1EFLA

Human malic enzyme in a quaternary complex with nad, mg, and tartronate
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a closed form of human malic enzyme and implications for catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MALIC ENZYME
total genus 175
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2000-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eflA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1eflA01
4XQEA 4E30A 4GVLA 2DFDA 3S1LA 4J6FA 4YTEA 3GH3A 1NFFA 4FN4A 4UUMA 4WGGA 5JDIC 4P22A 4E5KA 3DR3A 1TVEA 5HS6A 1PL8A 4JJFA 1K5HA 2YV2A 4GX2A 4XX0A 3L4BA 2BELA 5THQA 2G17A 3D4NA 1KBZA 1YKFA 4H16A 3ZNNA 2HJSA 2FSVA 4FIZA 5G0SA 6LDHA 5JC8A 4HV4A 1IULA 3BAZA 3V2GA 3JSAA 2O23A 3E48A 1ID1A 4BMVA 1WP4A 1ZBQA 3GNQA 3P5SA 3OETA 3ETEA 1JKFA 3K2EA 2XF8A 2W2LD 1AUPA 1XGKA 5DDIP 2AE2A 3VH3A 2CVQA 5FYDA 2HRZA 4R51A 2JCYA 3G0OA 3VH1A 3WJ7A 3ZU5A 3W8DA 1U5AA 3ITDA 5JMPA 1T25A 4DMMA 2PKQP 3FNEA 3EW7A 1I8TA 3LK7A 5T64A 3VH4A 3WYCA 1PL7A 1U8FO 4LSMA 1C1XA 3OEYA 5ICMA 3OMLA 1LDNA 3Q2KA 4UVHA 4D3FA 3U3XA 5CAEA 4YB8A 2EJVA 3RC1A 3L07A 4O5OA 1AXGA 1P0FA 4JROA 4WJZA 4BO8A 2AE1A 3DONA 2GZ2A 4K1LA 4L74A 2CMDA 3Q0EA 3ZWVA 2HMVA 2BI7A 1EVIA 3HN2A 2RCYA 2HJRA 4WCFB 4RVDA 1ZK0A 1XU9A 4Q3CA 1YO6A 4UULA 2VUUA 2HDHA 3VDQA 3WIDA 1A4IA 4NMHA 4RO0A 1VM6A 2D5CA 4AJ2A 3TZHA 3FHLA 3D4PA 1NBOA 2BHLA 5L4NA 3DTTA 4R5MA 5KJ6A 2X58A 1X15A 4D46A 2NUAA 1R16A 4GGPA 5HRUA 1G0OA 3GZ4A 4DQUA 1E3LA 2SCUA 1EK5A 3V1YA 4KUEA 3P2YA 3MZ0A 4IXWA 4IQ8A 4Z9YA 3V2UA 5TF4A 4ZVVA 1RM5A 1R12A 1WZIA 1Z7BA 4JBHA 4AG3A 4ALNA 4R01A 1D4FA 1FDSA 1ULSA 3I9LA 3QLJA 4Q3DA 4JP2A 4MVJA 1DRUA 1XR3A 2ZQYA 2RH8A 1QMGA 3RIHA 3L6DA 5LC1A 3VPGA 1VRWA 4IDCA 1A9YA 4OGWA 2I65A 4BNHA 3ROQA 3JQBC 2B37A 4YWJA 5IZCA 4JBGA 2Y67A 3EDMA 5JAZA 4M1QA 4FC6A 4GMFA 4YEDA 3NX4A 1U3UA 1AHIA 4TZKA 3UCXA 1UZLA 3OECA 2Z5LA 1RM4A 3DAFA 2Q1WA 2YDXA 1A9ZA 3JYPA 5U4QA 4CV1A 1X0XA 1DJQA 4KWHA 5TSDA 3CINA 5CDSA 1Y5RA 2PR2A 4BNMA 4TKLA 5A3VA 4CQLB 1Y1PA 2Q45A 1NHWA 3S8MA 2ET6A 5KWEA 2ZCVA 3D1LA 3CXRA 1V3UA 3IDSA 2DQ4A 1W4ZA 4XGIA 5IZCC 1E6UA 1SOVA 3GDOA 7ADHA 2VHYA 4QT0A 4O0LA 2B35A 4HY3A 4CLRB 5A04A 1VKNA 3PHJA 1R6DA 4IMPA 2ZYGA 3KBOA 2GZ1A 4XB1A 2FPGA 4CM4B 2ZTUA 1GY8A 5F3RA 1OAAA 5IFLA 1GUZA 5AXBA 3FCOA 3HHPA 1EVYA 4J43A 4YXFA 4ESOA 4UEOA 1F17A 1HDCA 4CMEA 1A4UA 3DZKA 4Z9FA 2BFOA 1R0SA 2ZATA 2E6UX 1NTOA 2FZWA 2JL1A 3JQEA 1ZK3A 4Y6SA 4BQRA 2O4UX 4BOYA 3WOHA 4WOKA 3OIDA 4BNGA 3KM0A 4XRGA 1E5QA 5FI5A 4PRKA 4MVJE 1NR7A 3LLSA 2FPIA 3JQDA 3UICA 3NDRA 3WFIA 3GAFA 1LLCA 3NGXA 1ZSVA 2DTEA 3DB2A 4YCAA 4RF2A 4HADA 2OO5A 2NM0A 1I3LA 3BYZA 3SC4A 3EUWA 4J4HA 4D7AA 4X54A 2O7QA 3R3SA 4DRYA 3TFOA 2BFAA 2RBEA 4OXYA 4MJLA 3GEMA 1YQDA 2OUIA 3EK2A 5U1PA 5KKCA 3RASA 2TMGA 1JW9B 3A1NA 4IDGA 4IDEA 1N5DA 4E6PA 5L53A 4MVJM 1YL5A 3EC7A 2Q1TA 3RUIA 1ORRA 4HP8A 3LT1A 3ONFA 3HWRA 4BO3A 3I23A 2D5AA 5C7LO 3VZRA 5EJ2A 1MFPA 2GGSA 3PHHA 4UVDA 3ZV3A 2P91A 1F06A 2DTXA 3QWAA 4ALMA 3RD5A 3PLNA 3KETA 4Z0TA 1SNYA 3GK3A 4I9HA 4ZHSA 3UOGA 1OI7A 3FNGA 4HFRA 3MJVA 4OL9A 4CUKA 4ZICA 5I7VA 4F46A 1P1RA 3DMTC 4QEDA 2O3JA 4GAEA 2EIHA 3G1UA 1J6UA 1K0UA 4P4NA 4NIMA 1BHSA 1WLYA 1DJNA 1Y7TA 5DNAA 2VCYA 5EQFA 1I0ZA 5AQ1A 4A73A 3AFNA 3ZWAA 5DCUA 2FSSA 4L73A 1N9GB 1QSGA 2QIOA 2G82A 2H63A 2EV9A 4K28A 1L7DA 4WKGA 2DTDA 3PP8A 3GG9A 4OQZA 2QHXA 3TJRA 3ANNA 3GPDG 4JNKA 2Q1SA 5DOZA 4UUPA 3V8BA 4GWGA 3CH6A 2X8LA 1LSUA 4NHEA 3TSCA 4BNKA 3IUPA 3L9WA 4WLEA 5DCWA 2D0IA 1M6WA 3GPIA 1E7SA 2OXIA 1S6YA 1V9LA 2EF1A 4FFPA 4R1SA 3TL2A 1JN0A 5B37A 4G81A 3ZGYA 4QECA 5F1KA 3GUCA 3MJ4A 4AJLA 5DBFA 4B3JA 5KJFA 3ZWPA 1B2LA 4JCOA 4TSKA 5I7FA 1NHGA 1ENYA 2E49A 2JKVA 4R3WA 4XA8A 1R0LA 2PWZA 1DLJA 4B4WA 3ROKA 3S2IA 1JDJA 4AJ1A 3K9QO 3M6IA 1E1LA 4BB5A 4OM8A 3K30A 4YT4A 3IIEA 1ZMOA 4TKMA 3VHRA 2QZ9A 1P0CA 2GO1A 4UEKA 4CV3A 5JSFA 1CJCA 4R16A 2B69A 3H9UA 3GMSA 2P9EA 1YE3A 1JU9A 1MG5A 4ZQEA 2BGMA 4RPHA 1VL8A 2D8AA 1WZEA 2JCVA 5F1OA 5F5NA 3WWYA 1UZMA 2PLAA 1ZEMA 4KDEA 3A9WA 3PYLA 4BNLA 3E9NA 4CR8A 4Y98A 3F3SA 2CNBA 4E13A 3DBHA 2GN6A 1QV6A 1DSSG 3D7LA 3HG7A 4KQXA 4L76A 3BTUA 3H5RA 1UZNA 4FJ1A 5TS3A 1AHHA 1GUYA 2Y1OA 1R0KA 3A28A 2ZTLA 1LUAA 5JLAA 1LU9A 2PZMA 2X7HA 4KDFA 5A03A 2FR8A 3IOYA 4R9SA 3ROPA 5JYEA 2D59A 3AUTA 3H9EO 1ZH8A 5B4VA 3ZWWA 4EDFA 1UR5A 1E3IA 4XIJA 5H83A 1WPQA 1NQAO 5COQA 2PD4A 1YBAA 4KTVE 3E8XA 5IXSA 4FFMA 4HXYA 1NNUA 5K6AA 1RJWA 4WLFA 2X0IA 1RPNA 3T7CA 2NTJA 2VT3A 1U3VA 1Z6ZA 2VHWA 3DZGA 3K5PA 2X5OA 3NUGA 1PJCA 4IGFA 5IN4A 5EL0A 1BXGB 2DUUA 2QRKA 4R54A 4RVFA 3GR6A 4FOOA 4FW8A 1K6IA 3WIEA 3PDUA 4WCFC 2W8ZA 3I5MA 1A71A 2EXXA 2IXBA 2NTNA 3I6QA 3W6UA 2BFMA 4D41A 5BT9A 1EBUA 3B6ZA 5DP1A 1UXHA 3IAHA 1N1EA 4ND1A 3P7MA 2CZCA 3GHYA 4LW8A 2EW2A 5L45A 2Q2VA 3X2EA 4CODB 1ZCJA 1QP8A 5COBA 4MVJD 1U2GA 1BTOA 1DO8A 4L9RA 3JQCA 3AOGA 3PQFA 4B79A 2E82A 3AUSA 3EY4A 4B8WA 4S1VA 1DXYA 1H6DA 3GGPA 4NBUA 4IBOA 4LVUA 5A3JA 4JX8A 5CEEA 4IDBA 4BQPA 3CMCO 3VH2A 4EJ0A 2YDYA 4FFNA 9LDBA 3I3OA 1Y8QA 4RZIA 4RQTA 4Y67A 3R6DA 1X0VA 1HL3A 1XSEA 1I2CA 4CM6A 3HDYA 3DBLB 2FOIA 3NT2A 4BHTA 1T4DA 3WB9A 2A4KA 1GCOA 2OP0A 3IQDB 1OOEA 2VN8A 3PHLA 1KVTA 2CY0A 4K9DA 4WK6A 4E2YA 5ADHA 1Z75A 1ISGA 4XZ3A 2WJPA 1ISFA 4BNUA 3FI9A 3PQDA 1NPYA 5EESA 1ML3A 2PD3A 1PZHA 5DBGA 1UP6A 3FNHA 2OOSA 4IDAA 3TPCA 2YW9A 4OQYA 1Q0QA 1QLHA 2HKIA 3ONDA 2V6MA 4K6CA 1Q7BA 5T8KA 1DDOA 2YHUA 1JVSA 2AHRA 3EYWA 3MWEB 1XCBA 3IUSA 1JKJA 2DBQA 4CM8B 2Z95A 1LJ8A 4NJMA 5FFFA 1PTJA 2NV6A 1I36A 2VTEA 3GDGA 3GEGA 5EPOA 1T26A 2AQIA 4IIUA 1P31A 2Q4EA 3DHNA 1CIVA 3DEYX 1Q1NA 1YXMA 5TT0A 3C24A 3SC6A 4E31A 3I1JA 1JAYA 5IXYA 1T2CA 3ZWYA 5AOVA 1HDOA 1LDMA 1X7DA 1YQGA 1ZEJA 1XKQA 3FD8A 2P5UA 3ZHYA 1VL6A 1HTBA 1ZFNA 1VC2A 3PHIA 4ZGWA 4MVJI 1E1NA 4BGUA 2A9FA 3QVOA 1QKIA 5C5IA 2VQ3A 2PZLA 3GVPA 4DLLA 3VAZA 4MIEA 5L3ZA 1QLJA 1KIFA 1U7HA 4EJMA 1ZW1A 2O3QA 1O89A 4J0FA 3H2SA 4NK4A 3V1UA 4IS3A 1R66A 3PWZA 5AVOA 4EGFA 2B4TO 1NFQA 5AYVA 2PFGA 2DUWA 3DBHB 4TVBA 2X6TA 4RVGA 3BMNA 4NBTA 3VPHA 1DRWA 4KMSA 5A9SB 3V5NA 1E7MA 2EEZA 1KEVA 2A35A 2W4QA 5BNFA 4Q3NA 3QV1A 4W7HA 3WX0A 3ZWCA 2GERA 3BHIA 2R6JA 3PRJA 4XR4A 3WTBA 3ETDA 4FGSA 4R1UA 1GV1A 4B3IA 5B12A 3LYLA 4PLCA 1BGVA 3BMCB 2Y1FA 3ZWBA 2JFHA 5T67A 4YDRA 1GCUA 2O3SA 4GKVA 4JBIA 1JTVA 4NH4A 4W6ZA 2PA3A 3ZHXA 2HSDA 4EEXA 1LA2A 2EP7A 2QRLA 3COSA 1CQJA 3KOUA 1C14A 1NXQA 3WGHA 3GQVA 2DT5A 3PZRA 4FBGA 3UF0A 1GEEA 3H2ZA 1LC0A 1N8KA 3NDIA 5JNLA 5A9SA 2HRBA 2GN4A 4QTZA 1E3JA 4PIVA 3G17A 1PWZA 3TZKA 1YL7A 1E3WA 1KEUA 1EDZA 4B8ZA 1MFZA 1MC4A 4XKJA 1PGNA 2C7VA 4BNVA 3BZUA 2UV8A 1LRKA 4ITUA 4J7XA 2JAHA 5L4SA 1AXEA 2EWMA 4B4VA 2P2SA 2DBVO 3OA2A 5IF3A 2Q2WA 2VWQA 4NBVA 2FHSA 3F5SA 1SCUA 4W99A 4CLXA 4FB5A 2X23A 4GI2A 5CHEA 4A0SA 4BNFA 4WLOA 1Z45A 3FWZA 5L95A 3H9GA 3JQAA 2ZYAA 4XIYA 4LRTB 3TZQA 3H4VA 4M86A 1UP4A 1V6AA 5CEFA 1ARZA 1BRMA 1AE1A 3O26A 4FQ8A 5G2OA 4PLTA 4GSLA 4II3A 4KUHA 3ZH2A 1FK8A 4MKRA 5JBIA 1SB8A 1I2BA 2JD1A 4PN3A 4CM7A 1ONOA 1YL6A 1JLLA 3DBRB 2FR1A 3WSWA 4XDZA 3PJGA 1UUFA 1PJLA 1U4OA 1XA0A 5JY6A 1YRLA 3G49A 2X5KO 3WBBA 3LT2A 1YOVB 5ILGA 5I7SA 4WCFA 4IQGA 3GVXA 2WE8A 3W4IA 1DIBA 2I99A 5A5FA 4NU6A 2Q46A 2XAAA 4I1IA 4UREA 2BKAA 3WWZA 1H2BA 1NQTA 4UVIA 5DZSA 3WQRA 2PZJA 5L40A 2VHZA 4JJIA 4INAA 4L4SA 4AL4A 3JQ9A 5A06A 4FS3A 4OOEA 3C7CB 3ROMA 4U5QA 1QRRA 4BO6A 4L4RA 1I30A 3UN1A 4IINA 1HYEA 1PL6A 3JQBA 4DIBA 2AEMA 1PS0A 5CFZA 5JXWA 4HFNA 3K73O 4PLFA 2O2YA 4NFYA 3U4CA 4Z0HO 1SC6A 3KYCB 4YJDA 2Y0DA 3F1LA 3T7EA 2W2LA 1LNQA 2VWPA 3JCZA 2I3AA 1M66A 1EBFA 4AVYA 3LF1A 4J1TA 4Q39A 1LTHR 3DO5A 2HK7A 3CKYA 1EUDA 1FMCA 2W90A 4IDDA 2ZTMA 4AJ4A 3CTMA 4DUPA 1MV8A 3GA0A 2Y93A 4IZHA 1ZSYA 1KC3A 5F5LA 1U5CA 4KZPA 2ZCUA 1QG6A 3MEQA 3EHEA 4XYEA 5TX7A 1YOVA 3JQ9C 5JCJD 3U49A 1GADO 4BV8A 1H6CA 1I2ZA 1XWFA 1C3VA 3ZV5A 3SBOA 1MB4A 4Y8VA 1QYCA 1YVEI 2NVBA 2BI8A 3P2OA 4DLBA 3FF4A 3M2TA 1PGOA 3BXXA 3GRPA 3BMQB 3ZWNA 3KYBA 3F47A 3G79A 3HNPA 3GNSA 3CZRA 4GLOA 4YRDA 3G3EA 2C20A 4ND4A 4BNJA 4BO5A 5BQFA 1YDEA 5F1PA 1H94A 3VVCA 2Y1CA 2HAEA 4YQZA 5CG2A 4U8GA 4PZDA 1A5ZA 3KLPX 2X4GA 3MJEA 1ZK1A 3QWIA 1UXKA 3EMKA 1HLDA 4LSWA 5JW6A 3LSYA 4DIOA 4HNHA 3WFJA 2HK9A 4J4BA 2GR9A 2UUOA 1EVZA 3KSUA 3W4JA 1HLPA 1EFLA 1A72A 4PLVA 3JYNA 1WW8A 5DOVA 3WG9A 3H7AA 3AM5A 1EUCA 2YUTA 3INTA 3VDRA 2YV3A 3JQ7B 4F6CA 2FWMX 2PZKA 4OSPA 4BKUA 1TT7A 4P4GA 3ZNOA 3E1KA 2I3GA 4WUVA 3JD4A 2BH9A 4J1NA 4ZD6A 1OC2A 5HS4A 1BG6A 4RVSA 2AEJA 2VYND 5JAIA 1I33A 1UXIA 3LU1A 3U5TA 3B1FA 3B1KA 3ZI0A 3ENKA 3Q9UA 3AI3A 2HMWA 2QW8A 2GZ3A 1DC4A 5EIOA 3W1VA 2G0TA 4BO2A 2JFGA 2ILTA 4MP8A 3RFVA 3C7AA 4I9UA 4O1MA 4TMFA 4II2A 4TRRA 2PKRA 2POQX 4R1TA 4R68A 3KVOA 4CM3A 1QYVA 2WYVA 2EGHA 3BHJA 3IMFA 3PWSA 4ND3A 1R37A 4IUYA 2YV1A 4YQYA 2WEKA 4TQGA 3WTCA 2WE7A 1M67A 1LSSA 4BIIA 4HFJA 3UHAA 4OXNA 5G4KB 4JN6B 2NNLD 1B7GO 1ZUD1 3DFUA 4BV9A 4IS2A 1DHTA 1P9LA 4A5OA 1C1XB 1P74A 3HDHA 1FXSA 1XELA 3HADA 4D43A 4E4YA 4CR6A 1E77A 2FY8A 4J9VA 1PQWA 4DQVA 1SZJG 2FR0A 5JDIA 1DC5A 2VRCA 4CJXA 3CPSA 4YPOA 2V6GA 4J1QA 3QSGA 3L6EA 3FN4A 5G4LA 3FSRA 4CMIB 3KO8A 3TNLA 3F1KA 4UEJA 3NKLA 4W7IA 4A27A 5EINA 3GFGA 3NV9A 1LRJA 4N18A 4YBZA 1UDAA 1HZZA 4BUCA 4DPKA 2IODA 4JP3A 3N7UA 1HETA 2H6EA 1LXCA 4U0JA 1P3DA 1QORA 4I9NA 1PS9A 3LT4A 1IL0A 1UP7A 4FR5A 3WLFA 1CRWG 4MKZA 4Z9XA 4AICA 2Q49A 3K6JA 4DYDA 3F5QA 1YB4A 5TGDA 4QQRA 1Z7EA 5B1YA 4LK3A 2AQKA 4BO1A 5C37A 4E2ZA 1EVJA 4CLDA 3NT4A 2VT2A 3RBXA 3RBVA 2HMUA 2J5RA 1ENPA 4CQMB 3L4SO 1FJHA 3MWDB 3IKVA 2EERA 3DDNA 2FN7A 5KJ1A 3RC7A 3AM4A 2ZJ0A 4XQ9A 4OKNA 1Q0LA 1UAYA 3EZLA 3E9QA 3I4FA 1PJTA 5DBIA 3DAPA 3QVTA 1A7KA 1Y8RA 4XGKA 3TDKA 4CM5A 4UVEA 2A94A 4FFLA 1ADCA 3O8QA 4EEZA 4YJHA 2X1HA 3GZNA 1WMBA 3BTSA 4IZIA 1GQQA 1C0KA 1W0CA 3AK4A 1WWKA 1P1JA 1V0JA 4CMHA 2CF5A 3TN7A 4IQ0A 3WQSB 4ZA2A 2JAPA 3KTDA 4HX5A 1GD1O 4F45A 4G5HA 1E3EA 2NQ8A 4NQZA 4HWKA 4YJFA 1Y8QB 2ZK7A 4YRBA 5KIAA 5BSFA 2VOEA 3GT0A 3WBFA 3ZHZA 3ON5A 1E6WA 2HMTA 1UDBA 4BGEA 1VI2A 2YJZA 1WDMA 3ICCA 3KB6A 4R69A 1GYRA 5K6AC 1JVBA 2JD0A 1C1DB 1YWGO 4H15A 1KVUA 3EVNA 4JLWA 3D5TA 4DPLA 4YJFB 5I7EA 1R4MA 3PYMA 2CF6A 3KXDA 3AY6A 5KKAA 3HJAA 1YGYA 4QFCA 4CM4A 4WCDA 1T2AA 1GU7A 1U28A 3GVCA 5COAA 3IP3A 4IJUA 1DIAA 2O3RA 4TRJA 3ONEA 4CLRA 4KQWA 2O48X 2B83A 1OMOA 2F00A 4D3SA 1PJ4A 2D2IA 4CL3A 1Y8RB 3WGZA 1Y9AA 2EGGA 4DC1A 5MDHA 1MXFA 3DXFA 3MCVA 1GZ3A 3EAGA 3VKUA 4DLAA 1ENZA 3RI3A 2OBYA 3KSZO 2V7PA 3ZWMA 2YZ7A 4AFNA 2YY7A 4WLVA 5GMOA 1VSUA 2XOXA 3D64A 1BXGA 1BXZA 4Q3AA 3LQFA 2PV7A 2R00C 3CUKA 1NAHA 4RDIA 1DIHA 3WQQA 1FDTA 3TOXA 5IDYA 4RV9A 3D3WA 5KNLA 1QV7A 4Q9NA 5GZ6A 5IDXA 4PG6A 5ER6A 4E21A 1ZXBA 4FFRA 1UAGA 2EP5A 3GGGA 5JAMA 1JA9A 1YQXA 2QZZA 2WD7A 4J91A 1DEHA 1VKOA 3PFWO 3PJEA 2O3TA 2FP4A 2JJYA 3NJ4A 3L9XA 2Y68A 1V35A 3X2FA 2P4QA 2B4QA 3B1JA 4CMCA 1GPDG 1PJBA 2ZB3A 3PGXA 4BB6A 4BL5A 2NU8A 1ZJYA 1TB4A 5I9MA 1DIGA 1PX0A 2W2KB 3DQPA 3HE3A 3ZU3A 4BO4A 4CQMD 3STHA 1Y6JA 3WGGA 4DBVO 3VTZA 3VKVA 3ZWOA 3TL3A 3OFSA 2HUNA 2HK8A 3HB4X 1Z74A 3PEFA 2EG9A 3BMOB 2Y0EA 4IGEA 5EMHA 1W6UA 4PLHA 1WXDA 4Q3EA 3ZNQA 5A1TA 1HE2A 3FBTA 3PDJA 4CMEC 1LI4A 1U8XX 2Q4BA 3I83A 3QP9A 4E32A 2J5KA 4H7PA 2Q2QA 4FCCA 5L9AA 2Q50A 2QYSA 1PR3A 3WGTA 3JQ8B 5DT9A 1DFGA 1DRVA 2EJWA 4W9NC 2C7GA 3JQAD 2GUGA 4DIFA 1GUFA 1TEHA 5CDGA 3H3FA 3KZVA 5CG1A 4HUJA 3A14A 4YT2A 3F4BA 1WDKA 3QWBA 5KVCA 1Y9EA 3TOZA 4B7XA 1J49A 4RPLA 4RLHA 2C0CA 5T6BA 4ID9A 2NSDA 2CDAA 3BMCA 3KEQA 3PI7A 2AW5A 1HZJA 4R41A 5L4LA 1HEUA 4I5DA 4RCVA 5JE8A 4O59O 1BVRA 3RU9A 1C1DA 3OJLA 3ASVA 4MVJF 1NASA 4NFHA 4CL8A 1U3TA 3I9KA 2P9CA 5TNXA 1PGJA 4PLZA 2YYYA 2BGKA 3K31A 5C3MA 2P9GA 2YFHA 3LVFO 4DA9A 1HKUA 2JHFA 2F1KA 5TIIA 4YR9A 3WGYA 3DZIA 3JYOA 3JD2A 3ZHBA 5BSHA 1SEVA 3VZQA 1Y81A 2OBNA 4XQCA 4AJKA 2HMSA 5KVVA 3RFXA 1BWSA 1R4NA 4GPD1 4OHUA 3CIFA 3UCEA 3I52A 1MX3A 4OSOA 4B3HA 5G4KA 2PGDA 2V6FA 3ZNPA 3PZBA 1PQUA 5T8KC 4YJGA 5JCXA 3AOEA 1C0LA 2VNAA 2I76A 5L7YA 2V65A 3RJ9A 3INGA 3H8VA 4E5YA 4BO7A 3OA0A 2WYUA 2I5PO 8ADHA 1LSOA 1B16A 3RUAA 3K8ZA 3VPSA 3U0BA 3JD1A 1OFGA 1UDCA 3I6IA 1YB1A 4MP6A 4PZCA 4BMSA 3I9JA 1EUZA 2YQ4A 3E03A 4GMGA 2X9GA 2DPHA 3JQGB 4M54A 1KOLA 2G5CA 3PPIA 3KV3O 1I3MA 3CZMA 1NWHA 3DBVO 3GAZA 1O94A 2DFVA 1J5PA 2VNSA 3U4IA 4EW6A 4IPTA 4ALLA 3O03A 4CMKA 4AJOA 4XYLA 4HKTA 1J4AA 3ZW8A 4KWIA 3MJCA 4LMRA 4CMAA 2J8ZA 1GZ6A 1DBVO 1I3NA 2GNAA 2AA3A 2VHVA 3RUFA 1TA4A 2WMDA 1BXKA 3GVIA 4R1NA 4ONEA 4CMJA 4RPKA 3OSUA 5ES3A 1Y5MA 2NU7A 3K92A 1LSJA 4PVDA 2GSDA 2X5JO 1T4BA 2UAGA 3NTQA 2H1SA 1LDEA 1VJ1A 1DAOA 3KHUA 2VRCD 3ZU2A 4D0RA 1GAEO 1TT5B 3EGOA 4KTTE 4QXMA 1WVGA 1Q7GA 4LISA 4A2CA 4RL6A 1L7EA 2FRDA 4XYBA 3TZ6A 2VOJA 2CD9A 1RKXA 2BGLA 3ANLA 1ISHA 1GYQA 2NLOA 2BF7A 2RHCA 2H5LA 3WYBA 1SBYA 4XYGA 3PFFA 3NJ8A 5DP2A 4XGNA 1NQ5A 1X7HA 2OMEA 3I4CA 1SAYA 2PD6A 3ZN2A 2RHRA 3JYLA 4A7PA 3QA9A 4BO0A 1ADBA 2VTDA 3U4HA 5JYDA 3W8EA 1PSDA 4LGVA 1LEHA 4ILKA 4DYVA 1P44A 4BNWA 3WGIA 5AXDA 4DQXA 4C4OA 4JGBA 4URFA 2VZ0A 3H9QA 4GQAA 5I9LA 2Y1GA 3I9NA 3CEAA 3UVEA 5TJHA 4JJGA 1MUUA 1O8CA 3O4RA 2X0JA 1LRLA 3MTGA 5I8ZA 3KYCA 3Q3CA 4QSMA 3PLRA 5C7OO 3DC2A 2EKLA 2Y1DA 3NDJA 2O2SA 1E7WA 2OORA 1Z73A 5EN4A 4ALKA 2PKQO 2VWGA 1X1EA 2VWHA 2QQ5A 1GR0A 1CEQA 2AXQA 3UGKA 3L4BC 4Y9DA 3PVZA 1XEAA 1F8FA 5HM8A 2GD1O 3PIIA 3UFXA 4RJTA 4FJ0A 1FDVA 1GTMA 4O63O 1HE5A 4LCJA 5KOIA 4RPJA 3MJSA 4WNIA 4PZEA 3WLEA 3OH8A 3JQ8A 4AJIA 4EJ6A 3GFBA 1WDLA 4IJWA 1NWCA 2OHXA 3AOEC 3NT5A 4IY1A 4L75A 5HWSA 1ZKMA 1U2DA 4KP7A 1D8AA 3WNVA 4B7CA 4GH5A 2Y0CA 3KYDA 2DVMA 1YB5A 3ULKA 3WSVA 2O7SA 1EDOA 1PQPA 1V3VA 4ALJA 1GYPA 1F12A 5LDHA 3ZV4A 4E33A 3QVSA 4PRLA 1L1FA 1VL0A 2H9IA 3L6OO 1CERA 3BTOA 4DMLA 4K26A 2TMDA 4L0QA 4AJEA 4MIYA 4NFSA 1P1IA 4XQGA 1NQOA 3TF5A 3NTOA 3Q9NA 1M6HA 3JQFA 1F0YA 3E5MA 4RF5A 4J90A 2PGJA 4XDYA 3ZW9A 4B7UA 4DTIA 1B0AA 1EEHA 4PG4A 3GN2A 3D0OA 4J1SA 2DLDA 4FDAA 1X1TA 1TT5A 5H81A 4E5MA 4ZN6A 5CDUA 3VPFA 2JCXA 5ITWA 1DAPA 4G65A 2I66A 5ER9A 3OBBA 1LDYA 3PIDA 5T5QA 5ILOA 1P1HA 2G76A 4L8VA 1A7AA 2RIRA 3JYQA 2OFPA 4XD2A 1CDOA 1S7CA 3F4LA 1UXGA 3PQEA 5IG2A 3GVHA 1E7YA 1H9AA 4WEQA 2ZB8A 3C1AA 3UKOA 1IPFA 1I32A 3ZZNA 3F6YA 1X13A 2WYWA 3L0DA 5GY7A 3HDQA 3E18A 4ZQBA 5B4UA 3LF2A 4GKBA 1HDZA 3OJEA 5IAAA 4Z0PA 1HXHA 2B4RO 4FD3A 3RWBA 5BNTA 3RJ5A 3OQ1A 3B20A 4BNNA 1PWXA 3AI2A 3DZFA 2XXBA 4YYZA 2HLPA 2OZPA 3JD0A 4PG7A 1VSVA 3F46A 3BTVA 4IJVA 1Z82A 1XG5A 3PYXA 4NJMB 4WE3A 4UVGA 4E3ZA 5IZ4A 3DWFA 3FR7A 4J2OA 4CUJA 3ST7A 4YJGB 1B26A 4FC7A 3PK0A 2Y05A 3HQ4O 5AXAA 4MVJH 5CPFA 4GL4A 4R4JA 4G2NA 4JIGA 2DKNA 5KTKA 4LN1A 3RC9A 2UDPA 4WNCA 1GFSA 4F3YA 1JWBB 1H93A 5A02A 3AWDA 1D1SA 3K96A 4GLLA 4JXKA 1SPXA 3KUXA 4BGVA 4MPDA 1HYHA 4YJHB 5G0UA 1D7OA 2YQ5A 3KSDO 5IDQA 4DREA 4NBWA 3OP4A 1LLQA 1SO8A 1FDUA 3H3JA 1O95A 3K2BA 3SJ7A 1XYGA 4E2WA 2I9PA 3FWNA 3H65A 1NVTA 1H2HA 2CUKA 1ZMTA 3E9MA 1W73A 4RPGA 3QWHA 1H5QA 5DULA 1B14A 3GN1A 3IKTA 3HN7A 4UAGA 3LLVA 1VPDA 1QYDA 3DZBA 1T1RA 3U9LA 3TQHA 1RM3A 5TQVA 3KRTA 2V6BA 5BSEA 1GV0A 3IJPA 2P5YA 3HFSA 1O6ZA 3PXXA 2VUTA 4IMRA 4E5PA 1MC5A 4NR0A 5CEJA 1ZK2A 3ETGA 4YAJA 2NVUB 1DLIA 2VYNA 3OICA 3AY7A 4OYRA 3GDFA 4I5GA 3OHSX 4M55A 4E5NA 2NVUA 3FBGA 5LCXA 5A9TA 2PH5A 3KLMX 3ICPA 4CR7A 5B4TA 1HSOA 4KUGA 4OXKA 1NM5A 1HYGA 2C82A 4XWYA 3IJRA 4PGFA 1E6EA 1P1FA 4AJNA 5JAQA 1YJQA 4R9RA 4Z3KA 2QG4A 1PZEA 1PIWA 4P38A 3WNQA 2AQHA 4CLOA 3JQFC 2DU8A 5JCJA 1QYWA 2CFCA 5JO0A 4WOJA 3GRKA 4M8SA 4P4LA 2OL4A 4ALIA 1K89A 4OMUA 3DZHA 1X7GA 3OIFA 3CMMA 3RVDA 4HBGA 4RVHA 3DTYA 3DMTA 3N58A 3GNTA 4WEOA 4PG8A 1D3AA 3JQ7A 2GDZA 4OAQA 3TRIA 1ONNA 4PLPA 1ONPA 2O50A 4HNGA 1M76A 1CYDA 1C0PA 1KEWA 2YHIB 1N7GA 3GHHA 3IS3A 3QHAA 3RUHA 2GLXA 2QRJA 3AI1A 1H6BA 5C7IO 2OGUA 2NWQA 2CVZA 4U0KA 3TFQA 3M1AA 1U7TA 1YONA 4U6SA 2PK3A 2PTGA 1LQUA 1K6JA 2IEBA 1EE2A 3D3WB 3FNFA 3RKUA 3H5NA 3SLGA 1JQBA 3JQ6A 3WJAA 1NVMB 2D4AA 3KYDB 4J0EA 3KEOA 3E82A 4FSHA 3M2PA 1BSVA 1PJQA 2ZB4A 3NGLA 1W8DA 3ZU4A 1CETA 5FF9A 2IE0A 5JMWA 2C07A 1SB9A 3UUWA 2VYVD 2GYYA 1XLTA 4MVJG 3ZDFA 3FPLA 5TC4A 3PJFA 4NNJA 1TLTA 2NQTA 4PLYA 3R1IA 1E5LA 3RU7A 1N2SA 3OF2A 4N54A 4YT8A 3WR5A 4DPMA 1DFHA 5JPIA 3WICA 2LDXA 1M75A 2G1UA 1WNTA 3HSKA 1I5RA 2VZ8A 4GBJA 2X9VA 3QJ5A 1RYDA 4MO2A 4ZQGA 2X9NA 3U62A 2DBZA 3MOGA 2B0JA 3AFMA 1NAIA 3EVTA 4W4TA 5K0ZA 1ZSNA 1LX6A 4CM1A 1N7HA 3TWOA 5I9NA 2EHDA 4RLSA 3VC7A 1FDWA 3RCBA 3DOJA 2C5AA 3RUDA 2YHIA 4IJKA 4XR9A 1LBEA 4ZRNA 1PGPA 3T4XA 2J3KA 1IYZA 4A03A 1DC6A 1LLUA 3N74A 1IE3A 3DZJA 1A27A 3C85A 2C29D 3Q11A 1E0DA 3QIVA 1E7QA 3VVBA 2NTVA 4NI5A 3S2GA 2OP1A 3QVWA 5JDCA 4WASA 2UVDA 5L7TA 1ISJA 2NADA 3AU9A 1XQ1A 3ASUA 4FPXA 1O0SA 1P1KA 3UCFA 3MTJA 3BHMA 3JV7A 3RROA 5KJEA 1B15A 4PLWA 1VE9A 3LT0A 2PGLA 2PNFA 3NRCA 3DMYA 4GVXA 5GZ1A 1GPJA 3ZCXA 1ZO8A 3F9IA 1V3TA 4E12A 1HE4A 4GSKA 4A26A 5H82A 4NBRA 3FTPA 2Z1NA 4J4TA 4EBFA 3Q1LA 1ZK4A 5G0WA 5GZ3A 4J16A 5JDCC 7MDHA 2E48A 2Q99A 1EK6A 4D42A 1DHRA 1B3RA 1XDWA 2R00A 3RUEA 2CDCA 4XYMA 4BGIA 4OOFA 3QY9A 1KY5A 2IDZA 4D3DA 5IJZA 2GRAA 3DOCA 3RSHA 1T2EA 2AEFA 4BO9A 3ANMA 2WDZA 1MLDA 1ADFA 4J7CA 4QUKA 4OJNA 3IP1A 4XJSA 2C54A 3O38A 1IY8A 1PGQA 4DL9A 4FOSA 4CLEA 3OQ6A 1MGOA 4S3MA 2Y1EA 4YAKA 1PJ2A 1VJTA 4QO8A 1BDMA 1DOHA 1ENOA 1SEPA 2DM6A 2HCTA 4EI2A 3C7DB 3ORFA 1IZ9A 3O8QB 1LC3A 1Q7CA 1AGNA 5IN5A 3HFGA 3Q6IA 2VYVA 3RKRA 5G0VA 3CSDA 1B8PA 3U4DA 1P33A 1KC1A 2Q3EA 1V8BA 1JWAB 1X14A 5FEUA 3SLKA 3M1LA 3QW2A 3WDSA 3W6ZA 4RVUA 1P45A 1E1KA 2J5QA 2XXJA 3AY3A 1FF9A 1NP3A 2QYTA 4I8XA 4AJHA 3PHGA 4YAGA 3C1TA 1ZJZA 1EFKA 6ADHA 3D3EA 2AG5A 3VZPA 1HT0A 4BNYA 1RM0A 3DBRA 4FJ2A 1IZ0A 4LVCA 4I5FA 3SJUA 1OC4A 4ZRMA 2JFFA 5ICSA 2YFQA 1GEGA 4W9NA 3H5AA 4PVCA 3DFZA 3UH1A 1WMAA 1XQ6A 4RF4A 2JHGA 3V2HA 5L7WA 1H0KA 2WSBA 4Y6RA 1PU2A 1NFRA 4TZTA 4PLGA 1OBFO 4YAIA 2I6TA 1VLLA 1J0XO 1F14A 2C59A 5TJ9A 1I3KA 4BVAA 2XPCA 3BA1A 3AUUA 1XHLA 3SX2A 1WAMA 1K3TA 3A06A 1HDRA 4Z6KA 2IYOA 4ND5A 2CSUA 2IEDA 2PY6A 4BKRA 3NYWA 3MJTA 4RDHA 4CQLA 4AJJA 1N1GA 2BMAA 1KS9A 2NU6A 3AUAA 3VOSA 4N5MA 1U4SA 4W82A 4WECA 4CV0A 4O6VA 1T2DA 4U7WA 1G6KA 3AM3A 1ZVMA 2UYYA 3ENNA 1BDBA 2VRBA 4NJOA 5L51A 4KOAA 2QX7A 4YT5A 4ZQHA 4EUHA 3TZCA 2GN8A 4PCVA 4DGSA 1GDHA 4R3NA 1IHYA 1ZZEA 5JFOA 3C3XA 3LC1O 1N9GA 1YBMA 9LDTA 2J3HA 3O9ZA 4RGBA 4NK5A 3JD3A 4RZHA 3LZ6A 1UH5A 3E5RA 3HDJA 4GWKA 4BS9A 3H9JA 5ENDA 4UUNA 1HF3A 1KVSA 2IZZA 1B8VA 4L4XA 2ZJ1A 2HO5A 3OQBA 1IOLA 1E92A 5KJCA 1BMDA 1M2WA 2GPTA 5CDTA 3H6KA 4N5LA 1CF2O 2ZB7A 1B3BA 2X86A 4CLHA 4M89A 2B5VA 3LC7O 5A9RA 4GX1A 1NX6A 4LRSB 3W4KA 3RFTA 4U6QA 2X0NA 1I10A 4CM8A 1BW9A 4OIMA 2X22A 4OKIA 3WMXA 1DB3A 1KEPA 3GEDA 5MGBA 5T57A 5TRTA 5A4DA 4LMPA 4D79A 1NPTO 2O4CA 5K9ZA 4OH1A 1ADGA 3OEWA 2BRUA 2WD8A 2WWRA 3D5QA 2W98A 2W2KA 4IXTA 8LDHA 2RH4A 2GF2A 3ADOA 3GG2A 3OJ0A 4P8RA 1KVRA 1GL3A 2GCGA 4H3VA 4IM7A 4E2XA 3QE3A 2GN9A 3DOOA 1JKIA 2Q1UA 3RC2A 4ROSA 1HDXA 1K6XA 1NYTA 2IZ0A 1KETA 2ZIZA 2BFPA 2FZEA 2HQ1A 4EZBA 5TLSA 2WD7B 3ZWXA 3AW9A 2A92A 3JQGA 3JTMA 3L77A 4ZU3A 3U09A 4DXHA 2CDBA 5EERA 3D4OA 4MP3A 4C7KA 4DBZA 3NAQA 1D1TA 4QFDA 1ZIDA 2P4HX 3E6AA 1UJMA 5DN9A 2Y99A 1DFIA 1YDWA 4BKPA 1F8GA 5BNIA 4MVJP 2IYPA 1E3SA 2RAFA 5FWNA 3BMQA 3OJFA 3GLQA 4WLNA 1NR1A 1XU7A 4D0SA 3QWFA 2C5EA 3DL2A 3T4EA 1YH3A 2B5WA 4C7JA 3BIOA 2IXAA 5CDYA 2R2GA 3HUDA 5BSGA 1G0NA 4GGOA 4N5NA 4XRRA 2DBRA 5THKA 5JS6A 1PJSA 3P19A 1MP0A 1EZ4A 1E7RA 1R4NB 4BNXA 5JY1A 4JQCA 3V1TC 5IDWA 1GQ2A 1MXHA 2X0RA 1IB6A 2EKPA 1E1MA 2B36A 1KERA 4TVOA 5ENVA 1AN9A 4AJPA 1RYEA 3NTRA 3RAJA 1ZNQO 1HSZA 1IUKA 3RUCA 4B4UA 3UW3A 1R4MB 4BNZA 4YACA 3LC2O 1BVUA 2UUPA 4I5EA 5HBRA 4BKQA 1DPGA 5LDGA 3EZYA 3R3JA 1YS4A 4BNTA 1PEDA 2GASA 1DC3A 3FRJA 1OZAA 2AG8A 4TRMA 3GUYA 1H9BA 3RBZA 2NACA 1PZGA 4A10A 4B4OA 3C8MA 2NVWA 4CPDA 3QQPA 1CQIA 4JK3A 1U9JA 1U3WA 4UUOA 4NU5A 5TT1A 1JAXA 4J3FA 4CM9A 2NU9A 3UAGA 4CV2A 4MDHA 5FI3A 1LLDA 1QYXA 3GZNB 4MINA 5A5EA 4GX0A 2C2XA 2D3TA 3I9OA 1Q2XA 1VJ0A 3S2EA 2CVOA 3R0IA 3DHYA 4Z3DA 5JO9A 4DC0A 3G1TA 4DWVA 3QRWA 2VUSA 4R5HA 1HRDA 3I9MA 4NPCA 5J23A 1GQYA 4CMGA 2J3JA 5DCYA 4GX5A 1NPDA 1T1SA 1T2FA 4MKXA 1SOWA 3PJDA 3VTFA 4BMNA 4CQMA 5KVSA 4BKOA 4QX6A 3BMOA 1H6AA 1GZ4A 4Y6PA 4YAEA 3WGOA 3WS7A 3WYEA 3SEFA 4F6LA 3IL2A 4EITA 1I01A 1KVQA 1MG0A 1PR9A 2BD0A 1QXSA 2I67A 3A4VA 4D44A 1LDBA 3PGJA 1QR6A 2ZKLA 2E4AA 1YBVA 1K2WA 4WPGA 3S2FA 3UXYA 3C1OA 1ISMA 4RQUA 2Y66A 4J7UA 5F21A 3MOIA 5HTOA 4J2HA 3JQAB 5KVQA 4YA6A 5DF1A 1KYQA 5A05A 4ND2A 1TXGA 1CWUA 2DAPA 2DPGA 2P68A 1N92A 2J3IA 1HE3A 3B70A 3HZZA 3W8FA 4CMIA 4J49A 5CPBA 1ZXLA 3HB5X 3PWKA 4NG5A 3GY0A 4XCVA 4N7RA 2EKQA 4M87A 2IZ1A 1E3WB 2VZ9A 1P77A 1Q0HA 4HFMA 4PFJA 2D1YA 3IC5A 4CUZA 2ZQZA 4CMBA 4J9UE 4TROA 2DC1A 5U9CA 4IDFA 4EUEA 4D45A 3DAGA 3ITKA 5HA5A 4XJTA 4WLUA 2VHXA 4K6FA 4CLOB 3ZV6A 2LDBA 1LDGA 2WM3A 4XB2A 4M49A 4MOWA 4Q3BA 2PH3A 3GF4A 3S55A 3GOHA 3PTZA 4OO3A 2ZTVA 3ADPA 4NZ9A 3SXPA 4ZQFA 1PJ3A 3FPCA 3FR8A 4E0BA 1ISIA 1EE9A 3AU8A 4CM9D 3OM9A 4TWRA 1SMKA 5AXCA 5CP8A 3GGOA 1IPEA 1KY4A 3FTNA 3DHEA 4NDNE 5G0TA 1HDGO 1MA0A 1EQ2A 1G1AA 1TI7A 3SVTA 2AMFA 1HWYA 4BNIA 3AJRA 4RORA 2E37A 3WMWA 1EQUA 4TRNA 3VPXA 3VZSA 5ITVA 2EW8A 4I08A 4IIVA 2ZYDA 4XEHA 3LDHA 1HDYA 1UXJA 1U1IA 4FFOA 3NEPX 4FGWA 1B8UA 3BMNB 1PZFA 4PG5A 5JC1A 1RWBA 1EMDA 1I24A 1LQTA 1R15A 2BLLA 1T24A 2C2YA 2HU2A 2WTBA 1YJ8A 5KCZA 2FMUA 1IHXA 3ABIA 1XIVA 3CE6A 1DIRA 3RQSA 4EUFA 3INRA 3OIGA 2O3UA 3WGQA 4YRAA 2AQ8A 4EYEA 5I8WA 2FPPA 4DVJA 1PS8A 3GMDA 5EQDA 1O9BA 3DBLA 1O5IA 3WXBA 3OJOA 1BW9B 3GC6A 4QO7A 4ZJUA 3QVXA 1NVGA 2JD2A 2Z1MA 1ULUA 4LCEA 4MIOA 4YVFA 5BR7A 2IRWA 2J6IA 3Q2IA 4RF3A 1C0IA
chains in the Genus database with same CATH superfamily
2VA9A 4J6FA 4YTEA 3WGUA 3GH3A 1NFFA 4CEHB 4WGGA 5T7BA 4DCMA 2O2IA 3IQHX 4B35A 4F3KA 3QXCA 4BTLA 3O74A 3RFFA 3DR3A 1HMYA 1N6HA 2FQQA 3QPVA 5HS6A 5J5AA 1TCUA 4KHPB 1PL8A 5LOVF 1UK6A 3M5PA 1K5PA 3GEPA 3L4BA 3FPAA 2G17A 2PMEA 5E3IA 1YKFA 5FLXA 3I04M 2HJSA 3A4LA 1A95A 3LUHA 4LZZA 4DAEA 1IULA 3ZJVA 5DT2A 5FULA 3G6WA 1V2HE 2I4NA 4UTZA 2P62A 4B3XA 4BMVA 5BSUA 2QBYA 1PUIA 3OETA 2DETA 1JKFA 2PVCA 2VP9A 2QA5A 3C3AA 1VCMA 1SIBE 2W22A 3HP7A 3K2EA 2NZUG 3VNQA 4Q12A 3DHWC 4HX2A 1TRHA 4Z53A 4Z4IA 1OV6A 1QS0B 4JUFA 2QTNA 2TMKA 4OQFA 1OIWA 1WU8A 1N2ZA 3UOWA 4DT1A 3NIFB 3G0OA 1RR6A 3AL0C 2HA3A 4ZI2A 4GR9A 3T3EA 5J4KA 3JARB 1U5AA 2JGLA 4OLFA 3ITDA 1RC1A 4KO3S 4R2XA 4DMMA 2AOUA 5KO2A 2D6FA 1I8TA 3BCUA 1PL7A 4KYTA 4LSMA 1NUUA 1C1XA 3P2EA 3OMLA 3I9V1 4WZAE 1TKRA 1EVKA 1RBQA 2WQZA 4X91A 1AO0A 2VP0A 4LXQA 1QGAA 3L07A 4R2HA 3UT6A 1JQ3A 4HGPA 1W4AA 1AXGA 3HJNA 4NP6A 1NVBA 3N0WA 4Q6BA 2D2EA 2AE1A 2XQIA 4LVNA 4DR7B 3OQNA 3K70D 2ORYA 1N5JA 3CNOA 2HMVA 4WL0A 1T4GA 4KGDA 3A4NA 2GLUA 2PYIA 1F5NA 1QH8A 3OAAD 1YZUA 2HJRA 4WCFB 4OHZA 1Z3IX 5KSYA 4Q3CA 2PX0A 1E2NA 1T9HA 3H75A 3HZOA 3HJRA 1NI3A 3JR7A 4WBXC 1Z6QA 2GEKA 5E38A 5TVKA 2QR3A 2VF2A 2GZSA 4N12A 3QMWA 2D5CA 2ZFUA 3EVZA 5IAOA 4UW9A 2C96A 2DFPA 4WVLA 7REQB 4F91B 1ZHOA 3TZHA 3WK4A 2ONYA 1RACA 4GM4A 5CA0B 3GA7A 3O90A 4MYTA 4HRAA 4R5MA 4DMHA 5BV0A 3QE4A 4KAXA 2NUAA 3T4UA 2DB3A 2I1LA 5HRUA 3GZ4A 1M8GA 1E3LA 2SCUA 1EK5A 3R75A 3T99A 5CNMA 3KEFA 3WBKA 3HA2A 4D3XA 4D4MA 1PHPA 2ZSAA 4IXWA 2JKZA 4Z9YA 5GONF 1UC9A 1E4EB 2NYRA 2AOXA 4JMLA 5TF4A 3T3MB 2G0AA 4D74A 5IHPA 5LKAA 1OZ0A 1XAHA 2OLEA 3OFVA 1BRTA 1Q11A 2IEGA 3LUFA 4TUYF 2IWRA 3F90A 1Z7BA 2VSFA 2DYKA 3SX4A 4ALNA 4WTOA 1Z16A 1FPMA 3D1VA 4F9TA 4U7DA 1KKMA 1R50A 1VLVA 4UARA 3OOEA 3I9LA 1I94B 2GXUA 3FTFA 2ONKA 2WFZA 3HJGA 2RH8A 4OJTA 3I2GA 3F6BX 3L6DA 5LC1A 1VRWA 2V9CA 4R9UC 1R5NA 1PUJA 3VVLA 1X1AA 4PTZA 2Z8YA 2ZBDA 3KSRA 4R8KA 4MGHA 1C80A 3RSSA 1FC0A 3QVKA 5BW6B 3JQBC 3K53A 3UV6A 4WZZA 2AN3A 2XRFA 4UBKA 4UU7A 2OGSA 4FC6A 2HT6A 1CY8A 1XAJA 2YIVX 4ZYTA 3NX4A 2HNBA 1T3TA 5FLKA 1XJCA 3KEGA 4PXSA 1ZRSA 3ZE9A 2CXOA 2OQ2A 1RM4A 1ZOOA 1SCJA 3JYPA 5HIJA 1A9XA 1ZQ1A 5JYBA 2R8RA 5BSRA 4WBNB 4PFKA 3WLNA 4BNMA 4TKLA 1RT9A 5A3VA 3T9EA 2J30A 3DKPA 4DW8A 3QXJA 2XYRA 5KNBA 1JHXA 3H2GA 4OV6B 2X5NA 1NJ8A 1U3GA 2ET6A 2QLLA 2XGMA 5F4BA 2Z8ZA 1CDDA 2XKBA 3CXRA 3IDSA 4Z9BA 5DHFA 2ZR0A 3HJTA 1E6UA 4XGIA 2XVMA 1SOVA 3FYSA 3GDOA 5G41A 1N8NA 2VHYA 4MZXA 4WERA 4A8PA 3QPWA 5AVQA 5HVNA 3O93A 2B35A 2OHVA 3E22B 4H1TA 1ZI6A 2RCNA 4ECAA 5LN1A 3PHJA 2CVHA 2VJQA 3AFGA 1QFZA 2FKAA 2WWHA 2AWNA 2ZE6A 3IBSA 2A1UA 3KBOA 2Y3IA 4HVAA 4AURA 2GZ1A 3FAZA 1GTSA 1ZCAA 4Q48A 1X7WA 5FOXA 1UBHS 3P9CA 2CWDA 3A6ZA 5F3RA 1YKSA 5IFLA 4RX1A 1EEXB 3IP9A 1EX6A 1NYRA 1GUZA 5AXBA 3FCOA 3R3YA 3I4LA 1J5XA 4YXFA 4ESOA 1SXHA 1NY5A 1IOZA 3CNHA 3I37X 3V2IA 1J0DA 1E5TA 2C9BA 3I2HA 1TAQA 3JZFA 1W4LA 3DZKA 2VP3A 1P5FA 4Z9FA 5LQJA 1Y3CE 1R0SA 2OC4A 3H9BA 1TYEB 1NTOA 3Q9LA 3QUQA 2QG6A 3FUCA 4YH1A 3JQEA 4CT4B 1ZK3A 4LI0A 2O4UX 4CG3A 1JHUA 1L5OA 4K9KA 4WOKA 5CT5A 3WOHA 3WLQA 3G85A 5KTSA 4HF7A 1QH0A 2OV3A 4NNOA 3ER6A 3DVRX 1Z0JA 1TUBA 3JQDA 4E94A 2PMKA 4G4IA 3M7IA 3WFIA 4UNIA 2MWMA 5JASA 1HOXA 1ZSVA 1RDFA 4FHFA 4HI0E 4WZAB 4RF2A 4C4ZA 4KRFA 3BYZA 4B2YA 1NM5C 2IX3A 2R48A 1EX9A 4Y6QA 1QHGA 2IIVA 3KE9A 2GPBA 1TIKA 3QYFA 4YO8A 5AIBA 3EIOA 4MJLA 3UATA 3WDMA 3IJ5A 2OUIA 2O7RA 1A88A 1XL0A 3THRA 5KKCA 3RASA 3O3OB 1TZKA 4TS3A 4IDGA 1RWMA 1THGA 4KXWA 4EGCB 5L53A 3IT0A 1Z8FA 3PC8A 2PZBA 1X1BA 2Q1TA 3CV3A 1UMBB 2IL1A 2XUGA 2GX6A 1HDIA 2WY2D 5A4IS 3ONFA 3OLZA 4B83A 4BO3A 3I23A 2QZPA 4UMEA 1E2UA 1HFKA 2ZBFA 3FJOA 5EJ2A 2GGSA 3LLMA 3PHHA 3ZV3A 4F4IA 2GEBA 2GD2A 3QWAA 8AT1A 3CURA 2FSIA 1SNYA 4FP9A 4I9HA 1XZAA 4BLOA 1W0JA 2R8EA 5KU1A 3N8HA 4QEDA 3EWSA 5K3OA 4ND7A 1E9RA 2EIHA 2OKGA 1K0UA 4L2IB 4MPRA 1DV2A 4QVKA 4NIMA 2QN1A 1S8FA 1W2GA 4N8DA 3FYCA 2J0UB 2G0NA 4A73A 1F7UA 1QGDA 1GNQA 1U2GC 1RWNA 2OHOA 4U39A 3HM9A 1QTIA 1RHRA 3LLCA 5DCUA 1RZUA 2W8BB 2FX5A 1BN7A 2EV9A 4HQOA 4MQ5A 4QUEA 2BCJQ 4D82A 2O6LA 4GPAA 3IOBA 2PLRA 1KDTA 3U13A 4V1CI 4OQZA 2DRIA 4GOXA 2PLWA 2FWAA 3GPDG 3NKVA 4NAUA 5FBLB 1G2OA 3JRWA 3V8BA 4GWGA 1Z34A 1IG3A 4LHEA 4ZAGA 1U7DA 1U9IA 5J3JA 4LYYA 2ZS7A 5AHOA 1BDHA 4L5BA 3L0IB 3T3HA 5EVJA 1RLMA 4NHEA 2OAQ1 4K6OA 3VDXA 9ATCA 1NXOA 4H77A 4UM8B 1SUFA 3TLAA 3E3OA 4PAWA 5C35A 3GPIA 4DUZB 1O5OA 1U04A 4XWOA 4EHLA 5EXEA 1QPBA 2BEUA 2ZYVX 4OCZA 1V9LA 1V48A 5KYTA 4R1SA 1JN0A 3A04A 2D7CA 3JU3A 3MTIA 2QR5A 4Y2PA 2XMRA 3GUCA 1W25A 2ZAIA 4TL8A 1IM5A 4AJLA 1B2LA 4C6HA 1NHGA 1T1IA 4QDJA 5F2NA 2E49A 1JU4A 1EP3B 1SVLA 1WR8A 1KQOA 2NT4A 3IQEA 4YV0A 2WSMA 1Z47A 1X3SA 4JI0B 3ROZA 3HVJA 4B4WA 2AMYA 2RH9B 4DA7A 1X1CA 1QAQA 1IHOA 4PCUA 3S40A 3F6RA 4B7ZA 3QKSA 5CD9A 3AVYA 1DTSA 3QKRA 5FTWA 2DFKB 2PZ8A 5KSWB 3G9TA 3UJ3X 3TQFA 1I4OA 1XJ0A 3LPLA 4PWYA 1TADA 3W1WA 3ZVKA 4UEKA 4TTVA 5EXTA 4H7FA 1CJCA 1XXHA 1KAOA 2XQJA 2B9VA 1QE5A 3DQZA 2P9EA 5DSZA 3NASA 3NMUF 4WD3A 3AL3A 4O2RA 1EB9A 2D8AA 3E53A 5F1OA 4S35A 3IQGX 3G88A 4JJ4A 2LW7A 1QFYA 3EIFA 5EWLB 3WWYA 3USES 1QLWA 1VB3A 4M1WA 3RS9A 3CW2A 1P3Y1 1FDOA 3E9NA 1KYZA 3TFWA 3SHOA 1JEOA 4HAWA 2R4TA 3C6XA 1DC7A 1FNBA 3HYNA 2AR9A 1WUIS 1NUHA 2NV2B 4PSUA 2IP2A 4L76A 1TTQB 5IJ0B 1KTIA 1JHZA 1UM9A 2GILA 3MB8A 3N2NA 3PV0A 1AHHA 1Z4JA 5H7XA 3UNXA 3N86A 4BAUA 1Y9ZA 3IRVA 3QZUA 1AB6A 1LUAA 1MN6A 2C8LA 2W6NA 3BJEA 4HSGA 4ZO6A 1X39A 3N2IA 2DT8A 5F78A 2FR8A 3IOYA 4BQSA 5K0SA 2D59A 4Y1RA 1BEEA 4L3VA 4HLCA 1UZUA 1H3EA 2GHTA 3H2KA 4IJQA 3C8ZA 2QUZA 2MR5A 4JLNA 3OC0A 4TT3D 5BMOA 5EE5B 1BQ4A 1A5TA 2C9MA 1Z4LA 4HEA1 5LVAA 2RGGA 2GK7A 4I5IA 3DDUA 3AESB 4ZU1X 4LRXA 3NB0A 3PQ7A 3TXAA 5ITZA 3U4AA 3G0GA 2Y8EA 3PDIB 3K0HA 4TKZA 1B6TA 1MEOA 1XLVA 1YUBA 2VHWA 1PEKE 2YIJA 3K5PA 3NIGB 2X5OA 3HGMA 4IMJB 1ESCA 2GM3A 3QE2A 2HLDA 5IN4A 5EL0A 1QO0D 1QF7A 4H31A 3U3KA 2QENA 1EJBA 2C5BA 2GYVA 3BBLA 3NANA 4D2IA 4DSTA 1L9KA 4MITA 1ACJA 5CDFA 3H11B 2FPXA 2OAP1 4FW8A 5ICGA 4X66B 3WIEA 3PDUA 2IHKA 2W8ZA 1E2FA 3HB1A 1DX6A 3I5MA 1MT3A 2CHFA 4P3XA 3CVVA 1L7OA 2PMBA 4FQ5A 1R6UA 4HNQA 5DNCA 3P0HA 1NSFA 2V7XA 2QTVA 3L1IA 5FTNA 3DL7A 1UXHA 2QPLA 3B3AA 4HEJA 5B3JA 5JSHA 1D0SA 2Q2VA 1MQAA 4LQLA 3X2EA 5KWIA 4XFKA 4MLZA 2X6RA 4FX5A 4MVJD 1U2GA 3T1HB 4R0MA 3PQFA 5CYFA 5LP6C 4B79A 3EY4A 1Q1QA 1U0TA 3R4VA 4ZZ2A 5CVVA 1DXYA 3GGPA 2NVOA 3C98A 4ER7A 2IV2X 1SU7A 3FUXA 2GM4A 1RBYA 4MMZB 3TSYA 2QNRA 3L0CA 3IBCA 1L5GB 1LGYA 3K1ZA 1IJBA 3QXXA 4EIWA 2ENUA 3BH0A 1ZA2A 2NZWA 3ZV7A 1QHIA 2AI2A 3MTEA 4H59A 3HDYA 4JGGA 2B8JA 3TCKA 3E5HA 4KFTA 4L8GA 1OU0A 1T4DA 3PA8A 1GCOA 4D9KA 1K4KA 3IQDB 1KJ8A 3AF3A 4QXAA 3OPYI 1VGRA 1KVTA 1V4NA 2G07A 4LPKA 3BEDA 5ADHA 1SELA 4HD8A 3PL5A 4LX0A 1ISGA 1YOBA 5YASA 4C01A 2WJPA 3UYKA 3Q98A 3FI9A 1BFKA 5DIFA 1IZYA 5F2OA 4PN7A 1TL7C 2PD3A 1BQ3A 3NH9A 4HXGA 3VZBA 5A4AA 3VPAA 1C30B 3B9PA 4IFTA 3QX8A 2OOSA 2MOKA 4YV7A 4KWTA 2C58A 4OQYA 4AW9A 4TLBA 4EEKA 4WBNF 1MV5A 4N0PA 1CJTC 1NIPA 3ONDA 1CE8A 2Z0MA 3HWWA 4G0QA 1X7YA 1WY7A 4PZAA 1KJYA 2YHUA 4WRRA 4M6WA 2AHRA 1MMFB 4RA9A 1TK3A 1FYVA 2QOEA 3AVVA 1E99A 4PYNA 4HAUA 1WDTA 3DTVB 4GM0A 2IF0A 4NJMA 4CM8B 1EFVA 3EGXB 1PYDA 1WSDA 3GEGA 5EPOA 1VLHA 3KOXA 3UFBA 2AQIA 4LYAA 1II8A 2Q4EA 4LY6A 4UJ5A 1AQNA 1Q1NA 4MTLA 5K4GA 2LXNA 1TEVA 1KSFX 4MV6A 3DMPA 3QBVA 1AGXA 5E6UB 1X7DA 2P5UA 2DWOA 2JRLA 2NXNA 5ALUA 3D2LA 3I6YA 3PHIA 6REQB 1Z5VA 1UJ5A 2FQYA 2K7FA 4D26A 2VK2A 5DK6A 2ZRIA 3QVOA 5C5IA 4DLLA 3D6NB 1BYIA 1J2TA 2CXSA 4MIEA 1QLJA 3BPSA 1W5FA 1KU6A 1KIFA 1UKYA 1Y33E 4QQKA 10MHA 1ZVJA 3IKJA 1NBEA 3DP9A 3DE2X 4J0FA 2BSAA 2VNIA 2KLBA 1DQNA 4BV3A 2NP7A 2DWQA 1IN5A 5LD2C 4JDPA 3TTXA 1R66A 4MYRA 5AVOA 1DO2A 2NZ8A 1NFQA 4EKEA 1CNFA 4XLZA 4E1VA 5DEOA 5AW9A 4TXHA 1NNEA 2X6TA 5AI5A 3SNHA 2X8AA 2FSUA 3M1YA 1E3MA 2QTMA 2O9JA 2WYHA 3H5TA 3SJBA 1UEIA 3O9MA 1E7MA 1JGTA 1KEVA 2A35A 2WJYA 3IQXA 3MC1A 3FVRA 1PZXA 1MC8A 5EWLA 4W7HA 5I7WA 4V2UA 5KNDH 2GERA 3BHIA 1OKKA 2V0CA 2R6JA 1BU5A 2GFQA 3ZBTA 3PRJA 4XR4A 1JR3D 1CHNA 4ZARA 5FUYA 1BVYF 1NDHA 121PA 3WQBA 1XZMA 3H2HA 3GLFB 5BWOA 3REGA 1IQPA 1CRLA 1N7IA 1UMDB 3SF8A 5B12A 2HGSA 2WJHA 3BG5A 3LYLA 2IUTA 3S70A 3RF7A 4N9WA 5KQPA 4ZDWA 3T5PA 1BGVA 1NVDA 3V7NA 4OUDB 4YRFA 3HLTA 5T67A 3SSMA 5KMGB 2OESA 1KFKB 1P7CA 5LIPA 4TL9A 4K9MA 5LPNA 4IIJA 4NH4A 1QKJA 4W6ZA 4IL5A 4W8OA 1Y8AA 1L8XA 4OGKA 4IJ5A 3EUFA 2HSDA 4FBMA 2G4LA 2VHQA 3DVLA 4JX9A 4EEXA 3COSA 1RIIA 3ZJ5A 1CQJA 1KBOA 3WGHA 2JIZA 1XDGA 4UEQA 3C8HA 4TV9F 1GEEA 5A3QA 1AGRA 1ZAYA 3H1EA 4L5IA 1N8KA 4PXYA 4O0MA 4CKBB 2OV4A 2EW1A 4TQUS 5CLHA 2BDUA 5A9SA 3QY0A 1UFKA 3GAAA 3EWIA 4M8NE 4PIVA 2WJWA 2YHAA 2QAGB 3G17A 1NNI1 2JBHA 4ERNA 1VKRA 3EVBA 3H5VA 3TZKA 1E3WA 5K3CA 1MFZA 1G8MA 3OUTA 5B2EA 4NATA 3TEFA 5JZOA 5IM4A 1GXSA 4BNVA 1W8IA 4I36A 4DV6B 2UV8A 4X95A 1LRKA 3WAKA 3AQ4A 5L4SA 1XNGA 3GB9A 2DBVO 3OA2A 4DXAA 4R8MA 2BHSA 4CFSA 4PX9A 1QVWA 1Z18A 5E1MA 4W99A 5J40A 1JQDA 2ATVA 1U98A 2IU4A 2ZWPA 3K0EA 4JJ6A 4MHOA 5EMKA 2JA2A 1KJIA 4E2FA 3AJEA 1SG0A 4LYEA 2XE4A 1Z5ZA 1F0NA 4LRTB 5DX1A 5KTRA 3WYNA 1AE1A 4D9MA 1CB7A 1DWOA 1ZI8A 2VJMA 4UDXX 2RKWA 2KSQA 3ZI4A 2TECE 1FK8A 1KYXA 3AC0A 1NI4A 4FHCA 1JSZA 3STVA 1NQWA 4HQ6A 1QIEA 2W0MA 2RGNC 2OQRA 1SXGA 3FAKA 1NXSA 1N0HA 1V2GA 1Z62A 2FK7A 2PH7A 4L16A 1XWIA 5ALVA 1UMKA 1E1YA 1T6NA 3DYIA 3R0XA 4Y2GA 4G0ZA 1CUXA 2CJWB 4ODIA 5JY6A 3ISJA 4LJRA 3BGVA 1CZLA 1MORA 3EG9A 3G8BA 3MMXA 4IVQA 5JIBA 3H1BA 4RFVA 1JUDA 5ILGA 1K27A 2GBLC 1JYEA 4MWEA 2MCFA 4IQGA 2YWGA 3B8EA 4M4SA 5I7SA 3M9WA 3W4IA 2YJ6A 4N7MA 1J8DA 3GD5A 4NU6A 3WWZA 3MGBA 2OD7A 1H2BA 1XDUA 1K8ZB 3EE6A 1NQTA 3QLVA 4UVIA 1JZTA 5BWMA 4RTRA 4M76B 4G0YA 3DXXA 1SBQA 2VHZA 4G0XA 4Q02A 3W5SA 1J2RA 1SQFA 2AJCA 3LNCA 4OPMA 4YAWA 1UJ4A 3LKBA 3JQ9A 1W94A 3HJFA 4ZO9A 5ALLA 5B7GA 4OOEA 1FX0B 3MGCA 4ROTA 3ROMA 1RCUA 4BO6A 2E1PA 5K0LA 4XVUA 3DLTA 4RTPA 2WJAA 4IINA 5LLSA 1PL6A 5DM0A 4AS2A 5AVTA 3NP7A 4WZBE 5DTQA 3DEAA 2RKOA 2YWRA 3P4XA 3H4TA 2VKQA 3LWNA 1SCIA 2FW1A 4PLFA 4MJ7A 4NFYA 1UPTA 3RYHB 5CVTA 4EHKA 2AYXA 3U4CA 4DV4B 2UXCB 4LXYA 3SHWA 4JP8A 3KQOA 1EGQA 1SC6A 1AUQA 3AHDA 5CFMA 2Y0DA 3GROA 3T7EA 2O59A 1GWNA 1J09A 1LNQA 4IIGA 4KIFA 1IH8A 2JBAB 1GPH1 4MYHA 2C00A 2D3WA 2J3EA 3ZY2A 1BHO1 3DYVA 4A16A 4UCWA 4AO6A 2RC5A 3AIMA 3NHAA 4MB6A 4IDDA 2W90A 4DUPA 1NP6A 1A96A 2ID9A 3CTMA 4AJ4A 1QRSA 3F9CA 1P60A 1IAVA 5CLGA 1A0OA 4U6NA 4WV3A 1XRQA 3OZEA 3J81k 1D0IA 2A59A 4W7SA 5D1NA 1KC3A 1SM4A 5F5LA 1U5CA 4TSFD 3T94A 5CXUA 1QG6A 5JJIA 1YOVA 5JCJD 2O8DA 4QG3A 1E5VA 1JJFA 4QVIA 2QQFA 1S02A 1XD2A 5CBPA 1YZTA 5H8WA 1C3VA 2ZI5A 4JVOA 4HYTA 1CT9A 3BXHA 4LKRA 4RK0A 2ZEJA 3ROFA 3ZV5A 4PF1A 3FVTA 1QYCA 5CLQA 3DEFA 1I13A 4C7VA 2JCGA 3ZY6A 3FCXA 3U56A 3VUEA 1J22A 2IYZA 4ILEA 3BMQB 4CQNA 4YJ2F 4GI7A 3ZVMA 2QP3A 3IV9A 3F47A 3U6BA 3TLKA 5CFQA 3CZRA 2HD4A 2HA7A 3KPUA 5D86A 2NU8B 4DG8A 1RAEA 4AK9A 2L69A 3C3JA 2C20A 4FHDA 5BQFA 2CLSA 4MDEA 3W1EA 4A6EA 2OR3A 4IHJB 3SSNA 3OT4A 4LHVA 4CEIA 2X4GA 1V5WA 1QBKC 4W1RA 4EG8A 1UXKA 4K8OA 4E5DA 1UOEA 2HJWA 4CIBA 5INTA 2CHUA 3WFJA 2HK9A 1FA9A 3D9QX 2GR9A 2UUOA 4ZK2A 2X6QA 3O94A 3W4JA 4BZWA 2HW8A 1HLPA 4Q9IA 2VDNB 3BEOA 5KOYA 3WG9A 1EUCA 4W5TA 3VDRA 4TV8A 3VBCA 2C83A 1P72A 3MIIA 4F6CA 2FWMX 3ZNOA 4WUVA 5TPWB 2VBIA 3JD4A 1FSFA 2B1QA 5HTKA 2JH3A 1TM2A 5LBUA 4EI9A 4RVSA 5FA8A 2FPIB 3RM3A 4XD7A 1U99A 4ZZ0A 1UXIA 3DCJA 1C9EA 4PPGA 3B1KA 2LV8A 3T1NA 4P93A 3ZI0A 3ENKA 1Z12A 2ATIA 4ZCRA 6YASA 5E7QA 3GQBA 3SFVA 1O96B 2XVAA 3IUJA 2GPAA 4A0GA 3WJ2A 2UZAA 4IFIA 4QVGA 2G0TA 3H1FA 4ZRDA 1DG1G 1GCAA 4U8HA 3C7AA 4FE7A 4TMFA 3THXA 4TRRA 1JFVA 3PUVA 3TDNA 3TLXA 3O3NB 1IATA 5IARA 5JMTA 1FY2A 3HO8A 1JDUA 5LP1A 4RULA 2E4UA 2AKEA 4CM3A 1GKYA 1LPMA 4V0NA 3BHJA 1TM4E 1R37A 1NF3A 3QV2A 1I6LA 2WE7A 4WZBA 1M67A 2AMLA 4R3UC 3A9RA 1SURA 4N82A 2DQZA 2LPMA 5ESWA 2W4MA 1L5LA 3ZC3A 2IH4A 3PXDA 5LYJA 4KQMA 3DFFA 4R6WA 4AXBA 1XAGA 1XF9A 4ED9A 1GCGA 3KZNA 4RJ2A 5LLDA 4A5OA 5LUAA 5BWCA 1C1XB 1J33A 3NIWA 4EJFA 1KK3A 5JI2E 1YJCA 2H2IA 3GAMA 2CV1A 4E4YA 1GA4A 2ZSUA 4PAGA 1E18A 1TZBA 1R8YA 1YU9A 3AFIA 3IVXA 4CR6A 4EF5A 2B8EA 1W5SA 2FY8A 3BQ9A 4MQFA 1VMIA 2F1JA 3PFGA 4ZZ1A 2WVJA 3O2SB 4ZO8A 5HMLA 2V4ZA 3GMIA 3A2LA 5FBZA 3LO5A 5B1EA 1P5JA 1J1ZA 4YPOA 2E87A 4A15A 4J1QA 2ATEA 2YBDA 3GUUA 3HVKA 3OZIA 3FSRA 1ZJ4A 2B20A 1T0UA 4FLFA 1H2AS 3PC2A 4KQJA 1U6KA 1JDZA 3L93A 4TL7A 5HGXA 3ILHA 5EINA 1XALA 3DCIA 1LRJA 3K0FB 2QRQA 3KLNA 3MUFA 2HHAA 4M7WA 4ZVUA 5KAPA 2OOKA 5DB4A 1E32A 1YCFA 2Z8YM 4N47A 3RSQA 3T6KA 2GQ0A 4JP3A 4CHGA 5T6MA 3DPIA 1HETA 1LXCA 1GQFA 2VUIB 4I9NA 3LT4A 4X7MA 1UP7A 3MBKA 3NM6B 1WG8A 4FR5A 1J24A 2W93A 2YVUA 3I32A 3KUUA 3SHTA 2WA1A 1CRWG 4MKZA 4Z9XA 1P7PA 3B85A 4HVTA 1NBMA 1TW3A 1P2GA 3O4IA 2A1TR 4XX0B 5LA6B 4AICA 3K6JA 4WCVA 1JR6A 1FP1D 4DYDA 4JH0A 3M4YA 3ZBQA 5JS8A 4ENRA 2KQUA 1LWNA 4N3CA 4K46A 4ESHA 1Z7EA 4LK3A 4LQDA 3K0AB 2H08A 4NCKA 5F7ZA 3DFKA 3NVAA 5D5QA 5JMOA 2ZIWB 1EVJA 5JSUA 1RHKA 2QN2A 2I3BA 3CKMA 3QEJA 4BP8A 1GLGA 2V8OA 3E9DA 3NT4A 5AVKA 4QAJA 5TQ2B 1CJKC 1NVVQ 4F6RA 1FYEA 2EP8A 4CQMB 4UE3S 4Q15A 1XO1A 5J43A 1RE0A 4ZVLA 5KJ1A 2B1IA 2P6RA 1CW2B 2ZIFA 3RHZA 3BE4A 3R3WA 4XQ9A 1PLJA 1UAYA 2RB5A 3EZLA 4UXJA 2QN7A 3E9QA 4GOMD 4DIDA 5FTKA 5D51S 4KO1S 3TX6A 2CGEA 4DIKA 3KCNA 1GQRA 2WJZB 5DBIA 3ROGA 2NAFA 4Q1CA 2IU6A 3DAPA 5DGXA 4XGKA 1ZD4A 1EFUA 4KLAA 5K0GA 1EWQA 2FMXA 2F1IA 1EUYA 1G18A 2ZG6A 4XDGA 4XEUA 3WLMA 2HGZA 2W37A 5ALRA 4EEZA 2XNDD 4YJHA 1D9ZA 2A14A 1WMBA 1NVFA 1UMCA 1V8FA 4CI0B 3D6HA 1P1JA 1V0JA 3RRBA 3C16C 1L7NA 3TN7A 4IQ0A 2L17A 4O4IF 3KTDA 4HX5A 3UA3A 3OUUA 4J0HA 4G5HA 4NQZA 5EIBD 3RJMA 4HWKA 2JS7A 3AETB 1O58A 1OILA 3WRVA 5KIAA 2IT1A 2Y4NA 1YNSA 3SXUB 3GT0A 1FZQA 1NKTA 4L8YA 4C4TA 5K3FA 1AIPA 1E6WA 1AZSC 2HMTA 1UDBA 3N6RA 1TVCA 4B73A 3IQWA 1W29A 2O2JA 4AZ3B 4N3BA 2JD0A 4HMOA 5FOWA 3LM8A 4JQOA 1ZNXA 2FCAA 5I7EA 2WD9A 3AB3A 5EPUA 3KXDA 5KKAA 2XRYA 3NWJA 3AXSA 3P4YA 2ZZKA 2QSYA 2G1AA 1QB8A 3WO0A 4AUKA 1T2AA 1GU7A 1Z2PX 3GVCA 1U2TA 2QIPA 3K0CC 4RYLA 4V0QA 5CFPA 5HUJA 3M5CA 1EA5A 3SIWA 5D3QA 5F64A 3EZNA 2JLVA 2JLZA 4DWWA 1M2OA 2JA1A 1GL7A 5EOVA 1AT1A 1RHQA 2ES4A 4H6WA 3I62A 5IBRA 1OMOA 2BTQB 4D3SA 2XBLA 1PJ4A 1FSZA 4US1R 3ZZ1A 4EGAA 4KG7A 3ZK8A 3PNPA 4Z54A 2ABWA 4E14A 1HYBA 1Y9AA 4M0FA 4MYDA 3IIJA 1D1QA 1VXRA 1C9DB 2PAFA 3T38A 3V1LA 3DXFA 2EC5A 4DC1A 5MDHA 3CX3A 4NV1A 4QM7A 4QTYA 3VPDA 1C9YA 1GZ3A 3EAGA 3Q1KA 3A26A 1O9GA 3EXIA 3U9SA 2XNSA 3KSZO 4RZSA 2BGUA 3ZWMA 3ZK9A 2PKCA 3HCFA 4ZCIA 1JQJC 3D64A 1BXZA 1CTQA 4REOA 3BXGA 1E2PA 4QRHA 4RDIA 2VNKA 1X7XA 2MSKA 3ZJYA 1FDTA 4RV9A 4YMSA 5ALPA 5GADl 3NRJA 5CH3A 3TOSA 3FGNA 5EZ5A 5GZ6A 5DNUA 1Y4ZA 4EM6A 5IDXA 5KTNA 2VHTA 5L6LB 4NV0A 3K05A 3HUEA 3X2SA 4E88A 1LBTA 4HTFA 4I50F 1HQYE 5JAMA 3WBJA 1JA9A 1YQXA 1Z0FA 4KCGA 4Q1BA 4QDXA 4DA6A 2QX4A 4KSYA 4Q1VA 4HVCA 1OI4A 2FP4A 4BMYA 5DRYA 1V26A 3KR9A 4KBYA 4YMWA 3RSZA 4TPKA 3NJ4A 3GXOA 3L9XA 1V35A 3TNJA 3X2FA 1DTWA 2P4QA 1K66A 1VG0B 2B4QA 4CCYA 1H3NA 2ZR8A 2QJWA 3DVQX 5KC8A 4BL5A 4N7BA 4WA8A 4BB6A 2I54A 4LZLA 2VR1A 3WE7A 2BEKA 3HDVA 4AY4A 4ETWA 1J07A 2R5NA 4BO4A 4CQMD 1YJAA 4XM0A 1E1RD 2YXEA 1RXYA 2ONJA 3ZWOA 3PUKA 3V4PB 4BFXA 1KQFA 2O52A 1QVAA 1WTAA 2NAPA 2ODPA 3OFSA 4ISCA 3S1AB 4QWMA 2RB4A 3WYFA 3BMOB 2JVKA 2L42A 3VAAA 1FDIA 1QC5A 3EHDA 4HL6A 2IXFA 4DWOA 1W7AA 4FM9A 3PQ4A 2OBFA 2XIQA 4EO9A 4AKIA 2C2BA 2FYTA 3KAKA 1U8XX 5EE0A 2H06A 3QP9A 2P6OA 2W58A 5CX1B 2J5KA 4H7PA 2Q2QA 4PIPA 2NV0A 4B40A 1DP4A 2GARA 4MUYA 4EKNB 5DT9A 1CR6A 1DFGA 1N1DA 2P3SA 4M99A 2WTMA 3RT7A 1UJ2A 5JSZA 3CN7A 2C7GA 1FYWA 4BXOB 4Z1MA 3TUJC 2WHPB 1ZN7A 5G53C 3A1CA 1GUFA 1TEHA 1LVHA 1YBFA 3L0SA 2PUVA 3KPJA 4S05A 4QOHA 4HUJA 4H2DA 3WDKA 3AKZA 2OXCA 2XCIA 5KVCA 1RJEA 1MH9A 2C0CA 2PRYA 2C57A 3Q3HA 4HN9A 1ZGBA 2NSDA 2CDAA 3BMCA 1BE0A 5CK4A 5EIWA 2G1KA 4AF6A 1Q7EA 1HZJA 1RD4A 3T5CA 3FHJA 2GCOA 1FCJA 2ZETA 3OPQA 4M53A 4JR1A 5JAOA 5H4GA 1F7VA 4I4NA 2J48A 2P90A 3HKBB 1BVRA 3O4FA 4O59O 4WESB 4BVJA 1Z5GA 2W83A 1W1WA 3GJ4A 3HVUA 4PO1A 4ZAFA 4F92B 4KV9A 3BUSA 5IJAA 3I9KA 5ALDA 3BFXA 4AQDA 2PO7A 2BGKA 1QDLB 4QJ3A 3KQSA 3ZHVA 3K31A 2NO6A 5C3MA 3GLGE 1U3FA 3C7KA 4DA9A 4ZGBA 3J81A 4IRUB 1DEKA 4GBGA 2QQEA 5JNRA 2X8BA 3DZIA 3OJWA 4MUFA 3FWKA 3G1WA 3QOFA 1D5CA 1EWVA 5FL3A 3TB6A 3NWEA 5BSHA 1VIDA 1Y81A 4YRMA 2RMKA 3QI2A 2XECA 3RKSA 3ONNA 5AKIA 1E4OA 1UJBA 1FRFS 1OWNA 1T3HA 1ZQ9A 1Z2AA 2HMSA 1BWSA 3IAFA 4NE7A 3RFXA 3WLRA 5KVVA 4IF4A 3D2BA 5KPDA 3NCHA 4IFEA 2CD7A 3I52A 4FINA 1JHPA 1U63A 3VJRA 3N7AA 5IVPA 4YCSA 3BKXA 1FMTA 2IYEA 2J9ZB 1Q0TA 1GZVA 1U81A 4G86A 1QRAA 3NBFA 4YRTA 3RJ9A 4OQDA 3INGA 4INJA 1YZNA 4E5YA 1NT4A 3TAUA 2ZIXB 2I5PO 3IPCA 1JEDA 2AXNA 5AH0A 3ACBA 3RUAA 1JJIA 1YB7A 1D0VA 1VMEA 2CL5A 1PW5A 1YR2A 2FHPA 5JCOA 4DY4A 4F2DA 2ZIXA 5TE9A 1MO3A 1NP7A 4QDOA 1OFGA 1UDCA 3KDAA 1T2NA 3I6IA 4OEHA 2FTKE 2WMOB 2XUFA 3EC2A 3L8EA 1SKUA 4R2WA 3RGGA 3X1ZA 3UHFA 4WNYA 2AN1A 1I7NA 1S2IA 4RD4A 1YB1A 3HI4A 2A33A 3EGDB 2HC9A 4JBXA 4PZCA 2G9NA 2YQ4A 4UTNA 5AOCA 5GM1A 3N8DA 1G5HA 2JJQA 5EA2A 4DQDA 1Z8DA 5KYWB 4M54A 3C3YA 2PT7A 3TMKA 1X3LA 4Q4JB 3KV3O 3CZMA 1P9RA 4IICA 5E8RA 2WUWE 4AWBA 4E5SA 1V6SA 2PWYA 1DKQA 2V58A 3RVSA 2OO7A 3T5DA 4YALA 3O03A 4XYLA 1ILEA 4HUQB 3AJDA 1K4MA 2GLTA 3O0TA 5C8YF 2W42A 4D99A 1SCKA 2J8ZA 1GZ6A 5CVCA 2AA3A 2HSWA 3IEVA 2EYQA 2SICE 1BXKA 2WMDA 4FDUA 3SZMA 1NRIA 3GFSA 2J3LA 4ONEA 3OSUA 4RPKA 4IQ4A 2DSTA 1EP2B 3DDZX 5TB5A 2JBAA 2ACVA 2EBHX 1KH2A 2NU7A 2NU6B 2OLKA 2YV5A 3R6GA 3TQIA 3ZJUA 4FT4A 1LSJA 1M1ZA 1OWPA 1WZNA 3FVWA 3GPBA 3N28A 3LIIA 3O4HA 2WWTA 1T4BA 5F52A 3NTQA 5TQ0A 3PQ6A 3TIIA 1IY9A 4KRGA 1GAEO 1XI2A 4KTTE 1D07A 4QXMA 4IHQA 1CD5A 5J4YA 1Q6ZA 3PC3A 3C15C 2V6IA 3DAHA 1Y1SA 1YHYA 2C31A 4FKBA 4QDKA 1L7EA 4AKSA 4Z51A 1JHOA 2FRDA 1GFIA 4XYBA 3FFXA 1HFWA 4RKYA 4P33A 2PJUA 4G0NA 3UAXA 2XCTB 1XZDA 1TAUA 3ENQA 1GYQA 1W49A 3N2GB 3TJZA 5KNCH 3HR7A 3OX4A 5A3RA 1QJ4A 2RHCA 1D6NA 1DWQA 3LX5A 4XYGA 2XB8A 1BKDR 1N2CB 4TLMB 5DP2A 1X7HA 4E7PA 2GESA 1XRSB 4JWTA 4P5DA 3JYLA 3VZCA 4J6EA 1Y5LA 2M2IA 2YVAA 4GP7A 3T7SA 4H7KA 5JJLA 3D4BA 3B51X 3LSTA 1WB4A 2G83A 1AV6A 1MOPA 1KRXA 2N0SA 1H2FA 2FPMA 4CT0A 3WGIA 3LOPA 2MTBA 2UZ3A 3OZXA 2WFLA 4F5EA 3QGMA 1N7JA 4JS0A 4F4DA 1OWMA 4O29A 4URUR 3CEAA 1XA4A 5C5CA 2ORED 2YOFA 3CFYA 1MUUA 3HWSA 3ML1A 4UCXA 4BEBA 2RH5A 1U7OA 1LRLA 4ENSA 2D62A 1WE2A 2WG2A 4TMZA 1THTA 4HO1X 3Q3CA 1RRVA 3WGVA 3T7KA 5HG0A 3UMGA 4AX4A 2D2VA 4YX9A 1UWKA 1L4UA 5CDFE 1J1UA 2VXCA 3PLRA 5C7OO 1L1QA 3K1AB 2SHKA 2DY1A 1USIA 2MR6A 3H2JA 1KMIY 2KE5A 3LRPA 1KHHA 1VCHA 1Z73A 4NLLA 3GLGB 3DMNA 5AM1A 4TQAA 4UXHA 1X1EA 3QFSA 3AMVA 3AF6A 4DE5A 1C8BA 1R8JA 3Q41A 5AK3A 4LFBB 3NM4A 3R3UA 1QQ7A 1XEAA 2IPXA 2VK8A 3NNNA 2QLBA 2D0OB 1DEOA 1H85A 3CZCA 3OCWA 4RK6A 3MFYA 1GTMA 1KMCA 2AR7A 2YIMA 3KHTA 4HEQA 4HSEA 1XVLA 2QGZA 3UT0A 4IKOA 1QIKA 2V5UA 3ZZMA 3MJSA 5BW8A 4PZEA 3MJHA 5IKPA 1QWSA 3AL2A 3HRIA 3O75A 5ENZA 1V95A 1VI5A 1E6KA 3GFBA 2DH5A 2YFKA 3A3NA 2W6CX 1KZ4A 1W5TA 3EJ6A 4FE4A 1QHNA 1NWCA 2O0MA 3NT5A 2VAXA 5E0KB 4V0RA 1YKGA 1ZKMA 4ZVOA 1D8AA 2GZHA 5FR1A 4B7CA 2WF8A 2Y0CA 4BBAA 3LUGA 4KE9A 4DJJA 3O1HB 3DKRA 4LNAA 3ULKA 2O7SA 2P2GA 2ZITA 4LDZA 4OP1A 4QGHA 5IEJA 4KPEC 1PQPA 4ALJA 4WH0A 2M6LA 1WUHS 5BVHA 2IUSA 1EFTA 1OFUA 1QIJA 1GGEA 2H07A 821PA 1VL0A 2H9IA 5BOSB 3BH7A 4DMLA 3V48A 4ARUA 4U2KA 2TMDA 3K8YA 5I7RA 4MIYA 4NFSA 2OG1A 1P1IA 1S3IA 3G5UA 4NZZA 1M2OB 4KH0A 4XQGA 3MCAA 3TQCA 3VKWA 3TF5A 3JQFA 2EFHB 2IS6A 2A9QA 1Y7IA 2HCBA 4ZZIA 4RF5A 4Q9JA 4RU1A 3EBLA 1KK2A 1XTRA 5IXYA 4OX9Y 1O6GA