1EFPB

Electron transfer flavoprotein (etf) from paracoccus denitrificans
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVDELVGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
publication title Crystal structure of Paracoccus denitrificans electron transfer flavoprotein: structural and electrostatic analysis of a conserved flavin binding domain.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 71
structure length 246
sequence length 246
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1efpB00
1YULA 4XFJA 1XNHA 1T6YA 1EUQA 1NUQA 3G59A 3TQIA 1EE1A 1N2OA 3Q10A 2V0CA 4OJMX 5J58A 3CVWA 1N3LA 3UC5A 5LFAA 3PNBA 1N77A 3IODA 1LI7A 3HMQA 4ZCRA 4EFKA 1I6LA 3TNJA 1TYAE 1ULHA 2IJGX 1TFUA 4KPUA 1J09A 3FHJA 1EFVA 3RBAA 1T9GS 2WB2A 1QRUA 1NYLA 2BTEA 1O0CA 3P52A 2DERA 1QRSA 1G8GA 5DK4A 2A1TR 4Q16A 1FYDA 2J08A 1X6VA 4NZPA 4A91A 1F9AA 2NSYA 5HUHA 3CVYA 5DB4A 1QQTA 1J20A 2J4DA 3Q12A 4HK4A 3AFHA 4JFAA 3N05A 1Y42X 3CLRC 3K9WA 2BYTA 1EUYA 1WJGA 3CLUC 1OWLA 4MULA 1MC1A 4BWVA 2QJOA 2YXNA 3AG6A 3ZXSA 3K32A 1N75A 4YP5A 3CLRD 1TQ8A 3MUEA 1N2EA 2CYAA 4TS1A 2O8VA 3CLUD 4ZT7A 1O94C 4MUHA 4EF6A 4QREA 1U7DA 4EGAA 4ZT4A 4MWBA 1WXHA 3ISJA 4GRIA 1ZJWA 1SURA 3HL4A 1FFYA 1QU2A 1O94D 1WQ3A 2NZ2A 3DPIA 2CFOA 2E21A 1JZSA 1MB9A 1WXEA 1VBNA 4EG3A 1NUUA 3MXTA 1ZH6A 1DNPA 5K0TA 3INNA 4DDHA 2QUKA 3H05A 3CLTC 2CYCA 1NUPA 4MAFA 4CQNA 1PFYA 5HG0A 3ZXIA 2JA2A 3D6UA 4OUDA 3CA8A 1EFVB 1MAUA 1IQRA 4MWEA 2PIDA 2QTMA 4MVYA 1UFVA 4YP7A 4DDMA 3G6KA 2DLCX 4CT0A 1I2DA 4DNXA 1N2JA 1PG0A 1NZJA 1TYCA 1OBHA 1MAWA 4ZT6A 3GUZA 4MQ6A 3UY4A 3IMEA 2TS1A 2HGZA 1IFXA 1T6XA 4YP6A 1JILA 1YIDA 1OD6A 1HYBA 3A04A 5JBNA 2A84A 3ZJVA 4JZYA 5F23A 4L2IA 1NURA 4MUEA 4MW6A 3ZUGA 3CVVA 1O95C 1O0BA 1N1DA 1K4KA 3KT6A 2J5BA 3G5AA 2V0GA 1M8PA 3H9BA 3RFFA 1X8XA 1O95D 4HPWA 3JXEA 2X1LA 1I6KA 2DEUA 3AL0C 2AZXA 2GM3A 1CT9A 2J07A 3PXUA 2JAXA 1Q11A 4MW0A 1U0BB 5LM3A 1M1ZA 3H99A 1KAMA 3SZ3A 4EG4A 1R6UA 1P7PA 1G8HA 2A1UA 3H9CA 3A4IA 4FZJA 1U3DA 4ZT2A 3ND5A 4MLPA 3FH0A 1IH8A 4G5FA 2DXIA 4MVXA 1H3FA 1OWNA 3L93A 2ZUFA 1O97C 4OUDB 4MWDA 1TYBE 3PNYA 4J75A 1WZ2A 1O97D 3UOWA 1JEEA 3OP1A 1PG2A 4R0NA 2DR2A 3RK1A 5IJXA 4DDKA 3FETA 5H7XA 1R6TA 1T9GR 4KR7A 1A8HA 1G59A 2D13A 2YWCA 4AS1A 4NAUA 1V8FA 3MLBA 1B6TA 1Q19A 5FNZA 1QTQA 1NP7A 4ARCA 1KQNA 4L2IB 4MUJA 1VBKA 1JECA 1GN8A 3KFLA 2QUHA 3P0JA 4R2MA 1JMVA 1ZH0A 1KR2A 4DLPA 4G5YA 3RJZA 1N2IA 1Q77A 1O96B 4JXXA 3COZA 3N9IA 1XNGA 3MMXA 4YBRA 3FG9A 3UK2A 3ND7A 3COWA 5AHWA 2VTBA 5KWVA 2C5SA 1R6XA 1PFUA 3GMIA 2A1TS 3HGMA 3VGJA 2A88A 1YUMA 2QJFA 3AG5A 1TEZA 1J21A 2CV1A 1J70A 1MBZA 1PFVA 4EG8A 3IUEA 3SYTA 1K97A 3LCJA 2A1UB 2Z08A 3SP1A 5J59A 3X1MA 3KT0A 4U8HA 4UZFA 2H2AA 2ZP1A 4WNYA 1KAQA 1WY5A 3FOCA 5TS2A 4JYZA 4KR6A 1GAXA 1M8KA 1GPMA 1JIIA 1QJCA 1XNJA 3ILVA 1TYDE 1M8JA 5IHXA 1M8GA 2QJTA 3LE8A 3KT3A 5BNZA 2RD2A 3F3MA 4KKVA 2J09A 3DO8A 1MJHA 4U63A 1VL2A 5H16A 3COVA 1OWPA 2XRYA 3IOBA 4H3SA 4Q93A 3U1VA 4ZCTA 1GTRA 2PG3A 3P0IA 1U7XA 3CLTD 2WQ6A 4HJXA 3IDFA 4J76A 2HMAA 1COZA 4PBSA 1M8FA 1EJ2A 2A4MA 4MW1A 5TEVA 4K03A 1XJQA 4MW4A 1JIJA 4MUNA 2O5RA 3FIUA 3X1JA 2Z3VA 4EG6A 1N78A 2DPLA 3AKZA 4ZT5A 3VRHA 3LOQA 3PNVA 4ZCSA 5EKDA 1NUSA 1WXFA 2YWBA 1YUNA 1G8FA 2HZ7A 2H29A 1U3CA 2B7LA 1IRXA 2VTBB 3L92A 3RHSA 1WXIA 3N2YA 4MW5A 5KHAA 1WKBA 5TGTA 4NX2A 1KKUA 5DEOA 1WOYA 1O96A 4ZCQA 1K4MA 1PFWA 1KH2A 2G36A 3NBKA 2OQ2A 3SEQA 4MUFA 4ARIA 3COYA 3ZIUA 4MW9A 3QTTA 2PZ8A 1MB2A 1OWOA 2X3FA 3IUBA 3PRHA 1KQOA 1M83A 1ILEA 3TS1A 4F4HA 2Z09A 4MUGA 2QUIA 4PBTA 3IOCA 4EG7A 2RE8A 3IMGA 4CDMA 2IELA 3SZGA 1MRZA 2A86A 2DUMA 1N2GA 4NDAA 4RPIA 1LW7A 4PBRA 4DE5A 4KR9A 1WQ4A 1O6BA 3ZGZA 3ND6A 3D6VA 3FDXA 4MVCA 2GKSA 2X0KA 1IQUA 3MLAA 1KP3A 3IVXA 2D5BA 4G6ZA 5LLTA 1MOPA 4AQ7A 4ND7A 3GLVA 1JGTA 3A05A 3NBAA 4ZCPA 4XFDA 4U7JA 1IHOA 2QUJA 2R5WA 4S1OA 1RQGA 3X1KA 4EG1A 1S4MA 3IMCA 1VLHA 3HFJA 4I6EA 1YI8A 3CVUA 1V47A 3N8HA 2IP1A 4GU5A 3AIIA 2AG6A 4QRDA 4UZEA 5J5AA 2E18A 3NV7A 1EFPB 4K0RA 3SDBA 1H1TA 1IVSA 1GZUA 2PZBA 2QTRA 1KQPA 3ELBA 1K92A 4DJAA 1JIKA 4WSOA 3RK0A 4I6JA 4P2BA 4NAHA 5FO0A 1ZUNA 2QTNA 4MW2A 1NI5A 4E1AA 2XRZA 3Q4GA 5TEWA 1KH3A 4RUKA 1LI5A 2WSIA 2D54A 3KT8A 4XSVA 3C8ZA 1OWMA 2OV4A 1Q15A 3P0HA 3H97A 3M5WA 1OBCA 1QNFA 5DASA 2E89A 2ZUEA 4QBTA 2CYBA 1J1ZA 1N2BA 2PXHA 1I6MA 1GTSA 1JEDA 3E27A 1KH1A 4PY2A 3BL5A 1J1UA 3OTWA 4JXZA 1BS2A 1EXDA 4YMIA 3FNRA 3QTBA 2GOYA 1D2RA 2EL7A 3HV0A 2CV2A 4I6GA 2E0IA 2EJCA 5FO1A 4MUKA 4KPUB 4MWCA 4R2LA 4MW7A 3TQOA 3TZLA 3ZJUA 5K0SA 3A2KA 1JHDA 4MVWA 4HJRA 1VBMA 3DV2A 2I1LA 3TZEA 3IVGA 3SEZA 1GLNA 1KP2A 2CV0A 1IQ0A 4EG5A 4ZT3A 1F7VA 2AKEA 3QE4A 3FI0A 1KORA 3UMVA 1EFPA 4CDNA 2VXOA 1H3NA 1YIAA 1QU3A 3CLSC 4MUIA 2CUZA 2PZAA 3HZRA 3CVXA 3IVCA 5HUJA 1O5TA 3CLSD 1H3EA 2WQ7A 2YY5A 2A7XA 3DLAA 3FWKA 1N2HA 3IH5A 5KCMA 2JANA 1WXGA 3CR8A 4NATA 3FY4A 4X0EA 1QRTA 1NSYA 2CSXA 2X1MA 1F7UA 4ND6A 2CT8A 4F3RA 3I05A 2PFSA 2DETA 1JZQA 3IOEA 1NUTA 3VU8A 3ZJTA 1F4LA 1T6ZA 3S3TA
chains in the Genus database with same CATH superfamily
1YULA 3UWMA 1HFKA 1DQSA 1E18A 1EA7A 4JJ8A 4YLYA 1GCIA 1EK2A 1M6VA 3W8FA 1M66A 1ZJ4A 4WY5A 4FS8A 1G6KA 2K7ZA 4BNLA 5SYAA 1GZHB 2LDBA 3CX7A 3HBFA 4AS3A 5LN1A 4U8GA 1M0WA 3WZLA 3M4JA 3N0VA 4DCOA 3KJGA 5JPCA 4RANA 1G6Q1 3HJRA 4JD5A 4X3PA 2DX7A 1GL3A 1SBHA 1U0LA 4WN9A 3G68A 4N0MA 5EWLB 1XEWY 3SR4A 4OP1A 1ODTC 2YFQA 3RS5A 1U1EA 3B1ZA 5F35A 4MPTA 4NYJQ 2DQSA 4L75A 4KPUA 4C0BA 1NATA 3CSUA 4MTCA 1EFVA 2RMKA 4A6PA 2AFHE 5EHZA 4NMMA 1EBUA 1J9EA 3GNLA 1W5TA 1XA4A 2R25B 3IHKA 1LPOA 4PHCA 2IXAA 1U8FO 4CTNA 5DK4A 1AS2A 3K0CA 1VYTA 1QF6A 4X3CA 2H07A 1OYVA 2Q5OA 1EYZA 4B09A 4XWTA 1W581 1LPSA 1ZNZA 2F64A 1OW3B 3W5VA 3W6UA 1E6KA 3EWNA 4TKLA 1U8ZA 2Y71A 1L7AA 1DFIA 1MABB 3HYCA 4IX9A 4URFA 2UUBB 3PZRA 5LR6A 1UDCA 2BGIA 2PZJA 4RGBA 4IG9A 4PHTA 3B2NA 4KYTA 1ZH4A 4MZXA 4L51A 4QYWA 1L5FA 1W5SA 5I01A 3KSZO 1GPYA 1E9RA 1R18A 4GFDA 2H0RA 5JLAA 3EGVA 3M6FA 2WMNB 4ZO4A 3PUXA 3ZHZA 2O8VA 4RXTA 4E7PA 3WMGA 2RH8A 3GXBA 1E5XA 3TDMA 5K0FA 3R5KA 3FB4A 1MOSA 5AKGA 5F73A 1X42A 2WAAA 4KQIA 4YJFA 2QXTA 4YRMA 1GAWA 3CW8X 5JS8A 4O59O 2BFCB 3MJFA 5EWMA 5A4AA 2CFOA 2XYVA 1D1QA 3R40A 2ZBPA 1Z7EA 3C6KA 3DZIA 4LBVA 2IZZA 4QWWA 5YASA 2XUFA 1ZH6A 1FBNA 2PN1A 5C5IA 3INNA 1R6AA 4YP1A 2QUKA 4FYIA 3ZWPA 5BUSA 1OFGA 1QCCA 4OB8A 5FA5A 3L7JA 1TGYA 3CLTC 3OSUA 4N1AA 1Z5OA 1CE8A 2NADA 2JBAB 2CXRA 2FHSA 4PRZA 4P3PA 2WTXA 4ZAWA 4TRMA 3SBEA 1QVAA 2NU6A 2FN3A 1R5NA 3OOSA 4TKMA 2E2WA 1CS0A 4II3A 4Q3OA 4Z9FA 5EJEA 1B74A 2RHTA 4GZ6A 5HFNA 2FE4A 4LWOA 3Q5GA 4ECAA 3IXLA 3IFSA 1W87A 1QVVA 4GM1A 1HOXA 4UVDA 1ZVQA 3VSEA 1GPH1 4GPIB 3SBOA 2HSEA 4TQUS 3RRJA 1QCYA 3ANSA 1KOJA 2ARKA 3GJ8A 3Q7IA 5M04A 2PL3A 2JCYA 1YMUA 4EF4A 5CCXA 4J8PA 2ONCA 2FTKE 1D07A 1XWIA 2PT7A 5ED0A 2Z2IA 5EYPA 3EH1A 5C7YA 1PJCA 2ZIUB 3P0RA 3UV7A 3K5PA 5EGSA 1GCGA 1HK7A 1ZHHA 2AZMA 3RU2A 3OIDA 5KQGA 1Z18A 2P65A 1R3DA 1N57A 2GCOB 2HQOA 4F5ZA 3L6UA 2A7QA 3ZUGA 1U3VA 1CUUA 5KIAA 1O95C 3QFFA 3JS5A 5BN3A 2VEDA 3AM5A 3AP2A 4TS3A 1Y7IA 5EP2A 5EJAA 2J5BA 1MB3A 2VPTA 1H22A 2IDMA 2AG5A 2DQYA 4KH1A 5EIBC 4GP7A 3IE0A 5CA0A 1O95D 1RXWA 3QUSA 3JXEA 1XZIA 1SUFA 2E4AA 4QEDA 2WG2A 1L4UA 1UBRS 4HWKA 4ARZA 1RAAA 2H4WA 3MTJA 2R6R1 4Q02A 5B53A 4CPDA 1XRMA 1JU4A 2XYQA 1KDYA 4D46A 3SM9A 1I0LA 2J31A 3OQIB 3PQ6A 4QC2A 4BMOB 4F85A 4B81A 2FWIA 4H7PA 1BWSA 3B7GA 1EGHA 2VBGA 2JKVA 3QU9A 5LDHA 4IY1A 2KE5A 1EM6A 4E30A 4S1WA 4CEHA 1KK1A 2ZKLA 5EWJB 5DTIA 1FP1D 1C2YA 2ZDHA 2ZULA 3SC2A 3U5TA 1A9RA 1X1AA 2RGWA 1VHWA 4RNCA 4C0SA 4CKWB 3TRIA 4EA9A 3ANNA 4DR7B 2I91A 1C50A 4FCCA 4IWXA 1QPZA 4FI3C 3AUAA 4MVXA 5DT2A 3RROA 3NHUA 2OCBA 2IDJA 2O2YA 4TTIA 1ZIXA 3GHYA 5CXSA 3U81A 4ENVA 5MF6A 2AMVA 3VSBA 3PJRA 2CUNA 3O9VA 5K0CA 4R8RA 4AMVA 1XVLA 1QAOA 2WBLC 2WW8A 3KO8A 4JSRA 4UXIA 4AZSA 4BQIA 4PRLA 1G5FA 2ZUDA 2EHJA 2VT3A 3RARA 3RS3A 2NGRA 3KPJA 1TMKA 2VVTA 3GBVA 1F3LA 4HB4A 1PJAA 3CFYA 4MKFA 2HU8A 2I7VA 3MCWA 5TE9A 3DO5A 3W7BA 4X8LA 3UG7A 5JSQA 3OZSA 5JROA 3DC2A 3CEAA 3S44A 4ND2A 2ZSKA 5FNVF 1R6DA 5NULA 3MLBA 3JQ8B 2OXRA 4PNHA 1DZIA 1ENYA 2QMHA 4HB0A 4B5LA 3V9PA 5JH7F 2X2EA 2GXQA 1SIWA 2Q9BA 2VAWA 3PC7A 2X4GA 3WYEA 4JI8B 4OAPA 4WLUA 2BKUA 4WK2B 3RYTC 1P33A 5KDOA 5CCDA 3RAEC 3AOEA 3C74A 3PPWA 1IK4A 5LJIA 1LZLA 1S8NA 1E8NA 1EFHA 3FHOA 4G5XA 3O5AA 1TNDA 4LZOA 1JQ5A 5E4TA 3ZIDA 1F1BA 4L22A 1YOVB 1NBOA 5DI9A 4OU5A 2BMVA 3WB0A 3IUPA 1DDOA 4P8RA 4XYEA 3ZCXA 1IN8A 3UN1A 1CJTC 3FG9A 4MYTA 3ZLBA 2RHBA 4IQ0A 4M53A 4C2AA 2XUKA 4Y9RA 2CNOA 5FI1B 2JFFA 1UAGA 2FX3A 3W6ZA 1KEZA 1DCFA 2C8JA 3HA7A 4QBFA 3WJ2A 1JB1A 3PE3A 2J0VA 1UKBA 2QAGC 3BPSA 3G9TA 3NDRA 3VC3A 1BNCA 2J3HA 4DB2A 1XRPA 1MH1A 3QVUA 3HBMA 4KO1S 5AMXA 5T5QA 3C3XA 5FA6A 4BO6A 1CTQA 4S35A 3U7QB 1SC1A 5CEFA 3F7NA 5A0FA 4MWGA 1R2QA 4JYZA 4WFKA 4KNYA 4RTKA 5F98A 5IP5A 1M8KA 4PZPA 2P5SA 1U28C 3ZGXA 1DAGA 3Q2IA 1YL6A 4N82A 4Q01A 3U4GA 2JKZA 5ARBA 4HEA6 2BI4A 1JP7A 4UMEA 3ENWA 2TMGA 2IOFK 4F8YA 1Y8ZA 1FVXA 2CL0X 2W0SA 1RPAA 2YWXA 4IDDA 4IZHA 2WJPA 3VX4A 1H2RS 1ZK3A 3BSFA 1OXKB 1OPRA 2HU7A 2CE2X 5EMJA 2TYSB 4GBMA 1IHYA 3HR4A 2WQ6A 3KHKA 4BV3A 4UPDA 1G21E 4BV8A 4FQ7A 5TMEA 1GM5A 2WHXA 2X13A 3LGAA 3O21A 1UIMA 1FMLA 4EYKA 1TQ2A 3PI6A 3TGLA 3AP3A 1Z4PX 1W4BA 3A3YA 2PBLA 4M0CA 3HU5A 5KTTA 1UJ4A 5LBIA 4EG6A 1KYZA 4MGZR 4G36A 4XJSA 4ZT5A 1GG9A 5FWYB 4ZCSA 4UMVA 1V39A 1LWOA 3A25A 1WXFA 4X3OA 2EWMA 3T7CA 4C5BA 1DKMA 1M5TA 2UYCA 1JJIA 1D8AA 3U5ZB 3CBGA 5LLSA 4AN4A 4BDTA 1HEYA 2VK8A 4HN4B 5DCLA 3RHSA 3H5OA 1MEOA 5HQ3B 1HDZA 2IE0A 2FUG1 3WGMA 4JLJA 1FYEA 2C94A 2VNIA 3H19A 3LK7A 3OPYB 3TD6A 4CMAA 5KX5A 4RF2A 1MUUA 1K5DA 5L7WA 2V9PA 3W2IA 2EEZA 5REQB 1ISMA 2WV7A 3IAFA 1LPBB 1GLVA 4P08A 4CETA 4G4JA 1ZUNB 5JXHA 5LL6P 4NH4A 1DTWA 2Q21A 1AQUA 3ZQ4A 3M9WA 1VKRA 3V8RA 4UU7A 1GGFA 3IPYA 3AW9A 1EVJA 4AI6A 3IERA 1R8SA 3LXUX 1YR3A 3MCVA 6Q21A 2VSQA 4MS4A 1VYUA 5AT1A 4PBTA 2G1UA 3QJ5A 3TEFA 3PVCA 3E9DA 3RVOA 4GRAA 1O2DA 1X7ZA 3SZGA 2A78A 1IUNA 3GEPA 2H92A 3UCEA 3K0BA 4FN4A 3VOSA 4Q3DA 1HZZA 1DV1A 2K4MA 3CJRA 3EQ7A 3TBKA 5F9HA 1OAOA 1KMMA 3GJRA 4M9QA 3WIVA 4HH4A 2VJCA 2YN4A 1EPUA 4F6CA 2ACEA 1CFZA 2FVYA 1G4HA 3C3WA 3KKLA 1K0UA 1AKRA 2FU5C 3UPUA 5FWAA 1E9VA 4H4CA 4LGMA 1WCYA 2ORYA 3T5GA 5CDHA 4RV5A 3GPIA 4E5VA 1S01A 2MSLA 3NOVA 3KVYA 1N5IA 4X54A 1DC7A 2XLBA 3NM6B 4YLGA 4XFDA 3B8HA 3RFTA 1ZK2A 3EEBA 4Z51A 4PR3A 4TKZA 1HDEA 3AJ8A 3FSGA 1R3UA 3U7HB 4JJEA 3SOZA 2EG9A 1QMPA 1GT6A 5ENVA 5K03A 3DAYA 1UEXC 5HGJA 1AXGA 2XDAA 5DW3A 5EIEA 3CVUA 3UMFA 4C7OB 2W48A 2WG1A 4JT4A 1FDOA 3NVMB 3U4IA 3AIIA 3M5PA 3TLGB 4RESA 1L5QA 2CXPA 2EC5A 1WDWB 2AZ4A 2RK4A 3BWBA 4ZPJA 3ESYA 3HCFA 1RHJA 1XTKA 2XBLA 1OASA 3OUTA 4U1RA 2M6KA 4IDFA 2HMYB 5EIHA 1S89A 1WG8A 4DR4B 1UBMS 3ZV5A 3LC0A 2BKXA 1ATIA 1EDBA 3OJEA 4MKHA 4TZTA 3USCS 1AGYA 4DJAA 1MJNA 4ND1A 4QJ3A 1RMTA 1WSAA 5A2QA 3FWPA 3NIDB 3AERB 1ZOSA 2ZTHA 3UXMA 2H1SA 3MQ4A 4YRIA 4Y7CA 3RVLA 2HJGA 3UKJA 4LBYA 1YCFA 2O4UX 4MRPA 3WIUA 5BYKA 1E60A 1D4FA 1V8OA 1VE9A 3PC6A 1NI5A 3WLPA 1K2VN 3FNFA 5KQRA 2D7CA 4BGDA 4G07A 1LI5A 4TL6A 1WCIA 2BFDB 4ENSA 1LW6E 4YP0A 2DWUA 4R2WA 4S24A 5IJ0A 2VL7A 2XUHA 3OIUA 1I2ZA 1M1XB 1SB9A 1U63A 1I10A 2G0NA 4B76A 2HRQA 1RLIA 1NRXA 4YJ2B 2HHHB 2NP7A 1OLUB 3D5TA 2VJMA 3D4OA 4PSCA 3MJHA 1JAZA 1SKYE 2WR8A 1J1ZA 2OO5C 3HJAA 4GZ3A 4EJSC 1L5VA 1PFGA 4HLUC 4G1BA 3UGJA 2REXB 2B92A 3GYBA 4RK4A 4JXZA 5E95A 4GPD1 3ZWYA 5AP9A 4B73A 4XUEA 2NYRA 1PBNA 2VQDA 3FRIA 4JP8A 4PGGA 3A7DA 3IVRA 1L8AA 4F5YA 4UOEA 3WGTA 4J6EA 4ZICA 4QT0A 4YJKA 4M1KA 5JWHA 1VIYA 1UANA 1QTIA 4GEKA 1OFUA 1A0OA 1JL3A 4I1UA 2ZVJA 4RYDA 3L04A 3EYAA 4M87A 3J80A 1E9CA 1LEHA 2B1GA 1NKTA 2FFBA 1W6UA 3NR2A 1PKEA 3ZY5A 4QHYA 3WAKA 3S55A 4OY3A 4KOEC 2GD6A 3O3CA 2X0JA 2C7VA 4O4IA 4EMUA 4D80A 1T1EA 2CV0A 1CWUA 2OLEA 4Y2QA 5DNDA 5KNDA 4A15A 5F9FA 3B5JA 3MRTA 3PEUA 2OXIA 3S6JA 3S8MA 3W9UA 1DC8A 5G4KB 1QP0A 3NWBA 1NTRA 2C99A 1GRCA 1PJZA 3K0EA 4OX9B 3L2OB 4HDSB 3A0UA 1QU3A 4JLMA 4E51A 2VRCA 4D79A 4P1ZA 1I3MA 3V8QA 1JEAA 1T8RA 2C20A 3HXQA 1ZI8A 3G8AA 5JZBA 1OX6A 3EH2A 3LWZA 4HQ0A 1V4BA 2J6BA 3L7MA 4MVJI 1O08A 4IH1A 3UWOA 1F5SA 1ADBA 3JQFC 3BQMB 3OI7A 2EJTA 3FWKA 2PUJA 2C9DA 2J3EA 5COBA 1K2WA 1Q6ZA 1NVFA 5HMMA 1R88A 1WVGA 1UPTA 5I5EA 2CSXA 2ZREA 1V9SA 3DMTA 1M1YE 4UHKA 4K6CA 3OQBA 2CNWA 3PJFA 2OSBA 3KLNA 3W4IA 4F3RA 4P7GA 1I3CA 3SDZA 1YXMA 4IUBS 1UPUA 4L4UA 4JFRA 2H85A 1N5DA 1MJGA 4MRAA 4R1LA 3BGOS 1JA0A 3TRHA 2C57A 3W9BA 4ZIRA 2YVAA 2QROA 3PR2B 1ONPA 1P81A 5AKKA 4LGCA 3VVMA 1I1OA 3M6UA 1M74A 1T6YA 5DMHA 1SOMA 4OHMA 5BUCA 1IUPA 4ADSG 1BVHA 1NUQA 2LGJA 1JDNA 1KYYA 3WLOA 3P97A 3RRNA 2OL4A 3MGGA 3MJSA 1X1DA 2ERXA 3SC4A 3VKGA 3FLAA 4F3NA 1FP2A 1N6OA 4TMYA 1FS5A 1B6SA 1SCJA 1YCDA 3FLMA 4ZC1A 3HLYA 4B2YA 3MJ4A 4ZGWA 3CKKA 1RR6A 1GL7A 2OSVA 4GLJA 5H4HA 3HO8A 3DGEC 5JD6A 3HB5X 2PS1A 5TQVA 5B1EA 2IY8A 2MSNA 3OETA 4AY4A 4YQFA 1PGOA 2AN5A 4GEGA 4ZHQF 4CG0A 4I81A 2P67A 3RFCA 3RS8A 5BQ5A 5IAGA 3THXB 4UEKA 4ZTUB 2B2XA 2IL1A 2ZJFA 1IG3A 3USZA 2JB9A 2EU8A 3ZJ4A 1RKVA 2BHTA 2P2CA 3GMDA 1NRJB 4J0JA 1NXTA 1NR1A 2ZBFA 1QXSA 1DMRA 3HXMA 2Q5JA 5JFTA 2IHNA 2YXDA 5E4YA 3QELA 3W0LB 3ZHUA 1Z33A 3D8TA 1Q14A 4JFAA 3VV3A 1TUEA 2KI5A 3G1WA 1FSSA 4OAOA 4CKYA 2NQ8A 4D0SA 2H08A 5C9ZA 3PQ5A 3EGXA 5JAHA 3K9WA 1GG2A 2R60A 2ZPUA 1JZTA 4DUYB 3BORA 4FEGA 3A6FA 4H6WA 4XGKA 1VL6A 4O1HA 3UMGA 4ZOCA 5EXEA 4BHTA 3ZHXA 2PCLA 4RD0A 1H4SA 3HYLA 3DT6A 1MPXA 1TB4A 1P6XA 4GP9A 1SUDA 3UFBA 1Y8CA 1QHEA 4UNRA 1WF6A 5KVQA 4CMGA 4TQAA 4DIFA 3BD9A 3M82A 4R8SA 3FIJA 1A1VA 4UZSA 4X65B 1HYEA 3VPCA 1G64A 2PUVA 1YQ9A 4W1QA 3BH0A 2Q7OE 4FGUA 1I51A 1Z16A 2RB4A 4ZQIA 2AK2A 1DHTA 1GGMA 4GOND 1C9KA 4XA8A 1RPZA 1L4MA 1E7WA 3DPUA 4CFZA 3GPLA 4KFSA 2VP5A 1CJBA 3GELA 4LZZA 3K0HA 1PQPA 1SHLA 4PV7A 3HB0A 3KU1A 4RA6B 4UJ3A 1XCJA 2A0YA 1TW2A 3I2JA 2XVMA 1A3CA 3QV1A 2JI9A 1UM9B 1L7VC 2X9NA 3NVDA 4RTMA 4LUCA 5FHQA 1PR5A 1RXYA 1F2TA 4YN3A 1DJLA 4NXNB 1E3SA 3HUFA 3FCEA 1PG0A 4TWBA 3L79A 1UWCA 2YIJA 3VI4B 1BQEA 2HIGA 2AB0A 3IQWA 3WBJA 1K8ZB 1T4CA 1T9ZA 3R0IA 5CVCA 1HXHA 2A35A 1V16B 4ZV4A 4HEQA 2XZLA 4NBLA 4KR6A 1KBZA 4WXHA 4YP6A 1SWVA 2IYZA 5HILA 1HF3A 2V0NA 3NTLA 3TRJA 4ENRA 2FGJA 5HJ2A 1JPJA 3KYDA 5JBNA 1HDOA 3KJHA 3G17A 5H0IA 1ANKA 1GNLA 1P17A 2O7RA 5C8VA 2IGBA 1C3OB 5KQMA 2IBTA 2B6NA 2V6MA 2GM9A 1PR9A 3RRXA 1X80A 3HFRA 4E11A 3ZE2B 5DHRA 5CB4F 5LQDA 4F12A 1OXVA 1B3RA 1OZ0A 1Q3TA 3PR3A 3S40A 3CPHA 1PZGA 1M8PA 2G88A 4RM2A 3QI2A 1B1AA 2X76A 1XEAA 1ZRHA 2B37A 2FW9A 2YIVX 1TAHA 2HQ1A 4NICA 4E6PA 2RDMA 4LTDA 2FRDA 5AI0A 2DEUA 3PB3A 3H2SA 5GM1A 5IBPA 3VVCA 2YDXA 1CZNA 4IJUA 1EB8A 3BF7A 4GIBA 4MVJM 4XWGA 2HYIC 1MDFA 3NNSA 2YV4A 1D9ZA 3X1DA 3IAS6 5BPHA 4P7BA 3HVHA 5BV7A 3PNQA 2CCKA 4H59A 3PGMA 4FGKA 3Q87B 2DFPA 4KI0A 4QXAA 1QAQA 3U7RA 3UMBA 5IJ9B 1URPA 2FKNA 2R2AA 3CU5A 4WASA 1BXKA 5FUXA 4YV2A 1F6WA 2YOHA 5AI4A 6LDHA 1OI7A 2A1UA 2P79A 1QMGA 3SKXA 4OLFA 4HNAB 2CJXA 3MTEA 4JDUA 3T4UA 4QUBA 3V6LA 1NQVA 5LBTA 3R0QA 3N39C 1PJQA 5A7HA 1NXQA 1SKQA 3C85A 1XEXB 4PEVA 1VA5A 5CB0A 1YDFA 2PUHA 3L93A 3DWFA 3DNPA 3FCAA 3GLTA 2P4EA 5E9WA 3LWBA 1NZFA 4RVDA 5AVTA 2YTZA 2OZKA 4B7AA 4HTFB 4G0MA 1KFJB 3CUYA 2FK7A 2NPIA 1DBSA 2LPMA 2DR2A 4FFNA 1ADYA 1E89A 2P9BA 1Z5VA 4FFPA 5F2KA 4S05A 3AETA 5B58T 1PJLA 1HC7A 5PGMA 1G55A 2H63A 1YBMA 2QVGA 3LUDA 4OREX 1N4DA 3F5SA 3U3OA 3ZWDA 1XB2A 4IH9A 4RXMA 4F56A 4Q7QA 1ONOA 3ENZA 1I5RA 3K0CC 4IHAA 4WOKA 5CNKA 3OF2A 2B8JA 2ZB3A 1CQPA 4M0FA 4B3XA 2XNHA 2NNLD 3L5KA 3M3HA 1GN8A 3MRXA 1Z8DA 3AR9A 4Y1EA 4KWHA 5JEDA 5ELMA 3KB8A 2OMEA 3EIWA 3ZX5A 4W8OA 4H0FA 1KBQA 2GBGA 5TNXA 1O96B 2DY1A 2CUTA 2ZIEA 3GDOA 1XNGA 5I5GA 1CJVC 2FZWA 3PHIA 3FMVA 4GR9A 1GLGA 1C4KA 1DQPA 3LUKA 3NHBA 1SQ6A 3I9FA 1B7GO 4OSPA 2D6FA 4JHXA 2P5TB 1C0EA 4KN9S 4OHVA 5HE9A 4G5HA 2L17A 2B4RO 2A88A 1YUMA 3O75A 1ZR4A 1TA0A 1XF1A 3L0BA 4M9SA 1JE1A 4NBTA 4QU5A 3AFGA 3QJYA 1H4TA 3GUVA 4R1SA 3ZBQA 1YSCA 3H7AA 4FHGA 4S3MA 1GNQA 3UHFA 5F7ZA 1JQEA 3ELDA 1MTOA 4E2FA 1M1NB 1Y5MA 4A8PA 4RV4A 1OA1A 2PU5A 4OH7A 2CJWB 4UZFA 3LTNC 1Y9JA 4CKEB 3CHYA 2MR5A 3K1AB 3IKTA 1L1RA 4BECA 2YV5A 3QHAA 1J9GA 3UHAA 2VPWA 2QJTA 3LE8A 2NWQA 5KCZA 4KFTA 4RVFA 5HX7A 3ERCA 3PV0A 1Y8QB 2H9AA 3RUPA 4B9AA 3G79A 3ZHTA 3ZDDA 1WB5A 4JQCA 2JAOA 3HCCA 4TYPA 2GWRA 3LOUA 3NHAA 4IIJF 4Y9TA 1OH6A 2QJRA 2M6RA 4II2A 5HPYB 1KI6B 5FJIA 1T2UA 3A3NA 5ADUS 4M1TA 4OKIA 4ND5A 3TLEA 5DGXA 1V41E 1X15A 1M2OA 2DJIA 3I4CA 3K05A 1BYIA 3FGZA 3HXOA 4DVGA 2XDQA 3UTDA 3W5DA 2XOXA 3CZCA 1FTYA 3VNRA 3WMXA 1Z4NA 2C1EA 1U8XX 1AB5A 2PSFA 1J33A 1N0IA 4Y2JA 4Q6BA 1H85A 1RWXA 1X38A 5DYIA 4NOJA 5CXQA 1KJ9A 2DPLA 1JDPA 1G6HA 1RBQA 1U7PA 2CXXA 2PWAA 2Y66A 3O4IA 4Q4AB 4YJHB 2F67A 2NYVA 1E2JA 4WZAB 2RGUA 4XWOA 4RABA 3KKZA 3IUYA 4RMIA 1W4LA 2GK6A 5ALTA 4BMSA 4DADA 3KXPA 3ZDRA 1H5NA 4US2R 1XF9A 4V1CB 2YHSA 4LC9A 5D8DA 3U4AA 4N01A 4R5MA 1NTOA 1TT7A 4B40A 4CI0B 1U3CA 4FFDA 2AX4A 3SZMA 4F1JA 5JHGB 1GPNA 1RPTA 1EVEA 2PXXA 4LC0A 4E5SA 2RHHA 5DTJA 5I7AA 2FUNB 4WAUA 1OROA 2P8JA 1MIHA 3KKQA 4DDWA 5MN4A 3GLFA 9MHTA 3R4VA 4QE3A 1IZ8A 2RGGA 3NONA 4F4CA 3PPYA 1BDIA 2I6QA 5KUTA 1GGJA 4FDUA 4FZVA 2XT6A 1SRQA 2P35A 4MINA 3TUIC 4R9RA 4J2TA 3CIOA 4YUYA 2V55B 3RT7A 2DU8A 2J3IA 1RXIA 4EKEA 4K1LA 4Z4GA 1YBAA 2WJVA 2OCLA 1CRPA 1EIWA 2GXSA 1F8UA 3PE6A 1INLA 1UH5A 1RFGE 3G2HA 4GI2A 4RD4A 3LF1A 3IMGA 5AM2A 1E1YA 4CDMA 2PVSA 3PKIA 1S2LA 4YJGB 2JD2A 3BK2A 4Q66C 4UFOA 3TPZA 4EENA 4EW1A 5KSOA 1CY2A 4TWIA 1HGXA 4NDAA 5SYMA 1AY0A 1T5HX 1N25A 1XX6A 1F51E 2WJYA 3CF6R 5B1DA 1FSZA 4TTQA 3V97A 3MQFA 4MKZA 4NP6A 4CL0A 2HRRA 3M8KA 3A6JA 2ZSDA 3R8CA 4C89A 3WLTA 1P4SA 1TCVA 3NEAA 5TJ9A 2JFZA 2WI8A 4WESB 1KVRA 5LU8A 2JBHA 2WLTA 1IQUA 1U9JA 4IVQA 1W1IA 2JCGA 3DKIA 1AS0A 1L7XA 1GN9A 4NXMB 2O8BA 1EUCA 3NV9A 1XP8A 4X9XA 2R1ZA 5DISB 2B25A 3RF7A 3WGHA 4ENQA 1HNXB 4Q7KA 3LRXA 2AOTA 3OZDA 4KFRA 2C9ZA 4LI0A 4XGNA 5EHIA 3NBAA 1AXRA 5U4QA 2VF7A 2F17A 1WHSA 2EGUA 1ZK1A 5J1TB 3CCCA 4CYMA 1T8SA 1ZNWA 2ECPA 3FYUB 5IKPA 2GTPA 2O3UA 1GYQA 2Z5GA 3ZJYA 1FJHA 4NV3A 3VYTB 4IYJA 4NDNE 1UOOA 5AIAA 4UUBA 2GSDA 1KY2A 3A3OA 3ANXA 3E3AA 5ABPA 1DT3A 2JJ2D 3AOEC 3DM9B 4OKNA 5F3RA 2BGNA 4GU5A 5BSUA 2X6RA 4A23A 2HBYA 2DKFA 4M0MA 3E18A 4BP9A 4IXNA 1DRUA 2I4RA 4EL0A 5I9MA 2VO1A 2ZIXB 4K0RA 3I83A 1AMUA 2ZI3A 1P4JA 3FTPA 4MYSA 3SQLA 5CX1A 2H3EA 3ZX4A 3OFVA 4R0MA 1K92A 1Z6ZA 3ANYB 3KEMA 1R8XA 4CE6A 3EF0A 3NVKI 5ES4B 4E2XA 3K5HA 4TL9A 1KJNA 1GG8A 4HD8A 1YRQA 2WJJA 4RZSA 1QH0A 3U4DA 1GXSA 1JI0A 2EEPA 4LHSA 4JH0A 5HJEA 5IT0A 3N7AA 1V0JA 4BMNA 4ALIA 2YHIB 3RCBA 4QNNA 4EMBA 1DAFA 3VPBA 1JLLA 3VZDA 1YS1X 2YJ3A 2UVPA 5F21A 4TYWA 1SA0B 2MU1A 1SKAA 1JG3A 4WXYB 2Q9CA 3GVXA 4FFWA 2IWRA 3THWB 5GJBA 4KIGA 4MR9A 2VT2A 1L0BA 3KPWA 3ZN2A 3QKSA 4BTEA 3HSKA 1ECJA 1Z38A 2O3QA 3VUFA 1NJ8A 3OZBA 2NZYA 1NN5A 5KOIA 1YO6A 3OLCX 1Z29A 5IVDA 2HIMA 1B8PA 3LW7A 3T15A 2ZCJA 2JCXA 3Q40A 4X7BA 1NF9A 1EESA 3FKSA 4DA6A 1Y1RA 2Z56A 4X85A 4FGWA 5ULLA 2J9XB 4EVRA 5EIAA 4J3NA 1QWSA 1H2ZA 1ONNA 2H59A 4FT4A 4G85A 5ALFA 3LVQE 3HKBB 5BORA 3NC1C 5IPFA 1L8QA 4HNRA 5BNWA 1TJ5A 2YQ5A 1EB9A 4JBYA 4LHVA 1YMQA 2P78A 3K16A 5TIIA 2PLFA 3QU2A 3ROGA 4GOJA 2I6SA 4MDYA 1GTMA 4PCVA 5ER9A 2YC4C 5JZMA 5LP6A 1OYWA 3B82A 4GMGA 3JARB 2Y76A 1KVSA 3KZ1E 4GDMA 3J7AC 3DVLA 1T0HB 3M1AA 3PJEA 4B6GA 5K0SA 3GAFA 3H1GA 4ZP1A 1C7RA 2I5PO 3GLRA 2AR9A 2YJTD 5FKJA 1CC1S 5EHNA 2KPOA 5JSFA 1Q22A 4PG4A 3H87A 1F7VA 4RK0A 4UMFA 3FI0A 4MQBA 3AF5A 3F4BA 2REQB 4LJAA 4QQNA 1A9TA 1EFKA 1JKFA 4YAKA 1FZQA 2EFCB 3PEYA 2C84A 1CSEE 2HWWA 3C6QA 3SHWA 3WR5A 1F0YA 1N6PA 2O7VA 5C4IA 3FRHA 3V1YA 3H6HA 4R2HA 5EUQB 3A4LA 4OYHA 4HNVA 1LKZA 3O4VA 4NMWA 4LF4B 4OAQA 4XKJA 3W2TA 2JLRA 2G9UA 1HBJA 3QE3A 2XE4A 4II7A 1YKFA 5AJVB 3DMFA 5D2CA 1BXZA 1DU4A 1TMOA 1W88A 2OLJA 1LPAB 2BT4A 3FYHA 3G8YA 1V8PA 1B0UA 3L8HA 3Q0IA 4NOKA 2NZ8A 4OJKA 5ALSA 4Z9XA 1VG0B 1AQ6A 3DZJA 1SVUA 3CJQA 3ESBA 2ZS8A 3H5TA 3B9BA 5ALPA 1MGPA 5AM1A 5LKRA 5KTKA 4C0LA 2CB9A 1HZZC 3DOJA 1I32A 4DCPA 3UJ3X 1OAOC 2AMLA 5FFFA 3TSZA 6PFKA 3DEYX 1WSDA 4FTWA 3IB6A 5U1PA 5HKOA 2DETA 3CZ4A 4C4OA 4TLEA 5G0UA 3C4QA 1RRGA 4O4LA 2SKEA 3PKJA 1GL6A 2WPNA 3E82A 1P91A 4ATNA 4V24A 1HPLA 3E84A 4CKBB 2ZATA 1EWYA 4L74A 3W1WA 4Y9UA 3F1KA 4L0QA 2IV2X 3V8BA 2JH8A 3A1DA 2OV3A 4H1WA 3AUJB 1YZNA 1MEJA 2DR3A 3FLEA 4FGJA 4AP9A 2ZAYA 3DF9A 4B4KA 3DOCA 3LQYA 2QU8A 1JMKC 1FFEA 1PI3A 3UTCA 2PU7A 5ANRB 2COKA 4LRUA 1RW4A 2FPIA 3D7RA 3FSGD 1XAJA 3WXBA 1DAKA 2AR0A 4AO8A 1TUBB 2BZ1A 3DOHA 3W8DA 2Z2ZA 1JV2B 1A5SB 4XX0A 4D7AA 1NBWB 1EVKA 1TFUA 2RHMA 5CFZA 1M34A 4KGXA 2Y1LA 2ATIA 1J09A 3BGDA 3OECA 2JIZA 5LD2B 3FHJA 1VFNA 2CBGA 2NO5A 3DFUA 3BHMA 3HABA 3QSYA 3N2ZB 1RYZA 3AJRA 4ZRMA 3G8DA 3T7SA 1RQRA 2B2NA 4PSKA 4C05A 3IUNA 1G8GA 1NFFA 3GB9A 3A9RA 4J4TA 5M34A 1U2TA 2GRUA 2TMDA 1UDBA 3DW3X 3JWHA 3MS2A 4C3OB 3GVCA 3HDYA 4FCTA 4FOOA 4KIWA 1NC3A 1J20A 1BFDA 2XWPA 2BF4A 2J4DA 2NUTB 5IAEA 4H7IA 2X2PA 3LDUA 3MOIA 1QX3A 3OPQA 4CLOB 1QF9A 2VJPA 5THKA 4UUMA 4DCMA 4BIIA 4AO6A 3CLRC 5TPWB 2YX1A 3A11A 3PL1A 3IQZA 2WFMA 3NBFA 1JDSA 5C34B 2POCA 4DR5B 2BYTA 3EN0A 1RWVA 2PLRA 4BWVA 2QJOA 1YZLA 5JALA 1SQGA 2BTOA 1VRVA 2F00A 3FF4A 1J5XA 3CLRD 1MB4A 1N2EA 4J0FA 4RXUA 2IPMA 3WZ2A 1IPHA 4ARAA 1JN0A 5KKAA 1TEVA 1ZIYA 4DLSA 4BWFB 5K8TA 5ETJA 3LT0A 3MPUA 2Y2UA 4OU4A 1T2EA 2LVBA 4PLGA 4FW9A 3UMRA 2XQJA 4UAJA 1ISJA 1GITA 1NC1A 2FP4A 1M2VB 4HQNA 2E4YA 5E7MA 4E14A 3IHWA 5CT6A 5HKKA 3GJSA 4CNBA 2PH1A 3FUVA 3LFTA 1JZSA 2J30A 2AOUA 4S2UA 4D5EA 1NLMA 5HS4A 4FSXA 3LLVA 2J4CA 4MVJE 4NESA 3DBOB 3NZEA 4FN5A 4Z8YA 4MMXB 5AUPB 1JBQA 2DWQA 3LCVB 4URUR 4C7MA 1FNMA 3BMNA 1A7KA 5C7OO 3DNMA 2XNJA 4O6VA 3OM0A 2BDTA 3KUXA 4L0MA 4PFSA 4R69A 3I6QA 3WX0A 2QR5A 1PFYA 1XZQA 5HM6A 1KAGA 2IUYA 1T5SA 2IKSA 2YWFA 5AI9A 4OUDA 5DM60 5E9QA 1DCMA 5JE8A 2GK7A 1WD5A 4Q6WA 3HXKA 4GOOD 3LYUA 4HZUB 4KRGA 5GM2A 5HXAA 3DUWA 2C3YA 4G0ZA 3U9TA 4TXNA 3IT0A 2P4HX 4LJ5A 4LMBA 1GAQA 3P94A 3KR9A 1XWFA 1G8PA 1ZM9A 4KN6A 2ZU6A 5ALVA 3Q15C 3A3PA 4NL4H 2IKQA 3QUTA 3A10A 2BDEA 2FQYA 2TRSB 2QG6A 1BG6A 3EG9B 3RVRA 2GJ8A 3ZKAA 5A9SB 5C51B 1N7GA 4IO1A 3Q9SA 2YY6A 3WVNA 4DM7A 4O08A 3PWTA 4Y1RB 4UXHA 4C7KA 3GF4A 2YZMA 3PIRA 1DXOA 1HSZA 5BVGB 1DZ3A 2XXBA 2B1QA 4M0DA 3AL3A 2PL1A 1VSBA 2Z8ZA 4KXXA 3IB3A 4EY7A 4NPHA 3F8SA 4JJ4A 4B17A 3QU4A 4UBMA 1WV0A 4GLOA 3VYWA 1HYGA 4ENWA 1C3VA 3H9UA 4WXEA 4KUGA 4K26A 3TLXA 1G3IA 4XUCA 3K53A 3AINA 1VLVA 2B0CA 1B0AA 1NVVQ 2E7ZA 1XMSA 2ZJ3A 3D6FA 3DMTC 4HH1A 4YVFA 3KAKA 5K6AA 3ICQB 1P61B 1Q0TA 4EI7A 5AQEA 5A05A 4DEXA 5C8YF 2G9VA 2OPHA 3SX4A 1V7ZA 3H6KA 1PQ4A 3R6GA 5SYNA 2BEWA 4BEWA 2PJDA 4MA0A 1GPLA 5FJJA 4N3CA 4LDQA 2CNWD 4W63A 1KAMA 1Y5LA 3G2OA 2WA1A 2WTMA 1RZUA 2EJVA 4AW9A 5HWSA 3PTAA 1AGRA 4I5EA 3H9CA 3M4YA 1GCOA 1U3DA 4IUCS 4BO9A 3RT9A 3F73A 2BHNA 2EQBA 3GLFE 4FEEA 3I8OA 3IP3A 4S1VA 3ODGA 2KLHA 4A2QA 5KYXA 4JA2A 3BXFA 5C35A 4GPAA 4QM7A 5BW4A 4F96A 1JFFB 2UVQA 2IWHA 4BO5A 4EJSB 2WINI 4PPGA 3P5SA 4ESOA 4O2BA 1BXRA 4ZCLA 4U7DA 1Y7LA 5FAKA 1CVLA 1I36A 1Y0BA 1BCRB 2VDLB 3I6IA 1CUGA 1M0TA 5HF6A 1IY0A 1D7AA 1IHUA 3GVHA 2PD6A 3PUYA 3D8NA 3U37A 4B46A 4RACA 1MNAA 4R51A 4FYJA 4X93A 3RK1A 3IJPA 2CNKA 2UVDA 4KO8A 4MX8A 5DIZA 5FQOA 5ILOA 3FNQA 1G59A 4JJZA 1QRRA 4WWHA 1QGYA 1VHJA 2WTNA 3ZU2A 4C1BA 2WK1A 2NVWA 5EGNA 1EG2A 1S6YA 1O4VA 3FPCA 1DX4A 1QKKA 1O87A 4MS3A 1KQNA 4L2IB 4ARCA 1KO7A 1G20A 1GU7A 1XV5A 2C98A 2IS2A 4R01A 5AK3A 4F2WA 1PBTA 3F8WA 4IMIB 1ZVVA 4CL3A 1HLGA 3OQNA 2NTEA 2ZRGA 2CLEB 4R2MA 5DP2A 3GJTA 5P21A 3RUHA 3K0FA 1BIFA 2YFKA 1KFBB 2CXUA 2OEPA 3NCHA 4RORA 4KTTE 1JWAB 1MGOA 3EK2A 4CWAA 3U44A 2QM8A 2VHEA 3G7UA 3RO7A 1JU3A 2D1RA 4O29A 1E79A 4ZU1X 1EGAA 3I34X 4DEVA 4IOJA 1NT4A 3HFGA 1ICIA 1PFUA 4BL5A 1XVIA 1S2NA 3PR1A 4D41A 2ACWA 2D2IA 3AG5A 3WTCA 1J21A 3H1EA 1YQTA 2VDVE 1KO8A 2MYPA 5LB4A 1KJQA 1PFVA 2SCUA 3H5NA 1D1TA 4TMFA 1QHHB 3LP5A 2Q49A 4M7OA 2OM6A 3A9SA 3KS9A 3HYSA 2A59A 2D1TA 4RW0A 4Z0HO 3SP1A 3AP1A 4TVBA 5A0TA 1B76A 2Q2WA 1GNPA 2Y4OA 3IEKA 1I14A 1A5BB 4MIOA 2WWRA 4UUOA 1ADCA 1MXFA 3KZKA 4FD2A 2GXAA 3EUAA 1TYDE 1G5TA 4QYIA 5EZSA 1F60A 1M8GA 3FPGA 4B33A 6NULA 5KVSA 4Q00A 1KOLA 3KT3A 4I55A 4D3DA 4E4RA 1FS6A 2Q29A 3JVIA 2YFHA 3EA4A 3PFHA 3DJYA 4OHXA 4XSHA 2OAQ1 4CR6A 1A5ZA 2KS6A 1OWPA 4GQAA 3TLZA 4ZCTA 1GTRA 4PQYA 3VX3A 3KVOA 3RJ5A 1USIA 2X15A 2Q2NA 3E7PA 1NVGA 3T1TA 4FOLA 2I6TA 1JKJA 4EY8A 3MB5A 2PJRA 2Y6UA 1PKXA 1UWVA 2B61A 4K88A 3OZ7A 1OT5A 4EAAA 2NYAA 2XF2A 4MUNA 5KOJB 2XMRA 3RTBA 5A5DA 5BV8A 1CRWG 1WU8A 2J7KA 4EYEA 4BOYA 2Z1DA 3K0AB 1H5UA 2A9KA 3RSCA 1T8PA 3WGQA 1XK6A 2VWPA 4RTRA 3LOQA 4X7PA 4KQHA 2V96A 2IU4A 4G89A 1GUBA 4PG7A 4CUJA 3GZNA 2QP9X 3LY9A 2B35A 2QN2A 2V5AA 3JYQA 4R68A 3B38A 1IN7A 4K05A 4DJTA 4XVQA 1QR2A 4GX1A 4YAFA 2N42A 3MIIA 4MV5A 2WZQA 3RIGA 5GP1A 4F3CA 3ONWA 4WW0A 2QRMA 1Z4IA 3N2YA 3ORYA 2JARA 3BFPA 1RI2A 1Q1QA 5FLXA 1W96A 3H1PA 3LZCA 5TMBA 3PEVA 1P3Y1 2ATCA 4IGIA 2JHAA 5K3EA 4RVNA 4QYXA 4ZCQA 4QEKA 2NX2A 2IOFA 4D97A 1NY5A 2X7JA 3ONDA 1L3IA 2FRDC 3QXXA 3LDFA 5JAOA 1K89A 4XLTA 5HRUA 2JI4A 4Q9DA 1M2EA 4URXR 1E5TA 3I9V1 3PWKA 1N92A 3U1BA 3IJEB 1AGXA 3UF0A 3VR4A 4CL2A 3PLAE 2P2ZA 1T1IA 1JXOA 3GROA 5JMWA 3IMFA 4F04A 4XAQA 3WGUA 2P6OA 1YJBA 4CUZA 1FBTA 3NDPA 1CNFA 2I4OA 3SKVA 3FZNA 1W19A 3L0OA 4FZRA 3GRPA 2W6QA 4TXMA 4YUWA 3LUPA 4QGSA 5MDHA 1OQAA 2XCRB 2W6ZA 4PVCA 4UTOA 3BKWA 2V7QA 1FOEB 4Z4QA 1IXKA 3LXXA 2EZUA 2O2HA 3UJHA 1J23A 4AFNA 2GWHA 1YQDA 2V74B 1XTIA 3CRZA 5AJUA 3WNQA 4QDXA 5EHQA 1FTGA 3RLIA 4BLTA 1U2EA 1QFSA 4J4HA 2Q99A 5BR1A 5LQAA 2AXPA 5COQA 1RYHA 2V4UA 4I7EA 1FFXB 5JH7B 2XEXA 2Z4SA 5EAIA 1BMTA 1MNQA 4YJ3A 2CBZA 3IPRA 2ZE8A 1BHJA 4PHFA 4BQQA 1NW9B 4LX0A 4JROA 1PVDA 3BG5A 5AVSA 3HI6A 2XTZA 1VLHA 3QXJA 2O0MA 3CS3A 3UJ9A 4HGRA 4N39A 1HTWA 1VB5A 2BISA 2H2FA 1VL8A 3A06A 4YV1A 5BWNA 1XJCA 1VYVA 4ND4A 5IT5A 2HCJB 1J2EA 3C6XA 2QW0X 4ZQBA 1MKYA 1DUIA 1LJLA 3WKDA 3ZHRA 2FJUA 1UK6A 4MRVA 5TS2A 2QJWA 3ILYA 1L7NA 4R1TA 4Y6PA 2OZPA 3ICWA 3EBLA 1H1TA 1SVLA 2RHWA 2VATA 2PZBA 1QG0A 1CZHA 3O8DA 3I1IA 1ZVMA 1UWLA 4GX2A 3L9XA 2LP4Y 4ZTZB 4PO8A 1PV2A 4ZOLF 5C8XA 1U9IA 3W5IA 3KJXA 4HDRA 1VGRA 5GV7A 3AR8A 4ALLA 1C9DB 1Y4DE 2CVOA 2IEZA 4AUKA 2NPFA 3HO6A 3HY6A 3ROEA 1NKVA 2CE7A 1CFJA 4MW2A 5JFOA 1ORVA 3SJBA 3VDNB 5KHLB 3FYCA 5IT9A 3M49A 3DMYA 1AB6A 3RTDA 2AVDA 4BEBA 3ZD6A 1M34E 3O8QA 4BVBA 1FL9A 1G8JA 2P0EA 2WSIA 3JQDA 3KEOA 1RXEA 1HRKA 2E82A 3AGPA 3P27A 4P98A 4P54A 1KHTA 3I9LA 3RS7A 4B3MB 2DBQA 3FNBA 1LDNA 2Q50A 5DCWA 4JC0A 3FVTA 4H7FA 3E7WA 4L6AA 2NV2B 1JHUA 2J45A 3QYAA 4JL5A 4UCFA 2PKWA 4H0NA 1Q0SA 2X41A 2E89A 3CZRA 3LM8A 1O4WA 4GI1A 4OL9A 3ZZTA 1ZNQO 4A26A 1QPGA 2VAPA 3DYBA 1QDLB 1VE5A 4NHOA 3F96A 4JI5B 5BY2A 3STXA 2DH6A 2O19A 2G8NA 1I0IA 3TH5A 2AYZA 5ALWA 4X84A 3WRXA 4DJ5X 3SJAA 3B52X 5DNWA 2VQEB 3E2MA 3G88A 3HBLA 1JHOA 3WYNA 1MX5A 2C97A 1BOOA 2VYQA 2O2ZA 4EGCB 4ZMSA 4KZPA 4QGFA 5A4KA 2JFVA 3W5CA 3D9QX 1MAHA 4KPUB 5IKOA 1SQ0A 2EYUA 3S70A 4KYIB 3TXYA 4WECA 4RCZA 4G1FA 5DYYA 4RY2A 3EODA 5BR7A 3VYRB 1N8SA 3CO0S 1L6RA 1W76A 4HJRA 4QOFA 5E6RA 4COKA 2PWPA 3E1SA 1KP2A 1IBSA 1SC4A 3A1UA 4G0WA 1XU7A 3MWFA 3TK1A 1UT8A 3EY4A 1I80A 4GOLD 5A3SA 2JAPA 1FU8A 2KYRA 2VXOA 4C06A 3E9NA 2ZCVA 2HIAA 5EHGA 2QD2A 4OLBA 4JLSA 1F2DA 4CZ2A 2GO7A 4P80A 1P45A 4JUAA 4DWWA 3G0CA 1YV9A 4BTVA 2A9FA 2FH5B 1E8DA 1GIAA 1KMIY 2VHYA 1C9NA 1OGJA 2PS0A 5B12A 5EJ7A 1Q5PA 4FX2A 1DEHA 4GOKA 3EXG1 4KYUA 4Q4HB 4QDTA 5BQPA 3Q11A 2AFIB 4LOAA 2F3QA 1A8IA 3D43A 1NWCA 2O0KA 3T1VA 4JJAA 4R81A 2GCEA 3ZH2A 2VK4A 2H48A 1HX7A 2VEOA 1NU8A 1TJPB 4NYJR 1L5NA 1O9BA 2V6IA 2VSXA 3EARA 4G2TA 3L18A 1QG4A 5KNBA 5FD8A 3PDIA 3I9JA 1Y1SA 4R1MA 5EWMB 2ODWA 1BD4A 4BXOB 2FEXA 3D5EA 4Q21A 3OHSX 1THZA 4JEIA 4XR4A 4H31A 3UT5B 1OZHA 3I9OA 4M21A 1G5HA 1L5WA 2G7MC 3KYJB 1CZOA 2P9EA 3E3LA 2F3UA 4BB6A 5I7RA 5U9CA 1YRHA 4RENA 1CE8B 2NZJA 3E23A 5DNAA 3PHJA 1RBZA 4ZAZA 5C4GB 2JD0A 3V7WA 3IAUA 1O9GA 3OU6A 3N2NA 4HYEA 3OJOA 3ZCTA 1ZQ1A 3KQYA 3GCDA 1KYTA 1MW9X 4GHWA 4N54A 1U0EA 1BEEA 1LVGA 1W46A 1ZG3A 2C4VA 1E64A 2ZRIA 4M2LA 4YRTA 3TFQA 4Z2AA 3DXFA 2IJGX 3LUBA 1MIOA 7ABPA 2BUAA 1T3ZA 2Q28A 2R8YA 3AOGA 4WEQA 3A4VA 3EHDA 1JR3D 2XNCA 3MMPA 4LVNA 1I3NA 3B9PA 2ASVA 3A6KA 1G8KA 1KPGA 2PKCA 3A9TA 4A92A 3SFTA 4CLRA 3IJ5A 4OB7A 5B2ZA 1RIIA 3RE1A 1Z63A 2WE7A 1O3YA 3K1YA 2QMOA 2DERA 3EGDA 1CDDA 4O1IA 5BRAA 4ZTBA 2NMVA 2IA5A 2LCFA 4EKGA 1UPXA 1OXUA 4FKZA 1E61A 2GHQA 4MRNA 1L4LA 4E09A 5BXQC 1E0SA 4XTCS 4S04A 1SUPA 5C3UA 3D1LA 3UC9A 3H1BA 2IIVA 2ZBDA 3WL6A 3S29A 2A9VA 1DAHA 2C7GA 3UWPA 5CP8A 5BSHA 4GDFA 1J8YF 3VDRA 4INJA 4G0XA 4OFWA 2O2CA 1G8MA 2YJ4A 5BSGA 5HGXA 1PUXA 1Z6TA 3BDVA 2G67A 1J2JA 4J03A 4P9NA 4NCHA 4WOPA 4KGVA 5CA0B 4NE9A 1EFRA 5KEIA 3L4BA 4QICA 1XJ0A 3QIVA 2O06A 3T7EA 5AD1A 1JMYA 2JFPA 1GKKA 2GQ0A 3EXAA 5FI0B 4UDOA 5IUJC 3QBTA 2IZ7A 4LKRA 3ZLVA 3A6PC 4E5NA 2C9CA 2GF0A 3GN2A 4DLWA 1YZVA 1SXPA 4MVJG 1OYOA 4FR5A 1G20E 3JQBA 4MWBA 5FOXA 2XT0A 1T9DA 4HO1X 2OCIA 4QFCA 1P1IA 1P60A 2EBFX 3GLKA 4YFVA 4A0HA 5JXGA 1W52X 4CEHB 5WRFA 2R6CA 4BZXA 1GTG1 1XRQA 4MJ7A 4M9RA 2ZXEA 2DR0A 1U8UA 5EPEA 3UXEA 1M3SA 3GLHB 4DSTA 3G0IA 5BW8A 4ITRC 2BKAA 1AVTA 1QGUA 5IU6A 4WKOA 3FKSD 1NHGA 2IYVA 4RSRA 2XCLA 5DHAA 4A27A 1RJDA 1PZMA 4H9GA 3PNSA 1HDIA 1UOEA 2FSGA 2R5NA 4CF6A 1DAIA 1FXSA 4MAFA 1GPJA 3PS9A 1NVBA 3ESQA 4HLCA 5LP6C 1UXGA 3OVMA 1AGPA 2JA2A 4P7JA 5HG0A 1R15A 3SXPA 1Y6FA 1KI9A 1E2EA 4MGKR 1XZLA 3MMSA 1CF2O 1Y3AA 4MVYA 2WNSA 2EJWA 1Z82A 3C3PA 5CGQB 3Q3IA 1KERA 1S2IA 2LDXA 2XMPA 2XF8A 4LY9A 5FBKA 3VKVA 2FZGA 4UQPA 4MQ6A 4BVKA 1KKLA 4YGYA 4EJ2A 4DV4B 4FINA 3SLGA 3DV0A 1HL7A 1P73A 3FDFA 4G0UA 2RH5A 1UBOS 3FDJA 5CDUA 4P4LA 5LYJB 1IBMB 1HYBA 1EK6A 2OP0A 5J5CA 1GPDG 4Z49A 2HK8A 3DV9A 4JQOA 5F23A 1Y9AA 5J63A 1TLFA 1WMEA 4MSUA 4Q34A 3S2UA 1Y1KE 2EW2A 4HBGA 3ZWBA 2IITA 2R8OA 2KLBA 1XNRB 1U2SA 2FPLA 2QL6A 5KVAA 2ZSBA 2A57A 2Y77A 4L4YA 1J90A 2QNBA 5DXAA 1WB4A 1B0ZA 4DQLA 2C5EA 4X20A 1A7AA 4BGEA 4DT1B 5L6LB 2O8FB 2UZ1A 1F9EA 1PWYE 1Z4MA 5I9SA 1T8WA 1VKZA 5L3RA 3WFJA 1K7FB 3ZIAA 2PIAA 3HJNA 2D5LA 1ZXBA 1X39A 2Y0CA 4TV9F 2WKRA 4JP2A 1F2UA 5BNFA 3NHSA 1FU4A 2X5OA 5I51A 3RIEA 4ITUA 5LM3A 4KNWA 2LKCA 2HU5A 3P8ZA 1Q84A 3A6DA 3CE6A 4FIZA 4OF4A 2O5CA 3NG1A 3L0IB 4FGLA 3FCYA 1TO2E 3V7NA 2ODTX 4U2EA 3P2KA 1AXEA 2PA0A 3VR4H 3URKA 1I7SB 4MLPA 3FH0A 4F06A 4RNDB 5KTYA 1X9HA 2HV9A 1GTZA 4R5HA 2NU9A 1X7YB 4TN5A 3CUUA 1VMAA 3PNPA 1O6ZA 4AYWA 4YHHB 4ZVMA 5CDYA 1CUDA 5DRTA 3H11A 2ZAOA 3LYLA 5CCEA 4UC0A 2W6CX 4ZHQB 4OQEA 1KEUA 2GA8A 1ULSA 1M6YA 3NHRA 4U0JA 1A8UA 4QGBA 3FWZA 2J9ZB 1MJFA 2WRZA 3KDAA 3QG1A 3QVVA 4AROA 2VQSA 4TMTA 2LXNA 2A9QA 1B2RA 2Q0SA 2DQKA 5FYQA 1RWBA 3M6IA 4JITA 3MHTA 1Z6PA 3DMRA 3LDGA 1KDZA 2XCQA 1SOUA 4NHEA 4UMDA 4ZEVA 1RDFA 3AVWA 4ZI5A 3DKRA 3N2GB 4TS9A 3LBFA 1NFRA 4GD3Q 1TTPB 1QHIA 4V02A 2JIZD 1B6TA 3LIPA 4OKSA 2XA2A 2W2QA 3OQPA 4KQMA 5JSZA 3FMGA 1RQLA 3I72A 3IILA 4Z7NB 4Y18A 2FSUA 4WQMA 3P71T 1MZPA 4E94A 4BJ5A 3JW8A 2W2TA 3WGZA 1MTZA 3OJFA 2ONZA 4F60A 2ZUBA 3MF4A 3COZA 3E1GA 4X00A 3C3BA 3E3MA 1AUPA 4YMSA 3VNBA 4E32A 1QGED 1OLXA 1NBMA 2CHEA 3R74A 5G3YA 3U9SA 1UZAA 3LDHA 1V37A 2WPDA 3COWA 3OJ0A 4NJOA 5G2OA 1CIPA 3TPFA 5LMUB 4EPWA 1OVMA 1CUVA 4YXFA 1A4RA 2OGUA 1N8NA 2QJFA 1NXWA 3EWAA 4REQA 4N47A 1MBZA 4ZQGA 3TB6A 5K8CA 3AUTA 2IHYA 1EH5A 3C6ZA 4HDKB 1P31A 3EIQA 3S2GA 4FYPA 3DMPA 3OF3A 4MS4B 3P26A 3DBHA 4L5AA 1QH9A 5KJ6A 1SCUA 1PSDA 4XJVA 3LQ1A 2A14A 2ZYRA 4DBZA 1X7ZB 2F1JA 4UVIA 2Y1GA 1Y4AE 4TROA 1VJRA 4JUCA 3LQQA 4XRRA 3FGOA 1PUIA 4KDRA 3ZNOA 5HZGA 3I0ZA 2OHGA 3HP7A 3KTAA 1IXRC 3KZMA 5E6UA 5I8ZA 3UAGA 3QEOA 2P9CA 3EAQA 3TBHA 1IIBA 5IG2A 3HSSA 3KPYA 2EKPA 3KOMA 3TTVA 4F6RA 1IL0A 1RYMA 3F3MA 3Q85A 3VVBA 5HKKD 3V4RA 3DO8A 4NMXB 2OAP1 1J00A 1Z28A 1Z06A 4CIWA 2VSNA 4M49A 4YRQA 4C2BA 2BR3A 2Z6VA 1UMCB 1RCUA 2OR3A 1IQPA 4KNVA 2B2CA 3TLCA 2PG3A 4Y67A 1GJRA 4K9NA 2PS3A 3DXZA 4P38A 3NUGA 3PQEA 4D9EA 2HMAA 3VDXA 1ID8A 1M8FA 4I08A 4MW1A 5EQFA 3NU1A 3UB2A 4WY2A 1NHWA 4HMPA 3C6MA 2B9VA 4WNAA 2HV8A 3WSWA 2ZAMA 2XD9A 3FYTA 4ZMBA 2WEKA 3Q8LA 4CCYA 3DWIA 3Q6NA 6ABPA 4DMKA 4DC9A 3GRRA 5G1PA 2JK0A 2A3NA 1C0LA 2GZDA 3Q8WA 3WYDA 1Z5UA 3EGWA 3K6JA 5KYYB 1QC5A 2X0NA 2JLAA 3BWXA 1HE8B 1LTHR 3AVUA 1FIUA 3HUEA 3CISA 4AG5A 3BXEA 1I7NA 4YQZA 4B83A 1CJUC 5BUQA 1IRXA 4XQEA 5BYJA 3DJFA 4F2HA 5KKCA 4CVNA 3CRNA 5KDLA 4LDRA 1BE8A 4CI9A 5I7OA 1MORA 4MI1A 2C5BA 5J4LA 4TRNA 3LT2A 1LS1A 2WJHA 2OV1A 1NQXA 1IJEA 4J0EA 5K0NA 3VISA 4L9WA 4F8EA 3KG2A 7REQA 2QAJA 1V1RA 3I0NA 3QUBA 3EGEA 4M0EA 2ZBVA 1KDTA 1XLUA 2IXEA 4A7PA 4E2YA 1Z37A 1TZCA 2H4XA 2VTEA 1DO0A 4LJKA 3EE6A 3KBBA 1GPBA 4QGAA 1FFAA 3JAKA 3BIWA 1GZVA 1WDTA 1U7ZA 5A04A 2VBCA 1OXBB 4I9HA 4Z4FA 3GEIA 2EV9A 2EWVA 2HDHA 3N3BC 5E9AA 5EZYF 5ARDA 3TBFA 3ZQJA 2CSUA 4HP8A 1T6NA 3EXG2 4OHZA 3OTOB 4MCAA 4HEA1 4BNDA 4DYHA 1NPDA 1E63A 1XQ9A 3D1VA 3GD7A 4L76A 4UUQA 3RVKA 5D3KA 1XZMA 3C7CB 4JOSA 3RSGA 1LVUA 4L9AA 3JD1A 2JGAA 2B7BA 1ZEJA 5TB5A 2HCTA 2WWWA 4KR9A 1XQVA 4QLOA 3FCOA 1OKKD 3KUUA 4DWJA 1CRQA 3T7TA 4IQGA 2L19A 4ZFNA 1LTKA 4OXXA 1JPVA 2H2IA 3GG9A 3H8JA 4X1KA 4ZJUA 1QQ6A 3IVXA 1NMSA 4RKWA 4PAWA 4HNTA 3GRVA 2YICA 3Q9LA 5G1OA 3R3JA 5KNBH 3B20A 1PEKE 1CLUA 5EFOA 4WH0A 1Z45A 1A9QA 1R0XA 1R74A 5BQXA 4CQJA 4BFSA 1E8MA 1KS9A 2P6UA 5D51S 2J48A 4JIMA 5FTLA 2BMEA 3SY8A 3OZFA 1LWNA 2OCDA 3AJDA 3WGGA 2R1VA 4WXMA 4O5OA 3WWOA 3N8HA 3WQQA 1GSOA 2PO5A 2X0DA 4HX5A 4DLUA 4O1MA 1FUIA 1MA0A 1RYNA 2MINB 3JYHA 4QPCA 5EY5B 3SX2A 4K9MA 1K8YB 2O0LA 2VZ8A 3DZHA 2GYYA 2JGMA 2WF5A 3ZC3A 2PQMA 3FJOA 1BKSB 4P58A 5BV2P 1JH9A 1Z17A 2P7IA 3P9CA 1Z83A 5LMZA 4OI4A 2ISCA 4INPA 2E5WA 5KVVA 1RVDA 1JIKA 2OFXA 1XZPA 2W93A 1DJPA 1RACA 4MEAA 4DY6A 1RC1A 3LPLA 1FDSA 3V9AA 3W5SA 3ZWKA 3DFFA 1E79D 1OVGA 1TQDA 3QEMA 1X87A 2JGFA 4A3SA 2XRMA 4ZQEA 5C52B 2VRWA 4XIIA 4NBUA 4DMRA 4BKQA 3A32A 4I50F 2C8LA 2H3HA 2PX2A 3O1IC 3RS0A 2BKLA 3W5AA 2WHYA 3TZKA 2R62A 3IURA 4RUKA 1C8LA 5C1IA 1XZJA 3IR5A 3OPMA 5TGZA 5TMDA 3SQDA 3KT8A 1P1HA 1RC8A 2QSZA 1Z4LA 1DP4A 1TEXA 3C8ZA 3E9MA 3CLVA 2JRCA 2O8CB 2RGEA 3VO9A 2PZKA 2WJGA 4RH3A 3KBOA 4HQKA 5BSKA 5I9LA 3R3UA 4L07A 1Y9EA 1OBCA 3MCZA 3PF9A 4XXHA 4TM7A 1PX2A 1Z74A 4PZZA 2FFRA 2OBFA 4JEMA 2Q0HA 1JH8A 2I03A 4KU4A 2YYAA 4NENA 3MIZA 3E27A 1LV7A 4GWGA 4U02A 1AKWA 2XB6A 3K9CA 1BWQA 1KZ1A 3L7LA 2EDAA 3VAZA 1YS6A 2G5TA 3DZCA 4CM1A 4MI6A 4TYYA 4FSDA 4PYIA 4UUPA 1YS2X 2NXNA 1D2HA 4E5UA 2FUEA 2X40A 5B2FA 1MFPA 1NBEA 5ALZA 4BFYA 3OC0A 1TJYA 4LCEA 4V3CA 2GPAA 4HAYA 1GV0A 1RRKA 2OPBA 2IV3A 2E0IA 2AX3A 3IQEA 3QWIA 3IEMA 2YNMA 3PZBA 3Q7SA 1VB3A 1NXPA 2FSVA 2XY4A 2VSYA 1M5RA 2F3SA 4PICA 1XTJA 3LXRA 4AQYB 4UTXA 1NV8A 1YZYA 2I1LA 2JGKA 2XKAA 3MT0A 1LBHA 1F4VA 3KM0A 2CDNA 1Y1PA 4ZI7F 2X9LA 4TKUB 1ZXLA 2H52A 5LXTF 4K8RB 1ORRA 5K8JB 4FOTA 1BJTA 4WKNA 1ONSA 4FJ1A 3TNYA 2ZANA 5B36A 5CFPA 5DSZA 2SICE 1WMDA 1FZTA 4CU5A 5IMBA 3V2GA 3DT8A 1Q3KA 2XX3A 4JX9A 1E5QA 1WETA 3EGXB 4IEEA 2IP2A 2ZJ4A 3GGSA 1U9YA 1V9LA 3GQBB 5TF4A 5FTMA 3SU8A 3F6PA 1NRWA 2YY5A 4W8GA 2I3GA 1NIJA 4ZALA 4HWOA 1I7DA 3FFWA 1NQWA 1STOA 2NVOA 3GUUA 3OPYI 4X24A 3VR4D 3WZMA 5BN1A 2EIXA 2F2TA 4DG5A 1ZESA 3COJA 1Q7CA 4NWIA 5FTWA 5F51A 2OHFA 4LHWA 4EJMA 3CN7A 3RH0A 2CT8A 1PT7A 2QD1A 4IDHA 4MA4A 4DCCA 3KSRA 4DTCA 4MYRA 1CYEA 3PU6A 5T4EA 3HB4X 3A4NA 3ZD8A 1TKCA 5CA1F 2ONJA 3FD8A 2H1OA 2V7QD 4XYGA 5K6RA 3WIEA 4UNIA 3JWPA 3S3TA 2JLYA 3H5WA 2G09A 1Z4KA 3UMMA 5TQ2B 2ZYTX 3HXLA 3I39X 3ZE8A 3LU1A 2ZIAA 3O84A 4NE7A 5D01A 5AKIA 2BE7A 1JBEA 5H68A 2I2XB 5E2BA 2Z83A 3WQBA 4C76A 1T4GA 2HHAA 1NF3A 3PHGA 4OJQA 1FP4B 3PD7A 4YI5A 5ITSA 1Q21A 5A4JA 2C82A 2F43B 2B4YA 3WLAA 3DCIA 2Y6VA 3HK2A 1Z88A 4QU8A 4DLAA 5HM8A 1UKYA 3LF2A 4Q9NA 2IH2A 2WWXA 3BBLA 2QT0A 2D59A 4EHFA 3RRBA 3FOZA 1UP6A 5A4FS 5DM0A 5I47A 1OMOA 2YWJA 1J39A 1ULHA 4QX6A 1RKBA 4J3JA 4FMDF 3PPXA 1KZHA 1JAHA 5DP1A 2C3OA 4ABTA 4DAEA 4L3WA 4EBFA 1T4CB 3FSJX 3G0HA 4UAGA 4KSBA 2WU8A 2X5NA 5E3HA 1SXIA 2CCGA 1O0CA 2AGVA 4J0GA 3WB1A 2WKSA 1UOQA 3U17A 3DKPA 3KQSA 2P11A 3H1TA 5AOAA 3OD5A 4FFVA 5DLEA 3Q0EA 1IDN1 3U49A 2GJ9A 1U9IC 2Q3CA 2W98A 4AMBA 1Z0KA 2XUDA 2PZGA 4D96A 5G41A 1B00A 1RI4A 2QI9C 1L4FA 3B85A 3S99A 3KTDA 2BGGA 2F4VB 1X80B 2CN1A 3K9HA 3Q7QA 4X71A 4HXEB 3SQNA 4BWGA 3MTQA 1B23P 2QL9A 4R16A 5AW0A 2CW5A 2O1SA 3HTXA 1KO5A 1Y42X 2IEAA 3ND9A 2HB6A 4RZHA 4HWSA 5ALOA 2GCOA 4QTTB 1EE2A 3EB9A 5EIFA 1EUZA 2C9OA 5H02A 1LS6A 3CLUC 2C61A 1SU6A 2W2NA 4GG1A 4D6PA 1Q83A 1IZYA 1NQTA 3FUWA 2Q6OA 3MC1A 3DBLB 3ROTA 4LRQA 4CNQA 4ZK6A 2HMTA 4F4JA 1GR0A 4AJJA 5JAPA 4CG1A 1IHDA 3CLUD 4ZT7A 1DOZA 3T7AA 1QGOA 4K8OA 5GZ1A 3B3AA 3WYFA 1KDOA 3SHQA 2C00A 1N5KA 3FHLA 4OG2A 3CN9A 5JANA 3ZDQA 1LA2A 2B1IA 2J3KA 5EE9A 3V4PB 3L8ZA 2GZ2A 1S0UA 3D3NA 1Z13A 3BTVA 3OQIA 4OGKA 2PX4A 7AT1A 1VBNA 5EHXA 3V8PA 3WRXC 1NBME 4JYCA 2PS9A 2XE6A 1CJKC 3EEYA 1FB5A 3SEAA 3SMVA 1C3LA 2PAFA 2YJ5A 3FCUB 5EWJA 3EIXA 1YCHA 4J43A 4LCJA 4GP6A 3H7IA 2VDWB 4CKWA 1U0OC 1A82A 2XW6A 5AYVA 1SU8A 2BZ0A 1D7OA 3NDJA 4B82A 2WYWA 1VDMA 1Z6AA 1VIMA 2GN2A 1T2AA 1EGMB 3ED5A 3GFBA 5KPJA 2VJQA 4Q4LA 4I1RA 3RLFA 3AETB 3ITKA 2YWDA 5LOVF 4NLLA 4XSGA 4XOUA 821PA 4OI0A 2DLCX 3A9CA 1RRCA 3CZQA 2Z5VA 3OA0A 3CNEA 3TD9A 3W04A 4EITA 4IXMA 2I6GA 3D3QA 4QD3A 2HCRA 3L4EA 4YUVA 3EG5A 4WZZA 1X13A 3ESAA 2O8EB 1U8AA 3ROFA 1IFXA 1XD8A 3K8QA 3N8KA 4I5FA 5IC6A 4WLNA 3WGLA 4Z4CA 1XPUA 1O5IA 1N7HA 2C42A 2A84A 2Y8EA 3ETGA 3JSAA 1ZIDA 3MWGA 1KYXA 3O2NA 5EXDA 4DJEC 4UTVA 3T9DA 2PGJA 2CHVA 4K6MA 4OTZA 4INOA 1UPBA 3HDQA 4HZGA 4MW6A 3T9CA 5TRTA 4EB8A 2F48A 3LTEA 4JYBA 3PYXA 1JS1X 2GCNA 3DTVA 3TI7A 3G5AA 4FDTA 4CMIA 1EP1B 3WKBA 1YOVA 1YDGA 1R4MB 2WWTA 3V3KA 3VTKA 4DV5B 3ZY6A 4ASUA 5JLJA 4R1QA 1LPPA 5JV5A 4LYDA 3EQ2A 5DMXA 5E1DA 4K6HA 1NV9A 2J07A 3WDKA 1WM1A 1OAAA 3T4PA 1CP3A 3NHPA 5CLLA 1P1RA 1QDUA 3O1LA 3ZEIA 5JCZA 1YBFA 1Y3HA 2QVZX 2F55A 1ZM2A 4F11A 2GS9A 4PXSA 2QF7A 2QX7A 4D8UA 3CR3C 2EP5A 3NH6A 4PZ0A 3U7QA 4M8IA 1ZCJA 5KNBD 3T1HB 4GE3A 2X8AA 1E66A 4WBNF 2PR2A 4PO3X 2VK1A 1EAMA 3BD7A 4WVLA 2C92A 3EUEA 2WFLB 1H3FA 421PA 1ESDA 4J7XA 1XCGB 1O97C 4S1NA 1KMHA 1G3RA 5DKFA 3ILSA 4QAJA 3H84A 3O0TA 4KLRA 1NLZA 4J75A 3LY8A 2PXCA 5J4YA 4TGLA 1MQAA 3G0OA 1VKJA 2F90A 2XDQB 3UK0A 4MQEA 4UBJA 1O97D 3UOWA 4TWZA 2PUFA 3L9WA 1EP3B 4QASA 5CJ2A 2OV6A 3TLJA 3EEFA 4MWZA 2FPWA 4JI6B 4RSGA 1JDJA 3P9IA 2ENUA 3FETA 4MGEA 2HK9A 2GN1A 1Z0IA 4YMGA 3LAWA 3E7DA 2JZCA 4YLEA 1H6AA 2PQ2A 5L4NA 1NM5A 3N8DA 4Q19A 4CF5A 1LGYA 4IXTA 4RF3A 1XMJA 3H4TA 1KSJA 3KFLA 1XMXA 1GYRA 1I7PA 3UA4A 3CNBA 3Q3CA 4ER3A 3Q9UA 1N2CB 3FOAA 5FWYA 1ACMA 5FUVA 4GQIA 2M6SA 2X8JB 2XLCA 3GLFB 3KSAC 1K0FA 1SELA 4OQZA 3BE8A 2CKMA 2J6CA 1NMXA 2P2NA 2X9VA 4YBRA 4X6XA 3CRQA 3L4BC 2HL6A 2JLCA 5DEIA 3G9XA 4LX8A 4MPDA 2PH5A 1R12A 1M7BA 2B4TO 1XCBA 3HGQA 3T7JA 1RVV1 3EVTA 3OPYA 3U7IA 3VGJA 2AHOA 1EFRD 1RLUA 4KDFA 3I04A 4LQDA 1AUVA 4DCJA 5A3QA 4AZVA 1W36C 3O82A 2HLHA 4EG8A 5REQA 1WCV1 3L40A 5T4HA 2QY6A 3IUEA 3JQBC 3FPLA 4HQLA 1T9CA 2RH9B 5IYZF 3RS9A 4IFIA 1YA8A 4Q4DA 3EYWA 4B32A 1Z26A 3NAZA 2VCHA 1W36D 2BELA 2PAAA 3U0VA 1UJ2A 2IEBA 3QX9A 4PX2A 4D5GA 5BNIA 3EFHA 3A2NA 1A2OA 5K8VA 1P5FA 4DLTA 2GMWA 5IHXA 1PO7A 3I4LA 4FW8A 1XDWA 2H1VA 1HR0B 3DCJA 3SR0A 1C8BA 2WM2A 1SD1A 3ZVRA 4PZEA 3LC1O 1QHSA 5FUBA 1V71A 1YQQA 1SKBA 3KD2A 3QEJA 3LP6A 4KMOA 1SUEA 5CCBA 2O8BB 1JDZA 4NU5A 1TDJA 3KFVA 4Q93A 4N40A 2H1CA 2F9FA 5C0OE 2Y0DA 4LW8A 3PFFA 3VU0A 5FDFA 1NI4B 5FF9A 5CVVA 3W4JA 4B84A 4H0CA 1XBTA 1COZA 2YJGA 2Q5EA 1A77A 1PEAA 2YZNA 3Q7PA 4N8EA 3L02A 1U5BB 2Z2XA 3GFRA 4KSYA 1ADJA 4RC9A 5IM5A 1RWKA 2ZR0A 1DPFA 2H8KA 3KTOA 3SF0A 1GNSA 1R9JA 1RAGA 2C59A 2VS1A 1MR3F 3B51X 3FIUA 3PFCA 2O2JA 4FNOA 2PPLA 1CUXA 3OIYA 2E55A 3D3KA 2GEFA 2QPAA 3O7WA 4L95C 2ORWA 4BEVA 5JRDS 4GMXA 2I2FA 1RWPA 2Q8PA 2ZYAA 1ZMTA 2I55A 3A58B 4GPTA 3Q3HA 5JD4A 1NW4A 2DE0X 2Z58A 2AXQA 1CDEA 4DRXB 4RPCA 1SU4A 3HR7A 4ME6A 4C7OA 1J8FA 4OIFA 4PS0A 3PT9A 4KBYA 3LBAA 1R4NA 5IBQA 4FZ3A 5C8YB 2R1TB 1II0A 3ETLA 3VH3A 3O2QB 1XOIA 5BSEA 1QHYA 2Q3LA 1K7CA 1PFWA 3V33A 1ZXXA 3MD0A 4MVJF 1DEAA 2OCKA 2Z4TA 4Q1AA 3CPJB 2F62A 2B3DA 4F38A 3ZDXB 5B4VA 4OHUA 3TLKA 4UCQA 4MW9A 3UGQA 4RD1A 1HE2A 4RTOA 3ECAA 3KCQA 2Q5CA 1SO8A 4WOJA 3ZIAD 1U8EA 4ZVPA 2R6AA 3D02A 3VHXB 2D62A 2BVNA 3AR2A 1YBHA 4D92A 3HJFA 2CWWA 1PJ3A 3K6SB 2UVPB 5C80A 4ZXPA 3TE6A 1PDWA 3ESDA 3V80A 3MS7A 4N3AA 3K70B 2EX4A 1XDGA 3QKSB 4QXOA 3ZBUA 2VT6A 3JU3A 5FLKA 3U3DA 2BFDA 2VLBA 2IYUA 5F3DA 1Y5IA 4K6GA 1LW7A 4CU2A 3AQIA 4TLBA 3HNPA 4D1YA 4EBBA 3M6LA 3ZGZA 4YJ2A 2VNJA 4G56A 4PZYA 1OLUA 3VZCA 4BNMA 5KREA 3EA5A 5KC8A 3P9RA 1NIPA 4UCWA 3ZTWA 5CITA 4CV1A 4U9HS 1HM5A 2CVFA 2C4MA 2QLNA 1R50A 4QU0A 4QNMA 1UQUA 2CXQA 5H3CA 3LC7O 1PF7E 1O57A 3H16A 5E2IA 4JBWA 4ALJA 2WDZA 5LP6B 1SU7A 5HF5A 1SGWA 4GSKA 4TV8F 4A1FA 3O8LA 5T7BA 4ZEWA 5TGDA 1N2SA 2LWIA 3G49A 3MJRA 1BFUA 1J0CA 3DDSA 2XJ9A 3VH4A 4GL2A 1HDYA 3I58A 1C14A 3MGAA 3AIOA 2DLDA 1FDUA 1VG8A 1SD2A 2KQUA 3RHTA 3NHFA 5CLFA 1KGDA 3KOOA 1T0BA 5AW3A 3ABZA 3GEEA 3TINA 1BX0A 2VDPB 2ZRJA 3LT1A 4CMHA 5HJ5A 2HADA 4YXWA 1HV8A 2N3ZA 1HFWA 3WXMA 1XT6A 3ELBA 2H1FA 2P2LA 2PRSA 2QNIA 1RAEA 4LZPA 1QUFA 2A58A 4JLBA 5G4KA 1PYOA 5GJVC 2WPDD 2AMJA 3KSMA 2PUWA 5DSXA 3NCTA 4HDSA 3UJCA 1PS0A 4B6OA 2UXCB 5AR1A 2AG0A 1EK1A 2R5FA 3N8NA 4ZA2A 2I2CA 4JCOA 3W7VA 1G66A 1GZ6A 3