1EFHA

Crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
281
Chain Sequence
DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SULT2A3, human hydroxysteroid sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYSTEROID SULFOTRANSFERASE
total genus 98
structure length 281
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1efhA00
1UF9A 3C15C 4PR0A 1E69A 5CDFA 5IK2A 4MRNA 2QRNA 3FDIA 2F7SA 2RHDA 4PX9A 1E94E 2H7VA 4NDZA 1GL9B 1XCMA 2FSIA 4MRVA 5CJ2A 1SVSA 3FWYA 4D4LA 4XTRA 3VR2A 1NY6A 1YZLA 2ZRIA 3CKLA 5J4YA 2ZRDA 1NIJA 4KFRA 4EJSC 1LS6A 3CH5A 2WKRA 2WWWA 5TARA 4QC2A 2DWPA 1Q20A 4HI0E 2NIPA 2QU8A 1D2EA 4MITA 3ZS9A 1KMQA 3I8XA 1P3JA 1AIPA 2FFQA 5HZKA 1ZD9A 2G83A 1KSHA 2JCSA 3LQRA 1KSJA 1G1MA 1PLLA 2LKCA 5FUVA 1FL9A 2EYQA 5DI9A 3QNUA 4Q1EA 4FMCF 4GL2A 1E2HA 1ZNZA 2ZEJA 1DVRA 4NKRA 4P4SB 4QGHA 3QI2A 4TLBA 3WRXC 4D81A 5CK4A 4TL6A 4EPWA 2V8OA 1AS3A 3U7GA 4C0QC 3OAAA 4TYPA 3BORA 1PVOA 2EFCB 4V0NA 1J7KA 3B1VA 5ANRB 1V43A 1JPJA 1JAIA 1XMVA 4HSEA 4HLUC 3NKVA 1NJFA 4NZYA 5KNBA 4JL5A 2JJ2A 4ZI3A 3DMDA 4ZI2A 3HDTA 5L8VA 1F3OA 1QF9A 1CXZA 2XSZD 1K6MA 3CPJB 4PQFA 5P21A 4RZUA 1N6KA 1YU9A 2ZYVX 4Q1AA 3X1YA 2JLYA 3LBIA 2ZIAA 1TPZA 2VO1A 1XXHE 2R8RA 1GIAA 5FTLA 2XEXA 4OQNA 5TB5A 1U98A 4IFBA 2A2ZA 4BFSA 1KKMA 2VH5R 2JLRA 4I1VA 1S96A 3TH5A 1PUIA 3A1SA 1E2QA 1G21E 3KQHA 2A5YB 4TLEA 3FKSA 2Q9BA 2VP6A 4Q4JA 2OBMA 1G3IA 1XEWX 2EVWX 1IM2A 1RJ9A 1XJCA 2G6BA 3GMTA 1QHHB 4OYHA 2FH5B 3ZDQA 2RGDA 2AX4A 3QXXA 4LDJA 2F9MA 3T15A 3X1XA 5JJIA 4Y0AA 1SKQA 5JECA 2ZI3A 1PV4A 4G5SA 1TQ2A 2QT0A 2ZJBA 5L3SA 1GZSA 2HLDD 4P4TA 2I4IA 2LKDA 2Z4SA 3BERA 4LBWA 3U6BA 1I2MA 3GEEA 1B23P 3FFBA 3MRSA 4XD7D 2H17A 4NCNA 3WMEA 1CR4A 4WZ6A 2XTNA 2ATXA 1ZU5A 2Q3MA 4JLVA 2C78A 1W5SA 2HF9A 1DAHA 2GXUA 1S3SA 4NP6A 4QGAA 3KKPA 4RZ3A 3VHXA 3K70C 1NNEA 4Q5IA 4Q4LA 1XD9A 5JWOA 5L3RA 3H4MA 4DEYA 5DN6D 2JDIA 4GNKA 1PLJA 4IDHA 5SZIA 1F48A 1CKEA 5IF9A 1HYQA 1GRQA 1Q1EA 3WXMA 2ZJZA 4HEJA 4NMMA 2GF9A 2CK3A 3MWLA 2AXPA 3GLGE 1E9RA 2HF8A 2YNMA 3EAQA 1SXJD 3CZPA 4CZ2A 1FZQA 2IT1A 3CO5A 4RSGA 2R6GA 3V00A 1DG1G 3CM0A 3THXA 4MYTA 1CULC 1E2DA 3ZZ0A 2ZRLA 1ONBA 3LXRA 4AG5A 2G88A 4GBMA 4OQFA 2QPTA 1CP2A 5FH9A 2WSSA 4YDSA 5UKDA 4JT4A 3S1AB 5F3WB 1AGRA 2W2XA 4Q4AA 3I61A 3WHLA 2GJ9A 1LS1A 4XD7A 4EPVA 3ZVMA 1XXHB 1IN6A 1GL7A 2ANBA 2GBLC 2GXAA 2DY1A 2Q3HA 2IYXA 4M21A 4TSFA 4Q18A 1VCIA 4Y0VA 3ZVRA 4PAOA 3CH4B 2GF0A 3RYTC 2IYSA 4CEHA 1DPFA 1E32A 4PHFA 2ZRKA 1BH2A 5DNYB 2FSFA 2WV9A 5CLLA 1E3MA 1NVUQ 1DAIA 3QKRA 3QXCA 4MUBA 5DO9A 4BRWA 3AUXA 3QKSA 4M0LA 1N5JA 3AP3A 2CK3D 4LYJA 3KTAA 3B13B 5HR5A 4OL0A 4B32A 5JRZA 2ZRJA 4MKHA 2ZJOA 2BVNA 3EIQA 3FKQA 4TLCA 1DAEA 3PEVA 3F0TA 1SHZA 3CLVA 4MGIR 3IKJA 1OIXA 1IOZA 3Q5DA 2VHUA 3H84A 4P4SA 4MYCA 3WYGA 3KJEA 3AVTA 4L4UA 3AF4A 4RD4A 4UKDA 2WSSD 3RNLA 4QXAA 3SJBA 2PX0A 2NG1A 1II8A 5DE3A 4HLCA 3L0PA 4IEIA 2AKYA 4V02A 1BYIA 1W44A 1YJ5A 4MUAA 4DBLC 1JXMA 2NQ2C 4TT3D 1W0KD 3TVTA 3EX7C 4M1KA 3I73A 2VHCA 2FPLA 4HZUA 4M9SA 2J41A 2JLUA 5TVKA 1VIAA 1MO4A 5A0FA 5SZJA 2DR3A 2NO9A 1XCPA 4ZPXA 1KIMA 2BBWA 4FMDB 4YMVA 3DKVA 3W8NA 5C1BA 3L8YA 3LV8A 3M1IA 4IOMA 4GFDA 5JFGA 3U3MA 3RVBA 3F8TA 3TMKA 1TL7C 5EXXA 2VEDA 3OE7D 5KDLA 3W6NA 4BZQA 3K9NA 4B35A 2Z0MA 2F3RA 4JLOA 2ONJA 3RS0A 1N0VC 3H2YA 1NI3A 1C9KA 2RGGA 1N0WA 3ICQB 5EE9A 1UPTA 2NPFA 3LDAA 1YZNA 2GDJA 1OKKA 2KE5A 4U00A 4C7OB 5JSZB 2QZ4A 1KI3A 1R5BA 5FOWA 2GCOB 3DEFA 2NO6A 3T35A 4HDCA 1T8TA 1SXJE 4I1OA 2TMKA 4UQOA 3R9IA 2L0XA 1OF1A 1WXQA 5E95A 1OH6A 2NPIA 2UKDA 1RRPA 4RFSB 4BFWA 3C5HA 1FX0B 1IAQA 2CLDX 1ZM3A 4B74A 1KZ7B 3NBFA 3PV0A 5DIFA 2HCBA 2D2FA 4ON9A 1JEEA 1OJLA 1XD2A 1FQKA 2GAAA 5G40A 3C16C 3WBKA 1G8PA 1NJGA 1HT2E 5CM9C 2EFHB 5KNCA 3MMPA 1JAHA 2FPMA 4DB2A 1J90A 1I4DD 3LD9A 5IHPA 2V3CC 3ZS8A 2RMKA 2WJGA 4BFUA 1CEEA 4Q4HA 2I1VB 5SZKB 1HY3A 5FBRB 2DPXA 1G17A 2C99A 3P20A 3QF4B 4PPQA 4QNMA 4DEXA 4AKHA 1RVDA 1G6HA 1OKKD 5KDOA 5KO2A 1YVDA 2RGXA 3M4YA 4DCNA 4C0AC 1EX6A 2YZ2A 2QAGA 1Q3HA 2WSMA 3VR1A 3ZZTA 3KX2A 2PL3A 4LWZA 2DFNA 2W0MA 3MLEA 3NEJA 4D80A 2GZAA 2QE7A 4FCTA 3RDPA 1OT3A 4P4UA 1UEIA 4RCZA 4NYMR 3EZ7A 4TMTA 1OSNA 1VECA 4RD0A 3RS5A 2R2AA 4JSTA 2CL6X 4MH0R 1OXUA 2O52A 4QRHA 1II9A 3FYHA 4DSTA 3QSYA 4CDGA 3WHKA 3EWSA 2C9YA 1ZAKA 3FKSD 3RS4A 4A8JB 2IX3A 2G77B 1N5IA 5CJPA 4YMWA 4HB4A 1OYYA 1CR2A 1ZNWA 4TQ9A 1IJEA 3D6TB 2BEJA 1CTQA 3PQCA 1T3LA 3K0EA 4PPGA 1A4RA 4YXWA 3AVVA 4AKEA 1MT0A 3LBHA 4LPSA 1DAFA 2IL1A 4I1UA 3K70B 3THWA 1J2JA 1XNJA 2GCOA 2O0HA 3MJRA 1VTKA 4MKIA 1UDWA 3AKEA 2PLRA 3C5CA 4DSUA 5JMTA 3N2EA 3CNLA 1KNQA 4F4CA 1HEIA 1UBEA 4M4SA 4GI7A 1KI6B 1XZPA 3TE6A 4OI4A 1CRPA 1HH4A 4BEBA 4OK3A 2D4HA 4Q01A 3VNVA 2GESA 2VSOA 1TNDA 5FI1B 1X6VA 2BC9A 3KFVA 2FEOA 3RRNA 4L16A 4Q7KA 4B2LA 3DMNA 2ZSDA 3BH7A 1W4AA 4ILEA 4WZBE 3K0FB 3O8DA 5C18A 1XD8A 3W3AA 4C0LA 1X8KA 2IXFA 2NZJA 1X86B 4LYFA 1W48A 1QZXA 1QHYA 2A30A 2XZOA 3C14C 5FL7A 1VIYA 3U44A 2F6RA 2VF8A 3NEYA 2DWOA 2REOA 1KI4A 3IBGA 1ZM4A 4RVCA 5HKKD 3L8ZA 2V7QA 2BCGY 4HUQA 4XVQA 4EIWA 1HQCA 1M7HA 3MG9A 4WXPA 2ANCA 1E96A 4IJMA 2ZRCA 3AGQA 4LHWA 1TADA 2Q21A 1KYIA 3DZ8A 4LSGA 2FF7A 2F43A 4TSFD 1MO3A 2RCNA 2WVJA 2ZE6A 4PC6A 2PZGA 4IDOA 2R6DA 4B3BA 4IW3B 1GUAA 2PJZA 5TXGA 4QHTA 5CK5A 2PH1A 4GPTA 3NIBA 4A0GA 1J70A 3I5YA 1AK2A 2FFAA 6Q21A 4LJ7A 3QVVA 4D0GA 3FHCB 5H1YA 4P33A 2XOKA 1ANKA 3CBQA 3GJ6A 4B48A 3ECCA 5BXQC 1ZMXA 2BMJA 1AS0A 1KK0A 4FINA 5AR1A 3QKUA 3KJIA 4FW9A 3GJ8A 1KJWA 4NU0A 4Q48A 5KU1A 1O3YA 4Q7LA 3K0AA 4C0SA 4LX0A 3AH8A 5DGXA 4ZKDA 3EARA 4FMDF 4NTZA 2MMGA 2OEPA 1WA5A 4PAMA 1HTWA 2AK2A 1QBKC 2WJVA 2GILA 4EAQA 1KOFA 3REGA 2ODNA 4YMTA 4DJTA 1G3QA 3LX5A 4BZXA 3TKLA 1QVAA 3K0FA 4TT3A 2IEYA 1Z2AA 2BMDA 1FOEB 5DHAA 4BECA 2J46A 4FIDA 3Q9LA 1P62B 3N70A 1AM4D 4LYAA 4BLPA 1MH1A 3NHBA 2XB4A 2ZSBA 3U3KA 2G1JA 3Q8XB 4GOKA 3RRZA 4MRPA 1NN3A 2P67A 3QVUA 4U02A 2FZ4A 2GCNA 3D7MA 4KCGA 1F2TA 4HB3A 2BJWA 3WBJA 2O8CB 2F55A 1GFIA 1AZSC 2PT7A 3E5HA 1OFUX 1FTNA 2AK3A 2JJ1D 1EFRD 1XMJA 4PHTA 3QPWA 3BRWD 2Z4RA 1D9XA 4D6PA 1BMFA 4XVUA 2HUPA 3THWB 4L8GA 1OB2A 4F93B 2ZUDA 5FBWB 4CVNA 1UEJA 2QSZA 4PZLA 3AV0B 1SQ5A 2FGKA 1GWNA 1NRJB 1VCOA 4BRUA 2OUKA 3SE0A 3HU3A 1KI6A 3PUWA 4JMPA 1DO0A 1G7TA 3PR1A 3U5ZB 1GG2A 1ZP6A 4PSKA 5BYJA 2YINC 3CB4A 2F3TA 5AWFC 1XTKA 2ZS8A 1W4CA 3GLGB 4LC0A 1XJ0A 4V03A 3KDSE 1CRQA 4DLRA 3U6KA 3W3ZB 5C4MA 3B1ZA 3P4XA 4JKYA 1UFQA 4ABYA 2CCKA 2CMKA 3DDCA 3I72A 3GJ5A 4RKEA 2ZI7A 2ZRNA 3NBYC 4DLVA 1JR3E 2J9RA 2QM8A 3SEAA 5J4KA 3WY9A 2ZRGA 3DM9B 4DDTA 2YC2C 1KAGA 1LTQA 4JLJA 4XTCS 1NVVQ 5JHHB 5DH9A 3KZ1E 4DSNA 1FW6A 5E3HA 2ZR9A 4NBSA 4KSBA 8OHMA 4PO1A 1A1VA 4ASUD 3KXIA 2A5GA 2X2EA 5CDFE 2FFHA 5JCPA 2B6HA 4F38A 4EPYA 1N6OA 3EPHA 2DFTA 4PC1A 2YHSA 4TQAA 3PJRA 3EZ2A 1VMAA 4M53A 5AUQA 4KODA 2GZDA 2YC4C 5J47A 2ODEA 1T8UA 2W2VA 4A6XA 2C9CA 3I5XA 2ORIA 2F43B 4KO8A 3UIEA 3CWZA 4A2QA 3PEWA 3AVWA 3QF7A 1S9DA 1AKEA 1N25A 2IC5A 4WIAA 5JI2E 4IRUB 1RRCA 4IOKA 1RYFA 4KBGA 4Q1DA 4RY2A 2OBNA 4A0RA 4XIGS 1FMLA 4OI0A 3T1TA 2C03A 4TMXA 2YYZA 1F2UB 2Q3FA 3AEZA 1TQ4A 4KLZA 4UNNA 1GITA 3A1VA 4XSGA 2FE4A 4LK2A 5FUYA 2ZU0C 4Q1CA 3OESA 1E0SA 1RRFA 3T06B 1VDZA 3IO5A 3SJZA 5FL7D 3V4RA 3WNDA 4DIEA 4EPTA 1FMJA 4F92B 4LJ4A 2QT1A 4B2PA 3DM5A 4Z1MD 3CR8A 3TIFA 4OBEA 1E98A 4Z54A 3CRRA 5IT5A 3FMOB 2QMHA 1FUUA 1RZ3A 4Q02A 4MRSA 3HP1A 4YDHB 4G0NA 5GJBA 2ZROA 2FX3A 3A4MA 2W6IA 4IDPA 2B8WA 2ZI6A 2P6RA 3NBXX 2VHJA 2D06A 4DZZA 3TBKA 1UJ2A 4QFMA 3O8BA 4ARZA 5TDHA 3GJ7A 3ZGXA 4TL8A 3QXSA 2PCJA 5IRCD 3TSWA 1KNXA 4BFXA 3I62A 3EZ9A 3KQKA 3BD9A 3UATA 4A8JC 1NMZA 4UNQA 3TLXA 3U61B 2GEUA 4DUGA 2GJSA 2JGNA 4V0KA 2MSEB 4IDQA 4DVGA 2PZFA 2ZJYA 1AQUA 1I2DA 4ZIRA 3O8RA 3SBEA 2VIIA 1U90A 4IOLA 2ZJ2A 3VR6A 1G8HA 3LLMA 3PG5A 3AVPA 3LY5A 2CNWA 4TL7A 4W9MC 5CB8A 3ZLJA 2IXGA 2X8AA 1YZKA 3MWKA 3L82B 3B2EA 4B76A 4WAUA 1TF2A 4O3MA 4LOAA 2ORWA 4URYR 3SQWA 2J87A 4LY6A 2EQBA 3IBYA 4LJ9A 1VG8A 3QKTA 1VYTA 4DLYA 4UJ5A 1NBMA 2CJWA 4HAVA 3T12A 3NDBB 3DOFA 1W1WA 2QAJA 5J5CA 1E9EA 2JEOA 2OCYC 1GKUB 2QTFA 1A5TA 4CW7A 3IIJA 1IXRC 1X8LA 1EFTA 3HR7A 3QE0A 2FFBA 2R6FA 3W90A 1E79A 4GZMA 4HAWA 1II8B 4R9UC 5JWRA 4PZZA 3CRMA 1X8JA 1KTVA 3KB2A 5EXSA 1J8YF 3GEHA 1IY0A 1XBTA 2UVQA 4DHEA 4QBIA 1C4OA 2E1RA 5DYIA 1N6IA 2GJKA 2W00A 3FPAA 4IHQA 2Q0HA 4LV8B 1U94A 1XXHA 5GJWC 1M2OB 4IVQA 4K46A 2D7DA 1MRNA 3KKOA 1G41A 5BQ5A 3VU9B 4C2UA 5JWHA 2JJ1A 2QAGC 1EFRA 2VP5A 1K8RA 4B3FX 5LD2C 5JJLA 2FSHA 1G19A 4QJ4A 5BW8A 4MGKR 3VMFA 3ND8A 2AHOA 1DAKA 3ZH9B 3BWDD 3HU2A 4NCHA 2O8BA 2W2TA 3B9PA 3GQBA 1P9WA 3BFKA 3QKSB 3QPUA 4GOJA 4OKSA 1ZM2A 3W6PA 5JBQA 1XB2A 3CX7A 5EE5B 4RJLA 2BM0A 3SBDA 2OCPA 5HPYB 1NBMD 1YZQA 3SQXA 2OAQ1 4EUNA 5JEEA 1N5LA 2IYVA 4L9WA 1E1RD 1FNMA 3FGNA 1E9FA 2P5TB 4A82A 1PZNA 4HLDA 1RJ9B 4EPXA 3OEHA 4FI3C 3QXHA 1Q44A 4PO8A 4RCYA 4TTRA 3TSZA 4A0FA 4EQ6B 4AYTA 1T91A 2HYIC 1RYHA 1QHXA 5FOVA 1Z6AA 1Z0AA 4TTPA 2GCPA 2XNSA 1IQPA 2AWNA 3AM1A 1GRRA 4M1TA 3AUYA 2D7CA 1R4AA 5AJYA 2V1UA 1R5OA 4LV6A 2ZYWX 3TSOA 2VL7A 1CS4C 1N5KA 3PITA 3OIWA 2NGRA 1NMYA 1L4YA 4HZUB 4AI6A 2XJ4A 5B64A 2RH5A 3UANA 1LNZA 1XJQA 2GK6A 2IYQA 4NCIA 3R7WA 3ADBA 4G1UC 5H70A 3TJZA 4CGZA 3NDPA 2G3YA 1WP9A 1R6BX 1KO5A 1XPOA 1XWIA 4DIDA 4D26A 1BS1A 1E9CA 3D8BA 3ONWA 4D25A 2Z43A 2AKAB 3VR5A 3PFIA 3SNHA 1XRJA 2CXXA 4QM7A 2VHQA 5DI3B 2WOJA 4ARZB 4M2LA 1GP2A 4LJYA 5EE3A 2QGZA 3MGCA 4FN5A 1SVKA 1QG4A 4GT1A 1K5GA 2R62A 1TQ6A 3BAFA 4Q7MB 4NH0A 4FWTA 2DFLA 4W7SA 2PJRA 2IA5A 4MQBA 4GP7A 1OB5A 1FFHA 3ZYCA 1IN4A 4AURA 4CYMA 2ZI9A 3SZRA 3PUZA 2WAYA 1ZD1A 4LV5B 4S2EA 4K8OA 2IUSA 3BB1A 5JRJA 2ORVA 3IILA 2PCLA 1MRSA 2YKGA 2AFIE 4GMDA 3DO6A 2ERYA 1SVWA 2F1IA 2HEIA 3TNFA 3MFYA 1Q3TA 1Q1ZA 2RB4A 4JS0A 1N0UA 4II7A 1ESNA 1UKEA 1K5DA 1IY1A 1GL6A 1ZC3A 1ZINA 3B7GA 2AN9A 1LFDB 2P6UA 2W6ID 3HPRA 3OIYA 2XTMA 2KSQA 3W9YA 4NPHA 4RZ2A 2RKOA 4KV9A 4UXIA 4PSVA 4LGMA 2WJJA 3UMSA 3WNBA 2JA1A 2J0VA 3KL4A 4EFMA 2OLJA 1KO7A 2ZETA 2C5LA 5FPTA 2Z5FA 2ZUCA 5JJKA 2D2EA 1OYWA 1Q22A 2C95A 2AWOA 4HLQB 4URXR 3WRYC 4AD8A 3GFTA 4H9GA 1E2LA 4LYHA 2ZYUX 4QM6A 4V0LA 2MMCA 4GDFA 3EIEA 1QHGA 2OXRA 4N1AA 3LFUA 2OO7A 4AYXA 1YHNA 3BIFA 4YXWD 5EP2A 2OM2A 4M1OA 3FOZA 2KI5A 1CBUA 2VF7A 4JT2A 4ACAA 2OZEA 2KBFA 4XJXA 3B85A 4TLDA 4Z1MA 5FUXA 3IHWA 3OAAD 3FHTA 3GJXC 4LHYA 1JBKA 1KI7A 4R98A 3RABA 1E9DA 1G5RA 1UKYA 1BKDR 2XNDD 4MDEA 2BMFA 1E79D 1W0JD 2FPKA 2XJ9A 1D8TA 2J3EA 4HUQB 4EQ6A 2QQ0A 3RWMB 2CVHA 2GBLA 2DCUA 4N0EA 5FR1A 1ZNXA 3WNCA 3SR0A 4B3DA 2WKQA 521PA 4A36A 2GXSA 4I4LA 5L3VA 2P5SA 4UNRA 2JLSA 3DPUA 2XZLA 2P6NA 4KHZA 1GAJA 3U3OA 4RD2A 4C30A 4G5RA 1IXZA 1VG1A 1Z3IX 1RC8A 2DYKA 1E9BA 1KDRA 3ZVLA 3U4QB 5HKKA 821PA 1YR6A 3GJ0A 3PEUA 4LCBA 4QBGB 1Z06A 3KKQA 4HAZA 1P61B 4IOJA 3EW9A 1C1YA 2PBRA 3UMFA 2JLZA 3U3JA 1DARA 4LJAA 3RAPR 3GLHA 1A2KC 4DCUA 1WB9A 2JLXA 4BEJA 5HTKA 1KMHA 2ZE7A 4YMSA 1NY5A 3ADDA 1JECA 1W47A 1Z0DA 1TMKA 4BLSA 2ZVPX 3CPHA 1KJYA 2X77A 3FFAA 1COWD 2YOFA 2C77A 2EWVA 2ASEA 2Q9CA 4CEHB 2C98A 721PA 1G6OA 1G18A 5HCNA 5L3QB 2PX3A 1KGDA 4U5XA 1NLYA 5AJWA 4OJQA 1GM5A 2R44A 4HYYA 2EFGA 1L2TA 1Z0JA 1TF7A 3I4LA 4ZO4A 1YR9A 3PUVA 4JLAA 2IXEA 4KFUA 2N46A 4N0DA 1UADA 3EG5A 4GZLA 2WPDA 5FTMA 2F1RA 4YQFA 1E2FA 2WBLC 3KJHA 5JHGB 3P1JA 4KYUA 3EC2A 4P0TA 1NVWQ 2O8CA 1UBFA 3GJ4A 3NC0C 3I92A 3LQQA 1EG7A 2CE2X 3A4NA 3JVVA 4DLUA 2D74A 1JNYA 3T5DA 2W58A 1ZNYA 4MKFA 3KXKA 4V0MA 3HR8A 1KSGA 4AWXA 1GKYA 2NO0A 1XCGB 5CM8B 1YQTA 3ADKA 1E2PA 1MO5A 2HXSA 4B34A 4TYNA 1VYVA 2IK8A 4G01B 2R9VA 1GNPA 4OJKA 3IGFA 3QBVA 2OESA 3ZJYA 1PJRA 1CJUC 4E09A 4I99A 1G291 4TMKA 3KKNA 2IUUA 3LO5A 3HYTA 2NO7A 1R7RA 2O0KA 4JVLA 4O25A 5D3MA 4ESVA 3U4QA 4X8HA 5TMPA 4ERNA 2BBSA 3K53A 2WPDD 1F60A 2YWHA 2QI9C 1XEFA 2OLKA 1HE8B 2QP9X 2UZIR 2OILA 3GLHB 1ESMA 2QL6A 1EFHA 2CL0X 3GLIB 3JVUA 3PUYA 1NSFA 2JLWA 2VP2A 2ZR7A 3T1OA 3F3YA 2QP3A 2A5DA 1YZUA 2IUTA 2IYLD 3SYNA 3THYA 3THOA 5FR2A 4OI1A 1Z6YA 2PEYA 1Z08A 1R5NA 4E5UA 3R8FA 2WWHA 3IDQA 5HCIA 1FPMA 1JXOA 4OHZA 1AJEA 4LPKA 4LI0A 2IF2A 4Q1BA 1ZM9A 1DS6A 1ETUA 3IPXA 1Z28A 1T9HA 2QTVB 2A7QA 1KZGB 3VQTA 1H8ED 2QN6A 5FPHA 1U81A 2CCGA 2ZANA 4ZDIA 3AQ4A 4OQMA 3GLGA 3O8CA 4LBYA 3W5IA 2YJTD 2W6JA 3BBPA 4PAQA 3EPJA 2H92A 4F4JA 1OIWA 5FOSA 4FMCB 3K9HA 1J8MF 3X1WA 4OHWA 1R10A 2DHRA 2CHVA 5IDVA 3ZIAA 2B7CA 5CITA 1MR3F 2KJQA 1E1QA 1Q21A 2RAPA 3FB4A 3VKWA 2ZTSA 2FV8A 4BASA 2KWIA 2P3SA 3VAAA 5BWMA 2GJAA 1AA9A 1FP6A 4DT1A 2GZHA 1BOFA 3NHAA 1TX4B 2FGJA 2OFOA 1P2SA 621PA 1P9NA 2V6JA 3KUCA 3B5JA 3E2IA 3NBZC 1S1CA 4C4PA 4NL4H 2XXAB 1E0KA 2J5XA 3GLFE 1ZUIA 2RGEA 2ZSFA 3P4YA 1KO8A 3P32A 3M0EA 4B43A 3MSXA 1SXJC 3GLIE 1D9ZA 4TL9A 3K0SA 1H8EA 1U99A 1D2MA 2REXB 3FMIA 5JLJA 1FP7A 1XEWY 4QG7A 4ZDWA 1KJZA 1NN5A 1NP6A 1NMXA 2AXNA 3AF2A 3OHMA 3CIOA 2YWFA 2WIAA 3HPQA 4QHSA 1G7SA 5DSZA 1Z22A 3BFVA 1JEDA 5LDDC 1W7AA 3QG1A 2CLCX 3CRQA 4JLKA 4NYJR 1KHTA 1DTSA 5FFMA 4CIDA 3ASZA 1B0UA 2ZJ5A 4B3GA 1Z6XA 5FOUA 1X3SA 2R6CA 1F2TB 4DWJA 3IIMA 3QJYA 1M7BA 3NH6A 1Z6GA 1H65A 5FBVB 4BGDA 2LWIA 4KFSA 3VX3A 1VHTA 1Z0KA 1ZRHA 4JLBA 1ZYUA 1DAGA 1W4BA 3EZFA 2V55B 1GTVA 1DG3A 4D0LB 1G3UA 3U7FB 4P31A 2HCJB 1R0ZA 2EU8A 5BN3A 1E6CA 2QY9A 1WRBA 3DHWC 5KHOC 2CE7A 4KU4A 1R8QA 1U8ZA 1GSIA 2WWIA 4IKEA 2JASA 3LVRE 2GRJA 2GXQA 2VLIA 4Q21A 2GA8A 1XPUA 2J59A 4NCKA 4DDWA 2PZEA 3QUSA 3R9XA 3UPUA 1Z0IA 2NO1A 2WTUA 4DLXA 4PPNA 3T1QA 4W5HA 1KK3A 2ERXA 3H1TA 2ATVA 4GMXA 4A2PA 4A2WA 4FCWA 1AN0A 1GRNA 1LV7A 4QOSA 4FMBB 1UKVY 3U2QA 1JB1A 3S1AA 3BGWA 3GEIA 4MRRA 4AC9A 4IVPA 4NONA 3SYKA 3E70C 3OFNA 4C0KA 5M04A 4YLGA 3CF6R 1LB1B 4X8LA 1G7RA 3W6OA 1TQDA 5GJCA 5EJEA 3HYRA 1FNNA 5B57C 1OPXA 3AB3A 4KBFA 3FE2A 4DC9A 5LD2B 1Z5ZA 1P2VA 1Z2CA 3B60A 1ZUNB 4JLNA 5BN5A 1S4QA 2HDNB 1E2JA 4Q9LA 4OHVA 1H8HD 2IS2A 2ZXUA 4WZAE 3NWJA 3TUZC 2GETA 3RS3A 1CF4A 2YOGA 3SYLA 2Y8EA 2AFHE 5GADl 2KB0A 2HT1A 4BZPA 1SULA 4TMWA 2O0JA 1PLKA 4O2LA 1SXJA 4TN1A 4XVRA 2ZE5A 3TW8B 1NL3A 2O8EB 4A0HA 1P2TA 3HJNA 5F9HA 4JYBA 1DE0A 2IBMA 3I32A 5FOXA 3C8UA 2AL7A 2VA8A 3B8HA 4DLSA 2GVZC 4UNSA 3Q85A 2WICA 1T0JB 1XTIA 1Q1BA 1A7JA 3Q5EA 1T0HB 4DXAA 4V0ME 3B1YA 4OHXA 4L5BA 2G0NA 2BJVA 3MCAA 3L0IB 1IHUA 4LRWA 5KSPA 2EWWA 4DLZA 2GKSA 4LC1A 4C9BA 4A9AA 5IK2D 3C7KA 4F91B 1ZBDA 4B6EA 5EP1A 4BQSA 3GD7A 4URUR 1I4TD 3R7WB 4E07A 4OK5A 4ZDJA 4XWOA 1QG2A 3CRW1 3VNUA 5KPDA 4CEIA 1E1RA 1LF0A 4BFYA 3ICEA 3E1SA 2IYTA 4B6FA 1DELA 5DYGA 2VP0A 1H8HA 3MWJA 2QM7A 3K9GA 4DB4A 4KVAA 1HA3A 2PT5A 3K1JA 5AUOB 3DL0A 3MUFA 3TR0A 3BC1A 3Q3JB 5KYKA 1EXMA 1ZIOA 2H5EA 1P60A 1XTRA 5J4HA 2K5UA 1NVVR 4C3ZA 3G0HA 2NZ8A 1KI2A 1FUKA 1XPRA 3TQCA 2B8TA 1LW7A 2OCAA 4HLUA 1GNQA 5KUTA 3I8SA 5C4GB 4PO9A 4JL6A 2RHMA 5AJVB 4DDUA 3R9WA 3SDZA 1U0HC 1ZUHA 1ZCBA 3EA0A 2ZRHA 4JIMA 4KI0A 4AK9A 4R2HA 4LJ8A 2JJ8A 2WMOB 1QHNA 4KITB 2XITA 2P65A 1Z29A 3ND9A 3WP0A 4B44A 1HV8A 3T34A 4CT5A 4IXNA 4HAUA 1W0KA 5KOYA 4RFSA 4Q19A 1G5PA 1UM8A 1FX0A 3O47A 4H1UA 4M22A 4HUTA 4MYHA 5CLQA 5G41A 2ZS9A 5J4VA 1EFCA 1SXJB 2C9OA 1SKYE 1Z83A 3QBTA 3AVUA 1Z6TA 4XOIA 3GPLA 3JZMA 4G5OA 3KUDA 3RS2A 2CHGA 5F9FA 3B1WA 1MKYA 1XD2B 3IQWA 1GOTA 3TAHA 1DOAA 5LPNA 3CX8A 3DVLA 4D4MA 1KI9A 5D3QA 5TY0A 1MABB 2BWJA 4J0QA 2RGAA 3N2IA 2BKEA 2V9PA 3A36A 3PUXA 4HB0A 5FBQB 2HJGA 2ZQ5A 2N1BA 1WMSA 1IN8A 3TRFA 2EFDB 5K8LA 4IXMA 5AUPB 4PTLA 1D2NA 2W6JD 4DKXA 2J7KA 4AIIA 5DHFA 3ZQ6A 4JJZA 2GNOA 4R7ZA 1G7CA 1NLZA 2C04A 1GKIA 5JS7A 3SOPA 3FMFA 3QOFA 2QAGB 2C2HA 3GLFA 4R71A 4GSYA 2VHTA 1QHIA 4XSHA 3EZ6A 1RIFA 3VKGA 2GEVA 3HWSA 3K9LA 3RWOA 3PIRA 5HE9A 4B3CA 3QQ5A 1JI0A 1NSTA 3W8RA 3A1WA 2O8BB 4MKGA 2RGNC 2WMNB 3PVSA 3K70D 2HXYA 2IHYA 2FA9A 2B7BA 3GJ3A 3NH9A 1W36D 1LF5A 2G1KA 1T5LA 1M34E 4RD1A 4B47A 2O8EA 2VTKA 4JZKA 2ODWA 2QMOA 1KKLA 2JATA 1E0JA 4Q66C 5DISB 4CEJB 3KB1A 5B30A 1IONA 1KO1A 1BO6A 1CJVC 1R0XA 4BFVA 2AD1A 1YKSA 5FPYA 1EX7A 2JLQA 2QENA 4OI2A 4WBSA 2QMUA 1T3SA 5CIQA 1OFTA 5EUQB 2MSDB 5G53C 1M7GA 2A5FA 1J99A 3LH5A 1TU3A 1M8PA 5CYPA 4IFEA 4NYMQ 5AJXA 1YE8A 4UXHA 3N5CA 3B78A 1ZM7A 4PANA 5FTNA 4TLAA 5A4JA 2B92A 3LVQE 1RFLA 3IPYA 5EQTA 1XZQA 4KLNA 3LRPA 2JDID 4MDFA 5CB6A 2I3BA 2J7PA 3UWKA 3M6AA 1OV4A 5EE0A 3A4LA 1LVGA 4ZCLA 4G5QA 4TYWA 1MOZA 1VPLA 3ZD7A 3KJGA 5FTJA 1S2MA 5AJZA 3RRYA 5CYOA 3SHWA 3TUJC 4QJ5A 3RSOA 2OCBA 1S0UA 2FDCA 4Q4AB 4Q9HA 1P9RA 4LHZA 4TWZA 1CLUA 5EZ6B 1JALA 1EK0A 1KAOA 2YWEA 1QDEA 3VX4A 2CVFA 1U8YA 5FTKA 3V4FA 2OHFA 1JR3D 4NYIR 4O2RA 2OFWA 3SJAA 1E0AA 2UZ3A 4A1FA 1A2BA 3WMFA 4B75A 2OFXA 4E03A 2QA5A 3NG1A 4OK6A 4LBZA 1IN5A 4DSOA 3LW7A 2CJWB 2ZRAA 3TQFA 4YMUA 1COWA 5FPSA 2IYRA 1QVRA 1OXSC 1TTTA 1G8GA 2H16A 2QROA 1CR0A 2JAQA 1E2EA 3WP1B 4AG6A 2AD5A 4ZV4A 3RRMA 4A6PA 1UAAA 1I4LD 2VPPA 4RFVA 2BM1A 4BWYA 3RHFA 4QNRA 4YC7A 5K8TA 1SVMA 1JJVA 4W5JA 2ECKA 1XTSA 4PXAA 2G0TA 2FMXA 2VSFA 1KDPA 2ZAMA 1KMHB 1XMIA 2CNWD 1E2NA 3TK1A 1OW3B 3B9QA 1TEVA 2ZPTX 2HT6A 1R0YA 4JLDA 5DLQC 3VU9A 1TAGA 2BIFA 4M1SA 1XF9A 3K09C 4IEEA 3FHOA 2QG6A 3FVQA 4HDOB 5L3QA 5FBLB 1OLOA 4EJSB 2REBA 1JR3A 4QKQA 3CPEA 2BKUA 4ACBA 2XZPA 1CJKC 3MAAC 3UK6A 4DLWA 4EDHA 3CNOA 2FOLA 1YR7A 1XTQA 2XXAA 3U7HB 2KBEA 4JBWA 1P4SA 3VR4A 3EASA 5JZVA 2ZREA 1HUQA 2DB3A 3VKHA 3NXSA 2VSXA 3KQUA 1CU1A 1BIFA 1KDOA 5GVSA 5LB4A 4RZXA 2ZAOA 4WXRA 3EPKA 1E9SA 1R2QA 3Q72A 1P5ZB 2BCJQ 2O8DB 5GJVC 3ZZUA 2RGNA 5G3ZA 4BFZA 1ZIPA 4FD2A 1VCNA 4TYQA 2DWQA 4M1YA 1U8AA 3AVYA 1UKZA 4UJ3A 2WJIA 1AKYA 4D4KA 3OE7A 3NTUA 4N3NA 1W36B 1NVXQ 2QNRA 3VHLB 1HT1E 3Q7PA 1S8FA 4PZYA 2CHQA 4QBFA 2QRZA 5C2JB 4JLPA 1P2UA 4Q7JB 1XEXB 4KJZA 4PC2A 2O8FA 4X8OA 2GJ8A 1XU4A 3CZQA 4KVGA 4NYIQ 1IXSB 1IN7A 5HZHA 4M9XA 1W4RA 1FTSA 2BV3A 2VP9A 5DI3A 3KQNA 2ZI4A 1NKTA 4BLRA 1YZTA 3WYAA 3H0KA 1KO4A 1VCMA 2VQSA 3AKYA 2YV5A 4BLTA 2IWRA 4HDQB 4PHHA 3T61A 1R0WA 4DDVA 1G8YA 2VYFA 2X2FA 2ZJ8A 1U0JA 3BK7A 3UMRA 4AYWA 1AZTA 3OEED 1UDXA 4DT1B 3MD0A 1US8B 4GOXA 5EZ5A 3THYB 1SZPA 2GHIA 4O0MA 4Q9KA 3J81k 2RGBA 1MO6A 3AF0A 4TYYA 1ZD8A 2J0SA 3QF4A 5EUMA 4KYIB 3FTQA 1U0LA 2OT3B 2H1LA 3LA6A 1L8QA 1JPNA 1II0A 1OE0A 3LBNA 4PSAA 3ZIAD 2JJ2D 1AS2A 3JZAA 1KDTA 3BE4A 1KI1A 4EKDA 1VG0B 2P2LA 2W83A 1E2IA 3OIUA 4Q47A 1KI8A 2OBLA 1Q1QA 3GFOA 4BFTA 1RPZA 4US2R 1ZU4A 2IS6A 1N6PA 2XSZA 3PENA 221PA 3BFXA 1WF3A 2QTHA 1VYUA 2GEDA 2OV2A 3P26A 1SVOA 2J7PD 4QL3A 5TV2A 1NBME 1F2UA 4FXPA 2FN4A 1W2GA 5JS8A 4JVSB 1HQYE 3C41J 5J40A 2RGCA 2YOHA 4QGGA 4TZ6A 2PLFA 2WKPA 3CR7A 1S9HA 3GCGA 4XWKA 121PA 1W5TA 1M6NA 3CRVA 4RD6A 2BBOA 3OZXA 4Q9IA 1Q12A 1CJTC 4Q9JA 2IEZA 4Q1FA 1XEXA 2ODBA 4TMZA 2F9LA 2O8FB 1UBCA 1WBDA 1E2GA 3KXLA 4CEIB 1XFAA 2V6IA 1OXTA 3CUEF 3CX6A 3K09A 3KQLA 4D82A 1NN0A 2HLDA 4QGFA 3BB4A 3AF1A 3I1FA 1OH7A 1X1SA 1W46A 1KY3A 1YR8A 2HJVA 1NG1A 5GVRA 3CONA 2GK7A 4Q03A 3KFXA 5D3MB 3A58B 2ZYTX 2QBYA 1T3HA 4P32A 5LB2A 3SC3A 3VFDA 3RLFA 1TU4A 1TF5A 2C8VA 3DKPA 1T6NA 3KKMA 2YWGA 4CT4B 4B33A 5B2ZA 2VRWA 2R6AA 4M9QA 5FI0B 3GP8A 3AP1A 3D31A 1S3GA 2A5JA 3AKDA 4KFTA 3GLIA 4GRAA 1A82A 2Z6VA 1JJ7A 4IDNA 2ZRBA 2XOKD 5G3YA 2FWRA 3BJIC 4V0OA 3VR3A 2CDNA 3CWQA 1WDTA 4OQLA 3SU8A 4A4DA 4S35A 1Z0FA 2H18A 3RC8A 5FOTA 1Z63A 2XB2A 4WA7A 3WYFA 1W36C 2ZRMA 1E2KA 1T5IA 1ZVQA 2FNAA 3C4JA 1P6XA 3CNNA 4PC3A 3QKRB 4HAYA 2BOVA 3OFND 1G4AE 3G82C 1M1YE 2NMVA 3KTAB 4BPBA 1EWQA 2IHBA 2X1VA 2F1HA 3ADCA 2V7QD 3ZVNA 1QRAA 4E22A 2VBCA 4Z8XA 1JQJC 1EWRA 2ZVQX 3OEHD 5K8UA 3ETLA 1OH8A 1S1MA 2QSYA 1ZC4A 2WAXA 4X8MA 1SKYB 1HE1C 1OH5A 3IEVA 3EXAA 2I1QA 4JVMA 4OQXA 2FZLA 3AVOA 3OIVA 5JCZA 1OHHA 4JJKA 3AVXA 4NYJQ 2MSCB 4TZ0A 3CF0A 1XTJA 1YRAA 1DAMA 3L0OA 3W5JA 4Q00A 3SI7A 3B6EA 4LJ6A 2GTPA 4K81B 4URVR 1V5WA 3A1TA 3FMPB 5CIWA 2SHKA 4LBVA 3NVAA 3EA5A 3MJHA 3Q7QA 3IUYA 1U2RA 2J0UB 3QIAA 4DRZA 1ZCAA 3U7EB 1SVLA 2BDTA 2IYZA 1G16A 1G3MA 3BOSA 5E7MA 3I3SR 2AR7A 4L9SA 2GWHA 4PPFA 4AKGA 2ZI5A 4RKFA 2G9NA 4Q4JB 1OFHA 4H1VA 3HU1A 2ZUBA 5E7IA 4JSYA 2CL7X 1VKJA 2XTZA 3U3RA 3BXZA 4AY2A 2FU5C 1G64A 1O87A 2V4ZA 4JBYA 1W2HA 2D62A 2QMEA 4CF7A 3DOEA 1XMSA 3W34A 4DCVA 2N42A 4FWIB 3WMGA 4IVRA 3TW4A 1XP8A 1OXXK 1L4UA 3UWOA 3UXMA 1IBRA 4JLMA 1NG9A 3OEEA 4QBHA 4URWR 3EIHA 3IQXA 3GFPA 4XWAA 1RE0A 3TUIC 2JIZA 3F5FA 2ZSAA 1X1RA 3LAWA 4LZZA 1Y3AA 5F2EA 4C0BA 4M8NE 2PEZA 5C46F 3A6PC 2OE2A 3IO3A 4WW0A 1CR1A 3B1XA 1ZJ6A 4ITRC 5F98A 3PEYA 5KSZA 3CF2A 5KSYA 1KSFX 5JEDA 3QG5A 1JQLB 3BB3A 1E4VA 4KSCA 1VHLA 3THXB 1N6NA 2W0SA 1Y63A 3V9PA 2GVDC 2IS1A 5LBIA 1E4YA 2QBYB 5HE8A 1DEKA 1U9IC 2NOAA 4B73A 3A1UA 2ZJAA 3H86A 4R2IA 4JL8A 1Z8FA 1RRGA 1TUIA 3PXGA 1G5TA 4Q4HB 1EGAA 2WWGA 4B71A 4U7DA 1LY1A 4JBXA 4JVNA 1XDBA 2CEAA 3GLFB 3DZDA 5KDDA 4RD3A 4LHXA 4C0HA 3A37A 2V54A 1D5CA 3UKDA 4W5WA 2J0QA 4M9ZA 1P73A 2IYWA 4PQRA 4G5GA 2E9SA 2PMDA 2ZM5A 5KSOA 1JR6A 3AF3A 5JSZA 2EW1A 3EC1A 2B21A 2HV8A 4F4IA 4B2IA 3QPVA 5FPKA 4US1R 1TUEA 3BS4A 3SFZA 3EPLA 5A5GA 2ZITA 4MA4A 4WVFA 5H68A 4ASUA 2LCFA 5J4LA 1WQ1R 1RKBA 3TAUA 1AQYA 3K8YA 4ESHA 4A15A 2PMKA 2QPOA 4C2TA 4PFSA 5KTYA 4A8JA 3BH0A 1MABA 1W0JA 1SVIA 2XX3A 3QENA 4HATA 5AK0A 4TMVA 2NTYC 1ELOA 2WHXA 2Q6TA 2IYUA 1DBSA 4DUGD 2ZS7A 3D3QA 3U60B 1F6BA 4BLQA 2QE7D 4DCTA 2WWYA 2E87A 4WOPA 3G5UA 3IHLA 3QEOA 4EJSA 4ZCMA 4L15A 2IS4A 2IWHA 4MGZR 1DADA 2J0UA 2VP4A 1P7CA 2BMEA 5EP4A 1NIPA 1N6LA 1RW4A 2EFEB 3X1ZA 1NN1A 4B3XA 3IEUA 3BH6A 2ZU6A 5K8IA 2CCJA 3AKCA 2BHRA 2QP4A 4BE7B 2IF0A 4OHYA 2ZRFA 1BYUA 3SFVA 1KK2A 2R65A 3SS8A 5EP3A 2IW3A 1E1QD 2O8DA 4ZKEA 1MV5A 2C96A 421PA 3OF5A 4NCJA 3R20A 2P0EA 5EE1A 3TVDA 1IJFA 1R8SA 3EWAA 5FL3A 4CEJA 5E7JA 2OXCA 4ZDKA 2BEKA 3U44B 1OIVA 2CBZA 1T4GA 2A9KA 4M1MA 4QJ3A 1OHHD 4C7OA 3LXXA 4I1SA 5H8WA 1SGWA 1N2CE 2DFKB 5E4FA 2X19A 1YZGA 3REFA 2DBYA 2Q9AA 4M1WA 1SHKA 4MYUA 2ONKA 3R8CA 1G8FA 1KK1A 3IIKA 4URZR 3L0SA 4HAXA 1Z07A 3T5GA 1G20E 3LNCA 5B58C 1HURA 4LHVA 4JKIA 5SZHB 4F7WA 1WCV1 4I81A 2FEMA 2WM9B 4TTQA 1W49A 3SN6A 2D3WA 1CJMA 2QPAA 2IYYA 4BLOA 1DO2A 2QGNA 3L2OB 3MWYW 3QXJA 2ZE8A 3CW2A 1VG9B 2GAOA 1E9AA 2QORA 3LW8A 4KXFB 4AKIA 3VTKA 1Q57A 2OG2A 2HYDA 3UG6A 4Z51A 4DLTA 2QEQA 3K0CA 2XNDA 2J45A 2YVUA 4UXJA 4JYCA 1G9XA 5DN6A 1OXVA 1UBGA 1NLFA 5FUWA 4A92A 1U9IA 4US0R 4D0NA 1GVNB 4PHGA 4XH9B 2XGJA 3ASYA 1EESA 1ZW6A 2V1XA 4FCVA 3SHFA 1FQJA 2J1LA 3K0AB 3T1VA 4G3XA 3AVQA 1D6JA 1F5NA 4GP6A 3PCRB 4BUJA 2A78A 5BYKA 3AGPA 1PUJA 2WIBA 4HZIA 2JIZD 1E99A 2WZQA 3QY0A 2QUZA 5KNDA 3RSLA 5BN4A 3L43A 4EFLA 2ZRPA 3QEJA 2FSGA 4EPRA 4NE2A 5L3SB 1P72A 1WE2A 4P3YA 3RC3A 1GDDA 4LJ5A 3SJCA 5KPJA 1Q0UA 3P27A 4KAXA 2WJYA 3ZD6A 1YRBA 4POAA 1OFIA 2XAUA 1P75A 1ODFA 4NHOA 3TR5A 3UG7A 2WJHA 3A8TA 5AUNB 2FG5A 4D4JA 5EXTA 3TGPA 1NF3A 2Z83A 1XX6A 1GILA 3LLUA 4Z8YA 4CRWB 1N3BA 4C0JA 3NC1C 1GNRA 1N6RA 2EYUA 4TQUS 2OAP1 3AP2A 3K0CC 2BBTA 1E2MA 4LUCA 3RANA 2CLSA 4ZCIA 2OSBA 4YONB 1IY2A 1KY2A 5JI3E 1NKSA 4DCSA 2F1JA 1N6HA 1CIPA 1G3RA 1WBBA 2WWXA 1Z47A 1TEXA 3LWNA 5ELXA 1AGPA 2QQEA 2ZSEA 4HB2A 1QHSA 4MGYR 5EXPA 2O5VA 2H8KA 4QHYA 2H57A 2JLVA 1EFUA 2WOOA 1M74A 3GLHE 4PC7A 4PQYA 2WWFA 4UNPA 4EFNA 2A3RA 3LX8A 4ZIRB 2FJUA 1QHHA 1G4UR 1L7VC 4D2IA 3B82A 1US8A 3RS7A 1BMFD 2ZR0A 3ZQJA 3X1DA 3X2SA
chains in the Genus database with same CATH superfamily
1SR8A 1TAQA 2WAOA 1E69A 2XDWA 5IK2A 2VYCA 4FFMA 3FDIA 2IHZA 2F7SA 4GECA 3ABQB 4Y6RA 2RHDA 3UBTA 4PX9A 1E94E 1J1UA 2WEKA 4RLQA 2FSIA 1SU6A 1SVSA 3FWYA 1FJGB 2C3OA 4WD3A 3AR2A 1ISGA 2F3UA 3ZIDA 1TEZA 3IR7A 4FT2A 4UU1A 3INGA 3ISJA 2YRFA 4X1IA 1NIJA 3HG7A 4P7KA 1TRHA 3GDWA 5C8DA 3FPEA 5EZYF 1Q20A 4MW7A 3F5SA 2NIPA 2QU8A 3OTGA 4MITA 5D8DA 2NVBA 1KMQA 1X87A 1C4KA 3JD4A 2HF7A 3NTRA 5ALNA 1ZD9A 3CLTC 4DRXB 5C81A 3N1UA 5LYYA 3O9ZA 2G83A 2IZ5A 2JFQA 4YPVA 5KJ1A 1PLLA 1XZGA 1MGOA 1VFNA 3G0IA 5DI9A 4P5EA 5FUVA 4PG6A 1DCTA 4MVJF 4Q1EA 1JKIA 1ZNZA 1SA0B 4QDZA 4NKRA 4LQCA 4B87A 3DZCA 2P68A 3WRXC 1VDMA 3BKWA 1SBYA 2JK1A 4QREA 1WDKA 4WZZA 3OAAA 3AEXA 2MSNA 1T4CA 4ZOEA 5I3CA 4HSEA 5EJMA 3H11A 4DA4A 4BKOA 5ALEA 4X54A 5KNBA 4O4JA 2JJ2A 2BGTA 4ZI3A 3FI9A 3DMDA 4MUEA 3DV0B 1E4OA 2HHAA 4HMQA 3CPJB 1LC0A 1CXZA 5L8VA 4PQFA 5P21A 4XCXA 1N6KA 2F8MA 3ADOA 3UICA 1WJGA 3ZHSA 2GEBA 5ILOA 2FRVA 2H07A 1HMPA 2ZIAA 3H05A 1TPZA 4UEQA 4WRRA 4IGKA 1JLLB 2FYTA 2NNLD 4QUAA 2DJ5A 1VE3A 4AJEA 4BFSA 3RYCA 2A88A 3BF7A 3IX7A 2FE1A 2JLRA 5I4BA 4OP3A 2DVMA 1S96A 1PUIA 1Q19A 1E2QA 4Y7CA 4R1SA 1QC5A 4P08A 2A59A 2Q9BA 5GGXA 3PFWO 1HFJA 2OBMA 1XRRA 1FTQA 1XEWX 3I64A 1WXIA 4RKQA 4AF8A 1QHHB 4OYHA 1HK7A 1YDWA 3EXG1 1ADJA 1E1DA 3DWIA 1D4AA 3F7MA 3PGXA 3X1XA 5J59A 3T3MB 3LFHA 5CYFA 3GGOA 3D0RA 3UEOA 5JECA 4G5SA 2RIPA 2ZJBA 4NS1A 3FF4A 2PPVA 2HLDD 3AR7A 4PLTA 1JP7A 1P6UA 2DBQA 3DNFA 3GDGA 2RI6A 2I4IA 4KO4S 4P4TA 4FDMA 1ZPDA 4CIWA 3U6BA 4C87A 1I2MA 1OCEA 1Z5OA 3GEEA 4K6GA 2Y27A 2WC1A 1UQRA 2C1EA 3MRSA 3P45A 2IHJA 4WZ6A 3VO2A 3ZZNA 1D03A 2FW7A 2R1UA 1ZNQO 1ZU5A 1Y7IA 2Q3MA 2GPNA 1DAHA 2GXUA 2MJLA 3VHXA 4RZ3A 2CLKB 4C88A 1KXZA 3HI6A 1WR8A 2PSJA 3I28A 4Q5IA 3GXBA 3WIOA 3IH5A 1ZRSA 2HDWA 4BNHA 2JDIA 4GNKA 3RWBA 3PC8A 2XCIA 2G5PA 3D6MA 3T52A 3I2HA 1NC1A 1HYQA 1GRQA 1NXPA 4FE7A 4MR9A 3JAWA 1ZCFA 3AY7A 4B09A 1NUQA 5HF5A 4EQZA 2I62A 3UPDA 2CK3A 2X0KA 1V4NA 2LGJA 2Q6IA 4GX1A 4Y18A 5U9CA 5CIYA 1E9RA 4QVGA 4L4XA 5DHTA 2PMCA 1SXJD 4OUDB 1XAJA 3AYZB 3V1YA 2IXTA 2C7QA 2COKA 1FRVA 3H1EA 3RJ9A 4ENRA 1U2GC 2H06A 3AT1A 3CM0A 3THXA 4MYTA 1CULC 1G8AA 1SZJG 2BFCA 2EP5A 4EHJA 3QFSA 4M7PA 2IDJA 4WZBA 2YZGA 4Q39A 5AM1A 2YMMA 4GBMA 3WICA 2WJ3A 2WSSA 5K8JB 5HXAA 5UKDA 1G6Q1 3VPHA 1OLSB 2Y4OA 4F9FA 1FFWA 3I61A 3COZA 4W1RA 3U9SA 3PQ3A 5I7HA 2I78A 1SUIA 1ZLXA 4WKCA 4EB6B 4F46A 1R6TA 3SEFA 2AN1A 3G8BA 4RWEA 1O97C 1REQA 2Q3HA 4KQCA 3U7QB 4I66A 5ALYA 2Z2YA 3BG5A 1I24A 4ZAZA 4Q18A 2CV1A 1T1GA 1OBHA 2VDUE 3LKVA 4H0FA 2RGRA 1DPFA 4PHFA 4XB6B 1BH2A 1TYZA 3PD1A 4KIFA 5DNYB 4U1RA 1W75A 1MNAA 1MRZA 2Y1DA 3OJEA 4OD0A 4OU5A 1UMCA 2A57A 3LUFA 3I58A 5CLLA 4BFZA 2JFYA 5CD1A 4OBBA 1TVMA 3LIPA 1YVUA 1HT3A 3AP3A 5HR5A 2NZVG 3KTAA 1NW4A 1UK9A 1YZYA 3TG8A 1YMQA 4OAQA 1E77A 1U1DA 4FZ5A 4IDBA 4MINA 4RH0A 3RASA 2BVNA 4YRFA 1XJ5A 1B15A 4CN8A 3GJQA 1DMRA 1RMQA 5B37A 3WLHA 1DAEA 2H9YA 1V8ZA 4CKYA 2KLBA 1ENZA 3DZBA 3IKJA 2G04A 1TXGA 2A9OA 1OIXA 2QUIA 4PIPA 2CF5A 2VHUA 4P4SA 5KWVA 4MYCA 1GR0A 3WYGA 3FOEC 1FSPA 3AF4A 2WA1A 3NM4A 3RNLA 3SJBA 3EVFA 4INAA 1POXA 4CL0A 1H9BA 3HCWA 3FB1A 3OQPA 1KAHA 2ZTLA 4RF5A 4NMHA 1AO0A 4L0CA 1OBVA 3PD0A 2ABWA 4S1PA 2Z1DA 4DBLC 3PT9A 1W0KD 4QNNA 1PG0A 3I73A 4U2FA 1X15A 3PLRA 5SYNA 2JLUA 2H3HA 4M9SA 3QV1A 1K66A 2HSWA 3CEHA 3ZWXA 1VIAA 2WP0A 1MO4A 2I2DA 1L3IA 2W48A 1TO6A 5L7YA 4BWFB 2ORYA 5A06A 3K5IA 4Z9FA 4HNVA 2ENWA 4ZPXA 4UNIA 2AG6A 4FMDB 3DZIA 3RU2A 4M0UA 4MEJA 1N7IA 3DC7A 1GPH1 1GZ5A 1MG5A 1SCDA 2C4HA 2VT2A 3DKVA 2ZB3A 3IMCA 3MSCA 5TPZD 5D3KA 3W8NA 3HHEA 2RDMA 1GARA 1M1UA 1OPRA 3LV8A 2PYZA 2D7JA 1PS8A 3D6UA 3F5MA 3PDWA 5JFGA 1P29A 4TT8A 3RVBA 1LQ2A 4IF4A 4OLBA 5EXXA 4DV7B 3W6NA 1VI6A 4BZQA 4A91A 1CDOA 1PQ4A 1ZH6A 3ELWA 4BNUA 3ZY6A 3DSRA 1LSOA 4JLOA 5BORA 1GTG1 1KJ9A 2D1FA 1T6BY 3H2YA 1GLVA 2DR0A 5EPUA 5EZYA 2CZQA 3GOHA 3OFKA 4RPIA 1AXRA 3RVKA 1JIVA 1YZNA 3V33A 4D9IA 2ZTUA 4WWHA 1UBNA 1JU3A 4G65A 2K7FA 3NIFB 1I30A 5JSZB 4DV5B 4FS3A 1U3UA 3DVAB 3PRKE 5JAZA 2PXAA 1PZHA 1R5BA 1UT5A 3C70A 4IIVA 1Q92A 4Z7OB 5IFLA 3CLHA 2ZSHA 2K87A 3T35A 1UJBA 1O9GA 1T8TA 4I1OA 1XQVA 2TMKA 4JP2A 4UQOA 5EJIA 4HDSA 4I55F 3VU8A 1ECBA 4KQJA 5E95A 1E3SA 3ZDZB 4RHTA 4RHEA 1L0BA 2NPIA 1RRPA 5K0NA 2JAWA 3C5HA 3NBUA 4R05A 5F4BA 1IAQA 1N8KA 1KEUA 2CLDX 3PV0A 5DIFA 3G0BA 2HCBA 1GPJA 3MD9A 5KTOA 1Y4AE 5AXBA 2AJBA 3W2EA 1KP3A 4WJLA 1FQKA 1LLDA 3F6CA 3M9LA 5F5LA 3JRXA 1X7XB 3ZTWA 4DM7A 2EFHB 4HXFB 1JAHA 4IKOA 5IDYA 1AKTA 1DKOA 1J90A 1PV1A 2XMSA 4FDUA 1I3NA 1P33A 3EY4A 3IALA 3N87A 4MVJH 1UWKA 3CSUA 2V3CC 4NC9A 2QK4A 3IOYA 3NKFA 2GTHA 5AHRA 1M2OA 3FSRA 5IDQA 5FBRB 1PJAA 2WU8A 3IPCA 4F9GA 1Y6GA 2HW8A 2ZATA 3TNDA 1JAZA 3AEKB 3CJRA 3LBYA 4R0VA 4AKHA 3C6YA 1G6HA 3C3DA 2BHNA 5KDOA 2NU7A 1TTPB 3SQNA 3WFJA 5IX8A 3EF3A 1EX6A 2QAGA 1Q3HA 2P7IA 4LZLA 1R3DA 4RK5A 4TMYA 3VR1A 1QWOA 4LWZA 1I2BA 1O6CA 5IJ0A 5DP2A 1RS0A 3K5PA 1MAAA 1MA0A 4HQRA 3MLEA 2QGFA 2GZAA 3L0BA 4YCLA 5HSGA 5JNRA 1B6TA 2HZ7A 3RDPA 5MFZA 1OT3A 5CX4A 2OVBA 3L04A 2CUNA 1JMVA 2PZAA 4RD0A 2J9GA 1P8AA 3TO5A 1FS4A 3HYSA 4JSTA 3O74A 1DQSA 2O52A 4DSTA 1II9A 1TRKA 4LIPD 3E3OA 5ITZB 3R75A 2NSLA 3BTSA 3EWSA 2CLFB 4BE9A 4IIUA 3QSYA 5K09A 4EABA 3FKSD 5F3DA 1AMOA 2G77B 2JLZA 1FPQA 2SICE 4YMWA 1GRVA 1ZNWA 2C2ZA 3FCAA 2BEJA 1CTQA 1WMFA 4AKEA 3LBHA 5AKXA 1OTYA 3HDQA 4LRTB 1JJIA 3VZQA 3KT6A 1JQEA 4O4LA 1DZ3A 5ERXA 3ZWOA 5BSEA 5I7VA 2QL9A 1M0SA 2O0HA 4HRAA 2ZT5A 3RIHA 4DPLA 1P0PA 5CA1B 3P9IA 4GGPA 1OWOA 3C5CA 4XX0A 3SNKA 1EXDA 3E9CA 1HEIA 2PLWA 3LPCA 3DDZX 4JQZA 1USVA 1XZPA 3TE6A 1P7ZA 1UBKS 3DBLB 1HH4A 1E7SA 1PK9A 5E1DA 3WQSB 4BEBA 4OK3A 2D4HA 3SM9A 2GESA 2P4EA 3QPCA 1TNDA 3V2HA 4ZMRA 4FPXA 3OM1A 2BC9A 2G4LA 2BGGA 5HYVA 5LNK6 1ZA1A 2HCTA 1H0SA 3KUKA 1DKQA 4ILEA 1W4AA 1VKZA 3IEPA 3K0FB 3O8DA 4N3GA 3IEKA 5C18A 1GZHB 2WKWA 3ESYA 4M60A 3TLMA 4C0LA 4E0BA 2KPOA 4UBJA 3AY3A 5AW1A 1QS0A 2B1IA 1KGSA 1FSSA 1SIBE 1W48A 3G9ZA 5GV7A 1GQFA 4JUCA 1UBHS 3C14C 1EAMA 3IKVA 3PP8A 5FL7A 3RVLA 1E5VA 2UZ1B 2OZPA 3G5MA 2AFIB 2F6RA 2IW1A 5E6SB 2G0AA 2PR7A 2VF8A 5KOJA 4N18A 3FNHA 1ZMOA 4IM7A 1KI4A 3D9QX 4IZHA 1A7UA 4GE0A 2JH3A 4AY6A 2VHWA 3PWSA 2BCGY 2YDYA 4HUQA 1U80A 2OHXA 2VUTA 4KXWA 2C88A 1HQCA 1M7HA 2BY4A 2OM6A 6ADHA 3LA8A 3ORRA 4IIDA 2ANCA 3RHTA 4NJMB 1E96A 4LYYA 4B0PA 2Z6UA 3DMRA 3AGQA 1Y1KE 3L49A 3BXOA 3OTIA 4ZVTA 1E1KA 2FF7A 2JFZA 2VWPA 1UP7A 3RFFA 2RCNA 5CT8A 1BMTA 3RIEA 4U2KA 3NT5A 2G5TA 2JCYA 1UZAA 4ZZ1A 4IDOA 1B6GA 1OD6A 3DVRX 4L6IA 4QD3A 4WKOA 3N2NA 1GUAA 5TPWB 3PVZA 2R7AA 1O4VA 1WKCA 1SNYA 2PH1A 3H2KA 3I9OA 2NU9B 5THXA 4GPTA 3ZDYB 2XADA 2E5LB 3K96A 2DLCX 1TA9A 4J7UA 5H1YA 1GUBA 1AHHA 4P33A 5EWJB 4LRQA 5EUCA 1QP7A 4MV9A 5DLPA 3N0XA 5HBGA 3FZQA 1VXOA 3ESRA 3GMDA 4FINA 5BY2A 4K6MA 2WYHA 2WSYB 3GGGA 2OV4A 4XKJA 4AZ3A 1KJWA 1KFEB 2D0PB 3DHEA 4I4TF 1WSAA 4PYIA 4YI5A 4BLVA 3UWSA 4OHFA 4BNVA 4QUDA 3OMWA 3AH8A 3KVRA 2GBPA 1JTVA 4LX0A 2YZNA 4TUYB 2P62A 4FMDF 4FUTA 4CLXA 3MPUA 2I91A 2CNDA 1G8KA 2OEPA 3UNXA 3OURA 1Y9AA 2XWPA 4ENQA 1DT5A 4OLFA 2GZRA 2A1IA 2I6GA 3BQMB 2IU0A 4YJGB 1UKBA 2ODNA 3FUWA 3OF3A 2W8BA 3REGA 4YMTA 4DJTA 2OTCA 3HN6A 3LX5A 1TA4A 4WKGA 4BZXA 3TKLA 1IVNA 4A3SA 5A0TA 3GUYA 4N01A 2R00A 3LDHA 3FYUA 5KEIA 2B20A 3D59A 1HF3A 2J46A 6ABPA 3Q9LA 4NU5A 4ZREA 3VHRA 1H0HA 3N70A 4MS1A 2BLNA 4LYAA 4BLPA 2XB4A 3A31A 3RTBA 3RRZA 1ZK3A 2P67A 2C1ZA 4EKGA 4N5DA 5FCDA 4MJLA 1J0BA 4KXQA 4ZVVA 2CY0A 4KCGA 4HB3A 2YN2A 4HGPA 2BJWA 3CO0S 3KL2A 2F55A 4ZGBA 5CGZA 4YWHA 2PT7A 1FVOA 5G0VA 3E5HA 3UK2A 4YEDA 2J3QA 3KVNA 4PCLA 3RK0A 2WU4A 1EFRD 1XMJA 3ETHA 4RANA 3HP4A 5EINA 1JEYB 4PZ9A 4Q7EA 2BH9A 2HRDA 1MPXA 3F7OA 1NR7A 1PDOA 1T25A 1T4DA 2P6MA 3D8UA 3JZIA 3PJEA 4CJXA 5EJ8A 1Q77A 4CVNA 4ZI7B 1UEJA 3PTAA 3NOOA 1EDEA 2WUEA 1PT9A 1STOA 1XVAA 3OP4A 4BRUA 1YCHA 1YOBA 1E5XA 4QLAA 3ANTA 3GIWA 5LZ7A 3M7IA 3TQTA 3I6BA 3DE2X 1GPBA 4XQGA 1JA9A 3PR1A 3AU9A 4I3GA 4DGQA 3MWDA 1TQ8A 2COEA 5A3QA 1R8XA 5BYJA 2QTNA 3CB4A 2AMJA 5AWFC 9ABPA 3CMMA 5IW8A 2ZS8A 4UAUA 3DVSX 1UBLS 3T7DA 4F60A 2IOFK 1V5IA 1XJ0A 4KH0A 3D7RA 3KDSE 1QU3A 1CRQA 1LA2A 5LDHA 2GAFA 1YJXA 3K5WA 1I9GA 4FGZA 5DBGA 2EG5A 3P4XA 5F2OA 5C4MA 1IATA 1ZI6A 3L1IA 3HXPA 1F6DA 1YUMA 2CSXA 4DLVA 3EZXA 1Z9BA 3CT6A 4X93A 1NJ5A 5I45A 2QM8A 1BU5A 5FFFA 4OMUA 4TWBA 2ZRGA 3OM8A 1N32B 2D1RA 1IWBB 3LHSA 4CNBA 1C8VB 2GAJA 3D3NA 5DH9A 3PFHA 3URMA 4DSNA 1NVGA 3EFEA 4FBGA 4NBSA 4KSBA 1EP1B 1U3CA 3KXIA 5AK4A 5FF9A 4NG4A 2PD3A 4QBKA 1U0GA 2X2EA 3SMQA 5C37A 3H8WA 2B6HA 3ASVA 5JCPA 4FYPA 4F38A 3T7SA 4EPYA 5KQRA 5HX7A 5B55A 2ISCA 1H42A 4EMSA 1NGSA 2GMWA 1UOEA 4WOKA 5IC5A 1C5KA 1VMAA 3EZ2A 4M53A 1TIBA 5AUQA 1N3LA 2GZDA 3VMMA 2J3JA 2MOKA 3BMCB 1RXVA 3RYFB 5HKLA 1ZGJA 5J47A 3Q9UA 2GEKA 2FPWA 4RGVA 4YY3B 3OOJA 4DBLE 3CZ5A 3M33A 4A2QA 2JFUA 1VRWA 1BCSB 3CWZA 2PAFA 1DQYA 1RVV1 1Z39A 3BDAA 1S9DA 2WTBA 2E3JA 3JQ7B 1O08A 1FNBA 4J1SA 3BL6A 4AJNA 1RRCA 4LGCA 3ZBPA 2OY0A 3EVBA 2HJ9A 4D9HA 3LQ1A 1RIIA 3KLMX 4IOKA 3SX2A 1BH6A 4GKBA 5B1HA 3WAJA 3I2FA 3DDOA 4MUYA 4TMXA 4YP1A 2Q3FA 1TQ4A 4LK2A 4FYKA 4OXQA 1I5OA 2ZU0C 5FUYA 1F8GA 1A0OA 2BFEB 5BV0A 5CVTA 3I6ZA 1E0SA 1RRFA 4O4JF 3T06B 4D45A 2AS0A 1F38A 1CQZA 4C2AA 4DZTA 4DIEA 1E8NA 1K4KA 4F92B 3FTDA 2QT1A 4B2PA 3DM5A 3VBEA 4Z1MD 4AN4A 4D5GA 1VLJA 4X7BA 1N8SA 5CYGA 1GQRA 3A7EA 2XCUA 3M6MD 3KALA 5IT5A 3DS8A 1RFGE 1NLUA 3HP1A 3ZQUA 3CFYA 4RF3A 3I04M 2PKCA 3R3JA 2X5JO 1EUZA 2FX3A 4GOND 2W6IA 1FVXA 2FUEA 1UOQA 2B8WA 2ZI6A 3O92A 4D3YA 4EGJA 1BRMA 3RC2A 4DZZA 3UHJA 3TBKA 5BMOA 2QG9A 3HWWA 4HC4A 4EHKA 5KTRA 1IU9A 3CKYA 1KVRA 2VPIA 3GJ7A 3MJTA 1YQ9A 1QWSA 4A6EA 3OZUA 1YL6A 2PCJA 4L07A 3UBMA 3KIPA 1AB5A 5GZ1A 5A4IS 5LR6A 2O1SA 1T4MA 3LLSA 4BFXA 3ZVKA 3N7TA 3EZ9A 3I62A 2OFFA 4QDJA 5HIKA 1Y81A 2GA9A 3EE6A 3MJCA 3PJFA 1NXXA 1RD4A 4AIRA 5JXWA 3L79A 1GQSA 2GJSA 4V0KA 2YNMD 3VOBA 4DVGA 5B2FA 2ZJYA 3SBEA 4MUFA 4V3CA 1DLIA 2VIIA 1U90A 4DMHA 2ZJ2A 1J2UA 3R40A 5EOVA 1WVMA 3JQAD 4DV3B 1N9GA 4TL7A 5CB8A 3NTLA 2C4TA 5DMHA 4DZRA 2X8AA 3CLUD 3HB5X 5CT5A 5FWXB 4K0KB 3MWKA 4HXGA 3B2EA 3EVGA 3NV9A 1TF2A 1EM8A 4UHFA 1CE8B 2EIXA 1DT3A 1IJKA 4R54A 3SQWA 1PJ2A 2J87A 4LY6A 1B8VA 3LTEA 3IBYA 4GOLD 4OQEA 3EHEA 3U3DA 3HC7A 4QXRA 4UCXA 5CCEA 3JWEA 4E1VA 3TINA 5FORA 2PGDA 3DOFA 1W1WA 5J5CA 3VZDA 1LPNA 3MRTA 4L2IA 4WNYA 1I4WA 1IXRC 2B6NA 2PL5A 1EFTA 3NBKA 5C5EA 2WK1A 4GZMA 1PGNA 4R9UC 5JWRA 4I4TA 1X8JA 1B3BA 1T5SA 3OKFA 2GPTA 1J8YF 2CDAA 1XBTA 3RVOA 4FDTA 3ZWPA 4R2MA 4M88A 4F0JA 1SKUA 1PK8A 4WGGA 2Q0HA 1UINA 4EYQA 1EAYA 4IVQA 4RGYA 4XYMA 1LDMA 2CHEA 1Q2UA 3WJ2A 1G41A 1OILA 5BQ5A 3VU9B 4M9RA 2I80A 3Q10A 5K3CA 3VDQA 4C2UA 3L9WA 2WUFA 1EFRA 1R6XA 1Q0TA 1ULZA 3PQEA 1G19A 5I9NA 1N34B 3RKUA 5U4XA 1HG1A 1KVTA 4M1ZA 1G5IA 4JR0A 4II3A 1DAKA 2H59A 4NCHA 1YU6A 4NIMA 2WUDA 4RA6B 3TWOA 3T1HB 1P9WA 4OKSA 1SN7A 4YALA 3MCUA 2FXIA 2DT8A 2PKYX 3QBEA 5EE5B 1O57A 4XRGA 5LZ2A 1UWCA 2Q5IA 4JEUA 4NEQA 3IUMA 2OORC 5ALGA 1BEEA 5A6VA 5HPYB 3GWZA 3SC4A 3CN7A 2OAQ1 3HKCA 5JEEA 3R2JA 5BT9A 3MWGA 1PE0A 3FGNA 1AUXA 1E9FA 1NT4A 1OX5A 2QVYX 5EZYB 1W5FA 3G7UA 3HUEA 1KF0A 5JBIA 2ZVJA 3OEHA 3PHHA 1T8WA 1Q44A 3GJSA 1O95C 1RWPA 1XWWA 3QXHA 4PO8A 4EQ6B 5KYWA 2RIRA 3HA7A 3ANLA 1QHXA 3EJWA 1UP4A 4XDHA 3AQIA 1NBAA 1UL1X 3O3NB 5D86A 5HK8A 3H5IA 4OQ4A 3AL3A 2X0FA 2ID4A 1IQPA 5E6RB 3K94A 2ZBFA 1SHTX 2O3RA 3GRCA 4M1TA 3AUYA 2B94A 2PTHA 3N3BC 1JG6A 4MPTA 3HUUA 1QFSA 3K8ZA 4RVFA 3REOA 1R5OA 3EQ8A 3Q41A 5CA1A 2ZUSA 3PITA 4L28A 4AVYA 2NGRA 3CCBA 1NMYA 1L4YA 3MJEA 4BNMA 5HRUA 5FI5A 2AEJA 5I7EA 1LNZA 4UU0A 2OHJA 4RQUA 4TRRA 3URKA 2XQVA 5EXEA 2LV8A 2AG0A 3FTCA 1NOKA 2FPOA 1R6BX 4MCAA 2DPYA 1Q3KA 1VE5A 2UYOA 1N1GA 3FGZA 3ONWA 5K3BA 3VR5A 2YIVX 3PFIA 3I0NA 3V1MA 4KV7A 2F3PA 2LIPA 2CXXA 4UM5A 5KTTA 2WOJA 4B85A 3JD1A 2AXEA 5FDFA 2Q5HA 4MUJA 1HE5A 1C8BA 2ESRA 4L5AA 3MGCA 5EE3A 5BOSA 2F8SA 5JARA 1SVKA 3E81A 1NW9B 1Y0BA 3WGKA 3BAFA 4NENA 4EUSA 4Q16A 2PJRA 4W7SA 2IA5A 1G8SA 3UV3A 3U7RA 3PNLA 4L8VA 1OB5A 4OKIA 4WN3A 3WWCA 4AURA 3SZRA 5DM60 1S4MA 3WA7A 4K8OA 4OQQA 2IUSA 1P4GA 3E9NA 4YJHA 5TS3A 5JRJA 3T6KA 4HEA6 2ORVA 2HK7A 1X1DA 5LLTA 1CZHA 5KU7A 2YKGA 2OWEA 5CMLA 2E1PA 1A9PA 3O4HA 4ZFNA 2X0NA 4RM2A 3PWKA 4YMGA 1NXSA 1Z5NA 4M46A 2HEGA 1Y9DA 2PX8A 3H6KA 2HEIA 4B8ZA 3K1TA 3CEMA 5B53A 5KCMA 3O82A 4FYMA 4QECA 4ZXPA 4AMUA 2ZB8A 4YIKA 3LT1A 4M7RA 1VGQA 5IBQA 1ESNA 5EIEA 5I9LA 1K5DA 3P96A 4D96A 4FFNA 1ZINA 4G1EB 5SICE 4LJLA 2QRJA 4JV5B 1ZJ4A 2DP4E 4Y1FA 4ZI7F 1K7CA 4RZ2A 4KV9A 5A9SA 3FI0A 1FP1D 1PFYA 4LGMA 1RAGA 1JKMA 2WJJA 4MW1A 3C6KA 3UY4A 3K4PA 4YRRA 2J30A 3GEPA 3WNBA 4BN0A 1H6CA 3JX9A 2V4UA 1RQPA 5T5QA 3UB3A 3KL4A 5TQ2A 3EGCA 3OU6A 4AMYA 2V5AA 4IIGA 1EDBA 2Z5FA 2ZUCA 5JJKA 4KPGA 4BO7A 4ECAA 5JY6A 1RQ2A 2BI8A 2ID8A 2YV3A 3C1UA 3JASA 1AK1A 1ES9A 3KKEA 1RCFA 3Q12A 4GP9A 4ZAWA 3A9CA 4OGGA 3RFTA 5PNTA 4HLQB 1OQAA 2CVOA 1KBZA 5EWLB 1QAOA 3WRYC 4CN9A 4CM7A 5COQA 1TCCA 4LVUA 4DKJA 1CY1A 3EOBI 4J4TA 4V0LA 2MMCA 2HL6A 7YASA 1X1BA 3NONA 4N1AA 1UK7A 4ISCA 3W05A 5AQ1A 3BIFA 2OM2A 2G9QA 7MDHA 2PUEA 1GCIA 2O2CA 2VF7A 4JROA 2NV2B 3UXYA 4CM9A 3FY4A 5TLSA 2KBFA 3ZHUA 3B85A 4B6JA 2VJQA 5EZQA 4X63A 5CLJA 3DZJA 4DHWA 5FUXA 5IU6A 4R16A 4ID9A 2ZJ1A 3OAAD 4JLUA 3QEAZ 1C1DA 4Z0TA 2Z6QA 1ECFA 1HFWA 1XZAA 4EUEA 4M0KA 1W4LA 4D8TA 3RABA 3WK5A 2YVQA 3BSFA 4QARA 5BWCA 2XVAA 5E2IA 3ZX4A 4EG4A 1BX1A 4N40A 1B00A 4P81A 4RH3A 1IWPB 1QNLA 2FPKA 1W0JD 3QEMB 1IULA 2FTKE 2B1QA 1Z6PA 3RWMB 1OA0A 2CVHA 2E82A 2Y6VA 3SEZA 4JUIA 5B4UA 2IPXA 2GBLA 2QF7A 4HWGA 2QYHA 3LUBA 1ZNXA 3EQ9A 3O4VA 4B3DA 2EW2A 4YV7A 4YAIA 4K9KA 4X7MA 4I4LA 4ZOLB 4C4ZA 5KB3A 4YNBA 4MULA 3W4IA 3DPUA 1YQGA 1PFKA 2P6NA 2C54A 3F7TA 3ETNA 1GAJA 2SECE 3HCRA 3KUXA 3NGXA 4ONEA 1JDPA 1LBSA 4RD2A 3REQB 3OOYA 4RK0A 2ZGVA 3JQAA 3MS4A 2QZPA 3FJYA 3FIUA 4S1OA 4HNAA 3E3NA 1RZUA 4R9RA 3E84A 5HKKA 4W8HA 3PEUA 3T99A 1Z06A 3KKQA 4HAZA 4G6ZA 3TL3A 1P0MA 2GYUA 3KZMA 4CHGA 2XMPA 4ZGWA 1C1YA 4IQFA 4IIHA 3K5HA 2I4OA 4F9TA 4HFRA 1P18A 1S3IA 2LW7A 3LY7A 3OZBA 4MXDA 4PZEA 3PFCA 1ILWA 4ZAYA 3S4YA 3TTSA 4BEJA 4BNKA 1IHDA 5IUKC 1KEWA 4KMRA 5CPFA 4YMSA 1XU7A 1SZCA 2J3DA 4OB7A 3OZVA 3LDUA 3VNRA 2LCQA 4G0QA 2X77A 4J0EA 4NICA 2UUBB 2JH9A 4HV4A 3SR4A 1XQ1A 2C98A 1I6MA 1SXQA 1HNNA 2VJLA 1KGDA 3TOVA 1NLYA 4HWKA 1CUDA 2R44A 1SXHA 1OC4A 4KQ2A 1GJRA 2H9AA 1S2DA 3FYUB 2EJTA 2IVZA 1WW8A 1YR9A 3PUVA 4QRDA 5T3YA 2IXEA 2L42A 1XQXA 2AYZA 5F2NA 4P7JA 4J1NA 2HJSA 3AILA 5EPOA 3QYJA 1DKNA 3HN2A 4FIZA 3GPBA 1IB6A 2VH1A 5FTMA 4CQMA 2F1RA 4BATA 4YCJA 1E2FA 3T3IA 4ZV9A 3KJHA 3E22B 4KYUA 4CE6A 1RAHA 3AONB 4URHA 1NVWQ 2GLTA 4E2ZA 1UBFA 1H1TA 5F1YA 1EUYA 3GJ4A 3NC0C 5B36A 4GWKA 3B36A 2ENUA 3A4NA 1YFLA 2XYHA 4FFBB 3RSHA 3JVVA 5C8YB 1Y4UA 1LPBB 2YFQA 2W58A 1ZNYA 3FOWA 3HJUA 3IT3A 4ERXA 1A88A 3L06A 4HGYA 2JAOA 4QU8A 4CQNA 2AFRA 2HWYA 1G38A 4RZSA 1WMEA 3KJFA 1BROA 4QEKA 2HWWA 2VPYA 1HQDA 2IU6A 4ATNA 4DMCA 3ADKA 3BXHA 3HACA 1EX9A 1E2PA 1MO5A 4IWNA 5EESA 3UGJA 4TYNA 1VYVA 3L7YA 1OVGA 4AJ9A 3J81A 4R0MA 1BQ4A 2OESA 2BTQA 4PRKA 4UDXX 4MS3B 4IINA 1TM7E 2XUGA 4EKNB 3AHHA 4J1TC 4BCBA 2AOUA 1XALA 3S0JA 1P5RA 3IBTA 4G86A 2C29D 1OROA 5IN4A 4ERNA 1THGA 2EZTA 3RUDA 2HSDA 1FDWA 3Q0TA 5I8ZA 1FYVA 2P2NA 2WPDD 2PS3A 4LS3A 5CNMA 5IVDA 3SFTA 1K7EB 2OLKA 4EKEA 1RJWA 2D1TA 2NSHA 2UZIR 3AR9A 4JB0A 4Y6GB 4C0SA 1ADCA 2VDWA 1G21A 4QT0A 4OIMA 5ESRA 2QN7A 4DJJA 2PX5A 2CL0X 3VOAA 3GLIB 5TT1A 2V98A 3ONDA 4YRCA 3GFGA 4GKJB 2J5RA 1D5WA 1V2HE 1ULHA 1SD2A 2QP3A 3IV7A 4IIFA 3TLGA 1L4BA 1N7JA 4JGBA 4ZT7A 4JXJA 2HTEA 2IUTA 3VR5D 5JY1A 4FHFA 3SYNA 1A50B 2ZBPA 3C4QA 1QVZA 3FPSA 4OP1A 1XA0A 3I42A 5DXJA 3KHUA 4OI1A 1ECCA 4G5FA 1Z68A 1R5NA 2VJKA 2WT9A 3PHJA 3MTIA 4X44A 3FR7A 3NEPX 2BFFA 5ALTA 4OFXA 3KTFA 4BJ5A 5HCIA 1FPMA 4OHZA 2MCFA 1DL5A 5EIFA 3ZKWA 2XDQB 3NTOA 1YXMA 4I5EA 4Q1BA 2YVAA 4D02A 2O5RA 1YZFA 1MJNA 4FGUA 1T9HA 1TJYA 3B38A 3E22A 3QSGA 5CT9A 3RSGA 3VQTA 2LBPA 3WLFA 1H8ED 1IEWA 2CLOB 3JVDA 5B1DA 1U81A 3SF8A 2CCGA 2EHJA 1R16A 1RWVA 4MW0A 4OQMA 4WNCA 4LBYA 2RD2A 1EB9A 2IRWA 2W6JA 1SA0A 2YJTD 5B3JC 2JLXA 3A3YA 3HVHA 1H94A 4FMCB 4HNQA 1R10A 1HL7A 1WB6A 3IVGA 1IMJA 1KOJA 4W6QA 5EHGA 2DHRA 1A9XA 1EUCA 1XZIA 3ZDRA 4ZIRA 1GPWB 1I7QB 1LUAA 2B7CA 5C8YF 5JS1A 2KJQA 1JXQA 3UKOA 2WU1A 3FB4A 4Q15A 2AZTA 3USZA 1RP7A 5CRIA 1NQVA 1O6BA 1XL0A 2QW8A 4XYBA 5EPEA 3UGQA 2POQX 3WB9A 1DWPA 4B9EA 1WXHA 2KWIA 2MDTA 2GJAA 4CMGA 3RJ5A 3VV2A 1DRKA 1FSGA 1GYPA 2V4MA 4BU1A 4E5MA 5ABPA 3NHAA 3OLXA 1Z75A 1I2AA 2PANA 2RHHA 3IB6A 4FX2A 3Q6IA 1RYEA 3GROA 1P1CA 3OWHA 4P3XA 2AYXA 2YVLA 3B5JA 3DF7A 621PA 5K0EA 2C7OA 3DH0A 3W7VA 1LBIA 1E0KA 1URPA 2ECPA 3ZV4A 3GLFE 4IJQA 2RGEA 3KPYA 2FF5A 4ESEA 1KO8A 3P32A 1GNTA 2G28A 1D9ZA 2GO7A 1D6MA 1FIUA 1H8EA 2REXB 2X15A 3E35A 4QG7A 1U3TA 1L5GB 1U6IA 1NN5A 2AXNA 1NMXA 1PZEA 1ZK2A 1IXKA 2B5VA 1FU4A 2O3TA 3FAZA 3L7NA 4HNRA 16PKA 3OO1A 4XEHA 3WYNA 3HPQA 4M0EA 4QHSA 3UJNA 1X7ZA 1JEDA 4UPDA 1TQHA 5IAOA 2YIDA 4HWOA 1E60A 4JLKA 3WI7A 4D41A 4BQPA 3DBVO 3VPGA 2WIGA 3DTNA 5FFMA 2JIMA 3D6AA 3AM4A 4NZZA 2F17A 2YTZA 3B3QA 1B0UA 2ZJ5A 3UH0A 1DIAA 2PXHA 1S2IA 1H2HA 1GCAA 1APBA 2X0RA 2JGRA 3NAMA 4K03A 1Z6GA 4ZQHA 1WG8A 3FPHA 1QYRA 3IP5A 1H65A 5CM2Z 4C6TA 5A6SA 5FBVB 3V7UA 4HEHA 2E18A 5K2MA 3DPSA 3G23A 2N47A 1WRBA 2FCAA 4KU4A 2PO7A 4U9UA 3GLQA 4UHEA 1GSIA 4CV1A 4O59O 4BAZA 5JRDS 5D2CA 1LBHA 5I9SA 2VLIA 3ZXYA 3NJ8A 5C1PA 1DWUA 4KRXA 4NCKA 3DOIA 2AMFA 3WKCA 2PZEA 3R9XA 3UPUA 5YASA 4HNGA 5CDYA 3CUSA 1ZL2A 3EQ6A 5KIAA 2WTUA 4PPNA 2WYVA 1NTOA 3H1PA 3SSAA 2ERXA 2H2IA 3T5AA 4A2WA 4K6HA 4PLCA 2DUUA 2AE2A 1YULA 2B2XA 3E5NA 3I3OA 1E9VA 1UKVY 4FXOA 3BGWA 1XVUA 1BQ3A 3F8SA 1G2IA 4GVLA 4NONA 2VWQA 2YXBA 1GHTA 4R01A 4U2CA 3T3GA 4A2CA 3A1DA 5HQTA 5AJHA 4YLGA 1T2VA 5M04A 1FJHA 3CF6R 4UEWA 4RNCA 5CHEA 3ER8A 3W6OA 2G9VA 1IYZA 3HYRA 2GO1A 1FTYA 1C9DB 1EBUA 1EP9A 2ZXEA 3IA7A 2AJLI 2PT6A 5LD2B 1CE8A 1YBHA 1P2VA 1Z2CA 3B60A 3T8YA 3WZLA 3IL2A 3FWNA 1RABA 2I99A 3W9UA 5A4FS 1FP2A 3NORA 1QUEA 1T8SA 2WMDA 3C8MA 1RJGA 2J67A 2C0PA 1LPSA 2I33A 3BXGA 4DNQA 3PNPA 4MIKA 3R8XA 3RS3A 1I0IA