1EFPA

Electron transfer flavoprotein (etf) from paracoccus denitrificans
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
307
Chain Sequence
AVLLLGEVTNGALNRDATAKAVAAVKALGDVTVLCAGASAKAAAEEAAKIAGVAKVLVAEDALYGHRLAEPTAALIVGLAGDYSHIAAPATTDAKNVMPRVAALLDVMVLSDVSAILDADTFERPIYAGNAIQVVKSKDAKKVFTIRTASFDAAGEGGTAPVTETAAAADPGLSSWVADEVAESDRPELTSARRVVSGGRGLGSKESFAIIEELADKLGAAVGASRAAVDSGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQIADYGLVGDLFSVVPELTGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
publication title Crystal structure of Paracoccus denitrificans electron transfer flavoprotein: structural and electrostatic analysis of a conserved flavin binding domain.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 82
structure length 307
sequence length 307
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1efpA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1efpA01
1EXDA 1D4OA 2Q27A 3GLRA 2YWBA 3D6VA 3FZNA 3ZJUA 1YULA 1YI0A 1T9BA 2BYTA 1M8PA 4I6JA 1NSYA 2VK4A 1KORA 2QUHA 1MA3A 5IJXA 3S3TA 2WVHA 4MQ5A 3H9CA 1IQ0A 1O97C 4DDMA 2NXWA 4MPJA 1A8HA 4NATA 4K9QA 2R5WA 1PT9A 3PNBA 4OJMX 4EF6A 1JMVA 4MPRA 1BS2A 4EFKA 4NDAA 1EFVB 4UZEA 5K2OA 3I05A 1QRUA 1HZZC 4K9KA 3CLSD 1EUQA 1JECA 3ILVA 4EG1A 1NUTA 2X3FA 3FHJA 1FFYA 1R6UA 1ZUNA 1N2GA 1WY5A 1WQ4A 5EJ8A 2QUIA 3P0HA 1NM5C 4JSRA 1NYLA 4FEGA 4MLPA 3H9BA 3GMIA 1U28C 3EY9A 4KGDA 4L2IA 2H2DA 4F4UA 4BWVA 1PFYA 4ND7A 3EYAA 1OVMA 2VJYA 3PKJA 1IH8A 4Y6OA 4MW0A 3LQ1A 1OWMA 1J1ZA 2TS1A 4PBTA 2PZBA 4MW4A 4UU8A 3U3DA 4HJRA 4BVEA 3CLRD 2JI7A 4MUGA 1M2KA 1UPCA 4COKA 5HUJA 4L3OA 1KH3A 3HV0A 4RPIA 1T9GR 2E0IA 1JHDA 4AQ7A 1GTRA 1O6BA 1WXGA 1QU2A 3CVXA 1GPMA 1J8FA 1WKBA 4IAOA 3RIGA 3Q4GA 3FETA 4FVTA 1VL2A 2QQGA 5EJ4A 4I6GA 3IVXA 4X0EA 1WOYA 1OWLA 3DLAA 3FH0A 4K9NA 2BRUC 2PZAA 4F56A 4K9OA 3JWPA 4D5GA 1N2IA 3MLAA 4BVHA 4MVYA 2JANA 3RK0A 1X8XA 3LOQA 1COZA 3ZGZA 4BVBA 4ZT4A 1G8FA 1MB2A 4RMJA 5DEIA 1F4LA 5MF6A 4MUHA 1XNJA 4ZT6A 4MPPA 3VGJA 2QTMA 4G5YA 4QBTA 2O8VA 1OD6A 3IH5A 2RD2A 1XJQA 2HZ7A 2YWCA 1JIKA 1OWNA 5EJ9A 3CLUC 3HGMA 2VTBB 4PY2A 3UC5A 3GLVA 2HMAA 1IRXA 4EG8A 4F3RA 2Q29A 4UTZA 4MW9A 2PANA 3PNYA 2ZP1A 1U2DC 1O96B 3PXUA 3SEZA 2DETA 3QTBA 3CF4G 2X1MA 3CLTD 4KKVA 4MZXA 2V3WA 4GM0A 4MVXA 4FEEA 1I2DA 4KR9A 1DJLA 4JD5A 3N8HA 1T9AA 5AHKA 3KT8A 1EFPB 1ULHA 4MULA 3U1VA 5K0TA 2J4DA 4FZ3A 3CVYA 2DLCX 3AIIA 1QQTA 1O94D 2QTRA 3FIUA 3KT0A 1YUNA 2OQ2A 2O5RA 4YP5A 5D7NA 4QREA 2NYRA 1VBMA 4MUFA 3JR3A 1NUQA 3ZG6A 2E21A 5JBNA 4AS1A 4GG1A 3X1MA 4RMGA 4ZT5A 1K92A 1I6LA 1KAMA 1N1DA 1SURA 1JGTA 4KPUA 2CYAA 1G8GA 4CQNA 3H97A 3RFFA 3N9IA 3OTWA 4ZCPA 1SZCA 1G8HA 3UK2A 2A88A 2H2GA 3ZXIA 4EG7A 1JIJA 2H4JA 2G36A 5LM3A 1ZH0A 1MOPA 2C5SA 4DJAA 4BV2A 1BFDA 2OD9A 1M8JA 1PFUA 4MAFA 1U2GC 4V1CA 1K4MA 3P0JA 2A1TR 1Q19A 1IQUA 1M2JA 3G5AA 2XRYA 2VBGA 1T6ZA 2FRDC 3P52A 2IHUA 2PG3A 5FYQA 2GOYA 4X3PA 2IELA 1IVSA 3OE1A 3Q10A 1N2OA 4IF6A 3BL5A 4S1OA 3IUEA 1KQNA 3F6BX 4GM4A 4Y6QA 2CUZA 2Z3VA 4YBRA 5FNZA 3IVCA 1OWPA 5DASA 2A1UB 3IVGA 5LFAA 2EZTA 5HG0A 2UZ1B 4I5IA 3ZJVA 1PG0A 1U0BB 1Z8NA 1QJCA 1YC2A 4WNYA 1YI8A 2GKSA 1LW7A 1MJHA 2QTNA 4XSVA 4YP7A 4GPEA 3NBKA 1WXIA 1T9CA 5TEWA 4Q16A 2V0GA 2J09A 5BWLA 3ELBA 4RMIA 4HJXA 1LI5A 5KWVA 4RJJA 4ZP1A 4BN4A 1J70A 3CLTC 3GUZA 3COYA 4XFDA 3IMEA 1PNOA 3P0IA 1NUUA 3FWKA 4ZCRA 4DLPA 2H2IA 4JUAA 3ZGOA 4RMHA 3U31A 5J59A 1S5PA 4DNXA 2B7LA 4MW5A 3AFHA 1N77A 4EG4A 4J1TC 4JFAA 5K6RA 1Y42X 4Y6LA 1ZPDA 3COZA 2Q5LA 3VU8A 3IDFA 1N0HA 2JA2A 2XRZA 1Q15A 1TYBE 2JLAA 3ZJTA 4UUAA 1MBZA 3RJZA 5DEOA 1VLHA 4F4HA 1Y9DA 3D6UA 2FR8C 4OUDA 3X1JA 1K97A 1PFVA 1WJGA 4MWDA 4L2IB 5HUHA 4MW2A 3LE8A 1H3EA 4ZT3A 1S4MA 4MW6A 2AG1A 2W93A 3HWX1 1U7DA 1N2BA 1F7UA 1V5GA 1WQ3A 1OZGA 2QUJA 3TZEA 3ZIUA 1S7GA 2EJCA 4YMIA 4P2BA 2IHVA 4MUKA 2CV1A 1U3CA 2DERA 1GAXA 4QELA 3IODA 1I6KA 3C8ZA 1X6VA 2AG0A 4H3SA 1POWA 1YNOA 3EA4A 5K6TA 1R6XA 4ND6A 1Q77A 4UZFA 1EJ2A 3UY4A 3X1KA 3ZGVA 1M2NA 2WB2A 5F23A 3ND7A 3RHSA 3FY4A 1OZHA 3E27A 3NBAA 1N2HA 3TQOA 2CSXA 4E1AA 4QRDA 2BTEA 2Q5OA 3LCJA 1YUMA 2OORC 1ZH6A 2Q5QA 3SYTA 2A4MA 4KXQA 1U3DA 2WQ6A 4QQ8A 4UTRA 2H2AA 1N3LA 3SDBA 2H59A 2IHTA 4C78A 1MB9A 1LI7A 1O0CA 3CA8A 3ND6A 2JAXA 3MMXA 4G5FA 2VK8A 1PFWA 1WXFA 1M8KA 4FZJA 4K9LA 1N2JA 2JLCA 1Q14A 1J09A 2ZUFA 2A86A 1QRSA 4MUEA 4R0NA 2DPLA 1JZSA 2HGZA 3CLSC 4ZCSA 3MXTA 2A1TS 3VRHA 4ZT2A 1QRTA 4U7JA 3TS1A 2X7JA 3KT3A 4CDMA 4JUBA 1PYDA 5DB4A 3PNVA 4NAUA 3IOBA 1O97D 3IOEA 1XNGA 3HFJA 3K9WA 3JXEA 4HPWA 5H7XA 3CLRC 3IOCA 3ISJA 1TYCA 3KFLA 1H3FA 1IQRA 2Z09A 4ZZIA 4K9MA 2PXHA 4KR7A 4BUZA 4UTVA 2WVAA 5TS2A 4KPUB 3GLTA 1V47A 2H29A 3IMGA 4JXXA 3IUBA 4PBSA 4RUKA 3PKIA 3COVA 4J16C 4YP6A 1J21A 5KHAA 1IFXA 4D5EA 3RBAA 3G6KA 4JUDX 2CYBA 4EG3A 2FSVC 4JYZA 2YXNA 1PI3A 4V1CB 2AKEA 2WVGA 2VXOA 1NZJA 1O0BA 5H16A 2DUMA 4EG6A 3TQIA 1TYAE 1F7VA 1YIAA 5FO0A 1MCZA 4DDHA 4GRIA 2B4YA 4K0RA 3QE4A 2H2FA 2E89A 1M1ZA 1OBCA 2JI6A 1KP3A 3HZRA 3COWA 1VBKA 1PO7A 4C7BA 1KKUA 4J76A 3K32A 4PBRA 1HYBA 1R6TA 4K9PA 3FSJX 1XLTC 1GZUA 5EJMA 4R2MA 2WSIA 4UUBA 3GLUA 1H1TA 1NI5A 2EZUA 3ZXSA 3CVUA 4CT0A 4HD8A 3OP1A 3IAEA 1T9GS 4DDKA 1T9DA 4V1CI 4MWBA 2AZXA 3UMVA 1YTLA 5EJ5A 1YHYA 1YI1A 2A7XA 1JILA 1TFUA 1O94C 2Q5JA 1B6TA 1PNQA 1J20A 2PGNA 2EL7A 1OZFA 1O95D 3N05A 1M8FA 3CLUD 4U8HA 1JZQA 1U7XA 2J08A 2PZ8A 3PDHA 3DV2A 2E18A 5MFZA 1YBHA 1FYDA 1KQPA 2NSYA 5DK4A 1POXA 2VBIA 1EFVA 3AG5A 4GP9A 2OO5C 4BVGA 2OV4A 1KP2A 1O5TA 3INNA 1J1UA 2DJIA 1Q6ZA 3SZ3A 2PFSA 1PVDA 3D81A 2X0KA 4ZCQA 1TYDE 1V5EA 1DNPA 1F9AA 3N2YA 2EZ4A 3H05A 1V8FA 3AL0C 1UPAA 1VBNA 4O8ZA 4TWIA 4UU7A 2DEUA 2PGOA 3FLMA 3CR8A 3SZGA 1SZDA 1V5FA 1H3NA 5IHXA 4BVFA 4BN5A 4OUDB 4G1CA 4EG5A 1EUYA 2QJOA 4MWCA 3Q12A 4UTNA 1M83A 1MRZA 4JXZA 1UFVA 1NP7A 5TEVA 1MAUA 4MVCA 4MUNA 1JIIA 2EZ9A 1QTQA 4GU5A 4MW1A 4XFJA 5BNZA 5EJAA 3HWWA 1N2EA 1KAQA 4DE5A 3CVVA 3KT6A 2H4FA 1M2HA 2VBFA 4NX2A 1KH1A 5KCMA 4MUJA 3TNJA 5J58A 1ZJWA 1Q17A 4ZT7A 3RIYA 1T6YA 4JU8A 1QPBA 1WXHA 2RE8A 2CT8A 2CV2A 2QJFA 1JEDA 3HMQA 3M5WA 2DXIA 5DGTA 3G59A 2JIBA 1WZ2A 1ICIA 2HJHA 1QU3A 1Q11A 3A2KA 4K03A 3H99A 2CV0A 5BWOA 1GN8A 1D2RA 2NZ2A 1JSCA 1RQGA 4MQ6A 2VTBA 2JI9A 4ARCA 1YIDA 3AG6A 2WQ7A 2H4HA 5EJ6A 2IP1A 2ZUEA 4MUIA 2Q28A 3MUEA 4QPZA 4HDAA 3FG9A 1EE1A 1O96A 3DPIA 1O95C 3NV7A 1KH2A 3RK1A 5EJ7A 1QNFA 2YY5A 1XNHA 4RJIA 4BV3A 2D54A 4HK4A 2QQFA 2JI8A 1EFPA 2J5BA 4UTXA 2D13A 1N78A 4R8MA 1OBHA 3FI0A 3UOWA 2QUKA 5EKDA 4Q9DA 3HL4A 4MWEA 2X1LA 3FDXA 1IHOA 3FNRA 4G6ZA 1MC1A 2J07A 3F6EX 1N75A 5MFPA 2Z08A 3K35A 2PIDA 3ND5A 4JU9A 3TZLA 2VK1A 3A04A 5FEMA 2OD2A 4TWJA 5MGNA 4MVWA 1ILEA 1NURA 4R2LA 4X3OA 4JUFA 1KR2A 3A4IA 5J5AA 2D5BA 1T6XA 2V0CA 1Q1AA 4Q93A 1TEZA 1U31A 5LLTA 1NUPA 3SP1A 2CFOA 1MAWA 1G59A 1KQOA 2CYCA 4WSOA 1M8GA 4JT8A 4RJKA 2H2HA 5TGTA 3SEQA 1UPBA 1M2GA 2EZ8A 3D4BA 5BWNA 1GLNA 3DO8A 3IMCA 4MW7A 4KR6A 4CDNA 4EGAA 1TQ8A 5FO1A 2FWNA 4JT9A 3D7KA 3F3MA 2C31A 1OWOA 1PG2A 3L92A 3GLSA 1PTJC 1P7PA 3AKZA 1WXEA 2A84A 4A91A 3QTTA 4ARIA 1E3TA 5DGDA 1GTSA 3CVWA 3A05A 2IJGX 2GM3A 3L93A 4I6EA 4U63A 4JUCA 4ZCTA 5IMSA 4JZYA 2DR2A 4GM1A 3E9YA 1CT9A 3ZUGA 2UZ1A 4TS1A 2A1UA 3PRHA 5K0SA 2OD7A 2QJTA 5AHWA 1I6MA 3MLBA 1JEEA 4NZPA 4J75A 3IAFA 2AG6A 1NUSA 1YHZA 3FOCA 4IG9A 1YC5A 2I1LA 5K3SA 1K4KA 2FN3A 4NAHA
chains in the Genus database with same CATH superfamily
4HR7A 5IDXA 1KETA 2HMUA 2CLLB 2WNSA 2Q5CA 2RK3A 3C1AA 1LV7A 3EE6A 3R7DA 4BJ6A 4C76A 4CV3A 3WGTA 1AHHA 5KSWB 2XZLA 1QF9A 3C1OA 2RAFA 2WMNB 1YACA 3FYSA 3F7TA 4C08A 2BYTA 4NBNA 4DEVA 1ATZA 1EE9A 4DV1B 1TJYA 4MPTA 5EE0A 2WDPA 2OC9A 2WZBA 1E1LA 1Q1ZA 2CVPA 1B8PA 3H9CA 1Q0HA 1GDTA 3NXSA 4IJUA 5C5CA 1DT3A 2OL4A 2V7BA 4M0EA 5G4KA 4C0KA 2FPSA 1ENZA 2HIGA 1PT9A 4Y2VA 3SIPA 4CDRA 4M0KA 5LQRA 3QV2A 3TBKA 1I2ZA 3HNRA 2WT8A 3BEOA 2GJSA 4MV6A 4EFKA 1MO3A 1I24A 1QRUA 1LI4A 3Q2IA 4PZUA 1NTRA 1XVIA 4GZLA 3ZE0B 3HXPA 6NULA 1OFIA 2VUIB 3A58B 1DQSA 1PYOA 5ALUA 2H1HA 3ORFA 4JSRA 1IYZA 3LUAA 1R74A 1QOPB 2VH1A 5E8RA 3I9KA 1QIEA 2NX2A 3KU4A 3V8EA 4ATNA 2H16A 5DTIA 3JALB 4PGAA 4OHBA 4QPDA 3WGNA 4UU8A 4A8HA 1CCWA 1SPXA 1UP6A 1ODTC 1Z2AA 4JYPA 3SSOA 4CF6A 1VE9A 3EAFA 3K0AB 3KUDA 4QBIA 5HUJA 1L3CA 2P0AA 3HV0A 5LMZA 4B6EA 3VO9A 5C3MA 1VKZA 2HJRA 1FBTA 4Z53A 2HI0A 3VPHA 1I10A 1E92A 4FNOA 1PD1A 3QWAA 4QPJC 5JHGB 5A7HA 3C1UA 4HWPA 5EZQA 3WWDA 1C81A 1NMZA 2C77A 3Q88A 3PJGA 4J2HA 1GXSB 2OEPA 1G5HA 1X70A 4CT4B 2NP6A 3WGVA 1VB3A 3MW8A 3P19A 1S1CA 2XUAA 1CLUA 5A5GA 4FGUA 3NYIA 3LOQA 5FWYA 1H6AA 2J5QA 2H5EA 2WNIA 2VRBA 1N92A 1QIHA 3C6QA 3GCWA 3QF4B 4YRZA 3FCXA 1P0PA 4LDQA 1VP9A 3CRRA 4F5WA 4ZT6A 4Z5XA 3CPHA 5C1IA 1DG1G 1MX9A 1SC6A 1VOTA 1WPGA 1DT5A 3JV7A 3ZUPA 2PH7A 3NTOA 4IHJA 3T0GA 1EYZA 3ZWQA 2ZTHA 2Y93A 2V98A 2G0NA 3W5IA 1UPUA 5HK9A 1CUVA 1R0ZA 4K1LA 4UDYX 1ZZEA 1PGQA 4TV8A 3PD0A 1ZCZA 5AKGA 2IOHA 3RAGA 1A1VA 1PL0A 4MXDA 4CM4A 1GG9A 2ZTMA 3H87A 2X15A 4PQEA 3G7SA 2N1BA 4LBVA 2W4QA 3DG9A 5I8WA 5COAA 1E3SA 4PZ0A 4CL3A 2R6DA 2HRZA 4WACA 1YRWA 3EEFA 3CPSA 4L07A 1UKZA 4M1ZA 3HCFA 4XOUA 4Z4FA 3R4VA 1K7CA 3EARA 4TV8F 1YUNA 3BK7A 2O5RA 4DR7B 4YACA 2IOQA 4YTEA 5BV0A 3CIOA 4FW9A 3CTMA 4OHKA 3E61A 2GKOA 5KOIA 3X2FA 4EO9A 4AS1A 3KTOA 4GG1A 4XX0A 2E4UA 4ZT5A 2YQZA 1N1DA 4RXTA 5BQOA 4HNQA 1RLJA 3F8SA 5LQDA 1ZOOA 3EVZA 4IY1A 1E99A 2VYFA 3RFFA 4CT5A 1AKNA 2A3NA 5EPOA 5JCPA 1KYQA 2CL0X 3JQBA 3PHJA 1Z7BA 2ORYA 3LRTA 3VZBA 2XKAA 3ET5A 5DRTA 3PCTA 4PV7A 3ZW7A 2G36A 3LPCA 3DDOA 1TUGA 4P7BA 3W5UA 3ZDRA 5K4HA 1F2DA 3CO5A 1V3QE 2FQYA 1QANA 2VJBA 4G3XA 4JXJA 3UKOA 2PYIA 3PXXA 1GPH1 5DCWA 3RR2A 4B3GA 4OHZA 2HZBA 3CJQA 4HS4A 4WCFC 3IO5A 4TV9A 5FWNA 4AKSA 2ATIA 4JEHA 1T2CA 1H65A 2EJWA 1D2AA 2XNDA 2JRLA 3BJRA 2JRCA 3PSAA 1WCIA 4Y8VA 5KOYA 3V34A 3I01M 3C3AA 4DJFC 3K4PA 4KV7A 1FTGA 1AB6A 2FWIA 3ANXA 5A3VA 4RHXA 5GGYA 3KAJA 1SIWA 3K9NA 1N1GA 1ZI8A 4GLOA 2QL6A 1N2OA 3EQZA 3JQ8A 5LB4A 1JEQA 1BO6A 3NHWA 4D4HA 1KQ3A 3IUEA 3PGA1 1FJ2A 1F51E 2XE4A 1II9A 3F97A 3NIBA 5E9AA 4OFZA 5ENDA 2A1UB 4OXXA 5HG0A 3N3AC 2YWFA 3IQIX 3KFVA 4HFMA 3FJOA 1Z4PX 4BRUA 1YZKA 4TYNA 4GPEA 4YP7A 3UJCA 3VH4A 1UOOA 4QAQA 4MRPA 3WWOA 1AQJA 2J5XA 4U5XA 3NNNA 1N5DA 4LZWA 1MNAA 3GRUA 3E1GA 3ZHZA 4Q21A 1KMCA 5CD9A 5K0CA 4MVJA 2QQEA 5HPYB 4TRJA 4ZOLB 1JIUA 4XPIB 3K70C 3H3FA 4ZGWA 3NV9A 5F7JA 3TG2A 2H2IA 2W11A 3ZGOA 1P62B 2RHRA 1UC4B 1Z5NA 4IRUB 4K46A 2BGRA 2CNOA 2QTZA 5IUKC 3A1SA 4TL7A 5GMOA 4UCFA 1YB4A 4J1TC 5K6RA 2Z2ZA 5JANA 3N0TA 1Y80A 4NKRA 2Z6UA 4MVJF 3DVAB 3MHPA 3WMWA 2XT0A 2I7VA 1AO3A 1VLLA 4TTAA 2XRZA 2OOSA 1TKBA 1ZR4A 1SD5A 5FA6A 4QYXA 4N0QA 5D8DA 2GDJA 2AF3C 5AUOB 3NH6A 4IDOA 1TGYA 2B6NA 1UZAA 1WHSA 2ON6A 1P4AA 2JAUA 4G0YA 4L4YA 3T3MB 3NUGA 3BH7A 1RWVA 1JLLB 2D1RA 3U16A 2B9VA 1LQTA 1LLQA 3EGDB 5HKAA 1H8ED 1DC7A 2HN9A 1KPGA 3CR7A 4OMDA 5DV9A 1TQ4A 2MYUA 2VDQB 3JD3A 4LKRA 4F72A 5BW4A 5ILGA 2XUGA 3DUFA 3BIXA 1RBYA 3IQXA 3UUGA 3MCVA 2PT5A 2ZEJA 4BZZA 1DTEA 4N4AA 4E4TA 4ND8B 1LTQA 1ZD1A 1FSGA 3HDJA 4FP9A 4NRDA 5HZKA 3F8TA 4OHVA 4KZPA 3W4JA 2MDTA 1OVGA 1L5ZA 1KJ8A 1UADA 3M1IA 3IAAA 1QHEA 3RYFA 4CF3A 2PQ6A 3TM4A 5E9JA 2JBAA 2ZB4A 4CRWB 3S1AB 1GG2A 1HNNA 2Q5OA 1HDRA 2FUNB 4AJKA 3GJQA 4U9HS 2YIDA 1X9HA 4IRXA 1OHHA 1ECFA 1X7ZA 2HWKA 4KR3A 1EESA 2NU9A 1EEHA 4FWBA 3U6BA 3THWA 2FPMA 3IX7A 4MGHA 4G1BA 5KYUA 2O7NA 4V39A 5I7SA 2Q3DA 3SDBA 1YRYE 1GGVA 1S2LA 3STYA 2BTQB 5KQLA 2V7UA 2AOXA 1RPNA 2JIMA 2Q1TA 2P2CA 1F20A 2VSXA 3IDZA 3H2BA 3JD0A 4J6FA 5BNFA 4LJLA 3ZKWB 3ZV6A 1C7JA 4DN6A 2XXAB 3MGKA 1FQOA 1Z73A 2A86A 3W8RA 3SJZA 4HAUA 1M0WA 3R3HA 5DLYA 2E55A 2QLLA 3ETGA 2WU8A 1EAYA 4QL3A 5ED4A 1NX6A 1CHNA 2FSGA 2PUHA 3GQBA 3O4FA 5DFAA 1ZJZA 2O0LA 4CTKA 1GNRA 4FHEA 4PGGA 3I4CA 4ZGGA 1GZVA 4YQEA 1GPAA 3ND9A 3OM9A 3U2QA 2PL3A 1MQAA 1ITZA 1SWWA 1OJ7A 2ZJ2A 3DKIA 4WUVA 4IL5A 1TT5B 5DHPA 2GXQA 1E5TA 1W4BA 4P4GA 5G3YA 4BLSA 1RRFA 3VR3A 5IVKA 1TCBA 1CB7A 5LCXA 4QOGA 4RFSA 1MPTA 5JASA 2WVAA 4RMNA 5TGZA 4WBNA 1B41A 1OGJA 1O6GA 3QU7A 2Q6IA 4TMZA 3X2SA 4F6RB 2NXEA 2Q2QA 3OQIB 2ZYTX 4MWTA 3OQVA 5IVDA 1WW2A 1YFZA 5JCOC 1OFTA 3NTVA 2ZJZA 4NG4A 2OTCA 3C6XA 2GPSA 3NAMA 3OD5A 4MSUA 4F5EA 4WK2B 4JYZA 1OOEA 2J7KA 3A27A 5IWCA 1KJWA 2FPIB 4V1CB 2O2IA 2J87A 3ME5A 2F8SA 4NFLA 3D8HA 1CIJA 3WICA 5EZ5A 4WBNF 4S0XA 1H8HD 4IIJB 4WA8A 1D6JA 1MOSA 5F3DA 2ILTA 3SR0A 3ZHVA 1Z33A 4TZTA 3CUKA 3F4BA 3GMDA 2ZJ5A 3QE4A 1P2TA 3K1AB 3QJ5A 4E09A 2DU8A 2OXCA 4MV5A 4F2PA 4JOSA 3NX4A 3I5UA 2RMKA 3RKRA 1K7EB 1F1JA 1E7SA 2UYQA 5DCYA 3DBIA 1JEOA 2QRNA 4NL4H 2MMCA 3BB3A 2REOA 5K20A 3K0EA 2WSIA 2BF7A 3ZXSA 5B5SA 3CVUA 1HKHA 2GEVA 3GRCA 3R41A 1XXHB 1HX7A 221PA 2XUDA 2YASA 4GLFA 4O8CA 3NCHA 1ZD9A 1IHPA 4W8GA 4F04A 2C58A 1NONA 1RTTA 1RM0A 1N3BA 2ANCA 1P18A 2HKIA 1YHYA 4KH0A 1G4AE 1OKKD 4RPCA 4EZIA 4AG3A 2VT7A 1TJ3A 2QGFA 2XA2A 3MWKA 1N2CA 1PNQA 1U7PA 3ZCSA 2TMDA 2PSEA 3NIWA 4G5GA 3I34X 1Q21A 3CUTA 1Q0TA 2WWVD 1H69A 3UJ7A 4H2DA 1T4CB 3L3BA 3DDHA 3DO5A 3DZDA 3VKGA 3C4JA 3S68A 2FZ4A 5MN4A 1KKMA 2YRXA 3QKRB 2P9EA 3V7UA 4IWXA 3WJ1A 1U1EA 4EF5A 2UVPA 1KS2A 1DNPA 3UXEA 4Q9NA 1XJCA 2A7QA 3GN2A 4KGXA 3BWMA 4DSOA 1Z0IA 4OAQA 1XTBA 3AC0A 4YGYA 4FHGA 5TDHA 4EJSC 3TFQA 2RCNA 1BEEA 2BFFA 4G8DA 3T5BA 3ZIAD 1EM6A 2GK7A 3T7IA 1P2UA 4DIFA 4G5HA 4MR8B 2DP4E 4OUDB 2VYNA 2V6FA 2PXAA 1GPJA 4OY3A 1WEHA 5ALQA 5K09A 1NJ1A 2QQ0A 1AHIA 3ECSA 5B1IA 1G7SA 4BFUA 1SU8A 5FHQA 3OQHA 4CEIA 2COEA 4F3NA 1JI0A 1EFRD 1CP3A 1T5TA 1D6NA 2ENWA 2X0JA 3H17A 1X7GA 5JSZB 4YAEA 2B82A 3T1TA 3ENNA 4MROA 9MHTA 1UBEA 3BF8A 1GQQA 4MUJA 4OAOA 3FB4A 5CNMA 4MGEA 1N0VC 1WXHA 1EK5A 1V35A 3GFSA 4H17A 4L02A 4L5JA 3ZI7A 2PO5A 4AIIA 2FETA 4L7QA 3VR2A 1L5GB 1RS0A 3H0EA 3KQQA 3D0QA 4CKBB 1XZBA 2KLHA 4M9ZA 3NATA 1A98A 4LZZA 3ITEA 3PUIA 5FOVA 5BV1A 3L7JA 4IDEA 4O2BB 3AQ4A 3NS7A 2QTLA 4XDZA 1ZUWA 3I83A 1Q84A 2OY0A 3R09A 1LJUA 4H18A 1KFBB 3EDCA 2ZM5A 3LLSA 3D8SA 5JH7A 1H5QA 1R3UA 2IYQA 3FG9A 1ZLYA 4MYDA 3U7RA 2FWRA 2XCRB 2BH2A 2JHPA 2MTBA 1U9IA 1HURA 3KKQA 3CC8A 4HK4A 3O4RA 2O6LA 4F2WA 1VRCA 1RE0A 1T29A 2ZS7A 4ESEA 4RVUA 5CD1A 1MORA 1L5YA 1E2GA 2NSDA 3GGGA 4C5CA 8MHTA 1HLPA 1MH1A 5IJZA 4URWR 5EY5B 1OPXA 5JH7F 3F6EX 4JKYA 3U40A 4YY3B 4D9KA 4FOPA 5IEJA 1VFPA 2I3GA 1Z07A 3P20A 2W4IA 5E38A 3RVKA 4V0OA 5JJIA 3OFSA 4I8IA 2IHZA 1G5IA 3OX3A 4IQ8A 4L85A 4YLGA 3VNQA 1SOUA 4IDPA 2C4UA 4JLMA 3KIPA 2QIOA 1Q1AA 4RF3A 2XA9A 1ONSA 2O2YA 4Q93A 1ZJ5A 2VPPA 2YY6A 3FGZA 4H3VA 3ZK8A 1JHZA 3L0OA 1MAWA 4BFCA 2X6RA 3RSHA 2O19A 3OLZA 4TTIA 1DBWA 1K3FA 2Q0XA 3FPHA 5T4FA 2VUTA 3P2YA 3GVCA 2VNJA 4F5ZA 4DADA 3B7PA 5HQ3B 4B2IA 1DUIA 3NKLA 3WRXA 1HG1A 1E7WA 5EGSA 2IW1A 2DQZA 3D8UA 4COOA 2EFEB 5C3UA 1OWOA 4IS3A 4UD6A 3LWNA 4NS1A 5ALXA 4ESVA 2D0OB 1GYPA 5H4HA 3RJTA 1DAMA 1WXEA 4OYLA 2CHUA 1P0CA 3LC1O 4KN9S 5AVXA 1HYHA 4HDNB 4LGMA 5JC8A 5B53A 1VE5A 4YJ3A 4DA6A 5F2KA 2Q9BA 2Z9CA 2E1PA 1SJ9A 1T1JA 3AW8A 2FHPA 4FT2A 4JUCA 4JZYA 3IEXA 1Z29A 1RW4A 5IDWA 2UZ1A 4JENA 2I0FA 4II2A 1MD9A 4U0JA 3LHIA 4CKCA 3ET4A 4BP1A 1UMBA 2C2HA 2PJDA 2PZLA 1Z6ZA 4M8IA 3UJHA 5MHTA 1RLIA 4EEKA 5JDIA 3ECCA 2C94A 2G76A 3CSUA 2PPLA 2X3YA 2DLDA 4G26A 4MNTA 2WTAA 4YJ3F 1E1CA 1VG0B 3DOFA 1LLCA 2ASEA 5EXPA 3M1AA 3PC7A 1YULA 1N7JA 3C5EA 1T9BA 1FUEA 1SA0B 1M2EA 2GEJA 3G2KA 3O73A 2FCAA 4JVNA 1W1WA 1DBSA 5JTUA 1NSYA 1GZ3A 3JCZA 3WYGA 3WL4A 2IOFA 5CIYA 1YH3A 3OURA 4MQ5A 1FQJA 4MPJA 1QQ6A 3EGOA 2P5YA 3IPXA 3MCAA 1V41E 2PL1A 3I8SA 4XIGS 1OLUA 4OJMX 1T8SA 1W73A 3O8NA 4PHHA 3HBAA 3TLJA 4UZEA 1Z4QA 1N0UA 2C98A 3OZDA 1T3LA 2DHQA 2FN4A 2XCTB 5IC6A 4CEJA 3R5HA 1Y7LA 3QFFA 5G0UA 3VOSA 2JEOA 4BPBA 5J2UB 1ZP6A 4JWKA 2KWIA 3P0HA 3OOYA 2C7PA 1NYLA 3WLQA 1QZUA 2V6MA 1C7FA 2JJ1A 3GMIA 3KKLA 1O4WA 4LI3X 5GVSA 4D9NA 2I22A 4Y6OA 4DQDA 1OVMA 2RIPA 1Q74A 4JP3A 1OWMA 2GZAA 4ZCIA 4P22A 4PBTA 4DMGA 4JC8A 2B92A 3IE1A 1MABA 2WAOA 5JNRA 4HXEB 2X1VA 4NZOA 5CT6A 2UXDB 4DTCA 3LYUA 2DSTA 1OX4B 2XNJA 3BWYA 1AU9A 2A9QA 1E9DA 1WKBA 1WD7A 3A6KA 4WLVA 3WKCA 4ZJUA 1RZRA 4OQPA 2OVBA 3W1WA 4IH1A 2BGKA 3GT7A 1R8JA 3E1SA 3TFWA 5GTDA 2J45A 1E0JA 3FUVA 5LMCA 4ZV4A 1E2DA 1Y3CE 1PNTA 1ZESA 5DX0A 2FJUA 4MVYA 4HUJA 1GUYA 3A10A 1UXJA 3AF0A 3CZCA 3IESA 4LHWA 3SIWA 3HVKA 1GCOA 4HRVA 5C53B 2WIDA 3O5AA 4YV2A 2BBSA 3HXLA 4MUHA 4L7VA 3CBGA 2DULA 3FUXA 3R7WB 1OXUA 1V8BA 3B60A 4QFBA 2ZYGA 1QHHA 1YFKA 1KSGA 1NKSA 1B3BA 1M66A 1V39A 2FEWB 5BYKA 1IL0A 5JD3A 6AT1A 4AKHA 1YOVA 3C1TA 5D5HA 4RC9A 3PNLA 3QGMA 1WL8A 2RHBA 2WJWA 1LPMA 3RU3A 3LY7A 1W2HA 1FDUA 3WGIA 2AN9A 4EO7A 3WHLA 4MTCA 4ARBA 2DETA 1V16B 2C92A 1I9GA 1QO0A 2CJWA 4PSCA 4MR7B 2V3WA 1G5QA 4HWSA 4U2CA 4UOEA 4L5YA 2G6BA 4TL6A 4JNCA 3VDNB 1H0KA 1G7TA 1RMTA 5KWSA 1SGWA 5KTRA 5MN5A 1NAIA 5AW7A 1BGWA 2AQHA 3DGFC 3QELA 1WCXA 2I3ZA 3I6MA 3NFRA 3RAFC 1P0QA 2AE1A 2M1ZA 4U7DA 5B7PA 1B6GA 3D1JA 3FYUB 4FMBB 2E21A 1KYVA 5EAIA 1FQKA 1NI4A 1Z38A 4DYHA 1VE6A 2CLHB 4NG5A 2VDNB 5JAIA 5ALKA 4D9FA 4JJ6A 4Q34A 4BO8A 1EK2A 2XMRA 2X6QA 3GLFE 3NR2A 2Y0CA 2ZXFA 3QM1A 4L95C 3MS7A 2R79A 5JECA 1FJGB 1KBOA 1PSZA 2QSYA 4N18A 5IT5A 4E22A 3O84A 4IJWA 5JISA 3TDMA 2DB3A 4Y3UA 4B2PA 1F12A 2HSGA 3RRJA 3ICWA 4E6PA 4HYEA 5IZ4A 4TWAA 4EW3A 4XQ9A 2I78A 5IDVA 4MMXB 3SZOA 1L4LA 3G5AA 1KEPA 2GJKA 3KZCA 4UAGA 3TINA 4CCWA 2VT3A 1UJ2A 4WLEA 2O2XA 1VGVA 2IHUA 2ZE6A 3ZNNA 2PG3A 3FE2A 3Q2KA 4RV5A 1DV1A 4V0MA 4JLJA 2OAEA 3VR4H 5BR8B 1YJAA 1JTEA 4DSZA 2P3SA 2X7HA 1G55A 4PQYA 3L7BA 4RY9A 4C07A 1FU4A 4LQDA 4ZANA 3S0JA 1P2GA 1LY1A 2O0HA 2OGUA 2ZUBA 3QLTA 3J81A 1R0XA 3HJCA 2YR0A 4M86A 4NC9A 3O31A 4QOIA 3WK4A 3IIMA 4WPGA 1EINA 4PZLA 1YI8A 3KJXA 3OZBA 4K28A 1I01A 3OJEA 5H3CA 4ARZA 5CAEA 3S2UA 1OAKA 2EFHB 1EWKA 2D2VA 2EVWX 4LJYA 1ZIDA 4UDXX 5DYTA 2XYHA 3ZV4A 5ALPA 3LWDA 3UQZA 1GZDA 3CF6R 4OQMA 2GCPA 4F6CA 1JDTA 3AIKA 4OIFA 4XH9B 1E2PA 4YCSA 3UENA 4EZEA 4PZZA 5K01A 3KJQA 1AGRA 3PJDA 2NV0A 1HEIA 3TF5A 3V2IA 4YQYA 4AROA 1W6UA 2P11A 3CRW1 4TXHA 1GSAA 1UAYA 2QF7A 3DSRA 1ECLA 2JGFA 5BRAA 3AR4A 1C1DA 2CDCA 1XVLA 3N2KA 1B23P 1L5VA 4Z0TA 4YRAA 4RULA 3NFYA 3LRPA 4IIBA 3O03A 1Y42X 3VYTB 5HKOA 3GJYA 2HA2A 4KOAA 1L5FA 4MQFB 4N3AA 1EWYA 3JYHA 2VAVA 3OESA 4UE3S 1W2WB 1X92A 2O2EA 1N0HA 2OBNA 2DF8A 3CX4A 4LC0A 4U1RA 4R1UA 3VPGA 5LYJB 1VE3A 3EQ8A 2VI5A 1MBZA 3AUXA 4QDZA 5CURA 4Z6KA 2PSSA 2WYHA 3UBMA 4W5NA 3GU3A 1TQ2A 4BWFB 4F96A 5C51B 4BU0A 1HMPA 4TTRA 1H2AS 3ZHRA 1A8UA 1PFVA 4RCYA 4PO8A 3EGXA 3G13A 1ISFA 5AKEA 1QNLA 4DHEA 2FQWA 1TEXA 1ND6A 2RC6A 3OAAA 4ZQHA 1U7DA 3LPMA 1HEYA 1QONA 1V5GA 4FE7A 1N57A 4X1YA 3TZEA 1KSHA 2DWPA 1W35A 4J49A 3GZNA 5E4TA 5G02A 2Z95A 2YS6A 1PF7E 1XZIA 4LXHA 3P7MA 2EAUA 4L6IA 3AKYA 1NW9B 2RJ3A 3P9ZA 1Q77A 4UZFA 3PIIA 5E9QA 3PRYA 4WFJA 3UY4A 2IBTA 1AS2A 4CLXA 1K27A 1GN9A 3C6YA 1R16A 2QMEA 3HYNA 3OO1A 1KAHA 3R3YA 1KI6A 3ZE6A 4PIPA 4C87A 1NRIA 5CXQA 3RHSA 1J0BA 5CYGA 1DGQA 4HAZA 2QTGA 4ROSA 1JDBC 3ZE8A 4MV9A 4Y9UA 1GQFA 1CQZA 2PKEA 1E9BA 1FLVA 3GC6A 1ODCA 3PNOA 4PO9A 5CHYA 2A4MA 1UMKA 3EC7A 4FZRA 1TCAA 3U4MA 1JI3A 2NUTA 2PAAA 4UTRA 2XB2A 2IKSA 4O5AA 2HU8A 4R51A 5FBQB 4KXXA 3K70B 3AU8A 4O63O 4BEWA 4GPZA 4HGPA 3ND6A 4M0DA 2HJSA 4MJ3A 1WBDA 2GPTA 2FZLA 1B15A 1ESMA 1PFWA 4K9LA 4ALIA 2UUOA 1JR3E 1Q14A 1TPZA 3GRRA 3BORA 4M8LA 4Q5IA 2HBZA 3BCHA 1M6NA 1K8ZB 3KVNA 5BORA 2AUMA 2FPPA 2M9MA 1EG2A 1IY9A 4Z3OA 3I23A 3LQ2A 4RY8A 1IN1A 2I5PO 2Y4NA 1DHTA 2R6R1 4PYQA 2IFTA 3CE6A 1U8CB 3LLUA 4C7OA 3L1UA 3BD8A 1JXMA 2D6FA 1NVVQ 3RVMA 5A0TA 1A9QA 2YZGA 1JDJA 3T9FA 1RWKA 1NJ2A 3JTMA 3P9NA 3EVAA 2VF7A 3SSMA 3OTIA 3UICA 3V8NA 5KSZA 5LQKA 1EHCA 4WV3A 1Z34A 2FW6A 3A0RB 1HDIA 4CGYA 1NZFA 2AZMA 2PT6A 2Q3EA 1IXRC 3LUHA 2R84A 3TMKA 5AFSA 4M1EA 4J9UE 5LXTA 2LIVA 5AXCA 3KZMA 4NQZA 2JAOA 1Z2CA 3I0MA 4R5MA 1HDYA 4J91A 3EZ6A 5JZSA 3H5OA 4CMIB 1QVVA 2XSZD 2VYQA 1KTVA 1N5OX 3C24A 3FOAA 3HA7A 3LNTA 4W7HA 1RYBA 4K6FA 5C8XA 4I1VA 3GZJA 4RIEA 1N9KA 2ZRHA 1HMYA 3OJWA 2PJRA 1Q22A 3NH9A 4IQ0A 5LXTF 1UOEA 3LT0A 3OCXA 4B34A 4JQOA 3QW4B 4AK9A 4TKVA 1TIBA 4LPSA 4YUZA 3M9WA 4YRCA 4YCMA 4QULA 5B3AA 4MS1A 5AUQA 2C3MA 2HK8A 4NMHA 4EHAA 4BTEA 5FCDA 2ZWIA 5DE3A 2C2WA 2YIMA 4ZVKA 2BGLA 1KHTA 3EWSA 2OAGA 4WKOA 1U98A 4LQ4A 4BE7B 3B1YA 4KTTE 2Z2YA 4MGYR 5EJMA 3WC4A 5KU7A 5ADVA 4Z99A 2I65A 1JBKA 3O94A 2O1EA 4BKUA 5LN1A 1NYQA 1XP5A 5K3OA 5T4EA 3UMJA 3I1FA 5FTNA 1CJVC 1EX6A 5I4CA 4DWOA 2P3OA 3FNHA 3RVNA 4C88A 3TW6A 1BA2A 3ND8A 1VJRA 1YZVA 5L7TA 2TECE 4TOIA 3UV6A 2AZXA 1TD9A 3I45A 1J8DA 1PNVA 3F5SA 3OTQA 1Y6ZA 3B48A 1F0PA 2FUG1 4GDFA 3OOHA 2FN8A 3D2CA 3ZBTA 2J7PD 3AOEC 4D0LB 1SQSA 3ZCRA 4YMGA 3IUQA 3B13B 5LBUA 5KX5B 2CFSA 1PLLA 4GNKA 5CVJA 3LDHA 4KE7A 1RRMA 4FFBA 4JL6A 5P8WA 1P60A 2C7OA 2ZQ5A 3IR5A 3O8DA 5BNIA 4UXJA 1GO2A 2NUBA 4GGPA 1J0XO 1N9GB 1MV8A 3UK0A 1KMMA 2EL9A 3JD1A 5M5BA 3BPSA 1JR4A 3OCYA 3FWNA 5KJFA 1R64A 3TG8A 1D6MA 2BMFA 1W8IA 2Z3WA 2EZ4A 3BDIA 3R8CA 3CZRA 1Y82A 2AFRA 2O4CA 3CZ4A 3I2FA 3WB1A 1X0VA 4N47A 4ZYZA 2Q6OA 1DC3A 3NHUA 4IMRA 3NM4A 1P2BA 4I08A 3TI9A 4OKNA 3ZQUA 1DKRA 2C9OA 2QNBA 3OCJA 4RWEA 1J4AA 4YIKA 4BN5A 3AKCA 4KRXA 3L05A 5IJ0A 2OSVA 1Y8RA 3L0CA 5DHUA 1KPHA 1V7PC 1THZA 1ZX1A 1EVLA 1K98A 1XHEA 5CM8B 4R2JA 3AB8A 1T24A 4QG3A 4RESA 1LBIA 5HF5A 3ESAA 3EBPA 5KQPA 4NZZA 1SUFA 2HEGA 3LZDA 4RLHA 3UBTA 1LPNA 3LG2A 3BSWA 3MIIA 5CK5A 1JA1A 1FNSA 2NYUA 5JS1A 4I5FA 1F6WA 2QX9A 1ZIXA 4PONA 4C0SA 5JZVA 5DX8A 4A8JC 1CQJA 1Z7GA 3CBQA 2G1KA 4WXRA 3SLRA 1QDLB 5TQ0B 5IW8A 2C59A 3WL3A 4F7WA 4L4UA 4YRMA 5J4HA 2O50A 2P5TB 5BVGA 3PFFA 3RAJA 2Z1NA 3HUFA 1JEDA 1QIGA 1YR1A 2VDJA 4TS9A 5B1SA 4I9NA 3CF4A 1F3OA 4QSMA 3M89A 4XM2A 4BLTA 3R5TA 1PVVA 3ER8A 4PLHA 2NU7A 3SQNA 5EWJB 3TBHA 3J7TA 3QVMA 3SK0A 3MN1A 2WJ4A 1XJWA 1JNYA 2R6HA 3IP5A 3O2QB 5A4AA 3EH2A 1RQ7A 3ORHA 2ZUEA 4MUIA 3OHPA 4WKBA 5LP6C 2OGZA 3RS0A 2E3JA 1SBCA 1ZBDA 4LHSA 5C18A 2F3TA 3VOTA 1A69A 3CVOA 3AI3A 3ZJ4A 3F67A 1HYGA 3RK1A 2VH2A 5F2OA 2WWTA 3TIIA 4R6XA 3UNXA 3MTGA 5FEUA 2D54A 4YRBA 2AZ4A 5YASA 4DIBA 5CB0A 1DAGA 3UOWA 3M9LA 3LHKA 4I81A 1EVQA 3EIXA 5DNDA 1HY3A 2Q5IA 4AMVA 2PWAA 5CEFA 5H8WA 3IJRA 3GL9A 1P72A 3PGMA 4EJSB 2ZWOA 1T8TA 2Z08A 3TKLA 2HNKA 1Y9JA 4ND2A 3OIGA 4M0LA 3A04A 3RRMA 2XZDA 5MGNA 1SCBA 2EYQA 1DQZA 2GVNA 1D1QA 3H3XA 4Y9RA 5EZYA 4CVNA 4CXMA 2PUAA 3A4IA 2XB4A 5B30A 2VJPA 1C8VB 5DBEX 1G5FA 3UOGA 4DY6A 5B7NA 1FJXA 1U3TA 3C5CA 1IN7A 1PUJA 2VDRB 3R77A 5DGHA 4K6GA 4ETWA 3G8CA 1NNUA 1X1SA 4BNYA 3SR4A 3AHGA 1QO7A 3QVUA 4N6OA 4D57A 5AKYA 4GOOD 4AECA 1Y4ZA 1WKVA 5C37A 3HP4A 4ZOCA 2G5GX 4TTTS 3VJKA 2NVUA 3G1TA 4I4NA 4NEQA 1N6PA 3WSWA 2JBHA 3DP7A 2ZBEA 1M75A 4FFVA 3A05A 2QYHA 3NAGA 4Q24A 5DI3B 1N36B 2NQ2C 3THYB 3B3JA 3V8BA 3EJ6A 3VMFA 1RZUA 3KJIA 3UB3A 1BAPA 3ER6A 4IVRA 5IANA 5EMJA 4AJLA 2J3QA 3VH1A 5CDFA 5AW8A 3MWYW 4IVQA 5FUYA 3WLKX 1PIWA 3O74A 4UOQA 3CWCA 3WX0A 2A9JA 3DB2A 1ZRHA 3DLTA 3U4CA 1MN6A 1DX9A 1ZK2A 3DZBA 4R1TA 3KU1A 1D4OA 3EDRA 4EL0A 3M0EA 4KFSA 1USKA 2XWPA 4Q7JB 4AAYA 3ZJUA 2P3LA 1PR4A 3LP6A 1QV9A 3C3BA 3DDZX 4HDCA 4DQUA 3QE0A 1JALA 1O54A 2X4LA 3OT1B 3S3TA 4V3BA 4YJ2F 4OLBA 2NU6B 3DDCA 1PWXA 1JTFA 1A8SA 2WF7A 1MAHA 1QIIA 2EEPA 3M82A 1HDOA 1K9VF 3A32A 1X1AA 4PTZA 1QFZA 3FCCA 1DAOA 1IBSA 3R7FA 3NT5A 5K2OA 3I05A 2ZJOA 1XD9A 2JAHA 4DSAA 2IPLA 3FHJA 2ERYA 1PZXA 4N12A 5G2OA 1CLEA 3G8AA 3UXYA 3B9BA 3DLHA 5BQXA 3CR3C 3STVA 2XYQA 4IW3B 3ZLTA 4F4JA 3BDAA 1P19A 3L06A 4QOJA 1D8AA 4PLZA 1OIWA 4L8LA 2WWWA 4YREA 5JS7A 4EIWA 2ZSEA 3PRJA 3VNVA 4EKDA 3QBJA 3D8BA 3PC3A 5DHSA 2D0IA 3T3OA 5EMMA 1UPTA 3ZH2A 1EX9A 2RH4A 3E53A 3HJNA 5AVKA 3UWMA 2E87A 1GPMA 2GZSA 5FBRB 2ECKA 5LWQA 1SBQA 3GDHA 5DM4A 3KBOA 3STWA 3TVDA 4AWAA 4DNOA 5B57C 4UUPA 1ABBA 3VXKA 3RIXA 3VX3A 3T3EA 1WKCA 1EFAA 3E9NA 1XL0A 2YHSA 4KGZA 3M9XA 3THXB 4DA0A 1N2IA 5DHTA 4J6EA 2VDWB 2C9ZA 1T5BA 1XZJA 3GV0A 1BMDA 3MERA 5DX1A 3OY2A 3HEMA 5JTTA 1TVKB 3TOVA 3G5LA 4ARVA 1BS9A 1VL5A 1FDIA 4ZO4A 4G41A 3AB7A 4ASUA 5EIBD 4Z4QA 1J8MF 4RMJA 2TRSB 4U2DA 3QJGA 2VPYA 3WR5A 1YDFA 1Y4DE 1LVGA 2VYVD 2YOFA 4R84A 1GSHA 2VSQA 1YHNA 2WMDA 2O8VA 1XKLA 1U8TA 1WMSA 2IQ5A 2O2GA 1QTNA 3QVLA 1SIOA 3QPUA 3HWRA 3AB3A 1Q7RA 2PQ2A 1EVKA 1LSSA 5KDLA 4S1VA 4P8RA 5EJ9A 3LKVA 3UMYA 1ZMXA 4PY2A 4OI2A 3LY9A 2Z5FA 3M3DA 1OIVA 3ZDDA 4TKVB 2YJTD 3OPYB 3CHYA 4YRQA 4BO7A 4Q9IA 2RBEA 4WVFA 1GA6A 1YVDA 5BURA 1RXVA 1KFJB 3I92A 3AJRA 5FH9A 3OE4A 3EOZA 4P82A 1BHSA 3CLTD 4PZYA 4KW7A 5HE9A 3VJLA 4CETA 4JASB 3N8HA 4IVPA 3L1KA 1ZICA 4UUNA 4O2RA 3U3MA 4HZUA 4HRXA 1NJ8A 3G82C 1HYEA 2G1AA 2OZLB 3KEGA 3QX3A 1D07A 3I04A 2OCIA 1CP2A 4B40A 4OO3A 1AZWA 5JY6A 3KZXA 3QUSA 1CPYA 4HKTA 4TQAA 5JAZA 2O8CB 3FPGA 4WESA 2XCIA 4CKWA 2GX6A 5EP4A 3LKZA 4EOGA 1KHHA 3RUPA 2FF7A 2MINA 2I62A 3OICA 3QRWA 3W1VA 1PS8A 4YV1A 3JASB 3FOFC 1MT0A 1OILA 1T8RA 2F62A 2YOHA 3DWFA 4UKDA 3GA5A 3WQSB 5M2QA 2GETA 2X13A 2ZXEA 3D6AA 3G68A 3JQAA 4YJGB 5CFPA 3T1VA 5LQUA 5DBHX 1X7WA 2FZKA 2H2GA 3G8BA 4PYRA 4YRSA 5LM3A 1A9XA 3LZCA 1ZVVA 1EP2B 3ZTYA 3D64A 5GP1A 3FGPA 1RIFA 3IEUA 3L8EA 4ZJYA 2H9AA 1TYEB 4KJXA 3CTPA 2IH5A 5F1KA 5JAPA 4QBHA 4O33A 3KKOA 1EX1A 2IX3A 1IQUA 2BFEB 4G89A 3B8HA 3CCFA 3QEJA 2AXNA 4CFYA 2VRNA 3DZKA 3L7DA 2WBLC 2PRJA 1O5IA 2IZ5A 1GG5A 4IDHA 3EIHA 3GWZA 4BP8A 1KSFX 1Y8AA 3EHEA 1SOWA 4P3OA 4LKOA 2V5AA 5JBQA 4XVCA 3BL5A 2H0AA 5JVDF 2CHGA 2CUZA 1YL7A 1FY2A 3UXMA 5JI2E 4ZDKA 1CR0A 3E22A 3IVCA 3ETHA 4JYMA 4WIAA 2B35A 1U0BB 3A3KA 4H0FA 3OM1A 1V43A 5FJIA 2QVLA 1E7YA 1OA0A 5CVUA 2PE5A 4L50A 2RSLA 4MS4A 3RC9A 4BC0A 3HRKA 1RHRA 2WE7A 3OKCA 3ZS8A 3FHTA 3X3HA 5IMBA 4RK1A 1I6WA 4KITB 2WZCA 2FN9A 2JFOA 1IBCA 2HTFA 4UBKA 3VZCA 4HAOA 2XBMA 5K7SA 4CIXA 5K6AC 2H07A 3BMNB 5J1TB 3M4XA 3DLBA 1DMRA 2IZ0A 3DZIA 1QS0A 2NZXA 2YXEA 3IQWA 4RS4A 1NULA 3OEEA 2E48A 3Q7QA 2PQ0A 5HEKA 3AJ9A 4CG0A 1PL7A 1DBRA 1QH1A 3IAUA 4JFAA 2EJTA 3EUAA 4KAJA 4BNVA 2D1YA 2BGMA 1WG8A 3CUYA 4BJ1A 3Q40A 1G8SA 3ASUA 4BGVA 5FADA 2WTUA 1C0LA 1IPHA 5CVDA 4B5LA 1OLSB 1EQUA 2BHNA 3DAFA 2AGVA 5ALJA 1AS0A 2EBFX 3H75A 1NY6A 4LYJA 5C4MA 1WMAA 2OUIA 3ZR4B 2YVLA 2IDMA 2PS0A 4PNPA 4EY5A 4FZVA 2UYGA 4DKXA 1FYVA 1PEDA 1DBQA 1S4MA 3QHQA 3O83A 3R0VA 1ONNA 2UDPA 2HDWA 5K3AA 4BQQA 1F7UA 3SQXA 2XB8A 4TMYA 1QC5A 3C4VA 4YMIA 3K0AA 3KO8A 1SVWA 1FFHA 2VPTA 1TAUA 1Z3IX 1X0XA 1ORHA 2JK0A 1FZTA 2C9DA 5JMWA 1V4BA 4RTRA 1GL6A 4H3SA 5AESA 5E0OA 3F1KA 3IMFA 3OFVA 5KBYA 3ZXUB 1A2BA 2QTCA 2XAAA 5DWVA 1ZLXA 3BZWA 1YRBA 4N82A 4MVJP 2KBEA 1PQYA 4AL4A 5B6JA 2DBQA 5FPQA 2MOKA 2C1EA 3TNLA 1S2GA 1RYNA 3KYDA 3SQLA 3MJHA 1RHJA 3OIDA 2P7IA 4JEIA 7YASA 1KQGA 1GRQA 5ER6A 1ZQ9A 1T5LA 4RY2A 5HCNA 3RU9A 3SYTA 3Q3GE 1NG9A 2NM0A 4WW0A 4TZKA 4OHOA 3EZ7A 1OXTA 5KMGA 3K0BA 3ZVKA 1ID8A 1E5LA 3QI2A 4QICA 1W5AA 4RVHA 3QVJA 3TNFA 5DOVA 2H0RA 1FSPA 3FHCB 3WK6A 2FX2A 4OXYA 3AM1A 1FFSA 3TZQA 3BHJA 3MILA 1DG3A 2GUGA 4XGIA 2IYLD 4JI3B 2DR3A 2OHVA 3X1YA 1N2JA 1NX9A 3O4VA 4HT3B 5SICE 1F1BA 5KO2A 3I9LA 1FFGA 3RU2A 5HRAA 2LKCA 3KOWA 2V54A 1OASA 1TU0A 4JJKA 1CJUC 2VDMB 3AETB 4QVKA 2NZYA 4R3WA 2ZAMA 4ZU1X 3FTQA 3GRYA 4JBLA 4MQLA 1FU7A 4ESHA 1RZ3A 1HG0A 2K6GA 2QUAA 2XF8A 3CRVA 1FRVA 2OO3A 3DHNA 2GHQA 3NHRA 3P5BA 4JUBA 3H2JA 1SVUA 4TXMA 3ROFA 3U4GA 5LIRA 4XVHA 3NVDA 5ALVA 5LZ2A 2I7XA 4WXMA 2PIAA 2X6TA 1PX0A 1Z45A 4CGZA 3A11A 3D7RA 2IYAA 2OZKA 3H1PA 3E8SA 4Y2JA 3M6AA 4EY4A 5KYNA 1TYCA 5CLLA 4C4AA 4EHBA 2YUTA 2W2MA 3BH6A 1NXWA 1CEXA 4E14A 5CMLA 4CIBA 1DWUA 2J9ZB 3NWPA 4C4SA 2G9UA 5AJVB 3KJZA 4LJ8A 4PXSA 5K2MA 1YS1X 3FF1A 3BFXA 3IXMA 2FCRA 2O8BB 3TQRA 4KQMA 4MB6A 2QRPA 4PX2A 4CCAA 3I4LA 4XJTA 1AKUA 1PZMA 2YNMC 2CD9A 1GCAA 2YVAA 3Q85A 4A73A 2XBLA 3RD5A 2CYBA 2D5AA 1TJNA 2FSVC 1S96A 3ORSA 4QQKA 4PYMA 4M8NE 4A6EA 2R2GA 5EIBC 4ER3A 4P4LA 1UXOA 3RVRA 3H0CA 1EGHA 1AA6A 3SFVA 1WABA 5EHQA 4P36A 3FVQA 2FGKA 3TLGB 4W1QA 4Q0MA 4MYTA 2C5FA 2KQUA 1HTWA 4NDZA 2V4ZA 1VMDA 3TPZA 5AVQA 2CKMA 3PPYA 2QN3A 4M6WA 5IN5A 2VAMA 4X66B 3D43A 3ENVA 3NW9A 3N2GA 4PANA 1QAOA 1J2EA 2BM0A 4O4LB 1BQ3A 3T0IA 1RCTE 3DO6A 5B1HA 2WKRA 3OZ7A 1W5FA 1XLUA 2DM6A 3HN6A 4HD8A 4K81B 3RLIA 3UMSA 4HUQA 1LK0A 1KMIY 2B5OA 3D7LA 1KJJA 3C8UA 1HE5A 5AJZA 1XROA 5EYPA 3DVSX 5LQSA 4X85A 2ZIEA 3JYPA 3GRKA 5DT2A 1ZGAA 1KZ4A 2AX3A 16PKA 1LNQA 2A92A 1UKVY 3AI2A 1XVAA 3CV3A 3IPAA 3VSAA 5IX8A 3CUWA 3DMYA 3KZ1E 4WXYB 4KQ1A 3G79A 5KJCA 2IYUA 4ZOLA 2CVHA 4RAOA 3PDHA 2N75A 3RSCA 1MJ5A 3C8DA 3NM5A 4CQLB 3EW9A 1BU8A 2P9GA 1H1LB 3PJRA 1T1SA 3F6PA 3IQEA 3R0QA 5B58T 3VH2A 4MIOA 2IWRA 1Q6ZA 1U9CA 3QWHA 3RVLA 4AJ4A 4ZCQA 3ENQA 1Q3KA 1I2AA 3A26A 4RV4A 4UM7A 3B89A 3AL0C 4ZOLF 4M2LA 4UHCA 1YFLA 2C07A 2DEUA 3L6OO 1BFUA 2W7TA 3IVAA 3QQPA 4AS3A 1NNI1 1USVA 2VJMA 4YUAA 2PWZA 1AH2A 4EB3A 4ZYUA 1SXJD 3PK0A 1PJ3A 3OJLA 3EVEA 2ZSDA 3P2MA 1C3XA 2QN8A 4EECA 1H4SA 2WIGA 3Q12A 4MIYA 3CRQA 2G25A 5C8DA 2GT1A 3MBKA 2GYWA 4JXZA 2AXQA 2ZPAA 3AF4A 5LZ4A 3B7GA 4LRWA 3GZ4A 4OXRA 4DM4A 3DJFA 2IH4A 2CN1A 2O7RA 3WQRA 1OYOA 3LIIA 4ECAA 1ULTA 2V6GA 4W8HA 1ZXLA 2PV7A 3I3SR 4BO5A 3REGA 4MYRA 4UE2A 1AF4A 4C03A 3GJZA 4J03A 1H66A 3C3JA 2NAFA 5K0BA 2R86A 3FFXA 3UHAA 3BXZA 4GR5A 2OMKA 5B3LA 4YRJA 3FDIA 2J1LA 2W98A 1E4YA 2HYDA 4PPYA 2X40A 1ETHA 3N8NA 2GF9A 4L0DA 4XIJA 3TYXA 4YAKA 1HDEA 3GY0A 3ZVNA 1L5HA 2JGKA 2YTZA 3Q98A 4MQBA 1AN0A 3CEPB 4L28A 4TM7A 1JKJB 2FVYA 4BGDA 4HLCA 4AJPA 3A2KA 2A5GA 5E4JA 1J5PA 1HLDA 2Z43A 3KQMA 4NAVA 3NMUF 1M0TA 1RQGA 4XGKA 2P9YA 3U17A 4E30A 3L8MA 3SVZA 1EXVA 2CXXA 3UFXA 4FIDA 4BV8A 2PLNA 3OY7A 4Q6WA 4E21A 1QFMA 4JCCA 2SECE 3K6RA 1U6KA 2IUFA 1X77A 4CM9A 4FGWA 3HV2A 4DMFA 4DL9A 5K8JB 4P6VF 4L9AA 1PLJA 4D3XA 1CNMA 1KEVA 4YAFA 2XXAA 3H2IA 1I2CA 2GNPA 2B30A 1E0DA 2W48A 3EVNA 4LIPD 5WRFA 3R44A 4KUHA 1KDVA 2GYUA 5JJCA 5JT1A 5DXFA 4IV8A 2X1LA 1BDMA 3RLFA 1TMKA 1R3DA 4GC9A 2FUCA 4YPFA 2NSJA 9LDTA 1JFTA 2BIFA 3P9YA 4IOMA 3ZWNA 4TZ0A 5IULC 1KJIA 1JH9A 5BR1A 1XO1A 3UB4A 2HBQA 1UBKS 2CMHA 2Y92A 3ZYZA 1TT5A 3V1UA 1HETA 2EJUA 3HXQA 4U9UA 3EDQA 4MIKA 2I6TA 4U7TB 1KQOA 1LDBA 2EIHA 3SU8A 3KB8A 3O6VA 4W5QA 3QKTA 1IK6A 3TRJA 1OAAA 1JQEA 4URVR 3OWXA 4CV2A 2ZE7A 1E2HA 1ACJA 2CNWA 4YV0A 1U0JA 2ET6A 1T0JB 4NICA 1VCIA 3NJ4A 4HQ6A 5IC4A 4KYIB 2D7CA 3DOCA 1TQ8A 4ZAFA 4A8JB 1PK8A 3L7LA 3PA8A 5I9IA 2Q1XA 4R9SA 3DZCA 3ZHUA 3DQQA 2IXFA 3K9CA 2GYVA 2EF0A 1SCAA 3GLSA 4EYGA 5KQGA 1RRCA 2VWQA 4HXFB 3AKZA 4RF5A 1K68A 4MI9A 3RTAA 1LF5A 1I4EB 1A9ZA 4E7OA 1JX6A 4XDGA 3RGGA 3VJMA 4QTZA 5KWJA 2GM3A 3A3NA 3INGA 2KW5A 4BZWA 4KRGA 1QPZA 1NBMA 1I3MA 1YRAA 3R3WA 4JX8A 4PFQA 2HXSA 1L4YA 1U2RA 5GQSA 4FBLA 4DUGD 2GF2A 5B4TA 4QQRA 1JS1X 5I7UA 4FMPA 4DBVO 1DC8A 5ELXA 1M5TA 5LP6B 2ZULA 1YHZA 2VO1A 2YWJA 2YYZA 4I9HA 3TOXA 4OB7A 3O8LA 5AXDA 1L5MA 4KODA 5A2QA 4A27A 5HFJA 2SHKA 3L1IA 2C2KA 5EZ6B 2PMKA 4WUTA 2HWUA 2NTNA 1FP4B 2PZKA 5DP2A 4JS0A 1HOTA 2PWYA 3TD2A 3VYWA 1FUUA 4B4DA 5JFTA 5IVHA 1K8XB 2Q3CA 1KY3A 3ETNA 4IZIA 1LSJA 3KQOA 3ZWVA 3GLIA 3FYHA 3PFHA 5AVWA 4Z9BA 5HIKA 1TEHA 1TOAA 2C2YA 1VKRA 2E5WA 3GLKA 1TQDA 1W6RA 3PGVA 4R1MA 4XCVA 1FP2A 1PJ4A 3HK2A 4PFSA 3IKMB 5IZCA 3C43A 3A9VA 4RVDA 3WOHA 4CEHB 2C5EA 3PLAE 3C7KA 4CLEA 2JCXA 3CJTA 4K9KA 4WN9A 2N46A 2X3FA 1FFYA 3A4YA 5LR6A 4Z4IA 1JG2A 4ZI7A 2AEJA 5JNVA 1W581 3CE9A 2OV1A 4Q4LA 3T0FA 1P4HA 2YWHA 2GCGA 4UM8B 1S3GA 4WNCA 5DNVA 4I19A 1V45E 2BMJA 4UJ3A 3KX2A 2V5UA 1C7EA 2PNFA 4LYYA 3WS7A 2VHJA 2EXXA 2V03A 4HJRA 2CL6X 3PP8A 4R7ZA 1C2TA 2MYTA 4LK2A 1NF3A 4ZFNA 1QU2A 3D31A 3PS9A 2EDAA 3KUXA 5IAKA 4ZI7F 1EFUA 4DJEC 4X7MA 2YJ5A 4G63A 1J49A 3U80A 2AC4A 3HYTA 2P2ZA 4B8ZA 2J4CA 3KZVA 3FUTA 4X0EA 5KVCA 5ALTA 3I01A 4QU0A 4ALNA 2SKDA 4I8XA 3PEUA 5IJ9B 1L7PA 4TX1A 2BC9A 4F56A 4K9OA 4A26A 5EUCA 4BQRA 3ORQA 5ITZA 1UZMA 4DXDA 2WHRA 5JO9A 3WK8A 3JVEA 4QUJA 4AKEA 1ZISA 1DE0A 4ZT4A 1FQWA 2W5UA 5PNTA 2P6PA 3ZGNA 3MOSA 1F4LA 2HHCA 4WGFA 1AE1A 2CY0A 1NN3A 1DAPA 1I51A 1UBNA 4KQJA 3W8NA 1X9IA 2E4VA 2I8LA 2VSYA 2W2OA 3HP7A 4KQCA 4MR9B 5A0FA 5HVNA 3AZPA 2G82A 3VM6A 5L3SB 2R6CA 3TPCA 4QWWA 2RBKA 3ROMA 3EEOA 5HK8A 3T5DA 1UANA 1CF2O 5DYGA 1CY2A 1Y9AA 3GMSA 3UC5A 5KB3A 2ZJFA 3J81k 1WS6A 1JQ5A 2APJA 2ZT8A 3K94A 4NFYA 4HQFA 3VNBA 5E3JA 1PNRA 1A5ZA 4LYEA 3IPLA 4ZJPA 4KE8A 1BWPA 1TMGE 2VQDA 4LXIA 4D0NA 4MMZB 1MH9A 3VTKA 3B78A 4DILA 1QQBA 3V9AA 4AF7A 1Y1TA 3PC6A 4QDJA 2AN1A 2FFHA 2F9MA 3LCCA 3VKFA 3CS3A 5KJEA 4JMLA 3ZQ6A 4HWOA 3I9MA 4EM6A 7REQB 1W19A 1YD7A 4Q7MB 3ESZA 4RD1A 3UPDA 4MGKR 1SXJC 2Z9DA 4PPQA 4E2XA 5CDUA 1MOQA 3X1MA 2CXSA 5T67A 2GO1A 1Y98A 3R9XB 2PBFA 4CQNA 2GD0A 6ABPA 2Q50A 2WFLB 2FDRA 1B0UA 1ZD3A 4MQEB 3TB4A 3UWSA 1XX6A 5G41A 5LQMA 4X24A 1AUPA 4IEIA 4O29A 5TSDA 4ZEVA 2JZCA 2QZJA 3D6TB 2P62A 4FN4A 4YEDA 4CTOA 4F11A 5EMLA 2WJVA 5AKKA 1CQPA 4R41A 1N8TA 2WKQA 4XQEA 3V1YA 1NC3A 5IF3A 3G5TA 1R18A 1E9VA 4UPEA 1YASA 4UFOA 4AP9A 6ADHA 3KQUA 2YXBA 2VBGA 3KV1A 4P58A 1A2QA 1SC3A 3PYMA 1V3UA 2P6UA 2AW5A 3HE3A 1DMSA 1JN0A 1W94A 3DW3X 1T4MA 4GIBA 5AVJA 4EHDA 4LE1A 4HQKA 1VCMA 3R5KA 5FOSA 4NE2A 3A1UA 1M1NA 1DEOA 1GQYA 5KYVA 1QKKA 3KLNA 3M70A 4GPAA 4WT7A 5JAHA 4I4TB 2WWRA 4GLBA 4NECA 3ZOZA 1C9JA 3GFQA 1FDWA 4ZO9A 3VI3B 1PP4A 2B4KA 4XXHA 1XCJA 4YLYA 2PVPA 4C3VA 2XITA 3FWHA 1UIMA 1E6MA 2XVMA 3DV0A 4YR9A 4NZYA 1J00A 4HAIA 3V4LA 1GV1A 1QIKA 5HIJA 4IZ6A 4ME6A 4PAOA 5AXBA 5ES4B 4L9RA 2R1TA 4E0BA 5HOQA 5IK2A 5KWVA 3REQA 1RTKA 3PXCX 4S35A 5I9NA 1SA0A 4NPAA 2WE8A 4TT3D 3RSFA 1TTHA 4B4OA 1I7NA 3G49A 4IOKA 3RF7A 2FEAA 4Q00A 2HLPA 3FCAA 3QBEA 3OPVA 2NLOA 2D59A 2IEAA 2Y66A 3AEYA 3ILYA 1PZFA 2XGSA 1QMPA 1TDJA 4R68A 4RKYA 1EK0A 1FFWA 1NHWA 2ERCA 1FVOA 3M6UA 2PH5A 3M5PA 3PNKA 3T7AA 2BMWA 3WRVA 2YZNA 3TLYA 5D01A 2ZSFA 1O8CA 2E1RA 4E5UA 3DFMA 3SHQA 5KUTA 2I4NA 3WGMA 2B8NA 2HRQA 4EI9A 1U1DA 2G1UA 2JLAA 1WO8A 4IIXA 3CH7A 1DCMA 1RYEA 5IBCA 3V55A 5JZOA 3LSYA 2BKXA 3TRIA 3RFUA 2WW8A 2O48X 3T6KA 2ZITA 3K6KA 1U0SY 2FFJA 3HVJA 4AZ0A 1W9MA 3RUCA 3VR5D 3UG6A 1KEZA 2HHHB 2ZRGA 5E6RB 2BCGY 3QX9A 1E5XA 5AQ1A 1SXIA 3ITDA 4A0HA 4CM8A 4RIFA 3D3WA 1ZC3A 4NHEA 4OHMA 2K87A 2P35A 1ORTA 1P2DA 3JSAA 3OP4A 4JGGA 2XF2A 4N6NA 5B55A 1UAAA 4P7FA 2CVFA 2J32A 5FUQA 5H80A 4CMKA 2B34A 4WK6A 4ZQIA 3SJAA 4JJZA 4LFBB 4EUSA 4ZMRA 2H4ZA 2WICA 3OO0A 3RRFA 4PSAA 1JJVA 2HJWA 2Z8YA 3OKFA 4UHHA 1W75A 4YJHA 2HUPA 3L18A 4AX8A 2X19A 5CFOA 5F23A 4ILEA 1AF7A 1TLLA 4PYNA 5IXSA 2BUCA 5F52A 4BMPB 4D41A 1SVSA 2NTJA 2F7SA 2JGRA 3NEJA 3WO0A 4DMKA 4WJZA 2D2XA 2P4EA 4UHKA 1KWKA 2JPDA 4FDMA 5DU2A 3ABIA 4HAWA 3WLLA 1U3DA 5KC9A 4YONB 2DFVA 2CVOA 3NWOA 1N3LA 3PVCA 3B3FA 4J0DA 3HUTA 4UEQA 3N58A 3PC4A 3HR4A 2P2YA 4Z0HO 5FWXA 3ZI4A 1PKEA 3UK1A 1N5RA 2A78A 2OO5A 2ZANA 1JHMA 1F48A 2IDZA 4OMCA 5L3ZA 3KEQA 2A30A 3LLMA 4YROA 3MOGA 2WLSA 1TO2E 1OXVA 1UZNA 1XP8A 5JAUA 1W96A 2HWWA 3R3VA 1JPJA 1VYUA 2XE8A 4LJ9A 4MR7A 4HWTA 3KXLA 4RWZA 3TR6A 2AX4A 4Q9HA 5DB4A 5KOJB 3DJYA 3K73O 1JJ7A 1Q12A 2HA5A 5TPWB 1P1HA 3O90A 2WDZA 1IEXA 3ZE7A 1E61A 4LRUA 1VYHA 1OYYA 3K1JA 2V7PA 3M1YA 4LOHA 2P4SA 3BHNA 2OWEA 521PA 5KAMA 4NONA 2BDEA 2H4XA 5GM1A 4PCAA 4Y7CA 2XKBA 4AM8A 5FL7A 2M6RA 4IMPA 3O0DA 4TLCA 2O8DB 2H7YA 1CUUA 2Z5LA 5F3WB 2QU8A 2EIXA 4CU5A 1CUAA 2WV9A 1RYMA 3QA3E 4AICA 3BREA 4GZ5A 1IFXA 3NVAA 1XTJA 5EESA 1JPUA 3VR5H 4K40A 4ZALA 1XEWX 2D62A 2RH5A 4RA6A 4BHTA 1PI3A 4BTLA 3G23A 1LS1A 4G1FA 3WGLA 1C7QA 2ZYRA 3Q8WA 3CZ9A 1U0TA 1E4OA 1A1SA 3ZLVA 1T8PA 2A2ZA 4GRIA 2AD5A 1GHTA 4K0RA 4DMCA 1BKDR 1LF0A 1YV9A 1PS9A 2PRKA 4GOND 3LTNC 3WLTA 4ZVLA 1J9ZA 4X45A 4L76A 1CUFA 4P92A 3GJ4A 4LZOA 2YWDA 2NXJA 2P1RA 1XZGA 3N87A 1O08A 1J99A 3NEAA 1E1KA 1VL6A 1G20A 2B3TA 4CT0A 3NALA 4V0SA 3Q5GA 4FB5A 4DMLA 3FBGA 1VKJA 3DL4A 4DDKA 3C3KA 1N7HA 4KQKA 5IKPA 3NDBB 2GPBA 3B53X 2PUFA 4EFMA 2GNOA 1XAIA 5HYVA 1WB5A 3A0UA 5BYAA 1JG4A 2UXCB 2A7XA 1VRWA 2C99A 1TFUA 2IE0A 2V7GA 1CIVA 1U9JA 2AOUA 2EU8A 3A9WA 2X77A 4OXQA 4XKJA 4JI8B 1UT6A 1XALA 1Z2DA 3IEPA 2A9OA 3QSGA 1DO2A 3DTVA 3EDYA 3N05A 5BQFA 1IZ8A 3L41A 2B8JA 3ABRB 3OEHA 2J08A 4JLDA 1BCRB 3CUEF 5KI6A 1ORIA 2V7TA 4REOA 2W42A 1V3TA 1EFVA 2HCRA 4FFDA 2AHRA 3PUXA 2ZR8A 4MDYA 1HQCA 4BVGA 1QM5A 1RYFA 3EEQA 3ZU5A 1DKPA 5CEJA 1A7AA 1SBYA 1NUAA 2VSFA 3VNAA 1XDUA 1UC5B 4P3NA 1S3FA 3MMNA 2XQIA 4CTMA 2XKJE 3PL1A 1V3VA 1CQXA 2RGDA 3CR8A 2WA1A 1GNSA 3SZGA 4CODB 1P74A 2G71A 3JX9A 1FFXB 1U5BA 4NCHA 3BMXA 4E4RA 3SJBA 5FBZA 1IUPA 4M7PA 4KE9A 1OMOA 1N4DA 4MWOA 1C9EA 1NW3A 1UFVA 4NU8X 3UGJA 2OFXA 3KKKA 1M1UA 4J43A 5A2GA 5C4IA 1JKXA 4WCFA 4DKJA 2QD4A 5DNCA 3HTXA 2LZ0A 1QJ4A 5AI6A 2AIRA 2HGSA 4NABA 3SEFA 1USWA 4XFJA 4JVLA 2J0SA 4QT0A 2E4AA 2V4UA 1K6IA 2PX2A 1KAQA 2W2KA 1I0ZA 1M7GA 2ENUA 3II6X 3OZXA 4TQUS 3SS9X 4DLWA 3TNJA 1K5GA 2UV8A 3KM0A 1USUA 2ODAA 3QLUA 4FINA 4MCJA 4Z1MD 3G0DA 2XHEA 4FOOA 1P17A 1P44A 1RMQA 2ADFA 5CNKA 3T7JA 2J6IA 2R4TA 4KLZA 4E2YA 2IS1A 3DMRA 1N2XA 3EAQA 1CE8B 2PGJA 3EMVA 5L7YA 4RA9B 1FDTA 5ALHA 1ICIA 3DXYA 1A9YA 2Q6LA 3T3IA 3A6PC 1Q11A 1EX7A 2NXNA 2Y77A 1LH0A 1T34A 2LGJA 4INJA 1RWQA 3H4TA 3L6UA 1F3LA 2OQRA 4IDGA 1KO8A 2R4UA 1V71A 2V3VA 5NULA 4G23A 2JJYA 3OCUA 4P81A 3RS9A 3VOBA 3TFOA 2I4RA 1EE1A 3R8XA 4NXNB 4KDFA 3E8MA 5JARA 1MW9X 2QQ5A 4JCOA 4Q3LA 4KO4S 3PEYA 4EFDA 1L7BA 4ZQBA 4AKTA 3OKPA 4CM5A 3VMMA 5FTWA 2PMWB 3AEQA 4LHZA 3VPCA 3HO6A 1N78A 1X7XA 4X9XA 4GX1A 4I3FA 3NORA 1BXRB 3PGLA 3RVJA 1RI5A 3RFTA 5EP3A 4J4TA 4EZBA 1URPA 4OXIA 3K2EA 3RANA 4IXDA 4ZK6A 1N75A 1NBWB 1CX9B 2F4VB 2OK8A 5TV2A 4BO6A 2VHZA 4CLHA 1DAIA 1Y6FA 5EHZA 2NPOA 2AKAB 2A0XA 3O3MB 4HDSB 4DG8A 5EHGA 4DLTA 1G3RA 3O7WA 1FS5A 1Q1BA 2Y05A 3IFSA 3NOOA 3PQ3A 4L6CA 4B46A 2IL1A 4Q01A 4EPVA 4ZKDA 2JIZA 2O1WA 3QZUA 4JUIA 3FAZA 5J40A 2V0CA 3IT1A 1NUPA 2AK2A 3K9HA 3KAQA 2PKYX 1EVYA 1HO3A 1BJKA 1GZSA 1RAGA 2XJ4A 3M33A 1M8GA 2HSZA 3OPYI 5TMPA 1UDWA 4HB0A 4D2IA 3SEQA 5BSWA 1F2TA 3KZOA 4NMMA 3D4BA 2E85A 2BFOA 3SY8A 2QTBA 3O1HB 2RHMA 5BV8A 5TPZA 3IUPA 4BMOB 3HH8A 1GTZA 3G2IA 3ZHOA 1PG2A 2DRIA 2OHOA 3SZLA 2FLKA 3HJUA 1PTJC 1B8NA 2X22A 4GPTA 3ZOKA 5BOSB 4LTNA 3IQHX 3ETDA 3GP5A 2WK1A 3FPLA 2IOFK 3SC3A 1WCYA 4YAOA 2VAXA 4O4JA 3HKBB 4KPEC 2GJ9A 2H57A 2Q6VA 2VPZA 3PFCA 4GM1A 2VJKA 2EHDA 2ZSHA 3PFIA 3IHWA 3RBZA 3MOIA 3MLBA 1P9WA 1R7RA 2FYTA 4A15A 3T3GA 3IAFA 1AMUA 3I2KA 3P2OA 1YR9A 1WSAA 4BQSA 1D3AA 4E3ZA 1NFFA 1YC5A 1W29A 4MVJE 3TL6A 2IZ7A 1JDUA 4RGQA 2FN3A 4PLGA 3QK7A 5DMHA 4O4JF 1IJEA 2Q27A 4LOIA 3W3ZB 5I8PA 2I6XA 3KPYA 4OV6B 1Z6XA 3QFRA 1L8AA 5FTLA 4YALA 2BEKA 3N8KA 3K7EA 4PPGA 1SCUA 4X84A 2SICE 2WJ3A 2YFHA 1T3TA 3ZX4A 1EFTA 4BO1A 1IOLA 4Y1FA 4PAWA 4XEUA 3S2EA 4A0SA 3JQDA 3MA0A 3E2PA 4LSMA 1JB1A 3O4HA 1O9HA 3HNOA 1CV2A 2R5WA 1KNXA 1YZUA 5KX5A 3C97A 1RJWA 4JVMA 3RW9A 1BMQA 4RKRA 5D3MB 1U9IC 4E11A 3DVRX 1GUZA 3OU2A 2FZGA 3HN7A 1JFFB 1U5AA 2PMEA 3SS7X 3NVMB 4TN5A 1RCFA 1NUTA 3G7NA 4ZPJA 4F2GA 1YQXA 1ZUNA 2JGNA 2WRZA 2JGIA 1WQ4A 1OXSC 4IDNA 2EW1A 1KEUA 2DQYA 1R0LA 3DD1A 5FBKA 4ERNA 1QAQA 1M54A 1U2GA 3MZ0A 3P4XA 4BWVA 2QLMA 1LRKA 3EYAA 5HA5A 2VJYA 3AL3A 3OLXA 4MS3A 1EI9A 1OV6A 3WL8A 3AY6A 5CNIA 1J1ZA 2TS1A 1D5CA 1GTG1 2R6GA 4W6QA 1H2WA 4M83A 4HQRA 4RSRA 1NN1A 1W34A 2ZRKA 3LT4A 4TUYA 2Q7DA 5IAEA 4MUBA 4OP3A 3UOAB 4BO9A 5AVRA 2NUPB 4N54A 2X4IA 2XE7A 1S8AA 2PHZA 4REQB 4ADSG 4DAEA 5K8TA 5F4ZA 2WFMA 4FQ5A 2BRUC 5E9WA 4QC2A 1S9HA 4JL8A 2Z5VA 3NOQA 4D5GA 4WASA 2WF5A 4HSEA 2ZSIA 2JKZA 4Z0PA 4S24A 1UAGA 4TUYF 4YRKA 4XGNA 1D03A 2YJ4A 5E4FA 2AYXA 1GPUA 3BTSA 5IEBA 3SZMA 3WWZA 1QFYA 1ZN7A 5JYBA 2R6ZA 3W2IA 3KKNA 5LZ8A 3WGHA 2QTMA 3KP1A 3FOZA 1NVEA 3WMEA 3OM0A 3BYZA 2HZ7A 4MPDA 3UGKA 4UHEA 3M6IA 1P91A 1G8PA 1KP9A 3P0RA 4DBLC 2F8TA 3EIOA 1YCHA 3PB3A 4JIMA 2AQIA 4GZ3A 4YT4A 2VTBB 3H84A 3GLVA 4D9CA 1OW3B 2IHKA 4R8KA 3VHLB 3VPSA 3TZKA 3T5AA 5JDIC 5EE5B 4M0PA 2QVGA 2OGSA 3SHFA 1MFZA 1VI6A 3K2QA 3OLVA 3QTBA 1HBJA 1U99A 5H3HA 2EQ5A 4GMHA 4CM1A 3QMMA 1Z0UA 3PX7A 1XUOA 3AJ8A 3LL7A 2YJGA 4BIMA 2GM4A 2BCJQ 4FZ3A 1K89A 1I3OA 2G3YA 4F9FA 4CKXA 3LRXA 4XLTA 4CHGA 2PXXA 3L4JA 4PG5A 4YP5A 5H68A 3PGJA 1LPPA 3IKJA 5DISB 2D0PB 4KK4A 2X0DA 4AMGA 4KN8A 2J9FA 4KLCA 4EI2A 1RQRA 4BE4A 3AF3A 2YMLA 4Q48A 4WINA 1JGTA 3R20A 3RV4A 1G8GA 4YCBA 3S28A 2BJWA 1P5RA 2QN6A 3BE8A 3X2EA 2PRIA 5F9HA 1JR6A 4GE3A 2XGJA 3O0TA 4G09A 4EG7A 4QFCA 1JIJA 2IXTA 3S2ZA 2LNDA 2BR4A 2I3AA 3UYKA 1HPLA 4Z7JA 3P9RA 3Q9UA 4DUYB 4AQYB 3S2IA 4EB0A 3EGVA 1CRLA 2EGGA 3IEIA 4J3JA 4BNTA 1SBNE 4X63A 1U4NA 4XGRA 2OHXA 5KHLB 3GMTA 4MEAA 1DRWA 3TL3A 1ST2A 3PQEA 4MHSA 1X1DA 2AC2A 1FMLA 1PHRA 3LMKA 2FW0A 4RL4A 2I4MA 1M6EX 1T0PA 2YVUA 4M38A 4FS8A 5KZMB 2RKBA 3LI2A 1DJNA 3R3XA 1WMDA 3PNQA 3W4KA 2QX6A 4MYHA 4C22A 1W1UA 4ZHQA 2P4UA 1GQOA 5HW0A 2WJYA 1C3EA 1GT91 1T25A 4DDWA 2IW3A 5AUPB 4YUXA 3ZWKA 2GHIA 3WP0A 4JBNA 3THYA 2DE0X 3CNOA 3QEMB 5LFAA 4PVDA 2RB4A 4M89A 4D8WA 4FDTA 2GYYA 3K16A 4NEHB 5DCUA 2P4HX 3O91A 3VSDA 2B9EA 4LS3A 1OB5A 1T43A 3H4MA 1WXIA 1N25A 5TEWA 1BRMA 1N2CE 1DKQA 1JW9B 2OCYC 2Z8XA 3HJHA 3RIEA 3Q6NA 1RHQA 3WLIA 4ZHQF 1D2NA 4S2EA 1M10A 4MRMA 1E8MA 4X90A 5CW2A 1KJ9A 5ERXA 4D02A 3GUZA 2C2OA 3COYA 2NPIA 5L3VA 1WDLA 2LCIA 1MO2A 2HFJA 3NDJA 4BGUA 2EKBA 5CFZA 1QHSA 1HEUA 3BAFA 3ROTA 4PW0A 1UJ5A 4DLPA 1SXJB 3M83A 4FJ1A 4R9NA 4DNXA 1RRPA 2NU6A 3AFHA 3BXEA 4XVUA 1AK1A 4BFLA 5G4KB 2BR5A 4CPDA 1DRUA 1UDBA 1I30A 1PD0A 4JR2A 4EBFA 5ICFA 4UQLA 1Z3CA 3LBHA 1H8EA 2F3QA 4MV0A 5TT1A 4Q39A 2UZ3A 3VU8A 4H1UA 1E64A 5K8CA 5DULA 3FDJA 3PQDA 4EDHA 4Z4HA 1NBEA 4WADA 5FHRA 1PGOA 1TM4E 4L0QA 3RQSA 4B6GA 1MR3F 4YMTA 2H3EA 1W0JA 3A8TA 4U00A 2ZUDA 3TLMA 3RU7A 4PSVA 1D7OA 1HWYA 3PSHA 5JATA 1K97A 1OROA 1ZC4A 2WVJA 3D54D 4LBZA 4OD0A 3ZV5A 2QVBA 3LE8A 4ZT3A 4MW6A 2DJ5A 2DHRA 2XQJA 3GEIA 2R8EA 4GOJA 1N2BA 3DBLA 4JJGA 4P3PA 1Z68A 1CJSA 1R5OA 4WOJA 3MWDA 1SN7A 2Z2JA 5FF9A 1V7CA 4E5NA 2PS9A 4BFSA 2JFBA 1NXSA 5LU9A 4TLMB 2GMWA 3SI7A 3BQ9A 1FW8A 3VC2A 2Q6KA 1XU7A 4Z51A 2VHEA 4EUNA 1POWA 4RGYA 2B94A 4D0RA 3EDOA 1JBQA 1X87A 2VPQA 1UDRA 3WGKA 5HSGA 4QVGA 3W4IA 4K6OA 2O8FA 2Q5FA 3BQNB 4J7AA 5AVOA 3B6IA 5E7JA 1QP8A 3THXA