1EFLA

Human malic enzyme in a quaternary complex with nad, mg, and tartronate
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a closed form of human malic enzyme and implications for catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MALIC ENZYME
total genus 175
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2000-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eflA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1eflA01
4RVUA 4XR9A 1N9GA 3INTA 1E7WA 3RUAA 2UVDA 3GGGA 4NR0A 4AVYA 4WLVA 5TIIA 3OBBA 3DONA 3CH6A 3WGQA 1H2BA 1ENPA 2HQ1A 1H9AA 4D41A 3AM3A 1LDGA 2X5JO 3GA0A 3DZBA 4I5DA 3PTZA 2HU2A 3NGXA 2I5PO 1Q7CA 3HFSA 4Z3KA 2B5WA 1GYRA 5L4SA 1WWKA 1A9YA 3SC4A 3PFWO 3PK0A 1Y5MA 3NV9A 3OIGA 5I7VA 3WS7A 3OJFA 3TRIA 4NH4A 1PTJA 3GC6A 4GKBA 4QTZA 3RU9A 4D3FA 1Z45A 1GU7A 3OEWA 1Y1PA 1HYEA 3D3WA 3F1KA 3I1JA 1WAMA 4UVHA 2E37A 4YACA 1KVQA 1VI2A 2IXAA 2UAGA 3PGXA 4P4NA 2EJWA 2WDZA 3ZU3A 3B1KA 3EK2A 5FEUA 2XXBA 1Y5RA 4U6QA 1NXQA 3DZHA 3KVOA 1NM5A 2X86A 1XHLA 1ZEMA 3ZHYA 1X1TA 5G0VA 3ONDA 1IZ0A 4II2A 4B8WA 1CJCA 4IDBA 3PHLA 3WMXA 1P74A 3NRCA 4U6SA 4PLWA 3SC6A 1YB4A 3QE3A 1T4DA 3KBOA 3RUCA 4GKVA 1B26A 1PS0A 3GF4A 3EVNA 3HADA 1BXGA 1ENYA 3G1TA 5B1YA 3AUUA 3C1TA 2QYTA 4EEXA 3WICA 4BL5A 3AI1A 1M6HA 4D43A 1ZVMA 4LVCA 4IBOA 2H5LA 3NJ8A 4FGWA 3ZHZA 3ZWMA 1J4AA 3PI7A 2NTNA 1HE2A 4KUEA 2FN7A 5JPIA 1PR9A 3IJRA 3RC9A 1NASA 4GWKA 4BVAA 4CPDA 5EN4A 1NQTA 1LSJA 3DB2A 2D8AA 4LCJA 2HJSA 3VPGA 4A2CA 2Q45A 5DOVA 4IM7A 4EJMA 4WLFA 1MC4A 3ZV6A 3OQ6A 1QLJA 3KSZO 4KDFA 3X2FA 1G0OA 3HB4X 4Z6KA 4JIGA 3KYDB 1XG5A 3D5QA 5EJ2A 4AJ2A 3WBBA 3WSWA 1J6UA 3DBHB 2FWMX 1Y81A 5I7EA 1O94A 4E2ZA 3BMCB 1ZNQO 1R6DA 4RPJA 2DAPA 1MUUA 2HK9A 3KHUA 4F6CA 1PJ3A 4ILKA 4CUJA 3C8MA 4CMKA 4JK3A 1Q0QA 4XYGA 1LSUA 1YRLA 2B5VA 3ENNA 3IP1A 5FF9A 5HRUA 1IPFA 2D5AA 3WYEA 4CODB 1U8FO 3GEGA 4CM4B 4Z0TA 1GDHA 5L7YA 2D0IA 3QP9A 4IIVA 4DMLA 1T2DA 2Q1WA 1Y8QA 1QV6A 2WD8A 2SCUA 4IS3A 3GNSA 5TJHA 2RIRA 3JD0A 1B7GO 3ITDA 3DL2A 3JQ8A 2C54A 1Y8RA 5JYEA 1WDKA 3BXXA 2NVUA 1IL0A 4DXHA 4FIZA 4QUKA 1JW9B 3VOSA 3JYQA 1ORRA 2X1HA 2IE0A 3FPCA 4J49A 2V6BA 1HLDA 2EERA 1I3NA 2W4QA 4IS2A 2HDHA 3EC7A 4PLCA 3TNLA 2NLOA 4FN4A 3OSUA 2OOSA 5JSFA 1T2FA 3DXFA 1GTMA 1TT7A 3CKYA 3KYCA 1IB6A 1V0JA 4J90A 1UZMA 2VOEA 5MDHA 4E4YA 3AM5A 2J8ZA 2O48X 1XA0A 3AY7A 2C29D 3JQAD 1ZIDA 4NJOA 2J3KA 4RPKA 4WLNA 1D4FA 1VKNA 1PZHA 2Q1TA 1E92A 2YJZA 3EMKA 1KEUA 3JQFC 3JD1A 1T1SA 1PGNA 3K2EA 4NU5A 3Q9UA 4A73A 1JDJA 1YH3A 1FF9A 3F47A 1YXMA 4CM6A 1T2CA 2P68A 3EZYA 1ULSA 4AJOA 3GVPA 1YBMA 3KXDA 5DCUA 1H6AA 1YDWA 3UH1A 2OMEA 3DR3A 3DFUA 4J1QA 3Q3CA 4U5QA 5DT9A 1NAIA 4PG5A 3AUTA 4JCOA 1R0SA 2X22A 3L6EA 2WYVA 5L51A 4XQCA 4CLOB 3UHAA 5I9NA 2PH3A 1SEPA 1AUPA 1X13A 2YFHA 1N8KA 3NYWA 4L76A 2LDBA 3TPCA 3NJ4A 4PZEA 5J23A 3JQDA 2CSUA 4JJFA 4O63O 1ONOA 4RZIA 4MVJP 1HDCA 3ORFA 1J49A 4YDRA 3WJAA 4YWJA 4N54A 1P9LA 2WSBA 3S1LA 2QYSA 4XQEA 1H6CA 3M1AA 3RFTA 5T67A 3NEPX 3D5TA 2FR1A 1QYCA 1NHGA 4XRRA 3ZWWA 1F12A 1HYGA 1BW9B 3DBRB 4Q3BA 2TMDA 4Y8VA 2VWQA 3BZUA 2HK8A 3GPIA 4ZVVA 3FF4A 1O0SA 1Q1NA 4ZRMA 1E5LA 1HLPA 4HWKA 3JD3A 1SZJG 2IODA 4FFPA 5A1TA 1L7DA 1P31A 3QW2A 2BFAA 1E6UA 3CSDA 2CNBA 4K1LA 3LYLA 1FDVA 3MEQA 4YAKA 4RQTA 2VUSA 4ZJUA 2BKAA 3AY6A 3LQFA 4ALIA 3HG7A 2ZCVA 3WNVA 1ONPA 2EKQA 4FSHA 2X7HA 2D1YA 3LT4A 3FSRA 3DDNA 1G6KA 3FBGA 3VPXA 4GX1A 2NVBA 4NBUA 2Q3EA 3E8XA 5BNTA 2W2KA 3BMOB 1RPNA 4Q3DA 3N58A 4CQMD 3JQ7A 4S1VA 1LRLA 1PJ2A 1KERA 3INRA 3KZVA 4I8XA 4RPLA 2YY7A 3MJSA 2W2LA 4ZGWA 1C0IA 1YBAA 2OFPA 3GFGA 3H65A 3RBXA 4H15A 4EDFA 3WTBA 4HY3A 3DOJA 3ZW9A 4R41A 3V2HA 3PWZA 3F4BA 3C24A 3FWNA 2HLPA 4MVJF 4BO3A 3DZFA 4IIUA 4Y67A 1T2EA 3FR7A 4YEDA 1B16A 4OOEA 4XIJA 1JKIA 3L07A 4M54A 1A7AA 1MXHA 1I5RA 2QZZA 4RDHA 2J5QA 1HZJA 2V6GA 5ES3A 1SO8A 3JTMA 4ALMA 4F3YA 2IEDA 1U5CA 4DVJA 3LT1A 1G1AA 1I33A 2YZ7A 4GH5A 4WPGA 3TZQA 4EYEA 4I5EA 5IDXA 3TZ6A 5IJZA 4R5HA 4BNLA 4A0SA 1T25A 5CDUA 3DZIA 3WJ7A 2C7GA 4AICA 5BQFA 4MVJG 3WNQA 1PWZA 4GLOA 1DHRA 2VZ8A 2GZ2A 1OC4A 3PHHA 4HFNA 3WGZA 5L4NA 1QSGA 4BHTA 2VTEA 3WYCA 3PIDA 1ADFA 3ETEA 4B4VA 1JA9A 2ZTLA 3IQDB 3QHAA 1DBVO 5KCZA 5HBRA 5KKCA 3DQPA 4DPMA 4HX5A 3RUFA 2OZPA 1P0CA 3GDGA 5CHEA 3E5RA 3JCZA 4OMUA 1O5IA 4O1MA 3W6ZA 2XF8A 2QZ9A 4PVDA 4BO4A 5ADHA 1I2ZA 5I8WA 1MG0A 1PZGA 1I3LA 3PFFA 4OIMA 1GAEO 4MKXA 4PGFA 2WYUA 1BHSA 1ZJYA 4D44A 2JFGA 2DKNA 2ET6A 1HT0A 2UDPA 5F21A 2QG4A 3OIDA 4LK3A 2BMAA 3ITKA 2V6MA 2I67A 1DXYA 1GPDG 3SVTA 4E2XA 1M67A 5F1OA 1RM0A 1EDOA 4IPTA 3TOZA 1EUZA 1I3KA 5FWNA 1U3UA 4QQRA 4BNZA 4ALLA 3OETA 3AFNA 4OXYA 1YL6A 2DTEA 1GYPA 3H9GA 4Q3NA 2IDZA 3HE3A 4FD3A 3PJFA 5ICMA 1EUCA 3DAFA 3I9KA 3OJOA 5T8KC 2WE7A 1LSOA 4BOYA 4LMRA 4J3FA 5T5QA 1HKUA 2FMUA 1GUZA 4OAQA 5H82A 2NM0A 4GQAA 1W0CA 3I4CA 3L6OO 1QR6A 4WNCA 4JP3A 3ZI0A 2QQ5A 4QFDA 2C07A 3NUGA 4CQLB 4G81A 3HWRA 1A4IA 1EMDA 3LT2A 4FFOA 2VWGA 4P4LA 5EMHA 1VL0A 4GX0A 1I24A 5FI5A 4BNTA 4B4OA 5GZ3A 4PIVA 1GUFA 3RJ5A 4BB5A 1GCUA 3OM9A 1IE3A 3KYBA 3DTYA 1ENOA 3W8FA 4HNGA 3B1JA 3D3WB 2CF5A 1JWBB 3BHIA 5JBIA 3OJLA 3MJTA 4IJUA 1NX6A 5EINA 4PLPA 4A10A 5U1PA 4YQYA 1LDEA 5A06A 1ZO8A 1FXSA 4P4GA 1E1NA 1T1RA 4QO8A 4TSKA 1VKOA 3U49A 1AGNA 2B4RO 2ZYGA 1BVRA 3GZ4A 4CM9A 5C5IA 4XB2A 3BHMA 2Z5LA 2G17A 2WM3A 1ISHA 1W73A 3DHYA 5G4LA 1AXGA 3AK4A 3ZWVA 3JD2A 3F6YA 1A71A 3OIFA 1N1GA 2EXXA 1ADGA 2FZWA 1H5QA 5FI3A 1H0KA 1XKQA 2AQIA 1I10A 2DLDA 4JBIA 4Q3EA 1KY5A 4R1SA 1RYDA 3VVCA 4E6PA 1ISGA 1RM3A 2PY6A 2Q2WA 3FTNA 4W4TA 3JQAA 4E2YA 4J4BA 4PRKA 4PLFA 3IP3A 1P33A 1WDLA 4GGPA 1KBZA 1DIAA 1E1MA 3QQPA 2OBYA 2RH4A 4NU6A 3DOOA 1OFGA 4DL9A 4OXNA 4E30A 2X4GA 4YJFB 2IRWA 2E49A 3DOCA 4MKRA 1ML3A 1D3AA 2AG5A 1MGOA 4D7AA 2AEFA 1SCUA 2D59A 2GCGA 3IS3A 1VL8A 4GMGA 4ND2A 4UULA 1KVRA 1Y7TA 3JQ9C 5C3MA 4F6LA 4WASA 2CDAA 2YYYA 5JLAA 4W7IA 2JD0A 3WDSA 1BGVA 3CIFA 3MCVA 4D3DA 2O3UA 4NJMB 2QRLA 4IGFA 1DAOA 1NR7A 1E7RA 4YAJA 2O2SA 3TFQA 5CPFA 4GSLA 4IJKA 1HRDA 1N2SA 5BSHA 4FBGA 1SB8A 3VTZA 2O4CA 1KY4A 1R4NA 4IDAA 5JO0A 3VDRA 3RBVA 5B37A 2EGGA 2BH9A 2NWQA 2BRUA 1P1JA 1LX6A 3ZH2A 2AEMA 3KM0A 2JHFA 1H6BA 3OICA 2FPIA 5KJ1A 1ZKMA 1C0LA 3ROMA 3TJRA 3V2GA 5ENDA 4CLHA 5A04A 1ZK0A 1WNTA 4LISA 3HFGA 1YGYA 4CMIB 2DTDA 3OP4A 9LDTA 1ULUA 1NTOA 3X2EA 1L1FA 1QG6A 2FRDA 1GL3A 4CMEA 4Y9DA 2JJYA 4BNKA 1EQ2A 3GEMA 4QT0A 3NAQA 4L4RA 1Q0LA 4W6ZA 3H3JA 4RVGA 4UEOA 4ZQFA 3EHEA 3OECA 2ZTUA 1VE9A 1MLDA 3MTGA 3DMTC 2O3TA 1P45A 4B3IA 1YOVA 1V6AA 2RHRA 3F1LA 3H7AA 4J0FA 4MVJH 9LDBA 3C85A 5KTKA 1GADO 4E0BA 3ASVA 3L6DA 3IKVA 4QECA 1KVTA 4LCEA 3TN7A 4BMSA 3NDIA 1X15A 2O3JA 3DAPA 3ZGYA 1HE5A 4K28A 4PLZA 5GY7A 5EQDA 3WFIA 5JAQA 4E3ZA 5AXDA 3M2PA 1DIBA 2J5KA 4B7CA 2X5KO 1C0PA 1FDTA 3LVFO 4E13A 4W7HA 4ZA2A 3MZ0A 3W6UA 3KLPX 4YRAA 4UUNA 1Z7EA 2Y1GA 4NHEA 3UF0A 1B8PA 5FYDA 3KEQA 4OH1A 3JQBA 1U8XX 2Q4EA 1SC6A 3CXRA 3QJ5A 5T64A 1BG6A 2Q49A 4BGVA 2NQTA 3C1AA 3IC5A 1TI7A 3RROA 1O6ZA 1F8GA 4R5MA 3VC7A 1EBFA 1TEHA 2HMUA 3CE6A 4PG6A 4FR5A 1I0ZA 2P5UA 4UVGA 3WX0A 1E5QA 1C1XB 4JN6B 1Z74A 1FDWA 1R12A 1SEVA 3KSUA 1I36A 3RD5A 5IXYA 3FNHA 2BF7A 1ISIA 2YV3A 3W4JA 1YONA 4HFJA 1D1TA 3DWFA 4BQPA 1LC3A 2D2IA 1BXZA 3G17A 2UUOA 4NBRA 5JY6A 3GGOA 4J4HA 4YVFA 3WGIA 2IYPA 3D4OA 4EUHA 2F00A 1A9ZA 1NPYA 4L4SA 4AL4A 1ARZA 3CMCO 4R68A 4BO8A 4YR9A 1R4MB 2E82A 1DIHA 3K30A 1BW9A 4R9RA 3H9EO 4XGNA 5JO9A 3C1OA 3H5AA 5GMOA 2V6FA 3K2BA 2WWRA 1P44A 1CRWG 1E3LA 2PR2A 3I6IA 2FOIA 3IL2A 2AE1A 1QYWA 2GNAA 1QV7A 4XQGA 4BIIA 1U1IA 1KVSA 2X8LA 1QMGA 4BKQA 4OJNA 5A4DA 3SBOA 3Q1LA 1MXFA 3UICA 3ZWPA 1B3BA 2C5EA 3EZLA 4YQZA 2JD1A 5KWEA 2I66A 1A4UA 3R0IA 2EGHA 3OA2A 4Q9NA 2DVMA 5I8ZA 2G5CA 3FNGA 2GF2A 2W2KB 3FCOA 4RVDA 5G0SA 1AHHA 3VVBA 4BO1A 2I76A 3JQ7B 4R3NA 3O8QB 2QRJA 1Q7BA 5IZ4A 3UFXA 4FFLA 2NU9A 3VZPA 3U3XA 4HNHA 5CAEA 4TZKA 4HFMA 1UP4A 5AYVA 3JQFA 1GCOA 1GD1O 3FR8A 4BNHA 1U28A 3SLGA 5DCYA 4RVSA 4CJXA 4UUPA 4BGUA 1JAXA 2FPPA 4EW6A 4Q3CA 3STHA 4J0EA 3QIVA 5ENVA 1L7EA 4CM5A 1BSVA 4XEHA 2ZB4A 3TF5A 4PLTA 3M1LA 4MJLA 5TSDA 3PQEA 3GNTA 4UVIA 2GASA 2IEBA 1V3UA 2RCYA 1M2WA 3MWDB 4ZD6A 1BXKA 3ADPA 3H6KA 3P19A 4QO7A 3AY3A 5T8KA 5THQA 2ZTVA 1PL6A 1K6JA 1U3TA 4J7UA 2AHRA 4KWHA 2Y99A 2EHDA 2PZJA 4PRLA 2YV1A 3ZDFA 2B83A 1JU9A 1XDWA 4D0RA 5B4VA 4CUZA 1XYGA 4TQGA 2YHIB 4WCFA 4JX8A 1ENZA 4ND5A 1U2GA 3KEOA 1QYXA 3PWSA 4DIOA 1E7YA 1YE3A 2DT5A 5KJ6A 1GEGA 2PLAA 3FN4A 3I9MA 3AUSA 1HL3A 3K6JA 4Z9YA 4F46A 1HETA 2AA3A 3O8QA 3E82A 1LLQA 3WOHA 3I3OA 4J2OA 5A5EA 5B4UA 3GGPA 1UH5A 5KJCA 1GY8A 5KNLA 2G0TA 3WGYA 2ZCUA 1YB1A 1UXKA 5CG1A 2VUTA 2C7VA 1U2DA 4N5MA 5F5LA 3ANMA 2A94A 4CM8B 3WWZA 3CPSA 5A9TA 4AJEA 4R54A 4FPXA 4AFNA 3RC2A 1TT5B 4IQ0A 7MDHA 4CL8A 3IKTA 3JYLA 4GVXA 3DBHA 1E1LA 2DQ4A 4BNNA 1LDYA 1A27A 4MVJE 4XYEA 5ICSA 1JTVA 1J0XO 1EFLA 3PVZA 4I5GA 4AJNA 4BS9A 3R6DA 2PD4A 4CV0A 5KVVA 3KSDO 2FR8A 1QXSA 4NK4A 3JYPA 1ISJA 4GX2A 2Y93A 3WGOA 5KJFA 2HJRA 2CY0A 3MJEA 3GMSA 2A9FA 3B6ZA 3JQGB 3PZBA 2GZ3A 4FS3A 4RORA 2P9GA 4WUVA 5JCJD 3OFSA 4UREA 4RF5A 3QWIA 1AHIA 1DRVA 5G0UA 2C2XA 2PGDA 1LEHA 3K5PA 2PD3A 3L4SO 2TMGA 4BNIA 4ZN6A 4P22A 2VUUA 2ZK7A 1A7KA 2VHVA 2DUUA 1RM5A 3FNEA 3LC1O 4E32A 2O3SA 4BO2A 2VWPA 2CUKA 1KEVA 4ND4A 4CLEA 1KIFA 3GHYA 2AG8A 1S7CA 1LBEA 5IDQA 4WLUA 4ZRNA 3ETGA 1LDMA 4NBTA 4YCAA 3H9UA 3PXXA 2X23A 4GX5A 3AM4A 1XELA 4ID9A 2VRBA 3WBFA 4IZHA 4J1SA 4M49A 4BNXA 3AWDA 4J16A 4U8GA 4WCFC 4CM8A 3KETA 2EWMA 3A4VA 3FRJA 2GPTA 4YTEA 5ILOA 3PYXA 4ALJA 3FI9A 3PIIA 1UXJA 1GUYA 2X0IA 3M6IA 4BO0A 2I99A 2OGUA 1E3EA 4JNKA 1YB5A 3WIEA 1ZW1A 1CDOA 5L95A 2H6EA 1QP8A 1LRKA 3LC7O 2FZEA 4UEKA 1SMKA 1PJLA 3NDJA 5KVSA 2NU8A 4CR8A 3JV7A 4EITA 4QEDA 1JKJA 4C7JA 2RBEA 3NT2A 3ANLA 1X0VA 1C1XA 2WTBA 1HDOA 3QRWA 3HNPA 4NFHA 1HDYA 3ROQA 4ESOA 4WEQA 3W4KA 3TZCA 2Y0CA 1GV1A 1NFQA 4D42A 4GVLA 4YRBA 2EF1A 1E3JA 2Q50A 1E6EA 1E7QA 1GQQA 1X1EA 5CDYA 1B8VA 4OHUA 3Q6IA 1A5ZA 2BI7A 2XOXA 2GN4A 3Q2KA 5AVOA 2CF6A 3FTPA 5JFOA 5JCJA 4OKNA 1SAYA 3DBVO 1M76A 5F3RA 4BMVA 4M89A 4LRSB 1ISMA 1S6YA 2R00C 4WCDA 4E12A 2JAPA 2JHGA 4CM3A 2J3HA 4PG4A 3MOIA 1P3DA 4M87A 3RC1A 1Z73A 2VRCA 3S2GA 1OZAA 4RJTA 1PGQA 3O38A 4D0SA 2BFMA 2ZQZA 2VN8A 2NV6A 5BSFA 3VTFA 4UAGA 3ZW8A 4TVBA 1PR3A 5BNFA 5THKA 1YJQA 4WOJA 4BNGA 2HO5A 3JQ9A 5CDTA 5L40A 1JVSA 1YL5A 4WEOA 3DBLA 2OL4A 2VQ3A 1P77A 3CZMA 2A35A 4XR4A 4XZ3A 2Y0DA 2Q4BA 4R4JA 4XX0A 4QFCA 5EERA 3U9LA 1XEAA 4OKIA 4D3SA 3MJCA 5KIAA 1O8CA 1EQUA 4R51A 5AXCA 1LLCA 2AQHA 2YDXA 4DUPA 2OUIA 3AW9A 3GUCA 4L73A 1EVJA 1NFRA 3E03A 1JVBA 4QXMA 4NBVA 3ZWAA 1CIVA 3GHHA 1HF3A 5U4QA 4BNUA 3V1YA 3DAGA 1CQJA 4ONEA 1XWFA 2PKQO 2UUPA 5LCXA 4IDGA 4EEZA 3U62A 3IJPA 4DIBA 1EZ4A 4X54A 4UUMA 5A5FA 3L0DA 3A28A 3EYWA 2P5YA 2AXQA 4LSWA 1LNQA 2VZ0A 3QVSA 2FR0A 2P9EA 4I1IA 1NPDA 1PJSA 3F46A 2ILTA 4GAEA 4PLHA 1DHTA 4LVUA 4Z3DA 3UCFA 2J3JA 5L9AA 1ADBA 3Q9NA 4WLEA 4YAGA 5CPBA 2AW5A 4DTIA 4JGBA 3RUDA 2QHXA 3GDOA 4YJGA 1HDZA 3SJ7A 2ZB7A 4ZU3A 5JS6A 2PTGA 3ZV4A 1GQ2A 3H3FA 1LI4A 2JCVA 2AQKA 4GWGA 4NDNE 3U0BA 2W98A 1QYVA 1LQUA 2O3RA 1NAHA 4BGIA 3G49A 2BHLA 3QWFA 4BKUA 1Y8QB 1M6WA 4EUFA 4XYLA 5JAMA 4XIYA 2Q99A 2X0NA 4WE3A 1CWUA 3S2FA 4ZQBA 5I7FA 4BNFA 3JQEA 4TWRA 1MB4A 4CV1A 1VL6A 4XKJA 3HDYA 2JCYA 2PKQP 2WYWA 1BDBA 1ZJZA 2ZQYA 1VLLA 4ROSA 5H81A 5K0ZA 4NMHA 3ZNOA 5TS3A 3ZNQA 3JSAA 2F1KA 1EEHA 4YJDA 1NBOA 3AFMA 4J9VA 3UVEA 4K6CA 1HDXA 3WFJA 1DC4A 5L53A 2Y0EA 4RVHA 4AJKA 1C1DB 1ZFNA 4HBGA 4PVCA 1KEWA 1LU9A 3I23A 4I9HA 5GZ6A 4KTTE 4FJ2A 1V3TA 1C3VA 1HSOA 4GMFA 1QYDA 4YJFA 3AJRA 3KLMX 3BMQA 4NNJA 5LDGA 1DC3A 4DMMA 1VJ0A 4MVJA 3ZV5A 1PX0A 2I65A 4Y6PA 4DWVA 1HE4A 3MWEB 3ONFA 3FNFA 4W9NC 4DC0A 4M86A 3PDJA 2BLLA 1GZ6A 3GRKA 2G1UA 5JDCA 3HB5X 2EIHA 5I7SA 3NTQA 2VRCD 4NIMA 4E5KA 3BTOA 4N5NA 3KUXA 4XCVA 4A7PA 1R4NB 3ON5A 1UXGA 2PV7A 3G3EA 3KYDA 4ITUA 1FDUA 2POQX 3HDHA 3KO8A 5AQ1A 1EK6A 3ROPA 2H63A 2O7QA 3BTSA 3GAZA 4M55A 2Y1CA 1Z75A 2DBZA 3DBRA 3JD4A 2X9GA 4CR6A 3LLVA 5G0WA 1T2AA 1BWSA 4FC7A 4KUGA 1R37A 4J7CA 3WLFA 3LK7A 1UAGA 4R3WA 2C59A 2EP5A 2NTJA 4R9SA 1PIWA 1B3RA 5F1PA 1MG5A 4Q3AA 4N18A 4URFA 1GZ4A 2GN8A 3RUHA 4IDDA 1VSVA 3KTDA 2NVUB 5IF3A 1IHXA 3JYOA 1EVZA 4TKMA 3L9XA 4WKGA 4Q39A 5JC8A 1U4OA 5CP8A 3NGLA 2CDCA 4E5NA 1MC5A 1ZK1A 5CDSA 2GUGA 4NBWA 4RO0A 1XR3A 2VNAA 1EVYA 4WNIA 2OP1A 1P1FA 4I5FA 4I9NA 4Y98A 4E21A 3V1TC 2Y1EA 4M8SA 2YV2A 1WZEA 3KYCB 1CETA 2X9VA 2D3TA 2VYVA 3V8BA 4JQCA 1E1KA 1EDZA 1HDRA 4WECA 4HFRA 5DCWA 5BSGA 3GT0A 1PGPA 2DFVA 3T7CA 4P38A 4J2HA 3HQ4O 1H6DA 2NUAA 1PEDA 1T26A 1B8UA 2FSVA 3WMWA 2VHWA 3HSKA 2XAAA 4IUYA 1BMDA 1PZFA 4AJJA 5K9ZA 4GI2A 2FPGA 2GD1O 5L45A 4TMFA 2HRBA 1XGKA 3DO5A 4AG3A 3E48A 4XGKA 1N9GB 3MJVA 4MP3A 1W8DA 4B7UA 1G0NA 3PQDA 4LSMA 2PGLA 2CVOA 4CMAA 3V1UA 1HXHA 1LLUA 1NHWA 2VOJA 1B0AA 1Y6JA 3K31A 3L4BC 3NX4A 2HUNA 4L0QA 1PQUA 1PL8A 1LJ8A 1X7HA 2ZJ1A 4IGEA 3E9QA 3ENKA 4IQGA 2R6JA 4CM4A 8ADHA 3GNQA 1R16A 1V35A 3PQFA 3PHJA 3AUAA 1ZK2A 4B8ZA 2ZB8A 1WMBA 3Q11A 3OJEA 4YAIA 4ND3A 2HMTA 3VPSA 2UYYA 3HJAA 2X0JA 1R4MA 5EL0A 4OM8A 1C0KA 2BELA 4BKOA 1UXIA 3OH8A 2BD0A 5G0TA 3VZRA 3GR6A 4TRRA 1K3TA 1H9BA 5H83A 1XU7A 3EW7A 4ALNA 3FWZA 1O9BA 1PS8A 2IXBA 4OYRA 1XQ1A 4CLXA 1ZK4A 4XWYA 2EG9A 2BGMA 4DBZA 1DEHA 3A1NA 3I6QA 4OL9A 4OGWA 4NFSA 2QW8A 1PJ4A 1IHYA 2DC1A 1EK5A 3UUWA 5A9SB 3DHNA 4E33A 1C14A 4E2WA 1W4ZA 2YUTA 4EBFA 1WVGA 1NNUA 1Q2XA 3WQQA 1B2LA 2VWHA 2D5CA 1ZEJA 4DRYA 4FQ8A 1IZ9A 1U7HA 3DTTA 3ADOA 4LRTB 5I9LA 2D4AA 1AE1A 4WK6A 3PHIA 1F8FA 3F5QA 1B15A 4I9UA 5TGDA 1Z7BA 5IZCA 1SB9A 1XIVA 3ZNPA 1AN9A 4NQZA 2X9NA 3PP8A 4MDHA 4G65A 3ZWOA 1N92A 3WXBA 2P4HX 1KOLA 2C82A 4A5OA 1X0XA 2ZYAA 3P5SA 1E3WA 3S8MA 4AJLA 1BRMA 3LF2A 1DLJA 4L4XA 4Y6SA 2VNSA 1LDNA 4JROA 2NU7A 3VH3A 4KTVE 4F45A 5HTOA 4EI2A 4L74A 1FK8A 3DZKA 5IXSA 3RASA 1X14A 1I8TA 3P2OA 1KETA 5IFLA 4E31A 4D46A 5AXAA 1FJHA 1VSUA 4IZIA 5CEEA 4L75A 5K6AA 1DIGA 1LUAA 2JKVA 2ZATA 5ER6A 3SLKA 3KB6A 1ZZEA 1HZZA 4J43A 2C20A 2HMSA 2O2YA 5DULA 2DBRA 3GVXA 3ZWXA 1GPJA 2B69A 2NACA 1CYDA 3WGTA 2VCYA 5DNAA 4RPHA 1DIRA 3I9NA 4KWIA 4J1TA 1P0FA 3GPDG 4XA8A 5A05A 5TC4A 1ZSNA 2B4QA 2DFDA 4GSKA 4HADA 2Z95A 1GZ3A 3BAZA 2VHZA 2YHUA 1LXCA 1PGOA 4UVEA 4W99A 4B4UA 1K6XA 3EY4A 3BA1A 5A9SA 1U3VA 3RCBA 5TQVA 5DP2A 1F0YA 1MV8A 4YJHA 3GLQA 3MOGA 2ZKLA 2C2YA 2O50A 4O6VA 1NVGA 1YO6A 4RLSA 2GDZA 3U4DA 1O95A 3ZU4A 1YWGO 1LTHR 1DPGA 1YQXA 3C7AA 4IXWA 3A9WA 4BO7A 3IUPA 3M2TA 5JY1A 1YDEA 3LF1A 4D45A 1X7DA 2Q2VA 4CV3A 1U7TA 1D1SA 1UR5A 3W1VA 2DPHA 3O26A 3HZZA 4E5PA 5G2OA 1NVTA 2C5AA 1DRUA 4MP6A 4IDCA 4PN3A 3VPHA 3U5TA 3GVHA 2O7SA 4M1QA 4KZPA 1HEUA 4R01A 2WD7B 3AOEC 2Z1NA 4NJMA 1WXDA 4XGIA 1BDMA 4BNJA 4BUCA 1Q7GA 3ST7A 3U4CA 4BB6A 3C7DB 5DDIP 4YA6A 3LT0A 4R16A 1UJMA 2GRAA 4WOKA 5JDIA 3WG9A 1CEQA 4H3VA 1H94A 4E5YA 5L7TA 4Z0HO 3BTVA 2NADA 4BV9A 1VPDA 4DQUA 4RPGA 3OA0A 4XDZA 2RHCA 2OP0A 4MOWA 2ZB3A 1SOWA 1ISFA 3JQBC 4A26A 5JCXA 1NR1A 4B4WA 4CLOA 1SBYA 1VM6A 3K8ZA 1GQYA 1F14A 1U3WA 3VH1A 1FDSA 1ADCA 3O03A 5HS6A 2PGJA 3R3JA 4JJIA 4OSOA 4Z0PA 1I2CA 2O23A 4RF3A 2V7PA 1YQGA 3D0OA 4CM1A 3NTRA 3INGA 4GPD1 4H7PA 4YJHB 2I3AA 3E5MA 4RGBA 1PQWA 4WLOA 2HSDA 1LRJA 3UOGA 5JMPA 3RKRA 2CVZA 2JFHA 4ZQEA 4J6FA 3VH4A 3I5MA 3QVXA 4RCVA 3TDKA 3CEAA 4ZQHA 5F1KA 4BO5A 2JD2A 4JP2A 3UGKA 1NP3A 5C37A 4WGGA 3GFBA 2B37A 2AE2A 2VT2A 4C7KA 4CMHA 3GAFA 1B14A 2GN9A 3ICPA 3I52A 4W82A 2J3IA 3DFZA 4PLVA 2J5RA 1KYQA 2CDBA 1TVEA 2LDXA 3OQBA 5FFFA 3RVDA 1XU9A 3TL3A 3O9ZA 3ZNNA 4YYZA 3B20A 1R0LA 3D64A 4A27A 1R66A 2E48A 3NKLA 4J91A 1YL7A 5BSEA 4R69A 2P4QA 3PGJA 2QX7A 3FPLA 4I08A 3T4EA 3WR5A 3FD8A 4GL4A 4AJIA 4Y6RA 4OQZA 4NK5A 5A3JA 4OOFA 3HDJA 1J5PA 3HDQA 3GN1A 3GVCA 5HS4A 3ULKA 1QKIA 4K9DA 1LQTA 5AXBA 3ZU5A 3JQCA 5BT9A 1UDCA 2PZLA 3ROKA 2DM6A 3U09A 2FSSA 4BNVA 1SNYA 1HTBA 2P2SA 2ZJ0A 4CQLA 3BHJA 4JJGA 5JXWA 5K6AC 1JLLA 3D7LA 3LSYA 4L9RA 3UN1A 2OBNA 3C7CB 5DP1A 6LDHA 1KEPA 2Q1SA 1PSDA 4YRDA 2DUWA 2H9IA 4PLYA 3RIHA 4ND1A 2B0JA 4RDIA 4CMBA 4EJ0A 2EP7A 3L9WA 3ZWYA 3PYLA 1XCBA 4RVFA 4YAEA 3QWHA 4NFYA 3PJEA 1EFKA 1P1RA 4AJ4A 4RF2A 3CMMA 1Z82A 1K5HA 4IQ8A 2P91A 3RAJA 1PS9A 3SXPA 5IDYA 4KOAA 1P1HA 3EDMA 3IIEA 2WE8A 1E3IA 4MPDA 2AQ8A 4DYDA 1ID1A 2JCXA 4TKLA 1IUKA 1ZXBA 5ILGA 1NVMB 2PZKA 3QVTA 5ER9A 2ZYDA 2P9CA 4NG5A 4DGSA 1HDGO 3DMYA 2HCTA 3OJ0A 4G2NA 2OHXA 3GZNA 3VHRA 5EPOA 1CF2O 3BMNA 5TLSA 2FY8A 5LC1A 5JC1A 4O5OA 5B12A 3RWBA 5DZSA 3LC2O 1UP6A 3TWOA 3WTCA 4B3JA 4YT5A 4IINA 1YOVB 3V2UA 4IDFA 1UZLA 4FJ0A 4KP7A 1HE3A 2PWZA 1D8AA 5COBA 1Z6ZA 5JDIC 4R1TA 1ZUD1 2QIOA 3D4NA 4J4TA 4OSPA 2IZ0A 3H2ZA 3R1IA 1N1EA 4RV9A 2HK7A 3K9QO 3RU7A 2BFOA 1SOVA 8LDHA 2O4UX 2A4KA 1DFIA 4IMRA 1K89A 3P2YA 3QLJA 4BO6A 5GZ1A 3LU1A 3WGGA 5HA5A 2QRKA 3AOEA 3PPIA 3QY9A 3I4FA 3PYMA 2NQ8A 3K73O 3O4RA 3I9JA 4RQUA 5TJ9A 4CM7A 3H8VA 5DBIA 1VJTA 3H9QA 3RC7A 3E1KA 3JYNA 3FHLA 2CD9A 4HP8A 1E0DA 1BTOA 1K2WA 5KVCA 3NDRA 3ZCXA 3GN2A 2GZ1A 2OO5A 4UEJA 1MA0A 3K96A 3P7MA 5IZCC 2ZIZA 1PL7A 3BMCA 3DMTA 5TT1A 5TRTA 1PJCA 3H5RA 3QSGA 3UKOA 4MO2A 1LC0A 2VTDA 2W2LD 4J9UE 5EQFA 3DZJA 4TRNA 2EV9A 5JAZA 2CFCA 1P1IA 1Y9EA 4BKPA 5U9CA 3FBTA 2VYNA 4J1NA 3EVTA 4CMEC 3T4XA 2B35A 3G79A 1GYQA 2WJPA 2G82A 4EJ6A 4IMPA 2CMDA 3I9LA 1I2BA 1A72A 4RZHA 3TOXA 3VDQA 4DLBA 3GH3A 5CEJA 2B36A 2YHIA 1PZEA 3CTMA 3JQ8B 1U9JA 4FC6A 4DQXA 3BMNB 2PA3A 5C7LO 3MJ4A 5DOZA 1V3VA 2GERA 1E3SA 1EBUA 3PJGA 4GGOA 4IJVA 4BV8A 3GRPA 1AXEA 1DRWA 5IN5A 3QA9A 1IULA 1ZK3A 3BIOA 1F06A 3U4HA 1DFHA 1FMCA 1GR0A 5COAA 3WQSB 5JNLA 5I9MA 4EUEA 3A14A 1C1DA 2W8ZA 3ABIA 3RQSA 4DIFA 1I3MA 1DFGA 3QWBA 4XD2A 2PZMA 2Y05A 1ZXLA 4YXFA 4CR7A 3HUDA 4FCCA 3CZRA 3DHEA 3WQRA 6ADHA 1ZBQA 5TX7A 3HN2A 5A3VA 4CQMB 4YB8A 3JQAB 3S55A 1GV0A 3LZ6A 1MFZA 2G76A 4GBJA 1PU2A 3E9MA 2AEJA 3ZN2A 2X6TA 3H2SA 1PWXA 1RKXA 3T7EA 5CEFA 3ZHBA 4YJGB 3ETDA 4MVJD 5A02A 1HYHA 5AOVA 5IAAA 1DC5A 1UZNA 3LLSA 3H9JA 3AI3A 4PG8A 2BGLA 5MGBA 3PHGA 1TLTA 2EW8A 4XDYA 1H2HA 5L4LA 4DPKA 2C0CA 2HRZA 5A9RA 3A06A 3MTJA 1WZIA 1Q0HA 1XQ6A 1JKFA 3JQGA 4FDAA 1ZSYA 3QVOA 2BGKA 3IUSA 3ZWBA 3PWKA 3WWYA 1YJ8A 2W90A 3AOGA 4ZHSA 3UXYA 3IMFA 4NZ9A 2GN6A 2XXJA 3GUYA 4FGSA 5JAIA 4B79A 4DLAA 3C3XA 4N5LA 3GG9A 3HN7A 2ZTMA 3CUKA 3F4LA 3WB9A 1HWYA 2I9PA 3DC2A 2R00A 5DBFA 2GYYA 3VKUA 1CQIA 3VH2A 4BNYA 1NFFA 4BMNA 2VHYA 3WYBA 3RFVA 3KV3O 4ALKA 1DC6A 4YBZA 4GLLA 4D79A 1N7GA 2H1SA 3D1LA 2RH8A 2V65A 1DDOA 4MKZA 4CMIA 5IG2A 3WGHA 4CLRB 5ITVA 4P8RA 5LDHA 3RKUA 3OMLA 1EE9A 1LA2A 3GDFA 2JL1A 5KVQA 3RUEA 1P1KA 1WPQA 1ZH8A 1UUFA 4E5MA 5JE8A 4IJWA 4PCVA 1YVEI 3ASUA 1GEEA 4CQMA 1K6IA 4XQ9A 1V8BA 5C7OO 3IAHA 1RYEA 1O89A 5T6BA 2NU6A 2AMFA 2OXIA 3BMOA 4KQXA 5EESA 1W6UA 4JXKA 4LN1A 5TF4A 2PD6A 2RAFA 4CM9D 5A03A 1OBFO 4TROA 1N7HA 2YQ5A 2DTXA 1T24A 3B1FA 3AU8A 4JLWA 5L3ZA 3NTOA 2VT3A 4U7WA 3V5NA 3ZU2A 4C4OA 3R3SA 5JYDA 4HV4A 1DOHA 2WD7A 1IY8A 2Z1MA 3ICCA 4FOOA 2YQ4A 3RI3A 2DBVO 2PKRA 3WSVA 3IOYA 3S2EA 3PLNA 4DA9A 5JDCC 3GEDA 5BNIA 7ADHA 1UAYA 1UDAA 5CG2A 1BVUA 3ANNA 3I9OA 2X58A 5B4TA 3OEYA 4RL6A 4IXTA 4II3A 3ZHXA 3WIDA 4BNWA 4R1UA 3AI2A 4J7XA 4FFNA 4PZCA 3BYZA 4OQYA 2GR9A 5CFZA 1LLDA 1R15A 3TSCA 4U0JA 5JMWA 3PJDA 2GGSA 3QV1A 4MIOA 3TFOA 2E4AA 1IOLA 5HWSA 1T4BA 4Z9XA 1IYZA 5KKAA 2BI8A 4XB1A 2PH5A 3TL2A 5HM8A 4O0LA 3COSA 3TZHA 3H4VA 4S3MA 4EZBA 4CLRA 1KS9A 2XPCA 4UUOA 3UCEA 3GOHA 3GZNB 3DBLB 1VC2A 3W4IA 2Y68A 4MIYA 2Y1FA 5COQA 2HAEA 3G0OA 3UW3A 3ZZNA 3ZV3A 1UXHA 1WDMA 1ZMOA 4FFMA 3L4BA 3GK3A 5KOIA 3N74A 1OAAA 2A92A 5TT0A 4DC1A 1ONNA 5BR7A 2EKLA 4U0KA 1RJWA 1TB4A 3VKVA 3PLRA 3HHPA 2NNLD 4JBGA 2DBQA 1MX3A 4K26A 1PJBA 3GQVA 1PGJA 3F9IA 4AJPA 4XJSA 3TQHA 2IZ1A 3UAGA 4PG7A 1NWCA 4XYMA 4TZTA 5DBGA 2CVQA 5L7WA 4KUHA 3W8EA 4N7RA 3RJ9A 4IY1A 4UVDA 2EKPA 3QVWA 1QORA 4PFJA 1TT5A 4MIEA 4DQVA 1EE2A 3F5SA 4MVJI 3OHSX 1QRRA 2HKIA 1DJNA 4TRJA 4BQRA 3OQ1A 4MINA 4CUKA 1SPXA 1QLHA 4CMGA 2BFPA 2X5OA 2EW2A 5JW6A 2HMVA 1NYTA 1HSZA 1XLTA 1U5AA 3D3EA 1TA4A 4AJ1A 3KRTA 5G4KA 4IDEA 3E18A 3EUWA 5C7IO 1YKFA 1U4SA 2CZCA 2I6TA 1EUDA 1K0UA 1V9LA 2VYND 3GY0A 4MP8A 2Y1DA 2UV8A 4HXYA 3F3SA 1OI7A 3Q2IA 4HKTA 1WMAA 2VZ9A 5DN9A 2GSDA 4OXKA 3ZWNA 4TVOA 1EVIA 2JFFA 1YQDA 4A03A 1F17A 4B3HA 4L8VA 3LDHA 1E7SA 1CERA 4DBVO 2HMWA 2VYVD 1X7GA 4CV2A 4DPLA 1I30A 2PNFA 1RWBA 2R2GA 2X0RA 2VHXA 5CDGA 2B4TO 4G5HA 4JBHA 2IZZA 4KMSA 4KQWA 1OOEA 2YW9A 3Q0EA 2OORA 3SEFA 1NQ5A 4WCFB 4YPOA 4TRMA 1Y9AA 3GMDA 2NSDA 3VZQA 1MP0A 4INAA 3RFXA 3L77A 5TNXA 1NWHA 3N7UA 2WEKA 5EIOA 2J6IA 1XSEA 4YT4A 1PJTA 3B70A 2EJVA 1NPTO 1Y8RB 4FJ1A 4R1NA 3SX2A 1DJQA 1E7MA 1LDBA 3OF2A 4W9NA 3WLEA 3D4PA 4OO3A 4ZICA 1M66A 1YBVA 4DLLA 1DB3A 3BMQB 1JAYA 3I83A 1DO8A 4QSMA 4CMCA 3G1UA 3DEYX 4B7XA 4NPCA 3EGOA 3JQ6A 3NT5A 4YT2A 5G4KB 3RSHA 3S2IA 1E3WB 2YFQA 3PRJA 4BKRA 1DLIA 1JWAB 1PJQA 3CINA 2GO1A 2Y67A 5DF1A 4O59O 3DZGA 3RUIA 1OMOA 1I01A 4CLDA 1KVUA 4FFRA 1I32A 3VAZA 1VRWA 3KOUA 1DAPA 2FP4A 2JAHA 4MVJM 4FW8A 1RM4A 1N5DA 2DU8A 1TXGA 2PK3A 1E77A 2PFGA 4Z9FA 5T57A 2NVWA 4ZQGA 3TZKA 3AU9A 3NT4A 4RLHA 4PLGA 2WMDA 1NQAO 2Q46A 4QX6A 4BO9A 1LSSA 2NTVA 3VPFA 2IYOA 3E6AA 2Y66A 3GVIA 1ZMTA 4XJTA 1YS4A 1IPEA 1WW8A 3H5NA 3QWAA 4NI5A 3K92A 4DYVA 2Y1OA 4LMPA 1DSSG 1PQPA 3SJUA 1UDBA 3PDUA 3GG2A 3ZWCA 5ITWA 1OC2A 4HUJA 4CMJA 2YDYA 3PEFA 2Q2QA 4YT8A 4AJHA 2EEZA 1KC1A 1ZSVA 4FB5A 1VJ1A 1R0KA 5F5NA 3PZRA 3VZSA 4DREA 1GFSA 4PZDA 4EGFA 3RBZA 1JQBA 4KDEA 4RF4A 1JN0A 4XYBA 5KJEA 1H93A 1MFPA 2I3GA 3W8DA 4H16A 1WP4A 1M75A 4BNMA 5IDWA 3EAGA 4BGEA 3BTUA 4LGVA 1ZCJA 4XRGA 3U4IA 5IN4A 2E6UX 2GLXA 3ONEA 2FHSA 3IDSA 1UP7A 4CL3A 3UCXA 4LW8A 1E6WA 3E9NA 4K6FA 1BXGB 2DPGA 2Q1UA 1KC3A 1D7OA 1NQOA 2O3QA 4FOSA 4WJZA 1WLYA
chains in the Genus database with same CATH superfamily
4XR9A 3HKBA 2VRNA 3KWFA 1N9GA 4M1ZA 3RUAA 2UVDA 4NR0A 1NV9A 3HYTA 5JVDB 2G5TA 2AW3A 2XT0A 3IUJA 1ENPA 5JQGA 2W2OA 5EUMA 2ORIA 4ZXPA 4PPYA 1U65A 2PS3A 3GA0A 3MLAA 2WFLA 5LP1A 2I5PO 1Q7CA 3HFSA 5CB4B 3MAAC 1GYRA 1WD5A 2JIBA 1N8TA 5KOJA 3KZKA 3V32A 3ECSA 5JRDS 1NT2A 3LHSA 3PFWO 1Y5MA 4PYOA 3TW4A 3UMYA 3FZQA 2GJ4A 1RWKA 1DAIA 2R8BA 3AJ8A 3K05A 3KTAB 3LUAA 3OIGA 4NJEA 4OLAA 3NTXA 1NMQA 3TRIA 4NH4A 2JGFA 1T5IA 2I34A 1ND5A 2NO4A 4MKHA 2VLIA 1EIZA 1PNTA 1XZKA 4KQKA 4QTZA 2FCRA 4XLZA 1FPMA 1UK6A 2QM7A 3MMZA 4HGQA 4ND8A 1PJAA 2C2GA 1P7WA 1QG4A 1O54A 3D7KA 1ZM9A 3I1JA 4UBNA 3PSHA 4I1UA 1ULTA 2P4EA 1KVQA 2IXAA 4P4NA 3RS8A 4BEWA 2WVJA 5AOBA 3IR5A 2PE5A 3VJMA 3GLIE 2VDPB 4ZOCA 1HO3A 4RS3A 2ASEA 4YASA 4D81A 2MSCB 2FLVA 1E69A 1Y5RA 2XXBA 5DM60 4U6QA 4BX3A 2V8OA 4W5QA 3GLGB 5REQA 6NULA 5CIWA 1EU1A 4BVFA 1NM5A 1WRBA 3MQ4A 5B64A 1ZIXA 4RDCA 1IZ0A 1U7XA 3CZCA 4NAUA 4ZVPA 2CWDA 1CJCA 1R9MA 3QLUC 2PWPA 4U6SA 1DTWB 4RK0A 3SC6A 4EW2A 3I76A 2H1VA 3QE3A 5JG7A 3IRUA 1T4DA 1TOAA 2JLAA 1K7EB 3HUEA 3NP7A 1PS0A 2A33A 1KKLA 5BR1A 3IQXA 2OCAA 4UDOA 3R5SA 1T36B 2BFBA 4EG3A 2ZT7A 2OGSA 3KFXA 4L9SA 3U81A 3VU0A 2MSKA 3DV9A 4I8IA 4EEXA 1AY0A 1YRYE 1SBQA 5CITA 2YVUA 3NETA 1YC2A 3FMVA 3VKWA 1SXGA 1ZVMA 2R1VA 2FUG6 4UZEA 2H5LA 2ZWIA 3KYJB 1A7UA 1IY1A 2K5UA 3CNEA 4FGWA 4XSVA 3ZHZA 5IVKA 3RSSA 3PI7A 1QQTA 1HE2A 1LBSA 1OROA 2FN7A 3GT3A 4FYMA 4INZA 2OGWA 4KUEA 4R6WA 4S1TA 1PR9A 3IJRA 3GJSA 3OZXA 4KGZA 2GYWA 4HZIA 4BVAA 1CJSA 3K0AB 3U7QB 5EN4A 2AFRA 3TTSA 4EB6A 3DB2A 2D8AA 2GXAA 2AYYA 3VPGA 2G77B 2Q45A 3OCZA 1JYFA 3QUTA 1N34B 1XA3A 1MC4A 2OCGA 2WJYA 1G6OA 1FMFA 3KSZO 4KDFA 4JDPA 1UIRA 4WIAA 2WP0A 4ENSA 1I3CA 1WP9A 4YI5A 3TPZA 4EY3A 3RT7A 1ZD8A 3GLRA 3KYDB 3VR6A 3FZGA 2JHAA 1MB9A 4HZUA 1CNEA 4BRWA 4QJ3A 1O1YA 1QF9A 2FSFA 3E9YA 1XLTC 4E2ZA 3C87A 3FLEA 1DKOA 4XUDA 3KHUA 5CA1A 4NDAA 1RKUA 5ALTA 4ILKA 5FFMA 2ZJ2A 3C8MA 3MERA 2HWYA 3FDFA 3N7TA 4JK3A 5DHPA 3S44A 1HQYE 4XYGA 4DJTA 4RTPA 5FF9A 3VBCA 5GZ1A 3CVOA 4OAOA 5AJVB 1HYBA 4OFBA 4CM4B 3THYB 1ULBA 4Z0TA 3UG7A 4EZEA 1TCBA 1WXQA 1GDHA 3EXEA 3LOPA 4QUIA 5AVJA 4X97A 4EHLA 2QNIA 1GVNB 4TV9F 5TJHA 3G68A 4GBGA 3TTVA 4LHZA 2AMLA 2YXLA 5A3SA 1B7GO 2DUMA 2FEKA 5E2AA 3UGJA 1LPNA 1Y8RA 4YMIA 4I1PA 5TQ2A 1WDKA 2VAPA 3BXXA 4EWLA 1L4HA 1OTYA 1IL0A 2H00A 1X8XA 2NVUA 1WPXA 4PQEA 4FBLA 1JW9B 5EYPA 3VYWA 1ESZA 3JYQA 4HNRA 2X1HA 4LGMA 2X42A 4I4TA 4CF5A 4ZOEA 2V6BA 3Q5EA 1DCTA 4NCKA 1S9HA 1EJBA 3W5BA 2UZ4A 3VR5D 5DV9A 3RNLA 3L7MA 4S2UA 1UQUA 2WAMA 3JWGA 3OSUA 3AEXA 1T2FA 1UEJA 2XTZA 3C1UA 3OCXA 3CKYA 3SIWA 1JEYB 3KYCA 1V0JA 4K8OA 5LBIA 1JDBB 4G5GA 4HDRA 4C0SA 5LQAA 3AM5A 4CKCB 1JE1A 5AW2A 1YIOA 3QEKA 1MZVA 1OT3A 3AUXA 3KOXA 4O33A 5AJHA 5B1SA 5T3YA 2QRNA 1M0TA 2XGSA 5JR3A 1IZ8A 3ZI7A 1UK8A 5BMVF 3GJ0A 1R2QA 1ZIDA 2GETA 2GK4A 2J3KA 1S1MA 4LKOA 3SSMA 2POCA 3ACCA 1PZHA 2AWOA 2YJZA 4EGCB 1DBWA 1M34B 1GKIA 1ZGJA 1NLUA 1JDJA 2YS6A 4IIXA 4YMHA 1HE1C 2P68A 3HZOA 3EZYA 4MV7A 5EHIA 2OC4A 5EIBC 4DDUA 2WJGA 1RRGA 1ZI8A 3DR3A 4II7A 3ZOKA 3ROXA 1Q0TA 2QM0A 1A8SA 2XJ9A 1L5WA 3G0HA 2P1RA 1ZGAA 2JS7A 1Y7IA 1JIIA 4CCYA 2VI5A 4CLOB 4EHIA 3TECE 4HT3B 4LHYA 4C2AA 3UJ8A 5AVWA 1Y3FE 4KWCA 1UM8A 3GLFB 3IDZA 4HMPA 5B7GA 1H2WA 4O25A 2WAYA 2VDKB 4EYSA 1T8PA 3RABA 3VR2D 4O63O 4RZIA 2XUKA 4MVJP 3KPYA 4M1KA 4TGLA 1HDCA 2J0VA 2OM2A 2PEZA 3I2GA 5ENZA 2G8NA 4YDRA 2AR7A 5E9AA 4IQ4A 3P52A 3UFXA 4XQEA 1D0VA 1H6CA 3M1AA 4BQNA 1DBPA 3UIEA 2FR1A 4AO6A 1FS6A 5F33A 1YFLA 3EDCA 4KMOA 1DGQA 1G8AA 1QYCA 3DW3X 3JARB 2Z0MA 5D84A 3UT5A 5EJFA 1BW9B 4BAGA 2QENA 2TMDA 2H2IA 3N0XA 4R2XA 3G6WA 1L4GA 2GPWA 2WVAA 4JB8A 4N5DA 3R3YA 4CKWB 3GPIA 1EG2A 4I2VA 3TLKA 1O0SA 3VU9A 1Q1NA 3FIUA 4B6JA 1J8DA 1USKA 1WHSA 1HLPA 3FYSA 5K8VA 2FMIA 2XTJA 3JD3A 1SZJG 4FFPA 1E3MA 1P31A 3TBFA 4HTFA 1OPXA 3CSDA 3DJYA 4LOKA 1G3QA 2FE4A 2WTNA 3AEUB 1FDVA 1SUCA 4TWJA 1E2FA 1Y1TA 3MA0A 4PC7A 2QMZA 1CJMA 1I4EB 4MQMA 1IIBA 5FPQA 3ORRA 3WNVA 5FUWA 2DQYA 3LKZA 2DR3A 4FQ7A 3NHRA 4N1AA 1G66A 1C9EA 2A5JA 5TQ0B 3C4VA 2Z1DA 2HQBA 3V8QA 1VBFA 1ORTA 2A86A 2OHFA 3K32A 3VPXA 2GNOA 3CJQA 4MYRA 4GI1A 4PNHA 1RPNA 5DTRA 3N58A 4RKQA 2EC5A 1TKCA 1ZUWA 1HDEA 2H5EA 5CXSA 1U6KA 3KZVA 3OX1A 5C1PA 1W87A 4RPLA 1K5PA 1O58A 3MJSA 4B1FA 1UMDA 2QF7A 5ILQA 3GFGA 1MVOA 1SRRA 1WBJB 1XTQA 3ESZA 3WTBA 1TM3E 4H77A 2ERYA 3AKCA 5I7WA 3ZW9A 4Y7DA 4CIVA 3PWZA 3L8DA 3F4BA 3SC2A 3UMSA 1NDQA 4FT4A 3DZFA 5EHQA 2ID8A 4DLRA 1KO5A 4YDQA 4YEDA 1JZSA 3ENWA 5J63A 3S27A 3UM9A 2QLTA 1TPZA 2Q9UA 2WOJA 3TVTA 3L07A 4M54A 4WBNF 1A7AA 1JHYA 1NONA 4EKIA 1KWKA 2C83A 1WG8A 5ES3A 4P3YA 3WL5A 3JTMA 1PWHA 1U5CA 2HXSA 4IVQA 5JQWA 3TZQA 4I5EA 4OQEA 5IJZA 4R5HA 2VFAA 3R9XA 4A0SA 2YWJA 4B3DA 3DZIA 3WJ7A 3DE2X 5KWIA 2ZDGA 3IVCA 5B6IA 3WZMA 1RYYA 4OG2A 1PWZA 2OV4A 3WNQA 1ZZGA 1ORWA 3ZE7A 4EPXA 2VZ8A 4IRXA 1HLGA 2YVLA 2FETA 2BMWA 1Y42X 5FNVF 3WGZA 5L4NA 2PJRA 1QSGA 1YJXA 5ALOA 3PIDA 1Q6ZA 4QARA 4BGDA 1JA9A 3R7LA 3PVCA 2WWIA 3QHAA 4GVPA 3TIVA 5KCZA 2ZJOA 5KKCA 3QHQA 4BQEA 4OP1A 3DTVD 3WLKX 2OZPA 2EQBA 1QGDA 5CHEA 3QFFA 1N5IA 1JJIA 3O8BA 1O5IA 2QZ9A 2QU7A 2WIAA 4URZR 4R2HA 2WRZA 5ARCA 3PQ7A 2A59A 3OLWA 1MG0A 2XCIA 3PFFA 1Y4SA 1DDGA 2ZBGA 3MF4A 4MKXA 4OIMA 3ZZTA 5EUCA 3V4VB 3FF1A 1QKKA 4BMDA 2WMYA 2WYUA 4DCPA 1ZJYA 2FFJA 3CUTA 2IXDA 1CJVC 3RS5A 3SHVA 1PFYA 3FCYA 1Z13A 1NZDA 3EC2A 2HU5A 3DEIA 4WOPA 2N75A 1S8AA 3OT5A 4ZO6A 5FNVA 3LUDA 2WF9A 4YUWA 4ENTA 3BGOS 3IVMA 1YZQA 2BMAA 4WFKA 3BC1A 4GOXA 1EXDA 4CKBA 2QQFA 3OFND 4NWIA 1JNXX 1M5TA 3EB9A 3MIIA 3MJRA 1M67A 4G4IA 1V16A 3KJHA 1EDOA 3TOZA 2K7ZA 3P9IA 4G8DA 3TDMA 1F4PA 3GBVA 4QQRA 1YS1X 3BE6A 4L08A 4N0EA 1M6VB 1W25A 3SPXA 1XXLA 2QDXA 3OCVA 4PZ9A 4R0NA 1OFTA 2DTEA 3KK0A 1M2KA 4Q3NA 3OUTA 2EGUA 2XWBF 1DKPA 1W581 2AXPA 3HE3A 3FPAA 3LPAA 1EAMA 4FD3A 4QGBA 3R76A 3PJFA 4IUBS 4PRZA 1QH1B 3UXHA 3LP5A 3TTUA 3RO7A 1M0SA 1JHDA 2W2XA 4TT3D 1PLJA 2RGCA 4KG7A 5KYTA 1REQB 3ZJ4A 2WNSA 5E1DA 2I4IA 2QP3A 3M6WA 1QHFA 3J7TA 2W43A 1CUYA 4OAQA 1RTTA 2NM0A 3A10A 1W0CA 5H82A 3RIYA 3WXMA 4WNCA 7YASA 1G8PA 1MAHA 1RPJA 3I42A 2LCQA 3ZI0A 3TAXA 4CQLB 1JLMA 2C9YA 2PX4A 4YLYA 3O1IC 4C0QC 3O9VA 3CBGA 2R6ZA 1BEZA 2H48A 2IITA 1SUSA 5EMHA 3HC7A 1XVVA 3EZ6A 2Q2NA 4J94A 5EFZA 3JATA 3ASYA 2WKSA 2ABWA 3RS9A 3DTYA 4LJ9A 3W8FA 4FB4A 3Q8KA 3ZHRA 1M7HA 2CF5A 2ZR9A 3BHIA 4O2BA 1OXTA 2B99A 4EVQA 3KSMA 3O4GA 5KO2A 3G0BA 5EINA 1J24A 4A10A 3MT0A 2OV8A 2VJPA 3NOQA 5A06A 3HXMA 1QLWA 3LT5A 4ZDIA 4HUQA 2PMDA 1E1NA 4LOJA 1M1YA 1T1RA 3G6KA 1N0VC 1KQOA 1S3IA 1AGNA 2B4RO 3DAOA 4V0SA 3ADCA 1NMEA 3V8RA 3L8HA 3V9PA 4N48A 1UEIA 1F7UA 3L92A 1AXGA 2NXCA 3AK4A 3O8NA 1T35A 4MWZA 1T5BA 4D3XA 5EJAA 1C81A 5C52B 1J0EA 3LKBA 5E4FA 3SYMA 2CJFA 5D1NA 1H5QA 4R7TA 2H85A 4ARAA 3KEGA 4LF6B 4GC9A 4U5XA 3ZH9B 3QPWA 1G59A 1GRQA 1KDRA 2NV0A 1T0JB 4QQ8A 4TLBA 1YF3A 3SS7X 2PY6A 5HIKA 2D00A 4PYRA 5A7HA 4L15A 3JQAA 4R6XA 3T6KA 4E2YA 4CIYA 4PLFA 4RX1A 4ZHQA 2WHEA 4FILA 4EW1A 5AJWA 4XVCA 3OD5A 2EKDA 4NU6A 3DOOA 2F9MA 2AMYA 3N75A 3ORQA 4RYDA 4Y2QA 5BYBA 4KPFC 1E5DA 4AY3A 2E49A 4MKRA 2W2MA 1Z56C 4QLBA 5JNVA 5LMZA 2AG5A 1X8LA 2XF2A 2PIDA 5SY9A 2OQ2A 3RVNA 5E0KB 1X1DA 5GONB 4D7AA 2FMHA 1L3IA 3NYQA 1ZU5A 2DECA 2R44A 1UBOS 3FDIA 4FSXA 4P84A 5BN4A 2BH2A 1D04A 5A5DA 1XRNA 1OXXK 1VL8A 2JVKA 2ATCA 3WKDA 1Y7TA 3UPTA 3K1JA 3QU4A 1SUFA 1VHJA 3S1AA 4B6SA 2P5TB 4MS1A 4WASA 1WEKA 2AUNA 2YYYA 4DAEA 4B31A 3BE4A 5KQLA 1OH7A 4Q01A 5EZYF 3WI7A 2YMQA 3MCVA 1U3DA 3O31A 3OLXA 3S2SA 1U2DC 3VJKA 5HJ5A 3ABRB 2O2SA 3GLHA 5CPFA 2JLSA 3UO8B 4QUJA 2XVMA 5BSHA 1WDWB 3C3PA 1YQUA 4FBGA 3SSOA 3EG5A 3U48A 1R4NA 3NUQA 1CQPA 1POWA 4LYDA 4C5CA 5CYFA 3VDRA 2CNWD 3RBVA 1C8BA 3ZDEA 1DIOB 5JAHA 2H17A 1ZH6A 1SXJC 2BH9A 3A4MA 5DYTA 1V3QE 3F6SA 3LUGA 3VR6D 2O2ZA 2AEMA 3W8RA 3D6JA 2JHFA 1H6BA 3OICA 1TJNA 1ZKMA 1TF5A 3JAKB 1AK1A 3V2GA 2JLZA 4UCFA 4HUTA 4CLHA 3A31A 2QKYA 1ZK0A 1WZNA 2BMDA 3LNTA 2LIVA 3BWEA 4WFIA 1FLNA 4HAXA 4CMIB 2A1UA 1P4JA 1U2GC 3FBWA 3HSSA 1RYMA 4JASB 1D2MA 4W5WA 4KPUB 1C7QA 3GDHA 5JJIA 3U4QB 2EL7A 2RH9B 1QG6A 1T9BA 4MAFA 2XWSA 5DYGA 1JJAA 5FL3A 4M0CA 3T5GA 3W2GA 1KJ8A 3RS4A 4UUBA 1EQ2A 3GEMA 4QT0A 1N7JA 4DY6A 2GZRA 4W6ZA 3H3JA 2A9PA 2BUBA 4UEOA 3T5AA 3PCTA 3UUGA 4I14A 2EAUA 4OXQA 7GPBA 3M83A 3ZTTA 4LYHA 1K86A 2YHAA 2CMGA 2O3TA 3DMTC 4C0LA 5CLQA 4DN6A 4ZV4A 3GLGE 9LDBA 5K05A 1N1MA 2ZKIA 1VZ3A 3QFCA 5EZYB 3SQDA 4H0FA 3PGLA 3EIEA 1CUBA 1NBEA 2FZ5A 3C85A 4KKVA 5JJCA 3ASVA 3LCJA 3IKVA 1OW3B 1RCFA 1KNXA 4BEBA 1LNSA 1Y98A 5GJCA 1WZ2A 2XUDA 1BJTA 4LCEA 6GPBA 5ICEA 3NDIA 4HF7A 1HE5A 1CQWA 3MTQA 4JLUA 4K28A 4DEVA 5BSWA 1GRVA 1XFAA 2NO0A 3K0FA 1FRNA 4G5YA 5F5XA 1DIBA 1IY2A 1KJWA 2AOUB 2TS1A 4XD7D 1CV2A 2OECA 4B7CA 3LVFO 3MB5A 4IJMA 5KAMA 1LPBB 2CXOA 4PZPA 3ZCPA 4ZA2A 1VPEA 1E0AA 1TK3A 1DCKA 1Z7EA 1NXVA 3PXCX 4NHEA 2GFQA 3LX5A 3PUWA 4L5IA 2GJ8A 1SHJA 1PF7E 3KHTA 3LUKA 2VIIA 1UPTA 3JQBA 2IY8A 1DWQA 3HVIA 1N6NA 1GDDA 5GADl 4G1UC 2GPSA 3WRVA 4BGVA 2NQTA 1JGTA 4N5HX 1TI7A 1IH8A 3PE4A 2CKMA 3IVRA 1IONA 2HMUA 1N1DA 1TEHA 2XHEA 3K4PA 4PPGA 1MABA 4PG6A 5J2TB 1EDEA 4OFZA 5C53B 2GKGA 4NVRA 1E5QA 1KJZA 3UG6A 2XUJA 1R12A 1WCXA 1XAIA 4N0QA 1BWPA 4DAOA 5DTJA 2PVSA 4FZ3A 1NOIA 1J9EA 3ZDCA 1TQDA 3AETB 3URKA 1TEVA 1KZ4A 2WAXA 3ABSB 2BGUA 1J25A 2R5NA 4GOND 1P2TA 3GJ3A 5ALUA 3G17A 1IN1A 2UUOA 4NBRA 1QNFA 3E9DA 5JY6A 4JMLA 1AKYA 4UHJA 3KS9A 4F60A 2JRLA 4J4HA 4ZAFA 1XXHA 2IBMA 2UZIR 4RHXA 4EUHA 2F00A 2G6BA 2O2GA 1NPYA 3B6EA 4L4SA 4NCJA 3TXAA 3CMCO 4R68A 4WW0A 1R4MB 3F5FA 3H9EO 4XGNA 4EMSA 3C16C 3ZQUA 4YMGA 4YREA 1SQFA 5LNK1 2XZOA 3OZVA 4HGRA 2RI0A 2IEYA 1OYYA 3BHNA 3IV9A 4L28A 4Q00A 4QG7A 3K2BA 2G9VA 1IN6A 3ZHUA 1SKBA 4UFOA 1H5UA 3WK8A 5F7OA 2ZBFA 3EPKA 3GARA 1RWXA 2V4UA 2GWRA 1L5KA 3PX2A 4EY5A 2GNAA 5HW0A 2LNDA 3WAJA 1P29A 1P4SA 2QMOA 4XQGA 2MR5A 4A8JA 4BIIA 1U1IA 1R50A 5CD9A 1SHKA 5I8PA 5A4DA 5L3SA 1I3OA 1GTVA 4HDAA 4L0MA 5HQTA 4BXOA 3I8OA 5KWEA 2I66A 4F1JA 1A4UA 1UPCA 2CJYA 1L3BA 2WU3A 3EXFA 3VSAA 4ARUA 2P7IA 2VP6A 3LQ2A 3OA2A 3BK7A 1Q5PA 2GHIA 1DADA 3F78A 4NNOA 2G5CA 1E1RD 1LFAA 1JBQA 3SBXA 5ALKA 2K6GA 5JEEA 1QFZA 1USVA 4RVDA 2RJNA 2QVZX 3FOWA 4R3NA 2HADA 2IIBA 3CSSA 1JL3A 4FEAA 4KIJA 4AYTA 4C89A 1CHDA 4FFLA 1X3SA 4OGGA 4QJBA 1PG2A 4HNHA 5K3AA 3MWEA 1X1RA 4KQIA 3U3XA 1OREA 5CAEA 1UP4A 1G16A 2ZIXB 1OR8A 3QUSA 3I5YA 5AYVA 4XJXA 4GECA 3OZBA 1E5TA 2ZROA 4UTNA 4EKNB 2WIGA 4LXTA 5DTQA 2IELA 4HLUC 1G2QA 1XNJA 2ON6A 4HQRA 2Z6VA 4CJXA 3U16A 2BE7A 1GGKA 4UTPA 5AM1A 3AIOA 4EJ2A 2FPPA 1IRIA 2D0DA 1ZD4A 2ZREA 4EW6A 3SDSA 2RG1A 2OKCA 4CR6A 3QIVA 4J6EA 2Y0PA 3I01M 3CVJA 1RC0A 1I7SB 1P61B 3HDGA 5FLXA 2O5VA 2ZE7A 3WBKA 1ZW6A 1XEWY 3FLMA 3LPLA 1VYTA 4F9FA 2BV3A 2GD2A 3RS7A 1Z22A 3GD7A 1KSHA 1R6BX 5FAKA 3ER9A 1BCRB 2HPHA 4F97A 3ANSA 1JLRA 4UVIA 1UBNA 4ZCPA 3A1DA 5AOCA 2FZLA 1KFCB 1BXKA 1OXVA 2HHLA 4XASA 2EZ9A 2JA2A 3P19A 1WHTA 3QBVA 2R11A 4H59A 1PL6A 1K6JA 2PQMA 2ZTVA 2D5IA 4KWHA 5T8KA 3GCGA 2EHDA 1D2GA 2GCOA 1PZXA 4ZYWA 4FCVA 1E1YA 4RKRA 4TV8A 3ZDFA 3KVYA 1H2YA 2QLNA 1Z17A 821PA 1IOVA 3B3QA 2DYKA 3BXPA 2GOYA 2C5SA 4WSOA 5AKEA 2QK4A 4C4AA 3SMVA 6ABPA 3A9SA 1IU9A 1U2GA 1CE8A 1MOPA 2FX3A 1LNZA 3PQ8A 4GUAA 3GEBA 5EMMA 3AEYA 3E9RA 4OB8A 3T5CA 3DKIA 3ZOZA 2DT5A 3TLEA 4ZYYA 3ESRA 6Q21A 1Z0DA 2PLAA 3E53A 2PJDA 3I9MA 1N8NA 5GJVC 1KI4A 1P2DA 4L2IB 3H1FA 3TXXA 3AVYA 3K6JA 1K8YB 1ZD1A 4DCNA 5E1OA 4Z9YA 1KI1A 3FVTA 5EP2A 3O3MB 1AO0A 4M1WA 3RGWS 3N3AC 3CWQA 3WOHA 3O73A 5THXA 5PGMA 4DWOA 3KSBC 1UH5A 4IKOA 1GY8A 2CBXA 3NP9A 3K3PA 4PGAA 2C31A 3RFFA 3QXJA 4G9BA 2G0TA 4TS9A 5JYCA 1JIJA 1FVHA 2UVQA 3P9XA 5KWVA 1ZWKA 1UXKA 2EARA 2JJ2A 1H2RS 1HRKA 1EHCA 3RDPA 2ZZNA 4YMSA 2C7VA 1U2DA 5AK3A 5BV2P 3ZDAA 2A94A 5A9TA 3OHMA 4R54A 2C9BA 4CCAA 2VSQA 2QV7A 5TARA 4TS4A 3QKSA 4ZODA 1QVVA 3MBIA 4XCXA 1YT5A 1N2GA 3T9CA 3K71B 1GUAA 3OZUA 3CUWA 4UBIA 4PIPA 1Z16A 5E7MA 2XZLA 4IQ0A 1B0PA 1IAQA 2HJWA 2OEPA 5D3MA 5LXTF 3TPFA 1OFHA 3L3BA 4P82A 1XTUA 2Z4TA 3G2KA 4MVJE 2ZJFA 1JTVA 2IFTA 1EFLA 3KQSA 3IBFA 4UARA 1W36B 3G5AA 4AJNA 5CB6A 2PD4A 1F2UA 1WNFA 3OSZA 4RCYA 1RXWA 1RQPA 2E3JA 4LJ7A 4Y1RA 3UAVA 3WGOA 2QTHA 4GX2A 2HJRA 1MC8A 3MJEA 2QA5A 4Z54A 2PUTA 4NEHB 2NZ8A 3GMSA 3PZBA 3COPA 4KR2A 1J9GA 1TU0A 1KSJA 2O7VA 2X2PA 4AIRA 5AI6A 2E89A 1X6VA 4K9NA 1AHIA 1DRVA 1Q57A 2BM1A 3GYBA 2JCSA 5ALRA 5KYGA 3U3RA 3L4SO 5GQSA 1JHPA 2B98A 4RCZA 3ZLVA 5LP6F 4WWHA 2ID9A 2PS1A 4P22A 3OIVA 2HH9A 3B5JA 4TXNA 5TGTA 1OLXB 2CFSA 1RM5A 4DYHA 2FVXA 5HFJA 1OVMA 2VWPA 1SKYB 2G07A 3EGIA 3UTDA 1QTNA 3M5PA 4NFLA 1S3FA 4K5QA 5AW5A 3GHYA 4J0HA 1LBEA 5CX1A 4WINA 4D4IA 1HDIA 4ZRNA 1LWNA 1OJ7A 4Q18A 4ER6A 3H9UA 1YMVA 4CDRA 3E05A 5TVKA 1ZVJA 2WB2A 3BF7A 4ARZA 5JTUA 5L6LB 2JAUA 4XWOA 2ZSHA 3UTCA 5K4GA 5LQRA 2WPDA 3H1PA 2VRBA 2XKBA 4IZHA 1T8UA 1KARA 3DM9B 4YJ3F 1CRQA 2PQ2A 3EDQA 4GZ5A 3U40A 3UHOA 1PFVA 1X42A 1EVEA 3PL1A 4R8LA 4CM8A 4BEVA 1ZH4A 1KAMA 1DXQA 2AEEA 4X63A 4DEYA 5ILOA 1U7PA 3PYXA 1ID8A 2EFJA 2VJOA 4LDJA 4UHKA 4DNXA 3QE4A 4B2YA 4PW0A 1L6IA 1U11A 2OWDA 2VHEA 1SQSA 2WSIA 1N0HA 1ZW1A 3NHUA 3D0RA 5L95A 4DR2B 3PA8A 3EA5A 2OPHA 1LRKA 2KPOA 1QCDA 2FZEA 5A6VA 7REQA 3SEAA 1L5MA 5EXDA 5KQPA 4HLNA 1QIJA 2ZYWX 1NBME 1JKJA 1OPRA 4FOPA 4FDUA 4QBIA 3X1JA 4C7JA 2O8FB 1Z4JA 3ANLA 2ZSUA 4PAQA 1C1XA 2F43A 4TMTA 2AOXA 3TKLA 4A3SA 5IUNC 1ICEA 3EQ7A 4NFHA 4ESOA 4WEQA 3W4KA 2ZRHA 1QBKC 1FYFA 4JU8A 3OTWA 2V7GA 3LVRE 1EFPB 1QHIA 8AT1A 3RK4A 3QFTA 1HFJA 4DEXA 2FRDC 2G4LA 4UTZA 2Q50A 1E6EA 1E7QA 4QOGA 3RRJA 1B8VA 4KO8A 2A84A 1A5ZA 3EW9A 4IXDA 2BI7A 2HBZA 2OVFA 3AC0A 1SXJD 3FTPA 3RLIA 5AESA 4C2UA 1KFKB 1C4OA 4L95C 1TO2E 2B20A 3LP6A 4MLPA 4D8YA 4M89A 1NUUA 2XGJA 7AT1A 1TAUA 4KFSA 5J4HA 5KYYB 2BFCA 2C97A 4V0RA 4WCDA 4E12A 2BRUC 2JAPA 4S0XA 5E9QA 2GLTA 3TQOA 3UK0A 4FK8A 5IC6A 2BPOA 1S3SA 2ZITA 3M1YA 4ISBA 3GXOA 3D4LA 2QE7D 4P5DA 1TM5E 1PGQA 4AZWA 3FMPB 1H8EA 1VA5A 3HA7A 1XN1A 4N12A 2GJAA 4D0SA 1FC0A 1SCQA 5GJBA 1Z2NX 2QGNA 2VN8A 3RVSA 2G63A 5TMBA 2JC3A 3FB1A 3PC4A 2DUNA 3SYNA 2R68A 4L7VA 4UAGA 3ZW8A 3GEPA 5THKA 4IIHA 5IKPA 2QUJA 3HY3A 1G7CA 1KFEB 4HQLA 5D3ZA 2OORC 1EX6A 3BZBA 4KX5A 5LZ7A 1DT3A 2R1TA 4LHEA 1RI3A 4GZ6A 1COWA 5FA5A 3VDNB 1J42A 1MN6A 2BONA 2FZKA 4EUNA 2VVTA 4OIFA 2F1JA 5BNWA 1LTQA 3P0FA 4QFCA 6CHYA 5EERA 4OKIA 4HRXA 3MJCA 1W94A 1O8CA 1EQUA 3C6BA 2VAVA 4CRWB 5KIAA 5CB0A 1CUGA 1Z7WA 2YDXA 3G2QA 3ONNA 1M73E 3D7RA 4L73A 1NFRA 2Q1XA 4J0IA 3SZLA 1GJRA 1Z88A 3ZWAA 4DG8A 1TYEB 4DABA 3V1YA 5B6PA 4L6CA 2I03A 2WINI 4IDGA 3WLMA 3K1YA 1XTJA 3U62A 1EZ4A 2VHUA 4UUMA 1SUDA 1ZOOA 1V7ZA 1RKVA 4ZI3A 4C6TA 1E8DA 4LYFA 1QIFA 1GA1A 1KOJA 4G86A 4H3SA 3F5MA 3QEJA 2DGDA 2QTLA 4BLUA 5CBKA 2P3LA 3P4XA 2P9EA 3OCUA 4IIJA 3MYRA 1ORHA 1OLSB 3ZD9A 2ILTA 3M89A 3OOEA 1QAQA 1GNVA 2R87A 2I4NA 4I9FA 4O8CA 2ZM6B 3EPLA 4B32A 2EVWX 2ZI3A 3OLQA 4PTYA 2PL3A 1IXSB 3NHFA 4RY2A 3RPEA 3PT5A 1WB4A 5C4GB 1ZRMA 5K0JA 1DL5A 2JI4A 1YZFA 3LQRA 2AW5A 5FO1A 1P7VA 1JG1A 1MVLA 1SVIA 2QHXA 3GDOA 1ZA1A 4ZVTA 2EQAA 1HDZA 4QEZA 1D03A 4DQDA 3L2OB 2EOAA 1NU8A 4WVLA 4I6JA 5DK4A 5FPTA 3KTFA 1E1CB 3IHLA 3MINB 2Y2UA 2C61A 2Q5JA 3PC6A 3Q7QA 3LLUA 4H7JA 2AQKA 3UJHA 3W5DA 2OZVA 4OI1A 5MN6A 2IXTA 3EXIB 2V5VA 1ZUIA 2XMSA 4TUYA 1VPTA 3O8OA 4KE8A 1FOEB 2C92A 1LQUA 2W98A 1NAHA 1YZNA 3KOYA 4HWTA 2A0XA 4O2AA 3REFA 2VRWA 1VRCA 3PRYA 3TRJA 4BKUA 2G06A 3AR3A 5KHOC 2PQ6A 1N2EA 4XIYA 5AK0A 5JAMA 1A9RA 4XQ0A 3CCFA 5EAIA 4PGMA 1R0CA 3I0NA 4WE3A 5I7FA 4ZQBA 2O2JA 4BNFA 1VE5A 1AD2A 2ZIGA 4OHCA 4CV1A 2DHQA 1CS0A 5F2OA 3HDYA 4CI0B 5FOXA 4BEJA 1X2EA 2IPOA 2AUMA 3CZQA 2HCFA 4PYMA 2AI2A 3ZBPA 1GAXA 1Y89A 3A4NA 5JD4A 2BEUB 4ARIA 3T9FA 3T8YA 3C7KA 3BL8A 4L9WA 5TS3A 2I22A 5D7BA 2CLMB 1EEHA 2C1EA 4NV1A 5CA0F 3GFSA 1Z6QA 1IUNA 1CNMA 2HLDA 3FSEA 5H8WA 4FZVA 4K6CA 4W5HA 5BQ5A 3W2FA 1DC4A 3WFJA 4Z4IA 3UT6A 3PFKA 4O4IF 4B3GA 1E59A 2JRCA 4B75A 1XOIA 4UC0A 4ZXFA 1Q15A 3I2KA 4X7MA 2X0EA 4C6RA 4F3NA 2DB3A 5MHTA 3T35A 4R8SA 1Z5GA 1LU9A 4LX0A 4C3OB 4MV6A 5GZ6A 4KTTE 4HOYA 3FUWA 4CIWA 4FJ2A 5IAJA 1ECFA 1H4QA 1CJTC 1AS0A 3IP8A 3KZMA 5FTMA 1SU4A 4BASA 4DG9A 3K5IA 1IG3A 1WPRA 2Y0BA 4YJFA 3KLMX 4REOA 2PSFA 1VG9B 2JLYA 2GCPA 1P72A 3IERA 2Y8EA 4ZT2A 4G1MB 1PX0A 3P9PA 1O6GA 4LFAB 4DWVA 1HE4A 1Z5WA 2I7CA 2BHRA 3HB7A 1ECCA 4KK4A 1THZA 1SR8A 4LJLA 1L1QA 2ZT5A 4RFSB 4OHBA 3GL9A 3TE7A 1UFOA 4DC0A 1I2MA 5KDLA 3GJ4A 3PDJA 4M7PA 4ZVOA 1D6NA 1SJ9A 1OU4A 4KACA 5JRZA 3FNQA 2CXNA 2ZWAA 3BERA 3SD7A 3TQFA 2G1UA 1OA1A 1D5WA 1KHTA 2H8GA 5JDCA 3QOWA 2RJOA 2BGRA 1IAVA 4JYMA 3ML1A 4JWTA 2ATXA 1SCIA 2QRGA 4MRSA 4NIMA 4RPCA 3CEJA 2PZEA 3F6CA 4W6QA 4CHGA 4LJ4A 1FRQA 2R4TA 3ON5A 1UXGA 2H07A 3G3EA 3JPWA 4ITUA 5BYKA 3BL5A 3O8LA 2POQX 4MDYA 3KO8A 1E20A 3EG9A 3SM3A 2ZIEA 4U00A 3ROPA 2OXFA 1SIOA 3Q5GA 3BTSA 4KIGA 2QD5A 3VBEA 4M55A 4CG2A 3DE0X 3DBRA 2X9GA 5LJIA 1CU1A 3IBSA 4M1SA 5G0WA 1N5LA 3DYVA 4DLYA 2NZYA 1UOEA 1BN7A 3TZLA 1GPLA 1S8FA 3FUTA 4CTJA 4HVTA 1R37A 2DULA 3MUNA 4LSGA 4K87A 5IPFA 2WQ7A 2FMFA 4R3WA 2C59A 2EP5A 2NTJA 2B4AA 4FX2A 5DSTA 1N6PA 2IIPA 1B3RA 3PPYA 4HO1X 1MU0A 1R9NA 1JUDA 4C7OB 1U2TA 1V9CA 1DTSA 4URFA 2B1GA 2P4UA 1VP3A 5TMEA 3BGSA 3OPYI 1TYAE 2ZE8A 4W7SA 3R74A 2FFRA 4X3OA 2JDID 4GEKA 3C5VA 3H4IA 1JHZA 3JYOA 3L8GA 3QPUA 5HUQA 5HOQA 4AY2A 1CRLA 2Q62A 5BN5B 1IVNA 1U4OA 2NXJA 3H2JA 5JC8A 3TUZC 2BEVB 4MVYA 4ND7A 4E5NA 4ZYZA 1MC5A 3CVWA 2GUGA 4F8JA 3OPYA 2VNAA 1Q3HA 1I2DA 1EVYA 4DT1B 2RHDA 1PX2A 4DIKA 1P2BA 1E2UA 1TYCA 5EP3A 4NOLA 4E21A 1AH2A 4BB9A 2Y1EA 3E35A 4M8SA 3FHTA 1WZEA 4OJQA 1Z0ZA 2VYVA 3V8BA 4JQCA 3UH0A 2GTIA 3HY6A 4OQDA 3VXKA 1YU6A 5DCWA 1YHYA 1EFDN 1QE0A 1T9CA 3GT0A 3R3WA 4P38A 2AZ4A 1RWPA 1XQ9A 3HYCA 2NUAA 4AKTA 3LL7A 1OX4A 4HGOA 4NATA 3WMWA 1G6HA 2VHWA 3UYLA 1MNAA 1M6YA 3N53A 2DKOA 2XAAA 4K9RA 4NSNA 5FLEX 3A70A 1QO0D 2Z2JA 5K9ZA 2P67A 1K4MA 1YUNA 2XA1A 3DXYA 2C0PA 3WVNA 5L45A 4IYRA 1XPUA 3PDWA 2J7KA 2YCBA 4GC5A 3ZIDA 2WKQA 1UBHS 1Y3BE 3E48A 4AG3A 3I01A 2MSDB 1CDDA 2I2BA 1W8DA 3DTNA 2QAGB 5BMVA 4LSMA 4ZZ3A 3EVBA 3HRKA 4XX1A 2RHJA 5DI3A 3JX9A 2X6RA 2FVYA 2VOJA 4IL5A 1Y6JA 3AFIA 3BJEA 1WF6A 1KORA 5IHPA 1A82A 3K31A 2OFOA 3L4BC 1B42A 3NBAA 1U9YA 4IGEA 4LF9B 5HRCA 3QPBA 3KFLA 1Y7PA 4CM4A 3FVWA 5AVTA 4ZZ2A 4HAZA 2F55A 2AN9A 3U7JA 4O3MA 1THTA 4RHFA 1O77A 2YX1A 5DYNA 3N39C 4DUGA 4TT8A 2WICA 3CEMA 1LX7A 4X1IA 4XLLA 4D02A 1A9XB 4DA6A 3WC4A 3N7AA 4X71A 2HMTA 2V98A 1KMCA 1I2AA 3BH0A 3VZBA 1FTNA 2C2HA 3I0MA 1MO6A 5EYPB 5E6RB 2YQZA 3BF8A 5TR9A 1BA3A 3Q72A 3SR0A 2J1LA 1EBBA 5IJAA 3UV6A 4B3FX 5AW8A 5J58A 1VDZA 4N41A 1QIMA 4EQZA 5HK9A 4TRRA 2FPOA 1QB7A 4MB6A 3NAGA 2X9QA 2WP8J 4ALNA 1O0CA 1YJAA 5KOHA 4YFVA 4OYRA 3WYNA 4CLXA 1W85A 2XUAA 1MB3A 1ZK4A 1NF3A 4RTNA 3QJGA 4LOIA 4IEIA 4QUBA 4E7OA 5FUMA 1W4AA 3U7HB 2F9LA 3L41A 4DIDA 4MRMB 1HYQA 3LUPA 3Q7IA 3UUWA 4GMKA 2XRYA 2YUTA 1Q1BA 3U7RA 4LXYA 1NNUA 3QNWA 1YHZA 4MA5A 1EX9A 1RLOA 3P27A 3VMFA 2YYAA 3G5LA 1VFNA 3DTTA 1XWWA 2Q4OA 5I9LA 2D4AA 4FKBA 2DT8A 4LC0A 1SC1A 3PHIA 3ZDBA 4TKZA 2WG2A 3HB0A 4I9UA 1E9VA 1Z7BA 1BH6A 3ZNPA 4BMCA 1DBSA 3C98A 4NQZA 5TPWB 2P6OA 3PP8A 4DIMA 4G65A 2BY4A 1N92A 3EISA 3ZWOA 3WXBA 2AC7A 1RSZA 1KOLA 5AW7A 4QUGA 5EIXA 4D9IA 1X0XA 1E3WA 1F2TA 1YUMA 3EGCA 4Y6SA 3BXEA 2X5NA 3JALA 4BLWA 3HKCB 4KTVE 4REMA 3WDMA 1NULA 3CLVA 4L74A 5EJ4A 4C76A 5IXSA 2O2IA 4MR7A 1X14A 1Z4IA 4ZAZA 5A4KA 5JH7F 3P2OA 1KETA 4CE6A 1RYZA 4ACBA 2WQ6A 4D46A 3FOFC 1FJHA 2QEQA 3BSFA 1II8A 1VSUA 5K5EA 2CW5A 2VJQA 5DASA 1QGUA 4MAMA 4FR0A 2XTAA 1E4YA 2H0RA 4M53A 1FZQA 3OZFA 5EWJB 1H3EA 2ZYRA 2HWUA 3GVXA 4US1R 4XM1A 3VKGA 2JA1A 3VOAA 1FMLA 1HFEL 1H4TA 1WSBA 3DA8A 3UGQA 1DJMA 4OJYA 5DNAA