1EFKA

Structure of human malic enzyme in complex with ketomalonate
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords MALIC ENZYME
publication title Structure of a closed form of human malic enzyme and implications for catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 185
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2000-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1efkA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1efkA01
3GVCA 4YVFA 1P0CA 4XGKA 3GUCA 1HDZA 3JQ7A 1HLPA 7MDHA 1TT5A 3PJDA 1XQ1A 3OHSX 2DBVO 1LC0A 2D5AA 2YHUA 1MGOA 5IN4A 5T6BA 5G0WA 1AE1A 4R41A 1DPGA 4OH1A 2CSUA 4II3A 2D1YA 2HRZA 3GR6A 1ENPA 2C2YA 2P9EA 3OECA 4MIEA 4KUHA 4M87A 3ENNA 1WDMA 4G2NA 3GOHA 2GLXA 4BNJA 1GUZA 1ISIA 5TRTA 1VM6A 3DMTC 4AJNA 5LDGA 1MUUA 3KBOA 4PIVA 2YV2A 3E9QA 4Y6RA 3WYEA 1V9LA 1MG0A 2VHXA 2ZCVA 5F1KA 4TQGA 4YR9A 2IYOA 3ZWYA 5TSDA 4LVUA 1BG6A 4ND5A 1PJTA 1KVTA 5TNXA 1R16A 4TRNA 1E1NA 1SCUA 1EQ2A 1LDGA 4RO0A 2VYVA 1ZK3A 3AM5A 1R0LA 2BFPA 1M66A 3FN4A 1NM5A 3FCOA 1U4OA 3WTCA 1OAAA 2VHYA 3DC2A 4HFRA 1M6WA 3DBLB 3RFXA 1X1EA 2PZKA 3FHLA 4BO3A 5JCJA 5JAMA 1RM3A 3VPHA 4OHUA 1BWSA 3VKUA 3QA9A 4XA8A 1PJSA 3JQGB 4KMSA 4FGSA 3DBRB 3ROQA 4HX5A 5CDYA 2RH4A 3U4DA 3ANMA 1PZGA 1Y8QA 1ONOA 1VL6A 3NGLA 1HDRA 2QZ9A 3B6ZA 3GVHA 1C3VA 2J5RA 2UVDA 4PGFA 4FB5A 4CLRB 4EEZA 1H0KA 1NTOA 3NAQA 1R15A 1XGKA 1MC5A 1SC6A 3MJ4A 3H5RA 5L7WA 1EVJA 4BHTA 1DB3A 2B5VA 1P1FA 4FIZA 4JGBA 2RCYA 4XZ3A 2HJRA 4YJGA 4K6FA 5CEJA 3WJ7A 3PGXA 1UXIA 1PGNA 2DBRA 2PKQP 1FDTA 3DQPA 1I2ZA 6LDHA 2SCUA 3GA0A 4CM3A 2W2LA 3R3SA 3ZV4A 5A02A 2NTNA 1I5RA 4YT5A 2QW8A 3ONFA 3KYDA 3W1VA 1HDOA 3L77A 4RF5A 1ZK1A 1BDBA 1R4NB 3RVDA 5G4LA 4AJ2A 4CUZA 3C3XA 3ULKA 4ALNA 5G4KA 4BNNA 1HRDA 2VUUA 3C85A 2IE0A 4KDFA 3WGIA 5EPOA 4A73A 1RKXA 2B5WA 1QYCA 4GX5A 4J3FA 3GAFA 4EGFA 3FBTA 5EESA 3PZRA 4WK6A 1H6AA 2GO1A 4LRTB 1PU2A 2V6MA 3PJEA 5FI3A 2PZMA 1VC2A 3MJTA 3ETEA 2FP4A 1IB6A 2DAPA 1P74A 3HFSA 1RYEA 4N5LA 5JLAA 4YBZA 1LSJA 2Y68A 2POQX 1HXHA 4PG7A 1GQ2A 3F4LA 2AQ8A 3LK7A 5A9SA 1ARZA 4N18A 3OICA 4CPDA 1DC5A 2AQIA 2HO5A 4IIVA 4AICA 4EDFA 3QHAA 1OMOA 4FC6A 4ZA2A 3WWZA 4J4HA 4MP8A 4IINA 4W7IA 4WE3A 4CV1A 3ZWBA 1Q2XA 5JDCA 3TFOA 1XQ6A 3MOGA 3N7UA 4A2CA 5B4VA 1H6DA 3JQAB 5BSEA 5JXWA 3KUXA 3GAZA 4IZIA 1HLDA 4WLEA 3S2GA 1Z75A 4DGSA 2HJSA 3FNEA 1T2AA 1E3IA 3NDJA 1SOWA 2EJWA 5ES3A 4IY1A 1WP4A 2WE8A 3L9XA 2VTDA 1KETA 3TZCA 3JQGA 3RBZA 3LC1O 4I5DA 4H3VA 4L76A 1LBEA 2EWMA 1EVZA 4RVFA 4CODB 4XJTA 2EERA 1ZH8A 2HSDA 2ET6A 2R2GA 2IEDA 1UAYA 5TS3A 4LRSB 3DBHB 3E6AA 5DOVA 3OIGA 4KUGA 2JCVA 4CLRA 1BTOA 1EMDA 3IAHA 3E5RA 4TROA 2HDHA 3I9JA 3SLGA 3TN7A 1Z7BA 2Q3EA 2E49A 1PQUA 3B1JA 1GQYA 4EYEA 2JAPA 2CD9A 4DIBA 2WYWA 5JCXA 4XWYA 3ADPA 3H9JA 3QVSA 3WG9A 2CZCA 4OQZA 4CMAA 4E12A 3I4FA 4OGWA 1PIWA 1LLUA 3FNFA 3I4CA 1D3AA 4RPJA 1U2DA 2EF1A 3MTGA 1F17A 2WD7B 2QHXA 1P1KA 1ZZEA 3KETA 2NTVA 3ST7A 4EBFA 3U4HA 4DREA 5L4LA 1QKIA 2HK7A 4Z9FA 4CQLB 3UOGA 4YT2A 2BKAA 3LF2A 3PDUA 4YJDA 1EDOA 3LT4A 1O0SA 1HF3A 1ZW1A 4IBOA 5CP8A 2UUPA 5BNFA 4XIJA 3ZWVA 1YB4A 3H65A 3HZZA 3AM4A 1I3NA 2FZWA 5TT1A 5HA5A 2X0NA 4J7XA 5A06A 4JJGA 1OC4A 1CQJA 1VJ1A 4GLOA 1J5PA 2FN7A 3RBXA 3QW2A 3L6DA 4BNVA 1ISFA 3ZV6A 4G81A 2HU2A 2YUTA 3H3FA 4N7RA 1IE3A 3INRA 3N58A 3KVOA 4II2A 4TKMA 4DVJA 1KBZA 4UVGA 4TRJA 1A5ZA 2LDXA 2J3JA 5KKAA 4N54A 1I3LA 4MVJI 4FFMA 1L7DA 1JA9A 3BMQB 1ZVMA 5DP1A 4DA9A 4BNMA 1P33A 4FSHA 1LTHR 3UAGA 1U4SA 5IDXA 3WMWA 2WDZA 1DEHA 2HAEA 3KO8A 5L3ZA 4EUFA 3E03A 1UDBA 4GKVA 4JK3A 1O9BA 3H6KA 3HQ4O 4XD2A 3AU9A 6ADHA 3FR8A 4I9NA 3GC6A 3C24A 1WMBA 4QECA 3VDRA 4CQMB 1DRWA 2J3HA 1CQIA 3A4VA 4D44A 3PYXA 5CDSA 3JQBA 5IFLA 1N92A 3EGOA 2Y05A 1F06A 4WCFA 4NFHA 2O7QA 4OXKA 3TOXA 4GX2A 3PFFA 4F6CA 2LDBA 4RPKA 5L53A 1JVBA 1NHGA 1ADCA 3ASUA 2FPPA 3IJRA 1GFSA 2XXBA 1UDCA 4L73A 4GGPA 3NTQA 1K3TA 1XG5A 4IQ0A 4J7UA 4FC7A 5JW6A 3Q6IA 4OQYA 1QLHA 3U62A 3GEGA 3F5SA 3FNGA 3QY9A 2OFPA 4NBUA 3GG2A 1SB9A 4BO0A 3HDHA 4M86A 2X58A 2EKLA 3DZBA 1YWGO 1WDKA 1I3KA 1YL6A 5C7OO 1RM5A 4FDAA 5AXCA 3VPSA 1UP4A 4AJJA 1EFLA 2X7HA 4J2OA 4J91A 4DLBA 2OOSA 4XRGA 2E48A 2GSDA 4WEOA 4E32A 4PG5A 3EY4A 5DCYA 1MX3A 1UXKA 2X5OA 4L74A 4PLPA 1VLLA 4UVEA 1NFFA 4QSMA 3K2EA 4WEQA 1ZXLA 1D1TA 3BTVA 3FI9A 3MJCA 3C7DB 4OXNA 3LYLA 3GZNB 3HHPA 3I1JA 4K26A 1XKQA 4RPLA 3TRIA 1Q0QA 5U1PA 4BV8A 1N2SA 5BR7A 4AJIA 4BNWA 2Q2QA 5B37A 2WD7A 4Y6PA 3UGKA 2YHIB 3S1LA 3K2BA 1Y6JA 2ZYGA 3Q9UA 3JD3A 1IL0A 3L6OO 3NTOA 2GF2A 4MINA 4NFSA 2O7SA 4QEDA 4CQLA 5JFOA 3D1LA 1Y9AA 3Q2KA 4FPXA 4LSMA 3M1AA 5KJEA 4U7WA 1T2DA 3KXDA 5GY7A 3I6IA 2CFCA 2D0IA 3QWFA 2G5CA 1X14A 2VHWA 1DRUA 3D0OA 2PD6A 4BNHA 1W8DA 4LSWA 4CM9D 3NDIA 3TQHA 1IYZA 2RBEA 2EXXA 3BHJA 4WLUA 4XDZA 2CVQA 4RF4A 4B4VA 1OOEA 3PEFA 3EAGA 1GPJA 5CHEA 3UHAA 3WR5A 1LQTA 3WGYA 2OP0A 4GL4A 4DYDA 1FF9A 1WVGA 5ENDA 3W6ZA 3K31A 5AOVA 4I5FA 4XJSA 2C82A 3K30A 4D0RA 4A27A 3UW3A 1DIBA 2P91A 2VWPA 1DIHA 4R68A 2W8ZA 3OBBA 4LW8A 4OOEA 1U8FO 1WAMA 3BMOB 5CG1A 1K6JA 1T26A 1U5CA 4RZHA 4E2WA 1NPDA 4CL8A 1JW9B 3WYCA 3PLRA 5DP2A 4CV2A 2PGJA 3G0OA 5FFFA 2J3KA 4D3SA 2DBQA 4GVLA 4YQZA 1P44A 1PZHA 3T7CA 1P45A 1NVTA 3JYQA 1LSUA 4O1MA 4XYLA 1ZFNA 5I7VA 4JP2A 3IKTA 1X13A 1OI7A 3HN2A 4WJZA 1DJNA 5KVCA 3QSGA 4EI2A 1O5IA 3K6JA 2NU8A 4GVXA 2NLOA 4Y67A 5JC1A 1I36A 2CDBA 2EIHA 2XAAA 1LX6A 1Z73A 5A3JA 1LEHA 3W8EA 4DXHA 4H7PA 1TLTA 3DZFA 2ZQZA 4YRBA 3F1LA 1C1XA 3JD4A 3W8FA 4XYEA 2QRKA 4YT8A 1ADGA 2OL4A 3WDSA 4S3MA 4FFNA 4RVUA 4C7JA 3HN7A 2DC1A 4PCVA 2BHLA 3DHEA 1DIGA 4NMHA 1E1MA 5ITWA 2J5KA 1PL8A 3ZGYA 4M89A 1VRWA 1I3MA 2BFMA 1E5QA 3BMCB 3C7AA 3CMCO 4U5QA 3DZJA 3QQPA 3VAZA 2O4CA 4KUEA 5C7LO 3U49A 2DUWA 1WW8A 2JD2A 5JDCC 4B3IA 4NG5A 3H3JA 2Q50A 3WIDA 1P1RA 3JYLA 4CMBA 3QP9A 2ZQYA 4I5EA 1KYQA 3GZNA 3ETGA 3COSA 1YJQA 5ILOA 1LRKA 2ZKLA 1H6BA 3ZWPA 5TLSA 1G0NA 2GGSA 2Q45A 3B1KA 4DWVA 1J6UA 2YHIA 3JQ7B 5J23A 4BKPA 3GGGA 4R51A 3NT4A 4QTZA 2DPHA 3GGPA 1BXGA 2W90A 5JO9A 1HYEA 3PWKA 1MG5A 3E8XA 3SJUA 4ALIA 5HM8A 3DZKA 3JQ6A 3EW7A 1JU9A 3CINA 2NTJA 2WD8A 4NBVA 1MC4A 4MVJD 3PYLA 3KEOA 3WGTA 1E6UA 2HMUA 2C20A 4I5GA 3KV3O 1B14A 1E6EA 1U3VA 2AQHA 3ZWMA 4BQPA 4R69A 1MA0A 3WWYA 1WWKA 4AVYA 1NASA 4CV0A 1B8VA 3DR3A 4DBVO 1MB4A 1V6AA 1TEHA 1Y7TA 2JD1A 2I5PO 2UYYA 5TX7A 2C7GA 4FS3A 5JAZA 4O6VA 5IJZA 2GZ1A 4ND1A 2QQ5A 3PJFA 1EQUA 3ZU4A 3OJFA 3KYBA 5CPFA 1PJBA 5LDHA 3BMOA 4RVHA 3K92A 4MOWA 3T4XA 3ZWCA 4FR5A 2B35A 3ASVA 3RUAA 3RJ9A 1XWFA 1WLYA 4WKGA 4ITUA 2WWRA 5TT0A 1A7KA 2Y1GA 1ONPA 3BTOA 4BKQA 2RIRA 4D3FA 1CETA 2BF7A 3HDQA 4WPGA 1QRRA 1U1IA 5HBRA 3GNTA 4BL5A 2WM3A 1IPFA 3WB9A 3R1IA 3M6IA 5IZ4A 1XDWA 4ZHSA 1IUKA 3S2EA 4UUOA 3ANLA 3PHLA 1L7EA 3KTDA 3D3WA 1CEQA 1Q7GA 2WYUA 4J9VA 1B3RA 3V2UA 4Z0TA 4FOOA 4M1QA 3UCXA 5ADHA 4PG8A 4MVJH 3WNVA 3RC2A 3UN1A 4D41A 5G0TA 1PGPA 4RPHA 4FGWA 1NP3A 4YJGB 2OMEA 3CPSA 5JNLA 3DAPA 3GN1A 3FWZA 4PLHA 1HSZA 2P9GA 3BMCA 4WOJA 5JE8A 4AJEA 4JJIA 1P1JA 1T25A 1RJWA 3C1TA 5EQDA 2CF5A 1ZNQO 3KEQA 1GCOA 1XR3A 1ZSNA 3JD0A 3JQBC 4FJ0A 1I0ZA 3FPCA 3VH1A 3ON5A 4WCFC 4Z3KA 4XKJA 3ZW9A 3U09A 3PRJA 1AXEA 1PJ3A 1EVYA 1M75A 5G4KB 3RU7A 1X7DA 3C1AA 4TZKA 1UH5A 2Y1OA 3IMFA 1YE3A 4HNHA 4U6SA 3I9MA 1XCBA 4IIUA 5CDUA 3N74A 4CLDA 1B3BA 2A9FA 4CMGA 4R1UA 5COAA 5ER6A 1U3UA 4Q39A 3AUAA 5T8KA 2XXJA 3PHJA 1W4ZA 5JDIA 5EL0A 1RWBA 2VWGA 1IZ9A 4RQUA 1SO8A 1NXQA 3DFZA 4PG6A 4TRRA 3VZRA 3H9QA 1DDOA 1R37A 4YAKA 4ID9A 4P38A 3GNSA 4J0EA 3IDSA 4IQGA 1NYTA 4EJ0A 3G49A 1I30A 2OBNA 2OHXA 3B20A 4PLZA 5A9SB 3LDHA 3TNLA 1BGVA 1P1IA 3KSDO 3AM3A 3CMMA 5DULA 2PKRA 4LGVA 3M2TA 2C59A 1PQWA 2QG4A 1Y8RA 4RORA 4ZQBA 4FJ1A 1E7QA 4Z3DA 3V8BA 4BNIA 3ZDFA 5KOIA 3CKYA 5L40A 1DXYA 3H4VA 3A14A 5DOZA 3HWRA 7ADHA 3MTJA 3ZU5A 1Q0LA 2YFQA 4NJMB 1MXFA 2PD4A 4Z9XA 4AG3A 3NGXA 2Q1SA 1K5HA 4YACA 1WZEA 4ZU3A 3FBGA 5JMPA 5JO0A 4RVDA 1LU9A 4UULA 3NT2A 2GPTA 1EDZA 4W99A 4ILKA 1WXDA 4FN4A 3E48A 4NDNE 4XYBA 1E3WB 2BELA 2OBYA 1VPDA 2V7PA 3ONDA 4BOYA 2BGMA 2V6BA 3BTUA 1CYDA 4CMKA 3ONEA 3AUSA 3PQDA 3IOYA 4IQ8A 2YQ4A 5A03A 1YL5A 2EGGA 3IP3A 1PX0A 4ZVVA 4YQYA 4OAQA 4B7XA 1IOLA 3W6UA 2AE1A 4OIMA 4WLOA 3LT2A 1JN0A 5TJHA 3E5MA 4RDHA 3I9OA 2OORA 4H16A 3W8DA 1AN9A 2C5AA 3PJGA 4OYRA 3ZWXA 4J16A 2Q1UA 2JL1A 4W82A 3SVTA 3KLPX 5JAQA 1PJLA 4J1SA 4J43A 3RIHA 2YW9A 1XIVA 3DZIA 5HRUA 5B4TA 4ND3A 1EBFA 3KHUA 3GVIA 4D45A 2JFHA 4Y6SA 3GPIA 1SBYA 2OXIA 3OQBA 5L95A 2O4UX 5KJFA 1YBMA 4B4OA 3WGHA 1ORRA 3RUIA 2BFOA 2X5KO 2X6TA 1ONNA 1DHTA 2CVZA 1I10A 4XR4A 5BSHA 1GYPA 3H9GA 3DEYX 4EITA 5H82A 3VTFA 4FFRA 1R66A 1ZXBA 1WMAA 1EK5A 2Z1NA 3H7AA 2P5YA 4RCVA 2C54A 3CE6A 4TWRA 2Y1EA 3ZHXA 3DOJA 2Q49A 2EG9A 3RKUA 2AEFA 4N5NA 1N8KA 2O23A 3WXBA 1VE9A 2GYYA 4RGBA 5A1TA 1UUFA 1ULSA 1Y5MA 5K6AA 3TDKA 1HE2A 4NNJA 4AFNA 2AEMA 1LLCA 1UP6A 1ZK2A 3AOGA 4YEDA 2Q1WA 3MEQA 2X0RA 1E7RA 4RV9A 3VH3A 4BGEA 3U0BA 1UXHA 2Q1TA 2Y1CA 5DBGA 3X2FA 1ADFA 5B1YA 2BRUA 4D7AA 1T2CA 1QR6A 2YQ5A 1HZZA 2JFGA 2NVWA 4TKLA 4IDEA 3ZWAA 4PVCA 4BMSA 2C5EA 2P9CA 1U28A 4NJMA 4J4BA 4W9NA 4WCFB 3QVOA 1N7GA 1HZJA 1GZ6A 8ADHA 4O0LA 2V6FA 3WIEA 1B2LA 1V3VA 2QYSA 2EHDA 2HK8A 3DFUA 1SPXA 4B8WA 3E9NA 1M6HA 1ENOA 4FQ8A 3UVEA 4IMPA 2OZPA 4BO5A 1GEGA 4NK4A 1J49A 5EJ2A 1GYRA 1E3WA 2NU6A 1PEDA 4IXTA 4E5YA 3P19A 3NJ8A 5AXDA 4NI5A 4AJ1A 4GMFA 2EKPA 4WGGA 9LDBA 4CLOB 2JHGA 3WSVA 1SZJG 2DU8A 2GERA 2WYVA 1NBOA 4NJOA 5THQA 1A4IA 4OMUA 2Q2WA 4J49A 4CM9A 4BNXA 1U5AA 1DFGA 1A72A 2QIOA 3PHIA 1IHXA 1ZK4A 4LK3A 3NX4A 1JLLA 3CZMA 3U9LA 2VUTA 2BMAA 3ICCA 5COQA 1T2FA 4YJHB 1HEUA 3UKOA 4NU5A 4E6PA 2PH5A 2QZZA 1M2WA 5ICSA 1B26A 3OQ1A 5IZCA 5AYVA 2VHZA 3JQCA 4OL9A 4BIIA 3WX0A 1LUAA 2AG5A 4MVJP 4MJLA 1DIRA 3KZVA 1N1EA 2NQTA 4K6CA 4RF2A 2VYVD 2JCYA 3AY3A 1S6YA 1A27A 2AW5A 4XB2A 2W2KA 1PJCA 1XELA 1O94A 4HFJA 1MV8A 1N9GB 5DBIA 3PTZA 1ZJZA 2A92A 3F47A 4NZ9A 4DYVA 1B15A 4FD3A 3ZNOA 2CF6A 1DFIA 1A7AA 1H9AA 4HFNA 5F1PA 1PR9A 5L7YA 3H5NA 5DF1A 5I7EA 1T1SA 1A71A 2GASA 4BS9A 1R4MB 3F6YA 1NPYA 3EZLA 4Q9NA 1HE5A 3DXFA 2E6UX 3FNHA 4E21A 4QO7A 4XQEA 4UAGA 3RI3A 4D79A 2G1UA 5FYDA 3S55A 4XYGA 5GMOA 1NAHA 3IUSA 3NT5A 4JLWA 3D4NA 4CV3A 3IL2A 3QVWA 2RH8A 2YDYA 4BO4A 5B4UA 5H83A 1E1KA 2FPGA 4RF3A 3SJ7A 4R5MA 3ITKA 4DQVA 3CUKA 4S1VA 5THKA 2FR8A 1LDNA 3HNPA 3U3XA 4BV9A 2GDZA 1P0FA 2IZ0A 4ONEA 1I8TA 2RHRA 3EDMA 1H5QA 1NQTA 1UAGA 4E5MA 1EEHA 2CY0A 1DC3A 3F1KA 3O38A 3OSUA 4ZQHA 3RUCA 2VZ9A 2O3JA 4NBWA 4HWKA 1O95A 3EVTA 2BLLA 1ISJA 1HWYA 4YDRA 3ZU2A 3A1NA 1HDGO 1NQOA 3RROA 4A26A 5T8KC 2GZ3A 2EKQA 1HTBA 4YRAA 1AHHA 2BH9A 5JDIC 5JSFA 3ITDA 4CM6A 4YT4A 3PLNA 1E92A 5G0VA 1E3LA 1KOLA 3OJLA 1EFKA 4B4UA 1ISMA 3PQFA 1C1XB 3KRTA 1G1AA 4MO2A 4GKBA 4D46A 4IDGA 3AUTA 2DTXA 3PXXA 4CLOA 1VI2A 1PQPA 2AMFA 2X0JA 1Q1NA 3ZH2A 5EMHA 1LA2A 1HDCA 1GEEA 3AW9A 5BQFA 4MVJA 4D0SA 1TI7A 4LMPA 4ND2A 1GL3A 3GF4A 1YL7A 1H93A 2PH3A 1HYGA 3PGJA 4J9UE 3PHGA 4W7HA 5KJ6A 2EP7A 1T24A 4GX1A 5I8ZA 2C29D 3BMNA 1Q0HA 3GDOA 3NTRA 4YJHA 3WLEA 2I6TA 1PJQA 3GT0A 3AWDA 4E0BA 4E3ZA 4TVBA 1U3TA 4L4RA 2O2SA 1P31A 1GYQA 4X54A 1C0IA 4R01A 3FF4A 3FWNA 3GHYA 3DONA 2BFAA 3I5MA 4YJFB 4J1NA 1DHRA 4XCVA 3RUEA 4IM7A 2BI7A 2ZB8A 3ANNA 3H2SA 4FFLA 4WLNA 4XDYA 4AJ4A 4LCEA 1BXGB 2P4HX 4C7KA 3JYNA 4J2HA 1N9GA 3WGGA 3BHIA 4E13A 1BSVA 2VRBA 4BMVA 5JYEA 1H2HA 4RZIA 4OXYA 4YPOA 3G79A 2O48X 2FPIA 1AHIA 2D3TA 3WBFA 1YONA 1ZEMA 2ZB3A 1R4MA 4IPTA 2YJZA 1ZBQA 2O50A 3O8QA 3RUHA 2AG8A 3U5TA 4BGIA 1WPQA 4R3WA 4L4XA 3ZNQA 2H1SA 1KVRA 2EEZA 5F1OA 4F6LA 1JKFA 3RKRA 3JQ9A 3OEWA 2ZATA 3LU1A 4WNIA 2C2XA 1YXMA 1GV0A 3DB2A 1GV1A 3IJPA 5I8WA 4G5HA 2B0JA 1G0OA 1PGJA 1XSEA 4B8ZA 1GU7A 3Q0EA 2VZ8A 3PIIA 3CSDA 2H63A 1GZ4A 1GAEO 4MVJG 4TSKA 3GH3A 1EVIA 5I9LA 4FFOA 1VSVA 2W4QA 4E2XA 1YOVA 4ALLA 2NUAA 2GR9A 4JP3A 4JROA 3CTMA 4JIGA 3UCEA 1WNTA 4A10A 1YVEI 4HNGA 2VT3A 4E4YA 2VOEA 3G3EA 2FY8A 3IC5A 4HV4A 2AEJA 1YRLA 4KDEA 5LC1A 5GZ3A 2CDAA 2ZTVA 4ZQGA 5LCXA 4Q3DA 1I2BA 1OBFO 1YQDA 3V2HA 2QRLA 4J7CA 1ZIDA 2FR1A 1U7HA 2JKVA 2VT2A 4CR7A 1C0KA 3HFGA 5L4NA 3K8ZA 4ZQFA 4UUMA 3E18A 3DHYA 5A9TA 4JCOA 3VTZA 1QYVA 3I9LA 5C7IO 1H94A 3D3WB 3DAFA 3EUWA 4DLAA 1HL3A 4ZRNA 2H6EA 3JD1A 3AU8A 3QLJA 2C0CA 4CLHA 4UVIA 1AXGA 1YKFA 2IDZA 3KSZO 3OA0A 1IHYA 4OM8A 3U4CA 5ILGA 3T4EA 5K6AC 5IDYA 1PJ4A 2GD1O 5H81A 3ROKA 5IF3A 3I23A 5DNAA 4UUPA 4D3DA 3JQ8A 4BB5A 4YAJA 3TZKA 3WSWA 1U7TA 1YDWA 5I9MA 2ZJ1A 1OC2A 3ZN2A 4DTIA 2FR0A 1E7WA 3LZ6A 5IG2A 1C14A 4PG4A 5BT9A 3QVXA 3ZHBA 2VWHA 2ILTA 1NVMB 3D64A 5A3VA 3DTTA 5HTOA 1PJ2A 5A5FA 3STHA 2FMUA 1UZMA 2NNLD 3PK0A 2PD3A 3MJVA 1NR1A 3FR7A 4W9NC 3ROMA 4CMEA 1H9BA 1KVSA 4O63O 2OUIA 1ULUA 3GK3A 1JTVA 1V35A 2AQKA 4TZTA 3KOUA 4YJFA 3P2YA 4B3JA 1JWAB 3GRPA 2NV6A 3ZWNA 1D7OA 4NK5A 1NAIA 3G1UA 3D5TA 1KVUA 2DVMA 3JQAD 3H9EO 3VC7A 4DIFA 1LNQA 4D42A 1Y1PA 1B8UA 4A0SA 5G0SA 1SB8A 3OQ6A 3BXXA 1VJ0A 3FRJA 1Z82A 3AI1A 2GN9A 4K1LA 4YTEA 4BO2A 3OJEA 3PVZA 1W6UA 2ZYAA 1X15A 5I7SA 1CDOA 1E7YA 4ZJUA 1Z45A 3FD8A 4GI2A 1J0XO 1MLDA 2D8AA 3SC6A 4PN3A 1QYDA 3LVFO 5L45A 4BO9A 4IJKA 4NH4A 4CR6A 4U0KA 4KOAA 3O03A 4A5OA 1NVGA 1KS9A 4I08A 3BHMA 4NIMA 1Y8RB 1VL8A 5K9ZA 4EUEA 2D59A 5T67A 5IZCC 4Z9YA 1KC3A 3JSAA 3VDQA 2AA3A 1Z74A 2ZIZA 4U8GA 5KIAA 4WUVA 5HS4A 3GUYA 3V1UA 1GD1O 2DM6A 4BQRA 4B79A 4FW8A 1E7MA 2WJPA 3RQSA 1ENZA 2Y1FA 5COBA 4EUHA 2G76A 4RVSA 3A9WA 4DMLA 5F5LA 3QIVA 4MP6A 3BA1A 1DOHA 2X9GA 1KVQA 4PFJA 3OP4A 3VZQA 3M1LA 4CL3A 2QYTA 1KIFA 1I24A 2HMVA 2FSSA 3NV9A 4FFPA 1X0XA 1KEVA 2AXQA 3PI7A 3GN2A 2PR2A 1EE2A 4CM1A 2PKQO 4RPGA 1EUDA 5DCUA 2DPGA 1I33A 4XX0A 1IULA 2ZB7A 1FDWA 1PGOA 3DHNA 3L6EA 2NQ8A 3O4RA 2VYND 4E2YA 5HS6A 4XQ9A 3WGQA 2GN6A 4MIOA 4NU6A 3TZ6A 4FJ2A 3WOHA 3Q2IA 5TIIA 1DIAA 2WTBA 3ZWWA 3ICPA 4PLCA 4NHEA 1F12A 4QX6A 4F45A 4AJLA 1JDJA 4KQXA 5F21A 3PHHA 1NFRA 3W4KA 2IZZA 3E1KA 5I7FA 4YYZA 3PDJA 1T1RA 2ZJ0A 2B37A 4B7CA 1LDMA 3HSKA 4PZCA 3RU9A 1QP8A 3TSCA 3LF1A 1YQXA 5FI5A 1E6WA 2NM0A 2XPCA 1E3SA 4EEXA 4ZN6A 1T4DA 2ZYDA 3QWAA 3SBOA 3LLSA 3AI3A 1LDBA 1BW9A 1CIVA 2HLPA 1JQBA 4KTTE 1ZSYA 4GGOA 4LCJA 3RC1A 3S2IA 3VZPA 4YAGA 5JBIA 2IRWA 5EQFA 4B4WA 3OH8A 4LVCA 3GY0A 3NEPX 3JQDA 1DSSG 5KNLA 2J8ZA 1IY8A 2Q99A 1S7CA 2DFDA 3AI2A 4R16A 1TXGA 3M2PA 1P3DA 8LDHA 3K5PA 1GADO 2WEKA 3ZZNA 2G82A 2OO5A 1HT0A 1JAYA 2VRCD 2CUKA 5JPIA 4KWIA 3G1TA 4PZDA 4PRLA 4CQMD 4QQRA 1UZNA 5HWSA 3KSUA 2YY7A 3DTYA 2CDCA 4YB8A 3GQVA 2PTGA 4IUYA 4PLFA 4NQZA 1ID1A 5AXAA 3MZ0A 3TJRA 3T7EA 2OGUA 3GEMA 3DL2A 1P77A 2BGKA 2JCXA 3JQFA 4BKRA 5KTKA 2CMDA 1IZ0A 4EJMA 4IGFA 4IJVA 2FRDA 2YV1A 2UV8A 1IPEA 4IJUA 4WOKA 5DBFA 5ITVA 2XOXA 4IXWA 3LC2O 2B83A 5G0UA 2AE2A 1NNUA 1GTMA 1GR0A 3I83A 1B16A 1SOVA 3HB4X 1UXJA 2GUGA 3W4IA 3P2OA 2B4RO 3AJRA 1A9ZA 4XIYA 4W6ZA 2JAHA 3FTNA 4Q3AA 4BNTA 4CM4A 5C37A 4YA6A 1YJ8A 1BVUA 4L8VA 3AFNA 2IODA 4DMMA 3HG7A 4E5PA 2R6JA 1X1TA 3D7LA 5AVOA 2BI8A 1XU9A 1NQAO 1LDEA 3VVBA 4CMCA 1BXKA 4Q3CA 1F0YA 4KZPA 1ZMTA 2AHRA 1F14A 5FEUA 4CM5A 2D4AA 3CIFA 1EZ4A 3WLFA 1RM0A 1CRWG 2Y0CA 1E77A 4Z6KA 3H2ZA 4K28A 4QFDA 2CVOA 2A4KA 3S2FA 3W4JA 3E82A 3R6DA 1ZMOA 3DOCA 4MKZA 4Q3NA 2VTEA 3EC7A 1HKUA 2BGLA 3QWHA 4XEHA 1HE3A 1NWCA 2O3UA 3RUFA 2V6GA 4DBZA 4GSLA 4HY3A 3PZBA 2WE7A 1BVRA 1WZIA 3ORFA 4HADA 3JQ9C 1NPTO 2YDXA 3OIDA 2VZ0A 4CMIA 4YRDA 4IJWA 4Q3BA 1V0JA 1LJ8A 3DZHA 2I67A 2HUNA 4M8SA 2Q2VA 3A06A 2WMDA 4TVOA 4R54A 4J6FA 3RC9A 4WNCA 4C4OA 2O3QA 5KVVA 2VUSA 1U9JA 3QE3A 3OMLA 1PL7A 1TVEA 1E0DA 2FSVA 4IDFA 4WLVA 3H8VA 2I76A 2X5JO 5FF9A 3EVNA 2GN4A 2HMSA 5IXYA 2PA3A 4GWGA 1DBVO 4KTVE 3WQQA 5TF4A 4A7PA 4CM8B 4RVGA 3PWSA 2X8LA 3IS3A 4CUJA 2P2SA 3IQDB 1ISGA 2W2KB 3ENKA 4AJOA 2VNAA 1EBUA 1NX6A 5TGDA 2E82A 3WQRA 9LDTA 3TF5A 4E2ZA 2VHVA 3HADA 3K9QO 2NVUB 1K6XA 2HCTA 3V1YA 4PVDA 1F8FA 3NDRA 3JYOA 3ZHYA 5JYDA 3AK4A 2GZ2A 3SX2A 5IDQA 3O26A 3MJSA 1LLQA 2NSDA 3LQFA 1Y5RA 4RQTA 4DQXA 4WCDA 4BO7A 4ALMA 1N1GA 5K0ZA 1R12A 3SEFA 3R0IA 1YB5A 4GPD1 2G17A 4GWKA 1PGQA 3OM9A 3SLKA 3GEDA 1HDXA 4CR8A 2P4QA 1MFZA 2A35A 2IYPA 4YCAA 1V3TA 3EHEA 2NADA 2NWQA 2QX7A 4BO1A 3EK2A 1K89A 1MP0A 2HQ1A 3KYCB 3PP8A 1OFGA 2G0TA 4OKNA 3OFSA 2Y93A 5C3MA 1XHLA 1EUZA 1D4FA 4E30A 5A9RA 2H9IA 5G2OA 4XQGA 3GDFA 4BMNA 3TOZA 4CMEC 4GBJA 1DO8A 2O3RA 5DT9A 4E31A 2DQ4A 3VPXA 1LRJA 2PNFA 2Y67A 3NKLA 4MPDA 5EERA 1FMCA 1K2WA 2Q4EA 3RUDA 4GLLA 2F1KA 1PSDA 5ENVA 4TMFA 3LLVA 1X0VA 2C7VA 4BKOA 2I65A 1Z7EA 2I3AA 3GFBA 1TB4A 3DO5A 4AL4A 3I9NA 4OO3A 1JKIA 3VKVA 3MOIA 1ML3A 5DDIP 1V8BA 4NR0A 3WYBA 2DFVA 1I32A 1YDEA 3UCFA 1ZO8A 3S8MA 3DBLA 5A4DA 1UXGA 2JD0A 4IS2A 1NQ5A 1SNYA 4UVHA 3U4IA 5JAIA 1I2CA 3L4BA 3LC7O 5A05A 4YAIA 4QUKA 3UICA 3Q1LA 4CLEA 3WBBA 3BAZA 5T5QA 3DBRA 2EJVA 4XGIA 3RASA 3BMNB 4DRYA 4XQCA 3H5AA 4MDHA 4TRMA 4J0FA 5CPBA 3Q3CA 2IXBA 3LSYA 4I8XA 4U0JA 2FOIA 1N7HA 4G65A 2Y99A 3GPDG 4HXYA 1E3JA 4CM8A 4BGVA 4Z0HO 4UREA 5IAAA 4RDIA 4RL6A 3ROPA 5FWNA 4JBIA 1AGNA 2GCGA 2I9PA 3JYPA 5MDHA 1B7GO 5TQVA 4IZHA 3F9IA 1PZEA 1ZKMA 4IDCA 5T57A 3UFXA 3AY7A 1GQQA 1CF2O 1PWZA 2EW2A 1SEPA 4MKXA 5JCJD 1C0PA 1OZAA 2X86A 1H2BA 2NVUA 2Z95A 3L9WA 5L4SA 1JAXA 3GG9A 2J5QA 1ZEJA 5CFZA 2E37A 3GHHA 4CM7A 3EYWA 3RJ5A 4E5NA 3VZSA 3DAGA 1X7HA 3KB6A 3O8QB 3C1OA 3NUGA 5L9AA 1D8AA 4R9SA 2TMDA 1R4NA 1R0SA 1QMGA 3GMSA 4RLHA 2X1HA 4OOFA 2R00A 1YQGA 4LN1A 4W4TA 5IDWA 5AXBA 1GDHA 4QT0A 3WS7A 1EE9A 4BO8A 4CLXA 3L07A 4R3NA 5CDTA 3AOEA 5KVQA 2H5LA 3WICA 4CUKA 1P1HA 3E9MA 3IKVA 2X4GA 4PLVA 3UF0A 1YOVB 4GSKA 3RBVA 3KYCA 1KEPA 1T2EA 3IIEA 4OKIA 4M55A 1XU7A 3PWZA 3HJAA 4ZGWA 1H6CA 3RFTA 1JVSA 2QRJA 4I1IA 3P7MA 4HBGA 1FDUA 2RAFA 3SC4A 4IGEA 2W2LD 4MVJF 3PQEA 4XYMA 3FSRA 3K73O 3VHRA 3FPLA 4O5OA 2D5CA 4BNYA 3R3JA 2NU9A 2B4TO 3TL3A 1GY8A 1SEVA 2DBZA 5I9NA 4YXFA 4L9RA 2Q46A 3LT1A 2X9NA 2X9VA 4Z0PA 3JQFC 5CDGA 1E1LA 2JFFA 3GRKA 3RAJA 4B7UA 3TPCA 4J4TA 1LSOA 2W98A 1XA0A 3JQAA 3UH1A 3TL2A 1F8GA 1E5LA 5EIOA 1WDLA 1D1SA 1DC4A 2X22A 2ZB4A 3UUWA 1LI4A 1SMKA 1YBVA 1N5DA 3PFWO 3JQ8B 3ZV3A 3BTSA 1YB1A 4M54A 1VKNA 5AQ1A 4JJFA 3GLQA 3TZHA 2O3SA 1DRVA 4JN6B 3L0DA 1UDAA 4OSOA 3P5SA 4BNUA 3Q11A 1FK8A 3DMYA 4PLGA 3EZYA 1HE4A 1NWHA 4NPCA 4NBTA 3L4SO 5EN4A 3RSHA 4PLWA 1X7GA 3PYMA 2EGHA 2ZTUA 3NJ4A 1A4UA 4NBRA 4DL9A 5B12A 1EK6A 4EZBA 3DBHA 5GZ1A 2YV3A 3PPIA 4HP8A 4R1NA 5TJ9A 2FZEA 3WFJA 2PZLA 5JMWA 3DMTA 3WQSB 4JQCA 4EW6A 4P4NA 2Y0EA 1GUFA 3DDNA 1LQUA 1C0LA 2PZJA 3G17A 2VCYA 4MIYA 4IDAA 4L75A 2B69A 3WGOA 4XRRA 4ZICA 1YO6A 3ZCXA 3HB5X 2E4AA 4JNKA 5KCZA 4MVJE 1EUCA 4PRKA 2J6IA 1LDYA 1Y9EA 1VJTA 1E7SA 4K9DA 3ZNNA 3KLMX 3ZWOA 4DC1A 1DLJA 1U3WA 4KWHA 4Y9DA 3TFQA 1JKJA 1QYXA 4L0QA 3ZHZA 1QSGA 3JD2A 1QV6A 1UZLA 3QWIA 4UUNA 1Q7BA 4MVJM 1DC6A 2PWZA 2VYNA 1BMDA 2EV9A 5JS6A 1W0CA 4PLYA 4P22A 1M76A 2FHSA 2EP5A 5IN5A 4WASA 2VQ3A 4F3YA 1O89A 2IZ1A 3RCBA 3CEAA 2V65A 3DBVO 3B70A 4IDBA 2HKIA 5DCWA 5EINA 4BNKA 5BNIA 4O59O 5ER9A 1CWUA 2J3IA 2ZTMA 4XB1A 4YAEA 4P8RA 3V5NA 4AJKA 3I3OA 4GMGA 5L51A 5KKCA 1HDYA 2Z5LA 2Y0DA 1JWBB 1QORA 2I99A 3I52A 2YZ7A 4QXMA 3GVPA 4MP3A 4BO6A 2A94A 2HK9A 3HE3A 1I01A 3CH6A 3BMQA 5CEFA 1UJMA 5KJCA 3OIFA 3AUUA 4R4JA 3OJOA 3JCZA 4PLTA 4CJXA 1B8PA 1DJQA 3ZU3A 4BNLA 5BSGA 4JBHA 1DAPA 5GZ6A 3MJEA 1K0UA 3LT0A 3PIDA 1R0KA 2VRCA 5DZSA 1ADBA 1MXHA 4CQMA 4E33A 1BHSA 4JX8A 4INAA 3Q9NA 4NFYA 3C8MA 2GNAA 3INTA 2YYYA 1FXSA 1B0AA 2DT5A 2I66A 1PWXA 3F46A 1ZCJA 4DIOA 2PGDA 3QJ5A 1RM4A 3RWBA 4ND4A 4AJHA 1YBAA 4QO8A 4BNZA 5T64A 3GNQA 2DLDA 2VWQA 3GDGA 1ENYA 5BNTA 1L1FA 2DUUA 3CZRA 2HMTA 4GAEA 4UEJA 1RYDA 1ZJYA 3INGA 1C1DB 4BB6A 1BW9B 5KJ1A 3ETDA 1LC3A 1TT7A 1G6KA 4UEOA 1XYGA 3ZI0A 1NR7A 3QV1A 2YFHA 3GZ4A 2PLAA 2NU7A 3MCVA 3QRWA 4BUCA 1GCUA 2O3TA 4CMHA 4KP7A 3A28A 1PZFA 2PV7A 1J4AA 2DTDA 4OSPA 1GUYA 2C07A 2UDPA 1QG6A 1ZK0A 3WJAA 5A04A 1CERA 1LSSA 3DZGA 3HUDA 1VKOA 1PTJA 1Z6ZA 4E5KA 4DUPA 3BZUA 3RC7A 1A9YA 1BDMA 2I3GA 4JBGA 4URFA 2TMGA 2Y1DA 4AJPA 1HYHA 4I9UA 3RD5A 1KERA 4J1QA 4UVDA 1GZ3A 2IEBA 3JTMA 5BSFA 4GX0A 4LISA 1QXSA 2PFGA 4DC0A 3DOOA 1TA4A 3IUPA 4HKTA 3I6QA 4XGNA 4U6QA 3GFGA 2GRAA 1M67A 2NACA 3ABIA 2VOJA 3TZQA 1UR5A 3VH2A 4RLSA 4LMRA 1FJHA 1MFPA 4DQUA 4R1SA 3EMKA 5F3RA 5MGBA 1NHWA 5KWEA 1BXZA 1O8CA 3I9KA 4IDDA 2F00A 2Z1MA 3GMDA 4IS3A 3ZNPA 1TT5B 3L4BC 4ZQEA 1FDVA 5ICMA 4PZEA 4GH5A 3OETA 1QYWA 4Y8VA 4KQWA 4WECA 1FDSA 3OEYA 3HDYA 4L4SA 2DKNA 1Q7CA 3F3SA 3UXYA 4ALJA 1DFHA 1PS0A 2ZCUA 4B3HA 4FCCA 1VL0A 1YS4A 4RJTA 3D4PA 4FOSA 1K6IA 1O6ZA 4P4LA 4R1TA 1U2GA 4DPMA 5CAEA 1W73A 3NRCA 4FBGA 4F46A 4CM4B 1KY5A 3VVCA 5CG2A 2IXAA 1CJCA 1YGYA 2WSBA 4BVAA 1V3UA 2VNSA 4JXKA 4UEKA 4ESOA 1SAYA 4ALKA 3JV7A 3OF2A 3WFIA 3QVTA 1RPNA 5KVSA 2UAGA 3CXRA 3H9UA 2EW8A 1KEWA 2ZTLA 3ZW8A 2BD0A 2OP1A 4BNFA 1UP7A 2HRBA 2PK3A 2XF8A 3HDJA 3ZV5A 1PS9A 3MWDB 4ROSA 3WGZA 3F4BA 1E3EA 4DPKA 1HETA 2ZK7A 4J1TA 4Y98A 2GN8A 4H15A 2UUOA 2B4QA 4N5MA 1KC1A 4XR9A 1ZSVA 2DTEA 3JQEA 3RFVA 4EJ6A 4R5HA 5JY1A 1GPDG 3ADOA 1P9LA 3C7CB 4CMJA 3X2EA 4R9RA 5CEEA 3O9ZA 1XEAA 3QWBA 4CMIB 4BKUA 4GQAA 2R00C 1VSUA 2B36A 4HUJA 4OJNA 1HSOA 4P4GA 3GGOA 1PR3A 4ZRMA 1YH3A 1NFQA 3AOEC 4BGUA 3FTPA 1PL6A 4MKRA 3AFMA 5L7TA 4WLFA 1QV7A 3AY6A 1Y8QB 3D4OA 3NYWA 1T4BA 3VPFA 4ZD6A 1ISHA 5TC4A 2X23A 1BRMA 4HFMA 1LLDA 3IP1A 4QFCA 2PY6A 5JY6A 2P68A 1C1DA 2NVBA 2D2IA 2P5UA 2X0IA 3KM0A 5U9CA 3WMXA 3V2GA 2Y66A 4Q3EA 3K96A 5A5EA 1DAOA 2PGLA 2JHFA 1XLTA 1PS8A 2VN8A 3OA2A 1AUPA 1LRLA 1U8XX 3D5QA 3GVXA 3BIOA 5DN9A 4A03A 5JC8A 3VOSA 4D43A 2CNBA 4BNGA 5U4QA 1Y81A 2JJYA 1DLIA 1R6DA 4M49A 5IXSA 3WNQA 3SXPA 3OJ0A 4IMRA 1KY4A 2RHCA 3VH4A 2O2YA 1QLJA 5F5NA 3DWFA 1ZUD1 3KYDB 3TWOA 4J90A 3F5QA 4I9HA 4YWJA 3BYZA 1KEUA 3B1FA 2Q4BA 5C5IA 4DLLA 2HMWA 3WTBA 2FWMX 3VPGA 3D3EA 3MWEB 4DPLA 3V1TC 1LXCA
chains in the Genus database with same CATH superfamily
1ZUNB 2GVZC 1N5LA 2H4FA 5CAEA 2XB4A 5GJVC 1EP2B 3JQ7A 3KT8A 1HLPA 1RWKA 4XVQA 2OYRA 3VHQA 1V41E 4LHSA 3OHSX 1SELA 3CB2A 4EMBA 1KDPA 3G2NA 4R0NA 4DIUA 1I6LA 1RABA 2YHUA 1MGOA 5JCZA 3R74A 4M83A 1SA0B 3IQFA 4YFVA 1AE1A 5JS8A 3DOFA 1Y3HA 2CSUA 4YV1A 3WL3A 4JP1A 2EFGA 2HRZA 2IW1A 1Y3IA 1YR8A 1FXWF 2P9EA 4I4TB 3OECA 4Z3OA 4YHBA 4FOTA 3SHQA 3H3XA 4LS3A 2R86A 3GOHA 2GLXA 2OSVA 2WZBA 3OZEA 2VI5A 2YQZA 1LK7A 1GUZA 1ISIA 2R1VA 4IIJF 3ESAA 5AOAA 3WRWA 2YJ5A 1E1QD 1Z16A 4EAQA 1MUUA 3VKWA 3UJHA 5SZIA 4YPVA 3SQXA 3EAFA 2FDXA 2HIAA 2ZCVA 2FWJA 1D09A 3JAMA 4EYSA 1YFLA 1Y0BA 5KHLB 3WLPA 4K6MA 4XLZA 1WXGA 1A4RA 5KHOC 1IHUA 1PLKA 2FG6C 1ICEA 1PDOA 3ABZA 3MWDA 4CEHA 3KAPA 5H59A 1EQ2A 1ULZA 4QVIA 1SXJE 1Z3CA 1RMTA 1CP2A 5KMGA 5ALVA 2ZREA 3C8HA 4OEHA 4EUNA 3FN4A 4ECEA 1XD9A 2J0UA 3FCOA 3KUKA 5JOQA 2C2HA 1O1YA 1BYIA 4WOBA 2P35A 1RAHA 3LA6A 2JFYA 4L15A 3G2KA 4NE2A 3SI7A 3FYTA 6NULA 3DC2A 4G0UA 3QFTA 3RFXA 3SS9X 4P36A 2VXCA 2PZKA 3EWSA 3HK2A 5JCJA 2FQYA 4LY9A 5JAMA 1TFUA 3V4FA 2CLMB 2ZRIA 4OD0A 4RADA 2V03A 3IMGA 1C9EA 2ZS9A 4E3WA 3VKUA 1RWMA 4XA8A 2ATEA 4H1UA 2JGDA 3TAXA 1OLSA 2GHIA 3DP9A 5DPMA 4DKXA 3KQOA 5H1YA 3ROQA 5DTIA 5CDYA 1V6SA 4QHYA 3DDHA 3U4DA 3ANMA 3FNIA 4LAFA 1ZIPA 4UOZA 1JIKA 1ONOA 3PQ6A 1CK4A 2QTNA 4KJXA 5E38A 4JEHA 1Q1EA 2XXAB 3WO1A 1T5BA 1FVXA 1YDGA 3LVBA 1C3VA 4PGFA 2QTTA 2JJMA 2GJ8A 2B9EA 1H0KA 1E64A 4UXHA 1JDPA 4OGFA 4ZKDA 3A1TA 1MC5A 4G25A 3H5RA 1VIMA 1EVJA 2J6BA 3NATA 4GIBA 2XRZA 1P1FA 4EQZA 1BS9A 2G4CA 1WXFA 4OJKA 4P83A 3MRSA 1T2NA 2QENA 1D2NA 4EHJA 1WW2A 2BCEA 4I4NA 4Q0MA 5CEJA 1PEKE 3FZQA 3WJ7A 3PGXA 1Q77A 4WFQA 1DX6A 5LMUB 1UXIA 3EIQA 3AYZB 2DQSA 2ZJFA 1FDTA 6LDHA 2SCUA 4EHIA 1IK6A 1YDHA 1G64A 1KJJA 3FOFC 1XVTA 2HPHA 3OLXA 2OEPA 3FSGA 4HAYA 1MC8A 1Y37A 5IT4A 3GP8A 3L77A 4QDZA 4RF5A 3SQNA 1R4NB 5FLYA 5BORA 1MEOA 4FT2A 4IXNA 4WINA 3R8XA 4HDSA 5G4LA 3ZU6A 3BFXA 4IMJB 1SXHA 2Z2ZA 4Y0VA 3UK6A 1FA9A 3MIIA 3GELA 3FPKA 3P9RA 4XM2A 1JQAA 1YVRA 4KHPB 1MT3A 1EEXB 4FQ7A 1Y5NA 4F5EA 2V7QD 3C70A 4QATA 1G4AE 4GX5A 3TVTA 4J3FA 3PC2A 1JA1A 3GAFA 4EGFA 5JLJA 1EFPB 2WU1A 3KWJA 5E3JA 2QG9A 1SA0A 2E7ZA 2W6ID 4PFKA 5ARCA 5LP6A 5EESA 3O8DA 1DRJA 4F2HA 1O4WA 2XUDA 4WK6A 2GO1A 4OGLA 4LRTB 1AA6A 1NLZA 2V6MA 1NI3A 1REQB 4F2WA 2HH9A 3D8NA 4I4TA 4XSGA 3M1YA 4NWIA 5FI3A 1VC2A 1VQ1A 3MJTA 5FDFA 3EASA 3SHFA 2XDWA 4OI4A 1FX1A 2DAPA 1P74A 3HFSA 1VP9A 3CT6A 2BGGA 1QP0A 4YBZA 2QTRA 1U0JA 3WYGA 4G6ZA 2POQX 1GQ2A 4FZVA 1QVZA 4YHHB 3UFBA 4OTZA 3W9YA 2XCRB 3HJRA 4EDFA 1GTVA 1YMQA 4LMAA 3ZXUB 2FE4A 3S81A 4EY6A 3WMRA 4IDOA 5DMXA 4EKYA 4YAOA 1QH8B 4FS8A 1YFJA 4FN5A 4JMPA 1M2FA 4IINA 4W7IA 4WE3A 5AIBA 5JDCA 1RLTA 3M4YA 4OX9Y 1BE6A 1B76A 2Y1WA 2FW8A 2WNIA 2JI4A 3PFNA 2I33A 2IYYA 1O08A 2I54A 3DUWA 3GAZA 4OH7A 4DABA 1HLDA 1MX5A 2YNMD 3TQCA 5JSUA 5A2QA 4G84A 2HRDA 1Z75A 3IT3A 3NHZA 4QPPA 1Z06A 3H17A 2W2PA 1DZIA 3BCRA 5H3CA 521PA 3DBIA 3NDJA 2FPPB 1J2UA 5ES3A 5TB5A 3WK7A 5L8VA 2ZJ8A 3DYVA 1JH9A 3L9XA 4NDAA 1KIMA 4PAGA 1EM8B 1SCBA 1S2OA 3LGSA 3TZCA 1K92A 3LC1O 3FNRA 4I5DA 4L76A 2C9MA 5DTQA 4OQ4A 2A67A 3BH6A 1U3DA 3F8SA 1EVZA 4RVFA 4AC9A 2C88A 1QO0A 1TCVA 2PH1A 3QU5A 3ZK7A 2XXAA 1K75A 3B82A 2P2NA 3E6AA 4MIKA 3B7WA 1SCIA 5DOVA 3GGCA 3LW7A 3CHYA 3OIGA 4RAOA 5ARDA 2P1RA 3S1LA 5BV0A 4JUFA 1CBUA 2FAXA 2J7PD 3E5RA 2HDHA 2OC9A 3F6BX 3I9JA 1PW5A 1P60A 3HKEB 4M21A 3VUEA 5LXTA 2E49A 2WK1A 2XWJI 5J5AA 1R6AA 4EYEA 1GPNA 4AUNA 2HD4A 2WYWA 1CUZA 1N3LA 2RGCA 1TZMA 1ZWLA 3H84A 2GKGA 4YRPA 1TF5A 3ADPA 3H9JA 2QTFA 3QVSA 4EK9A 2H2WA 1B0UA 3SYNA 5H5JA 3VSDA 4CMAA 1J2RA 4E12A 5JHGB 1KBOA 4ZXFA 2QUJA 3U7FB 2EL9A 1LLUA 3PICA 3E70C 3UMGA 2QT1A 3QMMA 3ZLVA 3I4CA 2YUIA 3FHCB 3JWPA 4RPJA 2EF1A 3MTGA 3WRYC 2WD7B 4GMKA 2A9KA 3A6ZA 4CI9A 1PFKA 2JJ2D 4JOSA 1WHSB 2NTVA 4V38A 4AW9A 3U4HA 1PUJA 3NFRA 4DREA 4FGZA 2HK7A 4YMIA 1DBRA 3E7WA 3GX1A 3WAJA 4YT2A 2FWPA 3LF2A 3PDUA 3OI7A 1M1NA 5ALDA 1EDOA 2JNWA 2PT5A 3O47A 3PUVA 1EHYA 1O0SA 1ZW1A 5BNFA 3RK1A 2UUPA 5I7HA 1CUEA 2ZSAA 1A69A 1PYGA 3IEIA 1M9NA 1ZA2A 3MPOA 1IBCA 2FZWA 2VJCA 4L08A 4MK4A 5HA5A 5A06A 1NR5A 4J7XA 1XHFA 1K63A 1PJ8A 1J5PA 1NG9A 2GPSA 1E5XA 1RHRA 3L6DA 4NCHA 4CNBA 3SYRA 2ZE6A 2RI6A 1JBQA 4DIEA 4D4KA 2H29A 2B8JA 3M3PA 2PU5A 1I4LD 1IE3A 1REQA 1KBZA 3AB8A 4MB6A 4N6GA 1JHQA 4TRJA 1L5HB 4IHKA 1U2EA 2ADMA 1I3LA 1E59A 3AEYA 2FN8A 4FFMA 1NRIA 4MUJA 1JA9A 4LJRA 2I2DA 3ODGA 4DA9A 2QRPA 4HTAA 3PC4A 2QSUA 3UAGA 2LIPA 3C14C 3H97A 4FYXA 3WMWA 1JXMA 4EHFA 1DVRA 2JGAA 2X9LA 3KO8A 2WZQA 1ZYUA 4MKIA 1UDRA 1XWIA 3KZ1E 3L7BA 1P4GA 1XAGA 2A78A 1ZKDA 2AXNA 2FQXA 1H65A 1XN1A 2JPDA 3GT4A 4PNPA 4BX3A 4FDTA 4I9NA 4WFKA 4N41A 3GC6A 2HX1A 2V54A 1QH8A 1ZN2A 1K8RA 1WMBA 1A97A 1RRGA 2W2TA 3HA7A 3N6VA 4QECA 4WIAA 4WZBA 1CQIA 2OFOA 2XBMA 3PYXA 4R7TA 4FFSA 1E6LA 3G2IA 3RG2A 5IFLA 5F76A 1BYUA 4DLZA 4WCFA 1TMGE 1WY7A 2O7QA 1NBEA 4J0JA 1L4KA 2AMVA 3PFFA 3H9CA 4GX2A 3UENA 3ESXA 2CE7A 5ERXA 5EJEA 1YJAA 1JVBA 4D82A 2HLDA 1HR0B 2C5LA 4Y2PA 3HVRA 1GSHA 2B99A 1T0BA 2FPPA 3HH8A 3K72B 2OKCA 3PUYA 3ELUA 3MA0A 3I2KA 1UC5B 9ABPA 4J7UA 2BHRA 1JLRA 3EDCA 3MHPA 4JMLA 2EZ8A 2F43A 2FEXA 4OQYA 1T15A 3OIUA 1ORVA 4JWTA 1URPA 3VDNB 1SB9A 2OXCA 1Y1QA 3EMDA 4QOFA 5AW5A 3GEIA 5J4LA 4HS4A 3ZZ0A 3NTUA 3L6RA 5C7OO 4ZPJA 1VLHA 2ZUTA 4YH1A 3UMYA 2F1OA 5AXCA 3VPSA 3V4PB 4BPRA 2C58A 1EFLA 2JFZA 2XAUA 2Y77A 4J2OA 1KYXA 1DG3A 3INYA 3KJGA 3HKEA 1F0PA 1BIFA 2LE0A 1TQ8A 2E48A 3I73A 3HDGA 2EKZA 1KMMA 4W5QA 2WTXA 1QGOA 1MX3A 1XCPA 1O96A 2X5OA 3QENA 4O4IA 5HRAA 3CW2A 1OILA 1JX6A 4RJLA 4Z8XA 3WA6A 4B3CA 4DQUA 5FV4A 1NM5C 4BRWA 3FPJA 3HFRA 3HZRA 5IMBA 3NGMA 1NNEA 3PRYA 1W2GA 3MJCA 3NQ41 1XRLA 2F1HA 1QG0A 2G25A 3C7DB 4OHOA 5AK5A 3R7SA 3EPJA 4GDFA 4HQOA 4V0RA 5K0EA 1U1CA 1Q0QA 2IHUA 5BR7A 4D9JA 1PT8A 1RR6A 2X19A 4QARA 5IC4A 1YFKA 1XNGA 1BOFA 2H3HA 2WD7A 2ZUSA 4P35A 2WHEA 4Y6PA 3UGKA 2YHIB 4O29A 1P7PA 1TO1E 1FBNA 1Y6JA 1MJGA 1WHSA 2A9RA 3IDZA 2KSQA 2PVSA 3L6OO 3OEED 2PKCA 3OWHA 1C41A 4UATA 3U7JA 5JFOA 1JF8A 3D1LA 1UEXC 3Q2KA 3A6EA 5I7AA 4EVQA 3QUTA 4U7WA 2PHZA 3KXDA 4ZT7A 3ENZA 4OFWA 3SQLA 1X7WA 1EFVB 2CFCA 1P5FA 1ZD8A 2VHWA 1X14A 1J0AA 3MTEA 4GLBA 1DRUA 1X7XB 2PD6A 4QULA 3MERA 1E1RD 1W8DA 1A5TA 4RHTA 3UJ6A 5LQKA 3OJXA 2JG3A 1IYZA 2RBEA 4RFLA 1JSRA 1KPIA 1FRZA 1U80A 4PNHA 4EY4A 4N6OA 5JD3A 4WJLA 3O4GA 5CHEA 3WR5A 4AX8A 4XJVA 2BFCA 4B81A 3IO5A 2I4TA 3BRCA 2QZJA 5LA6F 4X97A 1Y98A 3FCUB 1WMEA 4DYDA 1WVGA 3S28A 2UYHA 3DNFA 3W6ZA 1XVAA 3AVQA 2PXAA 3ZW7A 4C0AC 4K0RA 1SWVA 1DIHA 3MGBA 4R68A 3OBBA 4MA4A 3IMEA 1U8FO 3QU9A 1TW2A 2AHOA 1MJFA 3A4NA 4DEVA 4C76A 3FMOB 4Z4HA 1U5CA 4RZHA 1PI3A 5HE8A 2WJWA 2VP5A 1Z0DA 4N0DA 3PLRA 2LWIA 3ZD8A 2PGJA 2RKWA 3PC8C 4RD6A 1IG0A 4PCUA 4H4EA 3VZDA 2DBQA 4CCYA 1LFDB 1UDWA 5B2ZA 5BXYA 5IFKA 1SVKA 2GXSA 1PZHA 5H02A 3T7CA 1NVTA 3JYQA 2DPMA 3T0GA 4BP9A 3RIYA 1KPHA 2CLLB 1JLMA 4JP2A 2CNOA 2OVBA 3HN2A 3A9SA 3CRRA 3UAOA 3IHKA 2B8TA 4AI6A 3K6JA 2BMVA 4I4LA 5AJZA 5F23A 4RE6A 4U2KA 1J0CA 1ZQ9A 3CLHA 3VYRB 3DXZA 4MO9A 4JYBA 4RFVA 3PD1A 3TOCA 5JC1A 2B0CA 1ESCA 2CDBA 5A3JA 2XAAA 1N78A 4YRTA 5EAIA 1JEQA 1RYBA 1TJ3A 2OUKA 1TLTA 4K05A 4YRBA 1B6SA 2C5FA 4FBMA 3EOAI 1YA8A 5FBWB 1DX9A 2QRKA 3IPYA 1AMUA 5KOHA 2XNHA 1U0BB 4H2DA 4S3MA 4N3BA 5JCOA 4RVUA 3VI4B 5JNSA 2Z56A 4N5IX 4KAFA 1DUSA 4IIDA 2BHLA 3FLBA 3NRBA 5DXAA 4FSDA 1E1MA 1C3EA 3K53A 4DIBA 4U39A 4AZTA 4OHMA 2VC2B 1PL8A 2WZCA 3EZ9A 3LZDA 3ZGYA 1XXHA 2PRIA 1VRWA 1I3MA 2BFMA 5B3JA 5BV8A 2Z6VA 3OU2A 2B82A 3L8DA 3QQPA 4WXHA 2O4CA 3RRZA 1KP3A 3RRJA 3UWMA 4JJKA 3L1KA 1KSGA 3U49A 3V8NA 1WW8A 4QFMA 3PFHA 4B3IA 2VDMB 4NG5A 5DX8A 4ZDWA 1TU4A 4NVRA 3JWHA 5M5BA 1P7CA 3JYLA 2OCYC 3MWFA 4HNAB 4K3UA 4B7ZA 2XODA 5H3LA 1KYQA 4C1NA 2FCAA 4MWZA 5BOSB 3PEUA 3MCUA 1QVAA 4MUKA 2EJCA 5AR1A 4DLYA 1VRCA 5JZVA 5ILOA 1MR3F 1OCEA 4K6HA 5TLSA 1G0NA 5LDHA 1YC5A 5KI6A 2IUFA 4DWVA 3JAWA 3O2NA 1NV8A 2YHIA 3R24A 1IU9A 3ZGLA 5J23A 1KO5A 4BKPA 1TM7E 3O93A 3NT4A 3KOOA 1P61B 4X3CA 1QRTA 2BMDA 5C18A 4A8HA 3OUZA 4LF4B 1MJ5A 1BXGA 4RTOA 4UTZA 2NXJA 3OPQA 4DNXA 3W5IA 4GU5A 4KR0A 2GEDA 4UHDA 3OHMA 3SG0A 3PWKA 1NJ6A 1MG5A 4M6WB 3SU8A 3SJUA 1DPFA 3OX1A 3FNQA 5HM8A 2IHJA 2LIVA 3EW7A 3P9NA 1X7XA 2JLXA 4M76B 4OB8A 1OBVA 3PYLA 3A2LA 1GLNA 2C20A 1VECA 2HMUA 2I8CA 1ECBA 3Q3EA 3DVLA 1U3VA 3MTDA 4AULA 1SXQA 1AKQA 2ZRJA 3KXIA 1MA0A 3WWYA 5HPYB 1B8VA 2VAWA 2A9PA 1M8JA 3DR3A 3TIVA 1PV2A 1O0CA 5SY4A 1DWUA 5CH8A 4MV9A 2PS9A 3ESZA 1SD5A 3P5BA 1M2EA 4JAVC 2E2WA 3QOYA 4Q7QA 2CVPA 5BWNA 3ND9A 2ZI5A 3D8HA 4EHNA 1F38A 1G6Q1 4OMCA 1SCUB 4ND1A 3W7AA 5CRIA 2IZ5A 4DILA 3R7LA 4D3YA 5BRAA 2Z8YA 1RWNA 4Y7DA 1Y4ZA 4X62B 3GFRA 5CR9A 3IP8A 3KYBA 4GVPA 3M33A 1PJBA 3V7YA 1U2DC 3PGKA 3B3QA 4RVHA 5CH3A 3K92A 3F3KA 1PR2A 2ID9A 3QVLA 3P26A 1DADA 2PXHA 3WXMA 1JHUA 1ZLYA 1DEOA 3ROTA 3ASVA 3RS5A 1JYEA 3RJ9A 1YU6A 3DQZA 2GF0A 3A3YA 1SU8A 4L7QA 3X2SA 3X1KA 3I0ZA 1ONPA 3BTOA 4BKQA 4ZVMA 1GPMA 3RRNA 4FE3A 4D3FA 3ZTTA 3HDQA 4RTRA 4JD5A 1GGKA 2FPMA 2P75A 3F9CA 4BL5A 4YCLA 3GRAA 3M6IA 2YVUA 4GZLA 4MMXB 4ZHSA 6PFKA 4OBBA 1PO7A 1OKKA 3LYUA 2D13A 2FX2A 1XTIA 3R44A 2Q21A 4UUOA 5LR6A 4KC0A 1GTSA 1L7EA 1FQWA 3T7TA 2J59A 3D3WA 3OZGA 2WYUA 4HGOA 5K8JB 1UBRS 3JVEA 3AR4A 5BSMA 5C35A 2QK4A 1CS0B 1FW8A 5CJJA 1S2GA 4PXAA 5F9HA 4R8SA 1WY5A 3DV2A 4EX7A 1NBIA 3WNVA 3AKDA 1ZJ5A 1OXMA 5G0TA 5F64A 5A7GA 2ECOA 2W93A 3RS4A 1WB9A 3QXSA 3AVXA 2H2IA 4WXPA 3DAOA 4YRKA 4D9HA 1RAEA 3R3HA 2OMEA 4B3GA 3DAPA 4P4UA 5CTAA 1K9VF 4ED9A 3A1CA 4MV6A 4B45A 1QE3A 2ZSFA 4WOJA 1FTYA 1N6OA 1W5EA 3QMPA 3I72A 1RJWA 4WXEA 1R8SA 4AQ7A 1I6MA 2PX6A 2CF5A 1J5XA 1S0UA 3VR5H 5IKPA 4UHCA 3DE0X 1XR3A 4LBVA 3JD0A 3R3WA 1I0ZA 3FPCA 5AVXA 3HKCA 3MMNA 4H0NA 4Z3KA 2IZOA 3R5SA 3HU3A 4C2AA 4ESEA 3BFVA 3BF8A 2CXUA 1D7AA 1PJ3A 1G20E 5G4KB 3DLBA 1N1DA 1X7DA 5F2KA 2ZR9A 1D6SA 1TRHA 1TLFA 4TV8B 1LV7A 2QW1A 2VXBA 1KMQA 4D8VA 3NAMA 1UH5A 4X45A 1NVAA 4IVRA 4LGCA 2WWWA 4G4JA 3LUPA 1UOEA 3LRTA 4HNHA 3G9XA 2V98A 4IIUA 1DAHA 2ZPAA 4Z99A 4L3OA 4EAAA 2RG1A 3L8FA 2DPYA 1OWLA 1LTQA 5COAA 3O4JA 1WXQA 3G8CA 3H1BA 5ER6A 4L6IA 5T8KA 3OCXA 3W06A 3KELA 4CTMA 3GLGB 3SKYA 1Z8FA 4RQUA 5D00A 3G2MA 5DNWA 2PO5A 3CLUD 4YIKA 3H9QA 1R37A 4YAKA 4I1RA 5MFZA 3K0HA 4HNQA 2TRSB 4LE1A 3SJBA 4OYHA 2XH8A 5SYAA 3N8HA 1NYTA 5DW0A 2P2LA 3K0AA 5JZSA 5TQ2A 4B3TB 5A3QA 2V4MA 2CNKA 1U9IC 1P1IA 3KSDO 4LWZA 3G02A 3IT2A 4X5OA 4ZP1A 3AGQA 3CMMA 1YR1A 3SMQA 5KQPA 3T4PA 2Z1DA 4QDTA 1Y6GA 3DLCA 4X00A 4RORA 3W2HA 4FKMA 1Z0SA 1DCTA 3I6YA 2C9YA 1E2DA 4Z3DA 4BNIA 5IPFA 5JADA 5C8YB 5KCMA 3O8RA 2IH4A 5EVCA 5D3ZA 1U6JA 4LRYA 3H4VA 2AC7A 2AZ4A 4DG5A 4TS4A 3VU9A 1L9XA 1WXWA 1X70A 3LNCA 1AZSC 3K9LA 2WJ6A 3VR1A 3GLFE 1W1UA 3KJXA 2MWMA 1C0EA 3OUTA 3Q3HA 2C97A 4Z9XA 2C2BA 1PAUA 3OESA 5T4FA 1LPBB 1TUGA 4INZA 5JMPA 5JO0A 2WM2A 3U1BA 1RWXA 1LU9A 4UULA 3R5JA 3FMPB 4QDKA 3NT2A 3R5KA 5TPWA 4EL0A 4FI3F 3EZFA 1H4SA 4URZR 1EDZA 2W2OA 5TGZA 3V1MA 1E6CA 2VHQA 3R0JA 4ILKA 4R8MA 1EHCA 1EK1A 5BMVB 1NMQA 2O6LA 5CLLA 1E3WB 1I3OA 2O7NA 1VPDA 3EZ6A 2CYCA 2J31A 2YXBA 3IDOA 5C8VA 1QP4A 1S96A 4CHTA 4QPJC 2G71A 4RYLA 3ONEA 1F5SA 2GZAA 2VJBA 2XR1A 1M2GA 4A0GA 2BE7A 1IY9A 1T3HA 5BMOA 5IJ9B 1SUAA 2XMRA 4IQ8A 4N1AA 2YQ4A 1MENA 3HGTA 2XNCA 4RTKA 4O4LA 4M1KA 3A6LA 2DSTA 3NHLA 4JZYA 4B7XA 4I19A 1JU3A 5IM4A 4IRXA 1IOLA 5CLQA 3BQNB 3W6UA 3UV7A 1PK7A 5F9FA 4OP3A 3T1QA 4JBNA 4FTWA 3I9OA 4H16A 1C3LA 4ZYVA 1AN9A 2C5AA 3A10A 4O1IA 1DKMA 1E2PA 3LUDA 4L4YA 4PGGA 2JL1A 4QTYA 4K8OA 2GH1A 3SVTA 3HB1A 4ITVA 4J1SA 2JCBA 4J43A 1EWKA 4XUGB 2CV2A 1XIVA 2XADA 5ALKA 3EQ8A 2YRFA 1OTHA 5DYIA 2EX4A 2VNIA 5A5VA 2O54A 3GVIA 1RI2A 4QG3A 2JFHA 4Y6SA 5FV7A 4D9KA 1Z6AA 1ZG3A 2OHIA 3NAZA 3SDZA 3IIKA 3ZE2B 4B9AA 3NBAA 2HF7A 4S0XA 5AK0A 5ESRA 5L95A 2O4UX 4F0JA 2P9FA 4IKOA 5KJFA 4V0ME 1JV2B 1L4MA 3OT5A 5IBRA 1QAMA 2FN4A 3SX4A 2Q2OA 4HAIA 2FPSA 2MDTA 3GQBB 2BFOA 2X5KO 4DCSA 4WOPA 3TLJA 1DRKA 4XR4A 4TZ0A 1G41A 2V1UA 3DEYX 4MJ3A 2V45A 4B6JA 3B85A 3U16A 4RH3A 2R8XA 4FFRA 4H31A 1R66A 4MR8A 1DE0A 1ZXBA 4Y1EA 1WMAA 1KQNA 1E69A 5IT9A 4C4PA 2VSQA 1LVUA 3ZHXA 2Y1EA 4Z4IA 3GLGA 5JXJA 2IUYA 1IBSA 4F8YA 1DAGA 1MMFB 3N2NA 2O23A 3IAFA 2GEVA 4RFSB 1VE9A 3ONVA 3OQMA 3SBXA 2YJ6A 3CUTA 3RIEA 1TF7A 4JUBA 1YUMA 1RKVA 1CY7A 1Y5MA 1PG0A 3TDKA 1HE2A 1T2VA 4DEYA 3NKFA 4OHCA 1M2VB 3C97A 2VQEB 3JWJA 3IULA 4UTVA 1SVNA 3R77A 2CE2X 4B0PA 2AYXA 4AZVA 2HQRA 2Q1WA 1Z18A 1N7IA 2X0RA 3MEQA 4J0HA 3VH3A 4AMGA 2YXEA 3HSSA 4B1FA 4BGEA 1R9MA 1I7SB 1JHXA 1M6YA 2AC4A 4L0CA 4ZEMA 5HJEA 4XLLA 4AKIA 2I6SA 4RVCA 3QIAA 4IFTA 2XZDA 1HZZA 2JFGA 2NVWA 4TKLA 1STOA 3P97A 4MKFA 3T8YA 4EG3A 2P9CA 5TY0A 2PIDA 3ZPXA 2VPXA 3IT1A 1N7GA 2OM2A 1GZ6A 1P2SA 4MGEA 8ADHA 1L8XA 2V6FA 3Q41A 5C52B 3MQFA 1B2LA 2BZ1A 1TK3A 5IARA 4AZWA 1V3VA 5EYPA 3ZDYB 2KPOA 3EMBA 1AQIA 3JARB 3WJ2A 1SPXA 2ROQA 4B8WA 1BO6A 1KY3A 3E9NA 1ENOA 1T6BY 4IMPA 1JAIA 1KHTA 1TPYA 2R1UA 1CR2A 3NIFB 4EL5A 4NK4A 5DXJA 1GM5A 5EJ2A 4DUYB 2ZR8A 3GOQA 2WFMA 3QUBA 1E3WA 2H2FA 2JAOA 4WH0A 5CT6A 4JQSA 5D85A 2B8EA 4E5YA 1Z26A 2XA9A 4NI5A 1JZTA 4QPDA 4GMFA 4N0QA 1WEKA 4ON9A 5KNDH 1LBHA 5HIMA 1SULA 5FUWA 2FSGA 5F2NA 2JHGA 3A1UA 3Q40A 1VJGA 3WSVA 5JXIA 1G8SA 2WYVA 4O1MA 1NBOA 2NXCA 3BIXA 3A0UA 4NJOA 3ZKAA 3FDIA 4BNXA 1OGYA 2IK8A 1JG4A 1DFGA 1DIOB 2GM3A 2QIOA 3P96A 4X3OA 1ODKA 4BMYA 4F4IA 3DT8A 1IHXA 4Q4HA 1L7XA 4H6WA 4ZVSA 3RYFA 3U9LA 4HH1A 2BMAA 5IUNC 4B47A 3COVA 3FUTA 4K9QA 4RGQA 1T8PA 3GJ0A 1O6CA 3TZEA 4UW9A 3THXB 1OJ7A 3FF1A 2QM3A 2QZZA 2Z5FA 2I91A 2R97A 2LP4Y 3F8WA 2R4TA 4J94A 5AJWA 5KKNB 1UPXA 2A5GA 1LUAA 1E9VA 4MVJP 4RAQA 4MJLA 1FZQA 1XQ9A 5CJ2A 4YXWA 1N4AA 4YX9A 2QKYA 1CRZA 2C3MA 4K6CA 2WTAA 4Q05A 2P0AA 3GJ8A 3ZX5A 3KTAA 4HDRB 3VJKA 4OGKA 4FGKA 5GONF 1G8GA 1YRYE 2GAFA 3OZ7A 1S9HA 4JI2B 1DELA 1UWKA 1RQXA 1BFUA 3ANSA 2A92A 3CE9A 5JNWA 4OREX 3HBFA 4ZEWA 1EGMB 2CF6A 1DFIA 1VBFA 3AKYA 1D4OA 3LYHA 3WAGA 1L1QA 4FYVA 4K9RA 4HFNA 5F1PA 1PR9A 1GTL1 4U7HA 5L7YA 3WRXC 3GLIA 1T1SA 1QONA 3FFXA 4IUBS 4AECA 4BS9A 4ZALA 1JE0A 5LIRA 3K1AB 2K2WA 2KYRA 3I05A 1NPYA 2QA5A 1ZU5A 1GVNB 1GAQA 1BMFA 2GX6A 3HP7A 3TL6A 4B09A 3TSZA 5K7SA 1P0PA 3L7CA 5DO9A 2E6UX 2F8TA 4EG1A 4E21A 1N2XA 1ZGHA 2LCIA 2Y92A 3DMRA 3L01A 4XQEA 3HJUA 3SEZA 4B5LA 3I62A 1VCIA 3FTDA 2IV3A 1IUPA 3RV4A 3OM1A 4B6SA 2W6JA 3OQOA 1II0A 2G1UA 5EXTA 3S55A 2EHJA 4XYGA 5GMOA 4DR6B 2H1HA 3LG2A 3IUSA 1Y7LA 3D4NA 3RIGA 2X6QA 3QVWA 1GG9A 2P9YA 3IEUA 4PR0A 5DFAA 3GI1A 2JH9A 1IXKA 1T3TA 4C89A 1THGA 3PDHA 2IYZA 3FE2A 1XNQB 4FEYA 3J81k 1TX4B 2XBUA 3SJ7A 3X1DA 3IQXA 1KO4A 4R5MA 3CUKA 2WJYA 1YR6A 2WNSA 4KR2A 4M1MA 3LYAA 4QT4A 4F7DA 3HNPA 1GHTA 2WWGA 2XV1A 3HJHA 2QD3A 1Z0UA 4B3BA 1H5QA 1UAGA 2MINB 2CHUA 4E5MA 1ILEA 4C5CA 3CX7A 2H0RA 5H9VA 1MN6A 4LFCB 4PFSA 3H2YA 4ZQHA 4CL2A 4UFNA 2QRQA 5E3HA 3CUEF 3CH7A 3WLRA 3QEKA 3ZG6A 1WUTA 2QN6A 3EVTA 3OZIA 3I2FA 2C00A 3HMQA 1HWYA 2NZ2A 4ZO4A 2AK2A 1Y6QA 5JWOA 2QV7A 2NU8B 3V6LA 1WKBA 4P7BA 1S2NA 3RROA 5E7MA 1JMKC 2WM8A 3JARA 4A26A 3QQ5A 1F6BA 4RSMA 3MWKA 5FCDA 4YRAA 5LKAA 1G4HA 4NE9A 2M6LA 1QK5A 1UT5A 1WCIA 1JE1A 1USUA 5JIBA 5CVUA 2LPMA 3O8CA 1KOLA 4WERA 1EFKA 4K87A 3Q5DA 3UT0A 1G1AA 4EKNB 1VCOA 4EKIA 4B84A 4GKBA 4L5IA 1Z5GA 1DJMA 1JLSA 3MRXA 3II6X 4G1UC 4AQYB 3OFNA 3AHIA 5LLDA 4WNYA 3HDTA 3U3RA 3CLSC 1N8NA 1P4HA 1RRKA 2AMFA 4KH0A 3E7DA 3U4AA 3VNSA 1FPQA 1LA2A 4BMDA 4YMLA 2QJTA 2OMKA 3FCCA 3NYRA 3FYUC 4UBJA 4HN2A 4XOUA 5BQFA 4D0SA 1Q1AA 1TI7A 2JGEA 5EZYB 1W8IA 4LMPA 1GL3A 3GF4A 1YL7A 2PH3A 2IYTA 1NKVA 3T5DA 4ARSA 3PGJA 1NVUQ 3PHGA 4BV2A 2BFDB 2ZIEA 4UNPA 5I8ZA 4EKEA 1H0HA 1ST2A 2O20A 4TUYF 5T3UA 5IT5A 4MW5A 5JJ5A 2W0SA 4B43A 1ECFA 1PJQA 3THXA 4O8ZA 4E0BA 4HOYA 3AVYA 2OTCA 2H1LA 4HRVA 4RKYA 1XZAA 5F3DA 1VG8A 4WD3A 1D2AA 2IEIA 4E22A 1JQ3A 2F9FA 1XEWX 2G4LA 1C0IA 2HA2A 2QQGA 2DPLA 3B8EA 4P2BA 3ZIAD 4DJJA 5KTMA 3DONA 5GWXA 3WY9A 4IIFA 2XMBA 1HI9A 2XUOA 2IGTA 3MAAC 3P32A 1RYNA 4HDRA 2AFHB 4UE3S 4FFLA 4DCCA 4DLSA 2H9AA 2QZSA 1COWA 2VDRB 4M9SA 4RDCA 5HDBB 3OZVA 3UAYA 2C5SA 4N7BA 1YS1X 2XQGA 2JLAA 1BSVA 1K08A 2FX3A 2VRBA 4EMTA 1U9CA 1PJRA 1GNLA 2AS0A 4RZIA 5SY6A 1OI3A 2NIPA 4KPUB 3GUHA 5JYEA 4Q12A 1JPVA 1QLWA 4TLDA 5DM1A 3PTLA 4I6JA 2D4HA 3T4UA 1CJUC 5BW4A 1FP7A 1ZEMA 5K4AA 1MV5A 5EC8A 1DXOA 1ZBQA 2DMRA 3LQRA 1S2DA 1TYBE 4IQFA 3S3TA 1NJGA 1SZDA 3O8QA 5EFZA 4A2QA 3RUHA 4ZI3A 2AG8A 1WXXA 1X77A 2V9CA 2W6MA 2Z2XA 3E3NA 3ZNQA 1OYWA 4BGIA 3EWIA 5F1OA 4C05A 4F6LA 1JKFA 1L4HA 3OEWA 4ITRC 4LYFA 3DD5A 1JEDA 3LU1A 4JOQA 2FTKE 3K6SB 3DB2A 1ZGCA 1KKUA 1GV1A 4G5HA 2RK4A 5ECYA 5D1NA 3Q0EA 1NXWA 4J16C 2C9ZA 4XFJA 3A27A 3PIIA 4OHBA 3EVDA 1GZ4A 1NDUA 5I6DA 1GAEO 3KSAC 1GFIA 4JENA 4TSKA 3U3JA 1XZMA 2XMDA 3KB2A 4RNDB 1JR6A 4RHFA 4BE7B 5I9LA 4O1HA 1NQXA 3UJCA 1CT9A 3CTMA 1E0JA 4IVPA 5HIAA 3GDWA 5AUPB 1C7JA 2VOEA 4K2AA 1C7RA 2FY8A 3G88A 3KFVA 4QEKA 1TYDE 5GZ3A 3TUZC 1Q15A 1T0JB 3ED1A 1CFJA 1T13A 2I03A 2DX7A 4J7CA 4IWXA 3T1NA 3Q7SA 4F92B 1JMVA 1GPYA 4PRZA 2VT2A 1YQWA 3U17A 3UJDA 4E03A 1DQNA 3FDXA 5AUQA 3EXHB 4WV3A 4X64B 3DMPA 4ZU6X 3WDLA 5JNTA 5KPJA 4JCOA 5B1IA 1TYAE 3RT7A 2QT0A 1AG9A 1K5PA 1KAHA 2L17A 4KIWA 3VMFA 3C39A 3NALA 3IV7A 4GI1A 3ZHVA 1C7EA 1TTPB 3OQNA 2BOVA 1HL3A 4MW1A 1JQKA 1K7SN 2B5OA 2H6EA 1IZ7A 3HR7A 2HO4A 2XMGA 3JPWA 3JD1A 4FHCA 4LC0A 4UAJA 4UVIA 3VU8A 5HUJA 1F2UB 1UPUA 1VIDA 3KSZO 1IHYA 4UQPA 4Y2VA 1T43A 1VPLA 1ZGAA 3FMGA 2GD1O 5H81A 2AEEA 5CXUA 3QW4B 3GLHE 5IF3A 1D8TA 5KOYA 1QO9A 4UUPA 3DM9B 2IHYA 3JQ8A 5DB4A 1NVWQ 3GP3A 4YAJA 1U7TA 1P4AA 1YDWA 3KZXA 1DKQA 5FPPA 5I9MA 3ZN2A 4DTIA 5AKEA 4F71A 5ES4B 1SCNE 5IG2A 3T95A 1QFYA 3CNNA 2Z6AA 3SZGA 3VOAA 4UZSA 2ILTA 1RRPA 1THZA 3DTTA 3SQDA 3O0DA 3NAGA 1PJ2A 3MD9A 3HXPA 2BRUC 2FMUA 2OO3A 4N4AA 4RXUA 5BQPA 1PKEA 4UQLA 4DLXA 1MF7A 5KQRA 4QUIA 4HQ6A 5FLKA 4D9IA 4H7KA 4GD3Q 4NOMA 1AK2A 4G9BA 3MJVA 4W9NC 1M1ZA 5HFNA 3WLJA 4CMEA 1LNZA 4ZEVA 1L5YA 1OROA 2OLEA 3GK3A 4J0IA 5ESXA 3ZYCA 4NEHB 4BLQA 1PYDA 4UM5A 1QF6A 4TZTA 1GCGA 1X9IA 3P0JA 2XOEA 2EFYA 3M34A 3P2YA 2NZXA 5FOTA 1JWAB 1GA4A 2FF7A 2WFZA 3KR1A 4KFUA 3G1UA 3D5TA 2RGGA 4M9XA 2BTEA 4GYKA 5EKUA 3VC7A 3WLNA 1LNQA 1Y1PA 1K7XB 4D4LA 1B8UA 1WULS 4KIUA 4OJYA 5I9IA 1KEKA 3JATB 1Z0KA 4D9MA 3LP6A 1SB8A 1NF9A 4LVOA 4PAOA 2OGZA 5IJ0B 1AZLA 3FRJA 4LNHA 1J21A 4K1LA 2FPWA 3USES 2Z83A 4OSEA 3EVAA 4BO2A 4GOMD 4LXYA 5EQTA 3M6XA 1W6UA 5GVSA 4QGHA 5I7SA 1CDOA 2H1VA 2V7GA 1E7YA 4ZJUA 1KR5A 2V7EA 4BQFA 1X9GA 3EARA 1MLDA 2D8AA 3HHEA 3D8UA 3PE4A 3DH0A 3SC6A 2CCJA 3BJIC 1SKYB 3A4LA 3MGGA 2QTVB 4N65A 3STUA 1FIUA 5E9JA 5LMCA 4CR6A 3DVQX 1FDOA 2AVNA 3FYUB 3O03A 4A5OA 3FTQA 4NIMA 1Y8RB 5KQMA 4K0KB 2NMVA 3BWXA 1J42A 2RH5A 1LPOA 3E3LA 4BFSA 4NY1A 3QJYA 2ADOA 2D59A 1MDBA 1T36B 2GO7A 3RVLA 4Z9YA 3VGPA 3JSAA 4J0DA 4CFSA 5KSZA 1Z74A 2ZIZA 3N0XA 1CV2A 1GD1O 3AHFA 1S8OA 2OBFA 1GKLA 2RAUA 1IG3A 3RQSA 4B79A 1UL1X 2Y1FA 3LKDA 3UUGA 3OWXA 1HLFA 5F5LA 3QIVA 3G0DA 3KAKA 4Y3UA 1Y33E 2QUHA 1O94C 3JAKB 5DHSA 5J58A 2BGTA 4Q1FA 2EOAA 2IPOA 3MS2A 3OP4A 4RZUA 1TM2A 4GKJB 1I24A 2HMVA 1UBJS 1AUQA 1BD4A 1Y9JA 2CB9A 4D56A 4LJ9A 1UJNA 3AIMA 3DUFB 2YRXA 3A04A 3MCAA 2Q4RA 5DWQA 1ZQ1A 5E7IA 5FOVA 4F96A 1IZZA 3EXHA 1UC8A 2PKQO 1I33A 2AJTA 2ZB7A 1FDWA 1Z56C 3PFKA 4OFBA 4E2YA 2VYND 1D9XA 3K2QA 1RCFA 1PF7E 1CR1A 4XQ9A 2GN6A 4MIOA 3L40A 3CX6A 1MNQA 5HS6A 3Q2IA 5LQAA 1CIPA 1E20A 3RHSA 1CJVC 4Q7LA 2UXCB 3NWEA 1SG6A 3KKPA 4QX6A 2D2FA 2JW5A 4TTQA 5J4YA 1VDMA 1JDJA 1LZKA 4UCQA 4WHMA 4KQXA 1C7IA 1VSQA 4Y2GA 1F2UA 3PHHA 5F21A 1NFRA 3W4KA 4COKA 2CBGA 3OKAA 4BVJA 4TV9A 4YYZA 2ZJ0A 4PZCA 3RU9A 1GCAA 1VCHA 4M60A 2ORYA 3TSCA 4IDQA 5TQJA 3GV0A 5CDHA 5KB3A 2WP0A <