1EFHA

Crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
281
Chain Sequence
DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SULT2A3, human hydroxysteroid sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYSTEROID SULFOTRANSFERASE
total genus 98
structure length 281
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1efhA00
1W5TA 1M7GA 3CKLA 3R7WB 4BRWA 2C96A 1TTTA 4TYPA 4EUNA 2VP4A 3LLMA 3Q9LA 4OI4A 5JS8A 1RC8A 4A0GA 1P75A 4D4KA 4Q1EA 2WJGA 1A82A 2GWHA 4Q4AA 5CYPA 1MRSA 3VU9A 1XMVA 3A8TA 4NCIA 4Q18A 1E96A 1KKMA 4Q47A 3PENA 1Z0IA 3DHWC 4JVSB 1L4UA 4QM7A 2RGEA 4C2TA 3WBKA 2G1KA 4JSTA 3EIQA 4KJZA 2VLIA 4LYJA 1OHHD 5E3HA 4URXR 1HURA 2ZIAA 1F5NA 2MMGA 4I99A 4MRNA 4DLWA 4YXWA 4AKGA 2C77A 3KJGA 1CJVC 2CK3D 4RSGA 4C7OA 2GA8A 1FZQA 2A9KA 3AF1A 4EKDA 4KITB 1GILA 2WIBA 1Z07A 4B76A 1VHTA 1KK0A 1CU1A 3T5DA 4NYJR 1RFLA 4PO8A 3K70C 1MT0A 1W4AA 2P3SA 4R9UC 2QP4A 3P20A 4LJAA 4DHEA 2BKUA 3DDCA 2RGNA 4YMTA 4BZPA 5KSZA 4WVFA 1NN5A 4UJ5A 3REFA 5JSZB 4D25A 3I32A 1Z6XA 4XWOA 2IS4A 2QTFA 2IS2A 1NG9A 3QXJA 4RD6A 2XOKD 3ZD7A 2GXUA 1XJQA 2YOHA 2IXFA 4UQOA 4DCNA 1AZSC 3H4MA 4JZKA 1D6JA 1P3JA 2QPTA 4Q21A 1KI6B 1KKLA 2JASA 3U7FB 1ZC3A 1AGRA 3NIBA 1Z6GA 1JXMA 1GITA 3R7WA 4I4LA 2ZUCA 2EW1A 4M9ZA 5J4VA 1XPUA 5J4HA 2DWPA 1VPLA 2Y8EA 2HCJB 1KMHB 3GJ8A 5JWHA 2J0UB 1E9FA 3RS2A 2ZYUX 2CLCX 4WZ6A 5H8WA 1EG7A 4DCUA 4Q19A 2NO1A 4ZV4A 1SZPA 1C9KA 1XTQA 2R9VA 5AJXA 3TIFA 4D0NA 4B33A 3ZJYA 1DBSA 2EU8A 4LCBA 3B2EA 3OIWA 3CWQA 3IIJA 2J0QA 4HAUA 3QPVA 4O0MA 2QEQA 4CEJA 2R8RA 3LQRA 4LDJA 1X3SA 4LV8B 3UWKA 5EZ5A 2X77A 1WA5A 3FMIA 3NEJA 3W6NA 4IJMA 5L3QA 1N0WA 4PHTA 4DLUA 2IXEA 1YR6A 5IF9A 3WMEA 5KYKA 1R7RA 2OCAA 4IDOA 3TUIC 4HLUA 1E2HA 2FMXA 4LWZA 4TT3A 1GIAA 1SVSA 1E79A 1KJWA 1YZLA 5KSOA 4QBIA 4TSFD 3E5HA 4YC7A 5HE8A 1QVRA 2ZYVX 2ZJ8A 1E3MA 3O8RA 4MH0R 3KX2A 4RKFA 1UBFA 2BBWA 5KDDA 1HH4A 2V1UA 1EXMA 1BKDR 4E03A 4N1AA 1KO1A 3U4QA 2WKQA 2O0JA 3K0CC 4PTLA 2VRWA 3OFNA 3P32A 1QBKC 3THWA 4EJSA 4B74A 3M6AA 3Q7QA 2O8EA 3QXSA 4TMZA 2HT1A 4JLPA 3GJ6A 2A7QA 1MRNA 2V7QD 3LXXA 621PA 3THXA 4A36A 2CCKA 4DLVA 3THYA 4NMMA 1WB9A 2W2XA 5EP3A 5GVSA 4G01B 1W0KD 2CMKA 1M74A 4PAMA 4BUJA 4CDGA 3KKMA 4B2PA 1H8ED 4I1UA 3K0FA 5CLQA 1XRJA 1COWD 5HCNA 1N2CE 1GKIA 3GCGA 5G3ZA 4TL6A 5JI2E 2LKDA 2ZU0C 2JJ1A 1SHZA 2DR3A 3C16C 3X1ZA 1G3QA 2ORIA 4L5BA 3TNFA 3FGNA 3ZZUA 3B1VA 2JGNA 2G0NA 2QQ0A 4NCJA 3LQQA 1E2PA 2IYZA 2G88A 1X8JA 2FZ4A 1HA3A 3K1JA 3L8ZA 2QMUA 3K0EA 4Q66C 5J40A 3EZFA 3SFVA 2D2EA 4DB4A 2O8FA 2BHRA 2Z4RA 4MA4A 1TU4A 2AHOA 1PUJA 4RZ2A 5AJYA 3VMFA 3NWJA 1ZNXA 2BJVA 2IC5A 1KZ7B 2JJ8A 1W46A 4BFWA 4CVNA 1XF9A 2OZEA 3HDTA 2DWQA 2CCJA 2WSSD 4P31A 5HCIA 2WVJA 1FTSA 1DAKA 1XD8A 3VR2A 4QHYA 1FP7A 2JJ1D 4OBEA 4QXAA 2P6RA 4NCHA 5CIQA 3FMOB 1CXZA 4AY2A 2PLRA 2W00A 3DKVA 2GCOB 2GVZC 3RRMA 2QU8A 4AI6A 2NMVA 4QNMA 3VTKA 2D7CA 2N42A 4F38A 1KSFX 1TX4B 4IKEA 5FBRB 3Q5EA 1FQKA 4TMWA 3BFKA 4GI7A 4B3CA 4CZ2A 2QAJA 5E7MA 3AF2A 4BZXA 2QMOA 2ZJZA 1A2KC 1GAJA 4FMDB 2ZE5A 4C0QC 4XJXA 5AK0A 3PUYA 2FSHA 1TEXA 3BB1A 5C1BA 5LPNA 2GXAA 3AKYA 3PUZA 4AIIA 5F9FA 1UDXA 3RWOA 4PHHA 5G41A 4ZDKA 3KZ1E 1M7HA 1XTSA 3PUXA 3BRWD 1KI9A 4MYHA 4YONB 1HYQA 3FE2A 1GFIA 1ZNWA 1S3SA 3GFPA 2ZJ2A 2AK2A 1OE0A 4JYCA 4M1WA 1JR3A 3OEEA 1HQYE 3FVQA 4OHYA 1GWNA 1F60A 1FX0A 3KXIA 4UXIA 2IYYA 1B0UA 5KU1A 3REGA 1NLZA 3B1YA 2KWIA 3HPRA 3ZVRA 4L16A 5CB8A 4Q4HA 5CDFE 4HATA 2GK7A 3SJAA 4FMBB 5DN6A 3C8UA 4KFUA 3RRYA 2ZJYA 1KAOA 1JEEA 2ZI4A 1AS3A 2ZRDA 3WP1B 3CNOA 2OFOA 1ZYUA 4DVGA 1I2DA 5DI3B 4OK3A 1JPNA 2WOJA 1G1MA 1O87A 1NMXA 4OK5A 1NRJB 1ZINA 1XD2B 3T5GA 4DT1A 4RFSB 3KJEA 2XZLA 1HE8B 4Q9JA 3UIEA 2VBCA 3PEWA 1G8HA 1E0JA 4GZLA 4CEIB 3NXSA 3QVUA 1TMKA 5JBQA 2J41A 2VIIA 4DKXA 2VF8A 1QVAA 2VF7A 4URYR 2WWGA 3EWAA 1KO8A 1YR8A 2ASEA 3ZZTA 4UNPA 3T1VA 3AQ4A 1DO2A 2F43A 2H5EA 4LJ4A 1A2BA 2B8WA 3OZXA 1VIAA 2OM2A 1MO5A 1U9IC 4OI1A 5KNDA 1IY0A 3LW8A 1DAIA 3LBIA 3MCAA 3TJZA 2OBNA 2B21A 1AKYA 1EFHA 4QOSA 4R2HA 5LDDC 3U5ZB 2PJRA 4P0TA 2Q3HA 3RC8A 3ZQ6A 3PFIA 4JKIA 3U61B 1E9CA 4KV9A 2GBLC 1JR3D 1OKKD 2CE7A 2VP0A 4WZBE 5K8TA 1XEWX 4X8OA 4BECA 1CJUC 1NN0A 4B6EA 1G3MA 4Q03A 2AD5A 4QGHA 1E9DA 2XB4A 4JLMA 1FFHA 3TR5A 2OFXA 3QKTA 4V0OA 1SXJB 2FGKA 4MGIR 5CDFA 3O47A 3WRXC 4KVGA 2F3RA 5BXQC 4PHFA 1MO3A 2G9NA 1TL7C 3JZAA 4FW9A 1ZUHA 3GLFE 2NZ8A 721PA 5GJWC 2ZJ5A 5EP1A 1GRNA 1AS0A 4U5XA 4YMVA 5DI3A 4MGYR 4G0NA 5C4GB 3RS4A 4ZCIA 1G17A 1ZMXA 3KXLA 4B6FA 3M1IA 2HYIC 2GZAA 2FPKA 4TWZA 3C4JA 2GJ8A 2V6JA 5KTYA 4ZKDA 1F2UA 2AKAB 3Q8XB 3ZIAD 3AVPA 4AURA 4ZCMA 2YVUA 3GLIB 3K0SA 5JCPA 4G5SA 4F92B 3F5FA 3HR7A 2YC4C 4JLJA 5FPKA 3FYHA 4ZKEA 3CR7A 2CVHA 4WA7A 3ZIAA 4RZ3A 3MG9A 4IEIA 1YRAA 2X8AA 3A4NA 2PT7A 4HZIA 3Q72A 1KI1A 1W4BA 3QXCA 5EJEA 3IILA 2FEOA 1NVVR 2HUPA 2V6IA 5JJLA 5L3VA 1U94A 2W2VA 2Q0HA 1SQ5A 4JBXA 2QENA 1S0UA 2AWOA 3EW9A 4DDUA 3HP1A 1GNQA 3QG5A 3CNNA 1KMHA 3ADBA 2WWYA 1COWA 5EQTA 3K9HA 5LBIA 3LO5A 1QF9A 5FI0B 1W7AA 4LHYA 3AB3A 4ZIRA 3VKHA 3LBNA 2O8DB 4A4DA 1RYFA 3C14C 4CW7A 1XD9A 4PHGA 4US1R 3NDBB 2EYQA 5P21A 2ZRMA 3SQXA 2XSZD 2DWOA 2CL0X 5D3MA 1CRPA 1AS2A 1GKYA 4OYHA 4EPWA 2XTMA 5K8IA 1XP8A 2QRNA 4HLCA 4M1MA 2PCJA 4IXNA 2CJWB 4KBFA 2D74A 5HZHA 5EXSA 1WQ1R 3GEEA 3SN6A 4B48A 4NZYA 1G16A 4TT3D 5DISB 4TLDA 2FPLA 3CW2A 3LXRA 4TSFA 1X6VA 3ZLJA 4RD2A 4CF7A 1WF3A 3CZQA 2GHIA 2F55A 1XBTA 2WMOB 3MWKA 3OIUA 1CBUA 5TXGA 1S2MA 1L8QA 1CTQA 5J4LA 5A0FA 2O0HA 1P60A 1E9SA 5EZ6B 4DSOA 2ZE6A 2ATVA 3U7GA 4M0LA 1TQDA 4UNQA 3BFXA 4DLSA 3SU8A 4FD2A 3IQXA 2P65A 2IYTA 2WAYA 3VR6A 4PSAA 2B6HA 2QY9A 2QE7A 1QHGA 3BWDD 3EZ6A 1EESA 2AX4A 2VP6A 4HLDA 2W6IA 1IM2A 2ZRLA 3TKLA 4D0GA 3PJRA 4G5QA 1CLUA 1GKUB 1Z6TA 3BS4A 4M9SA 3AKCA 4P4SB 5IT5A 2BC9A 4DDTA 2GF9A 1O3YA 1TNDA 1DAMA 4US2R 1VTKA 4JBWA 1FUKA 2ZSEA 4A8JB 2AXNA 3FMFA 4CGZA 3HU2A 1VIYA 1II0A 1X8LA 5GJVC 2QM8A 1VG0B 4C0BA 3NBZC 3GJ0A 1W4CA 1ZD8A 4BFZA 3CRRA 4AG6A 2ZE7A 3VR1A 3GLGE 3B1WA 4LV6A 4HEJA 1TQ2A 4RVCA 1P2TA 4E5UA 3JVVA 3QE0A 2H1LA 5LB2A 5IHPA 4ZDJA 5E7IA 1AQYA 2GNOA 2R65A 3I4LA 5FBVB 2X1VA 4MYUA 2FF7A 1TF7A 3A1SA 3UKDA 4J0QA 2XXAA 2FWRA 3NH6A 1E2KA 1UADA 2VTKA 1XWIA 3B9QA 4DBLC 1T3SA 2RMKA 3NBXX 4B2LA 2NGRA 2C04A 2GEDA 3UANA 2EQBA 4A92A 1RYHA 1Q21A 2WZQA 1G19A 4PAOA 2FJUA 2JDIA 3O8DA 2A30A 1N6NA 1K8RA 2A5YB 5EP2A 1Q0UA 2GZHA 5K8LA 1DTSA 1W44A 3R9XA 1T3LA 5LB4A 4LYHA 4M53A 4DCTA 1OB5A 1R8SA 5ANRB 1NVWQ 1CR0A 3N2EA 2ZRPA 421PA 1C1YA 3UK6A 4LK2A 4V02A 4F91B 2ODWA 3QVVA 1JALA 4Z51A 1IJFA 1WMSA 3CLVA 3OIVA 2ERXA 4Q48A 2ZI6A 1WDTA 4ILEA 4IRUB 1HE1C 4LC0A 1Y63A 2VA8A 1S9HA 3PR1A 4PAQA 2OSBA 3AV0B 3IO3A 2FGJA 4Q9LA 1U0JA 2C99A 2FSIA 3SJZA 4M9XA 1KNXA 2EFHB 2BWJA 4PPNA 1Z63A 3GLHA 4D4LA 2QGNA 3PEUA 2V4ZA 1P73A 1MABB 3P1JA 4FWIB 1QHNA 4OHVA 3PUVA 3U3JA 1E9RA 2R44A 5G53C 1AZTA 4C0LA 1KDPA 5J5CA 4PXAA 1Z6AA 1JBKA 4EAQA 4R71A 3AP1A 4EPYA 5AJVB 4QM6A 3GLIA 3TVDA 2WJVA 3QXHA 3K09C 1E2QA 2UKDA 1KOFA 2QL6A 3VX3A 5DN6D 1S1CA 5FUWA 2F9MA 2RGDA 4V03A 1CRQA 1KTVA 1U0LA 4KSCA 4AKEA 4NDZA 1XX6A 3VKGA 1N6HA 2WBLC 2EWWA 1NJFA 2QP9X 5GJBA 1DG3A 2BMFA 4YLGA 1SXJC 2ZRIA 2H18A 1RJ9A 1VKJA 4BLOA 3VAAA 5FTMA 5CJPA 4L4UA 3B7GA 2IUSA 4W9MC 4MKHA 3EPJA 3QG1A 4XOIA 3GJ4A 4QRHA 4HAVA 4PC7A 4ZDWA 2ZUDA 4UJ3A 2WWHA 1MV5A 1XEFA 4FMDF 2YNMA 4TL7A 1KSGA 2LCFA 1GSIA 5H70A 2IHYA 2ZSFA 4HAWA 3SR0A 3U6BA 1N6KA 4XTCS 3UG7A 1GOTA 1YE8A 1G5RA 4Z8XA 4DCVA 4XSGA 4A2QA 2VHQA 1E9AA 2D2FA 3IPXA 4PZZA 3TMKA 1EFRA 5AJWA 5IDVA 3QSYA 1IHUA 2D7DA 3SYKA 3P4YA 4KXFB 3SC3A 4EIWA 3BD9A 1FQJA 4LC1A 1G7TA 1E4YA 5FL7A 2PEZA 2OESA 2ZROA 3PUWA 3IPYA 2CHGA 1OFHA 1G8YA 4TL8A 3U3MA 3OAAA 3SQWA 4JLKA 2V8OA 2GJ9A 2D4HA 1XTRA 1G7RA 1GL9B 3MJRA 1IQPA 4RY2A 3B5JA 4OQLA 1R0XA 2RKOA 4F4IA 4LOAA 3L8YA 2O8CB 3AVVA 1G8FA 2JAQA 1VG1A 3GJ7A 5DO9A 3KQKA 1ZVQA 1XNJA 3LLUA 4MRPA 4UNRA 1TQ4A 4K8OA 2QAGC 4L9SA 4LBWA 3BE4A 1P2UA 1YZQA 1NSFA 2GXQA 3LVQE 4Q9KA 3WRYC 1RJ9B 1XFAA 3N70A 4KO8A 2HT6A 2X2EA 1ODFA 1US8B 2IYWA 4M4SA 4B47A 4ZI2A 5AUPB 4N0EA 1JR6A 2NPIA 3PIRA 2JEOA 1E6CA 2ZI7A 4TZ6A 4C30A 4DDWA 4OK6A 2MMCA 5E7JA 4AWXA 2IL1A 4XWKA 3QUSA 5FL3A 4C0KA 3B13B 2IYXA 3SJCA 3ZS9A 3QKSA 2ZETA 1I4LD 3TW4A 2VH5R 4UNSA 2HXYA 2RAPA 3P4XA 3UMRA 2OO7A 3QEJA 3TBKA 5E95A 3CRQA 1ZU5A 2D3WA 4JLOA 4BFUA 3HU1A 3RSLA 4NU0A 3GLFB 3CONA 5AUQA 2HLDA 2EYUA 4RD1A 2JLZA 5KNCA 3KKQA 5BW8A 1I4TD 3B1ZA 5HZKA 1UKEA 1VYTA 5DLQC 4DLZA 4D82A 1SXJE 1KO4A 5FOUA 4LJ9A 3CUEF 4C9BA 3H84A 1OFIA 1FUUA 4Q4HB 2OEPA 1A5TA 3I1FA 2CL6X 2FZLA 1FPMA 1OXUA 4PANA 1NP6A 1KI6A 3U44B 1IY2A 1ELOA 2H8KA 2Z83A 4IDQA 2OE2A 1NJGA 2LWIA 3ZZ0A 1FMJA 1HT1E 1KZGB 5BWMA 4JIMA 4UXJA 1FOEB 1GP2A 1W36B 5EE9A 3K09A 2QUZA 1CIPA 1ZM7A 2UZ3A 3IQWA 3WY9A 1M6NA 2HYDA 1KSJA 4IDNA 1MKYA 2JLVA 3LNCA 5J4KA 4URWR 3SEAA 2PX0A 3GJXC 4TL9A 2BEJA 5FOWA 3PXGA 4LX0A 2F1RA 2D62A 2QG6A 4E22A 2DCUA 1D9ZA 4OQXA 4G5OA 3S1AA 2XNDD 4DEYA 2CNWA 3U2QA 3AGPA 4B32A 1XJCA 1OLOA 1S96A 3UWOA 3GLGB 3MJHA 3QI2A 3GLFA 2VO1A 4M8NE 2RHDA 3K0AB 2XB2A 1UDWA 1T6NA 3ASYA 1QHHB 5B2ZA 2ZS7A 1RVDA 3TSZA 3HYRA 4HB0A 4TMKA 5B58C 4XVQA 2C9OA 4JJKA 2OUKA 1ZP6A 5JJKA 3M4YA 1LV7A 1YVDA 3DKPA 4P4SA 1DADA 4DT1B 4AKHA 1WBBA 1RZ3A 4BQSA 1RPZA 1KAGA 3AH8A 4LI0A 3EC2A 2CLDX 1IN4A 4P4UA 4A8JA 2WWIA 3RABA 4QG7A 1S3GA 3NKVA 1XMIA 2J7PA 2FSFA 4F4JA 1Q1EA 2ODEA 4MGZR 1FNMA 2ORWA 2P5TB 2QROA 4PFSA 2XJ9A 3ZD6A 2I4IA 2R2AA 1DELA 1NBMD 3L0PA 1JAIA 5KNBA 2BMDA 1NVXQ 1YR7A 1EWRA 1YHNA 4ZDIA 2ZRNA 1J90A 3NBFA 3C5HA 2I3BA 3KQHA 2A5FA 2ONKA 4OKSA 4D80A 1J8YF 2IUTA 2J7KA 5BN5A 4O2RA 1R4AA 1E2LA 2GETA 1ANKA 2P2LA 1II8A 1XXHE 1F3OA 2Z6VA 4JL6A 1HY3A 1AN0A 1DG1G 4MYTA 2FFAA 3LD9A 3V9PA 4NTZA 4HDQB 1U8YA 1SXJA 2AL7A 5DH9A 3D6TB 4HLUC 3NC0C 4KLNA 1HQCA 1R8QA 1W5SA 2FFHA 3K70B 1NBME 1MO4A 1OW3B 1N6PA 4OJQA 2IBMA 5JRJA 4GOJA 1GTVA 1KDRA 2BKEA 5EUQB 4V0MA 1XTKA 1WCV1 2MSDB 5EXPA 3BK7A 2QM7A 1PUIA 3OESA 3NHBA 4JT2A 4BLTA 4HDOB 1MO6A 4PQRA 4BFYA 3SE0A 4W5WA 3C41J 4Q4JB 4RD3A 1SVWA 1LNZA 2QBYB 2QI9C 3E70C 2XJ4A 2IEYA 1N5IA 3MLEA 1TF2A 3W3ZB 3KQNA 3GFOA 3VR4A 2JLRA 2XSZA 4TMTA 4IEEA 1Q1ZA 1XCPA 3N2IA 4W5JA 1P61B 4XD7A 3W5IA 1CJKC 4JVMA 3FKSD 1UJ2A 1ESMA 2GJSA 1IN7A 2P6UA 3RAPR 2VSFA 1E2GA 1WXQA 1OIXA 4M22A 2PJZA 1EX7A 3ADDA 4Q9HA 3RS5A 3KB2A 1XEXB 4NL4H 2HJGA 4FXPA 2DFKB 2JIZA 1VCOA 4NH0A 2REXB 5IK2A 4A0HA 1XZQA 3EPKA 4EJSB 2ANCA 3P27A 2BM1A 4TZ0A 1J2JA 2IYSA 4TMVA 1G7CA 2H7VA 2GXSA 1N6RA 1DPFA 1Z0FA 2KB0A 1Q44A 1JPJA 3EARA 1N3BA 4NP6A 2BDTA 1TEVA 4GZMA 2ZJAA 4PZLA 1TU3A 3VX4A 1Q22A 2RHMA 1M8PA 2WWXA 4TYQA 3QKRB 2GKSA 1X1SA 1DAGA 4PPGA 4UNNA 1B23P 4OQMA 2KJQA 2NO9A 3G82C 2WMNB 4KI0A 4YDSA 2ZE8A 5F98A 1SGWA 4C4PA 1S4QA 3AVYA 4HSEA 3UMFA 3GLHE 1UBEA 5GVRA 5DIFA 4KYIB 1Q1QA 3SBEA 3RNLA 4O2LA 5G3YA 1OXSC 4C0HA 3ICQB 3OE7D 1NI3A 2A78A 3CX7A 3O8CA 1L7VC 2OT3B 2IYRA 4HUQA 4DLYA 4EFNA 1RKBA 3MMPA 4MYCA 3TSWA 1Z2AA 4XH9B 3SDZA 1M34E 1N25A 2WJIA 1BIFA 3LAWA 5A5GA 4GMDA 4HZUB 5TB5A 2WHXA 5G40A 4A9AA 5DYIA 4P4TA 3IHLA 1AM4D 2REBA 5C46F 2IK8A 2V1XA 1W48A 1XCGB 1NNEA 3T61A 2ECKA 5JSZA 2VSXA 1CKEA 1VYVA 2TMKA 4QGGA 2YOFA 5KHOC 4QL3A 3I3SR 1IXSB 2PX3A 2VHUA 4WBSA 5EXXA 3QF4B 1NLFA 2ZS9A 3W9YA 4F7WA 1OV4A 4IVRA 4JLVA 3T06B 1AGPA 2VHTA 4MITA 4B35A 3MAAC 3QPUA 4U7DA 3AVOA 4X8MA 1P7CA 4TMXA 2DFLA 4A2WA 1NN1A 3R8FA 2DB3A 4DZZA 4RJLA 1XMSA 2ZXUA 1BYUA 1Y3AA 2QPAA 1Q3HA 1NVVQ 1J70A 3VNVA 2NZJA 4DCSA 4E07A 2KBFA 3L2OB 1LF5A 1RRPA 4I1OA 2FSGA 3T1QA 4DLRA 1DS6A 1GZSA 3CPEA 1A7JA 2YYZA 4LGMA 3GLGA 4TYWA 1SULA 5L3RA 2ZJBA 2YWFA 4Z1MD 4CEHB 3WXMA 1IONA 3CPHA 4CRWB 1P9WA 1OPXA 3E2IA 4PSKA 2GJKA 3Q7PA 4P32A 1OH7A 2A5DA 1FX0B 2HEIA 3QBVA 4B3FX 3EIEA 3ZS8A 2EFGA 4V0LA 2VL7A 1XXHA 1DAEA 4LRWA 4OI2A 1NVUQ 1S1MA 3AP2A 2WWWA 3TAHA 1KIMA 4XWAA 3PITA 2ZRCA 4QHTA 4ZI3A 4NYIQ 4A0FA 1K5DA 3H0KA 2R6AA 4NYMQ 2WM9B 2B92A 1F2UB 4NONA 4CYMA 4YMWA 1Z29A 3IGFA 2X2FA 2P5SA 1ZNYA 4JL5A 3R8CA 1XEWY 2O8BB 1Z3IX 1VECA 1OH6A 1G4UR 1ZRHA 1KI8A 4ESHA 1VHLA 2FEMA 4BFVA 4GL2A 3IIMA 1SKQA 3A4MA 1SVIA 2YZ2A 3KFXA 1Z0AA 3EZ9A 4L9WA 3TLXA 4KAXA 4LYAA 2PZEA 5JJIA 1PJRA 3UATA 3QF7A 1K6MA 3K53A 4RZUA 3DO6A 4KBGA 2VHCA 2F3TA 1Z28A 1KK2A 4KU4A 1XCMA 3H86A 1P6XA 2XOKA 3W6PA 5F3WB 1Z22A 4PQFA 5JWRA 1VG8A 3H2YA 5LD2B 4W5HA 1L2TA 3X2SA 3KKOA 2I1QA 3JZMA 2WPDD 5SZHB 3BGWA 1ZIPA 2IA5A 3KFVA 3UXMA 1K5GA 3AKDA 5CM9C 3ADCA 4FWTA 4JYBA 2B8TA 2ZRHA 3PQCA 3BIFA 1Z08A 2ZR7A 2QZ4A 4MDEA 3GEHA 5EE3A 2GEVA 1KI2A 4XVUA 1BMFD 3FTQA 4NHOA 1X86B 3KTAA 1E9EA 3AF3A 1E2JA 2ONJA 2QAGB 2J45A 4MQBA 3U6KA 5DSZA 1CJTC 1GRQA 4GNKA 3AVUA 5FPSA 4TLBA 1MABA 5CYOA 4JLDA 1Z5ZA 2WSMA 2G3YA 3OEED 5FBLB 3B9PA 2IEZA 1FMLA 3GJ5A 4EQ6A 4LJ5A 4JSYA 2ZRFA 3T1TA 2FA9A 1UAAA 1U8ZA 2XAUA 2J0SA 1EWQA 2A5GA 3BBPA 1DARA 2PMKA 1WE2A 1VYUA 2ANBA 2CBZA 2OLKA 4A6XA 2C9YA 3AVTA 2A2ZA 2DPXA 1HUQA 4WOPA 1LS1A 4LHVA 1GNPA 5HPYB 4ON9A 3LY5A 2OAQ1 4M1SA 4B3XA 3DM9B 3NH9A 4PC1A 3LV8A 4ACAA 4U02A 3L82B 4M1OA 5CK5A 4B71A 1AJEA 4MGKR 2ZM5A 4C0SA 2CDNA 2IHBA 3K9GA 3BJIC 1ZD9A 1T3HA 2JJ2D 3EAQA 1E2DA 1TUIA 2BCJQ 3MFYA 4OHWA 1CR4A 1QZXA 2RGBA 1QG2A 821PA 2JLSA 4O25A 5DGXA 2IYQA 2XEXA 1ZD1A 2QTVB 1OYWA 4MKGA 3WYFA 3V4RA 2ZUBA 1N0UA 4QFMA 2IWHA 1NN3A 5FL7D 2ZRJA 2AXPA 521PA 3I8XA 5H1YA 1XJ0A 3IIKA 2G83A 3W90A 5KUTA 2Q9AA 5JMTA 1P62B 1ZM2A 1JR3E 2ZR9A 3NHAA 3T12A 4OI0A 2JA1A 4NE2A 5FPTA 2QORA 4B44A 3DZ8A 3K70D 5EE0A 1NSTA 1R2QA 1U9IA 3RS0A 1E94E 2H92A 2DFNA 3I5XA 1V5WA 3D8BA 1JECA 2R62A 1E0AA 3QNUA 1W49A 2LKCA 1E9BA 4LY6A 4DDVA 4MRVA 1ZIOA 4LBYA 3WBJA 4OHXA 5IK2D 4NCNA 5L3QB 4TLEA 2RGGA 2F7SA 3KJHA 1KK3A 1NIPA 1LVGA 4Q00A 4ZIRB 4HI0E 2QGZA 1XPOA 3TR0A 2C03A 1IN6A 2FU5C 1W1WA 3RHFA 1GG2A 2C95A 1G9XA 1J99A 1UBCA 1ZM9A 3BORA 4AC9A 2EWVA 4LPKA 3LW7A 1UM8A 2QNRA 1U0HC 4PO9A 1R0YA 3ZGXA 2ZEJA 3DOFA 1KY2A 4OQNA 1KI3A 4Q4JA 2OFWA 5CJ2A 2QBYA 1N5LA 221PA 1XD2A 4RD4A 2XZPA 3NC1C 3KKPA 5TVKA 1U99A 1T5IA 4IFBA 1YR9A 4DIEA 2FDCA 1UF9A 1KYIA 4Q1AA 5FOTA 3I61A 3ZVMA 3U44A 3W3AA 2IWRA 2YKGA 3KUDA 3NTUA 4HAYA 3BOSA 1D2EA 3ICEA 4QBFA 4MUAA 4BLRA 1XDBA 1XZPA 4JVNA 4BRUA 3BB4A 4FCTA 1GL6A 3FKQA 2XNSA 2IS1A 2CVFA 3QBTA 5FR2A 1E32A 4TQAA 2VP9A 4HB2A 3EG5A 5GJCA 3QENA 2ZYWX 1NY6A 3OEHD 3QEOA 5EP4A 1BH2A 3B85A 2HV8A 1LS6A 1E1RA 5F2EA 3TQCA 4LJ8A 4AYTA 3EA5A 4O3MA 5TV2A 1LB1B 1RIFA 2ZRGA 1JAHA 2ODNA 2VP5A 4AYWA 2C9CA 1OJLA 3S1AB 4MRSA 3KKNA 5FBWB 2N46A 3QKRA 4DSNA 1XMJA 2WIAA 2ZR0A 3J81k 3ONWA 4LBZA 2VEDA 4BFSA 3FB4A 2H57A 2KBEA 3AUXA 3ZDQA 1OH8A 4G1UC 2JLYA 4PSVA 4R2IA 3RLFA 1G18A 2OCBA 4ASUD 5B64A 3V4FA 2F6RA 5AUOB 2Z0MA 3ETLA 1Z8FA 3GFTA 1G4AE 2WKRA 5TARA 4TYYA 2GK6A 2J7PD 4ASUA 3OF5A 2GRJA 4ZO4A 2BEKA 1ZJ6A 4E09A 4PC3A 5J4YA 3FMPB 2MSCB 2AR7A 1Z2CA 1Q12A 2YHSA 1GUAA 1E0KA 3QJYA 2GCNA 4QJ4A 2F1JA 4M21A 3DM5A 4IOLA 1AQUA 4M1YA 1KHTA 5B30A 4S2EA 4GPTA 1X1RA 3LA6A 2QPOA 2GF0A 1U81A 4XTRA 4EPVA 1KDTA 4LJ7A 4LYFA 2J0UA 5A4JA 1XB2A 2PBRA 4Q1BA 1C4OA 2IXGA 1AA9A 1W47A 4FCWA 5BN4A 1FP6A 3QIAA 1G8PA 1X8KA 3CF0A 4D0LB 3CB4A 4PQYA 3VHLB 4AYXA 2IS6A 2CNWD 5FI1B 2Z4SA 2ZREA 4NBSA 4EJSC 5KPDA 4AKIA 1YKSA 4D2IA 4Q7MB 4EPRA 3IDQA 3BAFA 4IVPA 5BYKA 3TAUA 3EZ2A 2Q6TA 3SNHA 3LRPA 4RCZA 1Q57A 3CR8A 4GFDA 4EQ6B 2XITA 2QE7D 2CCGA 2Z43A 2ZI5A 5JWOA 5B57C 3LX8A 4QHSA 4I1VA 3I5YA 4HB4A 4PPFA 3SBDA 2CHQA 1KO5A 2QTHA 2UZIR 5FOSA 2O8CA 1JJVA 4LSGA 4KHZA 4QKQA 3WP0A 5L3SB 2WWFA 4Q02A 3KL4A 4M9QA 3TUJC 1XTJA 4KFTA 2R6GA 4PC6A 2QP3A 5UKDA 5DE3A 5LD2C 3HWSA 4BFXA 4KCGA 3ND8A 4JVLA 4NYJQ 4H9GA 3D31A 1YU9A 2IW3A 5DI9A 2YWEA 2PMDA 1OFTA 3SYNA 1N5JA 2KSQA 2REOA 5GADl 5FTNA 3DZDA 4ARZB 4MDFA 2BV3A 4JS0A 4C0JA 2GJAA 3LBHA 3LX5A 4CEIA 4IDHA 3AF4A 1J7KA 4MUBA 1YZGA 2WJJA 4JJZA 1Z06A 4R7ZA 3AEZA 4EPXA 3SZRA 1CR1A 1T5LA 1F2TA 3C5CA 4LUCA 1R10A 3EX7C 3R9IA 2OHFA 1II8B 3MWJA 1N0VC 5AR1A 2E1RA 3THXB 1JI0A 1NG1A 3WYAA 3A58B 4M1KA 4NYIR 1W4RA 5CB6A 1NMYA 2W6JA 3IUYA 4DWJA 5SZKB 4II7A 4FCVA 3K0FB 3P26A 4LBVA 3VFDA 1M7BA 3A1VA 4HAZA 2BMEA 1LFDB 3OFND 2J46A 3CO5A 1KJZA 1JQJC 2AFIE 2HLDD 2V54A 3SFZA 5DHFA 1FNNA 3IEUA 1Q1BA 4KODA 4P3YA 4XVRA 5C2JB 3TSOA 1KNQA 4B3DA 3H1TA 2HF8A 4GBMA 5HR5A 1P4SA 1ZCAA 4LZZA 5KOYA 3TGPA 4D26A 2I1VB 2G77B 1CF4A 1GVNB 3BH7A 2EFCB 1BYIA 3FHOA 1LW7A 1QHIA 3A36A 3AVXA 3PEYA 3DPUA 2QAGA 5CITA 3WMGA 3RYTC 2J87A 2FPMA 4DUGD 1PZNA 3THOA 2PL3A 3AGQA 4QBHA 2AN9A 3BXZA 2BBOA 2GVDC 3BB3A 4IOMA 3L43A 1JXOA 4Q1CA 1CEEA 4AD8A 4CT5A 1E0SA 4FN5A 4Y0VA 3ZYCA 3CX6A 4HUQB 1NL3A 3BC1A 4K81B 1R0WA 2ZS8A 1PLJA 4TLAA 1IN8A 1KMQA 3L0OA 2BVNA 5FTLA 2QA5A 5EE1A 6Q21A 4C2UA 3PVSA 2ZI9A 5FUXA 4LJYA 3FHCB 3JVUA 1F2TB 2Z5FA 2ZRAA 5FPYA 1SKYE 1JJ7A 2EVWX 5KDLA 4UKDA 1H8HD 3NVAA 2XXAB 1Z47A 2A3RA 2C98A 3T15A 1JNYA 1Z0JA 2WV9A 1P2VA 1D9XA 1JQLB 1D2NA 3ZVLA 3U4QB 5FOVA 3QQ5A 4KVAA 4DLTA 2NQ2C 2R6CA 3C15C 4CT4B 4A15A 3K9NA 3ND9A 3W34A 3THWB 4BE7B 4GMXA 3CF6R 3LDAA 3VR3A 4US0R 3K0AA 4FINA 4PC2A 1W0JD 4TN1A 2WPDA 5TMPA 2WAXA 2IF2A 2ODBA 4BEJA 2Q9CA 2F9LA 2RGCA 3CX8A 3QKSB 4GT1A 1R0ZA 2BMJA 5DHAA 2OCPA 3LWNA 5JEDA 2D06A 2WJHA 2V3CC 1NF3A 3VU9B 2ZAOA 3D3QA 1BS1A 5CLLA 3KDSE 5FUVA 4B3BA 1G8GA 3EPLA 4K46A 1UPTA 2GESA 1DAHA 3IBGA 4RD0A 1L4YA 4M1TA 4I1SA 3D7MA 2DY1A 4WW0A 2CJWA 3CM0A 3MGCA 2DBYA 3GLHB 4GSYA 2FE4A 2IYUA 3N5CA 3CIOA 1TQ6A 1RE0A 4NPHA 2GILA 2FFQA 4Q9IA 5EXTA 4RZXA 1NMZA 4YXWD 2G0TA 2O8FB 3FFAA 4TQ9A 2R6DA 1PV4A 1YZTA 3QF4A 3K9LA 3SHFA 4N0DA 3GPLA 1G41A 1NKSA 3Q85A 5JLJA 2GZDA 3IEVA 3RWMB 3IBYA 2O8BA 2PEYA 4KSBA 3DMNA 1OB2A 1QHXA 2VHJA 2NPFA 1E99A 2HXSA 1E2EA 1KJYA 4URVR 2O0KA 3QY0A 4WXPA 4Q4AB 3CRW1 1TF5A 1GRRA 2BOVA 2RGNC 2PH1A 3X1YA 4QJ3A 3EPHA 4RCYA 3EXAA 4DC9A 3B78A 4ZPXA 2GAAA 3B1XA 3BERA 2ORVA 5FR1A 3VHXA 1OH5A 1OT3A 3AKEA 5SZJA 5HKKD 1V43A 2Q9BA 2W83A 3DOEA 3AVQA 4OJKA 1VDZA 4IHQA 4QC2A 3GD7A 1MH1A 1E2IA 1ZAKA 1G3IA 1XXHB 2BBTA 1FL9A 2OLJA 2IF0A 4FMCF 1UFQA 4MRRA 1Z83A 3A6PC 2XTZA 1PVOA 3B8HA 4G5RA 4TTQA 1TPZA 1F48A 1SVMA 2XTNA 2V55B 3RSOA 3NDPA 2AWNA 2IYVA 3EZ7A 5FFMA 4GDFA 2P67A 1F6BA 1SVOA 1JB1A 5EUMA 5FTKA 3U3RA 5L3SA 1QHHA 3DEFA 1YZKA 4B2IA 3WNCA 4DSUA 2FOLA 4DEXA 1U90A 1A1VA 1TAGA 5K8UA 1FTNA 1DAFA 1JEDA 1T9HA 1EGAA 2YINC 3AUYA 1KDOA 3EWSA 4IDPA 5AWFC 4BEBA 5HKKA 3W6OA 3HU3A 1QG4A 2SHKA 1ZCBA 2RGAA 4Y0AA 3CH4B 3TQFA 1GDDA 1IOZA 1EX6A 2ATXA 1CJMA 2CE2X 2QSZA 2ZVPX 3MSXA 4JBYA 4KFRA 4V0ME 3X1WA 1ZNZA 1U98A 2A5JA 5JZVA 1XEXA 2ERYA 4B43A 1OSNA 2ZPTX 3CRMA 1OFUX 4DSTA 1GM5A 4YDHB 4EFMA 1VCIA 2ZJOA 3TVTA 2JJ2A 2HF9A 4A1FA 1VG9B 1G6HA 2GTPA 1G7SA 3CRVA 3HYTA 4IXMA 4LHZA 4F4CA 4PR0A 1OKKA 2JLXA 4LJ6A 2W2TA 1E1QD 4LPSA 5J47A 1E2FA 1E2NA 4EPTA 1E1RD 2ZITA 3GLIE 3SS8A 3T1OA 5JRZA 1W2GA 2C78A 1T8TA 2BCGY 3OEHA 2OAP1 3CWZA 1ZUIA 3LH5A 5JHGB 4IOJA 4L8GA 3FFBA 1N6LA 1T4GA 4P33A 2H16A 2VP2A 1UKYA 1WRBA 1T0JB 4EDHA 2OXRA 2YC2C 5C4MA 4X8HA 3OAAD 2R6FA 3RS7A 3LVRE 1MOZA 2QN6A 3B60A 4BWYA 1G291 2E9SA 1GL7A 2Q21A 3K8YA 2QQEA 1G20E 4GP6A 2O8DA 1DO0A 4Q01A 1ESNA 1H8EA 1HEIA 1MR3F 2BBSA 2FN4A 3F3YA 3MUFA 4YQFA 5FH9A 4OL0A 2YOGA 2NO0A 1EFRD 1UEJA 4PZYA 2BM0A 3F8TA 4YMUA 1NLYA 1XTIA 4KFSA 1BMFA 2QMEA 2C8VA 4C3ZA 4MKFA 1WBDA 1N5KA 2QSYA 2VSOA 3DMDA 4TQUS 2B7CA 2AK3A 4RKEA 2OBLA 3PV0A 4NYMR 5KSPA 5SZIA 5TY0A 4BZQA 2Q3MA 1G64A 2C5LA 1OXVA 2OG2A 3FKSA 3I8SA 4QNRA 1VMAA 3IHWA 2F1IA 5DYGA 1G21E 1VCNA 1W36C 3K0CA 2JLUA 1IJEA 3U3OA 2EFDB 4TTRA 3VR5A 5C18A 3NG1A 2J5XA 2L0XA 1ZC4A 2J59A 2YJTD 4ZCLA 4PO1A 3NBYC 3L0SA 1DVRA 1Q3TA 2JATA 3ECCA 1N6OA 4WIAA 3FDIA 1OIVA 1H65A 4F93B 4BFTA 1AKEA 2GCOA 2ZRKA 1OIWA 4DLXA 1II9A 5DNYB 3KQUA 3RRZA 3ZQJA 1SXJD 3RDPA 1D8TA 1KK1A 1R5BA 4D4MA 2ZVQX 3IKJA 4URUR 3CNLA 1DOAA 3WHKA 1P9NA 3ASZA 2EFEB 4G3XA 1P2SA 1SVKA 2FNAA 1UBGA 3SJBA 2P0EA 5FUYA 4DUGA 4Q4LA 5JCZA 3BFVA 1HV8A 3KQLA 1RRGA 2ZAMA 2DHRA 2J0VA 4D4JA 1RRCA 1KI7A 2QRZA 5CK4A 4S35A 3UMSA 1IBRA 1N6IA 3WMFA 1G5TA 2WSSA 4ESVA 5KO2A 3U3KA 4DXAA 5BQ5A 1CS4C 2WICA 2ZSAA 2CXXA 3DL0A 4TLCA 2JLQA 2BJWA 2RB4A 1ZM3A 4JKYA 2OBMA 4GP7A 1G3UA 1W2HA 1E1QA 2AKYA 2PZGA 1T0HB 3I92A 5D3MB 2ZSBA 2IX3A 4BLSA 5ELXA 2KE5A 4HLQB 4QBGB 3OIYA 1QRAA 2JLWA 2ZQ5A 4KYUA 2NOAA 1I2MA 4WXRA 3RANA 3NEYA 1QHYA 3GJ3A 3WNDA 2NO6A 2NTYC 1VCMA 2OV2A 3GMTA 4TYNA 1US8A 4IVQA 1ETUA 3TRFA 2JIZD 4L15A 1YJ5A 3DVLA 4MKIA 1CULC 5CIWA 5FOXA 3U60B 2C2HA 2NO7A 1EFUA 4QJ5A 2NIPA 1M2OB 2XX3A 4GOXA 1P9RA 2WJYA 3RC3A 5JECA 3EA0A 3CF2A 1ZW6A 2AFHE 1RW4A 3L0IB 1KY3A 1NIJA 5AUNB 5KPJA 3PCRB 4CEJB 4BLQA 3SHWA 2F43B 3VQTA 1D2MA 4Q7LA 4Q1FA 4DRZA 3TH5A 3AF0A 4RFVA 4C0AC 1ONBA 4LV5B 4FIDA 1BOFA 5FBQB 2FH5B 2B7BA 5KSYA 1PLLA 2KI5A 3CPJB 1R6BX 3CH5A 2QT1A 4BLPA 4HAXA 1DEKA 1HT2E 4Z8YA 3G5UA 2HDNB 3MRSA 3WYGA 5JS7A 2E87A 3AP3A 5KDOA 1G3RA 3ZH9B 2ZTSA 1KO7A 4D81A 4QGFA 4FMCB 4Z54A 4A0RA 4DB2A 1DE0A 1XPRA 2QT0A 2IUUA 2G1JA 3W8RA 1G6OA 3ADKA 5AJZA 4RFSA 5EE5B 2IYLD 2W6ID 3SYLA 3KB1A 4EFLA 1E98A 1QDEA 3W8NA 4Q1DA 1EFCA 1S9DA 4NCKA 3T34A 4XSHA 4R98A 3EASA 4D6PA 1LF0A 4LHXA 3RVBA 4DIDA 5JHHB 4V0KA 2FX3A 2PLFA 3BH0A 1EFTA 1OXXK 3A37A 4M2LA 2WTUA 4A2PA 3O8BA 4TTPA 1S8FA 3TUZC 2W0MA 2O8EB 1IY1A 1QHSA 5BN3A 5JFGA 2J3EA 4HYYA 1IN5A 1W0KA 2CHVA 1U8AA 2RCNA 5JEEA 3V00A 4QGAA 2VQSA 4ARZA 1U2RA 3HR8A 4UXHA 3E1SA 2V7QA 1PLKA 1ZBDA 5IRCD 1LTQA 2JDID 3I72A 3VNUA 3EC1A 2GEUA 4AK9A 4ERNA 2OCYC 3A1WA 4AG5A 1G5PA 1UKZA 3PEVA 4Z1MA 3HJNA 1R5OA 4WAUA 1W36D 4A6PA 3B6EA 3EIHA 2VPPA 2Q3FA 4B3GA 1SKYB 3CZPA 1ZM4A 3MWYW 1EK0A 1YZUA 3TW8B 2G6BA 1D5CA 3A1TA 4HB3A 4B75A 4PPQA 2DFTA 2ZU6A 2YV5A 3CBQA 1OXTA 3KTAB 2ZRBA 3TK1A 1E79D 1H8HA 3A4LA 1TUEA 1YQTA 2BIFA 4POAA 4GOKA 1P72A 1W0JA 2J1LA 1OF1A 2ZANA 4X8LA 3M0EA 1YRBA 3KJIA 4A82A 1UEIA 2WOOA 4W7SA 4OHZA 3A1UA 4JLNA 2QMHA 2GBLA 5F9HA 1XU4A 5E4FA 2YWHA 2CLSA 4YMSA 2OXCA 3MD0A 4A8JC 3GQBA 4IOKA 2O52A 4U00A 4Q5IA 2ZI3A 4Q7JB 5FTJA 3X1XA 2XZOA 2CK3A 4HDCA 2PZFA 4HZUA 2H17A 2IT1A 2P6NA 3F0TA 3BH6A 4Q7KA 3FOZA 1FW6A 1AIPA 4H1UA 2JCSA 1OYYA 4B34A 1E69A 4JMPA 5L8VA 1P5ZB 3KUCA 3T35A 3LFUA 3U7HB 1NBMA 3OE7A 2GCPA 5M04A 2W58A 2GAOA 1ZUNB 2HCBA 3QXXA 5FPHA 2N1BA 3X1DA 3HPQA 1TADA 5HTKA 3ZVNA 3QKUA 1IAQA 3RRNA 3FHTA 2ZSDA 2XGJA 1KSHA 3PG5A 4GRAA 4JLAA 2OILA 2X19A 3VKWA 3AM1A 3AVWA 2W0SA 3MWLA 3GP8A 4XIGS 4H1VA 3THYB 2HJVA 1T91A 4DJTA 3UPUA 1WP9A 2CL7X 3G0HA 1A4RA 4IFEA 1AK2A 1R5NA 4B73A 1T8UA 3OHMA 3R20A 2PT5A 1CR2A 121PA 1IXZA 4CEHA 4NKRA 1LY1A 2NG1A 3FPAA 1ZU4A 2CEAA 3I73A 2FFBA 4JT4A 3Q5DA 4LHWA 4CIDA 1Z0DA 2ZYTX 3UG6A 1E2MA 5D3QA 1KI4A 2DYKA 1BO6A 1M1YE 4OQFA 2XNDA 3WHLA 2V9PA 2MSEB 4C7OB 1J8MF 2AD1A 3QPWA 4G5GA 2WKPA 2O5VA 4XD7D 3IO5A 1I4DD 3C7KA 4BGDA 1OHHA 1Z6YA 2W6JD 4ACBA 1UKVY 3B82A 3GEIA 4V0NA 4BPBA 2J9RA 1RRFA 1NY5A 1YZNA 4IW3B 4I81A 4KLZA 5HE9A 2VYFA 5TDHA 4URZR 5CM8B 5BYJA 2RGXA 1SHKA 3Q3JB 1NKTA 4PX9A 3SOPA 2F1HA 2FV8A 2YWGA 1Q20A 3QOFA 2FG5A 3WNBA 4JL8A 4JLBA 3KXKA 4WZAE 1GNRA 4BASA 5JI3E 4ABYA 4HUTA 2RH5A 1HTWA 1E4VA 1KGDA 3I62A 1SVLA 4N3NA 3SI7A 4ITRC 1CP2A 5H68A 3TE6A 2K5UA 3U7EB 4FI3C 3FWYA 1IXRC 3R9WA 8OHMA 3RS3A 3W5JA 2PCLA 2GDJA 2UVQA 1Z0KA
chains in the Genus database with same CATH superfamily
3CKLA 4BRWA 1NMSA 4TYPA 3K5WA 4EUNA 1O94A 4OI4A 1U1GA 2IFTA 3BWBA 5JXHA 1FBTA 4LW8A 4Y2JA 3GPBA 4BNWA 1GZHB 1MRSA 1R3UA 3VU9A 4M7RA 3A8TA 4Q18A 1ZZEA 4JVSB 2RGEA 1PT7A 2QXYA 1ECGA 5JALA 3SC4A 3WBKA 3OJLA 3EIQA 4OQZA 1WWKA 3DOUA 4QASA 4KJZA 4HEA6 3BA6A 4I1PA 1P1FA 5E3HA 3QEBZ 1F5NA 2MMGA 4I99A 4EW6A 4YXWA 1GRVA 2WA1A 2GA8A 1TO6A 2A9KA 2ZYHA 3AF1A 3KS9A 2OXTA 3TSYA 4KLAA 3WLRA 1UJNA 1WSWA 4QT0A 1A9XA 1WS6A 2WVAA 3BGDA 4A6EA 4ZVLA 1PDOA 5ICSA 1IM8A 2C2XA 2Y77A 4HEQA 3ONDA 1T6ZA 2IU0A 5JU6A 2BSAA 4CTOA 6REQA 1MT0A 1UBNA 4OSEA 1E6KA 4QXPA 2BW0A 1FFDA 2XCIA 4LJAA 4P38A 5ITVA 2UZ4A 4DC1A 2O05A 3DDCA 2BD0A 1SKAA 4C22A 4YMTA 5KSZA 3DJFA 4P36A 4TTSA 1JQDA 3NRBA 4XDGA 4ZO6A 3WLMA 1RAEA 3QPBA 5K8VA 2QTFA 1EFVB 1W30A 1LK7A 4CMEA 1ENPA 3C7DB 4XAQA 1XQVA 1VGRA 2AYXA 4K9KA 2OHJA 5KCZA 4B82A 1I7DA 2IXFA 2LUOA 2QNIA 4BVBA 4JZKA 1HI9A 5JAIA 3HGQA 1D6JA 3O8NA 2GNAA 2OCGA 4Q21A 3TRHA 1G2PA 1VL2A 3RVNA 1KKLA 5G0WA 1NP7A 3HH8A 5GP1A 2Q0XA 2PLAA 1AGRA 4BUZA 1JXMA 1TMGE 3E27A 4I4LA 4R7GA 1VMEA 4X6UA 3FPFA 4QXRA 3RBVA 1DB3A 2FSVC 3L4SO 4YRSA 1BDMA 3TNJA 5EJGA 5IJ9A 2J0UB 1C3EA 4Z4GA 2ZYUX 1QFYA 1PK9A 4IUCS 2CLCX 4M0FA 4X3CA 1ULTA 1FEZA 5EZYF 1UJ4A 4WZ6A 5CVJA 3NHFA 3C2QA 1EVJA 1P7WA 5H8WA 3HUEA 2NO1A 3MWDB 1WUTA 3EJWA 1GZ4A 2VDVE 1ZONA 5FLYA 3JQBC 4I55A 3ZJYA 3N0WA 2EU8A 4LCBA 1DCKA 3VKUA 1TIBA 1KE1A 4PVCA 4EMUA 1CJBA 1OREA 3QPVA 1TGYA 4BMDA 1ZOIA 4H0FA 4CEJA 1KH1A 2CC2A 1Z68A 1JHYA 1V8OA 3PDIB 2EQAA 2VJOA 1X3SA 3L7CA 1L7XA 3L1HA 4B3TB 2X77A 2YHIA 3JAWB 1Z7BA 4LNUB 2VBIA 1U0FA 4OHPA 4PYKA 4KN5A 2ECFA 5L3QA 3QLJA 1N0WA 3BHIA 1DWUA 1O89A 2W2LD 5KQPA 1R7RA 4IDOA 3B89A 2IDJA 4D9IA 4HLUA 4D5EA 2XGOA 3QFTA 1PL0A 1U3VA 2FZ5A 2H1FA 4KPYA 5EJ7A 5CT4A 2IXBA 2OYCA 1YZLA 1SELA 1PFKA 3C3JA 4TSFD 3IV9A 5HE8A 1C3JA 2ZJ8A 4B7ZA 3VC1A 5K3FB 3GH1A 1VLJA 4MH0R 3KX2A 4ZZ3A 1RXUA 1L4FA 2BBWA 5KDDA 1HH4A 4HGPA 3DV0A 1VZ3A 5CEFA 4X7PA 3HY6A 1LQTA 2WKQA 2UVPA 2VZEA 4QECA 1Y3IA 4QAQA 3FX2A 2PBLA 2PUWA 1GLVA 3AWDA 1BMDA 4PTLA 1TEZA 2VRWA 3FNBA 2OHXA 2W6OA 1X7XA 3P2IA 5DULA 4X61A 4CLOA 3THWA 3AESA 4PGFA 4Z53A 1YZ3A 4JLPA 3GJ6A 3L41A 4RAQA 1LBQA 1MRNA 2IP4A 2WAOA 2W7TA 4IF6A 4X92A 3R6TA 3K4HA 1JAZA 2PT6A 2QX4A 3WI7A 4E1BA 2YDYA 2R8PA 3HL4A 5FIUA 5EP3A 4AY3A 5JD3A 5KNDH 4G01B 4INAA 2R4QA 1QUEA 4XJSA 1M74A 3FIJA 1PVOA 1RQRA 3LWDA 4I1UA 1TD1A 4HRVA 1JZQA 3RFCA 2QJOA 2P6PA 2XWSA 1GKIA 2P4SA 4G67A 3H9QA 3EFOA 8ADHA 5JI2E 3F97A 2LKDA 4G63A 4BQRA 1SHZA 2P40A 2PS1A 3FGNA 3I0MA 1RRKA 2QN2A 3E05A 2PD4A 4JUCA 3TLJA 1SRQA 1N0HA 3B1VA 3PL5A 4GXQA 5K6TA 2QQ0A 4NCJA 5JD5A 5LKAA 1E2PA 1X8JA 2VRBA 4O29A 3H2JA 4WKNA 4F06A 3EZFA 4DA4A 4EECA 1YK0A 2EJCA 3DE3X 2BGTA 2I99A 4RSMA 1LU9A 4ZYYA 4DB4A 2Z4RA 2UYGA 3PX2A 5TNXA 3D8SA 5KJ6A 5FI5A 1G8AA 1TU4A 1TPYA 2P5YA 3BIXA 1OWOA 4LDAA 3E2MA 3GZNA 3R6DA 2BJVA 3OHSX 3ZD9A 3DHYA 3DMYA 2QRHA 1GN9A 3K6KA 2PRJA 4R2JA 4BO8A 3V2GA 4DV0B 1MTZA 2H1VA 1V7ZA 4J7AA 1KS9A 1KEEA 4H6XA 1B76A 2IZOA 5J9FA 1MQ9A 4HDMA 4QHYA 1F4PA 1FSFA 3E9EA 3AUKA 2EEPA 3KUKA 3MHPA 4ENRA 1CXZA 5JAZA 4F9GA 2W00A 4S1WA 2C57A 2ORYA 4P3KA 2GVZC 4P5DA 4TWJA 2P11A 4AJ9A 2QU8A 4AI6A 5JO0A 3VTKA 2NMVA 3ODPA 2N42A 4M60A 2XE7A 5D51S 4O8CA 3Q5EA 4ZCRA 2V7BA 4X1OA 1FQKA 3BFKA 3BGIA 1M6VB 1LLCA 2F48A 5TGTA 4XCQA 2Z6UA 4YUYA 3RT9A 1L6RA 2ZE5A 1L0BA 3F6BX 4I0WB 1N2EA 1QIJA 2FSHA 1TM5E 3ET5A 4EKNB 4R5MA 5CNIA 3PUZA 4W1RA 4AIIA 5F9FA 1UDXA 4HOYA 3RWOA 3SM9A 2HMVA 4N7BA 1LDYA 3BVPA 1M7HA 5LLSA 5EVJA 3ZTWA 1K7SN 1KI9A 2ZZMA 4YONB 4AZVA 2R68A 5JDIA 1GFIA 4QUKA 5C37A 1Y3CE 2ZJ2A 4U7GA 3ZGYA 1U7ZA 1JR3A 3SD7A 3OEEA 4DCGA 2X5KO 4QU9A 1ID1A 2NUPB 1GUFA 5JSUA 1L7EA 1FX0A 1VI2A 3NM6B 1OU0A 3L40A 2ETVA 2O20A 4RK0A 4UXIA 4BLUA 3KEFA 5DPMA 4KR3A 3W8FA 4CM5A 2Q3JA 5H9WA 3ZW9A 3B1YA 4NMXB 5J63A 2XRMA 3RS8A 5ALPA 4QOGA 2M6LA 2BONA 3WMWA 4Y2TA 5IFKA 1AUPA 1GQYA 1XA0A 5IDQA 3T3GA 4FMBB 1KFBB 3R3ZA 1LBTA 3FSRA 4OGWA 3N6RA 3LY7A 1EBUA 4L6AA 4M1ZA 3C8UA 4NIMA 1U2GC 2RH4A 3IDOA 3WP1B 4BQPA 4HGYA 3LT5A 4UBNA 3CNOA 4DVGA 1ZYUA 2PMBA 3JYNA 4NHEA 5DT9A 2E37A 4YR7A 1B3BA 1PR6A 5DI3B 3X1JA 5HIKA 1JPNA 2UYHA 3PYLA 3UWMA 1O87A 1QLWA 4OK5A 1NRJB 1T9BA 4HFNA 1Q0ZA 3PDCA 3ZCQA 2FVXA 1D4AA 2A92A 3KJEA 4UUNA 5CFLA 4LQCA 3R24A 1GGHA 1DHRA 2FW1A 2VBCA 4WV3A 5DNEA 3PEWA 4BNJA 4D9GA 4GZLA 4XEHA 4F60A 2QTBA 5DBEX 5JBQA 2FPOA 3RARA 1TTQB 3H4VA 1H85A 4IM7A 1ZICA 3WGKA 4CM6A 2Q7XA 2VDOB 3S5JA 2DQSA 3SR3A 4U2EA 3ZPXA 2VQFB 2VF7A 5IAAA 3AR9A 2WZDA 1J0CA 3AQ4A 1DO2A 2Q5HA 3H9JA 5EWLB 2H5EA 1A2BA 2YV1A 3KWMA 4YJHB 1J21A 1VJ0A 5C52B 5DOZA 3A27A 1L5FA 3H04A 3PPIA 4RHFA 1OGIA 2R6HA 3U5ZB 4YWHA 1AB6A 3G89A 4A8TA 2JHGA 2SECE 3U4HA 1EFKA 1G8SA 2GBLC 5C8XA 2K2WA 1GKKA 2GASA 1TLFA 3B9RA 3EVNA 4WZBE 5LXTF 5K8TA 4X8OA 1YZFA 2BEUB 1MDBA 2P9HA 3NUZA 1P44A 3H5WA 3KJQA 1EH5A 3E81A 2E4VA 3IBFA 2QUHA 2GCGA 1XN4A 3OCYA 5DV9A 2X2OA 3DEIA 2YUIA 4JLMA 3RV3A 1FFHA 2OFXA 1OD6A 1V4NA 3QKTA 4PV7A 1BAPA 1C9JA 1SXJB 3IAEA 4YRZA 4TUYF 5JANA 4JJ6A 4WNAB 3UJPA 5KJFA 2AJDA 4G26A 3ZCSA 3ETEA 1WD7A 4E6PA 2QPLA 3LIIA 2WMDA 1TMYA 4OLHA 2G9NA 4MPRA 4B4UA 4FW9A 3K3PA 4UM5A 1M8GA 4HP8A 1XDZA 1O54A 4LWOA 2HGZA 2O1XA 4OVKA 4QIHA 2E55A 3YASA 5C8ZA 4DV4B 4L0MA 5BW6B 2X5JO 4G0NA 5C4GB 1J1UA 1WXHA 3BGSA 4RKQA 1EPUA 4B3HA 4ZCIA 2CXPA 1C8BA 5CLGA 1CY0A 2HYIC 2V74B 4CQMA 3WRXA 2FRDA 4FKBA 3ZWBA 1XQ1A 4MJ3A 3S5UA 1XZEA 5KTYA 3ETNA 3PLRA 1AUVA 3ZIAD 2OHVA 4BNXA 4WEOA 4C3UA 2QV0A 4RK7A 3QELB 4MWTA 5JCPA 3QY9A 4CLRA 3QVGA 2QUJA 4ZT5A 4H0CA 2QW0X 4QO7A 2YC4C 4WUVA 3ZNQA 4JLJA 5FPKA 3FYHA 1QYRA 2FQWA 1J0DA 3CR7A 3JATA 3BD6A 3QITA 2G9UA 1UZMA 2PMFA 4IEIA 3OPYA 1ZO8A 1N3IA 1Y4SA 3S7TA 2PL5A 3UPDA 5AJTA 3Q72A 4PZ9A 3DLBA 3IAHA 4BL5A 1O9GA 1YL7A 2FEOA 3H9GA 1YMQA 4QVKA 2FE1A 1IQ0A 1QH1B 2D4AA 2V6IA 4ETNA 1V4BA 1EK5A 2F4NA 2Q0HA 2D59A 3OIDA 4JBXA 2QENA 2AWOA 4FEGA 1FQOA 1EFAA 3OCJA 3QG5A 4ZOLF 2VHZA 1KQFA 1IPFA 1KMHA 3UH0A 2H0QA 5AVQA 5ERGB 1V8FA 1E3JA 5AI4A 4OREX 1GR0A 4OD0A 1M33A 5CXQA 3SM3A 3RADC 1QF9A 1RHQA 1L4KA 3P0EA 3L0CA 3MMSA 5D01A 1DBWA 2O1EA 2ZOSA 1PL6A 2DT5A 3VKHA 5DGCA 3LBNA 2O8DB 4A4DA 1RYFA 4OKIA 4G41A 4PHGA 4ROTA 2EYQA 5DP1A 3W6ZA 2J9FA 3KR0A 2PS9A 2XSZD 2J85A 3PF8A 3VSBA 5D3MA 5GWXA 1S2DA 3HHEA 4ZREA 1RWKA 3V8VA 5CFRA 4B0OA 3CUUA 2PMWB 2QRNA 1CX9B 2ZKIA 3GY0A 2B20A 2B37A 2B5WA 3M5CA 4HLCA 4XVHA 4F21A 2P8SA 1XTBA 4KBFA 1C3OB 1CQJB 5EPEA 2HN9A 4NZYA 3TRJA 1BEZA 1CHDA 1G16A 2JGLA 3N0RA 5A06A 5JH7A 4LFAB 2OZVA 2C1XA 1YA6A 4CIVA 1H05A 3MB5A 2X0FA 4EGFA 5B5SA 3IOEA 1BW9A 5TQ2B 2NYUA 3OCVA 3RSSA 1MQAA 1DEHA 4RD2A 4JI5B 6YASA 5GZ3A 3U49A 4TKMA 3HEAA 3HJRA 1XBTA 4EYGA 5AM3A 3QMWA 4XD2A 4B0PA 2R4UA 4UQPA 1M3SA 2AOTA 2QGFA 1U1CA 2ZYAA 3Q0EA 1R4NA 2INGX 1THGA 4C4SA 2P9BA 1P0QA 3CLRD 2HHLA 2FTKE 3I64A 4DSOA 2XWBF 2RD2A 4NABA 1IIRA 4YQYA 4UNQA 4DLSA 3QVWA 4FD2A 1XELA 4HN9A 3IKTA 1INLA 1GGKA 2FZKA 5DCYA 2NVOA 2BR5A 2G5TA 3NEAA 3O8OB 1T1IA 1KY5A 1LTHR 2B6HA 3DR3A 1BE8A 2V9CA 3KSRA 1SK8A 2VWGA 1VB3A 1VIMA 3BWDD 5BV0A 2HHHB 2DLCX 4FXOA 4NQZA 1EESA 1RXEA 2AX4A 1Z17A 2W6IA 1IM2A 2ZRLA 3D3NA 3TKLA 4QTUB 4UARA 3FOFC 3PJRA 2VF2A 3N8DA 2WE8A 4RHUA 1CLUA 1OJ7A 1Z6TA 2AJBA 4M9SA 1B6RA 2YW2A 3AKCA 5K3AA 1NRXA 2I03A 4D3DA 5CXUA 2G1PA 2HNKA 2Q5FA 3J7TA 1Z16A 5COAA 2GF9A 5HUQA 4S04A 3A6HA 1TM3E 2WQ6A 1VTKA 2WHYA 1K6JA 2ZSEA 3S2YA 1KAEA 1I9CA 4TKLA 1JDJA 1C3LA 1S2OA 3FGOA 3IJRA 1CIVA 3HU2A 1VIYA 1X8LA 1E2UA 4ALKA 2XCLA 3F7MA 4C0BA 4C5BA 2YQ5A 5ERXA 3UN1A 4BFZA 3ZWAA 3EUFA 3VR1A 1F3LA 4DG8A 1T24A 1T10A 3GLGE 3B1WA 1H2ZA 2R96A 1O6BA 2XOXA 4HEJA 1TQ2A 5C31A 4DJAA 4EY8A 1XEAA 3VVCA 5DGIA 1RYMA 3QPAA 4J7XA 2H1LA 1Z33A 2BGJA 2FG6C 4XRGA 5KIAA 4EG3A 2R8XA 3ZY4A 3OF2A 2R65A 2FF7A 1A71A 2GM3A 1ZEJA 2DWCA 2EZ8A 4HNTA 5KBYA 5JVDA 2DMRA 3NH6A 1CUEA 3IUPA 3Q6MA 2VXOA 1XWIA 1YOVB 3D9QX 1Y6RA 2XVZA 3D8UA 2GPAA 3W4JA 2C04A 4LGCA 5JQGA 1H3FA 2GEDA 2J9ZB 4XPIA 4L6IA 1G8JA 3M4JA 1DKRA 1RYHA 1RRVA 4FHFA 1CNFA 2B30A 2BUBA 2WF5A 2YRXA 4AKSA 1Q0TA 1G66A 3EFEA 3H8WA 5AOBA 1G42A 4PXSA 1MLDA 3BWMA 3WLQA 2EJUA 2IOFK 2PRZA 4PS0A 3E1KA 4Z9YA 1K8RA 1VXOA 2NU9B 3VPBA 4JI8B 3KWJA 4QEZA 5K8LA 5CHEA 2DETA 5LB4A 4DCTA 1YMVA 4M53A 4HUTA 1USVA 3TJRA 1JLLB 1TJ4A 4YAJA 4QYXA 2XYGA 1CFJA 3E3LA 5ANRB 1HG0A 1UBOS 3G49A 1A7UA 3A11A 1QHEA 2I6XA 5DNVA 4ZC1A 2IV7A 4DMMA 1C1YA 1ML3A 4F91B 2ODWA 2VAVA 3QVVA 3PDJA 5AXAA 5A3SA 3UENA 5B6IA 3BCSA 5K0FA 3T8YA 2VRNA 2JBAA 3KJZA 3EQ7A 3G3EA 4CUZA 1WDTA 4BKPA 1LPBB 2VA8A 3HZOA 3LP6A 1BTOA 4WKBA 3IO3A 4HG2A 2FGJA 2PUHA 1URPA 4KEAA 5HDQA 5KSWB 3NW9A 3SJZA 1T8PA 1YS1X 3GNSA 2BGNA 3R3XA 4X93A 5E6SB 4FT4A 4CBVA 1Z63A 1VL8A 4LDRA 1KQPA 4QLBA 4RJTA 3PVZA 3IP1A 3O4FA 3OLWA 4FWIB 4OHVA 3OSUA 4PYRA 4GGPA 3U3JA 2A6PA 2C97A 4DCMA 1JAYA 4NZ9A 4PLTA 4X0EA 1KDPA 3WDMA 3K05A 4C78A 1I1OA 2QRLA 1JIKA 2UAGA 4S1TA 1WMBA 4ZZIA 1OXMA 2NN3C 5C3MA 1PFWA 1Y42X 4X66B 2I65A 4MIOA 1W85B 3GBPA 3I28A 1N5MA 2ZBQA 2WP0A 1BFDA 4WNCA 4RTNA 4MLZA 2OB2A 3K09C 1E2QA 2GHQA 4YJFB 1KOFA 4HS9A 4QDXA 4YAKA 2ZDGA 5LDGA 5CCEA 3R3WA 3T6KA 4EUFA 4U9IS 1IAVA 3MTBA 4X3PA 1F38A 2D2XA 2P3LA 3L0YA 3G5LA 4WLUA 3G7NA 5B1YA 5B58T 3I2GA 1GPJA 4M7PA 4UHHA 3VKGA 1MX1A 1N6HA 1CUFA 3MCWA 5GJBA 2VUUA 2QP9X 3UK2A 4YLGA 2ZRIA 1H2XA 4L7QA 1RJ9A 5CT9A 5DM4A 3MPOA 2PGDA 1FDIA 1QH1A 1VB5A 3N0TA 3CX3A 3ZDEA 4IV0A 4XGIA 3KQQA 1ZWLA 4MKHA 5LBUA 3UXYA 4DMHA 1T3TA 5DX8A 1TZJA 5HDBB 1KJQA 3OM0A 4QYTA 3OOYA 1IEVA 1N9GA 4UJ3A 4COKA 2GM5A 2WWHA 2AI2A 1SOWA 1PNOA 2P6OA 1RHJA 3H0CA 4A5SA 7REQA 5H70A 1FMCA 1GSIA 1Z37A 2IHYA 5DCLA 4UUQA 4DLLA 1Y3FE 3SR0A 3UG7A 2TS1A 1ZK3A 4ISBA 1G5RA 1UT5A 1PJQA 4ZODA 2APJA 4WX2B 4A2QA 1NZJA 3W5SA 1F2DA 2P9FA 2VHQA 4Y2UA 5C8YF 1E9AA 2JFXA 4KQ1A 3BHMA 4AL4A 3PFHA 3I30X 1SAYA 5AJWA 5IDVA 2X8JB 5TF4A 2ZBGA 5JAUA 1NBEA 4PG8A 1KBOA 3EHDA 2BGWA 1X94A 1KGSA 2FJ0A 2HHCA 3BD9A 3Q7SA 4LC1A 4XWYA 5FL7A 1E4YA 1NONA 2GPWA 3O03A 2OESA 4OF4A 3A2MA 3CW9A 4CM8B 2CHGA 1SIBE 2YJGA 4FGSA 3A9UA 4TL8A 1QIGA 1YHZA 1ZZGA 2DY0A 2GS9A 3LUHA 3QV1A 3TLZA 3D6AA 2GJ9A 3FH0A 3NP9A 3OVMA 2PLWA 1G7RA 1GL9B 2QRGA 5ARDA 1R8YA 3H9CA 4ZQFA 5KWVA 4OQLA 1YVUA 2RKOA 1PX2A 3AOGA 3ID6C 1U0BB 4GLOA 4YA6A 2JAQA 3JQPA 3EH1A 2H0AA 3UY4A 4UU7A 3CF4A 1ENOA 3M82A 3WO1A 3CURA 4OQEA 1KZHA 2OUIA 3JPYA 4MRPA 4UNRA 5IKXA 1P31A 1QS0B 2XWJI 4KAAA 3OETA 3JU3A 4NMHA 2XCQA 1NSFA 3F71A 3C74A 2P77A 5E8RA 2UYYA 2EERA 2VUHB 4JUDX 4PZPA 3TZCA 2FJPA 2X2EA 1ODFA 3KHTA 3Q1KA 4NBKA 4ZI2A 2FWJA 4CG1A 2R97A 2BR4A 3LK7A 4N0EA 3OPQA 4N0PA 1JR6A 5CLJA 4H7IA 5HF8A 5EFOA 1XZNA 2JEOA 1CG6A 1DC4A 1SN7A 1CUAA 2WC1A 1F2VA 3HEBA 1X80B 4G84A 2MMCA 3NVKI 3QEKA 2Q5LA 3DZCA 3QUSA 3TG8A 2R1ZA 1JRLA 1I4LD 2P27A 1U7HA 3LVFO 4OA8A 2FHPA 5C8VA 3TMAA 2HXYA 3K0HA 4RL6A 2RAPA 3H11A 1K8YB 2O0MA 3KE9A 1WVIA 2OO7A 2P62A 3JTEA 3QMMA 4BY9E 2RGRA 5F3RA 4B4DA 1Y8CA 2I1WA 4A03A 2XBLA 3N28A 5H7XA 3RSLA 3UJ7A 4LSMA 1XU9A 3ROPA 3F2IA 3OTGA 1OC2A 4LDNA 4Q16A 5CJJA 2YHAA 3CG0A 4NESA 4BJ1A 9ATCA 5HZKA 3PQDA 5E8JA 1MT3A 2W6ZA 3MS4A 4D82A 1YC5A 3CUEF 1CK4A 1CLEA 2FRDC 1WEKA 1YGYA 3CUSA 2XT9A 3OCXA 4RHCA 1FUUA 1KU6A 4Q4HB 1JHVA 1CEEA 3WWPA 4PG7A 1FDWA 4DC0A 2PV0A 1NKVA 1OXUA 3IRUA 4PANA 3ZCVA 4RYDA 4UOZA 3ZI7A 1XALA 1L4HA 4PZCA 4MUYA 4C4OA 1ELOA 1NV8A 2YBEA 3AETB 2OE2A 2B82A 1FLNA 1JT2A 2Q62A 1HT1E 1F8XA 1RI1A 4BPRA 1Z13A 2ROQA 4DR1B 5AVVA 1NFRA 4UXJA 3C85A 3MK31 5AKZA 5EE9A 1X7HA 1UXOA 2D5IA 2GZ2A 1EXDA 5JDCA 1ZM7A 1GZVA 3AT1A 3IQWA 4U7TB 1E7QA 2H31A 3COZA 2V4UA 1PJ2A 5EEGA 2HYDA 1MEJA 3QOXA 1JG4A 3LLSA 1MKYA 2DP4E 4IDNA 1MAWA 1AKUA 2XQKA 3TIGA 1KP9A 5J4KA 3K6SA 2J67A 4L5CA 2Q3BA 1FVFA 4UMFA 1HSOA 2PX0A 3ZV6A 4DIOA 1TYAE 2JLBA 2BEJA 5FOWA 5TF0A 2PWPA 2F1RA 2QG6A 4E22A 2PRKA 1U1DA 2DCUA 1ZVMA 5AVRA 4RADA 1E6MA 3N2GA 4DEYA 4S05A 2CNWA 5I01A 2O6HA 3PQ4A 1Z9BA 1ZD4A 3U4IA 4FX2A 1L4NA 1VRVA 3AXSA 3UWOA 2QTGA 2OORC 3AUSA 3MJHA 5CYGA 5JQWA 1T5SA 3GLGB 1TT5A 3OOSA 5NULA 3U6BA 3OTIA 4C89A 2RHDA 2VZLA 2QTAA 1X1TA 3K0AB 4G2NA 1UDWA 2I78A 3A9RA 3PQ2A 4M6WB 2OY0A 5EQFA 1MV8A 3BDAA 4HB0A 4K9RA 1OQAA 4WOKA 2C9OA 4Q3OA 4CKCB 1LV7A 1GPBA 3NAMA 4XSVA 4Z0HO 4K1LA 4XM1A 1UOOA 5EUBA 1RPZA 1BHO1 3MXTA 3SLKA 1IY8A 3AH8A 5AI0A 3OIFA 5KVVA 4TRNA 2CLDX 4MV4A 4JOBA 1YQEA 4UOQA 4X90A 3WZMA 1RYDA 1UFRA 3INRA 2J7PA 3QLUA 2AFHB 1PNRA 4ZEXA 4PLZA 2B35A 1JLRA 3V2IA 2OHGA 2Q29A 4UULA 1NC3A 2XJ9A 3L49A 1J5PA 1ZJ5A 1JAIA 4PBSA 4YRQA 1MB4A 2FG7C 2CFTA 4BCBA 3VO9A 3S29A 3TZQA 2Z8ZA 1Y7TA 4Y6PA 3QNWA 1VPDA 4DJJA 5KYTA 1BRTA 3BCRA 4O4HA 1RIIA 1J90A 2PPLA 3NEPX 2A0YA 4DBLE 5LZ2A 2M98A 3G17A 2JPDA 4U2GA 5I5GA 2YS6A 4BO9A 3MC1A 2WLTA 1X77A 1DC3A 2IUTA 1QOZA 5BN5A 1UZAA 5LP6C 1EX1A 1R4AA 2AH5A 5AVSA 1TUGA 2I87A 5B4TA 1E2LA 2NZXA 1SCJA 4M49A 1XXHE 1F3OA 2EQ5A 2Z6VA 1HY3A 1DG1G 1E5QA 2FFAA 2WU1A 3EXHB 5KKAA 3V9PA 2FEAA 4NTZA 4WJLA 4CEIA 2RKWA 1U8YA 1SXJA 1JYEA 1UJBA 2AL7A 2YBDA 3BMOA 3JWPA 3MGGA 2R8BA 1HQCA 4L0CA 1QRUA 4IMIB 4Y0NA 1C9MA 3K70B 3TPZA 1NBME 1Z2DA 5AHOA 1EIZA 3P19A 1DDGA 2IP2A 3OQBA 3ND6A 2PG3A 4GXTA 5CB4A 2FSUA 2YH2A 3QV2A 5FJJA 2BKEA 3ZWWA 2WFLA 4FOSA 2QRPA 2IXTA 4R2MA 1T0IA 3EOBI 1YV9A 4E5YA 5EXPA 2PAFA 1I8TA 1UMKA 5ELLA 1TKRA 3HU5A 1EJBA 4JT2A 3GAFA 3K8ZA 1MO6A 5LU9A 4ISCA 4BFYA 3F7TA 1Z75A 4W5WA 5J23A 3I52A 3G0DA 5EHXA 1N2BA 2N0SA 2QBYB 2QI9C 3OU6A 3RAJA 3MLEA 5FA6A 1TF2A 1SD1A 3CCFA 1WKVA 3ABSB 5AP9A 3D1VA 3Q7IA 3EGEA 3VO8A 4XCVA 1JEAA 1A9YA 3VR4A 3QVKA 4TMTA 3E84A 3CNBA 3V33A 1U0SY 4NBWA 5LQNA 3N2IA 4N3GA 2GKGA 2BMVA 1Y7IA 1ORHA 2WV7A 3IHKA 4YCLA 1TVKB 1I94B 2CDCA 1N5RA 3SCZA 1UJ2A 3VR4D 2GJSA 3JWHA 3RAPR 1WXQA 3ZKWA 3N74A 3WIVA 4Z9XA 3FUVA 3TMYA 3KB2A 1XEXB 3IKMB 5I9BA 4V1CB 1A9PA 2RK6A 3LUGA 1W2WB 4UM7A 2CV2A 2GBFA 1JIXA 1VCOA 4UEKA 2J3JA 2REXB 1FFBA 3HN6A 4ZHQB 3TWOA 1YIDA 3R5XA 1ZLXA 4NK4A 4QLAA 4EJSB 3D54D 4TZ0A 1ACMA 1GD1O 4TMVA 2XE6A 3AJ9A 5BSVA 3ZDCA 1EVIA 2VPQA 1TU0A 2HNBA 1YB1A 2HMTA 3IALA 4NP6A 2IKSA 4XUEA 4BZWA 1RPTA 2IZZA 4PZLA 1YJ8A 2OOSA 1ODSA 3O4JA 1Q22A 1QO0D 3C70A 4BN4A 3ILYA 4N0QA 2WWXA 2E4WA 2Z1NA 3QKRB 1NQWA 2DHDA 4UNNA 4F11A 4R51A 4DQKA 3HB5X 3NWPA 3HVUA 4AJNA 4Y1FA 4DPKA 1SGWA 3K1ZA 2VWHA 3RYHA 4C01A 3A9TA 3W2HA 1TC2A 5ICEA 3GLHE 4ZOLA 4OMDA 4FJ1A 1SCUB 1VBKA 2PGIA 1RMQA 1FRNA 1E4EA 1WF6A 3ICQB 3CX7A 3PK0A 4RFLA 4RPKA 4DIUA 1R6UA 4HUQA 2ZULA 5KVQA 4D98A 5CLIA 4ZO9A 1NBHA 1RKBA 2ZTMA 1Z2AA 2CMHA 4XH9B 1N25A 1LSUA 5JC1A 1O5OA 1QP8A 1E59A 3M6WA 3LAWA 3RF6A 3O2SB 2HX1A 1UIRA 3ZDAA 3PX7A 4R40A 2XWQA 4GMDA 2FMKA 2QN9A 3RYFB 3GUZA 3PP8A 2WY2D 4QOFA 1OX6A 1RWXA 2Z3VA 4H3HB 5DNUA 5GZ1A 1ULZA 1SOAA 4N3BA 5DOVA 2FPGB 2REBA 5CA1B 3GA0A 3R6LA 4X6LA 4ES6A 3DEZA 3TD6A 1DLJA 1XCGB 4G0QA 4RKYA 4JMLA 3RVOA 3L04A 4D57A 1XVAA 1KQGA 2ECKA 2A84A 2VSXA 3JVIA 5C7YA 1CKEA 2TMKA 3DDWA 5E6RA 1Z45A 3ETHA 5KHOC 4RABA 4IGEA 3OZAA 1DJQA 4JQZA 3DO5A 4E5MA 5CVUA 4WBNA 1D3AA 5FWDA 3ZE6A 1JLSA 2MR5A 3QF4B 1NLFA 4OP2A 4ZT3A 2ZS9A 2B5VA 4PSDA 2BKLA 1OV4A 3W9YA 4IVRA 4KX5A 5DW0A 1CVRA 5LA6A 3FNEA 5B4VA 2QWXA 2P9ZA 4L51A 4U7DA 3AVOA 3J80A 4PGAA 3C5VA 1HDZA 3GIWA 4TMXA 4X7MA 4A2WA 4EX6A 1FJGB 1JW9B 3M81A 3K1AB 1FJXA 3D5EA 1E4OA 1XMSA 3D0KA 4GHWA 4JV5B 2YYYA 5K3BA 1KP3A 1NVVQ 3VNVA 3JD2A 1L4EA 2YZMA 4G86A 4HBGA 5HQJA 4I2VA 3GF4A 3PTZA 1XO1A 4D3SA 3TLYA 4R0MA 3DXZA 4RXTA 1GZSA 4BWVA 2YWJA 2YYZA 4LGMA 1I9GA 1RP7A 1QYIA 1W6RA 1R4MB 4HVAA 1TT5B 4QOIA 2Y1XA 2YWFA 3AXTA 4Z1MD 3RU3A 2WE7A 5FF9A 2QVLA 3CPHA 4CEHB 3ROXA 4RENA 2Q4OA 1VE1A 2MYPA 3E2IA 1XF1A 4P32A 4RH0A 1WZ2A 2A5DA 3GRUA 3N7TA 2P2GA 2HEIA 3UB4A 3RNOA 4P5EA 4BV2A 1XXHA 1YJXA 5ED4A 3C98A 3BTUA 3TXAA 1S1MA 3FOBA 3HBLA 3SYRA 3WWCA 1P0MA 2WWWA 1MJHA 3KAJA 4R81A 4UCFA 3U39A 4BGVA 3H5VA 4XWAA 1ENYA 2H00A 4CCWA 1FIUA 4QHTA 4ZI3A 4A0FA 4WN9B 1QRDA 3MS2A 2COUA 3SSMA 2R6AA 3SIWA 3U09A 4NONA 3S2GA 2B4YA 2BFFB 3WVNA 3RPEA 4DQXA 3CNHA 2X2FA 4YALA 4LOHA 3RBAA 2FUEA 1ZSVA 2ZYDA 3PDHA 5E1BA 1ZNYA 4M0PA 5M2QA 3B38A 1N7HA 3RTAA 3EGWA 3DMGA 4NK5A 1UOQA 1AKMA 1RWMA 1TCVA 3CV3A 1NVFA 4C21A 1QO0A 1VHLA 2FEMA 3B5EA 4GL2A 1CD5A 4WXHA 2Q4RA 2D1FA 4MCAA 1HDIA 4U6NA 4ZEOA 4QVGA 3TLXA 2AN3A 3HDVA 1PNQA 2Q28A 2XVXA 3K7EA 3KZVA 3KYCB 4MVJM 3UATA 3QBDA 1K7EB 3K53A 1RJWA 3QF7A 5YASA 4KBGA 3KJNA 1N34B 4UCQA 3CUKA 2VHCA 1SQSA 1Z28A 4KU4A 4JN6B 3L4KA 1F4LA 1U3TA 3HB0A 2RAUA 4GGMX 2GUGA 4KQHA 4F72A 5L6LB 5F3WB 2RCYA 3H2YA 4PVDA 4W5HA 1UXHA 4TLLB 1YI0A 2WPDD 1EA5A 2V59A 4V1CI 1VLQA 3GFRA 3WLIA 2RDMA 2IA5A 1AO3A 3KFVA 3UXMA 3ADCA 4MNTA 4FWTA 1XTTA 2B8TA 4PO3X 2ZR7A 4FFOA 1K98A 2A14A 2PFSA 1THTA 4C06A 4WN3A 4M7WA 1H22A 1UBHS 5DMHA 1RADA 1Y8ZA 1EXVA 4R8VA 2NQTA 2PFGA 3KTAA 4TKZA 4R6XA 5AD1A 1E9EA 2JAUA 1E2JA 2CLIB 2ECQA 2P9YA 4KR0A 2H06A 4MQBA 3LHFA 2ONJA 4F3NA 3EC7A 2O23A 2I3DA 4B8ZA 1J24A 1ISIA 5T6MA 3N8GA 1BCRA 2XRFA 1HDOA 4OP1A 1MABA 2J4CA 3H3JA 4RLFA 2GF2A 4L5JA 4G0MA 4FWBA 5FBLB 1RMTA 3B9PA 2FLVA 1FFAA 1FLVA 2VTVA 2H48A 4LJ5A 4JSYA 2Z5LA 4Q7EA 1ZIXA 3S2ZA 2FA9A 2WNIA 1P4RA 4HNUA 2J48A 4XRRA 1W85A 4RH1A 4L8WB 4AJHA 2ZUFA 2POCA 1R0SA 4R05A 5DTJA 3WGMA 1NXXA 4BQIA 3BWCA 3MTEA 4YJFA 1SBYA 2ANBA 2OLKA 3WB1A 5IH7A 2IH4A 2A2ZA 5DU2A 3ZWMA 4QARA 3C4QA 4G8DA 2AI1A 4DLAA 3DA8A 5IKOA 2VRCD 5B4UA 4M1SA 4FOPA 3VH3A 5G1NA 4NJMB 4RHEA 4FSXA 3L07A 3W7AA 4B3XA 4PC1A 3LV8A 2HK6A 1C81A 5TQJA 2X13A 4ACAA 5ADHA 3DHEA 3L82B 3F90A 4EUKA 5A04A 1EM6A 2ZJ4A 1OTXA 4K9QA 2G7MC 3PSHA 5AM0A 4PRZA 4IDDA 3STXA 2IHBA 3DFZA 3FSEA 3BJIC 4DM3A 2JJ2D 5FV7A 5H81A 2BCJQ 2IVZA 4FR5A 1CR4A 1C4WA 2G5GX 1QG2A 4YEDA 5I7HA 3PI6A 4P7JA 1H6AA 2IJGX 3EGDA 2O57A 4X6XA 1YAHA 4F5EA 5BN3B 4M9RA 3OQMA 2WRZA 3C6BA 2ZRJA 1JH8A 4ILKA 1R9MA 2CJXA 1XJ0A 4KUGA 3OECA 2CYCA 3W90A 5KUTA 1H1DA 3GHHA 2Q9AA 1PEAA 3ESBA 1D1QA 1PI3A 5JMTA 1P62B 2HA3A 2EG5A 3H5OA 1Y1SA 4FILA 2JA1A 1V9CA 1RDFA 1Z2NX 4J4HA 3DZ8A 5EE0A 3T4XA 4ZT7A 5HGJA 1R2QA 3PQ3A 2HWWA 2QD4A 4MRMA 3JZFA 1X15A 2DFNA 4XE5A 1A50B 3D8BA 4Z2AA 1U7WA 2E4UA 4ZRNA 5HRAA 3CN7A 4WE3A 2LKCA 4LY6A 1E9BA 4XLTA 3DUWA 4ND7A 3HYNA 3KM0A 3VKVA 3IQEA 4TSKA 4NCNA 9GPBA 4OUDA 2RGGA 5D3ZA 2GD1O 4PYJA