1EFKA

Structure of human malic enzyme in complex with ketomalonate
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALIC ENZYME
publication title Structure of a closed form of human malic enzyme and implications for catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 185
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2000-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1efkA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1efkA01
1M67A 2BI7A 1T24A 3GR6A 2QRJA 1SC6A 3OA2A 3OBBA 3E8XA 3V1TC 5BSGA 3D7LA 3WWYA 3PK0A 4ALJA 4DWVA 3CINA 3K2BA 3B70A 1MFZA 2C7GA 3DBRB 5JDCA 4A2CA 2CZCA 1Z7BA 4RZIA 4DQUA 3AW9A 5F3RA 3KSUA 4M1QA 3D3WB 3GVCA 1X1EA 1KETA 3GZNB 4IIVA 1UZNA 1GUZA 4RQUA 4BKPA 3ST7A 4TMFA 2CVOA 1VSVA 2C29D 1R0KA 3I23A 1EMDA 2X5KO 3U4HA 5JAIA 1DOHA 1IB6A 4HFRA 1T26A 1Y81A 2WTBA 3GT0A 4CM6A 2EP5A 4RLHA 3KOUA 3I9JA 4CM1A 4AVYA 1ZSNA 5CDGA 5IDYA 4Q39A 3CKYA 1DC4A 4HP8A 2P9GA 1GQ2A 3PQDA 3S2GA 3ZWBA 4D41A 1NWHA 2SCUA 4BQPA 1YGYA 2IXBA 1HE5A 2DUUA 2W2KA 5DZSA 3TZQA 1BGVA 1PJ4A 3WS7A 4E13A 3ZN2A 5JAZA 1AHHA 2HMVA 3M1LA 3LC1O 5CHEA 4MIOA 1S7CA 3FNFA 1VL0A 1GL3A 4U0JA 4HFJA 4URFA 3QW2A 4FC6A 5JYDA 1I2CA 3TNLA 3GN1A 3JQGB 4YACA 2GLXA 4HXYA 4BKQA 2DBRA 2UAGA 4FS3A 5C7IO 3QWAA 5KWEA 1E7WA 4JJGA 4DREA 4J49A 3VPFA 2JL1A 3JQFA 5G0WA 4B3IA 1HDCA 4PG7A 4AJHA 2OMEA 1I2ZA 2OBYA 2GZ1A 1DC5A 4AJPA 1B8PA 1LLQA 3HG7A 5U1PA 3CEAA 5BSEA 3JQBC 2HRBA 2NU8A 4ALKA 1HTBA 1LNQA 5IF3A 2FR0A 2ZYGA 3WG9A 4CUKA 4BS9A 3AY3A 5KJEA 4HNGA 3RC1A 1YVEI 4A73A 3S2IA 4R5HA 1YH3A 3C1TA 4RPJA 3ICCA 3ROMA 1E0DA 3GY0A 3Q6IA 1X1TA 1VJTA 2JHFA 1JN0A 5A05A 3RC9A 2DC1A 2V6FA 4WEOA 1WDMA 3DZFA 4N7RA 2X4GA 4GLOA 3EW7A 5GZ3A 2BFPA 4IS3A 4QFDA 4KTVE 2GUGA 5EJ2A 3AWDA 5KJFA 3GH3A 4ND5A 1H6CA 2CDAA 3DBRA 4RPHA 4OO3A 1MA0A 2CDBA 3M2PA 3D3WA 4WCDA 4XB2A 3K9QO 1NYTA 4XA8A 3W8EA 3GZNA 2BLLA 2NVBA 3ANMA 3OP4A 3R3JA 5C3MA 3L4BC 4IBOA 1DRWA 3HFGA 5TIIA 1QMGA 2UUOA 2A9FA 3IJPA 2FN7A 4J3FA 3HE3A 3PGXA 4YA6A 2AW5A 1U9JA 3WLFA 5JY6A 1VM6A 3GVHA 3TOZA 1PJSA 4A10A 1C1XB 2DLDA 4OL9A 1NNUA 4S3MA 4MKZA 4PLHA 1GD1O 5DCUA 4PZEA 1R4MB 2JAHA 3ZNPA 3ZHZA 4BO1A 1RM5A 2X9GA 3PJDA 4R68A 4FFNA 4GAEA 4YJGB 1GR0A 1IY8A 1D3AA 3JQGA 1IPEA 3KSDO 4BV9A 3A1NA 3I6QA 3TSCA 2WD7B 1CDOA 1CQIA 4BO5A 2VRBA 1BDMA 4BO7A 5JS6A 2NQ8A 2H63A 2G76A 1TEHA 1UXJA 3D64A 3IIEA 1GCOA 2X6TA 4U6QA 1ADFA 1N1EA 1E1LA 1X7DA 4FCCA 2FHSA 4BNTA 1UH5A 1BW9B 1D1SA 5A3JA 4BQRA 4AJOA 1NQTA 4Q3NA 2O3JA 3AOGA 2YQ5A 4ITUA 4FSHA 3COSA 1SCUA 4RQTA 5IZCC 1YQXA 1IOLA 1XGKA 3OIDA 4BB6A 5FI3A 1ZH8A 3G49A 5DDIP 4UVHA 1E92A 3FTPA 4K6FA 2HMSA 3WJ7A 4YAKA 2HK9A 3TRIA 4B4VA 1U3VA 5FF9A 1QP8A 3PI7A 1BXZA 4OXKA 4MIYA 3DONA 4CQMD 1DXYA 3GGOA 4E5MA 4DIOA 2O3RA 2QHXA 3MTJA 1YJ8A 4XX0A 3RBVA 4MKXA 4CMJA 3MOGA 2O2YA 3LYLA 3ENNA 3PLNA 3F4BA 3OFSA 3BMCB 3T4XA 3W1VA 3W8DA 1A72A 2W2LA 1PZEA 1HSZA 1N1GA 5HS6A 1K89A 1T4BA 3EZYA 4GWGA 4WLUA 1EVIA 1LQUA 1NBOA 4E6PA 1HXHA 2B5VA 2V7PA 2DKNA 2UV8A 4KUEA 1Z7EA 4JBGA 1K5HA 1PJTA 2DTXA 4DBZA 2OBNA 1ML3A 1C1XA 3HZZA 1D1TA 3KXDA 1M6HA 1R4MA 3GK3A 2GYYA 4L73A 4RLSA 4Y67A 3U4IA 1YBMA 2Y1FA 4XWYA 1M76A 3I52A 4YJGA 4LISA 3D0OA 3DBLB 2EWMA 3SXPA 1GZ6A 1P44A 1MC4A 3WGHA 2WD7A 4EW6A 3WDSA 3KEOA 4XR9A 3D4OA 1ZXLA 4I5GA 2A4KA 3PYMA 5KVCA 3BXXA 5KVSA 1MB4A 4RVSA 4XKJA 1Q7BA 1P1IA 3GGPA 3H3JA 1NVGA 3INRA 4CM3A 1E5QA 1K3TA 3CZMA 4N18A 2CY0A 3F47A 3OF2A 3O26A 1BW9A 2DQ4A 3LSYA 4GGOA 1XQ6A 4RPGA 5LCXA 5IDQA 4W9NC 3O8QB 1PL8A 3PHLA 5L51A 1IUKA 3AUAA 1LUAA 4Q9NA 2NUAA 3TL2A 1V9LA 2J8ZA 3AUUA 3KB6A 1NR7A 4MVJA 3I4FA 5ITWA 1XQ1A 2X0IA 1ZSVA 1AE1A 3ZGYA 1MC5A 1UDBA 2D2IA 1VSUA 4QXMA 5C7LO 1Z74A 2AHRA 4BO2A 4KTTE 3Q11A 3EZLA 4I8XA 1GQYA 3C24A 4NG5A 4QECA 4XQCA 5AXAA 4D44A 1R16A 5EPOA 4Y6SA 2HQ1A 3H9QA 3VAZA 3DBHB 2JKVA 3FPCA 4XGNA 3WQRA 1QYVA 4YAGA 1F8FA 4G2NA 1GDHA 3C7AA 4O0LA 3S8MA 5IG2A 1UXIA 5KCZA 4R1UA 3FSRA 3ITDA 2Y68A 3JYPA 1C0PA 4R69A 3WBFA 2GERA 3OEYA 3BMCA 1PJQA 2YHUA 1GFSA 3WFJA 3QIVA 1F12A 3QRWA 4TSKA 3KHUA 2V6MA 2VHVA 4PGFA 1DRUA 4ZQFA 5A4DA 1QXSA 1O5IA 4TWRA 3ROPA 4RF4A 2I6TA 1PGJA 5C7OO 3H5NA 4JBIA 3H65A 1PIWA 4CPDA 3E9QA 1WZEA 4R16A 2GN9A 2OORA 3A14A 1VE9A 1DIGA 4R3WA 1T1SA 3Q2KA 1GYQA 4RGBA 2VWPA 2JD1A 4N54A 5C5IA 3AY6A 3DDNA 2ZK7A 2GNAA 3H3FA 4FGSA 4OSOA 4UEOA 4YAEA 2VCYA 3DBLA 4B4WA 4YXFA 1C1DB 3HWRA 1WMBA 2NADA 5H83A 4BV8A 3K6JA 3RAJA 2A92A 3ZCXA 5MGBA 2ZATA 4YQZA 3ZHBA 2UYYA 4NFSA 1Q0LA 1OOEA 1U28A 3JQCA 4BO0A 4FGWA 1ZFNA 4BB5A 5G0UA 1VL8A 2X9VA 3RIHA 4ZN6A 1CETA 2C5AA 3CIFA 2GDZA 1N7HA 3H9JA 3O8QA 1KVQA 4TROA 4Q3CA 4JX8A 3TZ6A 4CUZA 1H94A 2VRCD 1WDLA 2IEDA 4KZPA 5CG2A 3C1OA 1TB4A 3QVTA 4EUHA 5I7VA 2BELA 1HF3A 3VTFA 4YJHA 5F1OA 1DRVA 1EVJA 4OHUA 1L7EA 4RPKA 5L40A 4ND3A 1IHXA 1M66A 3WQQA 7ADHA 2EKLA 5A06A 3KZVA 1PS0A 3DZGA 4HFNA 2G17A 1YS4A 3F6YA 4OQYA 5I9NA 3QJ5A 5FWNA 1I10A 1N9GB 1YB1A 2NTJA 5AXCA 3GG9A 4D3FA 4ZJUA 3WGZA 2FP4A 4RF2A 3OJLA 4L0QA 4W6ZA 2VWHA 3DBHA 1ZIDA 2GASA 2HAEA 4DPLA 1GV0A 3IS3A 1FDVA 1ADGA 1H9BA 1PZGA 3L6DA 4CR7A 3PHHA 4I1IA 3WYBA 4YT8A 3LT0A 3ICPA 2PD6A 2Y93A 1SB8A 4DLBA 4TRNA 3MJTA 3S1LA 5EESA 2Z1MA 3I9KA 4RZHA 4B4OA 4CR6A 3JD1A 3I9LA 2CF5A 2PV7A 2YV2A 3DB2A 4CLEA 2X23A 1K6IA 3SJ7A 3P2OA 2O7QA 2J5KA 3Q9UA 4KQWA 1CERA 4D7AA 1MG5A 2PK3A 2BGKA 4GKVA 4ILKA 4D0RA 2PZLA 5KTKA 4I9NA 2RH4A 2DTEA 1FDUA 5CFZA 2Y1DA 2WE7A 4WCFC 3RBXA 1NASA 2YY7A 4XYMA 4XZ3A 4XR4A 1KS9A 5F1PA 3WFIA 4E5NA 4Z0PA 1NPTO 3TFOA 1HWYA 1C1DA 2I5PO 3WMWA 2EXXA 2ZB7A 5IXSA 3ZV5A 1PZFA 4CV2A 2X8LA 1R12A 4TVOA 2X1HA 2CDCA 4R1NA 1NP3A 2Q1TA 3ZWOA 2Q1WA 3VZPA 3M2TA 4Z9FA 3KYCB 1YKFA 3VOSA 5I7FA 2YFQA 2C7VA 2CFCA 4D79A 3H2SA 3KLMX 4LCEA 1I3MA 1K0UA 4R1TA 5TQVA 2C0CA 1VJ1A 1HYHA 1XU7A 4XIJA 2GSDA 4XYEA 5DP1A 1W4ZA 5BNTA 2X9NA 4YRBA 1U3WA 3DOJA 4XEHA 4BNWA 1ADBA 1ZMTA 3KV3O 4CLRB 2JAPA 5CPFA 4FJ0A 1TT7A 4MP6A 5T8KC 1LRKA 1E5LA 3RU9A 2Y1CA 1N9GA 4F45A 3HN2A 1V35A 1VLLA 5TC4A 2IRWA 1E3EA 4DBVO 2NNLD 2Y1OA 3OQ1A 2XAAA 3F9IA 3U62A 2FOIA 3DZIA 2QG4A 3P5SA 4DYDA 5JC8A 4B8ZA 5KJCA 2V6GA 3PYXA 3RFXA 2GRAA 4KUHA 2A35A 3PVZA 1W0CA 1DC3A 4WPGA 1ISFA 3GRKA 4OSPA 2DM6A 1RWBA 3GNQA 1Z75A 2WEKA 3ITKA 4OXNA 4W99A 1U7TA 5L3ZA 3ZZNA 5GZ6A 3PLRA 1Q7CA 3AY7A 3K31A 3ZV4A 3ZDFA 3PIDA 3WGYA 2Q3EA 4UEKA 3ZNNA 2PLAA 3I6IA 1PS9A 1PJCA 2FPPA 1TLTA 1IE3A 1BXGB 2ZJ1A 1LRLA 3FBGA 3H5AA 1FK8A 3K8ZA 3O4RA 3U49A 1U8FO 1FJHA 1BVRA 1M2WA 4TVBA 5DNAA 3VKUA 1H5QA 4BGIA 1UXKA 4B3HA 2AEJA 4GKBA 4UEJA 2I3GA 4A5OA 3VPHA 2QX7A 4CUJA 1QYWA 4GBJA 4YT5A 4NJOA 2Y0CA 1H6AA 3KYCA 4U0KA 2VTEA 1SOWA 1GCUA 1DPGA 1J4AA 3C3XA 3WJAA 1DIBA 4XDYA 1B7GO 3L4BA 1IZ0A 2C20A 2EIHA 2HO5A 2GR9A 5CEFA 3GMDA 4FN4A 5IJZA 3OIFA 4LK3A 3ZU5A 3QVSA 2I67A 4AJ2A 2AG8A 1TXGA 5A02A 3NUGA 2PNFA 5EL0A 5I9MA 1E7QA 1UP6A 3VVBA 5BNFA 4CLRA 2PD4A 2AE2A 4JJIA 5TGDA 2GN4A 1QLJA 4WOJA 3LK7A 4R41A 3NT2A 4L4SA 4UVIA 3AOEA 5AYVA 1QSGA 5AQ1A 1NR1A 3HDQA 3PWZA 1EUDA 2Y67A 1JQBA 2IZZA 1YB4A 2J3IA 4WEQA 1MGOA 1DIAA 1PQUA 3ADOA 4K28A 1E7YA 3N7UA 3T4EA 4NFHA 4DC0A 3KVOA 1PQWA 1JKIA 1ISIA 2HKIA 3DTYA 1DJNA 1EZ4A 3I9MA 4M86A 1AXGA 4IJVA 4NJMB 1M6WA 4AL4A 4MIEA 2VOEA 3EMKA 1QR6A 2HK7A 3GFGA 2PD3A 4GX2A 1HLDA 5IAAA 2VWGA 3WGIA 1E3LA 2QW8A 3TJRA 1HE4A 5COBA 4Z3KA 2P5YA 1VKNA 3KYDB 3GGGA 2ZTLA 4WGGA 2EGHA 5L7WA 1DLIA 1BXGA 3E48A 3GVXA 5L4SA 2DPHA 4Q3AA 4QQRA 4M55A 1B15A 4BO3A 3AI1A 3ZU4A 1OMOA 1Y6JA 3C8MA 4J4HA 3JYLA 4L9RA 1U3UA 1BTOA 4OMUA 3HJAA 3ROQA 3ON5A 1CEQA 3X2FA 4ALIA 1JWBB 5F1KA 2EJWA 3JQ7B 3UVEA 4K9DA 4PFJA 1ZKMA 5JLAA 4A27A 5EINA 1PGNA 1NAIA 2Y1GA 3RROA 4JP2A 5DOZA 2VRCA 2CNBA 1ZEJA 1KYQA 2ZCVA 5C37A 2OL4A 1UXHA 3VPSA 3ETEA 2G0TA 4G5HA 4R5MA 1XHLA 4NBUA 3W4KA 1LDNA 1T2FA 2AG5A 2LDBA 2JD0A 3F5SA 3WTCA 1LRJA 3DHEA 5EERA 4CV1A 3OJFA 3GVPA 3G1TA 1T25A 4NBTA 4J7UA 1HRDA 1K6JA 4GX0A 1Z6ZA 4XGIA 1SPXA 2DTDA 3B6ZA 1CYDA 1P33A 4BNLA 3CZRA 4M89A 1LLCA 1VPDA 3IUSA 4B8WA 2HCTA 3GEDA 1XLTA 5KKAA 1P9LA 4BNKA 3MJSA 1ZUD1 3ORFA 4LSMA 1WXDA 4OOFA 3RU7A 3GAZA 3WGGA 4FFMA 1B16A 1G6KA 3ZWXA 2W90A 3OECA 3HNPA 4BGVA 3LDHA 2VWQA 4DA9A 4EUFA 3B1JA 1NQAO 3GPIA 3PZBA 4NJMA 4DRYA 4BOYA 3SVTA 1XWFA 4IDFA 2B35A 4MJLA 4WE3A 5A9RA 1I2BA 1Q2XA 3LC2O 2O48X 1IZ9A 5T6BA 4E5KA 1HEUA 1U2GA 4E4YA 1SB9A 4CLXA 2PY6A 4NI5A 3FNHA 3KYDA 4JLWA 4CLHA 1XELA 1SAYA 1OFGA 3WB9A 4AG3A 4XJTA 1P74A 3V8BA 2PGLA 3T7EA 5JW6A 1DAPA 1O0SA 2PWZA 2QZZA 4D46A 3E1KA 1LX6A 3JQ7A 3IUPA 4S1VA 3HQ4O 2B83A 5DCWA 2JD2A 5L45A 2O4UX 3CH6A 1LJ8A 4E30A 2HLPA 3A4VA 2O3UA 1MXFA 4B7CA 3NAQA 4DXHA 3TL3A 1XR3A 2OGUA 4CL8A 1AUPA 2HSDA 3NDRA 3HB5X 2WJPA 2B37A 2Q2QA 2HUNA 2I3AA 1KY5A 2WWRA 4PVDA 3E03A 3NKLA 3SC6A 4BIIA 3UXYA 2WD8A 4I9UA 4L76A 4BO6A 6LDHA 2B5WA 1R0LA 2R6JA 3E82A 3UOGA 1OC4A 4UAGA 3F1LA 3G0OA 3QQPA 4NR0A 3P19A 3W8FA 3TZCA 3ZNQA 3WTBA 1GYPA 4XYGA 4EITA 4CLDA 4NNJA 4MVJE 1LSSA 3EC7A 1X0XA 3RSHA 4WNCA 2VT2A 1U5AA 2A94A 4LGVA 1ZK0A 3RUIA 1LA2A 3MWDB 1EEHA 4BO4A 1TT5B 3PRJA 2VZ8A 2WE8A 3AK4A 3FNEA 3QE3A 1ZXBA 3WNQA 3G3EA 2IYOA 3DAPA 4P8RA 3VDRA 4UVEA 3KM0A 4YWJA 2O2SA 4PLWA 1KOLA 3MTGA 4F46A 3MJEA 1B8UA 3K2EA 4ROSA 4LRTB 4ZVVA 1PJBA 4A7PA 3C85A 4ALNA 1SOVA 4WASA 3C7DB 3BHJA 2VYND 5JMWA 1HE2A 5FYDA 1W73A 4PLZA 4ESOA 1NXQA 1ZZEA 1DB3A 4CQLB 3H4VA 4YQYA 3ADPA 2B4TO 1RYEA 2DBZA 3B1FA 3F5QA 2VOJA 4O59O 3DOOA 4IGEA 3IQDB 4E2WA 4J0FA 1BG6A 4KDFA 5BQFA 2POQX 3ASUA 4TRMA 3DC2A 3JQ6A 5G4KB 3IKTA 2CF6A 1WAMA 3VH3A 1OI7A 3IC5A 4IDAA 2RAFA 4FFOA 3WX0A 4IINA 4WUVA 5TLSA 4J7CA 2HJSA 3L6EA 4KMSA 4BNNA 3MZ0A 2FR1A 4WOKA 2BH9A 4IUYA 1YQDA 2Q50A 2NVWA 4J90A 1P31A 1WP4A 3FWNA 3JQAD 4JJFA 1I01A 3ZWNA 5JDIC 4BMSA 1K6XA 1ZJZA 2P9CA 3LT1A 3BHIA 4BNUA 4ZRMA 3OJ0A 1ZSYA 4AJEA 1NAHA 2OP0A 1L1FA 2EW8A 1LC3A 1FDWA 2OHXA 1MLDA 1LSJA 2DPGA 3R1IA 2X0JA 2Y99A 3EY4A 4JBHA 3PXXA 1XA0A 4BGUA 4DLAA 3LQFA 3WYEA 1GYRA 1O94A 2WSBA 2BF7A 3PHGA 4DIBA 1PL6A 4TZKA 1HDOA 4L8VA 1Y8QB 4YPOA 4Y8VA 1EK5A 3JD4A 1PR3A 1A27A 4QUKA 3KBOA 1X15A 3OA0A 2GGSA 5CDUA 2CVZA 5K6AC 1I8TA 1TT5A 3PFWO 2VUTA 5JBIA 1GV1A 1IULA 1NFFA 1Y8RB 1MFPA 3VZQA 3QHAA 1RYDA 2Z95A 3QA9A 2Z5LA 4K26A 4GLLA 3VPGA 1H93A 4CMCA 3OHSX 4Y98A 1EUZA 3DMYA 4CQLA 1R66A 2UVDA 1TA4A 4TQGA 2FSVA 3KRTA 1LLDA 1OC2A 4WLVA 5TT1A 1YONA 3W6ZA 3ZHXA 5JC1A 1PSDA 4CMAA 2HMUA 3PJEA 4QEDA 1U7HA 5G4KA 5HWSA 2WYVA 5HA5A 5U4QA 1Y5MA 1B26A 4J1SA 1HKUA 2VTDA 3ETDA 1EDZA 4MDHA 4IQGA 5CDYA 4FFPA 3P2YA 1B0AA 1JWAB 3ULKA 3VC7A 1SNYA 3BMQB 2P91A 4XQGA 4YJHB 4C7KA 4MINA 4R1SA 1JAYA 2W98A 5FFFA 3W4JA 1UZLA 2TMDA 3WYCA 3PFFA 2RBEA 5DBIA 1LEHA 4OOEA 3IP3A 3BIOA 2Y0DA 4BNVA 3JQEA 3A28A 3Q9NA 1HZJA 2DVMA 1ADCA 2FPIA 3QWFA 1D7OA 5JPIA 7MDHA 4BNXA 1U8XX 3DQPA 4EYEA 1NFRA 4OKNA 2VYVD 4R9SA 3JQFC 2BFOA 3RASA 3I9OA 2PZJA 3ENKA 1R6DA 1K2WA 1YDWA 2J5RA 3K96A 4AJIA 3SLKA 1CJCA 3FR7A 3JQ9A 1P1KA 3DL2A 4XD2A 2FMUA 1HYEA 4XCVA 1Y8QA 6ADHA 3PGJA 3K92A 3RUDA 4J2OA 3AU8A 2EF1A 4YB8A 3GF4A 3AUTA 3HHPA 4XJSA 1BMDA 4EBFA 1MP0A 2YYYA 1V3UA 4P4LA 3RJ5A 4KUGA 2QRKA 4MPDA 2E4AA 1Y8RA 2CSUA 3EGOA 3GZ4A 3AJRA 3WIEA 5DOVA 1JU9A 1NVTA 3WIDA 4E21A 2BFAA 4YCAA 2IE0A 4K6CA 2NU9A 3NTRA 4XIYA 1FDSA 2D0IA 3L77A 1H9AA 3FNGA 2B0JA 3TOXA 4Z9YA 4B4UA 2VUSA 3ZWMA 4IMPA 1Z73A 2I76A 1HDXA 2PH5A 3RC7A 2DAPA 1EVZA 4UUNA 4XB1A 3S2EA 4MO2A 3H9UA 4P22A 1PL7A 3LLSA 1HDYA 4IDBA 2DUWA 4NQZA 4EDFA 3JD3A 1CF2O 1EUCA 3GEMA 4IZIA 2ZYAA 3UW3A 4RVHA 2AA3A 3E6AA 4HY3A 3ZWVA 1YQGA 2EEZA 1WLYA 3B20A 2D59A 2IEBA 3FCOA 4IXTA 5DCYA 2XOXA 3QVWA 3K30A 5JCXA 2BRUA 3BMQA 3ONFA 1UXGA 2Y66A 2HRZA 3BTUA 4RV9A 3KTDA 5TJHA 4CM9D 1KVTA 1CIVA 4GSKA 5IZ4A 2FR8A 1DFHA 4GSLA 4CQMB 3ABIA 3W6UA 3WLEA 2CD9A 2ZIZA 2ZYDA 1P77A 5KIAA 4O1MA 2O50A 4DUPA 3ZWCA 2H5LA 1I3LA 4NBRA 4A03A 4GWKA 4LMRA 1LU9A 5T67A 3G17A 2FRDA 1ZK2A 4R01A 1GTMA 4Z6KA 2O3QA 2G82A 4FIZA 4PIVA 2Q2WA 3SBOA 9LDTA 4WLEA 4MOWA 1N8KA 1QV7A 5AXBA 2VHYA 1YBVA 3LZ6A 3D5TA 1KERA 1JLLA 4FD3A 2ZKLA 2OUIA 2QYSA 3PWKA 3UF0A 3UICA 5L7TA 2OXIA 3ETGA 4GH5A 4EEXA 2H9IA 3UCFA 4CR8A 3GHYA 5TSDA 2CVQA 1EQ2A 1G0NA 4AICA 3DHYA 4O5OA 2Q4BA 3GFBA 5IFLA 1A5ZA 5ICMA 1JKFA 1V8BA 4I5FA 4FFRA 3OH8A 3BYZA 4NK4A 2YDYA 3D4NA 1NHGA 4OAQA 1ENYA 2GN6A 2VYNA 3BTVA 4BNFA 3TQHA 3WQSB 4W7HA 2E6UX 3LU1A 4MVJP 3E9NA 4O6VA 4YBZA 1EFLA 4H15A 4WLFA 3OM9A 2O4CA 2GZ3A 4BO9A 1YOVB 3H9EO 5HRUA 2ZTMA 4O63O 5F5LA 1ZK3A 1ZCJA 2FSSA 2DFDA 4KOAA 3WMXA 3FRJA 4LW8A 4NBWA 1HDZA 3VVCA 1KEPA 1UDCA 3G1UA 2NM0A 3ONEA 1ENOA 5B4VA 5G2OA 4G65A 4RCVA 3STHA 2G5CA 4D45A 5B1YA 3I83A 1IHYA 1DHTA 4HUJA 1GPDG 3EUWA 5THKA 1YO6A 4BMVA 1VC2A 4CM5A 3X2EA 3BAZA 4CQMA 3A06A 4FB5A 3DTTA 1H2HA 1DDOA 1QG6A 3UFXA 2YQ4A 2C2XA 4JK3A 3WXBA 1ONNA 1T2AA 1NFQA 1ZK4A 4KWHA 1AHIA 3BA1A 1PWXA 1C14A 2PKQP 4L75A 1KBZA 4PRKA 5ILOA 3GNSA 4PRLA 4FFLA 4DL9A 1G1AA 1GQQA 4J4BA 2VNAA 3EK2A 1HE3A 3JCZA 3Q2IA 3F3SA 1W8DA 4CV3A 4EZBA 4FQ8A 4Y6PA 2ILTA 3ANNA 1ISHA 3MWEB 4BNYA 4DVJA 1A9ZA 3JQBA 1DHRA 3O03A 4NHEA 1B2LA 3OJOA 2PH3A 2QQ5A 3T7CA 5G0VA 2NTVA 3BMNB 3RUAA 3QWBA 3DMTC 4IY1A 1PEDA 1ID1A 1YDEA 4I5DA 1PR9A 4JCOA 4BGEA 1PGQA 3PZRA 4XRGA 3MJCA 3DZHA 5DF1A 3IL2A 1XDWA 1KEWA 1NQ5A 3GNTA 2AE1A 4TRRA 3QY9A 5KKCA 4TKMA 3V5NA 1L7DA 3DHNA 4AJJA 3KETA 2NTNA 2J6IA 3JV7A 1U5CA 2RCYA 3F1KA 2JHGA 1KEVA 1C0IA 4CM8B 4YAIA 1YOVA 2C82A 4LSWA 5BNIA 2PR2A 3L6OO 4W7IA 2ZTUA 2PTGA 4HNHA 2X86A 4YTEA 3PYLA 2Q49A 1R37A 2PZKA 4CMEC 1R0SA 4IGFA 5ILGA 1ISMA 2DFVA 4YJFB 3CPSA 3ZWPA 3LT2A 3GRPA 2C54A 3FTNA 2E37A 2XXBA 3JYQA 1BXKA 1KY4A 1YB5A 4E3ZA 1AGNA 3PIIA 2VNSA 4F6CA 5F21A 3KLPX 2BD0A 2PZMA 1PU2A 3AU9A 4M54A 1PS8A 5AOVA 2X0RA 4XQEA 3UH1A 2ZB8A 3L9XA 3SX2A 2FPGA 1E1NA 3ZU3A 4D0SA 2QZ9A 1XU9A 4R4JA 2IYPA 2EERA 1QYCA 2VYVA 2RHRA 4J9VA 2JFGA 4BL5A 4D3DA 3M6IA 4IDCA 4CL3A 1BWSA 3NGXA 4FC7A 5TT0A 4QT0A 5CDTA 5G0TA 4P4NA 3TFQA 5JFOA 3Q0EA 1JW9B 2IDZA 4DLLA 4LRSB 1E3JA 1F17A 2JCXA 4DC1A 4NU6A 3GMSA 4QSMA 4F6LA 3O38A 2X58A 4YVFA 3GDGA 1ENPA 2AQHA 5IN5A 1GEGA 3DEYX 1HL3A 1BSVA 1E6WA 2YV3A 3JD0A 4J0EA 2NACA 5DULA 3IOYA 4JXKA 3BMNA 2J3JA 3IDSA 3Q1LA 1H0KA 4J9UE 1EDOA 1ZW1A 1XEAA 3GQVA 4J2HA 5GMOA 3U09A 1I0ZA 1SBYA 4TKLA 3SEFA 5IZCA 4J1TA 1GZ4A 3ASVA 5U9CA 3KO8A 1ISGA 2W2LD 2O7SA 4XYLA 1V3TA 2NVUB 3HFSA 4IJUA 3G79A 3GLQA 4B7UA 1X7HA 1GAEO 4IS2A 4CM7A 2HMTA 3RFVA 5DBGA 3AM3A 3NGLA 3OMLA 5A9SB 1ZMOA 2JFHA 1J6UA 4CM8A 5ENDA 4N5LA 2TMGA 3B1KA 1A4IA 3PQFA 2CMDA 3WGQA 4BNHA 1E6EA 5T64A 3VDQA 3RKRA 3WWZA 3PDUA 3P7MA 4YJDA 3I1JA 4ZQBA 1GUFA 3MJ4A 5TX7A 5BR7A 4YJFA 1N92A 2B69A 1JVBA 1Y5RA 4EI2A 2PKRA 3QLJA 4E5YA 3H7AA 1LQTA 4E2ZA 5CPBA 4JROA 3D5QA 3IAHA 2GO1A 2H6EA 2J3HA 4OH1A 5TS3A 1JDJA 4QO7A 1YRLA 2E48A 1XKQA 3BMOB 1SMKA 8ADHA 4W4TA 1JKJA 4Z0TA 3WGOA 3TF5A 3HN7A 5G0SA 1B3RA 1UAYA 3S55A 4D43A 3H8VA 1DC6A 1YBAA 1EQUA 3D4PA 4II3A 2YFHA 3H6KA 4BO8A 3RUEA 2HK8A 1NWCA 2R00C 5JO9A 3ZH2A 4UUOA 4MVJD 4CM4B 3JD2A 1V0JA 2EW2A 2FWMX 2IODA 4CV0A 5B12A 1KVRA 1WPQA 2YW9A 4G81A 5JY1A 1ZK1A 4Y9DA 4D3SA 3L0DA 1LDBA 3RBZA 2FZEA 3JYOA 4Q3BA 3WSWA 1E7RA 5TNXA 1C3VA 2C5EA 1G0OA 4PLCA 1PTJA 2P4HX 4MVJI 4W9NA 4XGKA 5DN9A 5A04A 5B37A 1EE9A 5JNLA 2D5CA 4YDRA 3JTMA 2NU6A 4OGWA 4DMMA 3UHAA 1YWGO 5EMHA 1XYGA 4FJ2A 3OQ6A 2NVUA 2EHDA 3EHEA 3R0IA 2O23A 5A5EA 1O89A 1PGOA 2CUKA 3GC6A 1T1RA 2P9EA 5A9SA 4ONEA 3M1AA 4IM7A 3KYBA 4BHTA 1DLJA 4DPMA 1FXSA 5H81A 2VHZA 4YR9A 1E3IA 4QX6A 1U3TA 2AQKA 3L9WA 1I3KA 1IYZA 3WGTA 4WLNA 4B7XA 3SLGA 5JYEA 3SC4A 4ZHSA 2VN8A 1A71A 1LDMA 2W4QA 3CE6A 3ZHYA 4CODB 4E31A 2P2SA 4I9HA 4YEDA 1PX0A 3PDJA 1R15A 1LI4A 2OZPA 2DT5A 1Z82A 1JA9A 5KOIA 3SJUA 1MUUA 3HDJA 1C0KA 3VKVA 1SEVA 4NDNE 4DMLA 3PTZA 1J0XO 4MVJF 5DT9A 5KVVA 1O9BA 4NU5A 4MKRA 1QRRA 2Q1UA 1NTOA 5A9TA 4LVCA 1N2SA 1O8CA 3BMOA 3GPDG 4LCJA 1LDGA 1O6ZA 2XPCA 3OETA 4DPKA 1ENZA 1PWZA 4QO8A 4BUCA 4BMNA 5CEJA 1U1IA 3TWOA 4CMBA 1JVSA 2YDXA 3GHHA 5T57A 2XXJA 3RC2A 3ZNOA 4WCFB 2GD1O 1HDRA 3I3OA 2OFPA 5IDXA 3UKOA 1X14A 1E6UA 3I9NA 3FWZA 3HB4X 3MOIA 4PN3A 1XG5A 1B8VA 2I99A 4ZQGA 3W4IA 4CM4A 1YJQA 1ULSA 2EKQA 4MP8A 1IPFA 2DBQA 2Q1SA 3N74A 5BSHA 4I08A 2AQ8A 4NFYA 2WM3A 1ONPA 2HU2A 4MP3A 1J5PA 1E7SA 3DZBA 2PA3A 1P1RA 4UULA 5K9ZA 4YAJA 4FPXA 1PZHA 4FJ1A 1P1HA 3QWIA 2EJVA 4GVXA 4J6FA 4EJMA 3QV1A 4JQCA 1BHSA 5F5NA 4AJNA 4XDZA 2P5UA 4RF3A 5L4LA 4LN1A 1UAGA 2PFGA 3ZV3A 1X0VA 1EBFA 1QKIA 3UAGA 1PJ2A 4DYVA 5JCJD 1P0CA 1SEPA 3NTOA 3CXRA 3PPIA 2V6BA 4F3YA 5HS4A 2EKPA 3DAFA 1HLPA 1Q7GA 3H5RA 1GADO 3GVIA 2R2GA 3QSGA 2I65A 4N5NA 3AOEC 3ZW8A 2GPTA 3GOHA 4FDAA 4JGBA 2D8AA 5LDHA 4WLOA 3R6DA 1UDAA 3DZKA 2X7HA 4XYBA 5LC1A 2ZJ0A 5JSFA 1SO8A 1U4OA 3EDMA 1I33A 3DR3A 3AM5A 3KUXA 4IIUA 4YRDA 4WNIA 2HJRA 2YV1A 2ZQZA 3AI2A 4U6SA 5G4LA 5JO0A 1HZZA 1U4SA 2DU8A 4OYRA 4GGPA 5H82A 4PLGA 3C7CB 4IDGA 1I36A 4KDEA 1I30A 4ID9A 3DFUA 4R51A 4D42A 5TJ9A 1T4DA 1AN9A 4Q3DA 5EN4A 4BNGA 4IDDA 5T5QA 5J23A 4X54A 4DTIA 2X5OA 1B3BA 2PKQO 4R3NA 4WCFA 3U3XA 5A1TA 2Q99A 4HADA 3ROKA 1F8GA 2G1UA 4C4OA 2ET6A 3CSDA 3DAGA 3NRCA 3PHJA 3KEQA 2YHIB 1YL7A 4QFCA 1UR5A 3HUDA 3DXFA 4AJ4A 2AEMA 3NX4A 2EGGA 4CMIB 4PZCA 1VKOA 3V1UA 1TI7A 4Q3EA 3OJEA 4OXYA 4JIGA 4WK6A 5I7EA 1X13A 3ONDA 3NTQA 3ZV6A 4HFMA 1U2DA 2Q2VA 2D5AA 1A4UA 1GPJA 3PEFA 1OAAA 4AFNA 4A26A 4M49A 4PVCA 1IL0A 3GAFA 4IJKA 2GN8A 4PLYA 1OBFO 4ZD6A 1HETA 1Q0QA 5ER6A 2Q45A 2RIRA 4GL4A 3WNVA 3A9WA 4PLPA 1UJMA 3GG2A 1NX6A 2D1YA 2P4QA 1H6BA 4AJ1A 5JDCC 1HDGO 3FI9A 1LSOA 3AFNA 1GEEA 2LDXA 5T8KA 2NU7A 4RDHA 3IJRA 3RWBA 3MJVA 1ULUA 3FF4A 1YL5A 2AQIA 5COQA 1ZNQO 3FPLA 4MVJM 4HBGA 8LDHA 5IXYA 4YYZA 2H1SA 3VH4A 5B4UA 1LBEA 3F4LA 3ANLA 3QVXA 4UVGA 4E33A 3AI3A 4OM8A 4BVAA 3H2ZA 4EGFA 4RJTA 2E82A 2O3TA 1WW8A 4KP7A 5A03A 5L95A 1A9YA 4OQZA 1Q0HA 1DSSG 4GX1A 1I32A 3RUHA 3I5MA 3DMTA 1LC0A 4RORA 2VT3A 1ZBQA 1E1MA 3BHMA 1MV8A 4C7JA 5GZ1A 1RM3A 4BNIA 2X22A 1FF9A 1T2EA 5FEUA 4K1LA 3F46A 5IDWA 1Z45A 4XQ9A 2Z1NA 3VTZA 4E2XA 1NHWA 4ND2A 4E5PA 1WDKA 3K73O 4GI2A 1T2DA 5HTOA 2YHIA 2VZ0A 3DBVO 4WJZA 2IZ1A 4IZHA 1PJ3A 1JAXA 1ZJYA 4L4RA 4Y6RA 2F1KA 3GEGA 3VZSA 5L9AA 4CMEA 2AXQA 4CMIA 3INTA 1DIHA 3IP1A 3OSUA 3ZWWA 1PGPA 3QP9A 4MVJG 3DO5A 4GPD1 3KSZO 1Y9AA 4IQ0A 4WECA 3JQDA 1CQJA 2NLOA 1QV6A 1I24A 4XRRA 1NPDA 1ZVMA 4PLFA 4UVDA 4IQ8A 4Z9XA 2HMWA 4J4TA 4CLOB 4E32A 3CMCO 1P3DA 2GF2A 4P38A 4PG6A 3DZJA 4J7XA 1X7GA 5A5FA 1LDEA 3DFZA 4NK5A 4UREA 4TZTA 1RM4A 2I9PA 4ZU3A 1HT0A 2PGJA 5L4NA 3PP8A 1E3SA 1HSOA 4NBVA 4PCVA 4IMRA 1E3WB 3LVFO 2QYTA 4H7PA 1F06A 1VL6A 3JQAB 1A7AA 5AXDA 3RQSA 1Y1PA 4YT4A 1GUYA 4LMPA 2ZQYA 1BRMA 4OIMA 4QTZA 3JQ8B 4II2A 5AVOA 2B4RO 4ALLA 3UN1A 1KEUA 3R3SA 4KWIA 4CMHA 1MX3A 3V1YA 3RFTA 1QLHA 5CDSA 1OZAA 1WNTA 2ZTVA 2NQTA 2DBVO 1SZJG 3PJGA 4OJNA 3E9MA 2X0NA 3HDYA 4RVFA 4B3JA 1YXMA 4ZGWA 1DJQA 4FOOA 3GUCA 4FBGA 1ZEMA 5DBFA 3AM4A 4A0SA 5I8WA 2ZB3A 3U4CA 1PJLA 1PQPA 3L07A 2Y0EA 3K5PA 3NYWA 4PLTA 3LC7O 5ENVA 4EEZA 2BKAA 1XIVA 3GUYA 4WKGA 4H3VA 1CWUA 5L7YA 1H6DA 4RPLA 1C0LA 1UZMA 4J16A 3HDHA 4IDEA 3VH1A 2EP7A 3U9LA 2Y1EA 1I3NA 1AXEA 1RM0A 2OO5A 2JFFA 3C1AA 4U8GA 4R9RA 5A3VA 4RVGA 3TPCA 3TZHA 4ALMA 3NJ4A 4PG4A 1Y9EA 2BMAA 4I5EA 1F0YA 3RVDA 1E77A 1ISJA 5I9LA 3NJ8A 1JTVA 4CMKA 1Y7TA 2NWQA 1FMCA 5JCJA 5BSFA 3EVTA 3FR8A 2FY8A 5EQFA 1S6YA 2BHLA 3CMMA 1LSUA 4JP3A 4CLOA 3Q3CA 4ZQEA 1EK6A 5CG1A 3CTMA 5K0ZA 2J5QA 3LF2A 2UDPA 4H16A 1DO8A 3OQBA 4P4GA 1R4NB 1D4FA 3UCEA 4E12A 3E18A 1EFKA 2C07A 4DIFA 4FOSA 2VUUA 2E49A 5ITVA 5FI5A 1V3VA 4DQVA 1LLUA 1WMAA 1E3WA 1QYXA 2D4AA 4IJWA 1LTHR 4PLVA 3E5RA 2R00A 4CMGA 5KVQA 4IPTA 1KC1A 3JQAA 3NDIA 5ER9A 3VZRA 4ZQHA 2Q46A 4NIMA 1KC3A 4J1QA 5DP2A 1KVSA 4E2YA 5L53A 3PWSA 5KJ1A 2NSDA 1W6UA 4JN6B 3UUWA 2Y05A 3U4DA 3JQ8A 3D3EA 3HSKA 1QORA 3RI3A 1YL6A 3EVNA 4RL6A 3RJ9A 1RJWA 1HYGA 3IKVA 4N5MA 1RKXA 4EUEA 3EYWA 2X5JO 4ND4A 3TN7A 3N58A 5CEEA 4BKUA 4NPCA 3BZUA 2V65A 2D3TA 1E1KA 2O3SA 2YZ7A 4BKRA 1EBUA 3L4SO 3VH2A 2AEFA 5EIOA 1J49A 3NT4A 2F00A 5LDGA 1WWKA 1BDBA 4IXWA 4EJ0A 3RD5A 1ORRA 3CUKA 5B4TA 1NQOA 4W82A 3OICA 3WICA 2FZWA 3NEPX 3GDOA 1NM5A 1UUFA 3U5TA 4DQXA 2IXAA 4HX5A 2P68A 4BNZA 3WR5A 4FW8A 4AJLA 3EAGA 5CP8A 4GQAA 5ES3A 2BGMA 3V2HA 2JCVA 5ICSA 4YRAA 3JSAA 1P0FA 1XCBA 1N7GA 1O95A 4KQXA 2YJZA 4BNMA 4EJ6A 9LDBA 1LDYA 1GY8A 3QVOA 5I8ZA 1FDTA 3ZU2A 3I4CA 1E7MA 4NH4A 4PG5A 4HV4A 1DBVO 1T2CA 1I5RA 3RKUA 2VHWA 3ZW9A 5ADHA 1DFIA 1N5DA 1R4NA 4RDIA 1ARZA 5BT9A 3RUCA 3MCVA 4M8SA 2OP1A 4HKTA 2BFMA 1WVGA 5THQA 3UCXA 5MDHA 2B36A 1M75A 3ZWYA 3NT5A 3NV9A 1BVUA 4HWKA 3JQ9C 1YE3A 3ZI0A 2EV9A 3FD8A 4NMHA 3BTOA 3NDJA 4E0BA 3BTSA 4GMGA 3INGA 1NVMB 1MXHA 4RF5A 3V2UA 1H2BA 2JCYA 5JE8A 1GU7A 4ZRNA 4L4XA 4MVJH 4Z3DA 1D8AA 1EE2A 4ZA2A 3RCBA 2Q4EA 4DGSA 1GZ3A 5CAEA 2PGDA 4L74A 3LF1A 3WBBA 4ZICA 3FBTA 1F14A 3OEWA 3PJFA 4FR5A 5HBRA 3VHRA 4J91A 4PG8A 1VRWA 3DOCA 4UUPA 5JAMA 2WYWA 3WSVA 1LXCA 5COAA 5GY7A 2BGLA 1UP4A 1B14A 1VI2A 2GCGA 3AFMA 4OKIA 4TRJA 3LLVA 3FHLA 3OIGA 1P1JA 3HADA 4Z0HO 5TF4A 4M87A 3MEQA 4GVLA 5TRTA 3PHIA 2W8ZA 3GDFA 3AUSA 4B79A 1DEHA 2ZB4A 4GMFA 4AJKA 3U0BA 2ZCUA 1NPYA 3LT4A 5KNLA 1DAOA 2QIOA 4RVUA 3V2GA 1V6AA 5JAQA 4NZ9A 1P45A 2EG9A 1DIRA 4JNKA 5I7SA 2W2KB 3TDKA 1CRWG 2C2YA 3E5MA 4BNJA 2JJYA 4U5QA 5JDIA 2WMDA 2I66A 2IZ0A 3TZKA 5HM8A 4BKOA 3DWFA 4ND1A 2UUPA 2WDZA 4LVUA 3QWHA 2VZ9A 4UUMA 3S2FA 3RUFA 3GA0A 4PZDA 4RO0A 4INAA 4J1NA 3IMFA 2BI8A 2WYUA 1QYDA 2VHXA 1RPNA 1P1FA 3GN2A 2YUTA 4R54A 3O9ZA 4CM9A 3VPXA 5EQDA 2NV6A 2OOSA 2AMFA 1UP7A 3UGKA 1DFGA 4RVDA 4J43A 1XSEA 3ZWAA 5K6AA 3FN4A 3PQEA 3H9GA 5IN4A 4YT2A 1KIFA 5JXWA 1EVYA 3D1LA 2B4QA 5JMPA 4CJXA 5KJ6A 1TVEA 1A7KA 3JYNA 2RHCA 2QRLA 2HDHA 2GZ2A 1MG0A 3WOHA 2C59A 4U7WA 2J3KA 1Q1NA 4GX5A 1KVUA 1ONOA 1ZO8A 2XF8A 2RH8A 2VQ3A 1WZIA 1VJ0A
chains in the Genus database with same CATH superfamily
1E2FA 1Y3CE 2BI7A 3MCAA 3G5MA 1E2HA 2QRJA 4RNCA 5ERXA 1NW7A 3WGNA 5BSGA 1VBFA 3DTVA 2EX1A 3HU3A 3WWYA 3ZY4A 3CINA 3K2BA 3B70A 2PS1A 5LWHA 1JXAA 1Z7BA 4YJ3F 3FRIA 1ODLA 2EBWA 2RD2A 4M1QA 3D3WB 3QLUA 4IL5A 3GVCA 4DMKA 3ZXSA 3BX1A 1FLNA 5J5CA 2FN4A 3H83A 4OQXA 2DXIA 3U7EB 2OHFA 2CYCA 3I23A 1EMDA 1K08A 2X5KO 3QKSB 4XWAA 3U4HA 4QUGA 2YWCA 1E2NA 3ZXIA 3CC8A 1WUJS 2XSZD 4CM6A 2EP5A 3KOUA 1H5UA 3I9JA 1ZSNA 1IOZA 4UNNA 1SUEA 2P9ZA 4B1FA 3O1JC 2OFWA 4CG2A 1COWA 3PQDA 5TY0A 1E4VA 1VOTA 5EGNA 3ZWBA 4DS3A 2O1WA 4OL0A 2JLVA 1BGVA 3I1YA 3UGJA 1GWNA 2V0NA 5BV8A 3CR7A 5CHEA 4ND7A 5LMNB 1ZQ1A 5AP9A 1VL0A 1GL3A 2AOUA 4C0LA 4NYMR 2WIKA 2WFLA 5JYDA 4RHXA 2GX6A 2R7NA 4LZWA 4YACA 1WOMA 2GLXA 4HXYA 1EH5A 2DBRA 3TNYA 3IV7A 1Y7HA 1BOOA 1BYIA 3G2OA 3QWAA 4M9QA 5EHQA 2J3MA 4TS9A 2GF9A 3VPFA 2JL1A 2IYYA 3VM6A 4B3IA 3AEKB 1CQIB 3ZJUA 1WXWA 2A0WA 4B3MB 3LUGA 4D8VA 1DC5A 1RNLA 3ZDYB 5C80A 4FEYA 4RVOA 5BURA 5KQMA 3PL5A 1J21A 1XROA 2IPAB 2EOAA 4FGLA 5CT5A 2P6UA 2PVPA 4KXFB 5F1YA 3ZHOA 1R5OA 3KSAC 3K0CC 3ZHUA 2CSXA 3IESA 1LNQA 4EGAA 2W22A 3EOZA 2FR0A 5C2JB 2UZIR 3K9GA 3WG9A 1EUQA 1RKUA 4A2WA 5JNWA 3MUNA 3AY3A 4FB4A 1CR2A 2D74A 4RU1A 1SCUB 3A6JA 3RC1A 1WA5A 4DRXB 1IXSB 3PENA 3S2IA 5LJLA 1VHJA 1U3FA 1E0DA 2ZZKA 3GY0A 1CNEA 3AUXA 1TGVA 2CNDA 1LZLA 2FCRA 1VJTA 4O1IA 2ECFA 2JHFA 3UOWA 2XLCA 5A05A 3SICE 3R5HA 4HXFB 5KYGA 1M5RA 2OCDA 4RY2A 1AO0A 4GOMD 4N7RA 1CR1A 1H8ED 2BFPA 4MS3B 1RRVA 3DE5X 3OHPA 4IQFA 5DI3A 1WM1A 4O4JF 4QFDA 4D9CA 3EPKA 5EJ2A 3QKRB 2F3QA 5KJFA 1P62B 3SXJA 4GP6A 4RPHA 3Q6MA 3R0ZA 4P54A 1A5SB 5HJ7A 2NUPB 2CDBA 3F6BX 4YHHB 2I8CA 3QPUA 4DLSA 3PNMA 1JFVA 3R2JA 3ANMA 3R3JA 1N6LA 1HOTA 2Z4RA 2V7TA 3EN0A 4RETA 3S44A 3VDMA 3HACA 4U6NA 4XSVA 2M9MA 4F72A 4BYMA 4NDAA 3G6KA 4YRLA 4URYR 2ZUFA 3SIXA 1N4AA 3FMVA 1D9ZA 3MPOA 4JU8A 4YA6A 2QTRA 3FBWA 3V7FA 4JWKA 2AW5A 1QS0B 3FMOB 3Q8WA 2ZIXA 3GVHA 1MW8X 3EXEB 3PQ3A 4QQFA 1B73A 1H2EA 4E14A 3I34X 3PX3A 4RTOA 4W8GA 4ACBA 2KM1A 2Y1WA 4QLOA 3I64A 4P6VF 2VL7A 4CHTA 4NYIR 3CB4A 3ZHZA 4MYHA 2XWJI 5IBRA 1BX3A 3PJDA 1OU0A 4QGFA 5HIKA 1Z0KA 2B30A 4P5EA 4Y2HA 3GMIA 1ABFA 1IY8A 1E63A 3JQGA 3N0RA 4D9GA 4RABA 4RPIA 3ZX5A 2FX5A 1TIKA 2A14A 1B6SA 3LBHA 4LHXA 1S9HA 4NE9A 2VHCA 5CA0F 2CNWA 1NSYA 2MT9A 1TW2A 1QQ5A 1G6OA 2Q3MA 1DGQA 4JYCA 3LP8A 4BO7A 13PKA 4V1CB 4NL4H 4BVHA 2I4IA 5DGIA 1SXIA 3EGXB 1F4VA 2WFZA 4OUDB 4RWZA 2OXEA 3VHQA 1Q1BA 2Q8PA 5JFGA 8ATCA 3AQIA 3W9YA 4BNDB 3KHSA 4KNVA 1BW9B 2QI9C 3JAKB 1AK9A 4UE6A 4AJOA 5BN3A 1NQTA 1TC1A 2O3JA 3B5JA 3AOGA 1QHHB 4MUNA 4FSHA 3CNLA 1GU0A 2CWWA 3MSXA 4RQTA 5IZCC 2Z2YA 4J1TC 2WQ6A 1QRTA 4HATA 2W0SA 4ER6A 2HT1A 1B2RA 2PYIA 5CUQA 5TV2A 1GL9B 3CUYA 2I1LA 3WL8A 1XXHE 3HCBA 2YYZA 2Z04A 3KJFA 4YMUA 1VJ5A 4UZEA 1ZH8A 5JVDB 4B34A 1N77A 5DTMA 6GPBA 3QLTA 4K6FA 3SC2A 4EEKA 4YAKA 2HK9A 1ZUNA 2J67A 1KKUA 3B12A 2YBDA 1U3VA 4LYAA 1QP8A 1D2CA 3K0HA 3MD9A 1AVTA 1WVMA 2EYUA 3VAYA 3IAS1 1XZBA 1B8OA 3V4ZA 4UM9B 2VP6A 3DONA 1DXYA 3WYAA 3OF3A 3CX7A 3A1SA 2CHVA 4DIOA 3H6HA 3AH8A 2QHXA 2JGKA 3TIVA 3EODA 1P6QA 3LHSA 4P3OA 4MKXA 3TZLA 3X2SA 1P6XA 5HZHA 5DSTA 1TTTA 2PJRA 2JCGA 2XVAA 2Y1LA 4MV7A 4ZPXA 3PXUA 2YV5A 4E5YA 2VYCA 5GJWC 1VGRA 1VPVA 2QTZA 3BPSA 2HLDA 3ELUA 3MGAA 2PNJA 3COWA 2XT9A 3BIXA 1NBOA 5E3JA 4E6PA 5BYAA 2B5VA 1JECA 4TSRA 5K4AA 5BQXA 4JXZA 5ALLA 1I0LA 3FYSA 2JFYA 2VK4A 1Z7EA 4I6JA 5BMVF 3VPBA 1MJNA 4Z8XA 1E9CA 1YJCA 1DCKA 1GKKA 2B1JA 1PJTA 2DTXA 4KPGA 4IRMA 4AKHA 1P4HA 3TUZC 3HZZA 4X3CA 5F2EA 4WK0B 3DMDA 2ODTX 4J0HA 4KLAA 3AF3A 1ZU4A 1T35A 1KZ1A 4L73A 4NNOA 4Y67A 5IC4A 3FYCA 2IQIA 1W0JA 2QQFA 3OMXA 3U4IA 4MI3A 5FBZA 3UAZA 1M76A 3I52A 5JZBA 3IEIA 3BBPA 4OHFA 4V0MA 3K70D 2PMCA 1QF9A 1P44A 1HURA 1VCMA 3A9RA 3VU9A 1PNQA 4RELA 4FN5A 5CLQA 3SQMA 4EW6A 5I4BA 3LGAA 2VEDA 5JS1A 1VB5A 2W2NA 2AFHA 2FZCA 4H3HB 1NU8A 3PYMA 2DPYA 3BXXA 5KVSA 521PA 5JAPA 2W2MA 3HV2A 4XKJA 3GGPA 2R84A 4F7WA 1FX0B 2HGZA 3QOXA 1E5QA 1FYVA 1T5DX 1APBA 5DM1A 1XAGA 5EJGA 2Y4NA 3RM3A 1AQIA 2CY0A 3BG5A 3CKLA 3F47A 3MRSA 4M1EA 4XJVA 5AVJA 3LSYA 1PTJC 4S12A 4Y7CA 3M5DA 2H1OA 2R7AA 4XOIA 5FPKA 3LAWA 1PHRA 1PL8A 4I4TB 3QK7A 3SYRA 1EXMA 2NUAA 5EIBD 3IERA 1QUEA 1NKTA 1FTNA 1C1YA 2J8ZA 2IEAA 3OOJA 4LSGA 5ARDA 4BUZA 1VYUA 5DLEA 3FOEC 1MAAA 1V96A 1H4SA 4RMHA 2C9YA 3OQMA 3VKHA 3I2KA 3DLHA 3WZLA 4XOUA 4ES6A 4L4YA 2EFJA 1QFYA 1UBFA 2O19A 3QE0A 1C8KA 1YASA 1SUFA 4I8XA 1GQYA 1GXSB 3ABRB 4JLVA 4QYWA 5HE9A 2C00A 4NCAA 2L82A 1W52X 4AY3A 2Q4TA 4DWOA 5EPOA 3WC4A 1DAFA 4DDMA 5JQGB 5K8LA 3CA8A 2HQ1A 3F96A 4BQSA 1O6CA 1U8EA 4LE2A 4KK3A 2AGVA 2D1FA 3M9XA 1TGYA 1F8FA 4G2NA 3C7AA 3RNOA 2WQZA 5IG2A 5KCZA 2EBFX 1T8UA 4A6XA 1ZRMA 4NYJR 1B0UA 4HGZA 2CLEB 2WFMA 4MJ3A 2QE6A 4R69A 2XUZA 4ZVKA 1NLZA 1RXUA 3MMZA 3Q10A 3OEYA 1NVXQ 4Z1MD 1G5RA 1TU3A 2ZULA 5K99A 3WFJA 3Q5EA 1EFUA 2F3SA 3BDAA 1Q0PA 4NZOA 4PPQA 2V6MA 3P0EA 3C3MA 1W30A 1QXSA 3P0JA 1T10A 3IQWA 3ROPA 3L8CA 5C7OO 1PGJA 4JVNA 3REGA 3DV9A 3FVRA 1P4SA 3RRNA 4BP9A 3H65A 5LMCA 1ODSA 1NXVA 3HPQA 2BDUA 2CL5A 2EAUA 1SUCA 4AROA 2OORA 3A14A 3WAGA 4ZVPA 3Q2KA 4RGBA 2VWPA 2JD1A 4EL5A 3HV0A 4CI0B 1G21A 4L6CA 3GCGA 4NCHA 4OSOA 3H3FA 2Q6TA 4V0OA 1Z5UA 2OQVA 4CKYA 5ABPA 1TRHA 2CK3D 2GAAA 4IJQA 4XASA 4JLSA 1C81A 3EVBA 3DE3X 4YXFA 5JTUA 4RA9B 4P1ZA 1WMBA 2ID7A 1SQSA 4L8WB 2G9NA 3UAXA 1L5HB 1AB6A 2HM7A 2A92A 1RWMA 3GNLA 2D00A 3HRIA 4O29A 1OZGA 2WICA 1N2JA 4YQZA 4CG0A 4W5NA 2YIJA 5EE9A 1BMQA 4XWKA 3JQCA 1U28A 1KH1A 1RQNA 2OSVA 4YMLA 5AVXA 2GBGA 1HY3A 3MYRA 3TPFA 1E1DA 3GJRA 4RFVA 4BB5A 4EUNA 1FVXA 1VA4A 3EWSA 5AM1A 1VL8A 2VK8A 2XTAA 3BH7A 3I9FA 4EHBA 1CETA 4K6GA 4X6XA 4ZCRA 1ZH6A 2BL4A 4TROA 3RAGA 1OH6A 2P62A 3N2LA 1QYIA 3NC4A 4JX8A 3TZ6A 4CUZA 1WDLA 1J1ZA 2IEDA 3F6EX 1UWKA 2RK4A 3P9SA 3CCCA 1EYZA 4LDZA 3OZXA 2QROA 4TXNA 3U17A 4EFDA 4YY3B 4HYQA 2Q5OA 3R3ZA 2ZS9A 5REQB 2OKGA 4KN9S 1LI5A 4IJ6A 1M66A 2BGTA 3WQQA 2BCJQ 4JR1A 3ZDBA 3DE6X 4RMIA 3DZGA 2IBSA 3CF6R 4HFNA 4YRRA 2DFTA 2UZAA 2NV0A 2B4KA 5JFTA 2GB4A 10MHA 5LIRA 2ADOA 4MV0A 3ZIAA 1NKVA 3QELB 1ML4A 2OCIA 1FFAA 4WZZA 4ZJUA 1QU2A 3OJLA 4L0QA 3VR3A 4W6ZA 4HWSA 4OX9Y 2X76A 1ZIDA 2GASA 4DPLA 3SQLA 4TYPA 4DLRA 1WB9A 2AC2A 5KS2A 2AFIB 3PHHA 5ITZA 3LY8A 1HT1E 2D7CA 2PD6A 4FVTA 4LNHA 5AKJA 2ODNA 2QX4A 3VSEA 1P5HA 1N6IA 1J2UA 4WCVA 3BORA 4TRNA 1IY2A 2Z1MA 5ERYA 1L4BA 5HEKA 5CH3A 3FROA 5FAXA 4B4OA 3UMYA 4YRCA 3I8OA 2CF5A 1ZMBA 2P78A 4HN9A 1JEJA 3NG1A 5AJWA 5LM3A 3L6CA 1YRBA 1K6IA 3SJ7A 5DM0A 4D98A 3GAMA 1Z5ZA 3D6JA 4A0RA 1MG5A 3A4TA 4ZCLA 4Y1RB 3RYIA 2J07A 1NOKA 1HMPA 4ILKA 4D0RA 2OHVA 1A97A 5KTKA 1N0VC 2R79A 2OXTA 1OB2A 1FDUA 3EUEA 4ZEXA 1H1LA 1II8A 1OVMA 1GSHA 1QDLB 3I8XA 4XR4A 2RH9B 3Q0TA 1CJVC 4MQEB 3WFIA 4CTOA 3SSNA 1SOUA 1MOQA 1NPTO 4JT9A 4Z0PA 1KJ8A 1W34A 5ARCA 3I2IA 2I5PO 1XZPA 3I73A 5DHQA 1FPQA 3KELA 2IYEA 2H2GA 1OIWA 2A30A 4EX7A 2W2XA 4X8LA 4CV2A 1DTSA 4O2AB 2ZYHA 2HA3A 2OG1A 2HCJB 3SKYA 4EMBA 2X0KA 2HMAA 3DTNA 1YSCA 1M6YA 2AZTA 4RWEA 4CYMA 2BFCB 3M2TA 3VZPA 3KYCB 3UB3A 4CF4A 5JQWA 5JUWA 2PYDA 1AIPA 5EWJA 1BCRA 4BFWA 4ZYUA 3FCXA 2YJ5A 3H2SA 2HU8A 2VNKA 3KLMX 2YOHA 5E2IA 2TECE 3O7WA 4HPXB 3SSOA 5D2CA 3BQMB 3LV8A 2PBRA 1HYHA 2AN4A 1B76A 3DMNA 2WHEA 3G9QA 4MIKA 3QTTA 2JJMA 5F7JA 4F85A 2RONA 4BNWA 3FDJA 3LJKA 3WLNA 1MVOA 5EY5B 1DTWB 1PTKA 1C50A 1BDJA 1NVKA 1U5BA 5BV7A 5T8KC 1TM7E 2NAFA 3CLVA 3IAUA 4HNSA 5EHZA 3T35A 1GL6A 3T3IA 3DBIA 5LQRA 4JLNA 1N9GA 2W00A 2PUFA 5AW5A 4Q02A 1E5DA 4MB6A 4BBAA 4KPUA 4F45A 5K5EA 1VPEA 4B6PA 3UOAB 2A9QA 5F7XA 4LBWA 2C1XA 3TRFA 1N2CE 5CA1B 3EIFA 2G4CA 3O7MA 4DBVO 4WFJA 4BPBA 3R20A 1SZPA 2JAUA 3UJ6A 3DZIA 1Y3AA 1R0ZA 4HWPA 5CFLA 1JH8A 4FUQA 1L5KA 3BZBA 3PGKA 3D1JA 2ZRIA 3PYXA 1YU9A 3DYIA 3LUJA 2J7KA 3OQIA 4LVOA 3LQRA 2IITA 3PHBE 4KUHA 4M4SA 3IV9A 1C7EA 5H9WA 5EIFA 3PE4A 1PT5A 2VPZA 1YF3A 3N3BC 3GRKA 1QWOA 2G28A 4HUQA 1RWBA 1F5NA 3T61A 1YS1X 3EE6A 4IKOA 5EG5A 3Q5DA 4O4LB 1P5RA 2WINI 1UL1X 3BXEA 5L3ZA 3ZZNA 1MVLA 1FYXA 2F43A 3R3UA 3ASZA 3MWEA 3NR2A 1CP2A 2Q3EA 4OYLA 4UEKA 5EQTA 4KQMA 3ZTYA 3WAJA 1PJCA 3UKDA 3ZXYA 4PYMA 1IE3A 1BXGB 2ZJ1A 4MW1A 3H5AA 3K8ZA 4EOGA 1XTRA 1X7YB 1CULC 4TVBA 3VKUA 4KWCA 5CYGA 1OA1A 1O1YA 2J5XA 1MQSA 4HL6A 2VEOA 1C8VB 1VRCA 7GPBA 2BEWA 3AUKA 3BB3A 1JZTA 2QX7A 2IU0A 2C2OA 1W47A 5LWQA 3E35A 2BMVA 2Y0CA 3O9MA 4MDYA 2CFSA 4ZZIA 5HIAA 4U0KA 1SOWA 4P5PA 1HDEA 2VDUE 4QBFA 2YYSA 3C3DA 2NPOA 2HA5A 3D6MA 3FMFA 5JSQA 3I2YX 1UFVA 2HA7A 1MX9A 2C20A 1P2TA 2X6RA 4O2RA 1DKPA 2G63A 1U6JA 4GE0A 5HFNA 4CFYA 1W25A 4L7VA 4OJTA 5IVPA 1KJZA 2K87A 2PAAA 4I55F 4AJ2A 1RJDA 2APJA 2AG8A 1QCDA 1TXGA 4WN9B 3NUGA 3FB4A 1SY7A 4MCIA 5I9MA 3TTWA 3RTAA 3VVBA 5JXHA 4FOLA 2FH5B 3Q8LA 2PD4A 1ADJA 1RZRA 2QD3A 2P9YA 4Q66C 3N70A 4MR8A 2GN4A 1QLJA 4RK1A 5FO0A 4A0QA 4R41A 4MHTA 3LPAA 4L4SA 5FWYA 2OM6A 4P92A 3RPEA 1QSGA 3NB0A 4D80A 1HPLA 4MPTA 2PSSA 4YUAA 4PBRA 1EUDA 2GI4A 4S1WA 5GOTA 3UMVA 3I58A 1IUOA 2IZZA 1GG5A 1W8IA 2J3IA 4WEQA 3UWKA 5BW4A 4LK2A 3UC5A 4K28A 1E7YA 2L0XA 5ILQA 4RKRA 1HKHA 3KQMA 3N7UA 5LYYA 4CEJA 1K7XB 1NUSA 3KU1A 4DC0A 4FFBB 2QJWA 3EXIB 3Q3GE 3T3DA 3V7YA 1H0RA 3EASA 4JBWA 5SYMA 1ISIA 3ETJA 2VZEA 3HKCB 3VYWA 1LS1A 2GXUA 1E8NA 2WYHA 1AXGA 1BE1A 1IRIA 3HU5A 1EK0A 2ZTSA 1M6WA 1KO8A 2B25A 4RCYA 2PXAA 3IR5A 2ZRMA 1Z08A 1PLKA 2GCEA 1JUDA 1OV6A 1M1ZA 2VOEA 3AT1A 4HPJB 3TL6A 5J2TB 2NXNA 4Q34A 1Z68A 3RLIA 4ZHQF 2VWGA 4ZWNA 3H1FA 1SBTA 1P8JA 1GTRA 5LUBA 2DCUA 3Q40A 4J0QA 3KQUA 2B9VA 1P61B 4KMMA 4Z3KA 1PV1A 5FB3A 3UV3A 2J9GA 2JFXA 4YQFA 2O6LA 1RXSA 1M34B 1JKXA 4PYRA 4D26A 5L7WA 1DLIA 3E48A 2JZNA 1N7IA 1OPXA 4QQRA 4U7JA 4NCJA 4UHDA 4YDQA 1GPBA 3K0KA 3FGNA 3W5JA 4QOGA 3NS7A 3N86A 1KI2A 1VE6A 4K9NA 2KBEA 3C8MA 4YK7A 3Q7EA 1U3UA 1BTOA 1QBGA 4TLMB 1KK2A 1KYTA 3HJAA 4IF6A 3ROQA 3X2FA 3JTEA 4C08A 4F7DA 4ALIA 1VL2A 2EJWA 3EIHA 3IT3A 4K9DA 4PFJA 2IYTA 4RSHA 2WC1A 4KRGA 2Y1GA 2V7WA 2RGNC 2D4HA 2XCTB 2VRCA 3O2NA 3QITA 1RLUA 1O0CA 4G84A 4QRIA 2FSHA 2QLMA 3H6GA 4ZJYA 2CNLA 4EW3A 4XWTA 1NT2A 1T3SA 2G0TA 2V3VA 3ETEA 4MYSA 2GQ0A 4R5MA 5HTKA 1U7PA 2O5RA 3BKXA 4G37A 4D4MA 3U37A 2AG5A 4EQ6B 3F5SA 5JZVA 3HBAA 4RK6A 3G1TA 2Q1XA 3LQKA 4BX0A 3E7WA 1P9RA 4J7UA 5JSYA 1J0AA 5BW5A 3RSOA 4BNLA 5J43A 4DB4A 2JRCA 1G3RA 3OZSA 3GGDA 3KSMA 1VPDA 3TM5A 2W0MA 4G09A 4TMYA 1NYQA 5KKAA 3D6FA 3GIDA 3O91A 4C2AA 1ILEA 3T99A 4KJXA 3ZLUA 1A8QA 2ONYA 4Q7MB 1L7QA 2QQ0A 2ZUVA 2G5TA 2QR3A 1J2RA 3EZ2A 3R5SA 1UMCA 1Y6RA 4W1SA 3OECA 1U8ZA 1FS5A 1MBZA 2BGNA 2VJLA 3HNPA 1CFZA 3LDHA 1WL8A 2FJUA 2VWQA 3JQRA 4Q7JB 3H1EA 4G9EA 3TXYA 4KQ9A 3GPIA 4DA9A 2H29A 4YRFA 2GHTA 4QYSA 2HIAA 1GZ7A 1G8AA 1XWFA 2WAAA 5AUPB 1KZGB 4PBSA 2B35A 4ZT2A 4HAWA 1GPUA 1I2BA 1QBKC 3H5LA 3PQ4A 4CTNA 4AMUA 1IZ9A 4Z4GA 2C83A 2OZKA 4E4YA 3QJGA 1L9XA 1JIIA 4OI1A 5LZ7A 4F5WA 1SB9A 4H6PA 4ID3A 1R6XA 4CLXA 2PY6A 4NI5A 2XLBA 5FOVA 5LFAA 1CVIA 2VXOA 4JLWA 4RD3A 5ECDA 2JLZA 4C4SA 4DLTA 5JROA 4CLHA 2BTEA 2R1TA 3C7KA 3WB9A 4XD7D 2C5BA 4ZT5A 5FUVA 1SZCA 1EJBA 1NV9A 2Z2KA 3T7EA 4PSDA 3P71T 1IBCA 2UXCB 1KSJA 5CCEA 3JAWB 3NIFB 4YROA 2PWZA 1YU6A 4QODA 3C0KA 3G88A 2JFZA 1LX6A 3WP1B 5BN3B 2SKEA 2YXPX 4FE3A 3JU3A 1CY2A 4QJ5A 1N2XA 4S1VA 2B83A 3M6UA 1LJ8A 2ZSAA 4V0RA 1ZD8A 1JLRA 4B7CA 4V0ME 1ZJ6A 2J7PD 2YRFA 1AKTA 1D8TA 3KXIA 1TZKA 3AUJB 1G98A 2E87A 1OHHD 3D81A 1UJCA 4JJEA 4O5AA 3VNQA 4CL8A 4GDFA 3NDRA 4H9GA 4RVNA 2AFHE 1V7ZA 4DMRA 2O05A 3W5AA 4IRXA 1PVVA 2BGRA 4P9NA 1EHYA 3H0CA 1KY5A 3Q88A 2G09A 3SC6A 3G8DA 4MQLA 1J06A 1CUHA 1T13A 4L2IA 3OOSA 2WD8A 4U9HS 4AZVA 2RGRA 4GXRA 2R8XA 3DQZA 4L76A 1NYLA 4DCVA 2B5WA 2G1KA 4OSEA 5K3FA 4ESVA 1ELOA 2R6JA 3HLTA 5CVUA 3UOGA 3CSUA 4UOEA 3L4JA 3ZJVA 4DV4B 4XGQA 2QS9A 2C84A 3VJRA 1ZP6A 3W8FA 1SWWA 4URUR 3TZCA 3VQTA 3ZNQA 4R2KA 3LP6A 3QFCA 5DEIA 2JGRA 4YJ3B 4EITA 1ZD2P 3GT3A 1IMJA 1IOVA 3M9WA 1UDWA 2ZSFA 4UHBA 4CLDA 5J4VA 1T4CA 2ONJA 4R31A 2NPIA 4CN9A 3DL7A 1U5AA 2A94A 3EZ9A 4B6JA 3TQSA 1LA2A 1U9YA 4E08A 1EEHA 5ALZA 3DV2A 2DJ5A 1NUHA 2DR3A 1E32A 2A1IA 2VZ8A 4ZT6A 5F7OA 1ZXBA 2HY7A 4QPZA 3WNQA 5CB4F 4B3SB 1HBJA 4NDZA 2IYOA 3GWGA 4P8RA 4HH3C 3VDRA 1DNPA 3KM0A 1F8YA 3CTPA 3MB5A 2FSGA 3MTDA 4PC2A 1BHQ1 1SGWA 2ZYSA 4EYKA 4QDKA 3WQHA 4GE3A 2YY5A 1QAOA 2R97A 4OXXA 1ULTA 4H7IA 2BY4A 4QDZA 4OYHA 3T5TA 1UFQA 3PJRA 1A9XB 3AEUA 3CRZA 4QGSA 3FLEA 4ALNA 4CCWA 4BMPB 4GG1A 1GPWB 3C7DB 4NX2A 1KRWA 2WF8A 3KKLA 1W73A 3LBIA 5FYDA 3T0IA 4MICA 1J2EA 1KI1A 3K15A 3GFQA 5IJWA 1DJMA 5DH9A 2PL5A 2O7NA 3H4VA 2AJTA 3U3JA 2OHIA 2I78A 1RYEA 5JI3E 4MV3A 5DK4A 2X15A 4LBZA 4J0FA 1BG6A 2ZI9A 2YZGA 2JEOA 2X4IA 4G25A 3EPHA 5CT6A 4TRMA 5G4KB 1WAMA 2H1CA 2E4UA 1DBRA 2XNDA 2VA8A 5LJIA 1NJ8A 4N6GA 3SOPA 3WX0A 5JRDS 2D13A 4IINA 4LZOA 5EKXA 3W7BA 3R6GA 1G9SA 4BNNA 2DHQA 2F3PA 3EIXA 4LWQA 2RGCA 1G21E 5FTNA 2X8JB 5AHOA 1M2KA 1QU3A 4J3NA 2OLEA 2XGJA 1K6EA 1UKYA 3QXGA 4WOKA 3FKSA 1OKKD 2BH9A 1R6BX 2Q50A 4IUYA 1GPKA 4KQJA 4B6GA 1WP4A 3FWNA 1RWKA 3B2EA 1NL3A 3NRBA 4S1TA 1WBBA 2EW1A 4D4JA 5KYXB 2OCLA 4KIWA 3W04A 2P9CA 3BERA 5LMZA 2LTAA 2IE8A 3BHIA 1GG8A 2C9DA 4QYIB 3V6MA 4KE8A 1XKTA 2J9XB 4FCVA 4KAFA 3ANTA 4LGCA 4CKBB 2M2IA 3BRSA 1FRFS 2EQ5A 2A0FA 1QIEA 2FPIB 2F8TA 3LNTA 2G04A 1L1FA 2EW8A 3D6AA 1LC3A 1FDWA 5KYWA 2R44A 4G3XA 1QIMA 4AS1A 3MLEA 4R2HA 3PXXA 4WKOA 4JVOA 1W9MA 3LRTA 4V0NA 4BGUA 2ZT5A 4O4JB 1KMCA 3V6LA 1OV4A 1RWWA 4RULA 1NE7A 3OT4A 3PHGA 3P32A 2IEZA 4FI3F 4WXMA 4DIKA 4F91B 3MIZA 1F60A 4WESB 5F98A 3FAKA 1W48A 4JLKA 3KE9A 4JAVC 1NRWA 2NT3A 1VCOA 3QYJA 4QU5A 1TF2A 4MPPA 1BXRA 2FLVA 2PFKA 5LXTA 1ORWA 4J0DA 3OPMA 3QLEA 2VUTA 1F3LA 2QYHA 4ME6A 4MTCA 3RVNA 4I4NA 5FEMA 5JBIA 2MSNA 2HTEA 1L8XA 1H22A 5J5VA 3S27A 4M0KA 1RHJA 3VZQA 4NV0A 4FNGA 4M7RA 3TLGB 3I2FA 3RJZA 5KTOA 3QHAA 2FF5A 4ZREA 3EC1A 4LA4A 3LCVB 2AR0A 1MABB 2XGSA 2LCFA 4JLMA 4K88A 3SE7A 3M6FA 5EWLA 3PPXA 4LKRA 3SYKA 2NPFA 4EW2A 1U7OA 4RA6A 3ERCA 1DAIA 1TA4A 1NJSA 1WZUA 1Z0SA 2FSVA 2RI0A 2Y4OA 2WIAA 1IZ7A 3QX9A 4MROA 4Q05A 4MV9A 4AC9A 5DTEA 1I7SB 3N9IA 1E61A 2E1RA 4PAQA 1OAKA 2GK4A 3P0RA 4L9WA 2EP8A 2W6ID 5EMLA 5FNVA 2H17A 3NU1A 3QLUC 2FMXA 5IEBA 3WB2A 5HWSA 4HZGA 4BRUA 5MN4A 5CA0B 5DM60 1D2HA 1R6VA 4H08A 3OLXA 5U4QA 3IE2A 1Y5MA 1Q14A 2KQUA 3K6KA 4X24A 3ETDA 1EDZA 1M6NA 1G8PA 3EMBA 1FJ2A 3QM1A 2ZVPX 4IQGA 4MW6A 5E6RA 3VR4D 1S9DA 5CDYA 1B0AA 1JWAB 1KFBB 1RBYA 1IXZA 1SNYA 3BMQB 5FOXA 3KTOA 2RG7A 3C48A 4Q4LA 3K4PA 1N6KA 2VS1A 1EAYA 1MX5A 1MD9A 5FO1A 2IVFA 1NVUQ 2G67A 1IEVA 2JVKA 1XRSB 2TMDA 4G8BA 4ZP1A 1LEHA 2GZSA 3CIOA 3WLAA 4BNVA 3PF8A 3A28A 2DOKA 3KUUA 2DVMA 3BE8A 4B5KA 5H9VA 3NXKA 1ZIOA 3GPLA 1U7ZA 4DCOA 4OKNA 5AJYA 2VYVD 1FFDA 2FU5C 3ELBA 2OZLB 3I62A 2DKFA 2WZQA 2QJRA 1ZKDA 3E5HA 3RYHA 3CPEA 4AJIA 1K2WA 2HIGA 2YVAA 2PWYA 3KPVA 4PBTA 4IGAA 3SLKA 5LLSA 1A9SA 1P1KA 2P1ZA 3DL2A 2GFQA 3NM4A 3NYRA 4EY6A 4B3RB 1E99A 1KBQA 4QBKA 4XCVA 1EX7A 4EYGA 3L5OA 2W7TA 1BGXT 2DFNA 1EBBA 3HHPA 4Q03A 2QD2A 4D6PA 1AUQA 3WWCA 4IV0A 5GVRA 1MP0A 1T9HA 2OESA 1L4UA 2HRCA 1J0DA 5FWXB 3OUZA 4GPEA 5K0FA 4GUAA 1J2YA 4JBLA 2DY0A 3AUYA 2XMZA 1KE1A 5LPNA 4HQOA 1E0AA 2QRKA 3DCNA 4NMMA 3DULA 5AI5A 5KKNB 2WIBA 1LH0A 2UZ1B 3HPRA 4XM1A 5IMBA 3PA8A 4U3JB 1O2DA 3W5UA 5BMVB 4AF8A 1V2GA 4PE5B 3UQYS 1JU9A 4RH3A 5BN1A 5KYYA 1M5TA 4E21A 5LD2C 4C29A 2XA1A 2C04A 2J4DA 4XPZA 3EZNA 4XCXA 4BAZA 3OTOB 1USWA 5CB8A 3HA5A 4V3CA 2B0JA 2VUSA 3M5CA 4F96A 2FFQA 1MQ8B 4LDNA 4OFZA 4DQLA 4X1YB 1RE1A 1YRAA 4IMPA 3H4MA 2I76A 4Q4HB 1CVLA 1Q95A 2GUWA 3RC7A 5FLXA 1FW6A 1EVZA 2CFIA 2WF7A 2YMMA 2YY6A 1D5WA 1PL7A 5AI4A 1K2VN 2ZANA 3RRXA 3V7UA 1B23P 2XNKA 3JD3A 1CF2O 1ETHA 3LQ4A 4V0SA 1Y9JA 5DHUA 1T9ZA 4CWAA 3E6AA 2YH2A 3N8GA 1XWIA 1YQGA 2JGDA 2JZOA 5CYFA 1XF1A 3OWXA 2J0UB 4IXTA 2B5OA 1U9ZA 4HT3B 1O4VA 3QVWA 5DHFA 1ILWA 2HSEA 2I91A 5JCXA 2CCKA 1H8EA 4R2LA 1NI5A 1AGRA 1FVFA 1UXGA 1W88A 3NWBA 3QVKA 5H3LA 5TJHA 4CM9D 5F12A 1GPH1 2R65A 1N36B 3I6MA 5EKSA 4CQMB 4OQPA 3ABIA 4Y30A 4J0JA 2ZETA 3EIWA 3ZVLA 1P77A 3BXGA 4O1MA 1RJEA 4FGUA 2R8OA 1DOAA 3GRUA 2H5LA 4XQ0A 3IA7A 4WRRA 3JQQA 4C6TB 4LJKA 5DCLA 3G17A 5C0OE 3EBLA 4M1YA 5JASA 3B7WA 1OYYA 4FIZA 3H2GA 4AZ3B 2GM9A 4YRMA 4ZALA 4FDUA 1ESMA 3IUNA 4MOWA 5JJCA 3JSXA 3RLFA 4WJKB 2ZJ7A 2VHYA 1YBVA 3DF9A 3QBDA 2ZUEA 2ZKLA 3WJ1A 4DE5A 3PWKA 3FPHA 1MRSA 1X87A 3WK8A 1QF6A 1JJIA 3CN9A 4IEFB 5B2EA 4CI9A 1W2WB 3UCFA 1DU4A 1I80A 2CVQA 2GPJA 1LPMA 1ODFA 2C2HA 1FFHA 2IU6A 4ZU6X 4KOEC 2IHVA 2Z8YA 3DHYA 3QVGA 5JYBA 2J0QA 4AY4A 4MVCA 2P2GA 1KDZA 2X1MA 5EJIA 4AKGA 2Q5EA 1XLWA 2Q5LA 2I6XA 4MGIR 4KFSA 5DYIA 5FBHA 3W7AA 3B89A 1U4NA 3BYZA 3D4NA 4Q01A 2JIOA 2FJ0A 2OUKA 5DGTA 2I54A 2IH5A 3AEQB 1ZH2A 1GSAA 2XGMA 3A32A 3HXKA 3QUSA 4O02B 4ZTBA 1YR2A 2G71A 5CK5A 3FFWA 1RYBA 2BFFA 3FUWA 5SZKB 3B9RA 3NP7A 1EFLA 1YB7A 1QH9A 2XRYA 1E1RD 1OE0A 4JR0A 4B33A 4H15A 4JYZA 2C7PA 1EE1A 2HRQA 3IBYA 1PBNA 1NW9B 5E3IA 2OBFA 3QNMA 2OSBA 4FYIA 2EZ8A 2A5DA 2ID8A 4KHPB 3W8NA 5IM4F 1YK1A 4O63O 4DDVA 2JK1A 4M76B 2BF4A 3CWZA 1QVWA 1XL1A 2E4VA 3N07A 1DJLA 3FRJA 3HY6A 4I1VA 3PR2B 1NBMD 4IMJB 3SSMA 1UDCA 1TTHA 2ZR7A 2NM0A 2ASVA 2QGNA 5H80A 2G5CA 1X8KA 1ECLA 3GP3A 3TNDA 3WLRA 4D42A 4UBOA 1DHTA 1TYZA 1Y63A 3EUWA 5HBGA 3U7GA 1VC2A 1U0JA 1UZAA 3X2EA 1WXIA 3U7RA 4QRDA 3T0GA 4O25A 4EFKA 4BVLA 4XEUA 3OIUA 5CD9A 4FB5A 3N8HA 1QG6A 1TM5E 2IC5A 3GU3A 1GN9A 3WXMA 1IY1A 2NO0A 3C3AA 3VMFA 1PEKE 3ZLTA 1T2AA 1NFQA 1HYQA 1ZK4A 1VLJA 3OZRA 5KYVA 1PJAA 1VG9B 4H1TA 2DERA 1AHIA 1TPYA 4YYEA 1BD4A 3VR6H 1G64A 4RUKA 4XVCA 4WXYB 1MAUA 4OLFA 1TMYA 4DL9A 4NG4A 1GQQA 1LX7A 4MV4A 5DE3A 4FIDA 4L57A 4C0WA 2MSCB 1XMJA 1YS9A 3OU6A 3AF6A 1ECPA 1VMAA 3ZE7A 4TV9A 3IQZA 2ILTA 4QU8A 4WV3A 3PSHA 3MWEB 1I9GA 5KIAA 2BGIA 2FE4A 3JQBA 4BWFB 4I5IA 1DHRA 2N47A 4HDNA 4KK4A 4NHEA 3VOAA 2OVBA 1RYZA 1EGAA 2QQ5A 1XPOA 2NTVA 3DHVA 2BSQA 4IY1A 3ZLVA 3PDIB 3EPLA 2AWOA 1ID1A 1VGVA 4IHJA 4AKTA 1YDEA 2BR3A 3P2JA 1EFCA 1PR9A 4I5DA 4BGEA 5A4JA 5L3SA 2YIMA 4M0UA 3PZRA 5C1BA 1VG0B 1ZRNA 4CKCA 1RADA 4XRGA 1UPTA 3DZHA 3TQQA 3AL2A 5KWIA 5FTWA 1NQ5A 4INPA 1BWQA 3ZQJA 5KOJB 2CCJA 2JIPA 4YUVA 2JA1A 4TKMA 3VC1A 1IG3A 3DHNA 3ZDQA 4NXNB 2ORED 4RIIA 1IWPB 3KETA 3JV7A 1SIUA 4V02A 4RFLA 1KEEA 1DARA 5AJTA 2HZ7A 2JHGA 3ICVA 4C05A 4KR7A 2I8LA 2OD9A 3OD5A 3I01A 1NJFA 4ABTA 3B48A 4W7IA 2NSLA 3K9BA 4LFAB 1CIPA 1DKLA 2X86A 1PYGA 2YHSA 4Q9LA 4YTEA 1R37A 2WYOA 4Y2VA 4CMEC 4FYJA 5HGJA 1NKSA 4GOND 4GQBA 1U0OC 5GOZA 2O5VA 1EUYA 1T29A 4KE6A 2JJQA 2FMFA 3HK2A 4GMKA 3GRPA 4ZDIA 2G7ZA 1V1RA 3FTNA 1KY4A 3DT9A 2PRKA 1AGNA 1JEYA 1SXJB 1HDIA 1VMEA 3B52X 3CBQA 1UPAA 1ZM9A 3K7EA 4FHDA 3NRJA 4F6CA 5EIWA 4H35A 1G6Q1 4UD2A 4ER7A 5IC5A 3MMPA 5F9HA 4FYYA 5FWDA 2QPLA 1MEEA 2ZB8A 3L9XA 4FEAA 1M2EA 4KSBA 5CVEA 3SX2A 3Q8MA 3ZU3A 1E1NA 1SZDA 2HPHA 4PTYA 2YW2A 3P9CA 1QYCA 3QV2A 4G4IA 3RVMA 2OORC 4C30A 5AVQA 4CTJA 4J9VA 2RHRA 4DIMA 1ZHOA 2SKDA 4IDCA 2ICAA 1YZ3A 4CL3A 5CDTA 1OLUA 2QY6A 4ZCPA 4YUXA 3OE1A 4Z1OA 2EBHX 4INJA 5JFOA 5K0BA 1FFWA 2ZR8A 2AR9A 2GK6A 4Z1MA 1F17A 4DC1A 9ATCA 3HMQA 1U2QA 3IEXA 2CLMB 4GSYA 2FUEA 3WL3A 2A5YB 2AQHA 3NPMA 1EPUA 1GEGA 1AKYA 2OQIA 2PQ2A 3DEYX 3BWMA 4OJQA 5DX8A 4ZC8A 5C3UA 1CUVA 4PTLA 1JIXA 1N78A 4WDQA 4BJHB 1E6WA 4A2PA 2YV3A 3SZOA 2IUSA 2BZ1A 1FNMA 1CV2A 1R10A 1U28C 2IYVA 1MH1A 3DOIA 4L5YA 2IELA 4QUHA 5FP0A 4A82A 5CFNA 3NHJA 2YCBA 3BMNA 4FMBB 2J3JA 3LD9A 4HQ6A 2CB0A 4J9UE 2YWEA 1PX2A 3BCRA 5HFAA 3AUFA 1SVWA 1XEXB 1XEAA 4HGPA 3U09A 1ECCA 4KXWA 2CK3A 1C8BA 2ZPTX 1GZ4A 3IV6A 5FPSA 1XPJA 5FPYA 1L7NA 1DP4A 2W6OA 3HA3A 1QP0A 3KO8A 2ZROA 4PZ0A 2JIRA 3NO4A 2NVUB 1YR7A 3ANSA 3C8UA 4IJUA 2OYSA 3GLQA 1MJGM 4EDHA 2V6JA 3RFVA 3CNNA 1XXLA 3FPSA 1CUAA 4UE3S 3W9BA 1GCIA 5A9SB 1ZMOA 2YMQA<