1EFKA

Structure of human malic enzyme in complex with ketomalonate
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
553
structure length
553
Chain Sequence
b'IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALIC ENZYME
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure of a closed form of human malic enzyme and implications for catalytic mechanism.
pubmed doi rcsb
total genus 185
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2000-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1efkA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1efkA01
1PJLA 4LCJA 3BZUA 4CQMB 1C14A 2CVQA 3O38A 1DFHA 1XDWA 3F5QA 1OC2A 1NQOA 1RPNA 5THKA 2V6MA 2FSVA 2PZKA 3H9QA 3F46A 5CP8A 2FHSA 2QYSA 4LGVA 1NX6A 1QYXA 3BTOA 5JPIA 3PEFA 3PYXA 1Z45A 4D44A 5DULA 2PD4A 5DBGA 3WX0A 1CYDA 2V7PA 2VHXA 2JHFA 1NQAO 2P5UA 4RO0A 3B1KA 1MC5A 1QV6A 1DRWA 3AUAA 2GO1A 3IP3A 3DOJA 3W4JA 1D7OA 3RUHA 4B7CA 4C7KA 2HQ1A 4MVJG 1LRKA 3ZWPA 1LSJA 2GERA 3AUSA 4DLBA 3PIDA 1DLIA 1EE2A 1R4NA 1U3WA 1V3UA 1YB4A 2ZYDA 4ZGWA 2QRKA 3GAZA 1ULUA 3CPSA 1LSUA 5JC8A 4OJNA 5AVOA 4CLRB 2ZJ0A 1RJWA 5FF9A 1HE5A 4NMHA 1U3VA 1VC2A 3DL2A 3OJOA 4MVJI 4R4JA 2W98A 1IZ0A 3GGOA 4EI2A 4MVJP 5EL0A 4OSOA 4L74A 2ZYGA 4OIMA 5HS6A 1X15A 2X7HA 1I24A 4IDAA 4JBGA 3TJRA 1ZH8A 4B7UA 1FMCA 4FIZA 1R4MB 1ZUD1 2E37A 4YJDA 4CMBA 3TOZA 2AQHA 2YV2A 4CM6A 4NBWA 3NDJA 1LEHA 4S3MA 1GUZA 4E32A 1HKUA 3DZGA 1XELA 4AJJA 2OBNA 4BNTA 2DTEA 4YEDA 3AU9A 2DC1A 4YJHA 2J6IA 5KTKA 1YBMA 3H9UA 5A9RA 4J0FA 1OAAA 3OECA 2VOEA 3JQDA 4YBZA 1GV1A 5A5FA 3U62A 1JAXA 1YJ8A 2EHDA 4R9SA 1VM6A 4E5YA 1P3DA 1VL6A 1EQUA 4FJ2A 2PLAA 2DUUA 5CG2A 3GVXA 3UGKA 5JDIC 1ZVMA 4OXKA 4PVDA 2FSSA 1KY5A 4DQVA 4FFRA 2NTVA 5IZCC 1GQQA 1HYHA 3ADPA 2CNBA 1ENPA 1PU2A 1NVMB 2X23A 2YV1A 5KVVA 1IHYA 2X9VA 5F5NA 4CR8A 5EINA 1YXMA 2UDPA 5EERA 1E5LA 4RL6A 4KUEA 1PL6A 4GAEA 1I2BA 4U5QA 1B8VA 1ZMTA 5L95A 3ROKA 2BELA 1HZZA 3DDNA 2EJVA 3H4VA 5TIIA 5HS4A 3AY6A 2Z1NA 2R2GA 3FBGA 3P19A 4XZ3A 4ITUA 5I7EA 3BHIA 2WD8A 1PTJA 3JTMA 2GPTA 1PIWA 3JQFA 4F3YA 2NWQA 2ZCVA 1YKFA 2QW8A 4MKXA 3K5PA 4Z3DA 4BO9A 1N92A 3PQEA 3CTMA 1QV7A 1F17A 4DA9A 1LLQA 3JQ8A 1DC5A 3H6KA 2SCUA 3RD5A 5ICSA 2H5LA 2CUKA 3X2EA 8ADHA 3K92A 3HWRA 5DNAA 3T4EA 1BXGB 2I3AA 4K6FA 1XU9A 3ZDFA 4DPLA 4IMRA 3ANLA 1VPDA 3QHAA 3FF4A 1DFGA 2QQ5A 5L45A 4CQMA 3E82A 4Y6PA 5C7IO 2BI7A 5BSHA 3VPFA 1IL0A 1UXJA 3F3SA 4L4XA 1NVGA 5ITWA 4DLLA 1J4AA 4BQRA 5DCUA 1X1EA 1HWYA 2YW9A 3HSKA 4Y98A 4BNHA 3HDJA 3VH4A 3HB4X 1OFGA 4NHEA 2G76A 5J23A 1R6DA 2Q4BA 4D3DA 1FDSA 4W6ZA 4BNIA 2JFFA 1E3SA 4WCFB 1K89A 5K0ZA 3LLVA 2HMUA 2XAAA 4YT5A 3U3XA 4D79A 2BLLA 2NUAA 4IPTA 2EV9A 5CAEA 2Y0EA 2FZWA 4CR7A 5G2OA 2Y1OA 2DTDA 1UZLA 2Y1GA 4TWRA 1O6ZA 2I6TA 3LC1O 5EN4A 4WOKA 1TT7A 4BIIA 4YDRA 3K9QO 4A26A 3R1IA 4F6LA 1ISMA 1E3WB 2GUGA 4HFNA 2OFPA 3C1AA 2G1UA 5TS3A 1I3MA 1EK6A 1HE2A 3AU8A 4JP2A 2DAPA 3ADOA 3AW9A 4O0LA 4R68A 5I8WA 4XQCA 4XWYA 1NHGA 2OXIA 4JNKA 4P4NA 3MTGA 4MJLA 4UUPA 3VC7A 4EJ6A 3A1NA 3CKYA 1YDEA 4GPD1 3LT0A 4OKNA 1G1AA 5ILOA 1N9GA 2OZPA 2Q2WA 5T6BA 3GG2A 3NDIA 3FWZA 2O4CA 3AY7A 3PLNA 4L73A 3WIDA 1DDOA 1DOHA 1YGYA 3O9ZA 3VH1A 1EK5A 4CR6A 4PLPA 1T4BA 2B4TO 4JLWA 2GCGA 5F21A 3ONFA 3RC9A 2O3RA 5HBRA 1NWCA 3KSZO 5DT9A 5KKCA 4BGIA 2ZYAA 1XWFA 3RFTA 1LQUA 1V3VA 4IMPA 4R69A 3SX2A 4BKOA 2IE0A 1WDLA 5HA5A 4NFYA 3K2BA 4P4LA 3KYDB 4DGSA 5KIAA 3MZ0A 1QKIA 1WW8A 1YQDA 5CDSA 3INTA 4KP7A 4CLDA 3KBOA 3WWYA 4DPKA 3WSVA 4ZQFA 1HDXA 3UICA 1BSVA 4BNWA 4WLOA 4RVGA 4WEOA 2X58A 5LCXA 4Q39A 3VOSA 5CPFA 1W6UA 3KLPX 2O3QA 2OORA 4PG7A 1P1KA 4OAQA 4XJTA 3RU7A 1ZK2A 3DBLB 4HUJA 4YQYA 4R1UA 5AXBA 1P0FA 3WS7A 3IIEA 1F8GA 4ND4A 2AEJA 3V2GA 1WWKA 1JAYA 4LSWA 3AFNA 1NP3A 1SBYA 4D41A 5GZ3A 5I9MA 4J4BA 4CODB 3HFGA 1GQ2A 1O8CA 2YDYA 4TSKA 2GYYA 4BNGA 2PKQO 3NTOA 1CIVA 1GTMA 3LC2O 1FDVA 1G0NA 2RBEA 1EUDA 4CL8A 4CV2A 1A9YA 1P0CA 4NU5A 1DJNA 1H6BA 2J8ZA 3EHEA 1E1KA 1FDUA 1H6AA 3GMDA 1T4DA 1TXGA 1UDAA 4OKIA 1L1FA 1YS4A 3B1FA 1JVSA 2P4QA 4BNMA 2P9EA 5DP2A 1A71A 1V8BA 3FI9A 1HLDA 4L9RA 1BXGA 2DTXA 2HO5A 3G1TA 1DRVA 4QECA 1KVSA 3ZWAA 2ZTUA 3K2EA 2PWZA 2X9NA 3NJ4A 4W9NA 3ZWVA 2I9PA 1CDOA 4XA8A 2VZ9A 3AOGA 1D8AA 3RFXA 2P4HX 2JHGA 2Z1MA 2IYOA 3A28A 2QYTA 2EJWA 3D3WB 2ZIZA 3GEGA 5ER9A 4DMMA 1MA0A 3PVZA 4XR4A 2IRWA 4AJ4A 3OJFA 3KUXA 1WMBA 1LA2A 1MG0A 1PL8A 2W2KB 4BO3A 4AJLA 3I9OA 1Z73A 4IDGA 1HE3A 3CMCO 2J5QA 4J6FA 1GD1O 1HETA 3RBVA 3OJLA 4FJ1A 4GSLA 1U2GA 1Z82A 1CJCA 1PQUA 3PYMA 1UR5A 2GLXA 3QWIA 1GPJA 4GX2A 1H6CA 1HDYA 2ZKLA 5CDGA 1UXKA 1F14A 3D0OA 1N7GA 2FPIA 3FBTA 4RPJA 4DTIA 3CEAA 3WGQA 5A9TA 4ZHSA 5IZCA 1SNYA 5T57A 4UEJA 1MFPA 2C7GA 2P68A 3ABIA 3UUWA 1RWBA 4KWHA 2OO5A 4BNUA 1BRMA 1DBVO 1LBEA 1MLDA 2FMUA 4I9UA 1ENZA 2G5CA 1B16A 4ZQEA 4AICA 4LISA 3SJ7A 4A2CA 3L77A 1U7HA 3PPIA 1PWZA 5JDIA 1PEDA 1GEEA 1E3LA 3HZZA 4E2XA 4ID9A 4GX5A 3WGGA 2PKQP 3T7CA 3HFSA 4UUOA 4ZVVA 4CM3A 3WGTA 2DLDA 1M6HA 2C59A 5A9SA 2EKQA 2V6GA 2VCYA 3FWNA 4DUPA 4WLVA 5JAMA 1E0DA 4FCCA 2NVBA 5U4QA 4QFCA 2Q1WA 5G4KA 3B6ZA 3EMKA 1ISHA 4RPGA 5T5QA 2QG4A 3O26A 2J5RA 4RQTA 3E48A 2Y1FA 4FFPA 4RPKA 1HRDA 3GG9A 3KVOA 3WDSA 2QZZA 1OC4A 4IUYA 3NKLA 3L4BA 3OJ0A 3VZRA 3U4HA 4YAIA 1SC6A 1LDGA 3GZNB 1RM0A 3ZU3A 3B1JA 5U1PA 1JKFA 3I9MA 1GAEO 1E7RA 4NG5A 5H81A 4YJFA 2VOJA 3PHJA 3JD4A 4BUCA 5I9LA 1WZIA 5DBIA 1PZFA 1XKQA 4JCOA 4WGGA 2NVUB 4CQLA 5C37A 2DBRA 3KXDA 2PD6A 3EUWA 1H94A 1CERA 2O3TA 1U8FO 3O8QB 4HNHA 2ZB8A 4NBTA 1CQIA 4XB2A 4NFSA 1R66A 2EWMA 3W8EA 4MIYA 1NPTO 2Q99A 4AL4A 2OBYA 2JD2A 3QWFA 5A04A 2DFDA 3C1OA 3ZGYA 4EW6A 2EXXA 3GVPA 2DQ4A 1N8KA 3DBRA 3TWOA 4WNIA 4HP8A 4HXYA 3IOYA 1ADBA 1P74A 3B70A 3DHNA 1DIAA 2R6JA 4M54A 3FCOA 3H9EO 1MV8A 5B4VA 1NFFA 5CG1A 1NWHA 1W8DA 3GZ4A 3ZNQA 4R41A 1YBAA 1NXQA 2X5JO 4LCEA 5CDYA 1HTBA 4B4WA 1IUKA 2AE1A 3F1KA 3S55A 3DB2A 1LLCA 3FTNA 2ET6A 3ZV3A 4BNKA 2J3JA 4XDZA 5FWNA 1W4ZA 5THQA 4LMRA 3TRIA 4BMSA 3L6DA 3RC1A 1J0XO 1QMGA 3G0OA 2X5KO 4XB1A 5TT0A 1OOEA 1P1HA 2UUOA 5IDWA 4D42A 1A9ZA 4GSKA 3MJEA 4YT4A 1Z6ZA 3RKUA 4HFRA 4NR0A 3AI1A 1EE9A 1DAPA 3IS3A 2Q1TA 2Z95A 1CWUA 3DMTC 5KJCA 3DAGA 1PQWA 5EMHA 3DFZA 4M1QA 1VL8A 3V5NA 4L76A 4MVJA 2GN8A 4PLYA 3H5NA 3QIVA 4EUHA 3GMSA 3WQQA 5JXWA 1GZ4A 1C0PA 1HLPA 2Q49A 4OM8A 2B69A 2GR9A 3DBHA 3OMLA 3FPCA 4MPDA 1IB6A 4U6QA 1JA9A 1H93A 4ZD6A 4UULA 2VUUA 1KVUA 4HY3A 4BS9A 1PJ4A 5KJ6A 4OGWA 4YQZA 4FBGA 3DC2A 2RAFA 4CMIB 1GU7A 5ENVA 2I66A 1ZK0A 3OQ6A 1HF3A 4CM4B 4Q3DA 1K2WA 2OUIA 3BIOA 1XIVA 3HDHA 3TPCA 4BVAA 4IBOA 5G0VA 2XXJA 3FN4A 4DIOA 4A5OA 1DHTA 4J9UE 3U4CA 3F4LA 3ZHBA 2XPCA 5JAIA 2C2YA 2VYVA 1M67A 4FFLA 3ENKA 4XYEA 5LC1A 4XGIA 2PZLA 4MKZA 1PSDA 2E48A 4IGFA 3H3JA 3UXYA 4BV9A 5MDHA 1E3IA 3AM5A 1ZBQA 3K6JA 1CRWG 4CLOB 1TB4A 4CMEA 3KLMX 1XHLA 2PZJA 1Z75A 3PJEA 1Y5RA 5KJFA 1UXHA 1Y8RA 2BFMA 4PCVA 3NJ8A 4EJ0A 4PZDA 3PDUA 3QVSA 4OXNA 3VZQA 1PJCA 3QWAA 3RC2A 4ND3A 3PQDA 3K96A 1H2BA 4IQ0A 5L9AA 2AQ8A 3AUUA 3DQPA 5C3MA 5U9CA 1R0SA 4TKMA 2W2LD 3ZHXA 3ZWNA 2ZK7A 5BNTA 5IFLA 2PH5A 1QYDA 3PGXA 5CEJA 1NAIA 2DPGA 3SEFA 1N1EA 4BL5A 2O3UA 4HNGA 4YWJA 3L4BC 1PJ2A 3F1LA 1NFRA 1YH3A 3GQVA 4IDBA 5CDTA 1U1IA 4E33A 9LDBA 1N5DA 3ITKA 4PFJA 3DTYA 4BMVA 4DIFA 1IY8A 4UVGA 5G0UA 4D43A 1EBFA 1QYCA 1YRLA 4R9RA 4B8WA 4RF5A 2Y99A 2JD0A 4FC6A 1MXHA 1QXSA 1LJ8A 1DC4A 4S1VA 4CLXA 5AQ1A 1GY8A 2HRBA 2PR2A 4R01A 3DBRB 4ZRNA 3VPXA 1ZK3A 3Q3CA 4GL4A 4E5MA 4DC0A 3ZWWA 5A1TA 1IOLA 4R3WA 4BO6A 5KNLA 5TX7A 1G6KA 3NDRA 2NVUA 3R0IA 4XYMA 5EJ2A 4DPMA 1ZSVA 3RVDA 3IUPA 1ARZA 1DSSG 3DR3A 1JWAB 1GQYA 1HEUA 4II2A 5JDCA 3I4FA 3H8VA 2F1KA 1QYVA 1NAHA 1NQ5A 5DCWA 3GDFA 1PGPA 1RM5A 3D3WA 4YRDA 2Y0DA 3WFIA 5MGBA 3KETA 1K6XA 5EPOA 1VE9A 3PK0A 1EDOA 1ZJZA 5IAAA 4GLLA 4K9DA 5JCJD 2JCVA 2W2KA 4RPHA 4FC7A 3DWFA 5A4DA 4KQXA 3R6DA 3KEOA 3OEYA 1UDCA 4CM9D 1UH5A 2QRLA 2EW8A 3RJ9A 3GFBA 3BAZA 3FD8A 3LC7O 2FN7A 4BNYA 3KTDA 4ALNA 1SB8A 4GI2A 4RORA 1A5ZA 3GGPA 4CJXA 3MWDB 1U2DA 1ZEJA 3CSDA 3I1JA 1NR7A 3RASA 4TRMA 3WBBA 2OGUA 3JQ9C 3HNPA 5B1YA 1PJBA 1JW9B 4JGBA 4IQGA 4OOFA 2FY8A 2NV6A 4IIUA 1ORRA 4OL9A 2VZ8A 4NFHA 1GV0A 4P4GA 4J9VA 1U4OA 1DRUA 3GNSA 3BMOB 3NRCA 4J1QA 1MP0A 4MVJE 2Y0CA 4BNFA 4EEXA 5AXAA 4BO1A 3V2UA 4MOWA 1FK8A 3FTPA 4CM1A 4QTZA 3BMNB 4JP3A 1XYGA 3TZHA 3E9MA 3OIFA 4JJFA 4I8XA 4QQRA 4RV9A 3AJRA 1DAOA 2WYUA 4J4TA 4KOAA 3AY3A 5IDYA 4G2NA 2FR8A 3H5AA 4O6VA 3T4XA 1TT5B 3FSRA 2ZB4A 2Q2VA 1I3NA 2V6FA 3MCVA 1MXFA 3JQAA 4GBJA 2C5AA 3NEPX 4YJGB 1L7DA 1LX6A 2Y93A 5JMWA 1LDMA 2P2SA 1XQ1A 2POQX 4WECA 1AE1A 1UXGA 2WJPA 4D3SA 2G82A 5ES3A 4KMSA 3PFFA 3DBVO 4JBIA 5ITVA 2C29D 3P7MA 1YOVB 2DFVA 1O94A 2X0IA 3E5MA 1B3RA 3Q9UA 1D4FA 1B3BA 3GZNA 3OIDA 3EY4A 4BNNA 3H2SA 2RHCA 4TQGA 1K6IA 3I9KA 4CM4A 4YJFB 2W2LA 2BRUA 2HK8A 2X8LA 3EVNA 1F8FA 1A72A 4PLWA 3WG9A 3RBZA 2RIRA 3ASUA 2AW5A 3TSCA 1LSSA 4L8VA 1GADO 3RCBA 3QP9A 4BNVA 4PLCA 2EKPA 4OHUA 2I3GA 1M75A 5FYDA 1LSOA 4NZ9A 4W9NC 2X0JA 2IEDA 3FPLA 3ZWBA 4BNJA 4XD2A 2O48X 5B12A 4GKBA 4NDNE 4IXWA 3DAPA 1LLDA 3D4NA 1DEHA 1Q7CA 1U7TA 4UVIA 2BHLA 4RZIA 4XEHA 3D64A 4XGNA 3RROA 5JAZA 4Z0TA 4A7PA 1JWBB 2VHWA 3KO8A 5JAQA 4CMCA 1BW9B 4RVFA 1NTOA 3VTFA 1PJSA 4LVUA 4WK6A 3WIEA 1AHIA 3NGLA 1DPGA 3OEWA 4UUMA 1XGKA 2HU2A 4CMEC 3KRTA 4A03A 5JW6A 1MUUA 3RUAA 1EVJA 4KDEA 2VWPA 4NJMA 1XA0A 4AJPA 1ZKMA 2DBQA 4L4SA 3QVTA 2FWMX 1BVRA 3R3SA 4PG6A 5JCJA 2BFAA 2NQ8A 3DZIA 2AQKA 1NR1A 5TRTA 1KVRA 1E7YA 1H2HA 3N58A 8LDHA 1H5QA 3CMMA 3WQSB 1E6WA 5KVQA 2YHUA 3AI2A 5KCZA 1PWXA 1ZXBA 4IJKA 2I99A 4M55A 3RUFA 2YFHA 3JQBA 1LDNA 1OI7A 2CFCA 4KTTE 3ROMA 2Y05A 3WOHA 4Z0HO 4DQXA 1GL3A 2O7SA 3LVFO 4CQMD 1WPQA 2VZ0A 4XRRA 1FF9A 3OQBA 2D4AA 4DC1A 1V3TA 4IJWA 3IC5A 2DUWA 4MDHA 3RSHA 1UP4A 3TOXA 2ZATA 1B7GO 4BO0A 4RCVA 4B8ZA 2JL1A 5L40A 4AJHA 1EVIA 1Y5MA 2WWRA 2EG9A 2DBZA 3LK7A 4BB6A 5JE8A 2A35A 2WM3A 1ID1A 1LDEA 2NU8A 2VTDA 3DZJA 3W4KA 4TRNA 3RUCA 2UVDA 1P9LA 4GVLA 4U0JA 1O0SA 3DBHB 4FGWA 1KC3A 3ZCXA 4NH4A 1SAYA 1P1JA 3WTBA 3ZWMA 5I7VA 2XF8A 4LMPA 3SXPA 4O1MA 3VH2A 1ZSYA 4CPDA 2FP4A 4XX0A 1SEPA 4N7RA 3ZU4A 3ZWOA 2VYND 1IZ9A 3LSYA 4W4TA 3UAGA 2X5OA 3BYZA 3A9WA 4TVBA 3ICPA 2W8ZA 1E6EA 2WMDA 1O9BA 1NYTA 1UJMA 2PV7A 5AXDA 2RH4A 1QLJA 4BO8A 3IKTA 4GWKA 2IEBA 4R1NA 4FJ0A 5EQFA 3JQEA 1PGNA 1E3WA 2OMEA 1E7SA 3DOOA 4XQEA 4PIVA 4WLEA 3OICA 5F1PA 1PR3A 3A14A 3GHYA 1B0AA 3GAFA 2IODA 2VTEA 2XXBA 3HG7A 1TEHA 2QIOA 4DVJA 1GYPA 4DBVO 3GN1A 3EGOA 3W6ZA 3UCEA 2IXBA 4AJNA 2BGLA 1E3JA 4CLOA 5JBIA 1I10A 1DC3A 3IUSA 3KYDA 4TKLA 3NT5A 4QX6A 4GGOA 2VUTA 4M8SA 2GASA 3PWKA 1UZNA 5JLAA 3UW3A 1BGVA 2CSUA 4YB8A 5AYVA 4EGFA 3UCXA 4Q3EA 2YHIB 3ETGA 4BKUA 1X0XA 5KVCA 2BF7A 4I9NA 4RVUA 1PL7A 2OHXA 2H6EA 4W99A 4H7PA 4XQ9A 4INAA 4ND5A 3COSA 4YAKA 3CIFA 2O7QA 1YO6A 2DVMA 1DC6A 3M6IA 2GNAA 2I76A 4TROA 4YJGA 1PS0A 4G81A 1B14A 4LSMA 3Q6IA 5TC4A 3VKVA 2GGSA 4IQ8A 2P91A 4CLHA 1ZCJA 1YL7A 2WD7B 2PD3A 4H15A 4HWKA 5ICMA 2Q45A 2BD0A 2V6BA 1YQGA 2EP5A 4N5LA 1KETA 2O2YA 2BMAA 4YTEA 4CLRA 4L4RA 2V65A 3H65A 1Q7GA 2EW2A 1ZXLA 3NT4A 4TRJA 2GD1O 2B83A 5IN5A 1Q2XA 5COQA 2VWQA 4YAGA 1OZAA 4U0KA 1HSOA 1O89A 3L4SO 4I5FA 4ALKA 4IGEA 1C1XB 3C85A 3KSUA 3Q2KA 1T26A 2BKAA 5ENDA 3HDQA 1R4MA 1X14A 4QO7A 3VDRA 2UUPA 3O4RA 3SLKA 1IYZA 2E82A 4WCDA 4Z9FA 3LT1A 4MP8A 3PP8A 2Q2QA 1PZEA 2HMTA 2P5YA 1G0OA 4M86A 3ZV4A 4Z6KA 5A3JA 4AJOA 1DJQA 2D2IA 2P9GA 4YYZA 3W1VA 3L9WA 3VVBA 2C20A 3EK2A 3KZVA 1L7EA 3C7AA 4M87A 4A0SA 1JQBA 3WYCA 1C1DA 4FR5A 1LUAA 3PJFA 2D3TA 4QSMA 3UVEA 1EBUA 5L7WA 2HK7A 4XQGA 5DDIP 3NX4A 3D4PA 3ORFA 5K6AA 1E1LA 1X13A 2IZZA 3RUDA 3V2HA 4K6CA 3ICCA 3OIGA 1H6DA 1S7CA 3C7CB 3LYLA 3QWHA 1X7GA 2Y1CA 5FEUA 5IZ4A 2TMGA 3ZWCA 3OSUA 3H9GA 5ILGA 1QSGA 3LDHA 4UVEA 4B4VA 2Z5LA 4WE3A 4CV1A 2TMDA 3G17A 2A4KA 1DHRA 2PNFA 5HRUA 4WUVA 4P38A 4GGPA 1XU7A 3ANMA 4IINA 3WSWA 4IJUA 1WZEA 4E2YA 3DOCA 1NM5A 4R1TA 3OJEA 3ZW9A 1A7KA 1ONOA 3RWBA 4H3VA 3HN7A 4FD3A 4WLNA 3WTCA 5BSFA 3JQFC 4UEKA 4U7WA 3IAHA 1A4IA 1I3LA 2FRDA 2DBVO 3FNFA 1T24A 4D0RA 3SVTA 5GZ1A 3QVOA 5AOVA 1UP6A 4JQCA 1M6WA 1DXYA 1SEVA 3PXXA 4RGBA 2JKVA 1WVGA 3OA2A 4ILKA 5TNXA 3EZLA 3LZ6A 2CD9A 4E2WA 2X22A 3GN2A 3ETDA 1YL6A 4ROSA 4A10A 4CMKA 3KV3O 1I2ZA 1VL0A 2BFPA 3IMFA 1BG6A 2B37A 3GT0A 3U9LA 2ZTMA 2PH3A 2PZMA 5KVSA 4Q3BA 4YVFA 5JY1A 5JS6A 2HK9A 3OH8A 4JJIA 2WDZA 5BSEA 5C7OO 3JYLA 3JV7A 3PJGA 1HDGO 4XR9A 4R51A 3U5TA 4NK5A 2GSDA 2NACA 1P1IA 3IQDB 3GVCA 4BGEA 1KOLA 1ZK4A 1Q0QA 4JK3A 3RFVA 5BT9A 4GMFA 3K30A 3MEQA 3P2YA 3RBXA 2D5AA 3PWZA 4EBFA 2B4RO 5JMPA 1MG5A 3B20A 1BXKA 4FOSA 4Y6SA 1B8PA 1K3TA 5CEEA 2QRJA 1SCUA 1S6YA 1P31A 1R0LA 1SOVA 1AXGA 2PGJA 1EVYA 4UEOA 4I5DA 1LNQA 5JY6A 1XSEA 4Y8VA 1JVBA 5AXCA 3UF0A 4BB5A 4G5HA 3I6IA 4NBUA 2CVOA 2JFHA 4RVHA 4FSHA 1I0ZA 2PK3A 3TZCA 2BGKA 3D7LA 3MWEB 3E9NA 5L3ZA 4J2HA 2B0JA 3MJSA 4ALLA 1GDHA 1PJ3A 1YB1A 1A27A 1U28A 1Y1PA 3AUTA 4MO2A 4CM9A 3Q9NA 2YYYA 4XIYA 4ZQHA 1IULA 2UV8A 4D7AA 1LRLA 1T25A 4F6CA 4OOEA 3ZN2A 3V1TC 1JKIA 5KOIA 2NU7A 4B3HA 4CQLB 2J3HA 1I36A 1T2FA 1V0JA 3ROQA 2HMVA 2Q3EA 4OQYA 1AHHA 3ONDA 1WMAA 4JX8A 4YT8A 3DZFA 1SO8A 4DYVA 1FXSA 4ZRMA 2WD7A 2B4QA 3Q0EA 2X4GA 2Y68A 3WGZA 3AFMA 1UP7A 3BXXA 4KZPA 4ND1A 1B26A 1ZW1A 1QRRA 4PZEA 3MJ4A 2VT2A 3QQPA 4DXHA 3D1LA 3MTJA 5IJZA 3JD3A 3QA9A 5F5LA 2VHYA 4II3A 5KJ1A 1U3TA 1UZMA 3LLSA 4P8RA 3L07A 4C7JA 3VPSA 1P1FA 2O3JA 1HDZA 2GZ2A 4OH1A 2AHRA 2JCYA 1R15A 3RU9A 3WGYA 2W90A 1KS9A 1WDMA 5L7TA 3JYQA 4XKJA 5JYEA 1C0LA 3E6AA 3DO5A 4EJMA 4DBZA 2D0IA 4YR9A 1D1SA 1EUCA 1ZNQO 3GVHA 3RUEA 4HADA 3CXRA 1YOVA 2OL4A 3PIIA 1SOWA 4BKPA 4K1LA 3JYNA 3U49A 2NU9A 4RVSA 3CZMA 1BHSA 3W4IA 1MGOA 3EW7A 5A9SB 9LDTA 4E21A 4J2OA 2H63A 3ETEA 5B37A 3RUIA 3RJ5A 3V1YA 2HAEA 4IM7A 4I9HA 1R12A 3IL2A 1H9AA 4IZIA 1PGJA 4GVXA 1GYRA 1RYEA 4GH5A 2AXQA 1ONPA 5K9ZA 4LW8A 1AXEA 3UCFA 2RHRA 1V35A 2WEKA 3OETA 4B3IA 4AJEA 4NU6A 1E92A 2B35A 2JCXA 1RYDA 2PGDA 4Z3KA 5JC1A 5DN9A 2P9CA 1YL5A 4CMIA 3HE3A 1EDZA 2Y1EA 2XOXA 3PRJA 3VPHA 5DBFA 3WLEA 1EFKA 2YJZA 2I65A 4HFJA 2Q1UA 4I08A 1HSZA 1HT0A 5IDQA 3M2PA 4E5PA 1LTHR 1BW9A 4TMFA 1TA4A 3STHA 4AVYA 1NASA 4PLVA 3FHLA 3I9JA 5ER6A 5TQVA 1VKNA 4Q9NA 3GA0A 3WGOA 5F1KA 1YONA 4GX1A 2Q50A 4NJOA 3IJPA 4NJMB 3AM3A 4WEQA 5CPBA 3O8QA 3WNQA 4CMHA 4ZICA 5C7LO 2PFGA 1P33A 1XQ6A 4CMAA 3JQGB 1LRJA 1M2WA 1O5IA 3WLFA 2PKRA 3WQRA 1YVEI 1CF2O 2GDZA 3U0BA 1JKJA 4XYBA 1N1GA 4B4OA 2FR0A 3GFGA 1I32A 4JXKA 3S1LA 2VNAA 4XCVA 3IKVA 5I8ZA 4U8GA 1VSVA 3ENNA 4PVCA 1R0KA 3KM0A 4WLFA 5COAA 4CUKA 4YRBA 2BH9A 3VPGA 2VN8A 5L7YA 3WYEA 3JQ9A 1KBZA 3G49A 1UDBA 3PZBA 3G79A 2AQIA 2ZB3A 2YQ5A 1CEQA 1T2DA 3E03A 4J7XA 1AN9A 4QEDA 5JDCC 4IS2A 2B36A 4MINA 5CHEA 2QHXA 1D3AA 4DLAA 3VTZA 4A73A 1IE3A 3H5RA 3LT4A 3NGXA 3W8DA 1ZZEA 2PA3A 3K8ZA 4LN1A 1XCBA 4B79A 1BVUA 1Q0LA 3BMCB 5JFOA 3RQSA 4ZQGA 1GFSA 2AMFA 1XG5A 1Y9EA 4HFMA 4EUFA 3NTQA 2HMSA 1GUYA 4P22A 1M66A 3H7AA 4IZHA 1KVQA 2DM6A 2C5EA 4FW8A 3C1TA 3FR8A 5T8KA 1BDBA 4WASA 4ZJUA 4BGVA 3AK4A 2CY0A 1R4NB 2GZ1A 4EEZA 3A06A 4J0EA 1Y8QA 2NU6A 2C07A 2R00C 1VI2A 4RDHA 3UHAA 5I9NA 4E12A 4JROA 3E9QA 2WTBA 4L75A 1C0IA 2X0RA 5DF1A 6ADHA 4BKRA 1WLYA 3QJ5A 3PZRA 5T64A 2H9IA 4M89A 5BNFA 1BDMA 1TVEA 1U9JA 2EKLA 5GMOA 3ST7A 4RJTA 4QT0A 1ISIA 3PHHA 5JCXA 1LDYA 4DREA 1JLLA 1EFLA 3OM9A 1GYQA 1ADGA 5C5IA 3GHHA 2VWGA 4AJKA 4YRAA 4YAJA 3K31A 1FJHA 4GX0A 3N74A 2O3SA 4K26A 4TZTA 3N7UA 4Y6RA 3S2EA 4PG4A 2FR1A 2VHZA 3INGA 3Q1LA 5A5EA 4E5KA 3M2TA 5CFZA 6LDHA 4FFNA 4MVJH 4PG8A 2NSDA 3JYPA 1PJTA 4ZU3A 2HRZA 2NLOA 4LVCA 4CV0A 4E4YA 4YXFA 1GCOA 3W6UA 4L0QA 1ZSNA 2CF5A 4EITA 1GPDG 2B5VA 3GDGA 1KY4A 3ITDA 3KOUA 3JD1A 2DKNA 5IDXA 4CM8A 3SLGA 4E5NA 2Y67A 1HYEA 1Y9AA 1RKXA 2FPGA 3H3FA 3WWZA 5DOZA 1Y7TA 2EP7A 4WPGA 1LXCA 3BMQA 3NT2A 3F5SA 2PY6A 1QYWA 5A03A 2YV3A 4X54A 3KHUA 3G3EA 1WDKA 3GVIA 1PGOA 1ADFA 3DFUA 4UREA 2ZTLA 2CMDA 3RKRA 4I1IA 3OQ1A 2ZCUA 4BNXA 3JSAA 3PGJA 2Y66A 3RIHA 3JQ8B 3ZV6A 4IY1A 5TLSA 2VRBA 3E8XA 5CDUA 1NFQA 4XDYA 1ZIDA 4Y9DA 3NYWA 5FI5A 4RPLA 3UH1A 3CUKA 1WP4A 1BXZA 1Y6JA 4PRKA 1YE3A 5JNLA 3F4BA 3DTTA 3ASVA 2OP1A 4XYGA 3V8BA 4AJ1A 2NTNA 3HQ4O 1LI4A 4NI5A 2HUNA 5KKAA 4D0SA 3ZU5A 1P1RA 1PR9A 2HDHA 3JQAD 4MVJD 1E5QA 1KEVA 5TF4A 3U4DA 1DIRA 4RVDA 1XLTA 4BQPA 4UUNA 1YJQA 4NNJA 5L53A 4K28A 1SZJG 4NBVA 3L6OO 3LF1A 5JO0A 4W82A 1CETA 1W73A 1Q7BA 3SJUA 3F6YA 3GNQA 1U5AA 1E1MA 4ALIA 3I83A 3UOGA 3BTVA 1ADCA 3PHIA 5G4KB 4GLOA 3WMXA 3ZWXA 4EZBA 3GPDG 3E18A 3BHMA 1JU9A 3KYBA 4FOOA 5IXYA 1J5PA 3ZNPA 1WAMA 4J1NA 4R5HA 3PJDA 5CEFA 3TL2A 5A05A 4I5GA 5GZ6A 5L4SA 1CQJA 1V6AA 3LF2A 3GPIA 1EVZA 1EZ4A 1K0UA 3D5QA 1M76A 3BMCA 2GZ3A 1MC4A 1ENYA 2IZ1A 3C8MA 1RM3A 3OA0A 2O50A 2VRCA 3ZH2A 3Q11A 3TL3A 3GC6A 2RCYA 4R5MA 5H83A 4F45A 3DONA 2VYVD 3PLRA 5F3RA 4ZQBA 4WLUA 1H9BA 2J3IA 4WCFC 1DLJA 3RI3A 5A3VA 1Y81A 3UN1A 1P45A 1PZHA 1KEUA 3WMWA 2O2SA 5TGDA 4DIBA 2QZ9A 1XR3A 1ZEMA 2C54A 1LLUA 1ZFNA 2HJSA 3HDYA 1HZJA 1MX3A 4EUEA 1K6JA 3RC7A 1C0KA 4FDAA 3I23A 2WYVA 3AI3A 1NQTA 2YQ4A 4JBHA 1P77A 4B3JA 2I5PO 1FDTA 3K73O 1E7MA 4BO2A 3BA1A 2D1YA 5GY7A 4IDEA 3OP4A 4YA6A 4IDFA 2HCTA 3INRA 4M49A 3GEDA 4RZHA 1YBVA 4IDDA 5DZSA 1ONNA 3ZNNA 1SPXA 2IXAA 2OOSA 3FNGA 1PS8A 4PLZA 3S2GA 1DIHA 4G65A 3ANNA 5BQFA 1Y8RB 3ZU2A 4FQ8A 4DWVA 4WJZA 3WGIA 1Y8QB 2EERA 2AG5A 2WE8A 3U09A 2OP0A 2NM0A 1QLHA 4J1TA 1DIGA 1AGNA 5TJHA 1I2CA 3QRWA 1HYGA 5IN4A 2D59A 3EVTA 5IG2A 4RDIA 1U5CA 4XGKA 3HHPA 1B8UA 3BMQB 1R37A 4KQWA 3PYLA 4LRTB 5COBA 3I9LA 3BTSA 4OQZA 3GF4A 2JAPA 3C24A 1N7HA 4Z9YA 2YDXA 5G0TA 2UYYA 2RH8A 1KVTA 2E4AA 1ENOA 2CF6A 2X0NA 3QE3A 4CUJA 3EZYA 3DMTA 3WGHA 3MJCA 3QVXA 2IZ0A 1E77A 2BGMA 2B5WA 1PJQA 4BNZA 2IDZA 3ON5A 3IP1A 5DOVA 1K5HA 2GRAA 2YFQA 3DMYA 4J16A 4W7HA 1QG6A 2AEFA 3QW2A 3VVCA 2EIHA 3ZHZA 5I7FA 2LDXA 1YQXA 5DCYA 3L6EA 2NTJA 1W0CA 3GLQA 4LK3A 3JQGA 1HDRA 3GUYA 1VRWA 1YB5A 3JD2A 3WNVA 5EESA 1LC3A 5IXSA 1O95A 3HUDA 4KDFA 2O23A 5LDGA 2EGGA 1B2LA 4ONEA 1I01A 3WICA 4BOYA 2QX7A 2G17A 5TT1A 4ZN6A 3VH3A 3OHSX 3TZ6A 2VQ3A 3WB9A 1F0YA 1GR0A 4B4UA 1I8TA 2X1HA 3DZKA 4GMGA 4PLTA 2AG8A 1X7HA 3QWBA 3WXBA 1VJTA 4OMUA 4E2ZA 1PS9A 4R54A 1A7AA 3T7EA 3AOEA 4J43A 4AFNA 2A92A 3LT2A 5KWEA 4CL3A 4MIEA 2H1SA 4D3FA 1LC0A 2ZQYA 1GCUA 3EDMA 5FI3A 2DPHA 4HKTA 4BV8A 3F47A 4DRYA 4OSPA 3ZZNA 1GEGA 1GUFA 2R00A 5I7SA 3WR5A 4YT2A 3TF5A 1DB3A 3H9JA 3TNLA 1VSUA 2HKIA 4QUKA 3O03A 7ADHA 4IDCA 2C2XA 1LQTA 3JD0A 4J7UA 4N5NA 3TZQA 5T67A 2GN4A 4J91A 1Z74A 3MJVA 3NUGA 1IPEA 4D46A 1J6UA 3JCZA 1YWGO 3BMOA 1C1XA 1XEAA 1ML3A 3RAJA 4J4HA 2AE2A 3H2ZA 1X1TA 1KIFA 3BMNA 3D4OA 3GUCA 4HV4A 4LRSB 1J49A 1Q1NA 4Y67A 3QLJA 3P5SA 1AUPA 1ISGA 4IIVA 5DP1A 1NBOA 1T2EA 2CDAA 4FN4A 1NHWA 3DXFA 1T1SA 4AJ2A 3PI7A 4AG3A 5G0SA 1E7WA 3R3JA 3A4VA 1EEHA 4ALMA 1E6UA 1Z7EA 3M1LA 5HWSA 1V9LA 3CE6A 1OMOA 1PZGA 4AJIA 4KWIA 4BMNA 3DHYA 1BMDA 3IDSA 1R16A 3ZV5A 4B7XA 4FGSA 1X0VA 5LDHA 4JJGA 1BWSA 3S2FA 1SMKA 1DFIA 4UVDA 3PWSA 4BKQA 3PFWO 2NADA 4KTVE 3VKUA 5A02A 4YACA 5G4LA 3WBFA 5BR7A 1VKOA 5L51A 4YCAA 2VHVA 2O4UX 3E1KA 1E3EA 4RF4A 3JYOA 1JN0A 1C1DB 4DL9A 1T1RA 3LQFA 3QSGA 4J49A 1FDWA 4TRRA 4Q3NA 4CM7A 4YJHB 3UFXA 2D8AA 4ALJA 4BO4A 3UKOA 4WCFA 3CH6A 3VZPA 1HL3A 5BSGA 2A94A 2UAGA 4MKRA 2HSDA 4H16A 4C4OA 4BHTA 5JO9A 4CM5A 4DMLA 4JN6B 4RF3A 3WJ7A 1UUFA 3PHLA 4E6PA 3GRPA 1JDJA 2WYWA 1DIBA 2BI8A 4F46A 2J5KA 5H82A 2CZCA 3V1UA 5L4NA 4FFMA 1HE4A 2NNLD 2IYPA 4N54A 3L9XA 7MDHA 1VJ1A 3I6QA 3P2OA 3PDJA 4J7CA 4NQZA 3D5TA 1HDCA 1I3KA 3VAZA 4CLEA 2J3KA 2Q4EA 4HBGA 2E6UX 4RQUA 3U4IA 1N2SA 3WJAA 4Z0PA 3MJTA 2ZTVA 2G0TA 3DEYX 4XJSA 3S8MA 1HXHA 3GNTA 3JQ7B 3GEMA 1T2AA 4WOJA 4W7IA 2X9GA 3NTRA 1TLTA 2GN9A 1PGQA 3HB5X 2JAHA 4FB5A 2EF1A 1KC1A 2VT3A 4HX5A 3BHJA 4IXTA 4IJVA 4YPOA 4TVOA 3I4CA 2NQTA 1B15A 4NPCA 1UAGA 2Q46A 4GKVA 1GZ6A 4PG5A 4RF2A 3WYBA 4OO3A 4CMJA 1TT5A 4R16A 5IF3A 2C0CA 5JSFA 3SBOA 3TZKA 2E49A 2FOIA 4N5MA 3GDOA 4A27A 3X2FA 3S2IA 3F9IA 1F12A 3FNHA 3JQAB 3NV9A 3QV1A 3KYCB 1UAYA 4RLSA 4R1SA 2VUSA 4WNCA 1BTOA 1I30A 3PHGA 5B4UA 4QFDA 4XIJA 1X7DA 1ZMOA 3C3XA 3E5RA 3DHEA 3I9NA 3MOGA 4TZKA 3GGGA 2CDBA 4J1SA 3PQFA 1EUZA 2GF2A 4PZCA 4Q3AA 3I52A 3WFJA 2VRCD 1KEPA 3GY0A 1D1TA 1ZJYA 3FRJA 4ESOA 3CZRA 4E30A 4O59O 2A9FA 2C82A 2X6TA 2DU8A 4FS3A 3GR6A 3D3EA 1MB4A 1ULSA 2ILTA 4BNLA 5EQDA 4E31A 2EEZA 1LDBA 2WSBA 4KUHA 3ULKA 3ZHYA 3W8FA 3JQ6A 4KUGA 2HMWA 4XYLA 1OBFO 3SC4A 2EGHA 2NVWA 4PLGA 5A06A 1QORA 4IS3A 1T2CA 3ZNOA 3ROPA 3GOHA 3PTZA 3DZBA 1NVTA 4CM8B 2I67A 1VLLA 4URFA 3ZI0A 3GH3A 1IPFA 4E3ZA 1EQ2A 3VHRA 2Y1DA 2DT5A 3LU1A 2YZ7A 4ZA2A 3CINA 3EYWA 1ISFA 3ZWYA 2FZEA 1RM4A 4BO5A 4OYRA 3VZSA 5L4LA 3VDQA 3Q2IA 1WXDA 2PTGA 3TDKA 3DAFA 4NIMA 1YDWA 2D5CA 4YAEA 5TSDA 4MP6A 2VNSA 2X86A 4CV3A 1SB9A 4NK4A 3OFSA 1HDOA 3G1UA 1U8XX 3AWDA 3GK3A 4UVHA 3TFOA 3GRKA 4FFOA 4J90A 4MVJF 3HN2A 3KEQA 3SC6A 5BNIA 4QXMA 1JTVA 1PQPA 4BO7A 2YHIA 2CVZA 4PGFA 1N9GB 1U4SA 2ZJ1A 1QP8A 3HADA 1P44A 3OF2A 2VYNA 4EDFA 1GZ3A 4WKGA 1KYQA 3EAGA 5F1OA 1U3UA 3L0DA 4Z9XA 1WNTA 2BFOA 4PRLA 3IJRA 2AEMA 4OXYA 5FFFA 3HJAA 2PGLA 4GQAA 3QVWA 4QO8A 4O63O 4I5EA 4EYEA 1KERA 1DO8A 3KB6A 3AOEC 4GWGA 3FR7A 1H0KA 4JIGA 2JFGA 4D45A 2WE7A 3QY9A 4CMGA 1C3VA 1F06A 3MOIA 5HTOA 1QR6A 3JQBC 2YUTA 4E0BA 4FPXA 3C7DB 1UXIA 3TFQA 3EC7A 4E13A 4UAGA 1LU9A 3FNEA 4MP3A 1KEWA 1NNUA 1ZO8A 5T8KC 4O5OA 1VJ0A 2JD1A 2Q1SA 2JJYA 3I5MA 2AA3A 2LDBA 3BTUA 4ND2A 4CUZA 4MIOA 4U6SA 1ISJA 3DBLA 4Q3CA 3TN7A 4DYDA 4XRGA 2VWHA 3JQ7A 1IHXA 2HLPA 3ONEA 4MVJM 2HJRA 3OBBA 5B4TA 3I3OA 4RLHA 5EIOA 3M1AA 3NAQA 2YY7A 5HM8A 1Q0HA 5KJEA 1NPDA 3AM4A 4PLFA 2GN6A 3JQCA 3TQHA 2C7VA 1I33A 4J3FA 4DQUA 4N18A 1E1NA 5ADHA 2CDCA 4NBRA 5K6AC 2ZQZA 1Z7BA 2F00A 4R3NA 4PLHA 3KYCA 1PX0A 1I5RA 1ZK1A 1EMDA 3DZHA 3ZW8A 3KSDO 4BGUA 5TJ9A 1MFZA 1E7QA 1TI7A 2W4QA 2ZB7A 1NPYA 1A4UA 4PN3A 5G0WA 5JYDA 2FPPA
chains in the Genus database with same CATH superfamily
5JC1A 3BZUA 3U7QB 1C14A 3W2TA 1A3CA 1SG9A 1H5UA 2C5BA 2VPTA 2F9FA 3NGMA 2NUTA 1EP3B 5CLFA 1NQOA 4BCDA 4OLJA 1EX6A 2V6MA 2FSVA 2PZKA 2OFWA 2XMZA 3VYRB 4WDQA 1JHMA 2FHSA 2QYSA 2VJBA 1TTHA 4QBKA 2BH2A 5DBEX 3GLGA 1KI9A 3AV3A 3PEFA 3PYXA 1VL2A 1Z45A 2DR3A 1XROA 4PR3A 4D44A 4RUKA 5DULA 4QEZA 1RAGA 1KKLA 1CYDA 3LUHA 2V7PA 2WHQA 3EXEB 4PHFA 3OZUA 4Q05A 4YAUA 5AW1A 4TM8A 5AH0A 1CRQA 2QTCA 2ZT6A 1M0SA 4JLUA 3TIFA 5B7QA 3FBWA 3DOJA 3IP3A 3RQIA 1D7OA 4WGFA 5SYAA 1XZBA 4MVJG 1CULC 2ZUCA 5ALLA 1LRKA 2R8EA 2C94A 4LDNA 3TZLA 2QA5A 3ZWPA 1PVDA 3WA6A 4Y2HA 3MBOA 1JTFA 1EE2A 1U3WA 1YB4A 2ZOSA 1CUUA 1M54A 2XLBA 3GAZA 3ITEA 1IIBA 3P2EA 3TMYA 1C30B 1PQ4A 1ULUA 1PNTA 4DB4A 1JDTA 1VGVA 5AVOA 3WDMA 1YRWA 2GYVA 1DT3A 4WNAA 3PF9A 4R4JA 2H9YA 3ZTYA 3GGOA 4G09A 2M1XA 4LGCA 4EI2A 1YMVA 4PHHA 2D5IA 1WD5A 4CT5A 3EZNA 4KN9S 1BFKA 2QN6A 2D4HA 2X7HA 4CQNA 3WQBA 1JG7A 1OGYA 3R6LA 1ZH8A 2A5YB 1G41A 4B6EA 1KYIA 1W581 4CMBA 2FRVA 1HQCA 3CLSC 4Z4HA 2W0SA 1REQA 1L8LA 1XMVA 4EUSA 1AKWA 1JHRA 1GUZA 3M6FA 4MICA 4QJIA 1KE2A 1UBNA 2FEAA 2OBNA 1EM6A 1IHPA 2IUYA 3W5HA 1QVRA 3AU9A 3TNDA 5E6SB 1Z7YA 5IFKA 4HEJA 5KTKA 5K3CA 2X1MA 4P3YA 2B6NA 2CNWD 4QD3A 3H9UA 1HORA 4Q4AA 2IYUA 4G36A 2H17A 4ECAA 3MXOA 1NKVA 3U13A 1BX3A 2J7PD 4HMPA 2VOEA 2AS0A 4WZZA 3WGVA 3DVLA 4DRZA 4JI2B 2MSKA 1XA4A 1QFYA 3K20A 1NN1A 4NEQA 5AJYA 1NXWA 1Z2DA 1Z39A 3LSTA 2HNKA 2JIOA 3MCWA 4HYQA 4LG1A 1QTIA 3BXHA 3KKMA 2PUFA 2WQ6A 1EQUA 4MKGA 1YBHA 1RQRA 2G9UA 3CVVA 2HFKA 4TX1A 5CG2A 3GVXA 5FPQA 2R8BA 1ZVMA 1E2PA 4P0TA 5A0VA 2FSSA 3AZQA 1IHDA 4XWGA 2VSNA 1UT5A 2NTVA 2AIRA 5D1HA 4BN4A 3ZS8A 2A2ZA 1E2HA 1TLFA 1ZM3A 1FL9A 5ALFA 3GARA 2BKEA 1PU2A 4KLCA 2WU4A 2X23A 1MNAA 1SQ0A 2FDXA 2GM3A 2VDOB 3I58A 2X9VA 3TLMA 4X1IA 5F5NA 1T9AA 5CH8A 4CR8A 5EINA 5A2GA 3T12A 1OPXA 4RU1A 1GP2A 3O75A 2VAXA 1E9VA 1QCCA 5J58A 2OAEA 4MUYA 3WK8A 2O8DA 2LGJA 4GAEA 4UBOA 1ATIA 2R1UA 2G4VA 2W2NA 3EGCA 1ZMTA 1JDBB 2EQ5A 3BE8A 3HCRA 5KTNA 1GPUA 5L95A 2BELA 3LLMA 4U3JA 2EJVA 5EIBC 5BSKA 1O4VA 3ER8A 1J2TA 1E2EA 3L7NA 4ESVA 4O4HF 5DYGA 2R2GA 4J03A 4U2DA 4XZ3A 5DLDA 5H3CA 5DLPA 1NL3A 2VTKA 2YXPX 4DZTA 2E6KA 2GPTA 3JZIA 2VZEA 2ZJZA 4PC7A 3U7RA 4Z3DA 1YKFA 1YF3A 1F8UA 5EXPA 3UQZA 1GDTA 1WP9A 1N92A 3NEYA 3NNNA 1PRYA 5IWAB 5C5DA 1GQRA 4NYMQ 4P7BA 3D7KA 1HTTA 3BQNB 3BICA 4JVNA 1BO6A 1QKKA 5ITZB 3B60A 1NW5A 3H6KA 2B7CA 1T8SA 3IMKA 2SCUA 5CXUA 1RYZA 2VKTA 1JU4A 1WX1A 3CW9A 3K92A 2J4CA 4Q4JA 3HWRA 4ED9A 1P7VA 1BXGB 2I3AA 1SUWA 4K6FA 4ZVNA 4KLAA 1C3OB 1QRAA 2D0DA 1GKKA 4YRCA 1VBKA 4Z1OA 3OQOA 1DFGA 3O7WA 5EI5A 1T5HX 4HWOA 4XVHA 4ZDWA 2HLDA 4CQMA 4XPIB 4LTMA 3FB4A 1G19A 1ZJ5A 5CDFE 4ZCPA 2IW1A 1L1RA 5BSHA 1DX9A 2RC6A 4QUEA 2SBTA 3A1SA 3DV0A 1IL0A 1UXJA 4CIXA 1PT9A 2FVXA 3ND6A 4JH0A 2OVFA 1GNSA 1SC4A 4XTRA 4A16A 1LPMA 4JS0A 4UOZA 1T6ZA 4LI3X 1Z4JA 4MQUA 2AZXA 1NJ5A 3ND9A 4XUCA 3RC3A 5J23A 2GILA 2CFOA 2JIRA 2Q4BA 2RBKA 2VAPA 3UMYA 1H66A 2JFFA 4IKEA 3FVTA 1T1JA 1UFKA 3ZR4B 5CTJA 1T91A 3M6LA 4CYMA 4EHJA 3PTAA 5BQOA 2HMUA 2PGNA 1D9XA 1HQDA 1UM9A 2W9XA 3KOYA 3MGCA 3SQNA 3MWEA 4J3NA 1WPGA 2EV9A 3FPFA 2FZWA 4RBNA 4R7TA 4B85A 4CR7A 1YULA 3R5HA 5G2OA 4EB0A 5A4KA 4Q7LA 1UZLA 4B8YA 1AK1A 2IY8A 3MIIA 3GUZA 1GKUB 4HDSA 4WN3A 3AZOA 1ODJA 1Z2AA 1YJXA 3B9BA 3GFSA 2Y4OA 3TM4A 1P6QA 5IKPA 4K7JA 3ZJUA 3K9QO 4ATNA 4F1JA 2WFLB 2V0GA 2HX1A 1JAHA 2GUGA 3I9V1 2G1UA 3D6FA 4OSEA 5EJFA 5JHGB 4EGCB 1RJ9A 1HE2A 1GSIA 2HBRA 1Y1KE 4FLEA 4R68A 1XDGA 4XARA 4XQCA 2OXIA 4YDHB 2HM7A 1WXEA 1L5VA 1S01A 3VC7A 4ZEMA 4WOBA 3ZHVA 4E94A 3CIOA 3UK6A 1Y0BA 2QQGA 3A1NA 3CKYA 1SULA 2WC1A 1RABA 1F6DA 4GPD1 5KQRA 1G1AA 4N0QA 3JALA 3THWA 4ZVQA 1CVLA 3HP7A 2OZPA 3OZAA 4RH1A 5T6BA 3KLBA 3CF6R 1J0EA 1E79A 2O4CA 3VH1A 1N2HA 1YGYA 2XX3A 4QIHA 4GUDA 5JQGF 3MJHA 5BNWA 1T4BA 1PLKA 3W5CA 3AF6A 1W93A 4JHLA 5ARCA 3VQTA 2WKRA 1BWPA 5HBRA 5BOVA 5ALSA 4EBBA 5KKCA 3DJFA 1XWFA 4ZO7A 1NOIA 3OPQA 3RFTA 4M0MA 3DULA 1WHSA 4YO7A 1P7ZA 1Z8FA 4ZC8A 5CDHA 4R69A 5I48A 2O2HA 5DSXA 5E9WA 4BKOA 5JS7A 1QB8A 4F4FA 1FQWA 3G2HA 5HA5A 2P6OA 3KYDB 5KIAA 1SH7A 1Y42X 3ELWA 1GPLA 1YQDA 1IQPA 3HI6A 3TIIA 4YR7A 5CDSA 1YCHA 1N6OA 1FOEB 3UICA 1QF6A 4WLOA 4A91A 4YHHB 3B5JA 4WEOA 3FPEA 4B3TB 1S96A 2ZU6A 2J3DA 1ZVVA 4QTYA 3KOOA 4QOEA 5K0BA 1U8EA 2JARA 4H0FA 4I55A 3F5DA 2XKJE 2NU9B 4E07A 2QLMA 3AQIA 3Q9SA 5ERXA 4ZKEA 4XJTA 3GEPA 3OX4A 3QNWA 4WKPA 3RH0A 1JLSA 4HH0A 2IVZA 3DBLB 3QUBA 3H19A 2JFBA 2ALJA 4M1WA 1R0ZA 4DNPA 2OHJA 4E4TA 1P0FA 3WS7A 3I2JA 3OPYI 2PFSA 3SIXA 5J2UA 1ECPA 4IXDA 3EFOA 4HCJA 4WXMA 1UIMA 2VPYA 3T0FA 1FFDA 4RTKA 3DBOB 1E69A 4KR7A 3LJKA 1RRKA 1P7PA 3KK0A 1HKHA 1O8CA 1JEQB 2FUG1 4BIMA 1BCRA 2H54A 4RTLA 4RV4A 1W0KA 1Z7GA 1Y3BE 1UKVY 1CIVA 1GTMA 2Z3WA 5AKHA 4BLUA 3USZA 1MOQA 2RBEA 4TN1A 3IVAA 4HJXA 1A9YA 2BFCA 1H6BA 1BE1A 1UDRA 2MHCA 4FFBB 4IL5A 3C41J 1QHEA 1HE8B 1VJCA 2PUJA 2J8ZA 4D81A 4YRMA 1M6YA 4AUMA 2D3WA 1KJ9A 2PFKA 1IQ0A 3GMDA 1UMBB 3JVUA 1L1FA 1OLSB 4RDCA 1HO3A 1P4JA 2H4ZA 3B1FA 2QAIA 3G9TA 2JGAA 2WKPA 3T3PB 1V8BA 3TD9A 3TTYA 4L9RA 3U4QA 3N0XA 2HO5A 2QEQA 2FF5A 3G7UA 2VPZA 1MOPA 1K5PA 2UUBB 521PA 5DM70 2Z4RA 1JQ5A 2WJVA 1E0SA 1JFTA 2YZMA 1JE1A 2PWZA 4OX9B 1YS6A 4TS9A 4W9NA 3UFBA 2RGBA 4L9WA 4P3KA 2I9PA 3WLOA 4UZFA 3P9KA 1XDZA 2VZ9A 3H97A 3LW7A 1ODFA 4G0OA 2WY2D 1BMTA 5BYAA 2IX3A 2C3MA 5JNVA 1E5TA 5K8JB 4BTVA 1BRTA 1I51A 3D3WB 2FXVA 2ZIZA 4FZRA 1R0XA 2HBZA 4PQEA 3DXZA 2Z2KA 4IVPA 4RPCA 2ONKA 2J85A 1MA0A 4G4GA 1AKEA 3VC1A 3PVZA 2QUBA 2IRWA 2REQB 1Y3IA 3QA3E 3KUXA 3OOJA 1LA2A 4RVOA 3A6JA 1FDOA 4JLAA 1OPRA 1QYIA 2J5QA 3GYGA 4NLLA 4LHXA 1GL7A 3OJLA 4GUAA 7AT1A 4GSLA 1I1NA 3E23A 4HDOB 3COPA 1KWKA 4B3SB 1GRVA 2GLXA 3QWIA 4ZTBA 1H6CA 2WJAA 4DEYA 1ZXXA 2ID4A 5CDGA 4Q15A 1N7GA 2BFBB 2FPIA 2XVZA 3I2IA 2I54A 3JPWA 4LYDA 2QL5A 4S2EA 1C8KA 2OBBA 4G1FA 4NCKA 2RHWA 4DWOA 3VA7A 5JBNA 5IZCA 2UYCA 1SNYA 4INPA 2WFLA 3HEBA 1MFPA 4O25A 4X93A 5K0LA 3L8GA 4QARA 4B81A 1BA3A 3ABIA 2QI9F 4F7DA 4NH0A 3FDZA 5JZSA 1RJ9B 1U0JA 2PXHA 3AJ8A 1AQUA 4BNUA 4TTPA 1DBVO 1JXOA 4B40A 1L5RA 2BFFA 1MLDA 3NALA 4HZUA 4QUDA 4YRTA 5AK6A 3V42A 1XXHB 4RW0A 2G8NA 3T5CA 5JDIA 5IK2A 3HRIA 4TTIA 3C4JA 2PZBA 1ZIYA 2JCSA 4GX5A 4KDCA 1GG5A 1NT2A 1P2DA 4W5JA 3HYCA 5YASA 3UT0A 2X3FA 3H2BA 1ST3A 1MJ5A 5K51A 2HA5A 2HA7A 2A3NA 3HEAA 1Z5NA 4OM7A 3T9AA 3HJFA 3GPDG 1WA5A 3HBMA 1NQWA 3BX1A 2VHTA 1ZLYA 2MCFA 1HT2E 3FUVA 5HTKA 3CRRA 2WJWA 4EGQA 2VA8A 4D0NA 3MILA 4FCCA 3OCJA 4K9SA 4QFCA 1ZJ4A 2P41A 1UT6A 3BXZA 5AKYA 2H0QA 5U4QA 1XTZA 4XVUA 2PUAA 3DEJA 4AWAA 3P45A 4JP5A 3ORHA 2C4MA 5MN5A 2IHZA 2JAOA 1MJHA 4BX2A 2ZT5A 3O26A 5D86A 2NP7A 1AKVA 4RQTA 2INGX 3ZDBA 3A8TA 2Y1FA 4FFPA 3WYNA 2FX2A 4RPKA 3GLIA 1T3ZA 4AF7A 3BDVA 2YJ6A 3PICA 2QZZA 4WXRA 5DO9A 5EZYB 4IUYA 3QLTA 1DBQA 3KE8A 4FYPA 2XGSA 2J6BA 1A2QA 3MQ2A 1DWOA 3BH0A 1AF4A 3NHZA 2VNHA 5EP1A 3U4HA 4LF6B 2I2XB 1G9SA 2B1JA 4YRZA 5LFAA 3RGWS 2F3TA 2JF0A 4Y2RA 1FFXB 3STUA 3BGVA 4NXNB 2CFTA 4UTNA 3QELA 4BUCA 3TTSA 5I9LA 4RKFA 1JXMA 1ZVJA 2JLSA 4WUTA 4YJ2F 2NVUB 1J0BA 2JAQA 2GRUA 5CXSA 2WQ7A 1KMMA 3KXDA 2PD6A 2WSSD 3EUWA 4LZNA 2ZB8A 3CHYA 4NBTA 3IMGA 4Z54A 4NFSA 2OLJA 3SHQA 3HKBB 2H5IA 2I1LA 1GHTA 4FM9A 2P0YA 1FQOA 3UMSA 4EHIA 1T0IA 3PT9A 4XSHA 3W8EA 4MIYA 4HQNA 1SQSA 1U8AA 3IKLA 4XWWA 3IA2A 4CETA 2Z6AA 2RKOA 3AFHA 2Q99A 3VJKA 4RSHA 4YCSA 2JD2A 5A04A 2NXCA 4KU4A 2OBXA 4EVRA 1L5QA 4KR9A 1KMHA 1DV2A 4EW6A 2AOTA 1FSFA 3G5MA 4IMJB 4KNYA 1BE8A 4FU0A 3CR3C 3ESBA 4WNIA 4HP8A 4HXYA 1Z15A 4Y9TA 3WKBA 3BWEA 4CEHB 1VSBA 3B70A 2IYLD 1DIAA 1KO5A 2FW1A 4M54A 5ENZA 1C9JA 2Z2JA 5CB8A 2UYHA 1QE3A 3UGTA 1MV8A 5B4VA 3ZHQA 3UJ3X 5CG1A 1NWHA 4M0FA 2WI8A 1DAGA 2R47A 1KY2A 3EQZA 1K8QA 4LCEA 4LJAA 3E7XA 3JZDA 2Q2OA 3VSBA 5JLJA 1B6RA 2AE1A 3LMKA 4L8LA 3KJIA 4I99A 2LCIA 2A9QA 3FTNA 1O57A 1S0UA 2FSUA 3LKBA 2ZSEA 4XDZA 5KTMA 5FR1A 3UJ7A 1RQPA 2Y0PA 2VF8A 2ZRFA 4LMRA 3C5VA 2HYIC 1J21A 2P9BA 3G0OA 2C0QA 2M9MA 2NYRA 2X5KO 4C4XA 4Z4FA 2UXBB 4BRWA 2EBFX 5E38A 1OOEA 4RETA 2IYQA 1R6TA 1P7YA 4ZN6A 2AJ8A 1F0KA 2QG6A 3HZRA 3ZH9B 1M1ZA 2IYNA 1A9ZA 4GSKA 1T5IA 2AT1A 3MJEA 3OFNA 3JY6A 4FZ5A 5JIBA 1IN4A 4UE6A 3QY0A 3DOUA 1EUCB 2V0CA 3FDXA 4V0OA 2CLSA 1UQTA 2QK4A 4G24A 1HEYA 1W5EA 2ZSJA 1T6XA 3MGGA 3FYDA 3VU3A 4EA9A 1YAJA 5LP6C 3L7AA 3E7DA 1VL8A 4OA8A 2XCTB 4YH1A 4L76A 1ORHA 1QNFA 2W58A 4KQKA 1J8QA 1W4CA 3GMSA 4AG6A 5JXWA 1C0PA 1W5FA 1JHUA 1N6HA 1SOAA 2Q49A 1YFKA 3FUTA 4OM8A 4MPDA 4JA2A 1Q1GA 3LOPA 5IJ0B 1RJFA 4RKQA 1H93A 1U0LA 4ZD6A 5LQMA 3KHTA 1KVUA 4HY3A 4M7RA 4OGWA 4R7ZA 1VBNA 3VPCA 1U4NA 5EXXA 3ZY5A 4AS3A 1G2QA 2EQBA 2N0SA 3VYVA 3UMVA 2IYAA 2RONA 4P6VF 5AM3A 4GQIA 2C7QA 2QTWB 1JPUA 4X85A 4GFDA 4WXHA 4PW0A 1HF3A 3KQLA 2B2NA 4RHUA 2P1ZA 2XB2A 4TXHA 3R9KA 4BVAA 3LUPA 5G0VA 4CW7A 2CN1A 5IBRA 4O0MA 4PGHA 4R71A 2GKGA 1E2GA 3NW9A 4UZSA 1JBKA 1OAOC 3B1WA 3TRFA 1U9YA 1OFHA 3HABA 3KJGA 2C2YA 3M9LA 4FFLA 4CG1A 2GXUA 5LC1A 1PR4A 4C20A 4MCAA 4HNVA 2PZLA 4X8MA 2XWQA 4MKZA 5J4HA 4GE0A 2QM3A 1II8B 3UZUA 3HU5A 1KH2A 1YCDA 3UG6A 4IGFA 4CTMA 2QX8A 5JAPA 1E2IA 2GPBA 1IBLB 1EA7A 4OQQA 4RK5A 4CMEA 1VRVA 4Q7QA 1WMEA 3P4XA 5TQJA 5BMVB 2ZLBA 3A3OA 2VBFA 3FZGA 1XHLA 2ZWOA 1Z75A 3A4YA 5CVCA 5B6IA 4RX1A 3U56A 3RF6A 3RYHB 3PR2B 1Y8RA 2OCYC 4PCVA 3NJ8A 2EOAA 5TARA 5I5GA 3QWAA 4CKEB 2NO6A 2FUNB 4ND3A 2GAIA 3PQDA 3AEQA 5FA8A 2RHTA 3QELB 5KOJA 4OK5A 1D04A 3T7RA 3RS5A 1J9EA 1G4HA 2E55A 3KELA 5L9AA 2HO4A 2WF8A 3R9WA 2JANA 4G26A 2HXYA 1M1YE 2W6ID 4KH1A 3H5VA 5LNK6 5U9CA 5IASA 3COJA 2FXIA 3ZWNA 2ZK7A 2DWOA 3UKJA 1D5CA 4ZCRA 1VG0B 2ZE6A 3K5WA 3W5VA 1F6WA 1T2UA 1QYRA 2DPGA 3EISA 1ZN9A 1CFJA 4MQFA 3CLUC 4WK2B 3WAGA 2OXCA 4EVSA 5JQGB 2O3UA 1VRCA 4IDBA 1KMNA 1Y3CE 1DV1A 3DTYA 5LPNA 3NO4A 4BMVA 5IVHA 2I9KA 1Z2PX 5G0UA 1MT0A 1KZ4A 1UBFA 3SCZA 2Y99A 5HKBA 1MXHA 1QXSA 2BGTA 4LKOA 1LFAA 4RGQA 3V7NA 3ZCSA 4CLXA 2Z9DA 5AQ1A 4MKFA 4ZRNA 3DHVA 2WG2A 4CCWA 4HB2A 4RY9A 3FNIA 4FCTA 4DC0A 5JJLA 1IOLA 4IZ6A 3EVAA 4IIDA 1V4NA 4FYXA 4PX5A 1XVLA 3O9MA 1A5AB 4YFYA 5TX7A 4DPMA 3FIUA 4IIFA 2I33A 2CMFA 3J7AC 1MF7A 1C9EA 3IQXA 5KWJA 2QTLA 1G9XA 3TR5A 3IT1A 1LTQA 4OG2A 1NXVA 5BV2P 1FTQA 1NAHA 1GJRA 4ZOAA 5B3AA 2OCLA 1L4KA 3F6CA 3TYXA 4AYTA 4YRDA 2Y0DA 1EVLA 1QIIA 1K6XA 1NRWA 3MUNA 2Y0BA 1OXXK 1UMKA 2QAJA 3GRRA 2O5VA 3IR5A 5AW5A 1EDOA 4BXOB 2JI8A 5LN1A 5KTTA 2ACEA 3QXSA 1KGSA 4EG1A 3H7IA 5DIFA 2W2KA 3HU2A 1V3QE 1QZZA 2AJBA 5EOVA 3QX8A 4ZDJA 5IJ9B 5AM0A 3EIFA 4RMJA 4ARZA 2D2FA 1UH5A 2Q6KA 3ESYA 2QRLA 3WP0A 3TXYA 4IGKA 3RE1A 5DGXA 5ALVA 1CUCA 4D80A 3SY8A 1KFBB 5GONF 1A5ZA 1BGWA 1F2VA 3AONB 4CJXA 5ECYA 1OBVA 3LOUA 3RASA 3WKDA 2XQGA 4TRMA 1Z0UA 2R8ZA 1M34B 4ARSA 3CNBA 3SC2A 3S68A 2HV8A 1SKBA 5A6SB 2OGUA 4MPPA 3UANA 5K0FA 3HNPA 2RI0A 4HH4A 4UM7A 3MTDA 1L4EA 1VIDA 4GYYA 1HNNA 2CLOB 5AK0A 4LNHA 3G8YA 4JGBA 4MWOA 3Q7PA 1EAMA 3HJUA 3N39C 3PL1A 3QX3A 1R10A 4IIUA 4JI7B 1RYHA 1OTYA 3V1NA 4UNQA 1WUYA 5KOYA 1W29A 4B5LA 4Z3OA 1C50A 4J9VA 1NUUA 1H3FA 5KPDA 3IP5A 3AEUA 3QKSA 1W30A 2A9JA 1JNXX 2WJ4A 4HATA 4MVJE 2QD1A 1MJFA 3CVUA 4M1KA 4BO1A 3CCFA 4QTZA 3BMNB 1XYGA 5A3SA 3K94A 3NTXA 5IDYA 3HU1A 4CL8A 3KZXA 2XBLA 3AR5A 3P4YA 1GSHA 2PS9A 2CLIB 2XCIA 3HDGA 4GRAA 2W2TA 4GWLA 5HPYB 1IXZA 3OOWA 3CRNA 5HJEA 1YZKA 2FR8A 3X3HA 3ANTA 4O6VA 2Q4RA 3FSRA 3VU9B 5EZ5A 1JMYA 1I3NA 2HTFA 3WLSA 2GK4A 3X1XA 1B41A 1XEWX 1PR6A 2OTCA 2ZBFA 3MCVA 3FOAA 2J9ZB 1HLGA 1ZUWA 3CEMA 4M7WA 3NEPX 1P2FA 3EVZA 5KC8A 1JEYA 2WYIA 2ZCJA 1HQKA 1LX6A 1TMKA 2Y93A 1PK7A 1U1CA 1VIYA 3K1JA 1O6FA 4NNOA 2P2SA 1NVKA 4QLBA 2ZVJA 4MV4A 4P2BA 3SS7X 2IWRA 1AE1A 1RC0A 3Q0TA 4ZT6A 1B42A 4OFZA 5FL3A 3CLVA 2DFVA 2PGOA 1O94A 1VG9B 4J0QA 1OYWA 1D4FA 1B3BA 3SVLA 2G71A 2X6RA 4TSFA 3N0VA 5HM6A 2B61A 1A04A 2N1BA 3NOQA 3I53A 1OTXA 6YASA 3AF3A 1CNMA 4P35A 2HK8A 2JIMA 3JAKB 5EEHA 3AR2A 2WZQA 3N6XA 1F8FA 1R6BX 4BV2A 2A7XA 5L3VA 1T0BA 3SQOA 1EXNA 4R2WA 3GRZA 4GKKB 5JAHA 3ADBA 4I1VA 3I61A 1P29A 3TSCA 2GEUA 1IZ7A 5DEOA 1AZTA 3B9PA 3AUXA 3RCBA 5LIPA 1Q83A 1IAQA 2XNSA 3CRZA 1JSZA 1QZTA 1R64A 4GE3A 4OHUA 5ALYA 4JQYA 4YQFA 2Q6VA 4NZ9A 3SFTA 1V7CA 2AVNA 2K4MA 3FPLA 3SQLA 4NPAA 2YWCA 3Q85A 4GKBA 5IDVA 1IXKA 4CDGA 1GAXA 4O4HB 3HNOA 1LLDA 4EFMA 4UHDA 1GG9A 5E1DA 3M6MD 2OCAA 3Q3GE 1XZKA 4OREX 4U9HS 3DTVD 4CHTA 1H2YA 4Z0TA 1THTA 3FYHA 1G8HA 1JWBB 1KSHA 1UODA 2XT0A 2QVBA 4FT2A 4Q03A 3C4QA 5JAQA 4AY3A 3C45A 4UNSA 1KPHA 2VJAA 1BW9B 5DNWA 1ODIA 1PJSA 2YNMC 5CVUA 1BMQA 4RTRA 4UPVA 4V24A 3OEWA 2EFEB 2C1XA 1HA3A 2G0NA 1XD2A 2J9FB 3C3JA 3SYMA 3KRTA 5BRJA 4GPZA 1A9TA 3ZI4A 4QRDA 4OAPA 5EXSA 1V1JA 2AB0A 4KDEA 2VWPA 1BROA 1RI5A 1XA0A 1YMQA 2C2GA 2DBQA 4AROA 4XLLA 3TR0A 4FNOA 3L43A 1ZIPA 4QBGB 3K1TA 3VOTA 2AQKA 2VJMA 1NR1A 4FB4A 3L0PA 1KVRA 3TJMA 2X41A 2CHEA 3N58A 2QMOA 2GBFA 1ELOA 4GR9A 1ZRMA 1TO2E 3IRVA 4JJ8A 3GBVA 2W37A 1IAVA 3VGPA 3VV3A 1DG9A 3IEVA 2QNRA 2BFDA 5IBQA 1JEAA 2IPAB 4FE7A 4BX3A 3IGFA 1ZOIA 1VG8A 2D54A 1S8AA 3CLKA 3GMTA 4MB0A 5IEBA 4LF5B 4P53A 2CKMA 5K03A 1KP2A 1J2JA 5TEVA 3FMVA 5JZOA 4DQXA 5AUPB 1QGZA 2ECQA 2QJTA 1KSGA 1YDGA 3KKQA 2WR8A 2DPLA 4XRRA 3AMVA 3DCYA 2BGUA 2P4SA 1YZ3A 2D4AA 4JLOA 4NAVA 5C1BA 5LDDC 2DUWA 3SZUA 1Z18A 1UP4A 4PNPA 3UB4A 1RMYA 1E4OA 1B7GO 2DZDA 4GP6A 2AJLI 3LQQA 4B8ZA 1EVIA 1Y5MA 1ZGAA 2EG9A 2WWRA 3LK7A 2NV2B 1FRZA 2PZFA 1G7SA 3GUHA 3QUCA 5C0OE 3IUYA 2FG5A 1BQ4A 2A35A 2N1MA 3TE6A 4B3BA 4QPDA 4GM1A 4TRNA 2Z6QA 4LPSA 2FI1A 2KWIA 1N2OA 2UVDA 4OPMA 4RSRA 5HKOA 4EG8A 2HSJA 1RLMA 2GAAA 5F2OA 3DBHB 1O96A 2QMYA 1XKXA 3FW1A 3QOFA 4QHTA 3W8RA 2PRJA 4NH4A 1SAYA 5DI9A 3ZCXA 2HK6A 2N42A 1IWOA 1Q6ZA 2CYAA 2XF8A 3B8EA 1SA0A 1XOIA 3SXPA 2NUAB 5HF9A 4C6RA 4PZLA 4OLHA 3EMBA 4NE7A 2OAGA 5CGQB 1Z28A 2FP4A 4GYJA 4N7RA 4IOLA 2AC2A 1AV6A 2VYND 3LXMA 1IZ9A 3WAJA 3UAGA 2FUCA 2AR7A 2X5OA 3JQRA 4OK3A 5K3AA 4FHCA 4TVBA 2HDWA 1F2DA 2G04A 2ONYA 1I5OA 1O9BA 1EB8A 2W8ZA 2KBEA 3IAM6 1KJQA 1THGA 2HI0A 2PV7A 5AXDA 5HIKA 2BUBA 1ISPA 4R1NA 1XJ5A 3NBAA 4FJ0A 3JQEA 3EBPA 1TJPB 1N75A 2NN3C 4B6JA 3ZVNA 5IYZB 4RULA 3WK7A 5CFLA 4JEHA 3OD5A 1ULZA 1BE0A 3A14A 1IZYA 3ENQA 3NRJA 2WVJA 3LX5A 3I28A 3RYFB 4B17A 4W5OA 2VTEA 3B53X 3U7IA 2QIOA 1L5KA 1QGAA 1GYPA 3KXPA 1J1ZA 1DMRA 2FSGA 3EGOA 2EBUA 2IUUA 4BGDA 3JARA 3UCEA 2HU5A 4AJNA 1GTVA 3KQYA 4JR1A 2OZVA 2GVDC 1FJ2A 1XD9A 1EP2B 4ZIRB 3NT5A 2D13A 2PBRA 3TBFA 3BN3A 5I9IA 4JGGA 2OQRA 4ARCA 3ORQA 3MWFA 1NI5A 4Y1RA 5CB4F 1GOTA 3FLEA 5AYVA 1AKYA 2WTEA 1MX9A 2ZYWX 3AHCA 3UCXA 1O7JA 4OHXA 2YHIB 1P2UA 2D7JA 2VT6A 2WU0A 1ICEA 2FEPA 3ETGA 4I6JA 3ZX4A 4BKUA 1GGNA 3FWYA 4I9NA 1KWGA 1I4EB 1TFRA 2HV9A 2H6EA 2VUHB 3FWPA 9MHTA 4YAKA 3PNKA 3CIFA 2O7QA 4URWR 1DX6A 3IPAA 4WNYA 2DVMA 1RI1A 4P0QB 3UB3A 1Y1QA 1DC6A 3O8BA 1POXA 2GNAA 2I76A 1PS0A 3ZCUA 5ISMA 3HJBA 3Q6IA 4KFRA 3VKVA 4J1TC 4JBNA 1AM4D 1ZCJA 1YL7A 2WD7B 3WGKA 4IAOA 2GD6A 4NAUA 3LUCA 1TM3E 1I4TD 2PZAA 1QX4A 3LM8A 5E9JA 4ZT5A 3W5AA 4R40A 4G4SP 1Q57A 4UMDA 1J8YF 1PD0A 5DGIA 4CLRA 2H5JA 4JC5A 2V65A 3I2FA 2N3ZA 4KQCA 1Q7GA 3OT4A 4I4LA 2XSZA 4GLJA 5DM4A 4CF7A 2B94A 3EE6A 1EGHA 3D8UA 1V8FA 3AVPA 3FFXA 4DLSA 4DMHA 5B6JA 5BN3B 3TQCA 1XEFA 4N47A 2VWQA 3QM1A 2HF2A 1T6YA 1OZAA 2E9SA 3ABZA 4CDRA 1XD2B 1HSOA 1FNMA 2J9FA 3LPCA 3QPAA 1FIUA 4K9RA 3Q2KA 3AFGA 1G3MA 2IY9A 3N0WA 4G8DA 1IU9A 1R4MA 4YLGA 2AN9A 2EAUA 2YS6A 2ECFA 4PNZA 4OI1A 3AR9A 1JI0A 1L5WA 3FLMA 4WCDA 1DKLA 3EEFA 3ZCVA 3O8OB 5JS1A 2H4YA 1YUBA 4REQB 8OHMA 3MD9A 3ZV4A 1I9GA 1XF9A 2P9GA 4YYZA 3G59A 3W1VA 5EIHA 3Q1KA 3MS4A 3JRWA 1OX5A 2JFVA 3VVBA 1P81A 1W47A 2C20A 1RCTE 1YNOA 3N2YA 1UEIA 2ODTX 5CYOA 4MZDA 2PBFA 2OV2A 4M87A 1JQBA 1C1DA 3PJFA 3A26A 1AKQA 1KI2A 4D8VA 3A6LA 4I0WB 4DVGA 2G36A 4EHLA 3KXKA 2N9UA 5L7WA 3L8DA 4F3RA 3D4PA 5FWAA 3QBEA 4C14A 2NVOA 4H2DA 4X45A 5K6AA 1E1LA 1RWOA 5F5XA 3RUDA 1SXHA 2HSZA 1PHPA 1T8PA 3S3TA 3UW1A 3V2HA 1H6DA 1S2GA 4JSRA 1X7GA 1IZZA 3B2NA 3PEEA 3U7JA 3VU8A 2TMGA 1S4QA 3QLUC 4QSHA 2ZP1A 1UOPA 3K09A 2Z5LA 2R4UA 3F71A 4CV1A 1SXIA 2JFNA 3G17A 2H18A 3ELDA 4J0GA 2P7IA 5JALA 1DAIA 2XZLA 3ZPXA 4FMDB 2CUTA 4QELA 4WUVA 4GGPA 1XU7A 2BE9A 3L1IA 1E63A 3DOCA 2PS3A 1TM4E 4FX5A 1NDUA 1VPLA 1ONOA 2VNIA 1WSDA 2TYSB 3T3IA 3BJZA 1VMAA 2ZIUB 4WLNA 4KXUA 4UEKA 4ICIA 5G40A 4U7WA 5C4MA 1OE0A 4NHOA 4Z9BA 3SC3A 1I3LA 2IUEA 2TS1A 4A5SA 1CUJA 2DBVO 2Z43A 3FNFA 1Z63A 1MRZA 4HN9A 2Z3ZA 4U63A 4WBXC 4RA9A 1Z4KA 2IXEA 4JQCA 1GKYA 2G80A 2YQZA 3LL7A 3ZCPA 1DWQA 4R81A 4RGBA 5HRAA 1WVGA 2WZDA 4ILKA 2NTEA 3UMGA 1K4KA 3EZLA 5J2TB 4E2WA 2X22A 2NXNA 4EF4A 2PBZA 4EHKA 4HNRA 1I2ZA 4HDQB 4J0JA 4G1BA 3GZJA 4YALA 1AK2A 1V5GA 2OO7A 3VU9A 2Q9BA 2GJ8A 2B4KA 2GPJA 2PZMA 2WWHA 4IYJA 3TX2A 2L82A 4ER6A 3QXHA 5A5GA 5KVSA 2PNJA 4I1PA 1LWNA 3KS9A 4GNKA 4WBSA 4EF6A 3ZQKA 2JC3A 4JMPA 3S1AA 1LV8A 4HRVA 1XP8A 2DUJA 4RMHA 1T2NA 3JV7A 3JYLA 4QPZA 1FSPA 1M73E 3N87A 3PD1A 3ZLVA 5JROA 1DQZA 2LWIA 4G8CA 1C5KA 3DYVA 2RHOA 1QIHA 3HXMA 1DQPA 4TMVA 1SIOA 1XCPA 2AZ4A 2IU6A 2R85A 3GVCA 2WUFA 2CMHA 4PSCA 1KOLA 4GOND 3OTWA 5DW3A 4O8CA 4UTRA 3PWZA 3M5WA 1G3IA 3OZVA 1TYZA 1KEEA 2CNKA 3PR1A 2ZUTA 5IUJC 1K3TA 3FDJA 3OZFA 1NJ6A 4P08A 2CLDX 3LX6A 1KEZA 4PPGA 3LIPA 2OEPA 5JEDA 1P31A 3LYUA 4MYUA 4P4SA 2ZZNA 1T0JB 4UEOA 3IEKA 3TQIA 2OY0A 4PC2A 1FTWA 1VHTA 4Y8VA 1JVBA 3V3TA 3WLNA 3ZV7A 3UF0A 4B84A 1FW8A 4BLWA 5IBPA 5C4IA 3BB4A 4IDQA 1DDIA 2CBZA 1H1LB 4BB5A 5SZKB 1SBHA 3KKEA 3VFDA 2AZTA 2CVOA 2YBDA 3A6HA 4FUTA 4NECA 2BPOA 2BGKA 1Y1SA 2P35A 3NHMA 4IQFA 5F78A 1ZIOA 2X77A 3CUYA 3GPLA 4J2HA 3JWGA 1T1IA 3UYKA 4DILA 2QPAA 3T3DA 1M6NA 4QYMA 5TE9A 4V03A 2PU7A 2VXBA 1U28A 3E1SA 5LBTA 4I4TF 1GUBA 2IPMA 3TRKA 5CU7A 4EB8A 1JS1X 2JLVA 5LMCA 4IH4A 3TGLA 1BQ3A 1L4NA 1EBBA 1G6OA 1M3SA 2ZVQX 3CZCA 4HVTA 3H87A 1LRLA 4IHAA 2CGEA 4F6CA 5IRCD 3ZN2A 3V1TC 1YS1X 2DFKB 5D01A 4WFKA 4MUMA 3HVHA 1XO1A 2IOHA 4H18A 1ESDA 4B31A 1YFJA 3HCBA 1G2OA 3EQ8A 1JUDA 1KDZA 4B3HA 2Y1XA 3ES9A 2V7WA 1SVKA 2R1VA 3OVMA 2J6HA 5JWHA 1H1DA 3W34A 2HCFA 5BYKA 2J3LA 1V0JA 3ROQA 4OQYA 1E3QA 2G5PA 4WY2A 3Q7IA 3ZIAA 4JX8A 4YT8A 4JEUA 1OIWA 4F5EA 1OXUA 4X20B 3DZFA 3BXFA 5T4EA 3DUFA 3QKRB 3TRDA 1EHIA 1OH5A 1Q1ZA 3FOZA 1OXVA 1FP6A 3EF3A 3TUZC 4TUYF 1QFXA 2CEKA 2J59A 4ZCMA 4G0WA 1XDBA 4U5XA 5JSQA 3EXHC 1TO6A 4GZMA 1L6RA 1B26A 2OCBA 4JKOA 1QRRA 2R4QA 1YNSA 1ZICA 2BFBA 2FPIB 2ZAOA 3FHOA 3QQPA 4DXHA 1KO4A 1KP9A 5FDFA 5IJZA 3A4TA 2VHYA 2PJDA 3LPNA 3IEPA 4ES6A 2CXSA 3BXPA 3HKDB 3UEOA 2PEYA 3DM5A 4ZOBA 1UZMA 3N7AA 3BJRA 3ONNA 5ADUS 2JLUA 3RRXA 2WA1A 4OYHA 4PONA 1R15A 5D1NA 1LCIA 1FDRA 3DE6X 1KTVA 3GCDA 2Z8YA 5BORA 2A5LA 3TCXB 3ET4A 1QBKC 1MJNA 1SBZA 3GFOA 4WN9B 1E94E 3H11A 1GSAA 1RWQA 2D0IA 2Q1YA 621PA 1TKBA 1X7YB 3IV6A 1D1SA 3S5UA 5KREA 3GVHA 3HJHA 3VSEA 4BECA 1N33B 4HWGA 1W5AA 2MINB 3AZPA 4HADA 3VISA 4DMGA 4W5TA 2VQEB 3PIIA 1MAUA 5DRYA 2ZUBA 1SOWA 4BKPA 4K1LA 3JYNA 1CEEA 4BUJA 3OWOA 2XHZA 3SQWA 1QGUB 3E81A 4YMIA 2ZAGA 2H63A 4XTCS 5B37A 1DKRA 1N2GA 3P0JA 4IM7A 1Z4PX 2B1QA 1FQKA 3ETCA 1G6HA 1PBTA 3LDFA 4RFSB 4TKZA 2L2QA 1RYEA 3L1VA 3GA5A 3UJAA 5KDDA 2AXQA 3IVGA 2GPAA 3EODA 3HZHA 4BJ6A 5JECA 3UCFA 2RHRA 2WEKA 2G40A 2GEDA 3WVNA 2FMIA 5AKJA 1T4CA 2DWQA 4IRXA 2IF2A 1T4MA 2JCXA 1RYDA 2JGMA 2PGDA 1P91A 2WNSA 2HEGA 4Z3KA 1ZH0A 1C9NA 2QT9A 1TYAE 4C0XA 4K9OA 5E4YA 5LZ2A 3PUHA 3VPHA 2HF9A 4PSAA 3WLEA 3NBZC 4QJBA 4A92A 3LDGA 4HFJA 2FQXA 3PV0A 2Q1UA 4JV5B 3ICQB 4B3FX 3OZBA 3RIMA 4LJSA 3Q6NA 3TMKA 3W6PA 2QRPA 1HT0A 3WK6A 2Q4OA 3M2PA 4E5PA 4TMFA 1TA4A 4LIPD 1FMFA 4D9EA 3C5EA 4ZREA 3GLUA 4PLVA 1U6KA 3FHLA 2JA1A 3CN9A 3I9JA 1DO0A 4R1MA 5ER6A 3H1AA 3AP3A 3U3DA 4CTNA 4Q9NA 2R1ZA 3ZDQA 1TZ2A 4N3AA 4ND8B 1YONA 5CPBA 4HK4A 1X1QA 3WNQA 4OJQA 1RKVA 3KWMA 1GKLA 2R