1EFPA

Electron transfer flavoprotein (etf) from paracoccus denitrificans
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
307
structure length
307
Chain Sequence
b'AVLLLGEVTNGALNRDATAKAVAAVKALGDVTVLCAGASAKAAAEEAAKIAGVAKVLVAEDALYGHRLAEPTAALIVGLAGDYSHIAAPATTDAKNVMPRVAALLDVMVLSDVSAILDADTFERPIYAGNAIQVVKSKDAKKVFTIRTASFDAAGEGGTAPVTETAAAADPGLSSWVADEVAESDRPELTSARRVVSGGRGLGSKESFAIIEELADKLGAAVGASRAAVDSGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQIADYGLVGDLFSVVPELTGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
publication title Crystal structure of Paracoccus denitrificans electron transfer flavoprotein: structural and electrostatic analysis of a conserved flavin binding domain.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 82
structure length 307
sequence length 307
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1efpA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1efpA01
3F6BX 4U8HA 5JBNA 1U28C 3UY4A 1N2GA 2IHVA 2OORC 4QQ8A 5EJ4A 1UPCA 4JUFA 2OD2A 4GU5A 4OUDB 2CYBA 1O94D 1VBNA 2C5SA 4MVWA 1KQNA 4CQNA 1G59A 4R2MA 4RPIA 2WQ6A 1PTJC 1UPBA 2QTRA 2QQFA 3IVCA 3COYA 2GM3A 2QJFA 4MW0A 2B4YA 1KP2A 4DJAA 4DE5A 2PZBA 2QUJA 4MW2A 2CV0A 2R5WA 1NI5A 3IH5A 4NAUA 2EZ8A 2OV4A 3CLRC 3HFJA 1NUQA 2HGZA 1JIKA 3OTWA 4JXZA 4UU7A 2H2AA 1MRZA 1ZJWA 4MAFA 4MW5A 4NDAA 4ZT2A 1R6TA 4HK4A 4CDMA 4DDMA 3TZLA 5LFAA 3PRHA 1TQ8A 3FI0A 2H59A 5H16A 1SZDA 1NYLA 1ZUNA 3AG5A 4MWCA 1KR2A 3CLSC 3A2KA 1O0CA 4Q93A 1HYBA 4OUDA 1S7GA 2A7XA 2H4FA 4G5YA 1EFVB 5DK4A 3DV2A 4MVCA 2Z09A 1NURA 1WZ2A 2IELA 1T6YA 1OVMA 1XLTC 4QBTA 1JMVA 1M83A 5H7XA 1YBHA 5EJ5A 2H2GA 3G6KA 4RMIA 4JT8A 3N8HA 3AFHA 3KT8A 1KAMA 4YBRA 4BV2A 2H2DA 1ZH0A 1ILEA 3IMGA 5K6RA 3ZUGA 4MW1A 4XFDA 1WKBA 2VBIA 3GLRA 3HWX1 4HJXA 5K0TA 5TEWA 2Q5JA 1F9AA 3CVWA 5BWNA 2CYAA 3IAFA 3AL0C 1N77A 2X0KA 3ZXIA 2VTBB 1F4LA 5IJXA 1I6LA 3H97A 1EFVA 2H4JA 2UZ1B 1WJGA 3G59A 4MQ5A 1GLNA 1POXA 3ZGOA 4ZCQA 3FSJX 2JAXA 1YC2A 4EGAA 1CT9A 5DASA 3JXEA 2PG3A 4BV3A 4JUCA 1MB2A 1O95C 4YP6A 2I1LA 1QNFA 1U31A 1ICIA 4C7BA 3L93A 1O6BA 2QQGA 2CV2A 2NYRA 4U63A 4G1CA 2GKSA 3CLRD 3PNBA 1MB9A 3MMXA 3ND7A 1GTSA 1T9CA 3TQIA 2VTBA 3D4BA 3EYAA 4MUEA 3HV0A 3RJZA 4BVBA 4FZ3A 1Q6ZA 3LCJA 4MUJA 1H3FA 3SYTA 2UZ1A 3CLSD 3N2YA 1F7VA 1M8KA 3ILVA 4CDNA 5LM3A 2DEUA 1NP7A 2J5BA 3IOBA 3S3TA 1PYDA 2FSVC 2V3WA 4K9MA 4K9PA 3FNRA 2BRUC 5DEIA 4BVGA 1Y42X 2E21A 3NV7A 2J07A 1OZGA 5BWLA 1RQGA 1MOPA 2G36A 4AQ7A 4F56A 2Q5QA 1YUMA 1WY5A 2H2HA 4JSRA 3CLTC 3IODA 1QJCA 3FH0A 2X1MA 3H99A 3U3DA 1U7XA 3FETA 1WXFA 1KH1A 2PXHA 2VK8A 4I6JA 4G5FA 3D7KA 1M2KA 3P0IA 4MPJA 4MUKA 4MWDA 2AZXA 1IQUA 4NZPA 1A8HA 1COZA 1XNGA 4K03A 1T9GS 2J09A 2WQ7A 1K4KA 5FO1A 3A05A 2Q28A 2QJOA 1ZPDA 5HG0A 1YI0A 1OZHA 4FEGA 4RMGA 5K3SA 5D7NA 4WNYA 1U3CA 2Z08A 5FNZA 4Y6OA 3ZGVA 1V5GA 4RUKA 4QRDA 1TYCA 3HMQA 4Y6LA 1QU2A 1WXGA 3UC5A 2JI8A 2E89A 3GLSA 4PBSA 1S5PA 1N2IA 3AKZA 1PG2A 4ZZIA 1QRTA 4MULA 3KT3A 3FZNA 1IFXA 1O95D 1NUSA 1IHOA 2IHTA 1IQRA 2Q5LA 1YUNA 3ZG6A 1JIJA 4V1CI 3RIGA 3KT6A 1N78A 4QPZA 3QE4A 1G8FA 1IQ0A 4RJIA 2DPLA 5F23A 2CFOA 3FY4A 4MPRA 4V1CB 4K9KA 1OWPA 5AHKA 4RJKA 2CV1A 1M1ZA 4PBTA 3D6UA 4ZP1A 1U2GC 3GLVA 4J75A 4ZCSA 2PGOA 1QRUA 1TYBE 3VGJA 2EJCA 2QUKA 1PVDA 3RFFA 2WVGA 3E9YA 4JUDX 2WVAA 4RJJA 1EE1A 2XRYA 3G5AA 4X0EA 2DR2A 1D2RA 4DDHA 1O5TA 3INNA 1Z8NA 1IRXA 2BYTA 1TEZA 1NZJA 3CLTD 2ZP1A 1JZQA 1YTLA 4RMJA 4BVEA 2VJYA 4MUHA 1M8PA 4ARIA 4ZT5A 1POWA 2EZ9A 2H29A 2YY5A 4V1CA 1OBCA 4KR9A 1V5EA 1MCZA 5LLTA 2PZ8A 1KQOA 3SDBA 1Q14A 3FWKA 4Q9DA 4UTVA 4IAOA 3H05A 2QUIA 1MC1A 1J21A 1GAXA 5J58A 3CVVA 3TZEA 3PDHA 4JUBA 4QELA 3F6EX 1X8XA 4ZCTA 1KKUA 1WXEA 2A1UB 4NX2A 1NUPA 5MFPA 4BN5A 3D81A 2RD2A 4GP9A 1PI3A 4L3OA 4ZCPA 3COWA 1PT9A 1KP3A 1N2HA 2JANA 3BL5A 2AG6A 1BFDA 3TNJA 1KH3A 4G6ZA 1WXHA 2EZUA 1YI1A 3OE1A 1I6MA 2J4DA 4DDKA 3CVYA 3CR8A 2C31A 1R6XA 1M2GA 1N2BA 2QUHA 1F7UA 4GM1A 1M2NA 1LI5A 4MW7A 4UZFA 2DLCX 4EFKA 4EG3A 3AIIA 4HD8A 4MUGA 3X1JA 1PFUA 2FR8C 1YHZA 2XRZA 2CSXA 4MWEA 4X3PA 2A1UA 4EF6A 4MW9A 1VLHA 1P7PA 1H3EA 2WVHA 2O8VA 1N2JA 2OQ2A 3DPIA 1JIIA 4F4HA 2B7LA 4J76A 4F3RA 4L2IB 1KH2A 1O96B 2X7JA 4FEEA 4JUAA 5EJAA 4ZT4A 1D4OA 2H2IA 2DETA 1EUYA 3ZJTA 1E3TA 3SEZA 3ZXSA 4BVHA 4UUAA 1JHDA 1K92A 3X1KA 2A88A 1I2DA 1VL2A 1YULA 3ND5A 1OWOA 1XNJA 3L92A 4EG8A 1U3DA 1M8FA 1EXDA 4WSOA 3JWPA 4JT9A 5K0SA 3K32A 5MGNA 1OWLA 1EJ2A 5IHXA 2Q27A 5AHWA 4K9LA 3FDXA 4BWVA 3TQOA 4IF6A 1JILA 3Q12A 2PFSA 3RK1A 4R2LA 1MA3A 2H2FA 2VK1A 4KR6A 1O96A 1QQTA 3CLUC 4ZCRA 5HUHA 1N3LA 4NAHA 5K2OA 1R6UA 4OJMX 1GZUA 1MJHA 2X3FA 3HZRA 4GPEA 5FO0A 2OD7A 1Q15A 1G8GA 2FN3A 3IMEA 4IG9A 4GRIA 2Z3VA 3IOCA 1QU3A 2JLAA 4JD5A 3Q10A 4MW4A 4ZT6A 2WB2A 2JA2A 5J59A 2A1TR 1FFYA 1M2JA 1QTQA 3LOQA 1SURA 2OO5C 1Q77A 1Q19A 1HZZC 3RHSA 1TFUA 4I6EA 4ZT7A 3ZJUA 4MUFA 3H9BA 2A86A 3UOWA 3IDFA 4JZYA 4D5GA 5J5AA 1YC5A 3AG6A 3KT0A 1PNOA 3PNYA 1YIDA 4XFJA 1TYAE 4DNXA 2RE8A 5DGTA 1YI8A 2DERA 3LE8A 1M2HA 2PGNA 2AKEA 1M8JA 3N9IA 2IJGX 3FHJA 3KFLA 1MAWA 4COKA 3SZ3A 1V8FA 2X1LA 3EA4A 2OD9A 4KR7A 4CT0A 1T6ZA 5HUJA 3H9CA 2AG1A 2QTNA 1WOYA 1KORA 3RIYA 2NXWA 2TS1A 3IUEA 2D54A 3E27A 4I6GA 4FVTA 4TS1A 1GN8A 1PFYA 2QTMA 4H3SA 4R0NA 4KGDA 1T9DA 3IAEA 1KQPA 4ND6A 1LI7A 1NSYA 4K0RA 4HDAA 4RMHA 4TWJA 5TEVA 3IVGA 1G8HA 4BN4A 4I5IA 3RBAA 4ZT3A 1EUQA 3HWWA 3F3MA 3P52A 3CLUD 3OP1A 3PXUA 2IP1A 4MVYA 5KHAA 3X1MA 1YHYA 4GM4A 5BWOA 1JECA 4D5EA 4XSVA 5FEMA 2NSYA 1PNQA 4MQ6A 3M5WA 3CF4G 3EY9A 2FWNA 1JZSA 3HL4A 3D6VA 4EG6A 1H3NA 4UU8A 3FG9A 3DO8A 4FZJA 5EKDA 4K9QA 4UTZA 1NUUA 1ZH6A 1FYDA 3P0JA 3IVXA 4KKVA 3GLUA 1N75A 1DNPA 2DUMA 1JEDA 1X6VA 1U0BB 1SZCA 2VK4A 1DJLA 4YP5A 4E1AA 1KAQA 1OD6A 2YWCA 3DLAA 3ZIUA 1OZFA 4BVFA 4U7JA 1N1DA 3NBAA 4QREA 3U1VA 1EFPB 2EZTA 1N2OA 1TYDE 4K9OA 4GM0A 4KXQA 4MVXA 3QTBA 2Q5OA 2GOYA 4KPUB 3HGMA 5DB4A 1I6KA 1UPAA 4EG5A 5KWVA 1YIAA 2Q29A 1QRSA 2PZAA 2D5BA 1T9AA 5EJ9A 1YNOA 2E0IA 1LW7A 2V0CA 3JR3A 3I05A 5EJMA 4TWIA 2BTEA 1V5FA 5DGDA 3U31A 4HJRA 1OBHA 1J1UA 2VBGA 3MUEA 1B6TA 1ULHA 1PFVA 3SEQA 4J1TC 1O97C 1UFVA 2H4HA 3MLBA 3UMVA 3TS1A 3ND6A 3COVA 4P2BA 1Y9DA 2YWBA 2YXNA 3N05A 4BUZA 1Q11A 1K97A 1N2EA 3UK2A 4EG1A 1EFPA 1GPMA 3CA8A 1PO7A 4ARCA 4UTXA 3ELBA 1MBZA 1J70A 4JFAA 3A4IA 4KPUA 5EJ8A 1VBKA 3MLAA 1OWNA 1J1ZA 4MZXA 2HJHA 2E18A 1H1TA 1PFWA 2VXOA 1T9GR 2O5RA 5BNZA 4MPPA 3Q4GA 1O0BA 1PG0A 3GUZA 3COZA 4Q16A 2V0GA 3QTTA 3FIUA 4JYZA 1JSCA 1QPBA 4GG1A 1XNHA 1IH8A 5KCMA 3ZJVA 4J16C 5EJ7A 2EL7A 3ISJA 2CT8A 4L2IA 1Q17A 1O94C 3GLTA 1U2DC 4O8ZA 4EG4A 1V47A 1WXIA 1N0HA 2JIBA 1JEEA 4PBRA 3ZGZA 2W93A 4X3OA 1T6XA 2AG0A 1J09A 1M8GA 3K35A 5TS2A 1J8FA 4MUNA 4HPWA 4DLPA 4C78A 1JGTA 3VRHA 1OWMA 1S4MA 4AS1A 2VBFA 4MLPA 4UTRA 2A4MA 2HMAA 2DXIA 2FRDC 4YMIA 4PY2A 4K9NA 5IMSA 4UTNA 3P0HA 1GTRA 1VBMA 1WQ3A 4UZEA 4YP7A 2PANA 1NM5C 4JU8A 3LQ1A 4R8MA 3PKIA 1WQ4A 4Y6QA 4MW6A 2JI6A 2HZ7A 5MF6A 1MAUA 2ZUFA 3IMCA 1J20A 3SZGA 3NBKA 3A04A 1O97D 3K9WA 2WSIA 3C8ZA 2CYCA 1K4MA 5EJ6A 1T9BA 3IUBA 4NATA 2IHUA 2ZUEA 2D13A 3FLMA 5TGTA 3PNVA 2JLCA 3PKJA 1IVSA 3RK0A 4F4UA 1BS2A 1Q1AA 4EG7A 4MUIA 3CVXA 2NZ2A 5DEOA 3SP1A 4JXXA 4UUBA 2J08A 2DJIA 2CUZA 3VU8A 2PIDA 2JI9A 1NUTA 5K6TA 5MFZA 3FOCA 4ND7A 4MWBA 1XJQA 3MXTA 1U7DA 4A91A 4S1OA 2EZ4A 3GMIA 5FYQA 2A1TS 4JU9A 3IOEA 2JI7A 2QJTA 3CVUA 2A84A
chains in the Genus database with same CATH superfamily
1F6BA 4Q3KA 3C43A 4J49A 2F3SA 3TBKA 4H6PA 1R9GA 3BK2A 1YQUA 1T36A 4B3BA 1X77A 4MCJA 5ALYA 3TX2A 1U80A 4OUDB 2EATA 2A35A 1XCJA 2IBMA 3EXG1 4YCNA 2LW7A 3GFTA 3GF4A 2QZJA 2R48A 3W8DA 2VP9A 4DY4A 3KQKA 4PLGA 1Y8ZA 4ZAFA 3PU6A 2QJFA 3U62A 3TIFA 3UKDA 5KJCA 1B6SA 2HIMA 1P18A 2J5RA 5CVJA 1U3TA 2FZKA 2AF3C 2IQ5A 3R6GA 1C4XA 2C9CA 2GPNA 2E3JA 1VIVA 1H2BA 2UYGA 2ZIUB 4TUYF 4UHEA 2UYCA 3NVKI 2EBWA 3DTVD 2YJTD 4NP6A 4RD6A 3E61A 4MV0A 1K6IA 4KIWA 4DSTA 4XQGA 4LWZA 3PRHA 3UT6A 3OD5A 4JMPA 4RM2A 3NDRA 1I14A 1NVDA 3NWEA 1MC4A 3BA1A 2WF8A 3TR0A 2PPLA 1AV7A 1H2HA 4A6EA 1PJAA 5D3MA 5FNVF 2BM9A 4HWKA 3T9CA 3EPLA 4BP3A 5DNAA 4E5DA 3CBGA 4CGYA 3D2LA 2ZIGA 3HRIA 3W4IA 3TOVA 2GGSA 2OFFA 3EXHB 3S5UA 1PS9A 2H1LA 2JFZA 4RHCA 3FCOA 1ZGAA 3UW3A 3A3YA 4IJUA 4F86A 1GGFA 2FEXA 1I51A 4REOA 3RODA 4P4GA 2H06A 4EUHA 4DJ5X 2R66A 2GLXA 5JEDA 1MQ8B 2IYLD 2IIQA 2F1HA 4GXRA 2VJDA 3BSSA 3ZUGA 3ONFA 1WKBA 2FPWA 3CXRA 3B89A 2VHJA 4H18A 4B34A 2VRBA 5EVJA 2I6UA 2RONA 2J5KA 3GJ3A 2O48X 2JFYA 2WG2A 4OKNA 4WUVA 2P5UA 4O08A 1PVVA 1GZHB 1TZ2A 4HDRB 5GINE 2Y4NA 2BFCA 3ONWA 1Z28A 5GOTA 2FFHA 3G1UA 3GFBA 1POXA 4NU6A 2WTNA 1V8BA 3PX3A 2JAXA 1K4YA 3BZWA 4EGAA 1G8JA 2ZYTX 2HRBA 1OSNA 4C87A 5GJWC 3RAEC 1KMHB 1N2CA 1S8OA 3H8VA 5E6SA 3GP8A 1Y3FE 4HVAA 4GZ6A 4JLUA 3MTDA 1ZQ9A 2I1LA 2EBFX 3SC2A 1KI6B 2J87A 1OC4A 1R0RE 3JSXA 4QUJA 1KSGA 4EM6A 2O2JA 5LMNB 2Q2NA 1NJ2A 2W9XA 4YUXA 3LP8A 4QLOA 4JLNA 2D0IA 2P79A 5HZGA 4NBTA 3RYCA 4DLAA 1X7XA 4MRMB 3R44A 3T9FA 3TL3A 5KYWA 3OO0A 4MJXA 4P86A 2WV9A 3RH0A 4FJ0A 4R1PA 4EPVA 5CXQA 1VOTA 3P2EA 1B7GO 3N2YA 2X5KO 4N54A 1X7WB 1WKCA 2VAWA 1FFEA 2FSVC 3HR8A 4OQXA 4QEDA 1Z29A 1RKXA 2XD9A 2ANCA 2NNLD 3UYKA 2FP4B 2LKDA 3ABQB 3KLBA 2XZPA 4F56A 4QPDA 3JD0A 2X0FA 4CI9A 4OQQA 1CNEA 2JLYA 1TTTA 4MARA 1C3VA 4P22A 3VA7A 1P2BA 4DLUA 4QTXA 4OB8A 1AMNA 4C05A 1V8PA 2AFVA 4BKUA 4MPJA 3P45A 2FJPA 3IV6A 3GJ4A 1EX1A 1W87A 1X13A 1UWVA 1C1DB 4A03A 1H66A 2B1JA 2CXPA 1YGYA 1Z0IA 3KJGA 4DCUA 3SQNA 1UH5A 3GAZA 3ZHVA 3ZNOA 2P9FA 3EMVA 2W2LA 3PGXA 4V0NA 4F7DA 5AKXA 3O82A 1N3YA 5CTAA 5JDCC 2J0QA 4BJ1A 2HPHA 1NNEA 3KSUA 4BX3A 4MIOA 4WXHA 3ZTTA 1QDLB 2GESA 4A8JA 3D7SA 5H3CA 1QG2A 4EB8A 2PNFA 2V97A 2ZJFA 1D2EA 1R0YA 3EFHA 3AUKA 5D1HA 3BHMA 1VE5A 1WUTA 2WWXA 4DJTA 5J4YA 2C07A 1KJWA 2ISQA 1VG1A 4I4IA 1RQLA 4QG7A 3TLMA 1O2DA 3AERB 3MRVA 3V2HA 3K1ZA 1IQPA 4N7JA 1W2HA 3UANA 2FA9A 2FXVA 1JIJA 3JR7A 1JDPA 2VT6A 4F4IA 1N1GA 3NASA 4WPGA 4YLGA 3WMEA 1MO4A 5EESA 1IQ0A 2VZLA 1XL1A 4IOMA 3MT7A 3RU3A 3H2KA 1N34B 4X20A 2JGLA 4BN0A 5E4TA 3MOIA 3HVJA 1HMYA 4F45A 4DIBA 1YZTA 5FQNA 5JADA 4RTNA 2WIAA 1MNQA 1DRUA 1WF3A 5AJTA 4J3NA 1D6SA 4QOIA 1CZKA 3SNHA 2YHSA 5B30A 3RWBA 3R9KA 1CULC 1Z6TA 4BFYA 2GA9A 4Q3NA 5CURA 4MPTA 4HY3A 1YBAA 2WFMA 3BQNB 1J0EA 3C1UA 3GVHA 4Q1EA 3N6VA 4BLOA 2I2WA 1P6XA 2DYKA 3R7LA 4FLEA 5ED4A 1Y3BE 4FM9A 4TRRA 4HF7A 5HA5A 1PX2A 3ANSA 1QP0A 4JBHA 1RLTA 3VSEA 1N36B 2KX7A 3QUAA 1B16A 2H29A 2QDKA 4LYEA 3YASA 1F8UA 5HJ7A 1ZCBA 1Q14A 3H11B 4MV4A 1OI3A 3L1JA 2QROA 2VHYA 1GM5A 3R7SA 1X7YA 3ZHQA 3CVVA 2INGX 3PDHA 4PANA 1VKRA 2FSSA 3DMTC 3OT1B 4A23A 4CDRA 4MI6A 1FSFA 5DRTA 3L1HA 5EZYA 5KOYA 3U6KA 2QD3A 2BOVA 2OHHA 5DBIA 1R1DA 2DHQA 3GDOA 1BE1A 2DFPA 3TUZC 4ZCPA 4OH1A 3O31A 2B37A 2QMOA 1BFDA 4N0DA 3PF8A 4HAWA 3CUSA 4WNIA 1H69A 4BKPA 4CLOA 4WWHA 3WO1A 3L40A 4C4TA 3CVYA 4V0ME 4OK3A 3BD7A 2VZ8A 4E51A 3D6NB 4FFBA 3FKSA 3GCXA 1E6MA 1F7UA 3EZ6A 4XIJA 2O8BA 1PJTA 2PQ6A 1SCAA 5J40A 4RZ2A 2IW1A 1TO1E 3CG4A 1FFCA 1ULBA 2IY9A 5C18A 1A9PA 3N3BC 1WMDA 3B9PA 4RGVA 4N82A 3RUPA 4M6WA 2DRIA 3FWNA 3T0IA 3W5UA 1UXOA 3KSDO 4HX5A 5CFNA 3Q3IA 5DBFA 2AZ4A 3ILSA 3INTA 3IEPA 4RVGA 5IG2A 4YDHB 1CJTC 2QBYB 4F5EA 1XTZA 4QXRA 4TT8A 2B7LA 4D7AA 4D4LA 2HY7A 1W85A 5BPHA 5AI0A 4KJZA 4AMVA 2DUJA 3ETCA 2Q6KA 4JOQA 4QXMA 3GA5A 4YQZA 2KMLA 4RKWA 5AR1A 1IVYA 2CBXA 4Z7OB 3E5NA 4YUYA 1H2XA 2FPPB 1YU6A 2HUNA 4WBNA 1OX4B 3HUEA 3V8RA 4M7PA 1U3DA 5J5VA 2J7PD 3FPCA 2H4WA 2Z3ZA 2C1EA 2VF2A 4ZVSA 4GR4A 2G40A 2D59A 5ENDA 2FKAA 2ZWIA 4ZYZA 5IKEA 2ZUTA 3SJUA 2F3RA 2WFLA 1X3SA 2O1XA 2IYEA 2QRVB 4P93A 3QUQA 3T7RA 3QV1A 2VK1A 3AJRA 1Z4QA 2XUDA 3CTPA 3EWSA 4GI5A 4O4HA 4L6CA 1PJCA 1SUBA 3TZ6A 2QVYX 3MLEA 5DT2A 2ZIEA 4RNDB 1M66A 1G8GA 4JODA 3F74A 3QVVA 1S7CA 3T94A 4PYIA 1HYEA 3EDQA 1FL9A 5EP4A 1PUJA 4Q6WA 3TX6A 2J3JA 1PR9A 5KTPA 4CLRB 1Q95A 1HZZC 1X3LA 5INTA 5CLJA 3PFNA 2PD4A 1OH7A 2EYUA 5C4GB 3ZCRA 1AKWA 4TV9A 3H9BA 1AZWA 3G0OA 1AKNA 1XKQA 3X43A 3EJ6A 1NMZA 4D5GA 1KEKA 1UC4B 2QP3A 1ANKA 4GL2A 1PNOA 2GK3A 3PQEA 4D6YA 1OH6A 4DR3B 1KPHA 4KVFA 3X1ZA 4PZDA 1HNWB 4II3A 4DKJA 2WZBA 1PT6A 1NOIA 1DC8A 3PUXA 2FUNB 3Q9SA 4CN8A 3FYUC 1DFHA 5JFTA 2BDEA 2G9NA 4IGIA 3O93A 4GI3A 5BSMA 4ESEA 1MV8A 1TIBA 3OBBA 3AP1A 2AG1A 2J67A 3A6DA 4IEFB 3T7CA 1T15A 1TXGA 5K8VA 4DCNA 3DEJA 1H1DA 3UB4A 2Q7OE 3LHSA 4BMYA 2ICAA 4QOJA 1KQPA 1VE1A 4NENB 3TTVA 1HTTA 3SBXA 2G63A 5E9WA 5IDQA 2X5JO 1BXGA 1K6MA 4NICA 5IM4A 2CMGA 2HRRA 3HJRA 3KQUA 5DULA 1KVUA 1E2NA 1YMUA 4H4EA 2PN1A 4I5IA 2ZUBA 4KUGA 4LHXA 1XQVA 2CCJA 4PQFA 4W8GA 1OH8A 1L4HA 3EDCA 3TDKA 1YJCA 5TF0A 1ZXLA 3ZDZB 5IBRA 3EPRA 5K0LA 4CCAA 3KCNA 1N6KA 1UC9A 5AESA 1M3SA 4JYCA 1YF3A 3V8VA 3M6FA 2C94A 5F7ZA 4B3XA 2QD5A 4PNPA 2W2NA 1A8IA 1GQOA 2EP8A 5HQ3B 3LPLA 4NG4A 5AO9A 1VE6A 2Z57A 2IL1A 5IT4A 2V5VA 2WJ4A 1LD3A 2YHIB 2CD7A 5DLPA 3TQFA 1TLTA 3AKYA 2B4TO 1Y6QA 4LJ5A 3LHDA 1XMPA 1X6VA 1PP4A 1SZCA 3CNQS 4I2NA 2KWIA 5AJUA 4ZEVA 5A4DA 4G3XA 3PGMA 5AM3A 4YP5A 3RT7A 3Q1LA 4AIIA 4E2XA 2OOSA 4QREA 2HJGA 3ANNA 3O91A 1E1LA 3O95A 5CH8A 1GV1A 3A9WA 2XNDA 4GMXA 4D56A 4QXAA 1FFHA 5HIMA 4BFVA 3OZFA 2QMYA 3HWRA 2OCLA 5JNSA 5KWVA 1U28A 3IIEA 4HS9A 5ECYA 1R8QA 2FQ1A 3N59A 5AP9A 4F38A 1I4TD 1OAOA 2GXAA 3U26A 1UK9A 2V9CA 1EG2A 1JZTA 2FWRA 2H9AA 4TWIA 1BCSA 3IDQA 1JG1A 2ARKA 1QQ7A 4YRMA 2G67A 2ZI3A 2WWVD 5LJIA 1ULHA 1UAAA 3UHJA 3OJEA 1E5VA 1DC3A 1SKMA 3JQPA 3LL7A 1HETA 5DXAA 4A5SA 1JFVA 5KYWB 4KX3A 4LBZA 2RGBA 3EEBA 1ZCZA 1C29B 1CF9A 1P0PA 2O20A 1F2UA 3A1VA 3I1YA 3M0EA 2C42A 4OO3A 1I36A 2VR1A 1V6SA 4DYVA 3GLIE 2J9YB 3FLEA 1L8XA 3K1AB 5KYXA 4JFAA 4HP8A 4D98A 1WDLA 3E7PA 4JVMA 1I7QB 1KY5A 1QTNA 4OQLA 5F64A 3ZR4B 1NASA 4MZXA 3KEFA 2VTVA 4DBLE 1U8FO 2ZJ2A 5BMVF 4WJKB 5NULA 1A77A 1RDFA 3AKZA 1U6JA 4DSAA 1QLWA 2V0GA 2ZJ3A 4TZ6A 2GM5A 1W8DA 4DY6A 3DV9A 2NTYC 3N2ZB 1KYWA 4NYIQ 4D42A 4DBVO 1Z88A 1I4DD 2OCXA 2HA6A 2W7TA 2XGMA 2YOHA 4U3JB 1GPBA 1AB6A 1XN4A 5GZ6A 2Q7DA 1WBDA 2TMGA 3C98A 1Z07A 2QPLA 5J23A 4P9NA 4Q4HA 1S3FA 4Y9SA 3VTAA 5ITVA 5J4KA 4CEHA 5BT8A 4Q3AA 2GTHA 1W36B 4LTDA 1SWWA 1NRJB 4KI0A 4TKLA 3VR4D 2WFZA 4L08A 2PUJA 3ZVKA 1KE1A 4ZO4A 3FUUA 1BDMA 3UAGA 5EINA 2ZUVA 4ES6A 1TQ4A 1UDXA 3PR2B 1NSFA 1I0ZA 4UTRA 1YFLA 221PA 3TN7A 1ESMA 3BD6A 4LK3A 3TSOA 3VO8A 1VYVA 2FXIA 3MWKA 4HQ0A 1JQBA 3SN6A 3S8MA 2OGTA 1PF7E 4M37A 4YP7A 3TTXA 1PQUA 2EP7A 4FTWA 1WMBA 1HA3A 3T61A 4MWTA 4AZWA 2ZB4A 1G16A 2PZKA 4NH0A 3KD2A 4PGMA 4UBKA 3T5TA 1H6BA 4DQDA 1RI2A 4XYEA 2UUPA 1IE3A 1A4UA 1ZIDA 2RB5A 3FE2A 4M9QA 2OBLA 4YT5A 5EPUA 1NU8A 4L28A 5ECDA 1TTHA 1V3TA 2Q4OA 4FKBA 3ZHZA 3VPAA 5T4FA 1AHIA 4I5EA 3K6SA 4GFDA 3BDIA 2R97A 2XEDA 1P0MA 4PO3X 3ZWCA 4ARVA 4JVSB 3K0SA 1QWSA 5JO0A 3EUWA 1BS2A 3LXXA 3OUZA 1UK7A 4B3IA 4EW3A 5AW2A 1B2RA 1K5PA 1I7DA 4FD2A 4AKSA 2UZAA 2VHEA 3IUQA 2A0WA 3LTNC 2IYYA 3VU8A 1NUTA 4C2BA 1T8TA 1XTTA 4ND7A 3MXTA 1DUSA 3AVOA 2EZ4A 2P4HX 2NO1A 4V2UA 3RANA 4UUAA 1MT0A 4FOSA 1ACLA 1ZHFA 2Q8QA 3ICWA 5GV8A 2B2NA 4LJ6A 4NS1A 2W8ZA 3SC6A 3GI1A 2JGDB 3K72B 1YRWA 3FGOA 2D1FA 4FDTA 5FOWA 3UK7A 1GZSA 4MYUA 1ZH8A 1E9VA 1PWYE 4WIAA 4R5MA 3ZYZA 3OJ0A 5L7YA 4D46A 3K9LA 2IPXA 4R2MA 5IARA 5AVRA 3UYLA 3PC6A 1UQUA 2LRHA 4GBMA 3PNPA 4MRVA 4YCBA 3OQMA 2GZRA 1DAKA 3M9WA 2QT9A 2ZSDA 1BD3A 2F8SA 2CV0A 4G0OA 1ZIXA 2O4UX 3DC2A 1RI1A 3KLMX 4QDUA 4C3UA 5M5BA 4KHPB 1LK5A 4OK6A 3TJRA 3LHFA 3EC2A 1WX1A 4LRYA 1KHTA 3EF3A 3LOUA 5ERXA 3RI3A 3LUBA 1G55A 3TZLA 1FDOA 1NJ1A 4Q9IA 4YJ2F 5GIPE 1M1YE 2FTKE 4DV4B 1G63A 3AYXB 3Q1KA 3BGDA 3CLSC 3IP7A 3MIIA 5AH0A 4YC7A 1RM0A 1YNSA 1VBFA 4G25A 1XZJA 3ML1A 1L6IA 3RRMA 4QO8A 3ZX5A 4URVR 1EFTA 2MIIA 2Z09A 2NVUA 2O8BB 4UNQA 2C0PA 1OVMA 1V5IA 4JASB 3O8RA 4QBTA 2NXCA 2B8NA 1O58A 4Y2XA 3PHCA 4EH1A 3VXKA 3W7AA 4YBRA 1GL9B 3LC2O 1SA0A 1TJNA 3EQZA 4GOKA 2OYRA 2QSJA 3B6JA 3KAJA 4GDMA 2QQ5A 1EE9A 1EFAA 5PGMA 5LOVA 4CQMB 4HJXA 1GGVA 5E9JA 5BWNA 3NT2A 3H83A 4ZPXA 4KZKA 1QC5B 4YT2A 1NC3A 1LPOA 1KYQA 3E4DA 5CD9A 2CHUA 4IKOA 4R9UC 3KVRA 4MVJG 2H57A 2ZJ0A 3CF6R 4AJEA 5LKAA 3G59A 1PLLA 5H70A 1FIUA 4WBNB 2PSDA 3SF8B 4AUEA 1PZNA 3UV7A 5A06A 1YH3A 3DZFA 3KFXA 4ONEA 4QTYA 3P2JA 3RKSA 1MO6A 1W4AA 3HJAA 1C2TA 4HB3A 1SHUX 1NPTO 5F33A 3ZDBA 2Q1YA 4FNOA 3D1LA 3P1JA 1OFHA 4IHAA 3PEUA 4KOEC 3R5XA 1H0HA 1FS6A 2ZYHA 3ROPA 2QVZX 2N1BA 1CR2A 2V7GA 3CEAA 2WFLB 5BV0A 2I0FA 4KPEC 3I2JA 1LBTA 4DLVA 3FMGA 3V8EA 3EHEA 3KVNA 5DXJA 4JT2A 3ABRB 3I53A 1T9CA 4MB0A 4OGFA 2E2WA 1LJUA 3TKYA 3U39A 4BMZA 4C3ZA 2V7WA 1QGOA 1USKA 2WUFA 3P4YA 3E4CA 4RHTA 3PCXA 1QVAA 3QHPA 3DAFA 2AQHA 4BRZA 3DWFA 1GILA 4HBGA 3EIXA 1FP4A 3VQTA 4XSGA 1KDOA 4BJ6A 4ZDJA 3E2PA 3ZLTA 1JYEA 4ZGBA 2ECFA 3K96A 5L9AA 3A0RB 2GNPA 1L7DA 3FF1A 1Y3AA 1XYGA 3FFBA 2PVCA 4JQYA 5EQDA 3ZDFA 2YOFA 4KQ1A 2G09A 2J9XB 2PUWA 4AKEA 4DDVA 1N1EA 1Q7RA 3E84A 4I55A 3V4LA 5HKBA 4ACAA 2XUFA 2MYNA 4PCVA 2EGUA 3H99A 2VHWA 1U7XA 3U3DA 3ZS9A 5AHXA 4TVBA 1SKYB 2N3ZA 2ODQA 4HDKB 1IY8A 3NTRA 4MUKA 5EXDA 5FP0A 2M6LA 1FUUA 3F7OA 1OIVA 4IHJB 5FO1A 1SBNE 1RXIA 4UD2A 4BPRA 4DLNA 4XSHA 5IF3A 2AQKA 2XUZA 1KZ1A 1MKYA 2ACKA 2W6ZA 2XV1A 1G6KA 3FFTA 4NCJA 4RA9B 4E5UA 5FNZA 2O9JA 1E7SA 4EGCB 1FDUA 3WZLA 1E99A 1P31A 2P30A 4HQLA 3WGIA 1TA0A 3D0RA 4CLXA 2O8CA 5JC1A 4H4CA 4DV1B 3LQ2A 4LOHA 1QU2A 2FCAA 3H1FA 3V00A 1LLFA 3TTYA 4WERA 1JEQA 5JCJD 1NW6A 3AHJA 5BN5A 1ECCA 1QH8B 4U2CA 1M6NA 2I2BA 1ZK4A 4IL5A 3TDMA 3V4SA 4BE7B 1DBQA 1SOWA 1DQPA 2ZB2A 3DCNA 3ETNA 3FRHA 3N8IA 4XA8A 4DC1A 4B3MB 1IJBA 2O7RA 3G79A 1PN3A 1Z6QA 3CFYA 4M60A 3X3HA 4QPZA 2O8FB 2QTGA 5HNKA 3MUFA 1TLFA 1PIWA 1Z0DA 3DUWA 4OIFA 4QQNA 4TUYA 4P4SA 3KTAA 4GVLA 4C14A 5A03A 2TSYB 3MWEA 5EHXA 1EK5A 2N46A 2XDQA 5JTUA 1RKQA 3GLVA 4J75A 2ZETA 4R2WA 4UDYX 5ARDA 2ZRJA 2ZT6A 1ZD9A 2H1HA 2WAAA 3K0CA 4JLOA 5JQGF 3HFRA 3GJXC 1D4FA 3PE6A 5F5NA 4V0MA 3V7FA 3VGJA 4OLAA 1E7YA 4R6WA 1JT9A 4QXQA 1WABA 5FNVA 1GSOA 4WCDA 3ENKA 4MDYA 3QKWA 1D2RA 1NVWQ 3IBTA 2Z58A 3BKXA 3U1TA 5JSZA 2BD0A 3EXHC 1P4RA 1YR2A 3CLTD 1OLSA 4Z4QA 2DGDA 1H8HA 1RHJA 4URFA 1NE7A 5KNCH 5JMPA 3MWFA 4BTVA 3JQFC 4P3OA 1N6IA 2OAQ1 3I1JA 3TR6A 6ABPA 5A02A 4CYMA 3HCNA 4PYLA 2HA5A 2PCLA 4Q3EA 5P8WA 1Z2CA 2P3QA 4IIUA 4ZI7F 1AK9A 2BGMA 2L17A 3OQ6A 3T5DA 1AV6A 5IXSA 1V7PC 1GITA 4G0QA 5C1DA 3HHEA 3ZLUA 1N1MA 2IV2X 3WOVA 4I1YA 1E5DA 2XTMA 3F6EX 4PAGA 3WI7A 1E2HA 1C4KA 1PEKE 1RU3A 1BCSB 2A1UB 4TWRA 5G2OA 3CW9A 3SXPA 3RR2A 3AIKA 2ORWA 5DCUA 1JHVA 2P78A 4I1IA 1KP3A 1H93A 2QAIA 5AKGA 4RZUA 5JNWA 1KH3A 5ALVA 3OA0A 3JWGA 4EDFA 2A30A 4GWKA 1K8RA 4DMRA 2H7XA 3K70C 1PNRA 2Q4DA 1ST2A 2XMDA 4MKFA 3ZVRA 3VJKA 5KYXB 4BFXA 1R3DA 3H17A 1QYRA 4GRDA 4PHGA 4ZOEA 2B2XA 3WGHA 4C9BA 1F2TA 2ZYVX 3BPSA 4JNKA 1UJ4A 1ZITA 1DS6A 4X71A 3SSOA 3BL8A 3TIXB 4DJDC 4D6XA 1P9OA 3W9UA 3DFUA 2SNIE 2UXCB 4IHKA 4X3PA 1DHTA 4ZTUB 3EIEA 1E7QA 1FX0B 4NMMA 1J25A 1SY7A 3AMVA 1N5KA 2ZIFA 2IGTA 2QTHA 1E3QA 1M7GA 2BKVA 1E4VA 3AWDA 3OEEA 5DISB 5ERGB 3T4UA 5ABPA 4TS3A 4Z0TA 4B3DA 1Q0QA 1H94A 1KH2A 3E6AA 4HL6A 5EJGA 4RTLA 4TLMB 5B3AA 2OVBA 4RWZA 3NAMA 2C57A 2PZGA 5FF9A 1PWHA 3R3XA 3I1FA 3V4FA 3SIWA 2LV8A 2A88A 4JC0A 4ZJZA 3VKHA 3PQCA 4DUZB 2Q3BA 3FCYA 5J3JA 4MQEA 1KKMA 2X86A 3L92A 1S9HA 3E7XA 3G8YA 4TRMA 4CEIB 3OG9A 3KU4A 4FHCA 3QQPA 2A1IA 2UXDB 4YXWD 4ZDIA 4GC9A 3NI2A 4NMLA 4I50F 4DNQA 2CDAA 3FDXA 1ZMXA 3U4MA 1M5UA 2ZRNA 3LPDA 4D41A 3AB3A 2VDVE 1XZQA 5FI0B 4UREA 5FJJA 3CZAA 2NU9A 2Q4BA 2RH9B 5EE3A 5HUHA 2GHQA 2JVIA 2PGIA 2DLDA 4Y0NA 1HQDA 1WCIA 2A2ZA 1WSWA 3UCEA 1EUCB 1HORA 2UZ0A 2ZAYA 2C20A 2XBUA 3RRYA 4CF3A 4CKEA 3K6SB 3NFYA 3H87A 2V4ZA 2YV5A 3SHTA 2E1PA 5I7HA 2WB2A 3NHSA 1XZMA 3TD9A 5A9SB 4CCYA 5CXSA 1W47A 1SURA 1T34A 2V4MA 4WAUA 1II9A 1QV7A 4I4TF 2I78A 2GEJA 2N75A 2OCAA 2PR2A 3GP5A 3SIRA 1K7SN 5IK2A 2NAFA 2M9MA 1JF8A 2BKXA 2YWFA 3L0CA 5KEIA 2WIGA 1RI3A 2OHGA 3M2PA 3G8DA 4XD2A 3PVZA 4LV8B 3RRNA 4IILA 5C51B 3UB2A 4RCVA 2B8WA 2GLTA 1QO9A 3RVRA 3UMRA 2G82A 3TOCA 4Z1MA 2Z8YM 5IULC 2LDXA 3I9LA 1TEHA 3IRUA 1IC6A 2EFDB 1CUEA 4Q3DA 5KSPA 2XOEA 1M76A 2RI6A 3LK7A 1CQZA 1T6ZA 5D5QA 1GTMA 2C83A 1TD1A 4FX2A 4ASUD 1NMSA 3IQEA 1FXWA 1N7HA 1OA1A 2QSYA 3OF5A 4HDSB 1IPFA 1FPQA 2P3SA 2F43B 4FWIB 3WGZA 1RI5A 1PLKA 1IHUA 5EOVA 1JQJC 4DC0A 3L1KA 3T7TA 4N76A 1H2FA 1LI7A 2HO4A 4GOND 1ZAKA 1PR2A 1BYIA 2IZ7A 2Z2ZA 4B3JA 1LX7A 1IHDA 5I9SA 2WZDA 2BF4A 4IBOA 1WZIA 2F59A 3FGNA 3UXHA 2B8JA 5BT9A 1K08A 3HWWA 2FLWA 3FWPA 2P9HA 1KJZA 4GM4A 1J9GA 5A3SA 2XXJA 3MB5A 4AF8A 4CKBA 2VEOA 2Y1EA 4E31A 2IZ1A 1GGHA 4RK0A 3GQBB 4QM6A 2PH5A 3NM4A 3UKOA 1FDWA 2C4VA 1TKRA 4E5PA 3ZE8A 4IDOA 3A1NA 1BHSA 1UQRA 1Y1PA 5DGXA 4BIMA 4KSCA 4TXLA 4TPKA 1C8LA 2OHFA 3LD9A 4ML3A 3UUGA 1H3NA 3GLIA 2D7DA 4NJMB 3ES9A 3OJLA 5DX1A 4BWGA 4DIKA 1KFEB 4WHMA 3DO8A 2PSEA 4FZJA 4EJ0A 3LDFA 4V0SA 3IJEB 2IUYA 3AKEA 1UEIA 4PQYA 1VM6A 3ZZUA 2C92A 3GNTA 5HTOA 1NVTA 4MKXA 1RYFA 2YFYA 4PRYA 2D0DA 2H54A 2J6CA 4MMYB 4V0OA 4D3XA 2IYPA 1K06A 4EY4A 4E1AA 4JAVC 4B73A 2RAVA 4LY0A 5CVTA 4GR5A 4LF7B 3NEYA 2Y0DA 4LC1A 1CD5A 1DKLA 5TF4A 4JELA 5DLQC 4BO0A 1WZCA 2HJWA 4Y7DA 1LV7A 4FIDA 4DSOA 5JZMA 3TM5A 1Z8HA 1XDWA 2D8MA 1C9EA 2JCBA 1QH1B 1NIPA 3E9DA 3ORFA 4O2AB 4BJHB 1ETHA 1UBOS 2ASEA 5REQA 3K31A 4S1NA 1S9DA 1WU7A 2DUUA 3CSDA 2O1EA 4YAUA 5K0FA 4HLCA 2J85A 2EV9A 1RWXA 3MLBA 5FOVA 1ZRNA 1OASA 1YR6A 2PA0A 4MYDA 3EA5A 3MQ4A 3OAAA 4DABA 1E2MA 1KI2A 3SPXA 3O8LA 2OHXA 1FZTA 4AMZA 1XYYA 2A9JA 3CA8A 5IC4A 3M4XA 3IKJA 3EULA 1BW9B 4JBWA 1DX4A 2CWDA 5KTNA 3A3PA 4KPUA 2RB4A 1Q50A 1EB8A 3A36A 1VBKA 3MLAA 4ARZA 4C88A 4LWPA 3F3SA 5L6LB 5B37A 1PFWA 1W4CA 2O5RA 3L1UA 2PMDA 3DZKA 4JC8A 4IIDA 4CMIB 5KTKA 2IX3A 2YBDA 5KTYA 4UNNA 4KRFA 2JEZA 1YVRA 2EKLA 3CZPA 1C4OA 4EY3A 4UDNA 1Q21A 1ECJA 5BRNA 2PWAA 4X90A 3ITKA 3KXDA 3Q3CA 4P0PB 1AIPA 3K94A 4RY2A 1ZA2A 2QA5A 3E1KA 3NW9A 2WWYA 1J09A 2B25A 3O8BA 2P4QA 2FZCA 2FHPA 2WJ3A 4RY0A 3T06B 4D44A 5CYFA 4LNAA 1PBTA 3BBLA 4QECA 1JTEA 1JDBB 1Q1ZA 1QIHA 4N5IX 1TM5E 2PUHA 3HFGA 4GGPA 2DOKA 4BO7A 3RQSA 4HBZA 1JEQB 1ECBA 3ZCVA 2FOXA 2G25A 4XIFA 5G0UA 3P7MA 1XEXB 2PAFA 5FUXA 3GP3A 4A36A 3HO6A 1PL0A 1MJ5A 2MYUA 3CEHA 3PDIB 1E1DA 1SU7A 3QFFA 1N5LA 1H5UA 3IUYA 5ARBA 1DWQA 1P3Y1 3EEQA 3RVNA 2PBRA 3SZGA 5HK9A 5HKAA 1TK9A 4UM9D 3Q8MA 5ERYA 2GJ9A 4FHDA 1PR6A 2VYNA 2FSFA 4LZPA 4P4SB 5F21A 2XKKA 2G5GX 2KYRA 2W2OA 1W30A 4JI2B 2ZYWX 3L8MA 4WY8A 3KE8A 4Q4DA 4ZJUA 1M1YA 2FHSA 2WWIA 2E7ZA 3UG6A 3KOMA 1QCDA 3UJDA 4F4UA 1H0RA 1BMFD 3HCCA 3PUIA 4Y6RA 3PEWA 2FEOA 4UUBA 2Y9PB 2MSCB 3RTDA 1OQAA 2R00C 3TRIA 2PT5A 2B1RA 2NZYA 2VUHB 3LUKA 4N5MA 4BHTA 1KY4A 3BILA 1P1JA 2HSZA 1ENOA 1XJQA 5AXCA 5AW1A 1L0BA 3GCGA 1RJGA 3Q2IA 1P39A 3MHPA 5MGBA 4B8YA 2C5BA 5FI1B 3BORA 3BXXA 2EW1A 1U0NA 4R5HA 2Z30A 1H0SA 5AOBA 4J0QA 5EZSA 3N7AA 2G9UA 3ANYB 3GLKA 1ADCA 5KX5A 2QQFA 1QGED 1HFEL 4WKBA 1KOLA 1ZNXA 1GQRA 2BR5A 4HRAA 4J4BA 4Z0NA 3RBZA 4MW0A 4QFCA 4NDNE 3W2EA 3VNUA 4TMYA 4NE9A 3N5KA 3K53A 3GZTB 4DIUA 3KC2A 4W5OA 1XK6A 4LPSA 4DT1A 3AJEA 4JXZA 5LXTF 1E1QD 4GRAA 4N8DA 3QJYA 3C3JA 3SLRA 4DQ0A 5DCLA 2VH2A 1NSTA 4URUR 4JENA 2DPXA 1SM4A 1R74A 4CTNA 1NXPA 5EIXA 3FMVA 4QGHA 1Z0SA 1I3CA 2BHSA 2H59A 4XJXA 3Q88A 1SZDA 2GN9A 3L8YA 3I6BA 4JX9A 1E3DA 4DW8A 1DP4A 4YR7A 2HWKA 3I39X 4TKUA 4Q66C 2FUG6 4R2IA 4M38A 3UWPA 3QEKA 4P92A 4WOCA 1SQ6A 1M2VB 4BEWA 1K98A 5JWHA 3BH7A 2NVBA 4WY2A 1XG5A 2ATXA 3NBXX 4MLZA 2OV3A 1DC5A 3F6CA 4PAMA 4ZYWA 3SZLA 1SHTX 2ZTSA 1U81A 2C5AA 2IY8A 4AN1A 2AD1A 3GVPA 3UMSA 1M1NB 4W7IA 2R7LA 1KS2A 2JDID 4OJTA 4EMTA 4JT8A 1SUAA 2A5LA 4D96A 3KT8A 3MJ4A 5AQ1A 3KU1A 2YNMD 3F3YA 2AN1A 4JA0A 2EX0A 2PZFA 2G72A 1ODJA 1VKZA 1NX9A 4HQKA 3BFVA 5C81A 4ZTBA 3P5BA 2VRCD 1CY4A 2J32A 4Q4JB 1BX1A 4JI1B 5CXXA 4Q4LA 1H1LA 1DAIA 1YMVA 5BMVA 1KK3A 3R3HA 3H97A 3K2EA 3TIVA 1WBJB 1WS6A 4Q7QA 5DCWA 3KKZA 1GLNA 4GPBA 2ZT8A 3ZLBA 1XCPA 1OFVA 4PS0A 1H22A 3G2PA 1TLLA 4RVSA 4DA6A 3WGJA 3VJRA 3ELWA 4QUDA 3I76A 2ORVA 1WSDA 3RCBA 2HV8A 4BVLA 4DR4B 3VU3A 4C0AC 5I7FA 4CWAA 4G65A 1CK4A 4F21A 1NW4A 1F1JA 2QEQA 3ITEA 1D1PA 1JEYB 2C95A 3CRMA 5FRDA 3PXEA 4KR2A 3V9AA 3LKDA 4RAQA 4MV7A 3MMXA 1AO3A 3LUCA 1E1CB 3A2NA 2DUWA 2FUCA 1GCAA 4X93A 1E9CA 3IP8A 1NNSA 4GHWA 5ALQA 1WCIB 3KVOA 3KZCA 5DGCA 3ADCA 1KERA 2J9RA 4B80A 2VKQA 4YMWA 3SYTA 1Z2EA 1ZW6A 5KINB 4PFQA 2X15A 1UINA 3IIMA 3O1HB 1N7IA 4ZZ2A 4AP6A 3KSMA 2RC5A 5JZVA 4CCYB 5JNVA 3IBSA 5BN1A 4RQAA 3JATB 1XXHB 3HMKA 3ROFA 5KYTA 3IR7A 4ZVPA 1Y6ZA 7GPBA 1GP2A 1QE0A 2G5PA 3AEUB 5BQFA 2J07A 2Z56A 4N9QA 4GR9A 5T3YA 4ZANA 3GFGA 1NXVA 2NN3C 3DPSA 3DCJA 3DKKA 1RXWA 1E0JA 1TZBA 3FH0A 4DILA 2P5SA 5JFGA 5E38A 2GXUA 2VK8A 5DX0A 1T91A 5AVSA 3EBOA 3D7KA 5I8PA 4KREA 4H1VA 3KJIA 1EM8B 3EDOA 2OLEA 3HABA 4QGAA 4F6RB 4K03A 4BNMA 4BUCA 3QF4A 1XAHA 2WQ7A 5K8IA 1RC8A 2I55A 4EHHA 1OYOA 5K6AC 5DTIA 5K3SA 3TOSA 3DE3X 1XU7A 1M0TA 2H7VA 2GZAA 1UMDA 1KEUA 2FWBA 4H1TA 1KPIA 4UDXX 1NY6A 1GZ4A 4RUKA 1CZNA 4GLJA 4MYSA 2DH5A 3HR7A 5DIFA 3GFVA 3WL3A 1RP7A 1YRLA 3HBJA 4JI5B 4Y6SA 3GLSA 4EI8A 4Y3UA 3UXMA 2AK2A 5FOXA 4QT4A 3TRKA 3ZJYA 4HDMB 2HI0A 2JW5A 1LLUA 4Z4HA 1IHOA 3DEKA 4YEDA 2HQBA 4WCFA 3AY6A 4DA4A 4JBIA 4AJNA 2W43A 2XYQA 1D1TA 1BA3A 2PFKA 1PT8A 5HJ2A 5GONA 3WRYC 4RBNA 1KFKB 2ZFUA 3TRFA 4HAVA 3JQBC 1OYVA 3NBZC 3TQHA 1SCJA 2DPLA 4EVIA 1YVPA 2Y4OA 2VQ3A 1XZEA 1RACA 1RT9A 1WD7A 2ZSIA 5M2QA 3ZHSA 3BMOB 4RD4A 4RJKA 2F1RA 4NU5A 5DYTA 3MCTA 4ZU1X 1QCYA 3C85A 5JPIA 4R1LA 1KEPA 4YDQA 4UE2A 2CLDX 5AKYA 4MB2A 4QGBA 4JYAB 3CUYA 1TYBE 1UEJA 2H0QA 3TEJA 4PSAA 2XYHA 5F9MA 4ZEOA 3NHUA 4LHZA 4F06A 1LVGA 1BH2A 1ULTA 4A27A 3QYPA 3WHLA 3HO1A 5BO5A 4QOFA 1KR5A 3EEIA 3PA6A 2G4CA 3WV5A 1RAIA 1NKTA 2CZQA 2GTPA 3HEBA 3P9ZA 3WHPA 1YTLA 4RMJA 3DTVA 5C7YA 4DCPA 3SVLA 3ZDQA 3A3NA 5KKCA 2N47A 2QTWB 2MT9A 4MVJI 3UWKA 5JOQA 1HE4A 5ADWA 2GYYA 1ZYUA 1T6NA 4U7FA 1AUQA 3O3MB 2ZE6A 1UT8A 4PCUA 5DIZA 2KLBA 3WYAA 4W5TA 2DMRA 4H7KA 2HKIA 2IC5A 3OX2A 1N8NA 2WA1A 3Q40A 5I4IA 2VATA 4R51A 4G9GA 3VJMA 2IF2A 1L3IA 3N1UA 5REQB 4ZU3A 1DAGA 2FZEA 5IAEA 2JLRA 3P2KA 2HA7A 3IESA 3D81A 2E4AA 1UT5A 4Y0VA 3ZW8A 1AQUA 1HE5A 3BFKA 2PUTA 4EX7A 1Y6GA 2PZLA 4M7OA 1ZC4A 4RIHA 2X4LA 1E59A 1V3VA 2AG6A 2NU7A 2YFQA 3WK7A 4XWYA 3GZ4A 1DFGA 2OT3B 2HZBA 4Y1EA 2OXCA 2W2PA 1I7SB 3NZEA 2EJVA 1WWKA 1CUZA 1Z38A 1FLAA 1KBZA 2C2MA 1MNAA 2HLNA 2IP4A 2PX3A 4NYJQ 3UQYS 3G2JA 1ZK2A 3ZGNA 4BCCA 5LQDA 5EIWA 5CCBA 1N2BA 2QUHA 3GDWA 5KQGA 2RGRA 4PW0A 2H1VA 4MW7A 1LNSA 3HRKA 4RU1A 5KYYB 1C41A 1RWQA 1RJ9A 4ENTA 4CBVA 5BR1A 2DY0A 3HVKA 3QVWA 1D04A 5LZ7A 4WN3A 2BZ0A 3DXZA 4G4GA 1XQYA 4DMUB 2YJ3A 5BSFA 3U44B 3LYHA 2R751 3CKKA 2DWQA 2YQ4A 4GXQA 2IU0A 3BFJA 1WRBA 1NF8A 4JCOA 5IVDA 3DOUA 4X6YA 4YRRA 1YB1A 4LX0A 4XJVA 4Z8XA 5HF9A 1A2KC 2GBIA 2IPOA 4GC5A 3SJAA 4MEJA 3KEQA 1AURA 2H2IA 2N0SA 1JP7A 2B99A 2GWRA 2O2XA 4AWXA 1EUYA 3UJPA 1K0UA 2E49A 4EYGA 4Y9RA 1X7ZA 2QENA 2AX3A 5BUQA 3Q72A 1AE1A 5AWFC 4BMPB 3G3EA 1YULA 2P7IA 4ND8A 1K6JA 3GIWA 1S2DA 4HZIA 4LX8A 2AD5A 3K32A 1GGEA 1G8KA 3G89A 3CWZA 3S29A 3OQVA 1LJ8A 2OQRA 3T1TA 2YOGA 5IANA 3TQOA 2XUJA 3HYNA 2PEZA 3MOSA 3B8EA 3CUVA 2B30A 4DIOA 1O96A 2A9PA 3M1IA 5BNTA 4FR2A 2ZSHA 4WDQA 1OX5A 3DWGA 3H0KA 5LBIA 3TL6A 1VPWA 1B00A 4H9GA 4HH1A 2ZBRA 4E6PA 3VMMA 3BSYA 4PZZA 4G86A 4IXDA 1U1DA 3K09A 4FJ2A 2GN0A 3NOOA 4PC6A 1PL7A 4XAQA 2F8TA 1NA5A 4RABA 5JPCA 2WD7A 3GAFA 3N28A 2XQVA 2ZAIA 2DT8A 2Y1OA 1BG6A 2CLIB 3DE0X 4DQKA 1VPLA 3GL9A 5BOVA 1PS8A 4LBVA 4UCWA 2RGXA 4DLKA 3K6JA 1XLUA 1CVRA 3BB1A 1B0AA 5BQPA 5THKA 4TQAA 1DLJA 1E2EA 2NYAA 2RGDA 4YRNA 3PFKA 1TYAE 4E2FA 5JQGA 1CJCA 1YZHA 3SHFA 3HVUA 4DR7B 4OL9A 4HWPA 4BNUA 4KVGA 3QVUA 1E5TA 2GBFA 5FL3A 2GT1A 2AFHE 2ZJ7A 5U9CA 1A72A 1IB0A 2XMSA 4RAOA 4KIJA 3AGQA 3H4TA 1RMYA 3JASB 4NABA 2PZJA 3O3CA 4NV0A 4ZODA 5CA0B 2WPNA 4NCBA 3DTNA 1GT91 2PJRA 4PRKA 1WOYA 4MKHA 1Q7TA 3NCHA 4X6LA 1LB1B 2HHHB 4V3CA 5HM8A 4TMWA 4FVTA 4DIFA 2P1ZA 3LDGA 3K0FB 3PUWA 4H3SA 2G7ZA 4MV3A 3O3OB 4D9FA 2NTJA 3IAEA 5JNTA 3OX3A 1IN5A 3KR0A 3IR5A 4HXYA 4CL8A 1R00A 3Q0EA 1K6EA 1N92A 3FCXA 2QT0A 1W1UA 1P5HA 1WPQA 3TBHA 1G4HA 2CY0A 4OHOA 1BVHA 2P65A 1RTKA 1XVIA 1HUQA 4L0CA 3HUUA 4X66B 2G17A 1A76A 3H86A 1SOUA 4V03A 4OUKX 1TCAA 2FFQA 4FZ5A 2IDKA 2HJSA 4FFWA 1CJSA 3S0JA 3PGKA 4FD3A 4HDNB 4OJNA 1OMOA 3GNQA 5SICE 3AM5A 4XSVA 1KEEB 1AHHA 4MQ6A 1XQXA 3D2CA 4D6PA 1FDTA 1DGQA 4DCSA 4JQSA 4BP8A 3EY9A 1ZHOA 2J0VA 3IMKA 3S2SA 1IUKA 4EG6A 1U6IA 2FMHA 4KAFA 1M9NA 2CUTA 1SHLA 1L5RA 4EYSA 2D1RA 2W2VA 3I2KA 5E95A 1PGPA 2VTDA 4EO7A 4AULA 1DINA 2RAPA 2LP4Y 3KV3O 1NHWA 2MTBA 1SXHA 2BY4A 3JARB 2D7JA 3ZQKA 1YZGA 1J56A 2DHEA 2RI1A 1JS1X 4HAYA 2ZSFA 4OOEA 4RORA 5DV9A 5BMVB 1YONA 3VZBA 2CEAA 2G0AA 2DKNA 3V7UA 4P6VF 3GEIA 1WZUA 2GKOA 3BL6A 2EL9A 4LSMA 3L1IA 4MVXA 1CY6A 4A2QA 2E5LB 3PVCA 1GCOA 4NS4A 1ADFA 5GPBA 1PR0A 1QBKC 3QI2A 2Q49A 3P94A 1I1OA 4BMSA 3ADDA 1YNOA 3TI9A 2JIPA 2P4EA 4MR8A 1ND5A 1ZC3A 5FUBA 4AMYA 4YO7A 3BT7A 5DTEA 3NMUF 2FQQA 5B3JC 4HHEA 4EABA 1XLWA 1E9FA 1NQAO 4MYRA 3WNBA 1Z56C 3FWYA 1Q11A 1LTQA 2XYPA 5EERA 4UHBA 5AKEA 1GPYA 3AFOA 3SC3A 1R18A 3QX9A 5LD2B 1WR8A 2ODNA 2NZ8A 2VPWA 4MQBA 2O6HA 1T0HB 2QL5A 3C3YA 3R09A 4OMFG 4P83A 3K2BA 1OWNA 4YT8A 2QTCA 2TRSB 4R4JA 3K8ZA 5FD8A 2RCYA 4JGBA 5FA5A 3A7EA 1ZD5A 5FKJA 2PKQP 3T5CA 2WC1A 1CR0A 1SK9A 2JLVA 4FFNA 2J7PA 1ISSA 3E3LA 4PYOA 1IZ8A 3CURA 4ED9A 2FPIA 3Q41A 5SZIA 4I3FA 4GG1A 2F3UA 4D9HA 4F85A 2WYIA 5KVVA 5F9FA 1XAIA 3LX5A 2VP5A 3ICVA 3MJHA 1FJ2A 4WN9B 3UK0A 3PYLA 4GZLA 5A1TA 4KP7A 3GLTA 1A2QA 1JQ3A 5FJIA 2G28A 4D4HA 1AMUA 3GDGA 1UDCA 1CLUA 3K1TA 3QY0A 4CCWA 2Q0XA 2PLAA 5L3SA 4X3OA 1DKNA 3Q7PA 4FS3A 1WUYA 3RBXA 4Z4IA 1UMDB 3O9ZA 1JIQA 1UP4A 1IHYA 3PG5A 1VIAA 3W8EA 1LF5A 4EI7A 4B3SB 2OA0A 1P9WA 1GRNA 2FG6C 3T9AA 3WP1B 1YQXA 2HMAA 3IMFA 2D1SA 2XMBA 3FAZA 4H08A 4HZGA 4RFLA 5IMSA 2ZE5A 4Z3OA 2FRVA 2NSDA 3I9MA 4QPJC 3IB3A 3W6OA 1O4WA 1IXSB 2BL4A 5KNDA 1ZBQA 2ZR8A 4IIJF 4BWFB 4DNFA 2VIIA 3MS2A 4S2EA 3AI3A 4Y2TA 1IYZA 1Z0FA 2W6NA 1P91A 4FP9A 1MAUA 2OFOA 5KSOA 5TLSA 2X40A 4EA8A 5HHTA 3OI7A 3L1VA 4NYMQ 3C8UA 1TF2A 2Y6UA 4OHKA 3K9WA 4TMKA 4U4AA 1FP2A 1FTYA 3JQ7B 5TS3A 4DR5B 3CT4A 1FS4A 5E9QA 4YRJA 2XVXA 1B8OA 3WB9A 2OGWA 2OGZA 4HEQA 5JAMA 5CB6A 2JLCA 3WBFA 4YJ2B 5TVKA 1LLCA 2QRNA 2W58A 3QPVA 3V6MA 4LOIA 1QYDA 3SKVA 2B69A 3LKBA 2P90A 4POAA 4AFNA 3P20A 5JI3E 4CKWA 3D8TA 3RPEA 4B7ZA 1IATA 1R8SA 2HM7A 3FUVA 4JVNA 1K7CA 1Q0TA 4BPBA 4G0XA 5EXPA 4LJ7A 3RC2A 2D5AA 2WI8A 1CIJA 1J8QA 3ENZA 2VJKA 2VJQA 3ACDA 3FA2A 5KMGA 2ES4A 4DSUA 3CVUA 3QUCA 1WEKA 3MVEA 4A8HA 5C1IA 4D9KA 3IA2A 3LBYA 1DBIA 3NIGB 3U7QB 5BSHA 4OBEA 3TEFA 3TCKA 2YTZA 3ZWMA 4IKPA 5ITZA 3OLZA 1Z4MA 2C5SA 3ZHCA 3LQKA 4GH5A 5FA8A 3X44A 1A71A 4CR8A 4MP8A 5AKIA 4CIAA 1V4BA 4LV5B 2OESA 3RTAA 4QU0A 1DC4A 4EA9A 4BLTA 1BN7A 1YIOA 4OYLA 3CPEA 1N2ZA 3OZUA 4D0NA 4KOAA 1NI5A 2GD2A 3JTEA 1VI5A 1Y1TA 1RR6A 4L9RA 2AOTB 5EE5B 2CFCA 3UF0A 1XMQB 2AOXA 1E3EA 1JUDA 3EXEB 5DNUA 4KFCA 1GQFA 2H1WA 3KYDB 1T0IA 2W2KB 4N3AA 5HIJA 3VFDA 1NUAA 1MXHA 3BRQA 4UBLA 3ECAA 4WBXC 1T4DA 3F67A 4BNNA 1H0KA 2JLXA 2L82A 2OOKA 5TSDA 5CAEB 1QG0A 2X77A 1I3NA 1IZ0A 2EEZA 4Q93A 1XTJA 4Z8YA 2XA1A 3VU0A 5CFZA 1JKJA 1N8TA 2HXYA 4OQPA 3R7BA 2WPDA 4AZSA 4ECEA 3NXSA 4DV5B 4OHBA 1U7WA 2PS1A 4BMOB 4ZO9A 4DZTA 3OPNA 4DSZA 1F3LA 1QPZA 1M7HA 4WXPA 3BXFA 3N53A 3TF5A 3S2YA 4TQUS 2O50A 1PS0A 3ZIAD 1SQSA 4PQRA 3AFHA 3EGDA 3ZYCA 3BHJA 4F91B 3QGMA 3TTWA 1GGKA 1FK8A 4ZZ1A 3CN9A 1D0VA 4K28A 1B73A 2B8TA 4Q24A 3GFRA 4EPRA 3W8NA 1U3VA 1BVRA 3NP9A 3F8WA 4M8IA 3IQZA 4LVNA 1YJ5A 4N6OA 5EXSA 1T35A 3K20A 2R0QC 4E11A 1XZFA 3AL0C 5KQLA 1G8SA 3JQEA 1XRJA 2VTBB 2MSDB 2GZ3A 5KHOC 1WZEA 2D4HA 3MB8A 2YASA 3UPDA 3T15A 2OVFA 3I34X 1ZVQA 2P91A 3QNUA 3V9PA 3O8NA 3IPCA 3WMRA 5IZCC 4I99A 3UNXA 1XMIA 2OC9A 5JWRA 5K0CA 2V3CC 1W0JD 3KYIB 2WSLA 2BM1A 1V3QE 3NNSA 4RXMA 1XTBA 1X7GA 1N9KA 1KYIA 1W5SA 3U4DA 1H85A 1PD0A 1VKOA 2BGTA 4MIYA 2Q99A 4C3VA 4TVOA 3H4MA 2K2QB 1P61B 3IO5A 3CX6A 3OBIA 4LGCA 4MVJF 4OF4A 1T5IA 3UV3A 1MW8X 1JXMA 1GTSA 4JP8A 3DL2A 5BYJA 1SULA 2XAAA 1IY2A 4PAWA 3HY6A 4HQ6A 3UMGA 3D64A 3LVFO 2IKQA 3SCZA 2W11A 1DEOA 1U9JA 3A4VA 4PLTA 4ROTA 4RMNA 3W04A 4EI2A 2IEYA 5JZSA 3PNSA 1ISHA 3OIFA 3AFNA 5LM3A 3EWIA 3P71T 1MO2A 4GX0A 1EIZA 1VLQA 3T4PA 4M21A 5B7PA 5J2TB 3ZJ5A 5K0JA 4FBLA 1FBNA 1O7JA 8GPBA 4U7DA 2E85A 2I2XB 1QFYA 2QI9F 1JYSA 2ZIWB 2C78A 4G0ZA 2REOA 1ZMOA 3FPJA 2EDCA 2QMEA 4UHJA 5TJ9A 2K6GA 5DT9A 4KL8S 3C3PA 5JQGB 3WO0A 1SU8A 4P58A 3QVMA 4RACA 3LU1A 3MCAA 2XWJI 4GPTA 4NJEB 5EKUA 2BC9A 1D7OA 1EVIA 1G20E 1MX1A 2VT3A 1T2NA 5JAHA 3A05A 3ZXUB 1T1JA 3HRHA 4EENA 5LR6A 4RE5A 4L8YA 1HT2E 3LWNA 1KJJA 4QD3A 3M3HA 3CIOA 4LW8A 3KQHA 2OZPA 2EU8A 5EKTA 2Z83A 1DRKA 1K88A 3IL2A 1A04A 3LPMA 4DWJA 5HM6A 4YRTA 1PG2A 1QIFA 4E88A 3BRWA 5FWYA 5K0ZA 3GHHA 4ZI7B 3TXXA 2QW1A 4XUCA 4GYKA 1GPH1 1UFKA 4IZ6A 5DTQA 5CVUA 2WD8A 3R7DA 3WWZA 3ZCPA 4C6RA 3KXKA 3OU2A 5D7BA 3GGPA 3HSKA 4J1QA 2B6HA 4M76B 2WF7A 2ZVQX 3HKCB 4JN6B 3FNHA 1G8FA 5F4BA 2WAYA 1EVLA 2WUDA 3A4YA 3BULA 1HLDA 3FPEA 3PFIA 3COSA 4PG7A 1YRYE 3HCBA 4ZAZA 5IHPA 3QHQA 2Q1WA 2CJFA 2OK8A 1U2EA 3RIXA 2C54A 4PBTA 1JHYA 6YASA 3SVTA 1SXJC 2GNOA 4ZCSA 1PGOA 2E4XA 4PF1A 1FZQA 3QUSA 2R84A 4D8YA 3S2GA 1UWCA 2QTZA 1Y9ZA 2XF2A 3HY3A 3NIBA 3QITA 4RVCA 2FPUA 4MDEA 2IITA 1GSIA 2PUVA 1GDDA 4X1OA 5CDFE 3QA3E 2OKCA 2O2YA 4WZBE 5MDHA 2GLUA 1ISRA 3OC6A 2BWJA 2NG1A 5AW0A 1RRGA 3DAOA 3HN6A 3IPRA 2HDOA 2BFBB 3MXOA 4LE1A 5A4IS 3ND8A 4U7PB 2GF2A 2ZSKA 3M6XA 4R2HA 2J4FA 1M8PA 4P3NA 2CLHB 3CF2A 4ZT5A 1W5TA 4DPMA 3T3HA 2QVXX 3ZWKA 4YMHA 1JKFA 1FRFS 5LSAA 5HCUA 2PZ8A 2YS7A 3MA0A 3FWKA 3OQJA 3SS8A 4Q5IA 1J2TA 3UTDA 3H05A 3QKTA 2QUIA 3BWCA 3TIGA 2HW8A 3ECSA 1VE3A 5DNVA 4QPNA 3W1WA 4YAWA 3AJ8A 3DZCA 2G0NA 3D6FA 3ZNPA 4RSHA 3L7CA 2XOXA 2RD2A 1PI3A 4L3OA 4DUYB 2PMCA 3EIWA 3AU8A 1ADJA 4MGKR 1NI4B 3A06A 5F98A 1A98A 2B1QA 1YZYA 1NKSA 3QLTA 4MGZR 5KNCA 3B52X 3U2QA 3DG9A 2JATA 3UJ8A 1J7KA 4JJEA 4I50B 3Q85A 5F35A 4B7CA 2G5CA 4HWOA 3RNOA 3HP1A 3EVEA 2CB9A 3ABIA 4QASA 4RSGA 5JXHA 1D8TA 3ZU6A 3PPYA 5IF9A 3RSFA 1Q22A 1NHGA 2PSSA 1LPPA 1BU8A 2NSJA 1Z4NA 2P67A 3BHNA 4Q1DA 3WLFA 1Y9AA 1PHRA 1YDGA 2I7VA 2V7PA 4QA9A 4AYWA 3RTCA 3U7RA 2CSXA 4UPEA 3G2IA 1KO5A 1FU4A 2FX2A 4MV6A 2BTQA 2VG8A 2O59A 3PXBA 1RKUA 1R9NA 3LNCA 4MWOA 1MTOA 4C01A 1V8OA 5JJBA 2O8VA 2C7VA 4MPDA 5CB8A 3UBTA 5DLYA 3DPIA 3NH6A 1LS1A 1Q2XA 1RXEA 3IAAA 4J76A 1XX6A 5EJAA 4MS1A 4O29A 4EB6A 1EBUA 3O7MA 4K6KA 4MH0R 4RPLA 4I4TB 1J0DA 1QJ4A 5IUNC 2CZGA 1E4YA 3KTOA 3D43A 4R9RA 1LDYA 1GAEO 1T3HA 3E0XA 3LT4A 4PG5A 4E4YA 3A1WA 3L49A 4CLEA 1TL7C 3WHIA 5KNDH 5K20A 5MHTA 2FYTA 2VAVA 3MCZA 3VTKA 3DLBA 3AOEA 2Y8EA 3AHIA 3O0TA 3VNVA 2XJ4A 1D6MA 4NK4A 2MYPA 1Z3IX 2VKTA 1NYRA 2AFHA 1OGYA 1FJHA 2GAAA 5G41A 4B5LA 4H59A 3WBKA 1OWLA 2JLZA 2XZTA 4HS4A 3EIUA 5DP2A 3U4CA 4P82A 5B36A 3GA7A 2V9PA 1C1YA 3DEZA 4G07A 5A3VA 1WVIA 3ZS8A 4F9EA 1B2LA 1Y5RA 5KAMA 3IAHA 1T1IA 5IAAA 1DX6A 2JD2A 4P31A 5E8JA 4OJMX 4DDTA 5LDGA 4L72A 1BMDA 6AT1A 1E2BA 4O5AA 1Z22A 4UEWA 1NXWA 1RM5A 3ZY2A 3KL2A 1FJGB 4B87A 2AOUA 5E7IA 1NR5A 4JD5A 4RF3A 1UPUA 1KMQA 1Y4SA 2JA2A 4HB2A 4IMRA 2XTJA 3K92A 3FB1A 2PBFA 1E9DA 2ZB7A 5SYNA 4BMDA 3AR5A 1YQGA 1XDSA 5T8KA 4CKWB 4I6EA 4CI0B 4ZT7A 2NYVA 4ZCMA 4Q48A 1QX4A 1NY5A 4BKRA 5CA1F 3U3JA 5KMGB 2BFNA 4A73A 3L43A 4O2BA 4CLDA 3LFUA 3DBLA 3W6UA 2QUAA 5K3OA 3PRYA 3KXLA 1NZFA 4PO8A 5EUBA 2HNKA 4HV4A 4RD3A 1Y0BA 1YI8A 3JQCA 1U1GA 1HQYE 2D2EA 1XEWY 3G5MA 2IJGX 5FA6A 1G6HA 1FRVA 2NT3A 4Q7LA 3KZMA 3HBLA 7REQB 2W6JD 1HM5A 2RFLA 2WOJA 1W5FA 4NHEA 1JG6A 1NW8A 4YWJA 3VNAA 4BTEA 2Y67A 2FW9A 4QDXA 1OGIA 1ZD3A 2F48A 5M04A 4C0QC 2H8KA 2BM0A 4QUHA 1NXTA 4B2PA 4YAGA 1ISMA 1JMYA 2FVXA 2GCNA 2QTAA 3E7WA 4KGDA 1TKCA 2V8OA 4EHBA 1AT1A 4KQ6A 2GVZC 4OLHA 1HEIA 2EBHX 4J2TA 4M0LA 2COKA 2QAGC 2I3AA 1UM9A 5C1OA 1A7JA 1H2ZA 3OZWA 5BQOA 3R9IA 2C2KA 2D00A 3IVGA 3OIVA 3VGPA 3KWJA 2QAJA 1LC0A 3TQQA 2JZNA 2OZLB 3PXCX 4C22A 2JAPA 1IEWA 2HIAA 3E9CA 4PSUA 2W70A 4PXSA 2ZJZA 3EGIA 4LI0A 5BWOA 1DOHA 1U0OC 1VLLA 2GD1O 2YWHA 2O5VA 4D5EA 4OBWA 3EAQA 2NSYA 4GI7A 7YASA 1DELA 5FIUA 1VMIA 1II8B 4PVDA 3KOYA 2JIMA 2Z2JA 4KWTA 4YJ3A 3SQMA 4F71A 3LLCA 3KR2A 2NSHA 3LL4A 4M46A 5EEGA 4BZPA 1U8XX 2OKGA 3KTDA 4UU8A 2WP8J 1RYYA 4YP9A 1XMJA 2WJPA 3OCXA 1EFHA 4KKVA 3A1SA 4BLRA 4HI0E 1NVVR 1F48A 5FOQA 1IZZA 4ITRC 1KFCB 2VS1A 4E5NA 1R4MA 1MH1A 4RTRA 1W88B 1NATA 4OAQA 1NQUA 2HMWA 4GUAA 1OD6A 3UT5B 1OZFA 4BP1A 4Q37A 4UHCA 1D2AA 4G4IA 3EPPA 1ZI9A 3WNQA 3OPYI 2ZTVA 4GM0A 1AUXA 4KPGA 3JX9A 3LF2A 2IYNA 1OVGA 4ZVOA 1QFJA 4I46A 2FP3A 4Q9KA 3EDRA 2OECA 2AW5A 1W4BA 1NP6A 3MCUA 3ZBTA 2HXGA 1C9NA 2ZPUA 1I2AA 3NYQA 3AETB 3ZWOA 3ZQ6A 3C3KA 3C8DA 3RS9A 4U0JA 3OZCA 2P9BA 4M83A 1QHNA 3OM0A 1TDJA 2PYDA 5PNTA 4X1YB 2Q5EA 4PLFA 4IXWA 4BNDA 1SJ9A 2B0CA 4EKGA 1J1IA 4JHXA 4XH9B 3UFXA 3G7NA 3MINA 4GOOD 1JG4A 3HA3A 5LA6A 4F5ZA 5LZ9A 3ER9A 1FDVA 4KU4A 4EVQA 1EFPA 3LT1A 1FY2A 1HE8B 1US8A 1V35A 4WI1A 3DHNA 3ND9A 4FCVA 4ARCA 3ECCA 3ELBA 4B33A 4WOJA 3ZZTA 4R6XA 1KTIA 3B85A 1HYQA 4IMPA 1B23P 4BLQA 3HU1A 4GXNA 1OBFO 1S0UA 3LTEA 4WXMA 4LVOA 3ZQJA 1ZH2A 1VE9A 1E92A 4R7GA 3NHJA 1T9GR 5JQWA 3A37A 4Z5XA 1NXSA 3T52A 3GUZA 4ITUA 4P2GA 4YXWA 1JVBA 2WHPA 4H4DA 5CDUA 1IH8A 3USES 4IVNA 2J9FA 2YFKA 4J16C 3ZJVA 4J9UE 1V8DA 3IQXA 1OFUA 2HR1A 4QARA 4XOIA 4X41A 4MNTA 1F51E 2VOEA 3F7NA 2GYUA 2LVBA 1Q3TA 5DHSA 1JEEA 4XQ9A 2BDTA 5EWJA 2I6FA 2B3TA 4XVRA 4RELA 5TGZA 1QLJA 1ATIA 3R6WA 3NOVA 2PUCA 1T5SA 1DRWA 2IWHA 2IPLA 2G1AA 2VP0A 5IN5A 4J43A 1S4MA 3TG8A 4MLPA 4E7OA 4MICA 2DG2A 2WHRA 3P0HA 5HE8A 2JFPA 3PNMA 1JLKA 3GT7A 2AE1A 2ID9A 4IX1A 4QYIA 4RGYA 4JU8A 4Y9UA 1P81A 3BMQA 1RI4A 1PK9A 3OWOA 2R60A 2IOHA 1ATZA 3WY9A 5TQ2B 5LWQA 1CJBA 3KQWA 2QNBA 1JEJA 3IMCA 2AEMA 2IYVA 5CXUA 2ZU6A 1YT5A 4PSKA 1GNTA 2QMUA 2YN2A 3MJCA 4XB1A 5A4KA 2GUGA 5LXTB 3DV0A 3Q87B 2DVMA 3IX7A 1T9BA 4XJSA 1AN9A 3IUBA 2MJLA 5KNLA 1Y3IA 5EEHA 1PWZA 2YVQA 4JCCA 1EDDA 1IVSA 1Q3KA 1QCCA 1E4OA 3LUDA 721PA 3GPCA 1GKIA 1ZGZA 3KPYA 3T35A 1JLMA 4R05A 4P3XA 4JXXA 1I80A 4NBSA 1RWVA 3TW4A 3A6JA 3R9XA 4GKJB 1BKDR 4QOGA 1GXSA 1SUSA 3KYCA 3NWBA 4A91A 3QVLA 1I24A 1HL7A 1UKBA 2FMIA 3OFNA 2A84A 5B58C 4LPKA 4JR1A 2IHVA 1JIUA 4LRTB 2M2IA 2Q5FA 3AUSA 3PSAA 4BGDA 4CXMA 4W1QA 3PENA 4W5HA 3NTVA 2CN1A 1T2DA 3CRRA 3EPKA 2WQ6A 1ZFNA 3H5WA 3WIBA 3FTDA 4D43A 1QDEA 1QQ6A 4NBUA 3HZZA 2O57A 4QOSA 2O2GA 4Q19A 4EFNA 2XCTB 3OTOB 1XV5A 1AQLA 2XMQA 2OR3A 3DMYA 4HQOA 4J7AA 4B43A 3RE1A 3OKPA 3U61B 4AWBA 3L0SA 1I3OA 3P19A 3LUJA 4MGEA 3WG9A 1G291 4NU0A 1Q1BA 1FBTA 1Q20A 3SYKA 1P8AA 1T5BA 4W9NA 4X7MA 5J9FA 3O1JC 2QRZA 2PVPA 4J0HA 1XDUA 3OZSA 2C2GA 3BMNA 3BA6A 4I0WB 1OTHA 2QIOA 5FADA 5LQSA 1GPLA 4OX9B 3A2KA 1HYBA 2X0NA 3CNEA 4HWRA 3SFZA 4Q82A 4ALIA 4BIIA 1E1MA 2O0HA 4RCZA 4CM4B 4LHYA 4P38A 1EB9A 2ZRQA 1ZU5A 3KLNA 2VUTA 3N39C 3TIIA 2WT8A 3L8CA 1BHJA 3V48A 4WVFA 1WB6A 1MFPA 4XXHA 1M83A 1V3UA 2CE2X 4KODA 4D9IA 1EGMB 1N4DA 3G8AA 4WMLA 4ZU6X 4CIBA 2OPHA 3NRBA 3N8HA 4C7MA 1HY3A 4CF5A 5LN1A 4Z4GA 1L5KA 2W8BA 3WQSB 1ES9A 3REQA 1MEJA 2C5GA 3N2IA 1RAEA 4JR0A 4I4LA 3V8NA 4EY5A 1Z6XA 3L8FA 5FPSA 1YZUA 2X0KA 4OHWA 1QV6A 1CIVA 1UMBA 1I6LA 1U1IA 3V4RA 2GCOB 1ZESA 4TKZA 5JH7F 3JQ6A 5EGSA 1CTQA 2JLQA 3AKCA 4PO9A 5EJFA 4B40A 2GASA 3BIJA 3E22A 4EHKA 3D8SA 1DE0A 4IYRA 5B2FA 3S2EA 3EUFA 1G20A 2DTEA 3JXEA 3PQDA 4Q9NA 2NUPA 2H0RA 2O07A 4XUGB 5L95A 2YYAA 3M6MD 1JA9A 3RFCA 1HZJA 4TVSA 4HNSA 4W1RA 1GAQA 2MYTA 2E5WA 3PHGA 4NY1A 1K89A 1DQNA 3MW8A 4AJ4A 3S8EA 1DT5A 2H1IA 1OXKB 2RJNA 4KWCA 1S1CA 4X8HA 4YCAA 5AI9A 4LWOA 1LSUA 2DT5A 2VDRB 4AT1A 5CIYA 2NU6A 5HW0A 2ORYA 3LY5A 3AHEA 4XVUA 3UT0A 1FNDA 3WGOA 3EYAA 1X1QA 3UAVA 2HF9A 4RJTA 1XVLA 3QLVA 4Y6PA 1Q6ZA 2ILVA 1E8NA 2C8KA 2AOUB 3G9ZA 4RDIA 1U9CA 3ILVA 4IIJA 4ZO6A 1H6AA 2J33A 2RGGA 2V3WA 3AC0A 4MP3A 1GZDA 5CEJA 1PGNA 3UMJA 2EX4A 2OCDA 1NNLA 4V39A 3ZDEA 2C1XA 1ZDMA 2CNLA 3NV7A 3K15A 3OZAA 3MTAA 4G8JA 5BWLA 3DKRA 3HG7A 3KLPX 4LA4A 2Q5QA 2PQMA 1VYHA 3LSYA 4GPIB 4A2PA 2JJ2D 3F4BA 2J3MA 5E3JA 2C0CA 4DMGA 4HN4B 2JEYA 4QUAA 3WGKA 1SKBA 1SHJA 3WXBA 2B4QA 4R9NA 1S2OA 4I1UA 3F46A 1EBFA 3P0IA 2CJWB 3D8NA 2Y1FA 3KHKA 2H18A 3R0VA 2J9ZB 3F3KA 3C3BA 4JVLA 5IVIA 5CDFA 3RQIA 4Q47A 1DUIA 7ABPA 4RVOA 2LWIA 3IERA 4IV8A 1ZMRA 4WZBA 4O4IA 4Q02A 3SFTA 4D4MA 1XVUA 1EXWA 1WCXA 4MR9B 1EI9A 3QWIA 5AW8A 2FPMA 3GN1A 2V74B 3IVAA 4II7A 1PDWA 2AWNA 2ECOA 2C4MA 3WMWA 3L01A 2AHRA 1USUA 3DDZX 3O90A 1SXIA 4ZKDA 5IX8A 2W6CX 3UXEA 2JI8A 2YHAA 1SVKA 3I42A 4D45A 3RKUA 3RVSA 2E89A 2RGNC 2G76A 5ITZB 3LZDA 2IH2A 1V1MA 2GJSA 4JB0A 1XEFA 2J0UB 1BMFA 2IHTA 3GEEA 1QBGA 5JDIC 3H5NA 2Q7XA 1CDDA 2IU6A 1MC5A 3GOHA 2E87A 4ON9A 1GKUB 3NU1A 5KTMA 5KPJA 2QX6A 3C1TA 1AKVA 4RA6B 1E3LA 1TJ5A 3VPSA 4R0VA 2HRDA 1PV1A 2F8LA 2XTZA 1P4AA 3NEAA 5HJ5A 3CB4A 2NV6A 1U8YA 4V1CB 4KKXB 2FN8A 521PA 2CDBA 2VQ6A 2BGJA 1M1ZA 3N6XA 2GAJA 3KZOA 3H5RA 4KN9S 2FFBA 1NJ8A 1U2DA 2MMGA 2WAOA 3BWMA 3ET4A 1WZNA 3H13A 1N8SA 3OLYA 3G49A 4CKZA 2FUG1 4O02B 2WU1A 3ST7A 2NVWA 1CZRA 3N8DA 3X2FA 3DE7X 4J0CA 2ADFA 2ODEA 3DQQA 1FDIA 2FDXA 4O0MA 5G0VA 4P5DA 4V0QA 5B4VA 3QPUA 1YFJA 2RAFA 3ABZA 3WDLA 1LTHR 1JEAA 1KI1A 1IIRA 1KVRA 3IPAA 3OE4A 2ZP1A 5C34B 3ZKWB 1YCGA 1E1QA 4BLVA 4BVEA 5KYKA 3NVAA 3CTMA 3P27A 4NLLA 1FRQA 3LCUA 5EGNA 4E0BA 3RYHB 3N0TA 3AEKB 3KKEA 4OQFA 4DB2A 4P3KA 1QQBA 1P44A 4IFEA 5AQEA 2DM6A 4A6DA 4CKYA 1WDMA 1XJ0A 3DYIA 4KQXA 4EIWA 2MHCA 4QEZA 4JLWA 4UFOA 1Z0UA 2JIQA 3HI6A 2H5IA 2C2HA 3B7PA 3OE5A 4NMXB 4DA0A 1JFTA 4IEIA 3R7NA 4RQBA 3NBFA 3PIDA 2RBEA 4BN5A 2D3WA 4DVJA 9MHTA 3T34A 1YR3A 4CFSA 3EVBA 4LFAB 4XD7D 2CK3A 3B78A 1TCCA 3CVOA 2HGSA 4BNDB 1FE8A 2GBLA 1JBQA 1KE2A 5I47A 2YNMA 2TECE 3PX2A 5A4JA 1DVRA 1Z45A 3R6DA 3WYEA 1RLJA 4KLRA 1RPZA 2PVSA 4E14A 2VRCA 2QRLA 4ZEXA 3T3DA 2C31A 5J1TB 3QW2A 1WVMA 1GA6A 4XUDA 1KJIA 3DP7A 4MVJA 1LI5A 3WNZA 4PZ9A 1PJ8A 1STOA