1EFHA

Crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
281
Chain Sequence
DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYDROXYSTEROID SULFOTRANSFERASE
publication title Crystal structure of SULT2A3, human hydroxysteroid sulfotransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 281
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1efhA00
3FHTA 3CWZA 1E0SA 1GOTA 2ZANA 5BQ5A 1FW6A 1JXOA 4A0RA 2C9CA 5EP2A 1DAGA 3M4YA 3IGFA 1E3MA 3GLGE 2CHVA 3BD9A 3CB4A 3IKJA 4YC7A 5E4FA 4OHYA 1VIYA 4K81B 2WJHA 4QM6A 1S9HA 3T35A 1NLFA 2VSOA 3U2QA 4KCGA 4NYIR 5FOSA 4BECA 1NN5A 2D2FA 4NL4H 3VAAA 3OIVA 1PLLA 4KODA 1G8YA 5JWOA 1TADA 2CDNA 2ZEJA 3TR5A 4BLQA 1XNJA 1G7CA 2VBCA 4IKEA 1RC8A 1GSIA 4A4DA 3TW8B 4PC6A 1J90A 5D3MB 3U3JA 4WZ6A 1XMSA 1U8AA 1G4AE 1XXHE 1ZNWA 2PX0A 2VP2A 3LBHA 4RD4A 4WZAE 2FNAA 5KDLA 3U7GA 2ODEA 5D3QA 2WPDD 1XEWX 4NCIA 4Q48A 4FI3C 1JPJA 2XJ9A 1XEFA 4TL9A 2CCGA 3OZXA 4XJXA 4HLDA 5JHGB 3DZ8A 2YV5A 4Q4JB 2CMKA 3PENA 1N6NA 3LV8A 1QHXA 3P20A 4A8JB 4EPYA 4BASA 2WPDA 5CM9C 4QGFA 1J7KA 4M8NE 521PA 3CF0A 2ZRJA 1CR2A 2NO1A 1UKYA 1SXJC 3RWMB 2GVDC 2IWRA 3K0AB 1JJ7A 2JLUA 4XSHA 4ZI2A 3QVUA 4KXFB 3PG5A 3U3OA 1Q21A 2WMOB 5KNCA 3BBPA 5C4MA 2HT6A 2OFWA 2GCOB 5EXSA 5TVKA 1UBGA 1J99A 3BK7A 4WW0A 1I4TD 1NG9A 2D4HA 4OI4A 3I72A 4AK9A 3BFXA 4OQXA 3HPRA 3EARA 1RYHA 1ZVQA 2DFLA 2NMVA 3EW9A 1D2EA 2PZFA 2X8AA 4IDPA 3U4QB 5KPDA 3DMNA 3I8SA 1NRJB 1ZW6A 4NHOA 1W44A 4RD1A 2V3CC 2A5YB 2GCPA 1TPZA 5H68A 1IBRA 4MRVA 1E9DA 1BOFA 1G3RA 4NCKA 3CX6A 1RJ9A 1US8B 1ZUHA 1KSJA 2OFXA 4HUQA 3AVWA 4BFYA 4C0QC 3G82C 4I1UA 2REBA 2YHSA 4W5JA 3RRMA 2O8BA 1SXJB 4FN5A 4B3BA 4KYIB 4C7OA 4LJ4A 2VP4A 4M9SA 2QPAA 4UNSA 2QORA 1P73A 2WJIA 1E9BA 2WWYA 1E2IA 3QVVA 4A0GA 4DLZA 3U61B 1ZJ6A 2ZE6A 4TT3D 4BEBA 3HYRA 3MJRA 4D0NA 1IN6A 5KSYA 4V0LA 2ORWA 1VCIA 5C1BA 2E1RA 1CKEA 1FUUA 1E4VA 2BEKA 4PC1A 4YXWD 1JR6A 2H57A 2GKSA 4TT3A 3HR7A 1W48A 4BLPA 2VEDA 2QQEA 3RS5A 4F91B 1W47A 1GRRA 3CRW1 4PO8A 5L3RA 2GK6A 1CXZA 1KAGA 1KI2A 1KSHA 4IFBA 4EAQA 2OBMA 4P4SA 4BZXA 5CDFE 1SVIA 3QBTA 4P33A 2RGDA 4YXWA 4B3XA 1ESNA 3QKSA 4CEJA 4LBZA 1W2GA 4LX0A 1JECA 1SVKA 5FPYA 1W49A 4GP6A 2NO9A 1XMIA 2QT1A 3UXMA 1XBTA 2PLFA 1P2SA 3GD7A 4M21A 1Z0KA 4R2HA 1S9DA 2OM2A 4LC0A 1U81A 2GK7A 4LBVA 3ZVLA 3IO5A 4URVR 2HUPA 5FPTA 1CLUA 1VPLA 3TUIC 4HDCA 4ITRC 5DSZA 1IXRC 3AEZA 4V0NA 5CDFA 1ZM2A 5AUQA 2CJWB 2R44A 2EFCB 3VMFA 2A5JA 2Z43A 3CONA 4M1YA 5B58C 2V9PA 3A37A 4OYHA 5JEEA 1F3OA 3ZS9A 1IJEA 1P6XA 1SVWA 2XSZD 2ZSDA 5KUTA 1ZD9A 1E99A 3O8CA 2X2FA 3KJIA 4IDQA 5GJVC 4Q7KA 1TUEA 4I4LA 4G5GA 5JI2E 2DFKB 1ZYUA 3QXCA 3ADKA 3SHFA 2EWVA 2D7DA 1XZPA 1V43A 1VG0B 2XSZA 3BB4A 3P26A 4C4PA 2IHBA 4C0JA 4Q4HA 4DDTA 4G5OA 4IDOA 1QG2A 2QY9A 2ZXUA 1MABB 2OSBA 1A2BA 3T1QA 2O5VA 4FCWA 3LRPA 1Q1QA 1OPXA 4MKIA 2GXQA 4MA4A 5IK2D 2IYVA 2RMKA 1YZTA 5FL7A 3JZMA 4XWOA 2XJ4A 4D4JA 5B64A 3SJZA 1P61B 3ECCA 4YONB 1P7CA 1E1QD 2YOFA 3ICEA 1VYVA 2QN6A 1OYYA 4HAWA 1CR4A 5IK2A 3SFZA 3GP8A 5K8TA 3ZIAD 4KO8A 5AR1A 8OHMA 1YU9A 1R7RA 2UVQA 3FTQA 2IUTA 3UMSA 2O8CB 1J8YF 3IEUA 1YRBA 3EAQA 2NQ2C 5DN6D 1XWIA 2YWGA 3ZIAA 3NC1C 2VIIA 3THYB 4QBIA 2HJVA 2QP4A 1DADA 1VECA 1W36D 3QNUA 1N0UA 1GKIA 1XDBA 1W46A 2F43A 5JS7A 3HU1A 3PUYA 4LHWA 4E03A 2DR3A 2JAQA 1I2DA 1Z28A 5DN6A 3UATA 4AKGA 1CR0A 5HZHA 1G6HA 2QPOA 1DAEA 4DCSA 3VKGA 1G7SA 4FWTA 4WZBE 3U5ZB 5P21A 1HURA 1SKYB 2QTVB 1N5JA 1NBME 4JZKA 3THWB 3CWQA 1BS1A 3A4LA 4QJ5A 2BDTA 2VYFA 3I5YA 4JT2A 2RGXA 2P0EA 2ZREA 1KK3A 1XJQA 3MRSA 2OBNA 4JIMA 4B6FA 5IT5A 1NLYA 2F9MA 2P3SA 3N5CA 3OEHD 4F4CA 4PQRA 3K53A 1KNQA 1E9AA 1RRCA 4R9UC 2CVHA 5KSZA 1ZCBA 1ZM9A 1K5GA 1LW7A 2OT3B 1OB5A 1KGDA 4W5HA 5FUVA 4RKEA 4IVQA 1N6RA 2J87A 1G4UR 3OEHA 4BPBA 1OT3A 4NYMQ 4M0LA 3ADDA 4PPFA 1RIFA 3LQQA 2XTZA 3V00A 4RD3A 1GKUB 4HAXA 1U90A 2RGNC 2JJ1D 1S2MA 4BQSA 1O3YA 2CXXA 2Q6TA 2H92A 1F48A 3QG5A 3AP3A 4M1TA 1G3UA 2HXSA 5JLJA 4URZR 3PUZA 4X8HA 3Q5DA 2JJ1A 3VNUA 2E87A 1F2TB 5JBQA 1CJVC 2ZYUX 3PUWA 4JVMA 2KBFA 5HZKA 2HLDD 1XRJA 4GSYA 4NYIQ 1CF4A 2GF0A 1AS2A 2UZ3A 2ANCA 5FL3A 1VHLA 2FPKA 4UXIA 2OLKA 4H1VA 2JA1A 2ZYWX 4LYHA 3QKRB 4LYFA 3UG7A 3U44A 2VQSA 2HLDA 4IOKA 4MRPA 4N0DA 1KYIA 4C3ZA 2VSXA 2HYIC 4QC2A 5IF9A 4IOMA 2OBLA 1AM4D 2ZRCA 4JYBA 4UQOA 1YVDA 5HR5A 2ZR0A 1G5TA 2C95A 3CR7A 1AKEA 5L3SB 2WKQA 1XCMA 3ZVNA 1NP6A 1Q3HA 1L7VC 1U2RA 4BEJA 1NY5A 1J70A 4ZV4A 1H8HA 1E1RA 4M9QA 1QHIA 1WXQA 4LGMA 5HPYB 2Z0MA 3GLFB 1RVDA 3IPXA 4DDVA 3UMRA 1SVLA 4FWIB 3QBVA 1SHKA 2CVFA 2ZUDA 4RY2A 3RVBA 4PAOA 3X1ZA 5KU1A 2KBEA 2ZRGA 5L3QA 2YNMA 2Z4RA 1G3IA 3ZYCA 4TLAA 2GXAA 1AS3A 4NYJR 2HCJB 1W0KD 4JLBA 1HE1C 2J7KA 2F3TA 4EDHA 2FPLA 3GJ8A 3FOZA 1PVOA 2J0SA 3KJHA 4MKFA 5SZKB 5CB6A 3AB3A 4BUJA 3I92A 2ZAMA 3BERA 2XTNA 4DLXA 4OQLA 1MR3F 3PXGA 4L9SA 3GLHA 4TMWA 2XNSA 1KNXA 3KXKA 3QENA 3HU2A 2IHYA 4LCBA 5GJWC 2AD1A 5FBWB 5F98A 1CJTC 3MG9A 1XCGB 2N42A 4HZUB 4LK2A 4B3DA 3I1FA 1UKVY 4KVAA 4NU0A 5KOYA 3I62A 1S96A 5KYKA 3QF4B 2B6HA 2ORVA 2REOA 1W4CA 1S8FA 4GOXA 3E5HA 3CLVA 1II8B 2H1LA 2PX3A 1T9HA 2PT7A 3IDQA 2BBOA 2EVWX 2R6FA 2GTPA 4RFSB 5DGXA 4C9BA 3AH8A 3LDAA 2ZI9A 4G1UC 1DO2A 1GILA 2J7PD 3KTAB 3BH0A 3EPKA 3MSXA 5C18A 3GJ0A 3E70C 3DHWC 2H7VA 2QUZA 2CCKA 4CEHB 3RS4A 1OYWA 1CBUA 4TQUS 5EQTA 1MH1A 2A30A 2J7PA 4TL8A 3O8BA 4DKXA 1ZU4A 1EGAA 4ACAA 2WJJA 2Q3HA 1JI0A 1KO5A 5IRCD 1G6OA 1M7GA 1SGWA 2HEIA 3CNLA 4C2UA 1Y63A 1Q12A 3S1AB 1JQLB 5D3MA 4D2IA 3SEAA 4ERNA 1PV4A 1GWNA 4L5BA 3EC2A 1YR6A 3GEIA 4IVRA 1PLJA 3W6OA 3QOFA 4EFNA 1O87A 3K1JA 4Z51A 3T06B 3CH4B 1L2TA 4JLAA 2O52A 1UBFA 3OF5A 4JL5A 4ACBA 2DHRA 3PIRA 1WB9A 4BFUA 3K0FB 1KSGA 3ZDQA 2QGZA 4F4IA 5JWRA 3MWLA 3NXSA 3P27A 4HDOB 3SU8A 2IUUA 4A8JA 5KO2A 2ZRKA 1Q44A 1BIFA 1A82A 3IIMA 4A92A 4LDJA 5CITA 2XEXA 1VCNA 2GJ8A 3K0AA 1XD2B 2OO7A 3KUDA 4K8OA 3FB4A 4BZPA 2ZI3A 3TUJC 5FPHA 4I81A 1G7TA 4Q02A 2GCOA 1OIXA 4HB0A 1ODFA 3KJEA 3OE7D 4LBWA 2XB4A 5EE3A 4IDNA 2FFHA 3MCAA 4TLBA 5G41A 2FWRA 1IJFA 1VG8A 3O47A 1W36C 2C99A 1SXJE 2FFAA 5DI3B 5CJ2A 2ZJAA 1Q1EA 3GQBA 1NKSA 2JDID 4JLDA 3JVUA 4QGAA 5JS8A 3OE7A 2KJQA 3RANA 3U4QA 1DAHA 4DUGD 1R0ZA 4JVNA 5FUYA 1NMYA 4ZCLA 2HF8A 1OFUX 5BW8A 1N6KA 1SXJD 2JDIA 2OCYC 2VHQA 3BRWD 3TK1A 3MD0A 2RH5A 4HEJA 1WRBA 4AURA 1SKQA 2W00A 4E22A 1US8A 2FZLA 4FMBB 4DUGA 5LD2B 2AWOA 3ZZUA 3GFTA 5SZHB 1G19A 1YZKA 2V6IA 3A4NA 3IQWA 5FI0B 4XTRA 1LB1B 3EZFA 1SXJA 1UADA 1N25A 6Q21A 4YMVA 3B78A 4JYCA 2ONJA 2ZAOA 1FP7A 2NTYC 1RYFA 1HT1E 1JBKA 3RRNA 4BFSA 1NJFA 1CRQA 4JL8A 1X8JA 4FMDF 3P32A 1AQUA 2AK2A 2IXEA 3CIOA 1AKYA 1W36B 3RC8A 2IX3A 2IS2A 4LI0A 2W0MA 4OK6A 1WQ1R 4GT1A 3TIFA 2JLSA 1II9A 3IHWA 1OH8A 3K09A 2JIZD 4YDSA 3VR5A 3H4MA 2R2AA 2KI5A 1U9IC 3QY0A 4JLPA 4Z8YA 2PT5A 1S3GA 5DNYB 4KITB 4B71A 1YQTA 2DB3A 3MLEA 2C03A 2JIZA 2RCNA 4B2IA 4LHXA 4B3CA 3AGPA 3F0TA 1M34E 3KKPA 2JJ2D 2ZRNA 5AUPB 3UWKA 2JCSA 3Q9LA 2JLRA 1UKEA 2Q3MA 1E2JA 3RRYA 3EPJA 2AXNA 2F7SA 5AWFC 4DLVA 1N3BA 1G20E 3RYTC 1G7RA 2FU5C 2Y8EA 2O8EB 2FH5B 2ZJZA 3WBJA 2CJWA 1R8QA 1UJ2A 2CHQA 1NMZA 1N6OA 4M4SA 1YRAA 3L0OA 4OHZA 1CS4C 4RZXA 3SNHA 5CB8A 3M6AA 1QDEA 3TKLA 3HJNA 1TQ6A 1D2MA 4PQYA 3ZD7A 1KOFA 2A2ZA 5J4LA 4UXHA 1ZAKA 2ZJYA 3PQCA 1G291 2C78A 3X1XA 3EWSA 1C9KA 5B30A 5HKKD 4XOIA 1TTTA 1IN5A 2RGEA 1IHUA 2JASA 4DLUA 3T61A 4Q00A 1MABA 2CCJA 1QBKC 2JLZA 1D8TA 2OV2A 1Z29A 4P32A 3OIUA 2F1JA 1R0WA 1EXMA 2FFBA 2BBTA 2I4IA 2PEZA 3B6EA 4ZDKA 5HKKA 4TSFD 3ZS8A 3VR2A 2QAJA 4O0MA 1FMLA 1VCMA 4GFDA 4EPRA 2QGNA 2P67A 1G18A 1OH7A 4HYYA 1UBEA 2ATVA 4JBYA 5KSPA 4MKHA 4TTRA 3SR0A 3EASA 4NE2A 1Z47A 2NOAA 3D3QA 4TSFA 4A2PA 3CRMA 4MUAA 4Q4AB 1RFLA 2OHFA 2PCLA 4DLTA 3DL0A 2J0QA 3AP1A 5J5CA 1TMKA 2O8CA 2ZRAA 1TNDA 2QZ4A 4Q21A 1SKYE 4JVLA 1W2HA 1G3MA 5M04A 1QZXA 4GBMA 1SVMA 3BORA 1GUAA 2WWXA 1HV8A 5E3HA 5FTJA 4HLCA 3CZPA 1WA5A 1YE8A 2FFQA 1XF9A 3T12A 4EPXA 3THYA 4N3NA 1IN8A 5G3ZA 2WJYA 5LBIA 1U8YA 3MJHA 3W3AA 3EA5A 3W8RA 4ZIRB 3MWJA 4DEYA 3C8UA 4TMTA 2ZI4A 1E2EA 1L4YA 1SQ5A 5FBLB 3HU3A 5B2ZA 3RS7A 2JLYA 5KPJA 3EC1A 1GZSA 2XNDD 2H16A 1X1RA 1W5SA 4TQ9A 1EESA 1GIAA 2ZM5A 2BEJA 3SYLA 4ESHA 4BFWA 1P3JA 1UPTA 4ABYA 3THWA 1G8HA 2XNDA 4JBXA 1IN7A 1NIPA 2RHDA 4MGZR 2PJZA 4DLYA 1OFHA 4GZMA 3B1ZA 4U02A 4B3FX 2X77A 3DKPA 621PA 4NP6A 4PAMA 1YZGA 3REGA 5FI1B 2O0KA 1NVXQ 4EJSC 3EIQA 2ZI7A 2ZRMA 3WY9A 5L8VA 2JLWA 1HUQA 4GP7A 4A8JC 1B23P 4DSNA 4LJYA 3I8XA 1U8ZA 1EFUA 1G5RA 4QBFA 2FE4A 3O8DA 4HAVA 3ZVRA 3BAFA 3VTKA 1WBDA 1KI6B 2V8OA 3AKCA 2OCBA 3EWAA 3AKDA 5J4HA 4BZQA 1R5NA 1DAKA 3A36A 5FUWA 2EU8A 1VIAA 1NVUQ 2F9LA 2CK3D 3G0HA 3UANA 2R62A 4AG6A 4JLJA 1F2TA 4XH9B 1Q1BA 1TQ4A 1ZD1A 2P6NA 3UK6A 2QBYB 2JLQA 3CX7A 3NHAA 2QNRA 2ZRBA 4JKYA 3GJ3A 1RRPA 4QHSA 5AJWA 4HAZA 1VKJA 3PVSA 5JCPA 1LV7A 2CK3A 4JLOA 1Z0IA 5L3VA 4EPTA 3MAAC 3GLFE 2KSQA 2MSDB 4EJSB 1KTVA 5CLLA 3QKRA 4KSCA 4D25A 2PZEA 1H65A 2RGGA 3FMIA 2WAXA 4WAUA 1WP9A 3TMKA 4MGYR 2IYTA 5EZ5A 4XD7D 4XTCS 1G5PA 1R0XA 1B0UA 1MV5A 3NDPA 5L3SA 2VP0A 3FE2A 3GJ7A 3RSOA 2JATA 2RGNA 4AKHA 3EX7C 3QPVA 4JLKA 3FGNA 3SI7A 4RSGA 1TQ2A 4US2R 3KKNA 3LY5A 4XD7A 2WJVA 1MO6A 2ECKA 2Q9AA 5J40A 1BMFD 3GLFA 2GEDA 1T5LA 2ZYVX 2H18A 1E2GA 1LS6A 1XMVA 2GDJA 1HH4A 3IIKA 4ZO4A 3QJYA 2NO7A 2KB0A 1BMFA 4AKEA 1DAIA 1E4YA 1LTQA 2FX3A 3K09C 3IHLA 2GZAA 4B75A 2GILA 5DHAA 2WZQA 4EUNA 3IQXA 2BM0A 3SBDA 1KJZA 5HE8A 4CDGA 4QJ3A 3THXB 3AKEA 3MFYA 4HB3A 2IXGA 1GKYA 2Q0HA 5JJKA 3BOSA 4JS0A 2Z5FA 2W58A 3LAWA 2P5SA 3B1WA 4TYQA 2H17A 4HZUA 1N6LA 5KSOA 1J8MF 3BIFA 1ETUA 3FMFA 2EWWA 1NSTA 1P2UA 1XPOA 3QF4A 5CLQA 1A2KC 3QPWA 1VHTA 4O3MA 3SJCA 1EWRA 3TSOA 1AGPA 1KO4A 2J3EA 1II8A 5EXXA 1GAJA 3D7MA 1Z5ZA 1IAQA 4LJAA 3L43A 2QI9C 3AGQA 1HY3A 4QGHA 4RFSA 1BYUA 4KLZA 1DE0A 4BWYA 3KTAA 2ZQ5A 4AD8A 5GJCA 4ASUD 4D82A 4CEHA 1T8TA 1TU4A 4S2EA 2YOGA 2ZS9A 3B13B 1E0KA 1NVVQ 2G3YA 1R5BA 1EG7A 1SVOA 3ZGXA 1Z83A 3NBFA 1I2MA 4ASUA 2AD5A 4XVRA 1XEXB 3HP1A 2D62A 1T3SA 4IW3B 821PA 3B7GA 4ESVA 3S1AA 3I3SR 4Z8XA 4LOAA 2WM9B 4PPQA 4ZI3A 1X8LA 4Q1BA 2OUKA 4AYTA 4G5SA 4Q5IA 2P5TB 1N6PA 3CRRA 5JRJA 2JLXA 4YMUA 4URWR 4ARZB 1TF7A 1P4SA 3K0CC 3Q3JB 1ZNYA 3CRQA 3R8CA 2DY1A 1IY1A 4RZ3A 4UJ3A 3K0FA 1FTNA 2FOLA 5EUQB 2I1QA 4B35A 4LC1A 4AYXA 3BB3A 3KKQA 1TF5A 4D4KA 3TE6A 4IXNA 1YZNA 4C0BA 3CO5A 3UPUA 4OI1A 5KTYA 1XD2A 3OIWA 4BE7B 4GOKA 5BYKA 3NBYC 1VG9B 4KFRA 1UEIA 4MGIR 3WMEA 1XPUA 2R6GA 3E1SA 4TL7A 2GZHA 3QQ5A 2GNOA 4MRSA 4RKFA 3TGPA 1ZM7A 1OFIA 2IT1A 1VMAA 2ZJ8A 3VX3A 4LUCA 5DI3A 3RDPA 2DWOA 2LWIA 3FWYA 3LX5A 1ZNZA 1VDZA 1ZUIA 2RGCA 1OXXK 2CHGA 1DAFA 2PLRA 2BV3A 3NTUA 1N6IA 2ZTSA 1Z3IX 3PR1A 3CF2A 1E1QA 3C14C 3WNCA 3D8BA 2VO1A 1JQJC 3LD9A 4C0HA 3BFVA 5DE3A 2QA5A 5JSZB 3J81k 3P1JA 4FINA 4YMSA 2PBRA 3GEEA 2GRJA 4OK3A 4QJ4A 1E2NA 3R8FA 4BLSA 2WVJA 3NBXX 3L82B 3ZZTA 3Q7PA 1T0HB 4DEXA 1AN0A 4NPHA 5AJXA 3FFAA 2QMOA 2O0JA 3UMFA 2MSCB 1GL9B 2FEMA 1XCPA 4FXPA 2ZE8A 1ZC4A 1NKTA 2DFTA 2EFHB 3QUSA 5EP4A 1BO6A 3AVUA 2DPXA 2CBZA 1NI3A 4QNMA 5CJPA 4B32A 3GJ4A 3WBKA 1M2OB 3MWKA 1DARA 5FTLA 4TTPA 4JKIA 2FSGA 1ZD8A 1X1SA 3U60B 4PHHA 4D0LB 3QKTA 4QNRA 1GNPA 3GFOA 5GADl 4C0SA 4G5QA 1DELA 2IK8A 2KE5A 2ZVQX 2QQ0A 4LRWA 3AF3A 1BKDR 2FZ4A 1T0JB 2BM1A 4LSGA 1P9WA 3C41J 1RZ3A 1SHZA 2A78A 1UDWA 4BRUA 4AY2A 1XX6A 4V03A 2ZJ2A 1RKBA 1PUJA 1C4OA 3BGWA 1GITA 2VL7A 4Z54A 3WYFA 2O8EA 1PLKA 2WWHA 4Q1EA 3ASYA 5JRZA 1OFTA 4WXRA 2N1BA 2FSIA 4PX9A 2XB2A 4OHWA 1E69A 3DO6A 4Q7MB 3CRVA 1U9IA 4U5XA 3VR3A 5TXGA 3KQKA 2WBLC 3R7WB 3VR1A 2R6DA 4RJLA 3ND9A 2L0XA 5CIWA 4B6EA 1OIWA 4DJTA 1Q20A 3FFBA 4ZKDA 2VF8A 2WV9A 3RNLA 2FG5A 5IDVA 3NWJA 2BBWA 4FW9A 4GMXA 4QM7A 4BLOA 1OW3B 1HQCA 3FHOA 1N5IA 2CE7A 3EZ6A 2VH5R 3AVQA 3TAHA 1JEEA 4PQFA 2OZEA 3THOA 4NTZA 1Z0DA 2YKGA 3NBZC 3VR4A 1E96A 4JJZA 4MKGA 3SJAA 4J0QA 2D2EA 2BJWA 3C4JA 3SQXA 4RZ2A 3GLGB 1IXSB 4XWAA 2ZYTX 4JT4A 2A5FA 3RWOA 1JR3D 4RVCA 4TLDA 4TQAA 5HTKA 4Q4AA 1CIPA 2ORIA 2NG1A 3GLHE 2GJSA 5EXPA 1PUIA 4HI0E 1XU4A 3H84A 2HF9A 2VP9A 2ODNA 5J4VA 5E7MA 1JR3A 1OH5A 4JSTA 3EPHA 1U0HC 3B1XA 1WDTA 1XXHB 2QU8A 2Z6VA 4DB4A 1AA9A 1R0YA 1EX7A 3R9WA 3B1YA 1HT2E 1Z0AA 2ZRLA 4ZIRA 2OESA 4R2IA 1XD9A 1OIVA 2YWHA 1X6VA 1W0KA 1UDXA 1XP8A 3BC1A 1OH6A 1FMJA 1GRNA 3A58B 4LV8B 4OI2A 2F55A 4MH0R 2VP5A 3BS4A 2G1JA 5CYPA 4HATA 1ZMXA 2BHRA 2EFGA 2N46A 4NKRA 4UKDA 4US1R 3I73A 4DCNA 3KQLA 4E5UA 2B8TA 1S1MA 2WSSD 1KI9A 2V55B 1RW4A 3N2IA 2GBLA 2GXSA 1N5LA 4MQBA 2XTMA 4PXAA 1KJWA 4M2LA 4EPWA 2BMDA 1DOAA 2DWQA 2WSSA 1IONA 1Z22A 5G53C 4A6PA 4BFTA 4CT5A 4DDWA 3K70C 1CP2A 3NH9A 4W9MC 3QXJA 2YC2C 1NL3A 2HT1A 5TV2A 1BH2A 4B2PA 2CLCX 3KB1A 4PZZA 4MITA 4FMCB 4XSGA 5JJIA 3L0SA 4DSOA 1CRPA 1KI6A 1CJMA 2BMEA 2G77B 2QEQA 2ZS7A 4M9XA 4FMDB 1G16A 3QXXA 3KQUA 4P3YA 3IPYA 1KKMA 4QOSA 3VFDA 1Q3TA 1EFHA 2ONKA 2WWGA 2GWHA 4MRRA 1ZM3A 4RZUA 1EWQA 3LWNA 4M1WA 1KK0A 4YLGA 4A36A 5JHHB 2VHUA 3T34A 5AK0A 1W7AA 2XGJA 3ND8A 1QHNA 5CM8B 2QBYA 3GCGA 1RRFA 1GP2A 1YR9A 4IFEA 5BWMA 4CEJB 3LQRA 3QKSB 3LVRE 1FNNA 3OAAD 4DCVA 3NEYA 3P4XA 3U6BA 2ODBA 3HWSA 2XOKD 1AK2A 4B44A 3ICQB 3UKDA 1YZQA 4EJSA 2W2XA 1C1YA 2IUSA 3K70B 2F3RA 2PMDA 4Q4JA 2OFOA 3ASZA 4NCNA 5LD2C 1E9RA 3ETLA 1HE8B 4G01B 1JJVA 2Q3FA 4TYYA 1JEDA 4V0MA 2R8RA 4X8MA 2EYQA 1L8QA 4WA7A 3V4FA 1P9RA 4HUTA 3K0SA 1W4BA 2ZU6A 4RD0A 2BWJA 2WOJA 2NZJA 3R20A 4CF7A 3CPJB 1QG4A 2RHMA 2OCPA 3AVYA 3CZQA 2CL0X 2Z4SA 3PUVA 2MMCA 1YJ5A 3Q5EA 4F7WA 4F93B 4D81A 3H0KA 4B47A 3BFKA 2QPTA 4ZCIA 1MO5A 2IL1A 2REXB 3RS0A 1QHHB 2PZGA 3W5JA 4DZZA 1Z8FA 1W0JD 3CW2A 4DLRA 2O8FB 3LLMA 1W1WA 1K5DA 2OXCA 721PA 3EPLA 3ZH9B 2Q21A 2C9YA 5BXQC 3THXA 1IY2A 1Z6TA 1U98A 3F3YA 3GLIB 4PHGA 1E79D 1W0JA 3AP2A 3SYNA 1G8GA 3LFUA 5E95A 1FPMA 1RRGA 2V1UA 4Q9IA 2GJKA 4FMCF 4RD6A 5J47A 1KI1A 4LYJA 5KNBA 2TMKA 3LO5A 1QHYA 3WMFA 2EQBA 5JI3E 2IYQA 3SN6A 3B82A 4TMXA 3FVQA 1OXSC 2PMKA 2ZROA 3VNVA 4JLMA 4U7DA 4BRWA 4P0TA 4EFMA 2ERYA 3LW7A 1QRAA 1L4UA 4Q1FA 4CIDA 2VF7A 3BWDD 3AUYA 1R10A 3PEWA 4NCJA 4OQNA 3SJBA 4AWXA 1R8SA 3FDIA 3DPUA 4OJQA 2IYXA 4KFTA 4IEEA 2YINC 4A2WA 4Q01A 2AKYA 2XZPA 4M1MA 4D6PA 3B9PA 4AKIA 1A5TA 2GA8A 4FCVA 4M1OA 1MRSA 3PCRB 3AVVA 1XEXA 1LFDB 2ZR7A 4PPGA 4URXR 3OIYA 2D74A 3X2SA 3GMTA 1Z2CA 3WNDA 1KZ7B 1Z6AA 1LY1A 2FSHA 4YDHB 1OKKD 3K9NA 2JJ2A 1P2VA 2BC9A 4OBEA 3QG1A 4GI7A 2ASEA 3OEED 3GJ6A 4Q9LA 4KYUA 2F6RA 4LWZA 4C0KA 3C5CA 2BBSA 3SBEA 4ARZA 2DWPA 2QMHA 3LNCA 1FFHA 5A0FA 2NO0A 3SDZA 1X3SA 3K9HA 1OKKA 3ZLJA 4M22A 4PFSA 2WWIA 2XXAB 3OEEA 2JJ8A 3AV0B 4Q03A 2X19A 3M0EA 1RPZA 5DO9A 5KDDA 2IC5A 2ZI5A 1KK1A 4QG7A 4FD2A 1N0WA 2ZPTX 1VG1A 3K0EA 4IEIA 1E2DA 1F5NA 2MSEB 1MT0A 2FDCA 4Q1CA 3L0IB 2BKEA 3RC3A 1XJCA 1LS1A 3AF0A 3I61A 4JBWA 2WJGA 2ZRIA 3NG1A 1X86B 4Q47A 4GRAA 2AR7A 1MKYA 2EW1A 3JVVA 4M1KA 1CTQA 1MOZA 1TEXA 4PPNA 4UNPA 1CR1A 3CM0A 2WHXA 2P6RA 4CYMA 1Z2AA 2PCJA 3NH6A 2BVNA 2J9RA 3N70A 3TNFA 2W6ID 4TYPA 5FBQB 2FGJA 1GRQA 4ZDIA 4GNKA 1G9XA 1KJYA 1Q22A 1VTKA 4HAYA 4DBLC 1OB2A 2GBLC 2QAGB 3TSWA 3K0CA 3G5UA 4KBGA 4JVSB 3A1UA 5AUOB 4LJ9A 2RKOA 2W6IA 3EZ7A 4HLUA 2C2HA 1OF1A 2C96A 4EFLA 3KXIA 1GNRA 3LXXA 2PEYA 4UNNA 1ZU5A 5JSZA 5FH9A 3REFA 4O25A 3SZRA 4HAUA 1E2HA 5BYJA 4UJ5A 1DBSA 3NKVA 2YWFA 2G6BA 3QXSA 1J2JA 3CKLA 3KL4A 2LKCA 4L15A 4DVGA 2VHJA 3H1TA 1DVRA 4E09A 1VYUA 2VPPA 1CEEA 2NIPA 2IF2A 2OLJA 4TWZA 5FFMA 3AVOA 1LF5A 3IBGA 2R9VA 3W6PA 4LJ8A 1N0VC 3EG5A 3GEHA 4R98A 2W2TA 3QI2A 4MYUA 4NYJQ 4PSAA 1P5ZB 2NZ8A 4PSVA 3VU9B 1T91A 1DAMA 1ONBA 1T8UA 1U99A 3W5IA 4D26A 5JJLA 2ZETA 2XITA 4V0OA 5B57C 3GFPA 4NONA 3DZDA 2GEUA 4C30A 4C0AC 1XTQA 4D0GA 4WOPA 3WP0A 2J41A 2IXFA 1E32A 1P75A 3KJGA 2ZSFA 3KQHA 4ON9A 4C0LA 1GM5A 4WVFA 1HTWA 2CNWD 2RAPA 3PJRA 1YZLA 1ZP6A 1ZUNB 1K6MA 4Q4LA 1IQPA 4ZPXA 5HCNA 5DHFA 3W9YA 5C2JB 3X1WA 121PA 1ESMA 3DOEA 1AS0A 3NEJA 4M53A 2IYLD 4CVNA 1XB2A 1FQJA 2FJUA 3LBNA 2JLVA 4NYMR 2IF0A 2CNWA 2OILA 3OFND 2DYKA 1E9CA 4QBHA 5JMTA 3NVAA 1HYQA 5GJBA 3CUEF 3KUCA 4DIDA 5F2EA 4Y0VA 5AJVB 1VYTA 4MDEA 1T5IA 3PV0A 1G41A 4AIIA 3OFNA 3HR8A 4TYNA 2ZU0C 2IS1A 2AKAB 2DBYA 1VCOA 4US0R 2P6UA 1KZGB 3R7WA 5FUXA 2XZLA 3CX8A 5FOTA 1FNMA 2BJVA 4PO1A 5CK5A 2QTFA 3HYTA 4UNQA 1XZQA 2H5EA 2W2VA 2A7QA 3WNBA 2GJ9A 2DFNA 4QKQA 1I4LD 4PZYA 4AG5A 4C2TA 3KZ1E 2ZUBA 4GZLA 1NN0A 1D9XA 1R5OA 1EFTA 1E94E 4QHTA 3V4RA 4JL6A 3GJ5A 3OESA 1ZC3A 1DEKA 5FPKA 4CEIB 1S3SA 2OCAA 1CJUC 3AVPA 3DDCA 4LHVA 3PUXA 2YVUA 4OK5A 3GLGA 1NNEA 1NIJA 2VTKA 3RSLA 1JAHA 3TRFA 1E0JA 2FN4A 3P4YA 4KFSA 3DM5A 4F4JA 2PJRA 1SVSA 3LX8A 4Q1DA 3U7HB 1LVGA 3TH5A 3A1SA 4AYWA 5K8LA 4Q7JB 3U3KA 3U7EB 3LA6A 4JLNA 3EIHA 1XXHA 2SHKA 4YQFA 1KY3A 1AQYA 2ZR9A 1FL9A 3Q85A 2YC4C 4IOLA 1ZRHA 5GVSA 4B74A 3PEVA 3U7FB 3JZAA 1NN1A 4KSBA 3Q8XB 2OE2A 1G8FA 4GOJA 4IJMA 5BN3A 3UG6A 3AVXA 3LW8A 2O8DB 2CE2X 3BH7A 2ZSEA 4IDHA 5JWHA 1W5TA 3QSYA 3AM1A 4O2LA 1FX0B 4JSYA 4RCZA 2BMFA 3QIAA 3VHXA 4HDQB 2BMJA 2A5DA 3C7KA 1E2FA 2JEOA 2CL6X 2QM8A 3Q72A 4ZCMA 1Z07A 3PITA 4Y0AA 2ZJ5A 2XZOA 2WIBA 1HA3A 1OE0A 1KI7A 4R7ZA 2QMUA 2AWNA 1Z0JA 5G3YA 3QE0A 1XJ0A 4HB2A 1Z06A 3U3RA 2GAAA 1DO0A 2F1HA 4IRUB 2ZSBA 2VHCA 2XX3A 4FIDA 4Q9HA 3TQCA 4AC9A 1T3LA 1ZNXA 1YR8A 2ZSAA 4KHZA 5FBRB 5KDOA 2VA8A 5KNDA 2AN9A 2QROA 4H1UA 1SULA 2D06A 1UM8A 3CPHA 2QTHA 2WWWA 5FTMA 5H8WA 4QHYA 2B8WA 3TR0A 1OLOA 2GEVA 4A1FA 5CYOA 5J4YA 4TMKA 1FOEB 2GJAA 2QSYA 3QF7A 3QKUA 1NLZA 1KDRA 3VR6A 5ELXA 1UFQA 1R2QA 2J5XA 2QM7A 4KAXA 3N2EA 4OL0A 5GVRA 4DLSA 3T15A 2LKDA 1EFRD 4DCUA 1Q57A 2IEZA 2HDNB 3LLUA 1F2UB 1YR7A 4DDUA 3K70D 5E7IA 4RFVA 4BFVA 1UAAA 4LJ7A 3ADBA 2GETA 4Q66C 3K9LA 1CULC 2J45A 3AVTA 5K8UA 4EPVA 1EFRA 4E07A 4TYWA 4DT1B 3KQNA 2GF9A 4PO9A 2C77A 2W83A 2NGRA 1UBCA 2J0UB 4HLUC 3X1DA 3I32A 2V4ZA 3AF4A 1ANKA 2VHTA 4LPKA 1K8RA 4PZLA 2QRNA 3DVLA 1NN3A 3B9QA 1NMXA 2WTUA 3QXHA 3RS2A 2QL6A 2WSMA 4B34A 5TB5A 1FP6A 1HEIA 1LNZA 1DTSA 1MO4A 2I1VB 1OXVA 4A2QA 3GLIE 3KXLA 421PA 5ANRB 2UZIR 1OV4A 4CZ2A 3ZQJA 2IYSA 5HE9A 2P65A 2G0TA 4M9ZA 3D6TB 3CBQA 3RABA 4NCHA 5H70A 3FMOB 1CU1A 1QHHA 2A5GA 2HYDA 5JZVA 4MYHA 4KVGA 5FL7D 3B1VA 4B76A 4DSUA 2OAP1 1HQYE 4B33A 1R6BX 2O8FA 1SZPA 2WKPA 3L2OB 1S4QA 2K5UA 5SZIA 1Z63A 3GLIA 2YWEA 4TLEA 3VKWA 3B85A 3ZJYA 2WOOA 4RD2A 4II7A 1QVAA 2ERXA 5AJYA 4IHQA 5FTKA 1FQKA 5LDDC 2EFEB 4K46A 4D4LA 2GHIA 4DHEA 1G3QA 3FHCB 1NVWQ 2G83A 1E2KA 3L8YA 5EE5B 4N1AA 2KWIA 1YKSA 2ZE5A 1P60A 1KO1A 5FOUA 1P9NA 1KHTA 4OI0A 1NJGA 5DLQC 221PA 1Z6YA 1GG2A 1PJRA 4IVPA 2GXUA 3ZZ0A 3B8HA 1XTJA 3VKHA 3K8YA 1JALA 3EZ2A 4QL3A 4KFUA 5FOXA 1G64A 2CL7X 1II0A 2YYZA 5TDHA 3W34A 2QP3A 5F9HA 1JPNA 2C5LA 5KHOC 1AZTA 1MRNA 4OHXA 2G1KA 4EQ6B 3O8RA 5EZ6B 1S0UA 3CF6R 5EUMA 3C15C 5EE9A 3WXMA 4QFMA 3RAPR 4P4UA 4TZ0A 2BCGY 2ZIAA 1XFAA 4XVQA 2WKRA 2ZRDA 1TEVA 4I99A 1T6NA 3EA0A 2J1LA 2ZRHA 5C46F 2ZJBA 5G40A 4JMPA 4Q19A 5SZJA 1KMHB 2OEPA 2YJTD 5TMPA 1WE2A 4YMTA 3TQFA 3BXZA 1NBMD 2EYUA 2AX4A 2FA9A 1IN4A 1AIPA 1XEWY 1GFIA 4PAQA 4Q9JA 1XTKA 5AUNB 3WHLA 2IA5A 3KFXA 2XXAA 3IUYA 4DB2A 1JB1A 2J46A 2VLIA 3SFVA 4MYCA 4Q1AA 5H1YA 4B3GA 2IYRA 3CNNA 4I1OA 4D4MA 1E98A 1NBMA 4CW7A 1KIMA 1EK0A 2VSFA 2PL3A 3KB2A 5BN4A 1WF3A 5CIQA 2C98A 2WMNB 2ATXA 2Q9BA 1M1YE 5LPNA 3W90A 4AI6A 1JR3E 4TMVA 1KSFX 4LY6A 3IBYA 3HDTA 2IS6A 3F8TA 3L8ZA 4ZDWA 3MUFA 1IM2A 3NIBA 3TW4A 4CRWB 3MGCA 5JCZA 3ONWA 1JNYA 4QGGA 1DS6A 1H8ED 3A1WA 1GL7A 3R9IA 3Q7QA 1FZQA 2A3RA 5F9FA 2B21A 2QAGA 3X1YA 4HSEA 3ADCA 2WWFA 2AHOA 4NH0A 1A4RA 1H8EA 1KK2A 3QEOA 4MDFA 2JGNA 1H8HD 2BCJQ 4OQFA 5DIFA 1E1RD 2VRWA 1KO8A 1XTSA 2V1XA 4L4UA 3TSZA 3RHFA 5JEDA 1G21E 1KY2A 3M1IA 2HXYA 1KAOA 4A82A 3W6NA 3I5XA 3SHWA 4L16A 2B7BA 1KDTA 1M8PA 1CJKC 4KBFA 1DG3A 4N0EA 3W3ZB 1E2LA 3IIJA 2DCUA 4KI0A 2ZVPX 3SS8A 3V9PA 1A1VA 2QT0A 4MGKR 1M74A 4D80A 1IY0A 2QSZA 3H2YA 1KI4A 4G3XA 4PSKA 2H8KA 1M6NA 1Z08A 2W6JD 3VU9A 3ZVMA 1E9FA 1D5CA 2ANBA 4TN1A 5FTNA 1E6CA 5C4GB 1U94A 5EP1A 5LB2A 2QRZA 4W5WA 2W0SA 4S35A 4OHVA 1WMSA 2W6JA 4TLCA 2UKDA 1RJ9B 4JLVA 4EIWA 1Q0UA 2ODWA 2J59A 2AFIE 1E9EA 4PC7A 4B43A 3AUXA 4HUQB 1OXTA 2AL7A 5FOVA 3QEJA 1M7HA 4TZ6A 2O8BB 1ZBDA 3C16C 4C7OB 3LBIA 4DRZA 2B92A 3WHKA 3T1TA 4GL2A 1ZIPA 1GVNB 1ZCAA 4A0HA 1D2NA 1P72A 3TAUA 1COWD 3I4LA 5BN5A 5FPSA 1N2CE 1GNQA 1Z6XA 2CEAA 2C04A 2PH1A 3KKMA 4X8LA 4A0FA 4L8GA 4R71A 2LCFA 4BFZA 1TU3A 1COWA 4V0ME 2X1VA 5DH9A 3HPQA 3UIEA 3A8TA 1F6BA 4X8OA 4P4SB 3WYGA 1E0AA 1G1MA 1JXMA 2EFDB 5DI9A 2AK3A 4CT4B 5EE1A 5E7JA 2ZUCA 2HV8A 1GL6A 2FGKA 4PHTA 4LZZA 2I3BA 4ZKEA 5JFGA 3H86A 4LBYA 4Q7LA 2ZI6A 4TTQA 3W8NA 2FF7A 3ZD6A 4WIAA 4BLRA 3OAAA 1KKLA 3C5HA 5FR2A 3VHLB 1W4RA 2XOKA 2IYYA 4KJZA 3A6PC 3DM9B 2RGBA 5DISB 4G0NA 4CEIA 1NG1A 1XMJA 4B73A 4QRHA 4A6XA 3GJXC 2R6CA 1TF2A 5JECA 2G88A 1G17A 3LXRA 5EP3A 2Q9CA 4HB4A 3A4MA 3B2EA 3D31A 3TVTA 3A1TA 3T5DA 1TAGA 3FKQA 4B2LA 2OG2A 3TLXA 1A7JA 2GZDA 2CLDX 3KFVA 1QHGA 2RB4A 2MMGA 3TUZC 2V7QD 3EXAA 4Q4HB 3K9GA 2WICA 4PTLA 1TQDA 3SOPA 2RGAA 2VP6A 2ZRPA 3BB1A 3PEUA 4PANA 4CGZA 5HCIA 2IW3A 1NSFA 3ZQ6A 1AZSC 2V7QA 2C9OA 1I4DD 2P2LA 2O8DA 4WXPA 2IWHA 3RLFA 3BJIC 5EE0A 2V6JA 4WBSA 2BIFA 2NPIA 1FX0A 1TUIA 3NC0C 4V0KA 1KDOA 1OHHD 1E79A 2BOVA 2QMEA 4BFXA 4NMMA 3IILA 3VQTA 2AFHE 4LJ5A 4POAA 4PR0A 3R9XA 3A1VA 3T5GA 5F3WB 2GAOA 1E2PA 1YZUA 3WMGA 3BH6A 1OHHA 5FOWA 2J0VA 4OJKA 4NZYA 3TVDA 4DCTA 3NDBB 1RE0A 4Z1MD 3UWOA 1KI8A 3GPLA 2CLSA 4LHYA 4GPTA 4TL6A 3L0PA 3TJZA 5A4JA 1OJLA 3T1OA 4W7SA 2A9KA 1GTVA 1LF0A 1PZNA 1DG1G 1Z6GA 1R4AA 4V02A 3U3MA 2F43B 4BGDA 3CR8A 1XPRA 4Z1MA 2OXRA 5TARA 1UEJA 2FSFA 4A9AA 1WCV1 2O0HA 3EZ9A 1Z0FA 4URUR 4MUBA 1NVVR 3DEFA 2ZITA 4QBGB 3CNOA 4ZDJA 1KDPA 2IYZA 3WP1B 4Q9KA 1M7BA 1ELOA 2YOHA 1T3HA 3VX4A 3PEYA 4LV5B 1XD8A 1U0LA 3FYHA 4LYAA 4DLWA 5FBVB 2BKUA 1F2UA 2NO6A 2FMXA 1E2QA 3AF1A 2QG6A 4NBSA 5TY0A 4YMWA 3FPAA 1OSNA 4OQMA 5A5GA 2WAYA 2GVZC 2ZRFA 2QAGC 4DT1A 4DWJA 4M1SA 4LPSA 1KMQA 1ZINA 2F1IA 4PHFA 2B7CA 2J0UA 3NHBA 5J4KA 3CH5A 4B48A 2QP9X 1AJEA 1D6JA 3U6KA 1KO7A 4OKSA 1JAIA 1NY6A 2IYUA 3QPUA 4TMZA 4DC9A 3WRXC 1IOZA 1V5WA 2E9SA 1U0JA 4JJKA 3AKYA 4KV9A 2HJGA 2IBMA 3KX2A 1S1CA 4O2RA 3TBKA 4F38A 4KLNA 3SYKA 1N5KA 3F5FA 3DMDA 4MYTA 3KDSE 2F1RA 1TX4B 1MO3A 1ZM4A 5UKDA 1P2TA 1FUKA 1Q1ZA 1TL7C 2QE7D 1FTSA 4UXJA 1AGRA 1XTIA 3LH5A 5EXTA 1X8KA 3KKOA 1G8PA 5IHPA 3FMPB 2HCBA 4LV6A 3CPEA 2QE7A 4A15A 3IEVA 5K8IA 3U44B 4ILEA 4P31A 1NF3A 1KI3A 1XTRA 3B60A 2R65A 3PFIA 3SC3A 1P62B 3MWYW 2OAQ1 3WRYC 2X2EA 2Z83A 3SQWA 4FCTA 1QVRA 3EIEA 4URYR 2IYWA 5CK4A 2IEYA 4H9GA 1BYIA 3WYAA 3AF2A 1EX6A 4NDZA 2V54A 4DIEA 2FEOA 3BE4A 3RRZA 3AQ4A 3LVQE 1F60A 4HLQB 4RCYA 3SE0A 1E2MA 3FKSD 4PC2A 1WBBA 2ZJOA 4KU4A 4L9WA 4DSTA 4I1SA 2IS4A 1QF9A 4EKDA 1IXZA 2R6AA 2G0NA 5LB4A 5L3QB 2FV8A 3DOFA 1EFCA 4PC3A 1D9ZA 4I1VA 4GMDA 2YZ2A 3B5JA 4GDFA 1OXUA 3FKSA 3IO3A 5DYIA 4UNRA 1QHSA 1UKZA 1W4AA 5FR1A 4IOJA 4P4TA 1E9SA 3RS3A 2GCNA 4U00A 1YHNA 2D7CA 2NPFA 2XAUA 3DKVA 4EQ6A 4HZIA 2C8VA 3MMPA 1ZIOA 4G5RA 4IXMA 1N6HA 1T4GA 4LHZA 4Q18A 3GLHB 2FPMA 1DPFA 1GDDA 5DYGA 3E2IA 3T1VA 2QENA 5EJEA 4XWKA 2ZE7A 2ZS8A 3OHMA 4XIGS 1UF9A 2G9NA 4MRNA 1Y3AA 4LJ6A 2WIAA 4XVUA 4F92B 2GESA 5AJZA 4BLTA 4DXAA 1KMHA 4QXAA 2AXPA 2D3WA
chains in the Genus database with same CATH superfamily
3R3WA 1YBAA 4L8VA 1PJ8A 2ZANA 2Z8YM 1CP3A 1LSSA 2WTMA 3ABQB 1JXOA 1ZUD1 2WJPA 4HDRB 3FOCA 5EP2A 5ALPA 3RE1A 2EP8A 3D0RA 3RUAA 3FCUB 5AI5A 2I3ZA 4BYMA 3GFFA 3RV4A 2ZBGA 4MJXA 1EIWA 4A0QA 5IYZA 3O26A 2H2WA 3DBVO 3OQ1A 2XBLA 1M0TA 3U2QA 4KCGA 1IK4A 2Q45A 3IYLW 2PWAA 4FE7A 5FOSA 1TU0A 3IRVA 2I4LA 2WV7A 3BQNB 1PLLA 1G8YA 1Q19A 1TADA 4BLQA 1XNJA 3PX3A 4FQ5A 5K2OA 1RC8A 1D0SA 3EIWA 2OBFA 4L7VA 4A4DA 3TW8B 5KU7A 1HF3A 1HFJA 4NJOA 5D3MB 4QT4A 3QLEA 4WZ6A 5IU6A 1U11A 4U2FA 2PX0A 2VP2A 2XXJA 2CMHA 2ZT8A 3BMQB 3DZJA 1T5SA 5EYPA 4QUDA 2HWXA 3HBNA 4PYLA 4R3UC 1NUPA 1XMPA 3IEMA 1VGVA 2FNAA 1BCSB 2GKOA 3BCRA 3UH1A 2GZ3A 1GFSA 1WX1A 3UGKA 3L8MA 4Q48A 3ZI7A 1ML4A 2HPHA 2I5PO 4WTOA 1L7EA 1R66A 2RHLA 3N0TA 5CVTA 2BGGA 5DOVA 1N6NA 4FFVA 4LDZA 1U6IA 3AF5A 4EPYA 4MUJA 1L7AA 1L7RA 2WPDA 3D9QX 5COQA 1GA6A 3IAAA 3QLVC 1IG0A 3KFLA 3O0TA 1X92A 2NO1A 1UKYA 1SXJC 2AC7A 2IWRA 3RWMB 1VGRA 3ZDBA 1L9KA 2V6GA 3E05A 5C37A 5LDHA 3G49A 4HX2A 4ZVUA 5KNCA 2QL9A 4MIYA 1MOSA 4E3ZA 2GCOB 1CYEA 4HDMA 4OXNA 1J99A 3BK7A 3P5BA 4WW0A 3PFWO 5TQ0B 4QLAA 4AK9A 1W93A 3BFXA 1TD1A 3OJOA 1R50A 3C6KA 3HPRA 2CD7A 3EARA 3P7MA 5IW8A 5SY9A 1RYHA 5DHSA 4JYAB 1ZVQA 2DFLA 3D1VA 3GQBB 4UDOA 1ML3A 5CBPA 3BFJA 5K0FA 2G9QA 1IVNA 1CWUA 1JHXA 4GYWA 3QOWA 2QN1A 1LQTA 3UUWA 2Q5CA 4MUXA 2FSVC 2WZBA 2LGJA 4XLZA 5D5PA 2OR3A 3I8SA 1UBHS 1NRJB 5DEIA 3FCSB 4NHOA 1XRMA 2X0FA 1RSZA 3EH1A 3UFXB 2V3CC 4GKKB 3CC8A 4ZQFA 1IBRA 3MPOA 2G70A 3HYSA 3I34X 3SHTA 2JFBA 5BR1A 3T54A 3ZK8A 4FQ7A 1ZUHA 4CBVA 4UAUA 1PGQA 1UBNA 1GO2A 3CURA 3JW8A 4KZPA 4GKAA 4NZPA 4EKIA 4HUQA 3BJRA 3H5RA 3BG5A 4ENQA 3O03A 2REBA 2ODQA 2B37A 2YHSA 4MHSA 2Q28A 2H1OA 5AICA 2HKIA 1KOGA 1CEXA 2VP4A 3LT5A 4JY7A 2QPAA 4UNSA 1FTWA 2QORA 3IR5A 2PXCA 1E64A 4YAEA 3SLKA 4A0GA 3ETDA 2ZIXB 4J03A 1KBOA 4TT3D 3C5WP 4ZMSA 1COZA 3MJRA 4D0NA 3EWIA 5KSYA 2BEVA 2JGJA 2ORWA 2POCA 3DS8A 3GELA 4PFQA 4C76A 2O1XA 2Q6OA 2AXQA 4BQQA 3C48A 3HA7A 1NLUA 1PJ2A 3QU9A 2BGKA 4XX1A 5IASA 1TKAA 4KGXA 4BLPA 3L7KA 4K3UA 3SQNA 2Y1KA 3KUXA 4PO8A 2ZW9A 3VC7A 1KI2A 1KAGA 2YV4A 5AVQA 4FEYA 2OBMA 1E59A 1JH8A 4BZXA 1SVIA 2QD4A 2D2XA 3CJRA 3QBTA 4B3XA 2FRXA 3IVMA 4NPAA 1ESNA 4TKUA 2JC3A 5TEVA 4QREA 4DXHA 2XHZA 4LX0A 1ZHHA 1LV8A 5ITWA 2Q5FA 3U9TA 3IUNA 2NO9A 2QT1A 4RK6A 1JAZA 4M21A 5C0OE 2IGTA 3TM4A 4BMVA 4EK9A 4KE6A 4G26A 4BBJA 1P3DA 2GK7A 4J9VA 3TX2A 2G9RA 2HUPA 5FPTA 1VZ2A 5K51A 5C3UA 4URVR 4EUKA 2YY6A 3DAPA 1LI5A 3L5OA 4ITRC 2GO7A 3O90A 5DSZA 4YMGA 4BTVA 2J0EA 1QZZA 5KQPA 2YICA 4BIIA 2HIMA 5HS4A 1JDSA 3NVKI 1VMEA 1NF2A 4MI3A 3E9DA 5GV8A 4EF6A 4K7JA 3UHAA 4NC9A 1CZNA 1KOJA 2CJWB 1SC6A 2C4MA 2EFCB 2R44A 2A5JA 3QW4B 8ATCA 1VSBA 2JD2A 2ZK7A 2V9PA 4I9FA 1MNQA 3B51X 3ZS9A 4H7JA 5KBYA 5JMPA 4C4SA 1C1HA 2NZWA 2WABA 3JQ7A 4BCBA 5JUWA 2XVZA 2O48X 4HDAA 2C1ZA 3EG9B 3H42B 1M66A 2PVCA 2HIAA 4Q7KA 1TUEA 1LW6E 5JI2E 1FTQA 3C7TA 5THQA 4A8TA 5JZBA 1XZPA 1V43A 2FZ5A 3P26A 3BB4A 3V7NA 2IHBA 1PQWA 3WGOA 4DDTA 3E2PA 5KINB 4YCLA 3E0QA 2ZXUA 3HVRA 4BNVA 1B76A 1XKLA 4I66A 1UJ5A 3VYTB 1A2BA 1W34A 3T1QA 4FCWA 1SOUA 5U4XA 3ZU4A 2VF4X 4RA6A 3OU6A 4PM4A 4B85A 2D2IA 4HY3A 2EQAA 3VUFA 5JR3A 1PGNA 2HY7A 4H59A 1L1FA 4LYDA 3T9AA 2QN6A 4Q37A 4HAWA 2DFDA 4MV8A 4OHMA 1ESCA 5C8YB 4CMGA 1ZGAA 3DOJA 3B6IA 4KGDA 3EODA 5K8TA 1RAEA 3VI4B 2A59A 4GI2A 2Q5EA 1ZS9A 3UT5B 1DBWA 1CVLA 1YU9A 1R7RA 2B6NA 2UVQA 3NYRA 1X87A 4L9RA 4TZKA 4WKNA 2O8CB 1HLPA 1CUCA 1NTOA 1J8YF 1SCUA 1QFJA 3PQ6A 3U09A 1PWXA 4AMBA 3OX2A 5JRDS 5DK4A 5DN6D 4GZ6A 3ZIAA 1I7NA 3BD6A 3CGGA 5G4KB 2VIIA 1VECA 1W36D 3HY4A 1B73A 1JEJA 1XDBA 1O5OA 4D57A 3DCNA 3OOJA 3DE1X 3UATA 4ZZ0A 4CETA 4QDOA 1JYFA 1XALA 1CR0A 5CM2Z 2TYSB 3U4DA 1A97A 3GAMA 3NIWA 4DCSA 3GPIA 1G5FA 1RI3A 3FNBA 2AX3A 3L7YA 4Q39A 1RBQA 5JH7F 4FWTA 4IJ6A 2ZJFA 3QFSA 2QTVB 1MFPA 1N5JA 5HILA 4PG8A 5JNWA 3V80A 1U7UA 3DB1A 3UGQA 3D2AA 3WO1A 3WAGA 3CWQA 3MJSA 1YSCA 3NYIA 1L7NA 2CYAA 1E4EA 3PEFA 3MRSA 1MGPA 1XJQA 1ZJ5A 2Z8XA 4EG7A 1RAHA 5CRIA 4B6FA 1GG5A 4FP9A 3IALA 1R0SA 4DYVA 1A76A 4I5GA 4F4CA 1N3YA 3HLTA 4PQRA 2VJQA 4B6OA 1KNQA 1E9AA 2AG5A 4R9UC 5KSZA 5IKMA 1ZCBA 4G9GA 3CQ9A 3MZ0A 3B2NA 1A4XA 1OB5A 4RKEA 1CUDA 2DBVO 4V0QA 5J58A 2J87A 3HDQA 4HC4A 5GZ1A 4M0LA 4A3SA 3ADDA 5IH3A 3HKCA 3RWBA 1GKUB 3MWDB 2C0CA 2NVBA 1TI7A 1Y9EA 3ZY2A 1O3YA 2CXXA 1XC7A 1CQXA 4UHFA 2J3JA 3O8NA 1ZIYA 3A9SA 3PT5A 3KKKA 4ETWA 1HDOA 1RZVA 1QDUA 2EOAA 3E3AA 4WFKA 2DSNA 5AQ1A 2W42A 5JQGA 2YHIA 3LWBA 1A9RA 1BGVA 2E4XA 3VNUA 4PXSA 3D4BA 3CUSA 4RF5A 3HBMA 5BRAA 3UT6A 2DQSA 2ZYUX 4P83A 2C57A 3V1MA 5LNK6 3MELA 3QI7A 3CVUA 4W5TA 3FSRA 3DHVA 1XRJA 3GNTA 2PMCA 1OX4B 2VC2B 3I5UA 4GSYA 1AHPA 2GF0A 2QTWB 5FL3A 2FPKA 1HFKA 4UXIA 1HE3A 4H1VA 2VDQB 1J2EA 3K9BA 4LYHA 3HABA 1C0EA 3EUAA 4QAJA 3U44A 2HLDA 4MRPA 4N0DA 1BQ4A 2HYIC 3MJCA 4IOMA 2WYUA 2FE1A 3DAYA 1JEQB 4JYBA 2OXTA 1YVDA 4LEIA 1PYGA 2C95A 4MB6A 3V1YA 1FNBA 1UL1X 4EO4A 5L3SB 1ND6A 2WKQA 4TRRA 4D96A 3OZWA 1XCMA 4XZ3A 1NP6A 5LXTA 1EEHA 1Q3HA 1L7VC 1FUIA 4V1CI 1NY5A 4URHA 3DLHA 3LF1A 4GX2A 4DLPA 4R05A 4RDXA 1XLVA 4Y6LA 4ZT7A 5DDIP 2VQ3A 1T8YA 2GNPA 1UMBB 2Z0MA 5HPYB 4I1YA 3Q4GA 4DDVA 2I7TA 3JQAD 3GLTA 1SVLA 4YJDA 4H18A 3DBLA 3T7TA 3UMRA 2VUIB 5AI8A 2BGWA 3RVBA 1JQBA 1KPIA 2GPBA 2JCGA 2WNSA 3DVQX 3GDGA 4PAOA 5CA0A 3U1BA 3CIFA 4TS3A 1Z4QA 2KBEA 2VBIA 2C20A 2ZRGA 5AW7A 2J5BA 3CUKA 1A9ZA 2UU9B 2PSEA 4EW3A 4P6VF 1XZLA 4TLAA 2GXAA 5CTAA 5B36A 3SKXA 5JAZA 1YDMA 3U13A 2H54A 4F5ZA 4I3HA 1V11B 3EUWA 3AU8A 3SMQA 1XIVA 2X42A 4F04A 2BJHA 5CB6A 3U1TA 5C32A 1NLMA 1TT5A 3GY0A 4XASA 2BRUC 5DJ5A 4WXYB 4JXKA 1TKCA 4QOJA 1M6VA 4WCVA 1XZHA 3GLHA 4G0QA 3KXKA 3QENA 1NRXA 4HTAA 1BTOA 4BVBA 4PEVA 1FXWA 1XCGB 3MG9A 1ADFA 1ZQ1A 2YJ3A 3OFVA 4CLHA 4Z99A 1HE5A 3QOYA 4NU0A 1SC4A 3K6KA 2G25A 2IKSA 3BSYA 3PCTA 2FQQA 4G23A 4NZZA 4YJ2F 2DT5A 1YXMA 4TV8A 2IQ5A 1NXWA 1W4CA 1S8FA 1GAQA 4X44A 4A8HA 1UP7A 3ND5A 4Z4HA 4N18A 4X7BA 3OM0A 2WYOA 3IDQA 2PT7A 1J22A 1D6SA 1H85A 2GTPA 3LXMA 4MARA 4RFSB 4C9BA 3O2SB 3LDAA 3Q3HA 3NJ4A 5AO9A 2FWNA 1DO2A 1SCAA 3BH0A 3SDSA 3U9LA 3EPKA 3VYWA 2QQ5A 2HDHA 1PNRA 3K05A 4GYYA 1VLHA 1FF9A 2H7YA 4P8RA 3S28A 3TOSA 4E31A 3MCTA 3RVLA 3RS4A 4CEHB 1H5QA 3OPMA 2XUIA 1GEGA 1ZESA 2J7PA 2B7LA 3REOA 4HN9A 4YWHA 2MHCA 4CE6A 1GQ2A 4PYMA 5AKXA 5LU9A 3KHKA 5ELLA 1KO5A 2L17A 1XWWA 3HB7A 4LVNA 1OGIA 4EM6A 2AR0A 2TS1A 3CNLA 3G2PA 4XEUA 4V2UA 3PWSA 1L8XA 4D2IA 1SELA 10MHA 5KZMB 5HQ3B 1PV4A 1OI4A 2PVSA 2RE8A 2UXBB 1QCDA 3GEIA 3I45A 3NPMA 4HEA1 3BQMB 3M2TA 3NBMA 3HCCA 3QOFA 4DCJA 2Q46A 4H6VA 5TS3A 1C3JA 1P9LA 2A9PA 4MV3A 2O52A 3L93A 4OP1A 4Q3EA 1BMTA 5JAQA 3OF5A 1CT9A 2Y1CA 3PIRA 1WB9A 1AB6A 2Y68A 4D9JA 5JWRA 3OM9A 1Z39A 2RHWA 4PLHA 1UCFA 2IUUA 4LMBA 4R3NA 1DL5A 2DPHA 5AJUA 1Q44A 4YRSA 5H3CA 3IIMA 1ABBA 1T36B 2DTXA 4LDJA 3WNZA 1CD5A 2ZTMA 4KE8A 3TL3A 1VCNA 1QV9A 3K0AA 3M1YA 2OO7A 4K8OA 3Q9UA 3FB4A 5D8DA 5BWNA 1XA4A 4U9HS 3VU8A 3L0ZA 3TUJC 3G6WA 1VHJA 4JELA 3I9LA 1G7TA 1YA4A 1FNDA 4LOHA 4ATNA 1WLYA 3AL2A 4HB0A 3OE7D 4C43A 4LBWA 1B8PA 1QGAA 3HS3A 4IDNA 4X5OA 1BEUB 1GL3A 3V8PA 4D8UA 1IJFA 1E62A 1XROA 3O47A 1JUDA 4BOYA 1SK9A 2C99A 4UBKA 3DCIA 3KYDA 5CJ2A 5DI3B 3SYTA 4DA0A 5BVHA 3WLEA 2OYSA 1TJ5A 1GPWB 1F8YA 3QWBA 4QGAA 1R64A 3R7LA 5G4LA 3L8HA 1RPJA 3F9IA 2QVZX 1R0ZA 2G40A 4LXYA 4URFA 2EBFX 4Y67A 1OWPA 2XPCA 4YNBA 5DNAA 4LFCB 3ZWPA 1WCXA 4EARA 3O7WA 3EOBI 2PKYX 1OZ0A 1OFUX 3L6EA 4I5EA 4ZCLA 4ZCQA 1N6KA 1M2EA 2P2GA 1QAMA 2VHQA 1H2FA 3F96A 4GPAA 3RYIA 4B09A 4UTPA 5EIHA 1SKQA 1NMEA 3KQOA 5BWLA 4FMBB 5LD2B 4EDFA 3ZZUA 3GFTA 2F1KA 2E0IA 1H6DA 3FI0A 4XIJA 4YYEA 2V0GA 1V7QA 1EVEA 3A4NA 3TLJA 2C07A 1DKUA 1KBZA 1UADA 1N25A 3A6JA 2JIMA 3UAXA 1A0OA 1QO0D 4A6EA 3D64A 1SKUA 3L05A 2ZAOA 4MINA 4NF2A 2CV1A 1GQRA 1RYFA 2X0KA 5HYVA 4LXXA 3SIXA 1NR5A 4V0SA 4BFSA 1JDJA 4JL8A 4Q6WA 2C1EA 1R6DA 3LP5A 1IZ9A 3WLTA 4FMDF 2H85A 2IXEA 3CIOA 3RC8A 2IS2A 2VP3A 3LQKA 4UCFA 3HCFA 3E9QA 2G5PA 2MYPA 3H0EA 3MOGA 2HPAA 4GT1A 2PANA 1A3CA 1QO9A 3PHCA 4ZXFA 1W59A 4YDSA 2QMZA 3OZAA 4MVJH 1MDBA 3WKDA 5M29A 3MTEA 4LJKA 5ESXA 1E8DA 2OGTA 3F4BA 3FR8A 4OJTA 4AM8A 1QYXA 4Z8YA 2PT5A 5IJAA 3CZAA 4E2ZA 2P9ZA 4OBBA 1NW5A 4DMRA 5DNYB 1C4KA 4KITB 3H8SA 5H4GA 4L4XA 2DB3A 1GARA 2MSKA 2WM2A 1OTHA 1ZH8A 3N6VA 4D44A 1WXWA 1GUZA 2PQ2A 4HH3C 2B83A 4MIOA 4CDMA 1IBMB 3F0TA 4TTIA 2DULA 2Y0BA 2ZRNA 2QT9A 3BA6A 4FIZA 4WNIA 1P2FA 1ULBA 4YECA 5DYYA 1JHYA 1ZOLA 2ZBRA 3ETEA 3OQBA 1UKEA 2Q3MA 1WVIA 5E2IA 1E2JA 5GY7A 2EKZA 2QD3A 3U4HA 4DLKA 2AXNA 2F7SA 4NJEA 3PC3A 4UHBA 2SCUB 4MUFA 3A2KA 2M6LA 3HVIA 4M8KA 1EINA 1VHDA 4KQEA 1OXBB 4AY4A 3ZDZB 4A6DA 3PQFA 1SIBE 2FU5C 1LXCA 2Y8EA 3PEEA 2FH5B 1ULUA 3E0XA 4EKNB 1NM5C 3N86A 3OZEA 4W6QA 1RXUA 5ALKA 4EUFA 1EXDA 2BSXA 2CHQA 4EG4A 1N6OA 3O2NA 4WNCA 5KX5A 4MVCA 1N3LA 2HTEA 3LLSA 4FFBA 2RC5A 1CS4C 4F6RA 3DOCA 1YL7A 3MM4A 1LEHA 4JASB 2FR8C 1QWSA 2PNJA 3L9WA 1KOFA 1JMVA 3WLSA 3ZD7A 1WXEA 1FP4A 2PVPA 5LZ4A 1A9QA 4UXHA 4Z4IA 3AR4A 4R0NA 4RCVA 4RHUA 5CB4F 3NRCA 2C78A 1DCMA 1VJ5A 2WNIA 5FORA 4OY3A 3UMGA 1WVMA 3EWSA 1TJ3A 1ST2A 2J6HA 3HVHA 5EIOA 1IHUA 1YL5A 4G0WA 2WZCA 5EFZA 2DG2A 1M1ZA 3DLAA 3Q7EA 3ZCUA 1BDBA 1PWHA 4P32A 2OV2A 1JXAA 4QYIB 4CLXA 4CQMB 1R0WA 1EXMA 2WVAA 2BBTA 4TSFD 2A0YA 3PUIA 1RKUA 3T3GA 1LU9A 2I7VA 4LYYA 3CZRA 3FSEA 4IZIA 5IFKA 1TGVA 5CLIA 4GFDA 1KR2A 3PHLA 2P67A 1O2DA 3JALA 1CZLA 2HRBA 2ATVA 1TO6A 4HYYA 4JBYA 5KSPA 5LLSA 3TOZA 3WYEA 4B6GA 1YKGA 2DR2A 3EASA 4NE2A 2NOAA 2P79A 3AEXA 1E7YA 5CJJA 2RAFA 1OAAA 3RYHA 1KJ8A 1WB6A 3R7DA 4TTAA 1GQYA 2BGRA 1AQ6A 6AT1A 3MHTA 1Z0UA 3AESB 5J5CA 1GNVA 1W5AA 2JHCA 1TNDA 1SKYE 3PKJA 3LTNC 2O2GA 3LC2O 3O74A 1G3MA 3TTWA 3E8XA 5EA2A 1UDCA 2JIDA 5E3HA 5FTJA 2G7ZA 2DGDA 2XYHA 2BHTA 2FFQA 3PXCX 1H3NA 4R1TA 2TSYB 3ECAA 5JJBA 1ITZA 5JNTA 1KXJA 1K8ZB 1XOIA 1S2DA 1UC5B 2WJYA 3GRAA 3MJHA 3NHPA 3O91A 1FUEA 1KY5A 4X45A 4EA8A 1NYQA 3AILA 5EVCA 5LCXA 1SQ5A 1ZL2A 2KMLA 2QXTA 1YUBA 2R79A 3HU3A 4REQA 3RS7A 2C2OA 1GZSA 5F5NA 2VTBA 3VNAA 5TIIA 1QLJA 5ETJA 5ALWA 4TQ9A 3NHRA 4JHXA 1V6AA 2B69A 2ZM5A 4NU6A 2BEJA 2WU4A 1D2CA 1N8KA 2PM8A 3P0IA 2XYQA 2XKJE 2KX7A 5T4BA 4ABYA 1NBOA 4HMOA 1RHMA 2QD5A 1BE8A 4BLUA 3Q15C 2ZAIA 3GBPA 1NIPA 2V0NA 4UEKA 4DLYA 5BT8A 1SBNE 1OFHA 2AJ8A 4RS3A 3WZ2A 1JU9A 4B3FX 2VAVA 2X77A 4J3FA 2C2ZA 1TA0A 4NP6A 4OSOA 3QGMA 1ESZA 4QTZA 3GJYA 1YF3A 1I2ZA 2QX7A 1XZNA 5K3OA 3C6BA 1QNFA 1CYDA 3PJEA 1NW4A 5IH7A 1L4EA 4RWZA 2JGDA 5MN6A 1N2ZA 1KJJA 3EIQA 3UO8B 3AHEA 3WY9A 5L8VA 3BILA 1TZJA 2NNWB 5HW0A 2PA0A 3I8XA 4DA6A 1U8ZA 1EFUA 1F0NA 2V65A 4E11A 3RTCA 5IM4F 3OOHA 4MS3A 4ZP1A 3O8DA 4HAVA 5FYQA 3ZVRA 2X9LA 3H5VA 2PRKA 4EI8A 2OCBA 3EWAA 1U9CA 2I2AA 3AKDA 3A36A 1DAKA 3ORHA 2EU8A 2OZKA 4CMEA 2FN3A 4P93A 4II3A 2CK3D 1FIUA 4BLWA 1ZZEA 1JU3A 1L4LA 3UANA 3QV2A 3ZDFA 1YA6A 4CCYA 3OF2A 2WTAA 1F2TA 3LBFA 1TQ4A 1UH5A 2HHHB 2H2HA 2JLQA 1CHDA 2OBYA 2WT9A 5AJWA 3VO9A 4C5CA 4JWTA 3PVSA 4DNOA 1T0IA 4CR7A 1LV7A 2V9ZA 4DR4B 3TLKA 2E5FA 1X7GA 1K3UB 3C45A 3QE3A 5EFOA 4ZVNA 4D56A 4YT2A 5I48A 5L3VA 1QU2A 1Z4PX 4TKVB 2XUJA 4BYGA 5EIWA 1KTVA 3BX1A 5CLLA 4O2AF 3U40A 3HA5A 3HFGA 1YIOA 3QKRA 4B5KA 4KSCA 3D8SA 2ICAA 2YZNA 1N2CB 3EGIA 4ECAA 1Z8DA 2GM4A 4D25A 3HB1A 5FI5A 4D7AA 3DE4X 1WP9A 4NICA 2DBQA 4MGYR 2GDZA 2IYTA 5EZ5A 3VYVA 4RA9B 4BN5A 1OXKB 1R0XA 2WJWA 1B0UA 3ZDRA 1X1DA 4XFKA 3NDPA 3VR0A 2VP0A 3FE2A 1PZFA 2Z09A 1UR5A 2AEFA 3TQQA 2BP7A 1FFWA 1WPRA 4UM9B 4RWEA 2UZ4A 3RAEC 4CV1A 3SF8A 1FFAA 2WJVA 2MSNA 1ZLYA 4RPHA 5AP9A 2ECKA 2Q9AA 3JS5A 3RIHA 1BMFD 3LOUA 3VRHA 4CG1A 3PUJA 4MUEA 1ISSA 2ZYVX 3LUCA 5DP2A 3A1DA 1VL5A 3RG2A 3SLGA 1E2GA 1LS6A 2LIPA 4FZRA 4V1CA 1J23A 2D1QA 4XRRA 1L5QA 2OHJA 2EARA 2NO7A 3JV7A 5A7GA 3GRYA 4YRZA 5AW2A 1RM5A 3RTEA 5IWCA 3WRVA 3ZTYA 2X1HA 4AKEA 1LTQA 2XKKA 5JBNA 4B75A 2MIIA 4PSDA 2WZQA 2IZ0A 3IKLA 3N2KA 4CCWA 4YV1A 3G0OA 1KJZA 4PZEA 1FDRA 1G8MA 5HE8A 1NZDA 4CDGA 2II6A 1NDUA 2JEZA 1I4OA 2PKEA 5F5XA 2X4IA 3FLAA 2VJLA 2X6TA 4AULA 4BZWA 4HB3A 2H4WA 4XVHA 1V7ZA 5FI3A 2PUVA 1GR0A 3BOSA 3D5QA 3MT7A 2Z5FA 1KDYA 3U5TA 2P5SA 3B1WA 3GWZA 2H17A 4UUBA 4E30A 5AVJA 5C1DA 1YK0A 3FMFA 1B6SA 5KYYA 1CFJA 1P2UA 4O8ZA 1GGNA 3O9MA 2UZ1B 4NWIA 4PIMA 5CLQA 3UBMA 5JXHA 1L6IA 3QPWA 3QBJA 4WI1A 2HBRA 5DBHX 4MVYA 2J3EA 1KQ3A 1C30A 3KKEA 3OUTA 1GAJA 5EG5A 3W9SA 3D7MA 3MJ4A 1T2UA 1IAQA 1KL7A 3PFKA 2V9CA 4LJAA 3LLVA 5EY5B 3W7AA 1AD2A 1BYUA 4YR7A 1KY4A 2JA2A 1JYSA 4XD2A 2E4AA 3V33A 4ZYYA 2Y3IA 5SY4A 4F21A 3HM2A 4AD8A 1IWBB 1JR2A 1LSJA 5B6PA 1JG1A 5IVHA 2WSIA 3INRA 5A5VA 2QB5A 1TU4A 4S2EA 1KERA 2VBGA 2ZS9A 4PSUA 4TKLA 3H8JA 5A3SA 5DHUA 1U8UA 2G3YA 4D41A 5K3SA 4FDAA 4X90A 3DTVA 5GGXA 5C5DA 3VZSA 1PG5A 2A14A 2HOQA 1M0WA 1Z83A 3NBFA 3I2IA 3ISTA 2Q6VA 5JH7B 1QGED 3I83A 1YQ9A 1GSAA 2FSSA 1T3SA 3C6MA 2JAOA 3IOMA 3L8EA 4RW0A 1L5HA 5BVHB 3DT6A 4XQEA 4BO1A 3HCAA 3I3SR 1PV1A 3P9KA 4LRQA 4ZI3A 2CVQA 4TYMA 4AYTA 2CFCA 4QUIA 4B6RA 1N6PA 1PNTA 2H00A 3KCQA 1P4AA 4NHEA 3ND6A 5I9MA 1NI4A 3K96A 2VRCA 2VWPA 3KZVA 1TF7A 1LLUA 1P4SA 4MYDA 4URWR 4G25A 3DL4A 4RTOA 2C2BA 5HBGA 4BB6A 3E35A 3P9YA 4N6OA 4YH1A 3UOGA 3F9RA 2WU0A 4PHCA 1JLRA 3U1VA 1U0BB 3EVEA 3DA8A 1EDEA 5AJHA 4K6CA 4DQKA 4D4KA 1EQUA 1D2HA 2YJZA 4RX1A 1OBVA 1JU4A 4QUEA 1E3QA 3OIWA 4RPJA 4MRMA 5BYKA 5I7VA 4KFRA 2BHNA 3WMEA 2YS6A 1TZBA 1UJNA 3KSMA 3FZEA 1QGUB 2R6GA 1KQNA 3V7WA 1FFSA 1Q50A 1RPNA 2GZHA 4PLVA 5CT9A 3G9TA 1QDLB 3WGHA 4B3RB 4QPCA 2ZJ8A 3AXTA 5K6RA 3RDPA 4O4LF 4AJPA 4DTCA 3BJMA 4FT4A 3KE9A 1E7SA 3PYLA 2P90A 3ZCSA 4R2WA 1XRPA 1CZOA 1OI2A 1PU2A 1WS6A 3SZOA 1VB3A 3IP3A 1L1QA 1Y8AA 3WNCA 2O3RA 1UFOA 3ZCQA 3PYMA 1CEEA 3DONA 3NTQA 4JR0A 1Z35A 3P1JA 3HBJA 3NONA 4ZPJA 4HYTA 3FI9A 4LZLA 4QJ4A 1E2NA 3VJRA 1BS9A 2VSYA 3FSJX 2WVJA 1R4NB 3NBXX 3AETB 4WJLA 4Z4CA 5JAIA 1T0HB 1AN0A 4BUZA 1U0GA 2H51A 1XZAA 4PF1A 2A4KA 1GFZA 4KPYA 3W8EA 4CKCB 2QMOA 2O0JA 1Y5RA 5JNUA 5LZ2A 2HA5A 3RGWS 2VUSA 1O97D 1L7DA 4DV6B 2PGOA 4FXPA 3LY7A 2CFRA 2ZE8A 2Q4RA 1KDVA 4FHEA 1R8JA 1E1NA 1NKTA 4D1YA 3S8YA 3KOMA 3B1KA 4B7UA 2C7QA 5C52B 2QRPA 1O58A 2ZJ3A 3PFBA 4U1RA 4FEAA 3R6TA 1R0LA 3WLIA 1ORIA 2CV0A 3ZE6A 4UUQA 4JEIA 3M4XA 3F78A 3A11A 2ZXFA 4FHDA 4QODA 4JN6B 3OECA 4KQ9A 4ZT6A 3TFWA 3WBKA 3EEFA 4ARUA 1X1SA 3I9OA 3IP1A 2IYEA 4FFRA 5AXDA 4D0LB 5D85A 1I1QB 1JHUA 4RPIA 3A05A 2JD1A 3BICA 1Q91A 2EF1A 2W9XA 1WOMA 3PSHA 1JSLA 3O1LA 4G5QA 4ZU6X 4C0SA 4FBMA 2A86A 4LRWA 1ZGZA 4NY1A 1GV0A 4Y2VA 4YJKA 1BKDR 3E3MA 2FZ4A 3EIUA 2H1RA 3BXFA 3GIWA 4XDYA 1V8ZA 2DKOA 2ONYA 1G5IA 4F4DA 3VPSA 3NT4A 3JX9A 3WKAA 6LDHA 4BRUA 3L0BA 1NVDA 3B5EA 1P1BA 3EIFA 1X77A 4OXYA 4YJ2B 5EKXA 1XX6A 2V7WA 4V03A 4CF3A 4D4HA 1OZGA 1IXKA 1PUJA 2AZMA 3WYFA 1KIAA 3RM3A 3GLFB 2W22A 2WWHA 3EBLA 3ASYA 3P94A 2R8OA 4NULA 4F96A 2HUNA 4QJIA 4F2PA 4PX9A 2D5LA 4OHWA 4QELA 3O1IC 3LUFA 1FYDA 3TLBA 4BEVA 2O2CA 2OQVA 2TECE 1KYQA 2MYTA 1IN1A 1I6LA 1X7YA 2WBLC 2ZYAA 4RJLA 4G56A 2L0XA 5CIWA 4ZCTA 1OIWA 4CIAA 4AY2A 2VF8A 4IQGA 3RNLA 4CQMD 1J42A 1VRWA 2FG5A 2P3LA 3W2GA 3NWJA 4EY4A 1JKMA 1PEKE 2BBWA 4FW9A 3VR4D 6ADHA 2XMPA 4JOSA 5BNWA 3QEKA 1HPLA 1Y7PA 7AT1A 5F7XA 1C0LA 2AVNA 2CE7A 3EZ6A 2FWAA 1KZ1A 1DNPA 3TB6A 2VPTA 3EAFA 3KS9A 3AVQA 4PZDA 3HFSA 3HJAA 5JXJA 3THOA 1QZTA 1PL8A 2KPOA 3VO8A 4NTZA 5GINE 4WWHA 2YKGA 2G06A 1IZ8A 3K35A 1HLGA 2C8LA 4MKGA 3E7PA 3SJAA 4B2YA 4ND1A 4BEWA 5AVSA 1HNWB 1CB0A 3QK7A 1I7LA 2BJWA 2G1UA 4WK0B 1X1EA 4R5HA 4AF8A 3V6LA 4D3SA 4WACA 4UZSA 4P86A 5I6DA 5ISMA 3ZWMA 2AZXA 1V0JA 3D2CA 4PLPA 3RWOA 3U4AA 5FDFA 5FQNA 3IR6A 4MLZA 1HOXA 1JR3D 2VHEA 1XZGA 3JASA 1WW2A 3MYRA 1V4BA 4XLLA 4TLDA 5ALNA 6CHYA 3ZG6A 4Z1OA 3X1KA 4GBED 1M2HA 2H1HA 2V96A 2WUGA 4NBKA 5LN1A 2WJ3A 4MOWA 1EVZA 2PXHA 1SB8A 1YQQA 1UEXC 2VXBA 3G2KA 5EXPA 4O3FA 3H84A 3VC1A 4BE9A 5CNJA 4ZGBA 1M1YA 4GQAA 4KPGA 3DB2A 3I42A 3G2QA 2BMVA 1NQWA 2NAPA 3DGEC 1BFUA 1U0HC 3WQHA 2P3OA 2Z6VA 1E3JA 5KI6A 1FQWA 5IDXA 3R9WA 2P9YA 2YMQA 1IH8A 3DR3A 4I08A 4MK4A 3G17A 1V25A 3PNQA 2ORED 2QJWA 3H04A 4GM1A 1P45A 4Y6OA 3PD0A 3UB2A 1KXZA 5EHNA 3ZHTA 1OIVA 2VOJA 2V5VA 2X4LA 1XVVA 2BN4A 4ZK2A 1UDXA 1XP8A 1SUWA 1Y1PA 2XRMA 3OIDA 4G97A 2F55A 1ODTC 3OQJA 2G1JA 2BTQB 1KC1A 5CA1F 4EGSA 3KR2A 1YO6A 1DBQA 2AA3A 2NXWA 2OV1A 4UKDA 3STYA 3OZCA 2B8TA 2Q50A 4PLCA 3O9VA 4HQLA 5EJ2A 2XCIA 1RW4A 4MV9A 1TZMA 4IJKA 3WLQA 3JWIA 5EIAA 1N5LA 4MQBA 5JXIA 3MUOA 1V8DA 3KU4A 1P5RA 5LLDA 2PKQO 2DWQA 2WSSA 1LSOA 3LC1O 5G53C 4Z3KA 1RXVA 2FRDC 3PZRA 2GN2A 2PWPA 3NH9A 3T52A 3QXJA 1NL3A 1QGZA 2GYWA 2P6OA 2GUWA 5TV2A 1MIOB 1ZI6A 4N8EA 5B1IA 2H4JA 3SKVA 4B2PA 2CLCX 3KB1A 3KEOA 2AJLI 5CXQA 4CIVA 5IYZF 3IQHX 2QTZA 2ABWA 3TI7A 2RJNA 3P2OA 1I10A 4UAJA 1Z6QA 2BMEA 2G77B 2ZS7A 5T67A 4FMDB 4LECA 5HOQA 1NYRA 2JL1A 3C8MA 4RZIA 5EHIA 3ZOKA 2JLAA 4CKYA 1GGJA 1Q3TA 2VJCA 5HUQA 2FB9A 4KWEA 2WWGA 2GWHA 4MRRA 4TXJA 5ULLA 4RZUA 1QE5A 1F1BA 1T26A 5E3JA 5HXAA 4JXXA 1JKJB 1CDDA 3AL0C 1EWQA 1IZZA 4QASA 2VHUA 1PQPA 2DEUA 4JITA 4I7EA 1YI8A 1QHNA 4XGKA 5CM8B 2QBYA 3GAFA 2MJLA 3GU3A 1NHWA 3L6CA 3NB0A 4IFEA 4LZAA 2GSWA 3GLQA 4CEJB 3QKSB 3R6WA 4G63A 5J2UA 3NEYA 4TRJA 3OUUA 3P4XA 4EGJA 2H11A 3HWSA 1EFLA 4B44A 2XUPA 5KWVA 1YZQA 1G60A 4EJSA 2YDYA 1TZ2A 5DGDA 3BE6A 3TKYA 4YHHB 2F3RA 5JAOA 4LF6B 1QB8A 4DMUB 1BDMA 3BHMA 4U0KA 5B1EA 3V1NA 1WLSA 1XQWA 1NYTA 1XFDA 2XNKA 4NCNA 1XQYA 4P7BA 4PX2A 4OJYA 4UM9D 2XQGA 2VDKB 5H80A 3N6RA 3PE4A 1JLMA 3MWGA 1XK6A 1T9KA 4X8MA 3C3WA 2EYQA 3GUCA 2QNBA 3L8FA 1XDUA 4FB4A 4W5NA 1JSCA 3KBOA 2DKFA 4G8DA 1IHXA 2B36A 4R69A 2CXNA 1DZIA 3DAFA 4YAOA 4KN6A 3JQ9C 1R6VA 2O8NA 2BFFB 2NUPB 5C5IA 2XECA 3AVYA 3CZQA 4LX8A 3STUA 1KEEB 2VCHA 3ELBA 4ZHQA 2HMVA 3NQ41 2VT3A 3U3XA 4EHIA 3N7AA 1RYNA 2BKLA 2YUTA 2YY5A 3PUVA 1YJ5A 1HR0B 4DIMA 1LPAB 3M3DA 2WU1A 5A03A 2BPOA 3GP8A 1O97C 2OC4A 2QUAA 4B47A 2DBRA 1RJEA 2XLCA 3FZGA 2ZBFA 5CB4B 2BHSA 1OXMA 4ZAWA 2N75A 3LZCA 4BVLA 2HU8A 3W5JA 3IL2A 2PX8A 2QSJA 4QLOA 4DLRA 5JCOC 2IY9A 2O8FB 3PB3A 1RXCA 1W1WA 3LLMA 4QQNA 5H81A 1C0PA 5AOAA 3VH2A 4YAKA 2C9YA 5BXQC 3THXA 2E1PA 1IY2A 3OJWA 3TTVA 1U98A 3G9QA 3V8VA 5C80A 4P36A 2QTMA 3F3YA 3T3OA 4HZGA 1VFNA 2WSLA 2Q27A