MA4A 4Q18A 3LWNA 1EX7A 2OCBA 1WQ1R 3B9QA 4JVSB 1FX0B 3HDTA 5AUNB 2Q9BA 5JZVA 1RIFA 2R6CA 3WNDA 1KSFX 1WRBA 4V0ME 5FTJA 2FV8A 1UEIA 5CM8B 3SYLA 4DCTA 4F7WA 1MRNA 4GP6A 3C16C 3O8RA 2WJIA 3RWMB 2SHKA 3LLMA 2F55A 1JPNA 3A8TA 4HLCA 1Z08A 2D2EA 2GZHA 4TTQA 2YNMA 4URVR 3OFNA 4LJ9A 1D8TA 4NCJA 1SXJC 4XTCS 3ZJYA 4KSBA 1IBRA 5HE8A 3QKSB 2FWRA 2IXEA 5J47A 2JATA 3AKCA 3AKDA 4F4JA 4M1TA 1RE0A 1GRNA 3T1QA 4UNRA 3PUVA 3K1JA 4MGYR 2JJ1A 3C8UA 2AD1A 4KLZA 3G5UA 1FMJA 5DI3A 5TARA 4QHSA 2ZJYA 1GNPA 3MWYW 1L4YA 1W5SA 4FXPA 1CRPA 1T3HA 4HAVA 1QF9A 2ZAOA 4G3XA 2Z5FA 2F9MA 2A5YB 1H8HD 2XSZD 2YHSA 5GVRA 3QEOA 1NVWQ 1WB9A 3GQBA 4S2EA 1DAEA 1YR6A 2FGJA 4IHQA 1YE8A 4B32A 4BFTA 3JVUA 3QE0A 3TAUA 3BB3A 4QM6A 5SZHB 3SQWA 1RRCA 3W34A 4MRPA 4LI0A 4YDSA 2CHQA 1JQJC 3R8CA 2RHDA 1F2UB 3O8CA 2CJWB 2PT7A 2WICA 1KI2A 2GEUA 2CNWA 3ZS8A 1DARA 4Q1FA 4ZDIA 1NN1A 2NQ2C 3E2IA 4IJMA 1W7AA 3UWOA 2RGDA 1JR3D 1SKYB 4JT4A 3TNFA 4MKIA 3TBKA 1RYHA 1RRPA 2ONKA 3H1TA 1R0WA 3REFA 4KYUA 1WCV1 1G8YA 2D7CA 1ZNYA 1UM8A 2FNAA 5E4FA 3V9PA 4DLTA 4M9QA 1Z0DA 3IEVA 4D2IA 2B7BA 2JIZA 3KDSE 4JL6A 5A0FA 1E32A 2GTPA 4NBSA 4PXAA 1OYWA 3SOPA 1KAGA 3UANA 4P32A 4XVQA 2ZXUA 5AR1A 1EFTA 1I4LD 4ZKDA 2JJ2D 1R0YA 4BPBA 1EX6A 1H8HA 1X3SA 2XSZA 3B13B 4ZCIA 1SXJD 5JECA 4RD2A 3SFZA 1K8RA 1S8FA 4KVAA 2QU8A 3LO5A 2W6JD 3GLHA 3EXAA 2F1IA 1YVDA 4Q4AA 1KSGA 1FUUA 2ZE5A 3EIQA 4YLGA 4EQ6A 2HEIA 5J5CA 1ZU4A 3FMIA 3TRFA 4Q9HA 4B35A 4G5SA 4Q1DA 4DT1A 1V5WA 2XTNA 1Q1BA 4G0NA 4TT3D 2GK7A 2PX0A 3HPRA 2GBLC 4RZXA 5C2JB 5JI3E 5CIQA 3KB1A 4M1WA 2VP6A 5KYKA 1U0LA 1SXJA 2WKRA 3BJIC 3Q3JB 4X8HA 3UXMA 3Q7QA 5CB6A 3FB4A 3H2YA 2NMVA 2ZR7A 4NYIQ 4V0MA 3WYAA 4LYJA 1IN4A 4Q5IA 4MKHA 1UFQA 1VPLA 3TGPA 3QJYA 1OH8A 1E2NA 3K0CA 4KLNA 2GXAA 4Q1AA 4JLDA 1U94A 2BEJA 3K0FA 4MUBA 1KZ7B 3NBZC 4LHYA 3P4XA 2Q9CA 2X8AA 1E1QD 1E2GA 4JIMA 2VP9A 3NDPA 3BC1A 3BORA 1NIPA 2ZRGA 4ZDKA 3KQHA 2J87A 1AKYA 4B75A 2AKAB 2IT1A 2H7VA 4LJ8A 3U44A 1NJFA 3X1YA 4BFZA 1QBKC 2JJ2A 3PXGA 2A2ZA 1F6BA 2IF2A 5G3ZA 3DKVA 4OQLA 4EPWA 4DB4A 4KFRA 4O3MA 5BYKA 2EW1A 1CJKC 3PUYA 2R44A 5H1YA 4P31A 5FPTA 4DLSA 2PMKA 2ZUCA 1MH1A 1R6BX 1ZUIA 1GL7A 2BEKA 2F43B 3SEAA 4DWJA 3AVWA 2BM1A 1QHXA 4KAXA 2GKSA 2IS2A 1ODFA 3B7GA 1PV4A 2D2FA 4B2LA 3SJAA 1M34E 1IXZA 4K8OA 3WMFA 3RC3A 1HY3A 3O8BA 2OLJA 3EZ9A 3K9GA 3OF5A 2AK2A 2V3CC 4P4UA 2CNWD 3C4JA 4KFTA 1HV8A 5BN3A 2ZR0A 3CPJB 1E2LA 1NN3A 3HWSA 3Q8XB 4LJ4A 4DRZA 2ZJZA 1M8PA 3QOFA 2PJRA 5GJBA 4LBYA 2E9SA 3BWDD 5FH9A 5BN5A 2OSBA 3THWA 5KDDA 3JZMA 2QM7A 1BOFA 3GD7A 4BFVA 5C18A 3FVQA 3AVXA 5L3QA 1IN7A 1XP8A 3EC1A 4M1SA 2G3YA 3NKVA 4DCVA 4BEJA 1Z0IA 1P2UA 1VG1A 5KHOC 4IVQA 2A5DA 4JKIA 5KNBA 4LX0A 3RANA 5G41A 4W7SA 3GPLA 4BLPA 1JB1A 3MAAC 4OQMA 1CF4A 1BO6A 1YR7A 4C0QC 1QHIA 4A8JC 4TT3A 5DH9A 2NGRA 3UMRA 2ORIA 4DLZA 1W4RA 3K8YA 3LLUA 1II0A 2OFWA 1N6LA 1U0JA 2AFHE 4NU0A 2PT5A 3THXB 2ORWA 2ZI3A 1OLOA 4A36A 3IKJA 1A4RA 1BS1A 1G9XA 1N6KA 1BMFD 4TYQA 3U7EB 5JJKA 2QP4A 1A2BA 3HU1A 2X77A 3NBFA 5FUYA 3B9PA 4OHYA 1DAHA 4ZDJA 2J0SA 1QVAA 3GJ6A 3KZ1E 4M9SA 4EJSA 4JYBA 3TLXA 4PQYA 4BZXA 5SZJA 2LCFA 2Q21A 4B2IA 1XTSA 1HE1C 4C9BA 5HZKA 1KNXA 3CH5A 4X8OA 1EG7A 2ZYWX 2RGEA 1YKSA 1LB1B 3ZQJA 2GILA 1LF5A 4HB3A 4BASA 2J46A 2PMDA 2G0NA 1J70A 1RFLA 2ZS9A 4LY6A 1IXRC 3U60B 2G6BA 3U3KA 1HTWA 1LS6A 4QGGA 1PUIA 5TY0A 1KI9A 221PA 3W5IA 5CK4A 4B3CA 5KUTA 3L0SA 1S1CA 3B82A 1KOFA 4WW0A 4B47A 1J8YF 5AUPB 2UZ3A 3CWZA 4Z8YA 2O52A 4C30A 1S3SA 1T5IA 1E9SA 2QAJA 2B8TA 4MYUA 5CDFA 3VX3A 1Z28A 5JI2E 2OE2A 2RGXA 2D7DA 5FI1B 1Z47A 4H1VA 1LF0A 3IBYA 3EZ7A 5DISB 3JVVA 5D3MB 3L82B 4LUCA 2IF0A 5DYGA 3AVQA 4FD2A 4GOJA 1Q0UA 2OCYC 1U8YA 2H18A 1O87A 4OHVA 3PEVA 4BUJA 4C0HA 3IPXA 2QA5A 1GSIA 3HR7A 2C95A 2AXNA 1QHSA 4A92A 3AP1A 4XWAA 3T5GA 2FE4A 1I4TD 4Q47A 4BZQA 3IHLA 3MWJA 3GLFA 2A5FA 2HT1A 2J3EA 3OE7A 1JEDA 1GL6A 2HT6A 2PL3A 4E03A 4PSVA 3FTQA 4PSAA 3T61A 1S1MA 2KBFA 3RLFA 4XWOA 4FI3C 3AKEA 2ZRNA 4M2LA 3AGPA 4R9UC 4TL6A 5AWFC 1XZQA 3B5JA 1KMHA 2PLRA 3A1TA 2O8DA 3DDCA 1C1YA 1NVVR 2A3RA 1GAJA 2QMHA 4FMBB 4LJ5A 2XB4A 4OJQA 4DCSA 1CR4A 2QAGA 3VKHA 4ZI3A 2EFDB 1LS1A 2OCPA 5GJWC 3KFXA 4L9SA 4U00A 3DHWC 3MSXA 1XCGB 5AJVB 2O5VA 2J9RA 4POAA 2WOOA 3PUZA 5FBRB 1FQJA 5GVSA 5JCZA 3RC8A 2GEVA 1US8B 3UPUA 2REXB 5KDLA 4NYMR 1CU1A 4M1KA 2KJQA 4I81A 1M74A 3LY5A 5FOWA 4DXAA 1RRFA 4DZZA 3QXXA 1JEEA 4EPTA 1MO5A 1HEIA 2DYKA 3ZIAA 1DAGA 1CS4C 5E7IA 5JEEA 4LJ6A 2WAXA 4NONA 2IL1A 1NRJB 5FL7A 2OBMA 2IS4A 2IUSA 4C0JA 1TEVA 2AKYA 821PA 1R8SA 3LA6A 4IRUB 2EQBA 1NP6A 3B60A 3CF6R 1GFIA 4LJAA 5EXPA 1YR8A 1A5TA 4OI4A 1QHHA 4I1UA 3B8HA 2BDTA 4M9XA 2O8CA 3W9YA 4Q00A 4JLVA 4KBGA 1S4QA 2QT1A 5HKKA 3VNUA 1VCNA 4JVMA 2OBLA 3V4RA 2JGNA 1QHHB 4GZMA 4EFLA 3GJ3A 1Y3AA 3MCAA 5FOXA 2J7PD 4BFYA 1OXUA 2PZEA 1OT3A 2F7SA 1XEXB 2RHMA 1ZC4A 3BH6A 3RRNA 3BXZA 5EJEA 4QJ4A 4PZZA 1E0JA 1Z2AA 1AM4D 3VU9B 1XWIA 4LC0A 4IFEA 5BQ5A 5C4MA 1G20E 3PEUA 1QHGA 1T5LA 2C03A 4QC2A 2QTHA 3QIAA 2OCAA 4QHYA 1MO3A 4HLUC 4L15A 1XD2B 2ATVA 1M6NA 4BLSA 1G4UR 2QMUA 3QQ5A 2BCGY 2ZRBA 1VDZA 3VHLB 1Z0KA 2WHXA 4FCTA 3V00A 3DMDA 4URXR 4TYYA 1NBMD 1P4SA 4QKQA 4HI0E 3FGNA 5F9FA 2VP4A 5B64A 4GMXA 3ZVRA 5IRCD 1D5CA 4TN1A 3HU3A 2J5XA 4PHFA 3CBQA 4DKXA 1NKTA 1Z0JA 4OHWA 2ZJ5A 4GT1A 4HLDA 2JASA 3LQQA 4ZV4A 1E3MA 3AVYA 5CJ2A 4I1VA 4IW3B 1YU9A 3MG9A 4LJYA 4NPHA 1XPOA 1LVGA 1E2MA 3NC1C 1GL9B 2OLKA 1KGDA 4DEYA 3EIEA 4TLCA 2C78A 2F3RA 4TTPA 3OIVA 4PPNA 2CK3A 2IYYA 4D4MA 4CDGA 1OB5A 4CEIB 1DVRA 2PX3A 3TSOA 1BMFA 2OT3B 3A1SA 4RD1A 1WE2A 2J45A 5CLQA 2ZRJA 4EJSB 3H0KA 2QT0A 2ZTSA 4I99A 1P3JA 3IBGA 1NLFA 3IQXA 3OEHA 3KKNA 3DEFA 3PR1A 3BOSA 4Q1CA 1G7TA 3HR8A 4B71A 2GVDC 1XD9A 3QPUA 2W83A 4NYJQ 1Q57A 2MMCA 5CYPA 4UXJA 4EPYA 4R98A 3CF2A 4IVRA 5IK2A 5J4VA 4QOSA 4XSHA 5KSPA 4DSTA 1W4CA 4CEHA 2XXAB 3WRXC 1KSHA 3K0FB 4HZIA 1IY2A 2J59A 2VEDA 4D25A 1NVXQ 4CF7A 3O8DA 4JLKA 3GMTA 4L8GA 1CEEA 4AWXA 1II9A 2Q3FA 1DEKA 3VR6A 3ZVNA 5CJPA 4V03A 3AGQA 3LX8A 2Q3MA 4B76A 2CL0X 1TU4A 2R62A 3AV0B 3B1VA 2JLSA 1SULA 2BV3A 4HZUA 3BK7A 3HYRA 3L43A 2QENA 4HUQA 1NNEA 2IS1A 4KXFB 3RWOA 4Q66C 2VYFA 1QVRA 4JBYA 5AJWA 1T6NA 4JBWA 3ASYA 1FX0A 3VR3A 4N0EA 1BIFA 2ZQ5A 4HZUB 4Q4LA 5KSYA 3W90A 3T1TA 2PZFA 4GP7A 5JBQA 1YZNA 1OW3B 4MRVA 2W0SA 3PUWA 3CX6A 3MWKA 4OK3A 1ZD1A 2ZRCA 4RZUA 4LRWA 5EP4A 4DDTA 3LV8A 1FW6A 4IOKA 2N46A 1N25A 1Z2CA 4V0KA 1Z06A 4P0TA 1WP9A 2XZPA 5KSZA 1M1YE 2Z6VA 1MABA 3CH4B 1GVNB 3KQLA 2OEPA 2X2FA 3M0EA 1T3LA 4GZLA 1EWQA 3QKSA 4B43A 1H8ED 2C9OA 2NIPA 4C3ZA 1OH5A 1IHUA 3QF4B 3DZ8A 3BGWA 4EPRA 4P4SA 3I92A 3IIMA 4FWIB 5BN4A 2WJGA 3IO5A 3PG5A 1KMHB 1ZU5A 4GNKA 4LYAA 4OQFA 2GJKA 4XOIA 3F8TA 4P4SB 3GP8A 1KI1A 3PUXA 4PHGA 3ETLA 2EU8A 4G5QA 4ITRC 5L3QB 4I1OA 5SZIA 1N0VC 3SNHA 2AD5A 4QXAA 3EX7C 4IEEA 1BKDR 1VYTA 2K5UA 3ECCA 2BBSA 3B2EA 1MT0A 1W5TA 2J0QA 1SVOA 3F3YA 5DYIA 3TE6A 1G21E 3T06B 5P21A 1IN6A 1T9HA 4R2HA 4FWTA 2G83A 3FOZA 1IXSB 1OH7A 1W36B 3N70A 1KKLA 3CNLA 721PA 1LY1A 2QNRA 2CMKA 3E5HA 2QPAA 5AK0A 4KO8A 1Z63A 1AK2A 2JLYA 1CJVC 3ZZ0A 3UG6A 3IIKA 5EUQB 4D82A 1ELOA 4KJZA 5B57C 2QSYA 4ARZA 1FZQA 4TL7A 2GCPA 2FH5B 2V7QA 4PR0A 3T12A 3WHLA 4K46A 1XDBA 1TX4B 2O0HA 1OXVA 2BJVA 5K8LA 1Z6GA 1P73A 3LVRE 4A0RA 3BB4A 3P1JA 2KE5A 3U5ZB 3SU8A 5DN6A 1KK3A 4DJTA 2J1LA 2DFKB 5TMPA 4M21A 4DCNA 5FUXA 1PLLA 1WBBA 4LHWA 4J0QA 3QXCA 4II7A 1W0JA 1ZVQA 1E9CA 2V6IA 4OL0A 4ACBA 2FX3A 4UXIA 4HDCA 4JSTA 3QBVA 4R71A 2OILA 3LRPA 2H16A 1E99A 5C1BA 4B3FX 1JR3A 4Q1EA 4MGIR 2OFOA 4Z1MD 3IIJA 2JLZA 4MYHA 4BQSA 1KHTA 5HZHA 4YXWA 1NLZA 1U8ZA 2BOVA 4AKIA 2ZU6A 4ACAA 2R8RA 2VL7A 3T15A 5F2EA 2DWOA 4LOAA 2DFTA 3GLGE 2QEQA 4DLXA 2WMOB 5FPSA 4RZ3A 1TTTA 2C9YA 4G5RA 1YZKA 2F1HA 3REGA 3T34A 1CR0A 5BW8A 3K0CC 1V43A 3AF4A 1NBMA 1GILA 1IM2A 3BIFA 3F5FA 3GLIA 3U7GA 1AS2A 2VHTA 2ZAMA 2GWHA 1X86B 4IDOA 5UKDA 3GFPA 1KDPA 3X2SA 2ZSBA 3QBTA 5FFMA 1T0HB 4IXMA 4EPXA 1SVLA 1GDDA 2ZM5A 1U81A 2WJVA 2ANCA 4O0MA 5DE3A 3RVBA 3ZVMA 1FMLA 4PANA 4TMZA 1F60A 5IT5A 1NJGA 4TMXA 5LDDC 2MSEB 2IX3A 3A1WA 3RSLA 3KL4A 1T91A 3D3QA 3NBYC 3QG5A 2RGAA 2X1VA 4JL5A 2ZUBA 3LBNA 4MDFA 3NBXX 3CRW1 1PZNA 4URYR 2J7PA 2ZRLA 3SI7A 2BC9A 1FP6A 3U3RA 1T8UA 2CL6X 4CW7A 1S9DA 4FN5A 2B21A 4NMMA 3GLFB 2YZ2A 3AP3A 3UMFA 4OK6A 5JLJA 2TMKA 3QKUA 4DBLC 2FFAA 3WYFA 1L2TA 1W0KD 3PQCA 3J81k 2EVWX 4HAUA 4KVGA 1E2IA 1P75A 4QJ5A 4DLYA 1NY5A 3I32A 4EFNA 1OPXA 2PEYA 3AVTA 4N0DA 3UATA 1ZM4A 1GITA 4B44A 2XOKA 1YZGA 2FEOA 4KI0A 3TKLA 3MGCA 1NMYA 2H1LA 5JWOA 4AKGA 1J8MF 3AB3A 5E7JA 2XJ9A 5DI9A 4AIIA 2CCGA 1ZBDA 2W58A 2BMJA 1CTQA 1HQYE 2IYTA 3AEZA 4V0NA 4D4KA 3K70B 1S2MA 2BVNA 2VHCA 1W4AA 2WSSD 4WZBE 1UBGA 2ECKA 2WSMA 5HCIA 1A7JA 4ASUA 2GXQA 3OZXA 5E3HA 2VRWA 3KJHA 5JS7A 421PA 2HLDA 1OHHD 3FFBA 3TH5A 4NZYA 5JHGB 1QG4A 4LBWA 2VO1A 1LNZA 3VKGA 1X8LA 2QBYA 5JJIA 1OFIA 1CLUA 3CO5A 121PA 1CXZA 1MOZA 1AS3A 2ZR9A 3QEJA 4GI7A 1KI8A 2W2TA 5EQTA 5M04A 2A9KA 3F0TA 2CK3D 4YMWA 4AKHA 1SVSA 3AUXA 1G5PA 1PJRA 1OV4A 2RB4A 4XH9B 3ZZTA 1JI0A 4DC9A 3QENA 1E9BA 4C0LA 2AR7A 5IF9A 3LH5A 2B7CA 3VR4A 1GOTA 4LYHA 3QY0A 1GKYA 4TLAA 2WAYA 5IDVA 1YZQA 3RRZA 1HA3A 1K5GA 4CGZA 4CT4B 3MUFA 1Z83A 1G5RA 2NO1A 1KJZA 5EZ6B 1TF7A 2VBCA 1VG0B 2J7KA 4US1R 2X19A 2GZDA 1EFRA 4DLUA 1KIMA 2VLIA 1KNQA 3U6KA 4WBSA 1ZP6A 2NO7A 4PZLA 4Y0VA 5HR5A 1HQCA 3A4LA 1E9AA 2QPOA 4W5WA 5K8UA 3L8ZA 3NHBA 4LSGA 4TMVA 3LAWA 2EYUA 3B6EA 4US0R 3X1ZA 5DHAA 2J41A 2JJ8A 2Y8EA 4CVNA 4UJ3A 2DR3A 1HE8B 3LFUA 3EZFA 2LKDA 3NEYA 2V55B 3BH7A 2CLDX 2I4IA 2FDCA 1KY3A 3EA0A 3HJNA 2ZROA 2IEYA 3TJZA 4JLOA 4DLVA 2ZIAA 1G3RA 1CRQA 3T35A 4UNNA 3LW7A 4IDHA 5AJYA 3ZS9A 3OFND 4AURA 2XB2A 2DHRA 3THOA 2RMKA 4N1AA 1UKZA 4D0NA 3M4YA 2IYXA 2IYZA 4NCKA 4TYWA 5EE5B 2FF7A 4B3BA 2IWRA 1E2JA 1P9NA 1YQTA 3K70D 1N6NA 4L4UA 4EJSC 2C98A 1XXHB 5FTKA 3TK1A 1D2EA 2CVHA 2HXSA 1QHYA 2FN4A 3KTAA 1CULC 3NWJA 3DM9B 4CEIA 3QKTA 5HE9A 3RS2A 1Z3IX 1IN5A 4PQFA 2O8BA 2ZJAA 5DNYB 3SJZA 1Z6XA 1ZW6A 3KTAB 3I5YA 1KK0A 1ZNXA 2X2EA 5J4HA 4NH0A 1VMAA 2HJVA 3ZYCA 1G6OA 1T0JB 1XX6A 2YKGA 1OJLA 3SJCA 3CRVA 5H68A 5EXXA 1RPZA 1U0HC 2GHIA 1E9EA 2QROA 1II8B 4D6PA 4DIEA 4CRWB 4D81A 2JLUA 2EWWA 2G1KA 1GRQA 1DAIA 1IJFA 1Z0FA 2WJJA 3GLHB 3QI2A 4JJKA 4B73A 2H57A 3BD9A 3LQRA 3Q7PA 2QP9X 4PC6A 2RGCA 2ODNA 3IQWA 1OIXA 4DT1B 3FHTA 1P2VA 2LWIA 3EPJA 1TEXA 2FSFA 2W2VA 3BFKA 2QORA 1HT1E 3IILA 3Q85A 1KJWA 2AHOA 2VF7A 4QBGB 1E2KA 2OAQ1 4RCZA 1C4OA 4PFSA 2YC4C 2OXRA 1N5KA 2ZSEA 4CEHB 2FU5C 1JAHA 3U3OA 1COWA 1FNNA 3N5CA 1W4BA 4QHTA 2FA9A 4OHXA 2HJGA 4URUR 4ZI2A 4EKDA 1LFDB 2J0UA 3WXMA 2R6FA 3QF7A 3CX8A 2KI5A 3Q5DA 2O8EB 4GPTA 2IYRA 4E5UA 4ZIRB 2J0UB 4MRSA 4OQXA 4HUQB 5HKKD 5DO9A 1DAFA 4WAUA 4DUGD 2GEDA 1JXOA 2NO9A 2OV2A 3IEUA 1A1VA 1XRJA 4A2WA 4DLRA 1AA9A 3U7HB 3QPVA 4UKDA 1CR1A 2GJAA 5IHPA 2VPPA 4YMTA 4LGMA 2GCNA
chains in the Genus database with same CATH superfamily
1UMCB 4AMGA 1L5SA 5BVHA 1UQUA 4NWIA 4H9GA 4J0FA 2E55A 3ZWQA 4AJOA 4TQ9A 2OENG 1X1DA 3A9UA 1TECE 1PT8A 3U4QA 1WBDA 5EXTA 4IX9A 3N8IA 1NI3A 2TYSB 3H5WA 3PQ3A 5BSEA 4Q9JA 3FAKA 1E96A 2O07A 5TQJA 4LXGA 1Z6YA 1PFUA 2XBMA 4E21A 2QQGA 3BUSA 5K3CA 2VWQA 2WJZB 2JVIA 4E7OA 1ZVKA 2EFEB 3KOXA 2JCXA 3W06A 1JWBB 5GM1A 3S27A 1J20A 1E2FA 2W43A 4NJEA 4X1KA 2REBA 1SHJA 4TWBA 2PUEA 1Z68A 3WP1B 3MBIA 3B1ZA 2YJ5A 4J2OA 5JROA 1KVQA 3PRYA 3BMNA 2WJWA 3HA7A 1GCOA 2FSHA 4H77A 5A03A 2I8LA 2JLQA 5LQDA 3FYTA 5E95A 4XQEA 1KVSA 4B6OA 1VL8A 3K4PA 2P30A 3ZDQA 3DWIA 5F98A 1I5EA 2XDYA 5ARBA 4DIFA 4MRRA 4K9KA 4FM9A 4KHPB 1I01A 2QL6A 4QODA 1G3UA 4MX8A 2CHUA 3DZJA 3HSKA 4HB4A 1DC4A 1KMIY 3QX9A 2F9LA 2BGKA 4RPLA 4W9MC 5K03A 5IVDA 521PA 3NHSA 1NVDA 3ZNNA 5JO0A 2W6ID 4UUPA 2XWJI 4MR8B 4ZOBA 3WP0A 3PC7A 3PYMA 1MJGA 5JNTA 1RHQA 1Q1NA 2H7CA 2HDNB 2ILTA 5I9LA 4PPYA 1HT2E 4D3XA 3IERA 3L0DA 1A82A 1PS9A 3OJ0A 3FVVA 2F43A 1ZC3A 4YAUA 2OXCA 2XOKD 1YBFA 4DRYA 3BERA 4IPTA 4L0CA 1OUMA 3N39C 4OLFA 2ZE8A 3V6LA 5F1PA 1SBHA 2ZBRA 1K7XB 2YYZA 3K3PA 4II2A 3FGOA 3HRKA 3LHFA 1F4PA 5B1HA 4I08A 5ICFA 4AY3A 3N1UA 4F11A 5KCZA 3B89A 4FK8A 4HFNA 4OXIA 3A37A 1I2MA 1P5JA 1QBGA 3WGLA 3WZ2A 4JI4B 3KXDA 3N2IA 3HHPA 3UMMA 2R9VA 2CJXA 3KVNA 4LGYA 1A9PA 5C31A 2IU4A 3VPSA 4Z51A 5FOSA 4DBLC 3HUTA 1T1IA 3TE7A 5KOHA 2Y77A 2ID8A 4FDLA 4MRMB 3WLMA 2IW3A 3JPWA 5T3UA 2XUAA 4REQB 4RPHA 1MHPA 1V7CA 3NAGA 1OWLA 3MJHA 3AR6A 4UTZA 4AXXA 2WDZA 3PSHA 4QG7A 1V39A 1I10A 2AQIA 3ZWXA 5CCEA 1C1XB 4GDFA 3TW4A 2DPLA 5BSRA 4YUWA 3P52A 2F8LA 1EK0A 4OLHA 4DA8A 1CF2O 5HMMA 3TIIA 4EMTA 3K96A 1SWWA 1WB6A 4ROSA 4DNPA 2G9UA 4CV1A 4YLYA 1PL7A 1YHZA 2CMHA 2XVMA 4IKEA 4KR2A 3T9EA 5TPWB 2H48A 1SQ6A 2WPDD 3H9JA 5AM2A 1GSOA 1RKBA 3VNBA 4LPSA 1LA2A 3ZNOA 1LW7A 1ZWKA 2BTQA 2JCYA 3B78A 3JPYA 3JZDA 4LDZA 1R0SA 3DP9A 2VJYA 3A58B 4XD2A 4CMEC 5CDSA 1R9JA 3G0OA 4NV1A 4YRNA 1JHZA 3GT0A 2A78A 4I4LA 4QO7A 3L4KA 1KORA 3R7WB 3SQNA 2RKWA 4OH7A 3NS7A 2Z2JA 3FIUA 3KXKA 5IWCA 5K3DA 3Q7IA 3DAPA 4Q7MB 4YRTA 2ZANA 5TE9A 1ISSA 2RI6A 2WC1A 4L7QA 4YMVA 3LCRA 5DHQA 1F1JA 5D51S 4O2AB 5B1IA 2PJDA 3KBBA 4HYYA 5FPKA 4BPRA 1NF8A 1XMIA 5HCUA 5KNDH 3RGGA 2FPMA 7MHTA 2VKQA 3A2LA 1I6WA 1PFWA 3GZTB 3JAKA 4KOAA 4F92B 3USES 2PZ8A 3RE1A 3L07A 3V6MA 2C83A 2PX5A 4IWNA 3KFVA 2YWBA 2F62A 1FFAA 2PUVA 2RAVA 3TKAA 5AVJA 3ZTWA 4LV8B 2DAPA 2I1QA 5LU9A 3RRMA 1W2HA 3BWEA 2E48A 4YCAA 2PU7A 3IULA 2MSWA 3IGFA 1L4KA 2PD4A 5E2BA 4A6XA 1A9ZA 1U6IA 1YUBA 2HIMA 1YVPA 5IK2D 2P4HX 1U80A 4W1PA 3VNSA 4ID3A 3P71T 1U65A 3QU7A 5BUQA 4F5WA 3A3YA 1N34B 3PD1A 4HAIA 1DCFA 3KQUA 2NSLA 4RZHA 4NABA 2QGZA 4RDIA 2W6IA 1NL3A 3BL5A 3F6PA 3GGPA 1SY7A 4RAOA 4KODA 4K40A 4K9RA 4OHZA 4LRXA 4DVJA 1QC5B 3VYVA 3ZUPA 2BP7B 4EY6A 1QIJA 1Q0QA 1QB7A 4Z7JA 4EYSA 5EIXA 3O21A 1TADA 1PFKA 3UHJA 2PUFA 2I87A 2JPDA 3PHBE 3E9ZA 2P65A 4YGYA 4EY3A 3AIMA 5JNWA 5FO0A 2DCMA 3ZCRA 2ZZMA 1K2WA 1Y0BA 4AJEA 5I48A 4LYFA 4LJ7A 1OFHA 5DXAA 4XD7D 3F4KA 2X3UA 3PYXA 2FUNB 5L4SA 2O6LA 5CVJA 2YBDA 1RAHA 4JLNA 2IUUA 1KZHA 3KQVA 1A9XA 1HOXA 1XU9A 3N6RA 5DHSA 1L8AA 3FFXA 4D8TA 3OEEA 4DSNA 1QQAA 4KWEA 2J0VA 3DAGA 3VZBA 5IJ0A 4OI1A 2QBYB 3K0KA 3ODGA 3EXHA 4LE2A 4YCBA 2FWJA 1KIAA 1Z6TA 2LGJA 2WJ4A 2X86A 3VR5H 3EQZA 4EM6A 1CJMA 1FJGB 2BLNA 4GXQA 4XW2A 2PMBA 5ALVA 3P9IA 1VHDA 1BTOA 1N6RA 4OIMA 1UMDA 2BGWA 3VTFA 4JLBA 1AO0A 3PFGA 3FI0A 3WLTA 3K71B 1B6TA 4IGAA 1GQFA 3FR7A 3I0ZA 3PSAA 4HDMA 1J6UA 5DLQC 3TLCA 3MCVA 5DVZA 2Z8YM 3G89A 2P9YA 3TLEA 4QLOA 1G1MA 4P54A 1QS0A 1GPWB 2FZ5A 1W5FA 4UHBA 5G1PA 4KBYA 3VR4H 1WY7A 1NLYA 2QRNA 3GZ4A 4H1UA 2DFNA 1U9IC 2ECPA 4AD8A 3OURA 4O4JF 2WVJA 1I7SB 1JDPA 4TTSA 4EJFA 3LX4A 4Q82A 4YXFA 1JHOA 2EQ5A 2FPLA 5FNZA 1AKNA 2FPRA 1F4VA 1UP7A 2QY9A 3BA1A 4ZALA 5K8JB 1SXQA 3VPCA 4DF3A 1X70A 3UGJA 5GAJA 1N32B 3OLCX 3F6EX 5L53A 1B1CA 1FNDA 2X42A 2JFPA 2PUAA 1J8VA 1GZDA 2YX1A 2XB8A 2IUTA 3EF1A 3HJTA 3HG7A 4XOUA 4HPWA 4UOQA 4ZXPA 3WWZA 2YWGA 1G3QA 4NZZA 3BMOA 4EK9A 4ZZIA 1VHJA 1Y98A 4BQRA 4JDPA 4I4TA 4GPIB 4M38A 4X8MA 3VC2A 3DR3A 3QUBA 4PVDA 4YQFA 1RMQA 3IUEA 4J1NA 3T7CA 1EM8A 3KQNA 5FOTA 4GAEA 2HV8A 1MB4A 1RW4A 4TM8A 4UAJA 1CDOA 3TOSA 1EE9A 1NDHA 2GEKA 2ZP1A 3JVIA 4B31A 3ESQA 3BMQA 4EH1A 2R00A 2FSVC 3DAFA 1BW9A 4W63A 1ABEA 2OY0A 3MB8A 4MUYA 5E4TA 1TPZA 4TKVA 4QXMA 4FMDB 2IKQA 1ETUA 3A10A 2YWFA 4TUYB 5ITVA 2E87A 2J5RA 4N3CA 1V25A 1EGMB 1YKFA 2XA1A 2QGNA 3AY3A 3NHAA 4AMYA 3C3XA 5K0ZA 1CJTC 5KTPA 3AKYA 5ES4B 3G0HA 1S96A 1SB9A 1F2TB 3DW3X 4ISCA 3G5TA 4K6OA 4D80A 2GAAA 2VIIA 1L3BA 3C6ZA 1PUXA 4WBNF 2EFCB 2P77A 1HYQA 4S1TA 5FD8A 1T8TA 2QM8A 3OOEA 4F3NA 2WJ6A 1FYEA 2G6TA 1T5SA 3E4CA 1E9RA 5A0TA 4DSAA 2O2SA 4X8LA 4WXYB 5IDQA 4Q05A 5ES3A 1DU4A 2XW6A 2RHOA 1JWAB 3VU9A 1D9ZA 2R7LA 3NBAA 4XM1A 5G53C 1WDKA 3UGQA 3ZJ4A 4KQWA 4U5QA 3UJ9A 4EUHA 4A2WA 5D3ZA 2L0XA 1YASA 5DDIP 1RWOA 3C1TA 1Y8CA 2FZ4A 1TJ3A 3WGGA 4IH4A 4ZCLA 4BCCA 4NJMB 3H8WA 4KUEA 1SOMA 2O1SA 4FI3F 2QT9A 4CDRA 3TG2A 4MTLA 2MYNA 3AEXA 1F0PA 5JVDB 2GRUA 1LPOA 4L3WA 3KKMA 3FUWA 2VHXA 4QAJA 1FSSA 3G3EA 2UVQA 4H3KB 3RS5A 2ZU0C 2XITA 4UAVA 2X8LA 2BFDB 3V1NA 1TZMA 2HSDA 3TO5A 1DRKA 1FDIA 4N4AA 2GKOA 2B98A 1OXMA 1ZCJA 5F77A 5TGZA 4ALJA 1BVUA 4C0KA 1JNYA 1HRDA 3W2EA 3PF9A 2ID9A 4LMPA 4P3KA 1PVOA 3IJEB 2QJTA 2QRZA 3LRTA 4R8VA 4G1BA 3TRHA 5KTYA 3WIUA 3D6TB 1HKUA 3ZDEA 2EOAA 1AKUA 1D2RA 3LP6A 4A6EA 1IUPA 5AHKA 2GF0A 1IU9A 2OG2A 3D6VA 1GRVA 4DUGA 3M6FA 4FGWA 1F3LA 1B15A 1YB5A 4BP9A 1FFHA 2YWEA 4OKSA 3FCXA 4Y7CA 1UIRA 3CLTC 2E1RA 4ZO9A 1L5ZA 3LWZA 5E6RA 1Q44A 1NRIA 1ICEA 1QV6A 2I8CA 3SKXA 4C05A 4JOQA 3VSBA 1P19A 2AFHA 3EXFA 3NP9A 4HP8A 4UTOA 5H9VA 5JXIA 5DCYA 3HRIA 4J3NA 4IXNA 3WG9A 3WMXA 1M7GA 1EB9A 1OVGA 1WF3A 2UZ1B 2DPHA 4AK9A 2WDPA 4IIBA 2Z6QA 2WUEA 1H9AA 4CIXA 2BMVA 5FBZA 2FWMX 2H2AA 2VC2B 1OZGA 5F33A 4NMHA 4YFYA 4R6XA 3ADCA 3H99A 1L8LA 3TGWA 4H16A 2Q5IA 1EJBA 1JFVA 1L8QA 1UBSB 2BELA 3K0AB 5KCMA 1P0CA 5LA6B 4YYEA 5D3KA 3I09A 2Z1NA 1SUFA 5BNZA 4O4LB 1U0TA 1TM4E 1WPRA 2CVQA 2H1SA 4HPJB 2P9HA 3RS0A 1SFRA 3W8FA 4BV8A 1T0UA 2QX9A 4L0MA 2MYPA 4JN6B 5C37A 3KJIA 3ZUGA 4DIKA 2B8JA 2B6HA 2VTBA 5LB4A 1RPTA 3FKJA 1HF3A 2C00A 2DFLA 3HZRA 4RVCA 2VPXA 1LCIA 2D5LA 1WNTA 1CS0B 2ONYA 1Q21A 3H1EA 3AP2A 2W93A 4R31A 1AZTA 2HCBA 1B6GA 5PGMA 4BLUA 4MDEA 2LD4A 1FSGA 2ID7A 3MAGA 1PQPA 4HBGA 1F0KA 5BNWA 5KQLA 1ZGGA 3DC7A 4MV9A 2MR5A 3C6BA 3K2EA 1WDWB 1HQDA 2AZ4A 3TX2A 3WLIA 3I64A 4GL4A 3BTVA 3GFVA 4RC9A 2DBZA 3WLNA 3OQOA 1LJ8A 1NFRA 3RT7A 3FY4A 4P5PA 3VR5D 4UD6A 4WNCA 1MO6A 2EATA 1M8KA 3DBIA 3WYGA 1P7CA 2C8KA 3OJWA 3ZI4A 1QHNA 4MUNA 4CQMA 5BVGA 4FC7A 5TV2A 2Q7DA 2CT8A 1KOJA 1NI5A 3DEJA 4CM9A 1G8SA 2ATIA 5A1JA 5HUQA 1HNZB 4ZEOA 1G8JA 3QW2A 2G4CA 1XWWA 1U2ZA 3KV1A 3V1TC 3LPLA 3ZK9A 2O3SA 4JYAB 1DUIA 3R7AA 1M76A 1XTQA 2YFYA 5M34A 3A70A 4AJ9A 3ILSA 3J80A 2Z98A 1JDSA 3EAQA 3M89A 1C3VA 4A10A 4I66A 4R1OA 5JJLA 1XBTA 2QSUA 3GL9A 1C8BA 3DEIA 5HG0A 4BRSA 3YASA 4WBNB 1XQWA 3Q6MA 5DSXA 5FDFA 4DMGA 5K0NA 3LBIA 1XXHA 4TLLB 3T1OA 4B80A 1PT5A 1B1AA 3HGTA 4B87A 2WJAA 2ZYIA 1GEEA 3ESBA 4MJXA 4OOEA 4WPGA 4YWJA 1W4LA 1K08A 1PG5A 3DDOA 1QOPB 3WRYA 1YKGA 1F4LA 2O3JA 4FJ0A 4DA7A 5DK6A 5JSUA 2O8DB 4B6GA 1EMDA 3OZCA 3GUVA 4EHLA 3ADBA 1NULA 4NE2A 4E70A 2AG6A 2H07A 3EF0A 3L41A 3D7SA 4ZVUA 1RXSA 2RI0A 5AW5A 3C4QA 2RJ3A 4Q4HB 4EI7A 5AVTA 4N5LA 1NXQA 2I03A 3U3DA 3UV3A 4FWBA 5HVNA 1TCVA 2VTKA 3PNSA 1WU7A 4DMCA 1P2SA 1NOKA 1E3LA 3S2EA 2ZUWA 1OA1A 2GT1A 1LD3A 2N75A 3DEKA 3FRHA 1KC3A 3IODA 4H7FA 4OU4A 4QDXA 3V7YA 4NCNA 4HVTA 1G8MA 2CBGA 4BP8A 3THXA 5JRDS 1LX7A 2IOYA 3EA5A 5J40A 1LDNA 1BJRE 1GKUB 1I0LA 2JBWA 2PBLA 3BEDA 3GHHA 1UDAA 5DNWA 1YE3A 2NO5A 1YHNA 3JQFC 5AMXA 3SBDA 2BFFA 3MPUA 4PC2A 4PQGA 3JQGA 2YV2A 5FP0A 4G8DA 2HSEA 3PNBA 1OTYA 1C1XA 1U2DA 3VAAA 1IBMB 5BUZA 5L3SA 1JDZA 5FADA 4G24A 2VYCA 3GN2A 3BREA 4NSNA 3RAEC 2PL9A 3CW8X 4MVJM 4ENTA 2O8BB 3IVXA 4X1IA 3DV0A 4ZYWA 3EOZA 3PFCA 3ASZA 1U1FA 4C0XA 4BIMA 4TZ0A 4PHHA 3EYWA 2L2QA 5LMCA 4O25A 5ADWA 3KLPX 1FDUA 5IJAA 2WSBA 1NBME 1TTQB 4CZ2A 4CIBA 4RVSA 1QE0A 3KPYA 4U6SA 1VE9A 3EIHA 1G4AE 3CUUA 4LWZA 1RYFA 3N8DA 3MRVA 2WNSA 2O8EA 2AGVA 3EHEA 1C2YA 5EWLA 1RRKA 2B61A 4FYIA 5K4AA 3PITA 3U1VA 4DHEA 5MFZA 3ECAA 4FQ7A 3S68A 3TOXA 1SIUA 2A86A 1XLTC 1L7VC 2VQ6A 2H2HA 2C54A 1XEXA 2NV2B 3GEPA 3Q2KA 2A1UA 4ZPXA 1E58A 1R0ZA 1JQ3A 3SDZA 5L8VA 1HWYA 1ZEJA 5I7RA 4KIGA 1MQAA 1MPXA 2AMYA 1NUTA 1Q6ZA 1JECA 1U7OA 4PO9A 5EZYB 4AYWA 5GINE 1T9KA 1Z7BA 3SIXA 1ZXXA 4KDCA 1D6JA 2SNIE 3GF4A 4WEQA 5FI3A 5LVAA 2G7MC 4XWWA 3UC5A 3ZYZA 1EUDB 5A3RA 3C6KA 4CFZA 1YO6A 1EVKA 1EYZA 1IEVA 4MB2A 4MRAA 3TJMA 4AQYB 4RKYA 4J0CA 3P9QA 4ER5A 4Z4HA 3K5HA 5KREA 4FYWA 4G8CA 4EUKA 2WKPA 3QBEA 2JRLA 5ECDA 5IM5A 4EBBA 3U61B 1UDWA 1AURA 1DXOA 3DE5X 4DAOA 2ONZA 2OO5A 2VHEA 3NXKA 3ZU2A 4BN0A 2WP8J 4DLPA 4KPGA 3P2KA 4QOIA 2IYSA 3OIYA 1ZUNB 5CNMA 2XX3A 4AZ3A 1UEXC 3KXIA 4YRBA 4D4LA 5C9ZA 1T34A 3WTBA 1ZKMA 4DEXA 2NZ2A 2DTDA 1YOVB 2HUPA 4HN4B 4NZNA 2BGNA 3AFNA 1NJ6A 3S7ZA 3WMEA 1E5VA 2OGTA 3BL6A 4NBNA 1JA0A 2A0YA 1XVIA 1VL2A 3BBPA 2I2FA 5CNKA 3KYDB 4GGPA 4A2PA 1DKNA 2QM3A 1N1DA 1P0PA 3C98A 4Y2HA 3OY7A 1ESDA 3QE2A 3M83A 2CV0A 5HTKA 2GM9A 1YJCA 3LDAA 3MGAA 4MV7A 3MTBA 4AN4A 3H3JA 1FRNA 3GO4A 1J8DA 3L46A 1FFDA 2YQ4A 2I65A 3D1VA 3MK31 3SC4A 4ALNA 1CZKA 4MGEA 5D01A 5KBYA 1D1PA 4H2DA 4RZ2A 1NONA 5IUKC 2QAGB 1RVDA 1BHJA 2P9BA 2QXUA 2FQWA 3AV3A 4JI6B 3RAJA 5AQ1A 2QUIA 4U3JA 2B8EA 6ADHA 3C85A 4F38A 2H65A 1GZ5A 2ODBA 4U6QA 4TRMA 3W7BA 3W8DA 5IU6A 2DXIA 3H05A 1Y3CE 4DZRA 2Q1WA 1OHHA 1PK9A 2KWIA 1BDBA 4Y9UA 3KSRA 3LF2A 3LQ1A 3O8LA 4GGOA 4BC0A 4EVQA 2QD5A 3HSYA 2WIAA 3P27A 4IHKA 5HRAA 2H4XA 1G18A 3AETB 3TEMA 1WETA 1RPAA 1EK2A 2PSEA 3DCYA 3L92A 5LA6F 1HORA 3OU6A 4MI3A 1U9ZA 3C74A 1KVUA 3PJFA 4ZU3A 3UK1A 3VH4A 3EGOA 3TSZA 5K09A 1ATZA 2PR7A 3ZCXA 1K9SA 1KEEA 3COJA 1ZL0A 2VCYA 3AEUB 3O26A 4QBIA 4RZIA 3K0EA 2WB4A 1A04A 2FHPA 3KLBA 4KPEC 2PE5A 3K20A 5KTTA 4L5CA 5K0JA 1GNSA 3TUJC 2VXOA 1P2DA 2C92A 5C8YB 2BGJA 3UJ6A 1T10A 2IXDA 3FHCB 4RD4A 1KJIA 5BSHA 3B36A 3EH1A 4XVRA 3BCHA 3LNCA 3BHJA 3SG0A 3HBMA 4RTOA 2VUIB 3I3SR 1NJ1A 4PLFA 5TF0A 3T3MB 4LDJA 4DV7B 1CJBA 4PAQA 1KTVA 3CFYA 3HMKA 4XTRA 1R4NB 3BEOA 4P4NA 2P3LA 3IBCA 4D1YA 2FFRA 2BE9A 3OETA 2POQX 3IPAA 2AG0A 4UXHA 1J1IA 2JBHA 3B6KA 4NBVA 4FYPA 1OYVA 2VTEA 1ZK2A 2FE1A 2ZI4A 1H93A 3BCUA 3LBAA 3RPEA 3VPGA 3R2JA 4DCGA 1KKMA 1MC8A 3RC1A 1W5EA 4MQBA 4E0BA 1RWWA 4L72A 3C3WA 5CB0A 1UBTS 1S3FA 1US8A 1OLSB 2YNMD 2V1XA 4YCLA 3WL3A 1LWNA 1M1YA 4RTLA 1ESEA 4XJVA 4KH1A 2XYGA 4XLZA 4ND3A 4D0RA 1CUAA 5K0BA 5CAEA 2PIDA 2MSLA 2DOKA 2FRDC 1X80A 4H4DA 5DBFA 5JBIA 4W5HA 2C0CA 1NR7A 2QTVA 4U7DA 1FB5A 1X19A 1XCLA 4X44A 1IXYA 3CJTA 2E1PA 4RQAA 1V11A 2VS1A 3BCRA 4HNQA 3V7FA 3GFOA 2AN1A 2V1UA 1O6BA 2EARA 1PF7E 4LN1A 3K53A 3THYA 1N5IA 3IAS1 4JYMA 1ZWLA 5JVDF 3ZCPA 2FPWA 2D8MA 2XT6A 3DMRA 4GLLA 4OAQA 3KQWA 5EUMA 5D3MA 1GP2A 1L5OA 1ODSA 3ZHRA 3LW8A 1X8JA 1EHCA 2JI8A 2DB3A 3OQJA 4Q3EA 5EPUA 2DY1A 5KWEA 2R48A 3WDMA 4MRNA 4ARUA 1GPDG 1DC3A 1MAUA 3MB5A 1GCIA 2J08A 3VOAA 2UYCA 1NY6A 1K8XB 3UMYA 3L1KA 2ECQA 1B41A 2FXVA 2P27A 3BWMA 5CLIA 3EPKA 3BXXA 2NSHA 5ALIA 1SURA 3ZG6A 3PC8A 1PYDA 1Y8RA 2VEOA 3CWCA 4WJLA 1LDGA 2MHCA 5AT1A 1RLTA 2D2XA 3PA6A 4X7BA 3TQHA 2F8MA 4W9NA 2J6BA 4HQLA 4ZAXA 3Q3VA 4B74A 2HRZA 2QQEA 3LFHA 1KTIA 3C15C 2ZRMA 4AX8A 4RFSB 4P2BA 1GQSA 1KOGA 2NUTB 2XCQA 5AI6A 4ER3A 4L73A 4O4IA 5FULA 3UXYA 1C3OA 1QFYA 2CUTA 2WPNA 4L27A 2NUAA 1P9RA 4GR5A 5AXDA 4W7IA 4C87A 2OUIA 2WFMA 3O6VA 5KJCA 5L3VA 2EX0A 1IBSA 1QO9A 1XXLA 1G9TA 4ZAFA 2QE6A 2WU0A 3UXEA 2HPZA 1M73E 1U7PA 4JJEA 3K9LA 3TPCA 3PCRB 5I4BA 4FSXA 1GGFA 2OYCA 1KDRA 3LOQA 1WUKS 1ZQ1A 2Q50A 1EHIA 3FGZA 3PV0A 4IMRA 2YRWA 1AUOA 3DOJA 3ER9A 4NKRA 3GFTA 2GZAA 1NW9B 2C9MA 3N0XA 4IWYA 4JELA 5EYPB 5LQAA 5JSKA 3SZMA 5AJXA 1TQ4A 1CETA 1RQPA 2C31A 3GNQA 4TS1A 4C0SA 1YJ5A 2GN2A 3QKRB 3RBAA 1U4OA 4HEJA 1DE0A 4A0FA 4B3IA 3R9WA 1E1MA 4FCCA 1UMBA 5LP6A 1KK2A 3G82C 2GUWA 1K2VN 2OM6A 2DM6A 2V7QD 2JH9A 3R9XA 1Z4JA 3AILA 3OE4A 1EDEA 3KAJA 4PNHA 1V5EA 2HDHA 1NX9A 3G68A 1YTUA 2XKJE 4G23A 3LCJA 4BVEA 5A0VA 2YV3A 2H08A 1JIKA 2O06A 3PZBA 4CM4B 4D6YA 1CY6A 4N3NA 1C7EA 3HPQA 4E07A 3EASA 3FMGA 3NXSA 3CUVA 4ZAZA 1E1CA 1H0HA 2P79A 1AN0A 1J2EA 1PVDA 1OBOA 1S9HA 3N7UA 4TTAA 4YAJA 4I4NA 2M6KA 3SHFA 4XYLA 1VPVA 5FNVB 4I0WB 4EYQA 1OD6A 1XZMA 3D4OA 1VB5A 2HF2A 5J47A 3TQCA 3VC7A 2GFQA 2Q8PA 2BI4A 4TGLA 3UC9A 3ANYB 5AJZA 2Q3HA 1AF7A 4WFIA 3U2QA 1SVMA 3A2NA 4I5EA 2E21A 2HK7A 2OVBA 3E9YA 3F73A 3KT3A 4EGSA 4E6PA 3DWFA 1M1NB 2IU6A 3V4FA 5A5EA 1WXFA 2QF7A 4Z7OB 1XYYA 4AMBA 3RS7A 1SRQA 1X7WB 1W9HA 4M37A 3HUDA 1LQUA 1C1DB 3GVHA 3MJ4A 3NLLA 4M7WA 4CNBA 5JEDA 3BCSA 1QOZA 5FLXA 4HLNA 1UK7A 1SRRA 2AFIB 1N6OA 1W46A 2B35A 3HVJA 4RJLA 4EELA 4EA8A 3ZHQA 1U7DA 1JFRA 2DT5A 1I4EB 2Z3ZA 2FP4B 2ZREA 1L5MA 2HMTA 5AESA 1MG0A 5AVSA 3CEHA 2PANA 2D74A 4JWTA 3I6YA 2Q2VA 1BMQA 1F8FA 2ILVA 2CYAA 3ZV5A 5K8IA 3HVRA 2BUCA 1EEHA 1T5DX 4R5MA 3E8XA 3FUVA 3U62A 1NAHA 3C3JA 3Q6NA 4QRHA 4YRMA 1WSAA 3W1EA 3L0CA 5LCXA 2HWKA 2Q1SA 3DTVB 3VU1A 4DYHA 5IYZA 4MQEA 2NZVG 1S6YA 3OZDA 3H2JA 4M9RA 1DBPA 2O2IA 4R16A 3CKLA 1NLMA 4Q4HA 3AJRA 2PCLA 3AK4A 3R0VA 4FJ1A 1X39A 1COWD 4GMKA 4JJ6A 5IDWA 3EQ9A 2QZ4A 3QEBZ 3ZHYA 4N9QA 3ILVA 3PL1A 4A8JB 5A62A 2TSYB 3LUBA 1PQUA 3DD1A 4QD3A 1E2EA 1P7ZA 3FUUA 5FUVA 3W3ZB 2ZI9A 3ZDZB 1PFQA 4U7PB 4AECA 4BFWA 3ICQB 3M4JA 3NTQA 3UPTA 2GXUA 1XAIA 1JMVA 2BGGA 4J0KA 1LLQA 4W9RA 3IPCA 1N2BA 4MWSA 2Q99A 1A4UA 2PJZA 3AYXB 3UJDA 1X1TA 2C61A 1BFKA 2IXFA 4NATA 4MAFA 5KPJA 3M6UA 4S04A 3NYIA 4AS2A 2C5FA 4P35A 4RS4A 2Q9AA 1HL3A 1YU6A 5CLJA 4KYTA 4Q3CA 2C9ZA 1J09A 1MJNA 1ZW1A 3BE4A 3RFCA 3U4DA 2COKA 2GCGA 4O2RA 5AKKA 2D1RA 3KOYA 2QDXA 4PG4A 3PWZA 5B7GA 1FNMA 5CEEA 5FB3A 2PV0A 3HB1A 1FYFA 1NYLA 1WZUA 5JXWA 2EERA 2GPYA 2I3BA 1PEKE 3RVKA 1EWVA 2ZUUA 1M6WA 3C70A 1MKYA 3C6MA 2MYTA 2Q3EA 4IZ6A 3EQ8A 4Y6RA 3P26A 4M0LA 4RVGA 3OZ7A 1OQAA 2RGBA 2IYOA 1YZTA 5EHIA 1EFUA 1T0BA 5JASA 1ZISA 2ZJ7A 2WF5A 2I4TA 3SR0A 4GH5A 4H7DA 4GNRA 4RVHA 4AMVA 3LTNC 1Z2NX 2QYSA 3LC0A 3H04A 7GPBA 1YQDA 2XH8A 5TB5A 1AUVA 5AI5A 6REQA 1QMGA 4B85A 3ZHBA 4L2IA 4H18A 1H2ZA 1TMYA 2BFFB 3PKIA 5AH0A 4BL5A 6PFKA 1Q22A 1PVVA 1AS0A 1G55A 1R5NA 2J9GA 2LP4Y 3F8WA 1VA4A 5DM1A 2I4LA 4UBMA 4MRMA 2HZBA 2HKIA 3VMFA 5JNLA 3QOWA 1LJUA 3ENKA 1V1MA 4PBSA 2WFLA 4MUMA 1LI7A 1RPNA 4BRWA 1FL9A 2GJ8A 4LA4A 1CNEA 2HQBA 3RTDA 4UTRA 2DUMA 4I4CA 1XF9A 3LC7O 4UDYX 3A4MA 2P68A 1JUDA 3B1YA 1O94C 3HA5A 1D2NA 2EIHA 3CE6A 4E5YA 3F6SA 3CSSA 3AUYA 1DRJA 1VSQA 3MOSA 2WF9A 2YJ6A 3HB0A 2I2WA 3ZX5A 3OPQA 4HMPA 2O3QA 5JBNA 3LUHA 3QEMA 1IZ0A 5KAPA 1HDCA 1SN7A 2YVAA 4Y1FA 4Q9IA 5DK4A 3AG5A 1UZMA 3G9ZA 4IVNA 5JS2A 3VSCA 3TZ6A 3E23A 3AMVA 3IDOA 4MQFA 1JA9A 3N8HA 3THRA 3CWQA 4RDCA 5CR9A 1ZMOA 1HYHA 3ZY4A 4ZK6A 2A9RA 4G07A 4B4OA 2V7UA 1U8FO 1JALA 1OSNA 3RHZA 3S4YA 3NGXA 3WXBA 1OXXK 1B42A 2EGGA 3Q41A 4I1YA 2QP3A 2GHTA 1R6VA 4IS3A 1ECLA 4XYGA 4CKEA 5BN3B 2YS7A 3OJEA 2BISA 1AXGA 1R8QA 2NUBA 1YQGA 1E3JA 2VJAA 4RDHA 4WA7A 2AJBA 2WKQA 1MZVA 4D5EA 4BGDA 3VR4D 2UYHA 3HJCA 1T4GA 1PDOA 1TF2A 4KREA 4NFLA 1XELA 3OD1A 1USVA 2AF4C 2GF9A 5B4TA 2IUEA 5KJ1A 1ZONA 3CJQA 1Z5NA 3DB2A 1M1NA 3HGMA 1UF9A 3O83A 1ZK1A 1PP4A 4MEBA 2LV8A 2PT9A 3SSAA 4YMUA 1S0UA 3L7CA 4BYMA 3A36A 3BFVA 5LP6F 2QQ5A 1Z4MA 2FN7A 3GGCA 4BY9E 1X7HA 3U9LA 2VHWA 4P3YA 1FRVA 2B8WA 2FQYA 3PLNA 4PO1A 1QH1A 2YXPX 3I8XA 2W6NA 3D0RA 1D3AA 1XCMA 5A7FA 4MW4A 3ZKWB 4BLQA 5AK5A 5DMHA 3U44B 3R3XA 3W6OA 4H4CA 4KITB 1MRSA 4U2FA 1BYIA 4FZVA 3KJEA 4TZ6A 4EG3A 3PHHA 3G2OA 3JCZA 1WG8A 1MMFB 4ESHA 1Z29A 1G2QA 3G2IA 5KVVA 2Q1TA 4LKRA 1NDUA 3RVMA 5IBQA 5ELXA 3LUKA 4GFDA 4K28A 3HZZA 3H5LA 1NX6A 2XDQA 3PUKA 4BXOB 5JJBA 2O8DA 3KSUA 4I4IA 4YCCA 2IVZA 4JKYA 1EX7A 4JVSB 1WQ1R 5JXHA 4QT0A 3HDTA 4LXXA 5JZVA 1EA5A 3K05A 2HA5A 4C4ZA 4V0ME 2XA9A 3GWGA 3ZDAA 1UEIA 2H1IA 2JFNA 1RI1A 1MRNA 2AG8A 10MHA 3DXZA 4BGUA 4N0PA 4GYKA 2CVOA 3A0RB 3RWMB 2P0YA 2SHKA 1LK0A 4IINA 5BWOA 2JJQA 4WL0A 4QSMA 3DZGA 4CQNA 4OXKA 1C1DA 2VDJA 3HH8A 1Z74A 2YNMA 3MNFA 5CHEA 3OFNA 4MYSA 5HQ3B 1SXJC 2BF4A 4XTCS 3EVAA 1IBRA 4YQYA 5HE8A 4O5AA 3OO1A 2ZIXB 1A5AB 2JATA 3QMWA 3GUZA 4FZJA 2YCBA 3AKDA 3AKCA 2BSQA 3IT0A 4M1TA 1PYGA 2E4YA 2ISQA 3DHNA 3HBJA 3K1JA 2G82A 3R24A 4KLZA 3DCJA 1FMJA 3IQHX 5TARA 3KV3O 3PTAA 3V8EA 5ALKA 2OTCA 3LRXA 4TOIA 2RD2A 2HGSA 3MWYW 3ROEA 1UBMS 1ZBQA 1INLA 1WHSB 2QVXX 3ZLTA 4EW6A 3LX6A 3EQ6A 4X1IB 3TQRA 5IN5A 1C29B 3T4EA 1ACLA 1CUZA 4XFKA 4BEWA 2SKDA 4G3XA 3E22A 5AI0A 5BN5B 1CNMA 1H2AS 1KA9H 1TCCA 3MN1A 3QEOA 3MA0A 2AW3A 4S2EA 1DAEA 4EGCB 4ALKA 2QY6A 2FTKE 2VRBA 4GOOD 4YRDA 5AIAA 4NU5A 3Q2OA 3RVDA 5JAMA 5AJHA 3ZI7A 3TAUA 4QM6A 2O4CA 1EFVA 1XK6A 2E4WA 2WZCA 5FO1A 3TFOA 1RRCA 4QRIA 1B8VA 1YJQA 2O2EA 2CHQA 2NXWA 1I7NA 1N7HA 3OTHA 4EHJA 4Y9TA 1USKA 2OB2A 3U26A 3CF4G 4DCOA 5B5SA 1UT8A 3AI2A 3RVQA 4J6FA 3O4JA 2K87A 1OAAA 4EHNA 1F5SA 3ZS8A 2CKMA 4TXHA 4TWRA 2ZULA 3ANMA 4ZDIA 4MULA 4RSHA 3HV0A 1R12A 1RQ7A 5F3RA 1GGHA 3T0FA 5B3LA 4F5DA 1O96B 2RGDA 4DANA 5KU7A 1ABBA 1IJBA 1SKYB 4MKIA 1X7DA 1R0WA 3DKRA 4BNHA 3A9TA 2RHRA 4ZO6A 2YJ4A 1AB5A 1HNWB 1RWXA 4FDMA 4BQNA 3OPXA 2JGEA 3FDJA 4I1PA 2PKCA 1QYXA 3I1JA 2NV0A 3VDRA 2WJ3A 4JL6A 2GTPA 3SF8B 2C2BA 4QQFA 4G2NA 3SOPA 1TT5B 3A9RA 1E8DA 2P2DA 4L02A 3ZD8A 2JGLA 5JSHA 4G56A 4P32A 4PGHA 2X0IA 3GROA 1PL0A 2ZXUA 4EO4A 3HVIA 3EIOA 3RODA 4CFYA 4JQCA 4KPFC 1B76A 4ZP1A 4ZKDA 2DFDA 1E6UA 2X40A 3FOAA 4BPBA 4IIJB 5JZMA 4UDNA 4ARAA 4AZ0B 4EG0A 4LHEA 4WADA 3SFZA 3WAKA 4MDFA 1FUYB 1JKXA 1K8RA 3MOGA 4KVAA 3LKZA 4DIOA 3LO5A 4OXQA 5ADUS 5A2QA 1P1KA 1TVKB 1YVDA 1PDVA 3I5AA 4Q4AA 1B6RA 3C8HA 5J5CA 1Q83A 3TRFA 4BUZA 2B4AA 3V4VB 1N78A 1FNBA 2WTXA 1YFZA 3ZHZA 3VO2A 1ZLXA 2VSNA 2IXBA 2QZZA 5DM0A 3ZHUA 5EC8A 3BG5A 1LSSA 3HPRA 1X1EA 2IZ5A 4LW8A 2XWQA 2G09A 3KETA 1UP6A 5C2JB 5JI3E 3RSHA 1QQ5A 2C2KA 5CIQA 2X7JA 3AU8A 1U0LA 1SXJA 1JQKA 2G04A 2WKRA 3BJIC 4L22A 3SBXA 3U31A 1K88A 3GA5A 3Q7QA 2H5JA 3H2YA 2VK1A 2ZR7A 3SCZA 5EGNA