1EFPB

Electron transfer flavoprotein (etf) from paracoccus denitrificans
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
b'MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVDELVGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
publication title Crystal structure of Paracoccus denitrificans electron transfer flavoprotein: structural and electrostatic analysis of a conserved flavin binding domain.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 71
structure length 246
sequence length 246
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1efpB00
1K4KA 1NP7A 4J76A 4EFKA 2ZP1A 5EKDA 1G8HA 4MUHA 1V47A 4MW6A 2WQ6A 1SURA 1KH3A 1PFUA 5DEOA 4MWDA 4K0RA 3HMQA 4MAFA 1KR2A 4MQ6A 3VRHA 4EG1A 4WNYA 3A2KA 2JAXA 2QTMA 2J08A 3P52A 2R5WA 1OWOA 3N2YA 2CT8A 5KCMA 3QTTA 4G5FA 3RFFA 3MUEA 4MULA 3N05A 1NUPA 3FDXA 3PNVA 1Q19A 3HGMA 3M5WA 2OQ2A 5JBNA 2Z3VA 3K32A 3TS1A 1N77A 4PBRA 3PNBA 4ND6A 1NSYA 1KQPA 1KORA 1WXEA 4H3SA 1J1ZA 4QRDA 1QU2A 1VBNA 4S1OA 3ZJVA 1MC1A 4KPUB 4J75A 5F23A 3CLTD 5H16A 1R6XA 1WXFA 2E89A 4NAHA 1XJQA 3JXEA 1EE1A 4MW5A 1O95C 4KKVA 1WXIA 3D6UA 2QJFA 2JANA 5J58A 1NUSA 4HK4A 5DK4A 2O8VA 1I6LA 3FIUA 1TYCA 1O96B 1M8FA 3HFJA 2DPLA 2AG6A 3SP1A 4ZCQA 3FOCA 1T6ZA 3IVCA 4EG7A 4MWCA 4KR9A 2J4DA 1DNPA 3IOEA 4KPUA 2DETA 3KFLA 3PXUA 5FO0A 2NZ2A 4YP5A 1WY5A 3CLRD 4ZT3A 4HPWA 3AKZA 4MUKA 3RHSA 2YY5A 3FI0A 3G6KA 3DLAA 1JMVA 3L92A 1MAWA 1MJHA 5HUHA 3FETA 1MOPA 1I6KA 1K97A 4JXXA 1IVSA 4ZT6A 2QJOA 1OWPA 5KHAA 3AL0C 3ZXSA 2XRZA 4JFAA 1KH2A 4Q93A 1O96A 3X1JA 4DDHA 1QTQA 1QNFA 1K4MA 4NDAA 1N78A 1YULA 1A8HA 1OWNA 1GPMA 3AFHA 1ILEA 1EUYA 2ZUFA 1D2RA 1F7UA 4MW2A 1OD6A 4ZCTA 4CDMA 5TS2A 1ZH6A 2D54A 4BWVA 4U7JA 3ISJA 4WSOA 1I6MA 2X1LA 4DDMA 1TYBE 4MUJA 1MB2A 1M83A 3SEQA 3HV0A 5DB4A 4YP7A 1IFXA 1WXGA 2AZXA 1EXDA 2PXHA 3COZA 4MLPA 1N2HA 1NYLA 1N2JA 3P0JA 4G5YA 3IMEA 1J1UA 3AIIA 3CLTC 3TQIA 1YI8A 1PG0A 1N3LA 1H3EA 1OWMA 1JEEA 2IP1A 4Q16A 2CV1A 2V0GA 1KP2A 4F4HA 1JGTA 5IJXA 1U7XA 2J09A 3CVUA 1JECA 2D5BA 1N2EA 2IELA 1KQOA 4NX2A 5BNZA 2Z09A 1GTSA 4RUKA 1TYAE 3FY4A 4MUNA 4YMIA 3UMVA 4PBSA 1H1TA 1WKBA 1F4LA 4QREA 4MW9A 3IDFA 3CLRC 4JZYA 1U3CA 1GTRA 1M8GA 1QQTA 1KAQA 3Q12A 3IODA 4MWEA 3K9WA 1T9GS 3P0IA 1EJ2A 1Y42X 1ULHA 1VBKA 2CYBA 1Q15A 3I05A 2CSXA 2E18A 2BTEA 1IQ0A 1MAUA 2O5RA 3GUZA 2QJTA 4MUGA 1M8KA 2AKEA 3H05A 2A1TR 3G59A 3IUBA 4I6GA 1WQ4A 4MW0A 4DNXA 3IVXA 1J09A 1LI7A 2PZ8A 3UOWA 3RBAA 2A7XA 2PG3A 5J59A 1VBMA 1NUTA 4R2MA 3H9BA 4JYZA 3IOBA 2E0IA 4AQ7A 3RK0A 1NUQA 1U0BB 1KKUA 5TGTA 1G8FA 2NSYA 2G36A 4MUEA 4DE5A 4U8HA 4CDNA 2CV2A 4HJXA 4DDKA 1BS2A 3GMIA 2J07A 3PNYA 3X1MA 2JA2A 4GU5A 3TQOA 5H7XA 4ZCRA 3ND6A 4A91A 3AG5A 4EG6A 4XFDA 1UFVA 1O97D 3H97A 4NZPA 5HG0A 2RE8A 3MMXA 5K0SA 1G59A 4XFJA 3CLUC 4G6ZA 2PIDA 2YWBA 3NV7A 4MW7A 3VGJA 1TYDE 1JIKA 4CQNA 5LM3A 4MVXA 2B7LA 3COVA 4MUIA 2A86A 3LCJA 3LOQA 1FFYA 1N2BA 2Z08A 4ND7A 3IH5A 2A88A 2GM3A 3IUEA 3SDBA 1TFUA 1WXHA 1GZUA 1M1ZA 5HUJA 2VTBA 3RJZA 1FYDA 3OTWA 2QUJA 2H2AA 1ZJWA 3RK1A 1Q11A 5TEVA 4ZT2A 3IOCA 4DJAA 1YIAA 2PFSA 1YUNA 1P7PA 3FG9A 4KR7A 4ZT5A 1J21A 1ZH0A 3KT3A 2QTNA 1F9AA 3CLSD 4ZCSA 3LE8A 1H3FA 3UC5A 3UY4A 3HZRA 3TZEA 2A1UB 3UK2A 3F3MA 4OUDB 3ELBA 2A4MA 3A04A 3AG6A 1R6TA 3ZJTA 3P0HA 1B6TA 4ZT7A 1GAXA 5FO1A 3BL5A 1WJGA 2QUKA 3SEZA 5K0TA 1J70A 2YWCA 4EG5A 4NAUA 4YP6A 5DASA 2BYTA 4U63A 3CR8A 3L93A 4ZCPA 2PZAA 4MUFA 5KWVA 1WOYA 2WQ7A 1VLHA 3CLUD 3OP1A 3CVVA 3NBKA 4YBRA 3ZGZA 4OJMX 3ZIUA 2DXIA 2A1UA 3CVYA 2QTRA 3MLBA 1NURA 3X1KA 4OUDA 2OV4A 4E1AA 1O97C 3CA8A 4EG8A 3VU8A 1U3DA 4ARIA 5TEWA 2HZ7A 1NUUA 3COYA 4MVWA 1LI5A 1JIIA 4L2IB 1KQNA 2DLCX 1M8JA 4UZFA 4CT0A 1EFVA 3H9CA 4DLPA 1IQRA 1TQ8A 2CV0A 3ND5A 1T6XA 3IVGA 1OWLA 2D13A 4EG4A 2A84A 2TS1A 4I6JA 1HYBA 4RPIA 1IRXA 2HMAA 3QTBA 4GRIA 2X0KA 1IH8A 2I1LA 1NZJA 5FNZA 3SYTA 1X6VA 2QUHA 1JHDA 3FHJA 1PFVA 1O94D 4EF6A 5LLTA 1KAMA 1K92A 3N9IA 4JXZA 4L2IA 1XNGA 4UZEA 1PG2A 1O6BA 5LFAA 5IHXA 1H3NA 3IMCA 4KR6A 3DPIA 2EL7A 2H29A 1EFPB 1M8PA 3CLSC 1N2GA 1XNHA 3ZJUA 3CVWA 1IHOA 1GN8A 4TS1A 1EUQA 4P2BA 3COWA 1O0CA 1G8GA 2IJGX 4PBTA 1YIDA 4ARCA 2DERA 3Q10A 2VTBB 1R6UA 1VL2A 1JIJA 1MB9A 3MLAA 3U1VA 2A1TS 4MVYA 1EFPA 5J5AA 2HGZA 1T6YA 3DV2A 4X0EA 1XNJA 3KT8A 1Q77A 3S3TA 1OBHA 4MW4A 1TEZA 1GLNA 1YUMA 3KT0A 1I2DA 1O5TA 3N8HA 4K03A 2VXOA 3ND7A 4F3RA 3D6VA 2ZUEA 1S4MA 2CFOA 4MW1A 1WQ3A 3ILVA 3SZ3A 2C5SA 4XSVA 1COZA 3MXTA 3CVXA 1N2OA 4FZJA 2WB2A 1QRSA 1QU3A 1JEDA 3FH0A 3FNRA 3ZUGA 1JILA 2DEUA 1O0BA 3HL4A 4PY2A 3IMGA 3Q4GA 5AHWA 3TNJA 1OBCA 2QUIA 3PRHA 1KP3A 4MVCA 1NI5A 1O94C 1PFYA 3DO8A 1QJCA 2CUZA 1J20A 4R0NA 2CYAA 2YXNA 4I6EA 3INNA 2V0CA 1N2IA 3G5AA 4QBTA 3NBAA 2GKSA 3E27A 2EJCA 1X8XA 3FWKA 3GLVA 3SZGA 4EGAA 1EFVB 1MRZA 3C8ZA 4AS1A 1O95D 4EG3A 1T9GR 1KH1A 3H99A 2X1MA 1QRTA 2CYCA 2WSIA 1QRUA 1CT9A 2RD2A 1U7DA 4HJRA 4R2LA 3ZXIA 1N75A 2GOYA 1WZ2A 4MWBA 1IQUA 1ZUNA 1JZQA 3KT6A 1F7VA 1MBZA 2DR2A 2DUMA 2X3FA 1N1DA 2E21A 3A05A 3TZLA 2PZBA 1LW7A 1PFWA 4NATA 1JZSA 2J5BA 3A4IA 3QE4A 2XRYA 1RQGA 4ZT4A 1V8FA
chains in the Genus database with same CATH superfamily
3M3HA 2B4QA 3I3OA 3KYBA 1MGPA 1XD9A 3E6AA 3K8QA 4H31A 3V2HA 1TUGA 3KP1A 1C3JA 3DD1A 4MW6A 5MN6A 3SWWA 4EUNA 2XJ4A 3W79A 2JD0A 3ADKA 1L8QA 1XDWA 2VDWB 4UHBA 3VRHA 4DEXA 5JMOA 4JV5B 3DV0A 4QTZA 1QIGA 1IEQA 3DCYA 1E3QA 3D7RA 3F4BA 4B7CA 4YV1A 2NXWA 2C04A 3FMPB 4EZEA 3GG2A 5KCMA 4AJPA 4W8HA 4DUGA 3CC8A 2Z5GA 4WNIA 2XBMA 4DDUA 3E23A 3HQ4O 2XOKA 2HA2A 4R0MA 4HLUC 4TQ9A 3LDFA 3GQBA 3KZKA 2HA6A 1DTWA 4BLSA 5JPIA 1CY2A 3L79A 3TCNA 4CT5A 4Y2HA 1SB8A 2ID9A 2HXYA 5BNWA 5T8KC 4I55B 1WBJB 3CEAA 5CXQA 5KYTA 3JQ9C 4UTRA 1IULA 3WIOA 4JC5A 3H87A 5KSWB 4LZAA 4XUEA 3AW8A 1MD9A 4J9UE 1N4DA 3E9YA 4V39A 721PA 5AVTA 2YNMD 3B53X 4D9HA 1H8HA 1R6XA 1H2EA 2OK7A 3EGVA 3H5OA 1NI3A 1NJ8A 3IDQA 1XJQA 4WASA 4ZJUA 4EA8A 1WSAA 4WUVA 2DT5A 2OCPA 3PHCA 2A5YB 4BKOA 1RBYA 3EGEA 4I4TB 1O5IA 4D4GA 4CTJA 3GDFA 1I1QB 5AJWA 4PO3X 4QYWA 3D6UA 1SCNE 2WYHA 3H4MA 3LBHA 3OCYA 5IZCC 2V98A 2C8LA 1I6LA 2Y1GA 2ZANA 1L5FA 3H6GA 2ZTUA 4OI2A 4Q9IA 3ROZA 4RJTA 3GJRA 2FUG1 3VPGA 2BI8A 4Q66C 4F3YA 3GVHA 4N47A 2AG6A 3CS3A 9LDTA 4JR2A 2F1RA 2NW6A 1HNWB 5TQ2B 2AFIE 3R5HA 1P19A 3JS5A 4N7MA 1UODA 3JPYA 3T1VA 1O4WA 1MHTA 1Y9DA 4QX6A 4AULA 4IQ8A 4BFLA 1GQRA 2ZM6B 4KL8S 3QUTA 1XPJA 3KR9A 5C1PA 4YDQA 1L5WA 3F0TA 1QX4A 3L6OO 4HP8A 2XXBA 1XLVA 1RHKA 1I51A 3L02A 2ECPA 1JEJA 4MCJA 5CVUA 3VNAA 2R8ZA 1GXSA 1SBTA 1IN1A 1STOA 2QJOA 3LC0A 1LNZA 5JUWA 2CXRA 3DC2A 3DDWA 1KEUA 4CKZA 3MS7A 2R25B 1GZ3A 1SQSA 3FDZA 4DR2B 3NUZA 1FDUA 2PXCA 3K1YA 3OIYA 3D8NA 1O03A 1A8HA 2KBEA 4QXAA 1KDVA 3GZNA 5L7TA 2P9EA 3QMVA 4KVAA 1NG1A 4WKOA 2OFWA 5JPCA 2P9JA 3G2NA 1OD6A 4U2FA 3WR5A 4TVKA 1A8IA 2D54A 2XBUA 4BWVA 3L05A 4HB0A 3R3YA 2VUTA 4QU9A 2PUJA 4C08A 5K3SA 2F9FA 3GY0A 1OW3B 4Z1MA 4DGSA 4CTNA 3A7DA 1TDJA 3DEIA 1LDNA 3IB6A 4MO9A 3RSLA 4GXRA 3B2NA 1DZIA 5A6SA 1MB2A 3TIGA 3LJKA 4Q9NA 2X2PA 4GG1A 3GI1A 3R6LA 1O9HA 1PDOA 1W88B 2HHLA 4CM9D 3EOAI 3HMKA 4F46A 4ODIA 1BGXT 1H2XA 1E6WA 5ERYA 2YBDA 1XJCA 1V1MA 4DCJA 3MBKA 4R81A 2BM1A 1U63A 1HMYA 2QPAA 3AF3A 4W5WA 3TO5A 5JNSA 3V3KA 1E4OA 5AIAA 1PN3A 1Y5RA 1XYYA 5DTMA 5EHZA 1G291 2ORWA 4LJ6A 4CMJA 2ZJYA 3AX6A 4V0NA 5AOCA 4CN9A 1H3EA 4BVKA 1OLUB 3Q6IA 2V7TA 2R8RA 2BI4A 4CU2A 4IVRA 1KP2A 2I67A 2W2NA 1IZZA 3BGIA 4PHCA 3DDOA 4XUGB 5I9BA 5TQJA 5F9HA 1PNVA 2HMSA 3KWJA 5CDYA 1E77A 1C0LA 6PFKA 5G4KA 2A3RA 5E8JA 3ZV7A 1M1YB 4W9MC 3D59A 3MGKA 1P9WA 1H23A 2P2DA 4WZZA 3EGXA 2XEXA 5ED0A 1F4LA 2P8JA 2YW9A 1W4BA 1CK4A 3MPOA 2YOFA 4MLCA 1SUAA 5AR1A 4L0MA 4AT1A 4AN0A 5TT0A 3HLKA 4C1NA 1DBSA 4KLAA 3BREA 2PR7A 3H2JA 6ADHA 5F5XA 2JIRA 2OCDA 1NIJA 2J59A 1U3CA 4PFKA 3PXDA 5K3BA 3OX1A 1PT8A 3U81A 2IX9A 3ZWVA 2NXCA 2ZJ1A 3BF7A 1V6SA 2Q21A 4E51A 1AZWA 2BFFB 2EV9A 1IOZA 3MJCA 3PUHA 3BJIC 5IANA 2PUBA 2XIQA 3B13B 2DPXA 1Y1QA 2FMXA 2LZ0A 4LGYA 4CI9A 1EVYA 4FLFA 5J23A 4N6NA 4YCAA 3TZ6A 1U8UA 3IA7A 1IXRC 4YRBA 1SOMA 3OD5A 5ABPA 4EIWA 2Q3LA 3VO2A 1EVKA 4BN5A 1XRJA 3BL6A 1LSUA 2P2NA 2RHLA 4FBLA 4OI4A 3C3PA 3H0KA 1G4UR 2MMGA 3EC7A 3PE4A 5FI3A 2A1IA 4QXPA 4YO7A 4NCJA 1U0RA 2FUG6 1VL8A 5DNAA 3RBZA 3JQQA 5DM4A 1C1HA 1XL0A 4KRYA 4YX9A 1F51E 1KJ8A 4PQFA 4P58A 3VHLB 3U40A 2BC9A 1WCIA 3IT0A 4UEQA 4LYDA 2VH2A 3CUSA 3S40A 5K4GA 4KCGA 3PTZA 1C3EA 4CMIA 1KMIY 3OSUA 1CJSA 2XAAA 1NVKA 4M89A 1T5HX 3CIOA 4JC0A 1G8FA 3VX4A 5CT8A 1C9EA 1IJKA 1WPXA 1QO9A 5COAA 3OJFA 3ZZUA 4D3FA 8ATCA 5KNBH 1F0NA 5A5FA 4NS4A 5BNFA 1N7JA 2WE8A 1KE2A 1BD3A 4BP3A 3H4TA 2C57A 1NL3A 1WUTA 2ZSKA 1EVZA 2WW8A 1B2LA 2WVHA 1WVIA 2WM9B 1G17A 1NOIA 4JAVC 1TC1A 3SFTA 3CKKA 5CLGA 3GLFE 1CJVC 4W8OA 1T8PA 3K9NA 4NZPA 5BSVA 4IDNA 3GEGA 1T6BY 3K1AA 4TRNA 1KQFA 4JXKA 3DTVB 3QP9A 4KR0A 1KFCB 3J81A 3OQJA 1CSEE 3NV7A 3TLJA 4DIBA 2A0XA 2PA3A 2ZQZA 4NU5A 6Q21A 2Z4RA 3ZE8A 2I7VA 4MVXA 5T67A 4BP9A 1YE8A 2BV3A 2OBBA 1WUHS 2FQXA 4UM9D 2AC2A 1XJ5A 3INYA 1Y9JA 1IEXA 5DWVA 4CIWA 3ZE9A 4JGGA 2N42A 1RZRA 4KV7A 2FWAA 3Q41A 1DEOA 3IXMA 5I51A 3TG8A 3IUEA 1N25A 5C3UA 3GCZA 3FHCB 4CRWB 4M98A 5KJFA 3KKMA 3LCMA 3CNNA 5DMHA 1SQ6A 2BGJA 3COPA 4O4IF 3RJZA 4F7WA 1Q0QA 3VR6D 2UXBB 2H2AA 3NBZC 5FR1A 3CKLA 3IOCA 4DJAA 2BDTA 2J1LA 3QUAA 5HKKA 1FB5A 4KTVE 1T35A 2GHRA 2HSJA 5G3ZA 3I30X 1E6KA 1GYRA 2QM3A 5GM2A 4XR9A 4IW3B 1C30A 3S44A 1BQ4A 3SJ7A 4DAOA 3V7WA 2BBOA 1X3LA 1C7QA 3G2LA 1HQDA 4I19A 4NYMR 1YB6A 2Z2XA 2FFJA 1OBFO 1QH8B 1V3TA 1E61A 3TZEA 4BFUA 1QPBA 2JEYA 1ODJA 3GUYA 4HNAA 3WLMA 1DJLA 5KX5A 1Q20A 1WF6A 1N34B 4FQ8A 4YDRA 1WBDA 3KOOA 3KZVA 3MWEB 1KSFX 1RAEA 4LSZA 2HF8A 4O8CA 1Z75A 3D4IA 1NN0A 4R2XA 3RUDA 5BR4A 3ZJTA 1YJQA 3TDNA 1QO0A 7GPBA 4G09A 2PGXA 3VH2A 5ALRA 1OXKB 2ZVQX 1T4GA 2P78A 4MB2A 1YQQA 3CMCO 4UCWA 3BJMA 5CCDA 3QHAA 5EKUA 4NJMA 2BHTA 2C95A 3V8VA 3O94A 4QNRA 1O6ZA 4JUCA 5LLDA 2G7ZA 3CVVA 2AZDA 1GDDA 2JF0A 1UKAA 3CRZA 4F5YA 4A73A 1P7ZA 4UTPA 1I3KA 1LX7A 4INOA 2OAP1 2AKAB 2XNJA 3KXPA 4M1OA 2GAFA 1W5AA 5A4AA 1VG1A 1O97C 1GTG1 1RHJA 1C3LA 1KDTA 4KQMA 3OCZA 5TEWA 2P6MA 2F48A 1W5BA 3QI7A 5CW1A 2FQYA 3K1ZA 3AB8A 4P08A 3KXKA 2JFFA 4JX9A 4ED9A 2H16A 2I2AA 3PUVA 1Y9AA 3AV3A 1P0QA 1EM8A 2BIFA 2X2EA 3DL2A 3ESAA 1NJSA 2GPJA 2ZJ8A 3C48A 5HKBA 4B4OA 1DBIA 2W6JA 1E9VA 3J81k 5IKOA 3ACCA 2WABA 2ZSDA 2A84A 4JMPA 2NZXA 3DMPA 5DHFA 2WP0A 1NAIA 4WXHA 3V7NA 3ESQA 2TSYB 1ZD5A 1PNOA 2GHTA 2I1LA 2ZIWB 3IXLA 1PVVA 5FNZA 1RHUA 1KZHA 2PUCA 3P2MA 4KX5A 4U2DA 3WS7A 3OMXA 3U4QA 2YY6A 3GFGA 1JRLA 1O94D 1X2BA 2WYVA 4UUBA 2IU3A 5E6UA 5ALXA 2ONKA 4CT4B 3E9NA 3HJHA 1K6EA 2ZZKA 2CK3A 3VX3A 4JC4A 1MV5A 3H1PA 4X9XA 5E2IA 4JVSB 3SXUA 2Y1DA 2FSUA 4CL8A 3ORHA 2NTVA 1OYYA 3B3QA 4NMMA 4LXIA 4U02A 1F1JA 1D2HA 4H2DA 3NVDA 3NVMB 4AG5A 4B5LA 4HDQB 2H4JA 3K53A 5E3IA 4CIAA 3DE2X 2BW0A 5E9JA 4LFCB 5G0SA 1LTHR 2JGJA 1MPXA 1XZDA 3K0EA 5FA8A 5LC1A 5J5VA 1N2SA 1YB1A 3EG5A 3GRRA 6ABPA 4ZTZB 1T1GA 1FX1A 3I8XA 1IB0A 4R7GA 1QTRA 4YJFA 4OHYA 4AY4A 3K2IA 1UXKA 3QVKA 1G8GA 2VNKA 3LWBA 3CG0A 1L4KA 3H8WA 2XV1A 4ITVA 4IZHA 1XQYA 2BVNA 4H0FA 4B76A 4D7AA 2DERA 4JQSA 2XUDA 5E7QA 1V0JA 4AZ0A 3KWLA 4MJLA 3DBRB 4DJFC 1XROA 1WPRA 1MO3A 16PKA 1HZZA 2FEWB 3DT8A 1G8JA 1F9EA 1MNAA 1NVBA 2BF4A 2HGZA 3FAKA 5C8YF 3G49A 2PV7A 1YTLA 1YDMA 4KI0A 5B4UA 2PVSA 1NHWA 2Q6IA 1YJBA 3OX4A 4WXMA 10MHA 4I66A 4YAEA 3ZE7A 3GFTA 3DYBA 4EPRA 2GPNA 4MA4A 2Q7OE 5AVWA 2OYCA 1JKFA 3CUKA 1IG0A 1H8ED 4H17A 5CVTA 1Y6ZA 2YJ3A 3O2JA 4TL6A 1IEVA 1CDEA 1QONA 4TTAA 5D2CA 3UV7A 4A6DA 2WU0A 4OJQA 1ZOPA 5F7XA 3W9SA 5JCOC 5CUQA 1EUZA 2WIFA 2EX0A 1R8JA 1YBAA 2DBZA 4JXJA 1QU3A 2GFQA 3IA2A 3W1VA 4D81A 5IDWA 5JRZA 2OBMA 3CUYA 3KDAA 4NBKA 4KFSA 3EDCA 3WNZA 1DSSG 4G4SP 1BMDA 2VPTA 9LDBA 3ZI4A 5EPEA 2GARA 4KO8A 3HWSA 1E1QA 2ZBDA 1KMNA 1H2AS 2CB0A 2RGWA 3SU8A 2FOIA 2HHCA 4LYFA 3PRHA 1PQUA 4F2PA 3SSMA 5CB4F 1XRNA 5JYEA 1TRHA 1KP3A 1P75A 2INGX 2OHIA 3P9QA 4DRZA 4FE3A 1YSCA 1YVDA 2IL1A 4UW9A 2H3EA 4JT9A 5T41A 5KOIA 2ZSAA 2OCXA 1ICEA 3F6CA 3T9DA 3AHGA 3ODGA 3BWVA 3ORFA 5ALIA 3RVBA 4I4CA 2IBMA 3TNFA 3QKWA 2B30A 4GR5A 4L4YA 3MLEA 1D6JA 2HMYB 3BK2A 2JFNA 1AO3A 3GLVA 2JJ1A 1EH5A 1FZQA 1M1YE 1UUFA 2BH9A 4M9SA 4UCFA 1T5SA 1SKQA 3FVWA 3P19A 4Y1GA 4Q9HA 5A2QA 5K45A 3E5MA 4NICA 4MX8A 2WFAA 4EUHA 1KY5A 2ATIA 2R6FA 2WJPA 4FM9A 3AEXA 4KUEA 5BMVF 1RLJA 4PAOA 1PCXA 3O47A 3T6KA 4AJHA 1KBZA 1G5QA 2EGGA 1H5UA 2YJTD 1OFUA 3OIFA 1F8GA 4G5QA 3I2KA 4L4RA 4PGAA 5DLEA 1NG9A 1TTTA 4Y0NA 4M1TA 4YY3B 5CRIA 3SDSA 4GZLA 3WFIA 1XUOA 5FUMA 1NI4A 2WA1A 3IC5A 1ZNWA 2MSNA 3Q5DA 3B85A 4HMOA 2O8FB 3UM9A 5EJAA 4IQFA 5KNBA 1ATIA 2WHXA 3OZBA 1RJDA 5TVKA 1P5FA 4QUKA 5F7OA 3W6UA 4H4DA 1FXSA 4PQGA 4B0OA 2JHFA 3DT6A 1P7YA 4NATA 4K6OA 3A6ZA 3MWDA 1A9QA 1LSSA 1PDWA 2HU7A 3HM9A 2AR7A 1UFOA 3BDIA 5ESDA 1UBOS 2P75A 2XCLA 1D2NA 1XCMA 2BOVA 1MZVA 2VHJA 1P4JA 4MP6A 5GADl 2D7CA 4X00A 2ODQA 2ZP1A 3ZY3A 1AHHA 1PQYA 1UJBA 5EA2A 2W7TA 3AU9A 3OPMA 1MQSA 2PLNA 3RODA 3NI2A 5EPOA 2FKNA 1CZUA 1AKTA 2WTEA 1U0LA 2OORC 3QY0A 5DEOA 4AZVA 2O1EA 2PMWB 1AS2A 1B0PA 1MB0A 3O4HA 3LRTA 2FSVC 4P3OA 1KQGA 4ZK6A 4Y2SA 4DSNA 3FWYA 3GLGB 2O3QA 1SEVA 2XDQB 2H2IA 5L45A 5C51B 5KNDD 1G8AA 1MDFA 2Q7XA 1QHHA 1RAHA 1G19A 1RYNA 2FR8A 2WAYA 3NG1A 3OFSA 3OSZA 4NPHA 3ZK8A 3MUEA 3E2MA 3N05A 2YV3A 2NZWA 1KK0A 4WZ6A 4N65A 4AF8A 2GBIA 1GAJA 3BF8A 3R77A 1DRKA 4QPNA 1E7YA 2LVBA 4BNFA 2FFQA 4KFUA 3NOOA 1T0JB 2AFRA 2N3ZA 1IOVA 2EP7A 4ND6A 4ZYWA 1AB5A 1JDJA 1DC7A 2G07A 2AA3A 3QV1A 4J0HA 1T9DA 4PC7A 1PZNA 1HPLA 3EXHA 4PO9A 4R1LA 4BB0A 4QBGB 2PS1A 3WK5A 1EG2A 1VKJA 2R4QA 1KSHA 3DWIA 4HQFA 5H16A 2IHZA 3QLTA 3R7LA 1Q7EA 2Z5LA 1RXSA 2I71A 5LP6A 2GK6A 3EZLA 4HS9A 4B71A 4DL9A 2J0UB 3D02A 2UV8A 4BAGA 5JO9A 1O95C 3MIZA 5B2FA 5ILGA 2PLAA 3C41J 4ZDKA 1BCRA 1GSIA 2WZBA 1Q17A 2GVNA 4KSYA 4NBTA 2QMQA 4UUPA 2Y1LA 2Z1MA 3J7TA 3AY3A 3R5FA 1NU6A 2G1JA 4C04A 2G67A 4G1UC 4V0QA 4G67A 4FFPA 2ZYWX 3F7TA 3FZQA 2VQEB 1JYFA 4KQ2A 4ZK2A 3B6MA 3IVCA 3G2JA 4MWCA 3F9IA 3OG9A 1G41A 1KJQA 1Q0TA 3KKLA 1S2GA 1U9CA 2C5HA 3JCZA 3UHAA 1MXHA 5A04A 1MA3A 5I01A 4QQRA 5GJVC 2GFHA 2Q3JA 4D80A 3QW2A 1UM9A 4J0EA 5C52B 1V37A 4X1KA 1E3SA 1JMVA 3I61A 2H2HA 2A9PA 1L7EA 4Q12A 2VJCA 1Q1GA 3OZEA 4Y9UA 2ZW9A 3OF2A 1N6RA 3A3YA 4B73A 1EUCB 4LN1A 5L8VA 1SG6A 2QN3A 3PLAE 2AYXA 4WL0A 3H3JA 3SC4A 1O96A 1YL6A 5DKFA 1F8YA 4DDHA 1QNFA 2D00A 4E08A 5LU8A 1WZIA 2RG7A 1M2OA 3E1SA 3S68A 3IBGA 3O2NA 3PSAA 4X20A 1XZCA 3IAUA 4QDJA 1TPZA 1F8XA 1A9YA 1TF7A 1UWCA 4XQ0A 1E20A 4MCIA 2EKLA 3KV1A 3NZEA 5KI6A 3CZAA 4CDMA 2PAFA 2ZB4A 3PC8C 4WHMA 1AGRA 1Z6ZA 1FVFA 5F76A 3I6MA 4IIYA 4Y6PA 5EWLB 4A2QA 1XQ9A 1T3GA 1MB3A 3ABOB 3E7PA 3EARA 3H2GA 3ZEAA 1K3FA 2IYEA 2HLHA 5TGDA 4C7XA 4IS3A 3EQ8A 3IKMB 2A0WA 2D8AA 4Q4CA 4Y2RA 1T9HA 2G17A 5IAGA 3HCRA 2BF7A 3NHAA 2GZ2A 1TJYA 4CYMA 2WMYA 4M0PA 2FOXA 5C1OA 4XGKA 4HI0E 2J0QA 1P8AA 4AQDA 3H5WA 3EN0A 3AILA 3DTTA 4U2BA 5FWXB 2FMTA 4F84A 1X8JA 3R3HA 1OI2A 4I4LA 2XUAA 1NMYA 2TMDA 3ASUA 3QMMA 1F2VA 1Z28A 4IHJF 2A0FA 1J0AA 4G5YA 2WWGA 1RWKA 2FLVA 1RC8A 2P7HA 2ZRQA 1CUEA 4FK8A 4KOEC 1HYQA 1KVQA 3AESA 2XTAA 1YS9A 2D3TA 1GLGA 4YECA 2WJYA 2OZLA 2F3RA 3ZY5A 5IT0A 2HA7A 1E89A 4HWGA 2QZ9A 4Q16A 3PPIA 1CW2B 3USZA 1YDWA 4XPIA 2FXIA 2PTGA 4RLSA 1CERA 2GZAA 3HVHA 5EE3A 1I4TD 3IDAA 4UMVA 4ZVNA 3VC1A 1KGDA 2W43A 4KGDA 3OEHD 4B6QA 4FQ7A 3LLCA 2EQBA 4B3XA 4HNTA 1IK4A 1E9FA 2VRCA 4YMIA 4B09A 3FFBA 1RXEA 1Z6GA 5FNVB 2YV1A 3SS7X 4AKSA 2V59A 1IVYA 2E87A 4R1QA 3FPKA 4RZXA 2ES4A 1IY8A 4MW9A 3IO5A 2XVZA 3L5KA 2PRIA 1OZAA 4V1CI 1SC9A 3EVNA 2W58A 3VPCA 4BE4A 3UAZA 1XVIA 5DXFA 3KQQA 1E2FA 1JHRA 5TV2A 5HDQA 4BTLA 3HSYA 2GN1A 4TV8A 3RRYA 1TKBA 1VBKA 2COKA 2XUJA 5DOZA 1ZC4A 5IUJC 1XQWA 1L7AA 4WW0A 1LZLA 4LY9A 4BEVA 1I2BA 2H4XA 2OPBA 3I8OA 5E4YA 3GBPA 1J7KA 3VPBA 3H05A 1YJXA 4ZAGA 5CA1F 3FNBA 2JLBA 1K7YA 1YONA 1JUDA 1Y1TA 2PTHA 2NZYA 1ZH2A 3LCCA 1OB2A 1E9SA 2Q4TA 3GRVA 4HAUA 4C43A 2OBYA 3H42B 3LGXA 3IALA 2BFBA 1DLIA 2OOKA 3KUCA 3JQEA 3AEUB 4KH1A 4PX3A 5AOVA 4TUYF 5LZ8A 4BIIA 3KB6A 1ISFA 2ATXA 2X14A 5SZIA 5BN1A 3QLEA 3BHJA 2ASEA 3KAQA 1JQ3A 4I14A 4BN0A 3H9BA 3I72A 1QO7A 1AIPA 4QBIA 2H7XA 2R7LA 2NU7B 1M6YA 1TTPB 1Y89A 1PVDA 1SXJA 1C9YA 4LKOA 2F6RA 3DP9A 5C3MA 1DQPA 1OZGA 5KO2A 3A9UA 1P73A 4YT5A 4P7KA 4LMPA 2C94A 2JAUA 2KJQA 3W4JA 5JAOA 1U6IA 5LMNB 3AJRA 4IQ0A 1XDDA 5KTYA 3SR0A 3FYUB 4OHRA 1ZU4A 4R71A 2HCJB 3TQOA 4YJ2F 2YZMA 1UMDB 4RKWA 3WKBA 1GUDA 1QKJA 2ZR9A 3ND6A 2C5EA 2CY0A 1I5OA 1U3WA 3UTDA 2NYAA 4F97A 1XD2B 5TDHA 1U7PA 1V2HE 1GZ5A 1XJWA 1PFQA 5ARDA 1R6AA 1PW5A 2G71A 4HLDA 4P6VF 4RFSB 3GLHA 4MR7A 2HA5A 5EZQA 2NSHA 3KSRA 1VRCA 3T7CA 4J0GA 5ELMA 3NANA 1OE0A 1YB4A 3LFTA 5FUBA 3IBCA 2H57A 3MTBA 4Y6GB 3M7IA 3TLAA 2VWQA 3O93A 4ETIA 2LRHA 4J2HA 5BQPA 3MIIA 4CM8A 4CZ2A 4PYNA 5FTNA 1YBHA 3EVGA 4W9NA 5F1PA 3EBOA 3P4YA 2XGJA 3CX7A 4H1WA 3ZX4A 4J0FA 5BSMA 3SYKA 4H7EA 3ST7A 2HMUA 3LT4A 4LMRA 3SDBA 2H5JA 2OUKA 1GGEA 4XGNA 4ZPXA 4AMBA 3VU3A 5ARCA 5IKEA 1B16A 5KYWA 2P27A 3GCDA 3PNKA 1SMKA 2REQA 3L8GA 1DBRA 3GGOA 3QF7A 4ZXFA 3RK1A 3NAMA 3KB1A 1Z2AA 2HXGA 4EI7A 1FLVA 2Y1WA 1X7YA 1VM6A 1WPGA 1CR1A 3R24A 3QFCA 2B1GA 2CNWD 3QPAA 4RZIA 3RTBA 1KHHA 3K72B 3OZVA 1ZH0A 4QZVA 3WLPA 3AO0B 4OBWA 1V71A 2WPNA 5FQNA 4DRXA 1BS9A 3EH2A 2WDPA 1V8DA 2CXXA 1H2RS 2YYYA 3O2SB 1L5OA 1TQHA 1YV9A 4LNHA 3FPGA 4OH7A 3SX4A 4DIOA 3WP1B 3QEAZ 1JBQA 2I1WA 4OUDB 3FVQA 1QFXA 1M1UA 2C9MA 1VIVA 3UOGA 1K66A 1ZGCA 1ZMRA 1W5FA 3BGOS 5C35A 1F2TB 5JSUA 3EZ9A 1MLDA 3I73A 4C4TA 2O8EB 1TLTA 3KJHA 2IH5A 2GCEA 4UFOA 4K40A 3NASA 4INAA 3DUFB 2LTAA 1WA5A 1HDEA 2Q0SA 1F14A 2XMPA 1EESA 4F4IA 2QVXX 5AHKA 1WOYA 2DULA 2VJKA 1K7XB 2PL5A 3OHSX 3WDMA 2H5LA 4UVGA 4QM6A 2I7TA 3FNIA 3V4FA 4I55F 4EDHA 3TDKA 3G5MA 4UM7A 1VMDA 1ZN2A 3IMKA 1NULA 1NURA 3GLGE 1H6CA 3L0BA 2HHHB 4YP1A 3KR1A 4FJ1A 3UKOA 3A9SA 4L0CA 4N39A 5FWAA 1P1FA 2Q3DA 3LA6A 4DV7B 4MR9A 1Z6QA 2F3UA 2Q6LA 1JLLA 2VS1A 3RS5A 4JIGA 4I4TF 1M8JA 5CH8A 1T24A 3NYRA 1W49A 1DKPA 3IBTA 1X7XA 1SC3A 3KVVA 1T6XA 3QNWA 1V39A 1HDRA 4K9NA 2ISSD 3ENKA 5ENZA 2HCRA 2UVPA 3DBHA 2IQIA 1JKJB 2VDKB 2WV9A 4Y2XA 3K0AA 4JB0A 4GDFA 2FSHA 1KI4A 2QZJA 3SZLA 1FLAA 1BXGB 3DQZA 3CH5A 3IJ5A 2XUIA 2JGAA 3FCYA 1D4FA 3M5CA 4QNNA 4V3CA 4KXUA 3ZXXA 3EH1A 2ILTA 1EWRA 4NRDA 4TMFA 4D9CA 3BVPA 1MEOA 3CN7A 3WG9A 2VRNA 3M81A 1M76A 3BDAA 2WZQA 4RSMA 4KIGA 3W78A 1QYWA 2C4HA 3KOMA 3M3DA 1P2GA 2ECKA 4X3CA 4FHGA 5G0UA 3AJ8A 2C4WA 5EIEA 1JFVA 5LMCA 7AT1A 1OXMA 1SKBA 3ZE6A 1KZ4A 2ZRLA 3HEAA 4E2XA 5J2TA 1ZIDA 4RULA 1H3NA 3IFSA 3STUA 5T6BA 2WC1A 3X43A 4D4IA 1S2OA 1CUXA 1QXSA 1NKSA 5HCIA 3PZBA 2RG1A 3U17A 4ID3A 1KI6A 5GJBA 4Q1EA 3CNBA 5HOEA 4ZZ2A 4X84A 4EELA 2G5GX 3W1WA 1TUBB 3MEQA 4C4XA 1P5JA 5BN4B 3WB2A 4EGJA 2YINC 4N3GA 4LBYA 3HWX1 4DIEA 3DKVA 1GV0A 3LC2O 4BJ6A 3QENA 2G4LA 3WLQA 2J3HA 4YQFA 3DF7A 3Q2IA 1TTHA 3B5IA 3BIOA 3PUZA 1IJEA 3T9CA 3ZHUA 5IMSA 2V0NA 1TQ6A 2X6RA 4C7KA 3C6QA 3A1NA 1IY1A 3ROKA 2H1SA 3W5AA 5ALPA 3HXPA 3A6DA 4HGYA 5CHYA 2QT1A 3NONA 5E1BA 1VB5A 3KPWA 2XKKA 1Q77A 1KOFA 3DBLA 3E35A 1A1SA 2R4TA 1M2NA 4PSKA 1PWEA 3DNPA 3S5UA 1GR0A 5CLFA 4D43A 4UNPA 1Z5GA 3LKZA 5DBHX 4DQDA 4BTVA 2YN0A 1Y81A 1Z6YA 3H86A 3IE2A 1NMSA 1YS6A 3WMGA 1WQ3A 4RM3A 5JHGB 3HK2A 3GEEA 2P4SA 4TLCA 4GI1A 4HQ6A 7ADHA 5ILOA 1JFFB 3WLAA 4C0SA 3BK7A 1OR8A 4FWTA 4NCNA 3ZZMA 3ZVMA 1DRVA 4ZDIA 1UDWA 2WAAA 1R9GA 2FPPA 1XKLA 4UXHA 4PC2A 4LVCA 5IJ0B 1H6BA 4MP3A 1BXKA 3DZHA 2VYVA 3N75A 3LH5A 2QUIA 4XJSA 3U7RA 1C9MA 3QEKA 1HE2A 2MMCA 3PL5A 4Q1BA 1ZOOA 4KAXA 3C5CA 1ND6A 1XN1A 2BMFA 3D7KA 4K6GA 1XMXA 4KYTA 1DAFA 4Z9XA 5D6OA 3UPUA 1FFEA 4PW0A 2J4CA 5LJLA 3FMIA 4IMRA 2VYFA 4C0AC 3ETHA 3UH0A 1NJGA 3QNMA 3ANNA 3GFOA 4BDTA 2SKDA 1PJ2A 3QI2A 4LCJA 3VPSA 3CTMA 2IRWA 1KJ9A 1M10A 2X77A 1CUSA 3EVBA 3MJTA 4NBVA 3PXGA 1VRWA 1RM5A 4F3CA 4Z4GA 1TJ4A 2B69A 3JQ7A 4L78A 4KWTA 4UAGA 4D2IA 5KYYB 2CYCA 5AVKA 3DGEC 4MRAA 2JLWA 3U7HB 2XNDD 2RBKA 2YQ4A 5JS1A 5KYKA 3FF1A 4HAYA 4DA7A 3GPCA 3IKVA 3I0ZA 3TR0A 1YDHA 2M9MA 4ZVSA 3WJ1A 4EVIA 3K15A 1JZQA 4EVQA 1FNNA 5FHRA 1I4LD 2IC5A 3TXAA 3DMTC 3QVOA 5EYPA 5KYUB 1NA5A 5EZ5A 2C20A 1XN4A 4BFVA 4BZQA 1R0CA 2O7QA 1GVNB 3MCTA 4BMDA 1I14A 1WM1A 2AN9A 2ZE7A 3SOPA 4D98A 4XVCA 3C6ZA 5DM1A 3NH6A 3BX1A 1KJIA 3MA0A 8MHTA 5AVVA 5I9IA 4MV3A 2CVQA 4HS4A 3UJ6A 1SCBA 4C7OA 4Q9AA 1RFGE 4TGLA 3ZS9A 3OPNA 4AWBA 3UXHA 4PRYA 5CFZA 1VJTA 2D1QA 4IXDA 1R1DA 1K5HA 1YQWA 3EEYA 4YGYA 1VJDA 2HJGA 2JLUA 3TG2A 1W1WA 1GA4A 5DGHA 1GKKA 4RD0A 5GINE 2B35A 2QDKA 3JARB 2ZRFA 1QZ3A 4LBZA 4P7FA 3NIWA 3IIMA 4URWR 4NYMQ 4YAOA 1IHDA 4K0RA 1N9ZA 3PEVA 1PJ8A 2Z58A 4UMEA 3CRVA 3BXEA 3WHPA 1DCTA 2V6IA 4IV8A 1QTIA 3I2JA 4FD2A 2AG1A 3S81A 5C80A 3X3HA 2G83A 3VNBA 4B34A 2R5WA 3O73A 1SVLA 2N75A 3JD0A 2NU6A 1ILWA 5DOVA 1CUBA 1L7QA 2YHIA 3H0EA 5FUWA 2CNNA 3BMNB 3CPJB 4I2VA 2OQVA 1X87A 4HN4B 3EXG1 4OAOA 3KQUA 2J30A 4D0RA 3ADDA 2WIGA 3HCPA 3SQMA 3RAGA 1ISMA 3B8EA 3USES 2YL2A 3I5UA 3RC9A 5P21A 3NORA 3OOWA 1UKZA 1OTXA 1VHDA 5H70A 3RVOA 1VL1A 2DTDA 1JS1X 1GQFA 1FTWA 1L1QA 2YVUA 1RKQA 1W87A 2RI0A 3QKIA 4E3WA 2HR1A 4PYQA 2YVAA 2FRVA 2DJ5A 3QWBA 1EZZA 4KV9A 5FOWA 4H59A 5AXBA 1YA6A 1W4ZA 1B42A 1JEYA 2XTNA 4DLUA 4M0FA 3Q2KA 5CEFA 2XUGA 1XKQA 2BFEB 2JAHA 1U8TA 1L9XA 4K9RA 4EJ2A 5I7FA 1U8CB 2DZDA 3I6ZA 3BT7A 4PZ0A 3ZD7A 4HK4A 1ETHA 1N1MA 3T7IA 3DLBA 4X6XA 3ZV4A 1KZ9A 1DBPA 4IOKA 1BRMA 1Y3IA 2J7KA 4RLFA 4LYEA 5FPPA 1M0SA 4Q4HB 3VAAA 4BMZA 4DCVA 5CFLA 3ICQB 5BUSA 4OYHA 2G9RA 2JHPA 2XA9A 1JSZA 1ZL0A 3EFHA 1OGIA 2F1OA 5EE5B 5AVJA 3UH1A 1A2OA 3Q7QA 2E37A 4OJKA 1N2XA 1MX3A 5AHRA 4YREA 1XCBA 3TTVA 4E5YA 3ESZA 3GG9A 4GZMA 4HF7A 4YP5A 3QWHA 1WTCA 5ALNA 1IHYA 5CFNA 4ZTBA 5JSQA 3RVDA 1A2QA 1LQTA 1MAWA 3EC2A 4CKEA 5JZMA 5JD6A 3QOYA 2PZJA 1I2AA 3D8RA 4B40A 4YASA 1CU1A 2JI8A 2TRSB 5FR2A 2HW8A 1K27A 1RAFA 3LL4A 2F43B 4XWAA 5EKXA 3FOWA 3O7WA 3S7ZA 1RYFA 4Q93A 4CDGA 2GAIA 2XMGA 4J0QA 3T5GA 3R0JA 1S0UA 4YACA 3ICWA 3BB4A 1YULA 2G70A 4WLUA 5HQ3B 1CVLA 4B35A 3U7QB 1ZJ4A 5GZ6A 1XFDA 1WUJS 3HKBA 4KQ6A 3K2QA 4NCIA 4ARZA 4YMTA 5M3BA 3WJ2A 1R5NA 4JLPA 4DV3B 1ZD3A 3RUAA 3W7VA 4NZMA 3THRA 4BMCA 4U1RA 3S1AB 1A3CA 4ER7A 4OVKA 3IPXA 4ENTA 3AIOA 2J6CA 3IQFA 2OB1A 3TMKA 4YXWA 4D9JA 1I01A 3OAAA 2OMEA 3OP4A 2DJIA 4PTYA 3JVUA 3SKYA 5IXSA 3N87A 1LBHA 3SEQA 2EFCB 2I54A 2VAWA 4RVOA 1PSWA 2HBYA 4BMSA 1Y8QA 3JATA 2QRVB 3W2TA 3MTQA 4X1OA 2NTNA 1NV8A 2C3YA 3A7EA 3CCCA 3PBKA 3QVVA 4KFRA 3COZA 4HGPA 1ZRSA 5BRJA 3RC7A 5C1BA 5JAPA 1GLVA 5KTSA 1DL5A 3ROMA 1E3JA 1A04A 2OAGA 5ICFA 3LP8A 3UHFA 1U2PA 3UF0A 2GD1O 2I4IA 5EJ8A 3FX2A 4L8GA 1KO7A 1AQNA 4O4JB 1BHO1 1UEJA 1JN0A 3M4ZA 3VNQA 3P32A 1R8SA 3NNNA 5BWOA 3T1TA 3DV0B 3P94A 5C4MA 3NHFA 5DMXA 1QOQB 2GTHA 4O2BB 3UJ7A 3CVUA 1E9RA 1RFLA 3WIVA 1MHPA 1PGNA 2IELA 4OGFA 1ZOSA 1EX6A 2Q6VA 1XU7A 3P2EA 1JDNA 1IIRA 1W36D 1W93A 3OQ1A 5BNIA 1AOXA 1DTWB 3UMVA 1WKBA 5FX2A 3ZWQA 5CXUA 2GPAA 1P9NA 3MINA 2FJ0A 2AOXA 2DP4E 5DO9A 1DLJA 1XHEA 3QBJA 4FMCB 5F4BA 2IZ1A 2FZKA 1TO2E 4ZZ1A 3EOBI 3JVVA 1D0SA 2PT5A 4QFDA 3EXEA 2J48A 4GYKA 4F9TA 1LPMA 1SQ0A 3L8FA 2FW9A 2SECE 4M1QA 4YRKA 5IVPA 4QM7A 3T7KA 1M5UA 3PGJA 3AJEA 1VMKA 2X15A 1AS3A 1NF3A 1UBGA 3KOWA 5D87A 4AJNA 1NP3A 2P62A 3FYDA 5AKZA 5KU1A 3JQAA 3PRKE 3N76A 1LLDA 3H5NA 4K9KA 4UC0A 1YR8A 3IP7A 3D0QA 3KB2A 4XIIA 1RYBA 3OLWA 2BTEA 4PNEA 5IDVA 3BG5A 3R5XA 1KTIA 3O74A 2ZWAA 2BR3A 1RAGA 2EGHA 2WM3A 3NT5A 4QWMA 2EW1A 2J9FA 3O4FA 4PEVA 4IIGA 2DHCA 1OPRA 1V16B 4PXSA 4BFXA 2COEA 3BCUA 3PD1A 5G3YA 2VDMB 4OXNA 3LK6A 1UP6A 1LBEA 2XQKA 3ICVA 3IESA 4LGVA 4Q34A 4WAUA 3PITA 4K8RB 3T1HB 4BS9A 3L7LA 4U7PB 3K5WA 1CIPA 1OQAA 3EJWA 3MELA 2AFVA 3O26A 3LIPA 3OUUA 1L3CA 4LV8B 4D26A 4XFKA 3LUAA 3HS3A 3WGQA 4OLFA 1RJ9A 2C4KA 1NW3A 2DY1A 3BE4A 5L3SB 4LYHA 3T5CA 3ANYB 3OHMA 3GHYA 4KRXA 2SICE 3N8GA 2QTCA 4DSAA 3KLMX 1DZ3A 3AINA 4MUEA 5DP2A 5FPSA 1JDZA 4P3YA 1UBJS 2V7UA 1EFRD 3NDIA 1K0FA 4GWGA 4R8VA 4A8JB 1ZESA 3FPEA 4IQGA 1QF9A 2NXJA 5B2EA 4RTRA 2GN0A 3TBFA 4GU5A 2I0FA 2YXPX 1DTSA 2B8NA 3GAAA 3LXXA 3TQHA 4Q4AA 3TVYA 5JVDA 4PFQA 4DT1A 1J33A 2WHYA 3BWYA 4F96A 2GGSA 1BMFA 4RESA 1C41A 3H2IA 4HH1A 4RPJA 5JJ5A 2AD5A 4BC0A 1NWCA 4EHLA 2DQKA 1XF1A 2H8KA 6YASA 2GSWA 1NVTA 4LWOA 3MMXA 3SQNA 2IYWA 4UREA 4JLSA 5BP7A 4UD2A 4W1RA 2ENUA 3KTFA 2Z2JA 3KYIB 3TCKA 2WDZA 4DLZA 2GDZA 3HUDA 1M6NA 4RK5A 5CXSA 3NT4A 5A6SB 3UMRA 1BOFA 4AWAA 2B1IA 2Q3HA 1QRRA 2DWPA 2FR8C 1HT3A 2ZYRA 1UOOA 1A7JA 3COVA 2AJLI 1UT8A 1ACLA 5JCJD 1VJCA 4I3GA 5JFOA 1PQPA 3QFSA 4HLQB 1YHYA 1N5KA 4KK4A 4YAFA 3ZCSA 1PO7A 2ZBEA 5FLKA 3GJXC 2O2JA 5KKAA 2H2GA 4L9AA 1SBIA 1B93A 2FP4A 1KYYA 1RBMA 4I8DA 2GBGA 1NXPA 3LV8A 3VR5H 4IIJF 3NH9A 3KIPA 4MV8A 4UNQA 3KKKA 1Q11A 4F8JA 2WWIA 2H1LA 4PAQA 1R4NA 5K4HA 5LP6C 2NPOA 2YQ5A 4HVCA 3QA3E 4WESB 1IU9A 3LUDA 3T34A 4D25A 1F6DA 2XF8A 1NV9A 3H16A 4QAJA 4W7IA 2TYSB 1SXPA 1JWLA 3OPYI 1L8XA 4HTFB 4J91A 1GGKA 3QYJA 3F49S 2VJMA 3CLSD 1MJGM 3UY4A 4EATA 2COUA 4TYQA 4GRAA 4LEIA 2BEWA 3BFXA 2WD8A 4RJJA 3PGVA 1U2QA 3E61A 3V2IA 1T5BA 4AURA 2FW7A 4OHMA 4B32A 1ZJ5A 2IYNA 4YONB 2RI6A 4MKRA 2RGGA 1KC1A 4WXPA 2Z6UA 1FRFS 3QV2A 1RADA 4DQXA 2H1OA 2IYZA 1K4YA 1LBIA 3LUCA 4RCZA 3T3GA 1ISJA 2IS1A 4FOLA 5BRNA 4O4HB 1N8NA 2JHGA 2XVXA 5AWFC 3SQWA 1Y8CA 3LXRA 3IAAA 1SVKA 3Q0TA 2X23A 1XMJA 1PJCA 4M22A 4EHKA 2BYTA 4FMPA 4Z4EA 1E9BA 2CD7A 1B23P 4GX2A 4F5EA 4FZ5A 3CLUD 5JC1A 3L82B 3NVKI 2RHHA 1WKCA 2IXFA 3AR6A 3OTGA 1SCDA 3MUNA 2ZJOA 2XB6A 4GL4A 4Q3DA 5JATA 4RK7A 3EWSA 2B94A 5JOQA 2EF1A 3JAMA 3LTEA 3TXYA 1P1RA 2RH8A 2IIVA 2A6PA 4JWKA 1EE9A 2XHEA 3FUXA 1QGZA 4UBMA 4W4TA 5AJYA 3SC2A 2K2QB 1I4EB 1JU9A 1VLVA 1ZSYA 3A27A 4XVUA 1GSOA 4XWTA 3SIWA 1F17A 1BG6A 3URMA 3BK1A 2CV0A 1KEPA 3FZEA 2WJWA 3AR3A 3PYLA 3EMDA 4JP8A 3ZOZA 4DPLA 3IJPA 3MOGA 3E70C 3KQSA 5ITZA 1FFGA 4HCJA 2YICA 2BN4A 1CZKA 2RSLA 4X94A 4JCOA 1KDZA 3OH8A 4GEKA 2EZTA 3HV2A 3BTVA 4YJGB 2MYTA 4ZAFA 3B78A 2CBXA 2NM0A 3FFWA 1Q0PA 3PI6A 4CMHA 5CLJA 2OSVA 4MINA 2YYAA 3PC6A 3ZH9B 2YR0A 4HH0A 5LKRA 3NBYC 2Q4RA 3KEFA 1UZUA 4JUIA 4EF6A 4R2IA 3WYFA 1QIKA 2GCPA 2DG2A 4Q7JB 3FGZA 1DC3A 3CNOA 3H1EA 4UULA 3QE3A 4F92B 4YCNA 4DIMA 4Y2VA 1SKMA 3NVAA 5ECDA 5C8VA 1PUIA 1E64A 3FR8A 4CJXA 2BZ1A 3K1AB 5LPNA 2REOA 4LNUB 4UKDA 4X3PA 4AMGA 1HKUA 4DMMA 5FUQA 4KR6A 1F3LA 3PJGA 3C5EA 2EL7A 3Q5EA 2ZYSA 2O0LA 3BSWA 4HC4A 3A4NA 1Y1KE 1H0SA 3PE6A 2JGIA 4KVFA 2HV9A 4OX9B 1HG0A 2ZWVA 2DWQA 1Y7LA 1LBQA 1Z22A 4FBMA 2GK3A 1JIXA 4JYCA 2GHIA 4GO1A 3WLJA 4D41A 2BDUA 4JBGA 2PUTA 3WLTA 2PL9A 4MGEA 1IE3A 4MS3A 4R9UC 3LUFA 1Q74A 3QLUA 1U2RA 1EJBA 3K6RA 2XBLA 3HSSA 4FC6A 4GLBA 1C8BA 4R4JA 3D5QA 5GJWC 2RJOA 3ZLUA 1L7DA 1VE5A 1QHNA 1YU9A 3DEKA 1DEHA 4GMKA 4W1PA 1K5PA 2ZSJA 4RDCA 2PKQO 4EPWA 4MQEA 1CF2O 2R6AA 3CWZA 4NMWA 1D0VA 4IILA 1A5BB 5BT9A 2IW1A 4Y3UA 2B61A 4ER3A 3AUKA 4EA9A 1VKRA 2WP8J 2L2QA 1RXWA 1VLQA 4QA9A 4OB6A 2KS6A 4HV4A 1IONA 1KO1A 1C30B 1WCYA 3H2ZA 3IERA 4I4IA 3KT8A 2YS7A 3T9BA 2RK3A 1XCJA 4X7MA 3DTVD 3S3TA 3OTOB 5ALZA 1EK2A 2C3PA 4FFOA 1H42A 4QDXA 2GR9A 2NUBA 4HDKA 3PB3A 2XYHA 1J0DA 2W2LA 4DLRA 1HZJA 3DM9B 2X42A 3I5AA 4HNAB 5ARBA 4ZAZA 4N9QA 4D57A 3OOSA 4MICA 1DG9A 2XMZA 1IZ0A 1ADYA 2CFTA 3PVSA 5I9NA 5JAQA 2I8AA 4MPRA 4C3VA 4ARUA 2QTZA 1LB1B 4TWJA 4F6RA 3F6RA 3O83A 1NFFA 1T3ZA 1KYIA 4JLMA 1RAIA 2E4VA 2OFOA 2PLWA 4A10A 5JWOA 3I53A 1YB5A 2ZI4A 4JJFA 2J3IA 1J2TA 3V7YA 5JNRA 1O0BA 4LE2A 1YBFA 3AIKA 4HNGA 3QFRA 1TVKA 5FKJA 5KUTA 1U3VA 2BFMA 4WN3A 4EQ6A 3AP3A 3CH6A 5AHWA 1NNI1 5FNVF 3TNJA 3VVLA 1WD7A 4WERA 3F97A 2QEQA 1E9DA 5IJ9A 1SXJC 2GWHA 4WY2A 2QSZA 4YUVA 4KTTE 3D8BA 1J20A 3GNLA 1JSRA 1R0WA 2FPGA 3AEKB 1PZXA 4AP9A 1ZJ6A 4CDRA 5JO0A 1LXCA 2F9MA 3F6YA 1PWZA 1U4NA 1UXIA 4CIVA 4OBBA 4XB1A 5E9QA 1XMIA 5H0IA 1X8XA 1MNQA 3OQPA 4EYQA 1BOOA 2DQSA 3PIDA 2VBCA 2PUEA 3V8BA 2GI4A 1P2BA 1EGHA 3QLJA 1AKMA 1M2GA 2FRDA 1N33B 1BSVA 2WJGA 3ZUPA 2WSIA 5DISB 1WDWB 3A1CA 5FAXA 2ZB3A 1P4GA 4PYJA 4QOSA 5G1PA 1U7DA 2YBEA 4DCGA 2GBCA 3OCWA 3ZXIA 1M2KA 3Q87B 2I2BA 2QT0A 1FVHA 3F2IA 3GAFA 1QFSA 2VP3A 3A0RB 2AD1A 3KYCA 4ZEXA 2CWDA 3QFHA 5BY2A 1JHUA 2ZIEA 1OHHD 3VR1A 3EX7C 2OL4A 3NJ8A 4IQ4A 1T4DA 1F7VA 4W9NC 3U4QB 1S9DA 3NC4A 1K6IA 1FK8A 1CQIA 2IEBA 2BEJA 1TM1E 2QTVA 4MV5A 5EIWA 3KVYA 3EUEA 2RJNA 2UYQA 1VE7A 2ZCVA 3QNUA 4PSVA 1VMAA 2PXXA 4QUHA 2CFRA 2PNJA 5TX7A 3WGKA 4EMUA 5JNUA 3CNEA 4TZTA 4D45A 4Y9SA 3T7SA 4F04A 4PSUA 2F8LA 4RTQA 1H2ZA 1CDZA 1GU0A 4WK0B 1VLLA 3UWMA 4QHYA 1BGVA 5KDLA 2C78A 3KQMA 2VPXA 2YV5A 4CFZA 1R66A 1VHTA 2Q27A 3WWDA 1Z06A 4BGDA 1ZLYA 2LW7A 5K0BA 3VOAA 1E94E 1V6AA 1G9SA 1WCWA 4MUHA 1Z12A 3M4NA 5SY9A 3TPZA 5GVSA 2OLKA 2I2FA 3W8NA 2WQ6A 1GZDA 3GP8A 1E6EA 1UBNA 4YJFB 3H8JA 3AM1A 3NXSA 1TGYA 1DWUA 2DKNA 2NLOA 2ZE5A 3RG8A 3RADC 3ECCA 3RGWS 2C0PA 1SVOA 3FPFA 4DKJA 1V1JA 5EIXA 1OBOA 2FE1A 2IXGA 4P3PA 2ODAA 1Z88A 3N58A 1FUUA 2JBWA 1ZK2A 1G6OA 1RQLA 1TI7A 5CM2Z 3R0XA 2VYNA 3T3HA 4F11A 3C1OA 1SIOA 1H2FA 2QGNA 5EJMA 5ESWA 3IULA 2GJ8A 2XVAA 1R15A 7MHTA 3FSEA 4D4HA 4OMCA 3VR5A 3NHMA 4E6PA 1T9KA 5FV4A 3SN6A 3AOEA 3G89A 4GGOA 5KQSA 1MENA 2VDUE 2X4LA 1MVOA 1Z37A 2YWJA 5CVVA 1JR4A 1JWAB 3O3MB 3HSKA 3U7JA 2CUTA 3NUGA 5EJ2A 1LF0A 5A1JA 2XI4A 3HXKA 4EHJA 5F23A 2WTMA 2PGDA 3RSCA 5IC5A 5AW0A 2E89A 4RKYA 1TL7C 3KOUA 4G89A 5E9AA 1DG3A 1EE1A 5T3YA 2MR5A 4WKNA 4KNWA 4K1LA 1UADA 4H16A 5K3FB 3IPAA 4F4FA 1JHPA 4JSTA 1U4SA 3LYHA 3V4VB 3FMVA 3IOMA 3D0RA 1MC8A 1SFRA 3KJGA 1HY3A 4GBMA 3FIUA 3OJLA 1A71A 3LCRA 1JALA 3W05A 4PC3A 3VR2A 1XVVA 4ZCQA 4JHLA 3L8ZA 4GMGA 3M34A 4BCCA 4M9RA 4DIUA 2JI4A 2PX0A 4RVSA 2J4DA 1JEQB 4UDXX 3VV2A 3T9FA 4G97A 2NPIA 2CJPA 1Y9EA 3CLRD 3BBLA 1NMEA 3DVAA 1Z35A 2X4GA 4MUKA 3BD8A 3IPYA 4AJJA 2WTBA 5HBGA 2E4ZA 4W6QA 1MJHA 1W2WB 2A5GA 1QV9A 4L22A 1I6KA 3OQVA 3ZHSA 4DBZA 1KETA 2Y6VA 2I1QA 1MPTA 2XD9A 3NUQA 5KHAA 4ZDJA 5JJIA 4TM8A 2XUHA 2YN4A 3KHUA 4JFAA 4I5DA 2GYYA 2R79A 1EE2A 3FSRA 2Y2UA 1EEHA 4TSFD 2GESA 3BTOA 2JCVA 4MDFA 4KRFA 3M2PA 5ADWA 4BJ5A 1E5DA 2CDBA 2UKDA 3AFHA 1QV7A 5CYGA 2H51A 4DLSA 2GZDA 3HXTA 3AZOA 4FHEA 5AKKA 3FHLA 2NVUB 1GFWA 1B3BA 3R3WA 3D4LA 3UPTA 3HKCB 1Z2DA 2JD2A 2P11A 2REXB 2WTNA 3AR7A 3KVNA 4LJ4A 3V8QA 4BNDB 3WISA 3EXIA 2GNPA 3K31A 4K87A 2RC6A 1DWOA 4WCFA 3NB0A 1IAVA 4JA0A 5H3CA 4XUCA 4UDOA 1RKUA 1UBRS 1BKSB 1OYVA 1BEZA 1UFQA 1YHZA 2OILA 1JHZA 2QE7D 3AUUA 3FYSA 1X38A 1V8PA 3I01M 4DSZA 2F55A 5F98A 4UVEA 3DOUA 1P17A 3W2GA 4DZZA 3JQ8A 1EXDA 5FUYA 1KR5A 1KI2A 3B7GA 1V45E 4HDAA 1NYLA 4O1HA 2FV8A 3DMHA 1ORIA 4GUAA 1SUBA 4GOXA 3CZCA 2V3VA 1IMJA 4ZFNA 1N3LA 3UKJA 3DXFA 5LQRA 2IK8A 2QYOA 1EXWA 2ZTLA 2YHBA 3EA0A 3G2KA 4RY0A 3TTWA 2NT4A 5BN5A 4D8WA 1TT7A 4BUZA 1Q21A 1N2EA 4DARA 1QHHB 5DE3A 1RZUA 3EFBA 4C6TA 1QVVA 2G1KA 2V7EA 4US2R 4A2PA 1XPUA 3UMCA 1ADGA 4CM5A 2PBRA 4FEAA 4RUKA 3EZ2A 2NXNA 2HU2A 3N2IA 4H08A 4Q3LA 4RK6A 1MX9A 1NJ2A 2DPYA 2RGYA 1GO2A 2PEZA 1TRKA 2B7CA 2I5PO 4ZO4A 1JLHA 1Z4JA 1GZ6A 3EAFA 1U0TA 3PQ4A 4UFNA 3BJRA 2QBYB 4Q21A 3EXHB 4Z6KA 2HDHA 3TECE 2PDAA 1JR2A 4HN2A 4CFYA 1CYEA 1JB9A 1U0NA 1QQTA 1RC0A 1COWA 2E49A 1KAQA 1MT3A 3JZMA 4MWEA 2CN1A 5ALYA 3G0DA 4PG4A 4YLYA 2XAUA 1EJ2A 5CLIA 3ZHRA 2NVBA 3KTAB 2CXPA 3PI7A 4HVLA 5HM6A 1T5IA 4Y7DA 4DABA 1BCRB 1X7WA 1VOTA 2IBSA 1NR5A 1MAUA 3LC7O 1YZQA 2BFDB 1P39A 1LCIA 5D7NA 1QIEA 3ZTTA 3SVLA 1BDMA 5BW8A 3H83A 4GMXA 2ZRHA 4FGWA 1O6GA 4IM7A 1ZEMA 1ZUHA 5EFOA 4EUKA 2W2MA 1E2PA 2VBGA 4AZSA 2G72A 2PZ8A 4RA6B 2AOTB 2RC5A 3EWIA 4DB2A 2VF8A 4C0QC 2RI1A 1E2MA 3ZHOA 1EZ4A 3I34X 3UGTA 4CQMA 5MGBA 3DWGA 1GA6A 1KYWA 1SC1A 2XR1A 3NHLA 1ZM9A 1HDIA 2ZJAA 4Z9YA 3GAMA 3FGNA 5DYTA 1L9KA 2OMKA 1GNRA 1W0JA 3LKVA 1HSZA 4FX5A 5IAEA 4RAOA 4KMMA 3KPVA 3IOBA 3O9MA 1ZXBA 3HZZA 4HVTA 4CG0A 1T0IA 2PUHA 2J9RA 1Q50A 1YA8A 3LWNA 3SZOA 1DRWA 3TSCA 2MT9A 2W9XA 3EZNA 1HR0B 1TW2A 3H1BA 3HE3A 2O8CB 1JR6A 5E2AA 4FD3A 4CDNA 1R27A 2BJWA 1ZK3A 4WJLA 2HPVA 3I9MA 4EKIA 1GR1A 5TRTA 2DFVA 4BCBA 4BNKA 4FI3F 2DOKA 1XA3A 3MZ0A 4PLFA 2Z2IA 2NUAA 1B8UA 1CRLA 1Z13A 4ESVA 4EKNB 5GWXA 3TX2A 3O31A 4EUSA 4ZYTA 3RREA 3CJQA 4K9QA 1Y1LA 2VEDA 2NACA 2VHUA 3DONA 4H7FA 4RF3A 3GXOA 4YO8A 1XMQB 3EIXA 1H6DA 2P9BA 3A8TA 3KE8A 4PS0A 2FSSA 5HZGA 2UXDB 4L4UA 1NQVA 2D5LA 3PXCX 3R6TA 5TIIA 2ZBPA 4JP2A 1C3OA 1AGYA 1U0HC 2A5LA 4MW7A 5AHOA 3VJMA 3ZGLA 3U61B 2O14A 4EB3A 4IRMA 1QDEA 3A9VA 4MR8B 4FC7A 2EW2A 1LS6A 1UAAA 1N2BA 4XVQA 2D0PB 3G2QA 1RM3A 4YRRA 1YMVA 3OMLA 2PFKA 3ZNOA 2HUNA 5EP3A 4D74A 1DINA 1EHCA 2A88A 2P3QA 2FGKA 3TNLA 3D4OA 3ETLA 3VVMA 6CHYA 1YBMA 2VHXA 3N3AC 1I3LA 1GL6A 3F8TA 1H2YA 4R84A 1OOEA 3AESB 3R7WA 4KHPB 3AY6A 4R2WA 3VGPA 4GL2A 1KDRA 1KMMA 1TZMA 2OZLB 3CISA 3REFA 1R00A 5LUAA 4Z8YA 1KU0A 3GZ4A 3PKZA 4ZT2A 3PKIA 3P2IA 4RVNA 3EIFA 4DC1A 5LBTA 4D3ZA 5LZ9A 2E7ZA 4BCDA 1NBMD 4ZVLA 2B2NA 1Z74A 2FN4A 3K5HA 3IP3A 2X8JA 3EPPA 4FW8A 1N7HA 4FBGA 4GI3A 2IEIA 4NDZA 4TKZA 1T0BA 5CA0B 1G3QA 2QM0A 4HB2A 1C1XA 4K6MA 2W93A 3QHPA 3L1IA 4ZQFA 2JVIA 1USUA 2A67A 3HO6A 3OTIA 4JUBA 4S04A 4V0RA 2ZULA 2BD0A 4A8HA 2GXAA 2XA1A 4YXFA 1EQUA 1WL8A 2WWXA 3AKCA 3GDHA 5SZKB 3ZW9A 3P0HA 4DS3A 4YR7A 1JP7A 1DMRA 1PLJA 2GM9A 1R0BA 3ZDCA 1O77A 3ANMA 4TV8B 1WP4A 4B83A 1K8RA 1M0WA 3O1JC 4U39A 1J2RA 2CLLB 3CKYA 3KAPA 3TZBA 3PP8A 3TSOA 3IX7A 1BE1A 1A5ZA 1JL3A 3HBFA 3LZ6A 4R1NA 4XOUA 4OH1A 2QVCA 2R11A 3EVDA 2XKJE 4GYJA 4N7JA 1GAXA 3H2HA 4Q7LA 1OKKD 2OHFA 1W0KA 4UNSA 4U8GA 5TF4A 3Q7EA 1KMHA 4LTNA 2P4EA 3G2HA 1M2VB 4MITA 1QH1A 1PL6A 1SUIA 1FVXA 4P3KA 1PGOA 3BEDA 1UT6A 3QELA 3OURA 1FC0A 2ID4A 4RTMA 1GZHB 4EFMA 2B36A 1F4PA 1YI1A 3MILA 2W6QA 4WK2B 4UCXA 1TO6A 5BN3A 1ECFA 1JR3E 2WJ3A 3BMCB 1L4NA 2QRQA 4TRRA 4R2JA 3W5DA 4Q19A 1BWQA 1RR6A 2YX1A 4W7HA 4HMQA 4N49A 4TROA 2JIBA 4Q9JA 3ZDXB 2DKOA 3ZN2A 2JLCA 3TIFA 1JA1A 4KEAA 5E38A 4YYEA 1N36B 2PKXA 1OI3A 1FTGA 2PBFA 2Z2ZA 3L8EA 3QTBA 3JD1A 1U31A 4GRIA 1MH1A 3AM4A 2OE2A 5TMBA 2VF2A 5BVHA 1QPGA 1JHDA 2HRRA 1LPNA 1PTJC 4EW2A 2O5EA 2VPIA 5DT9A 3EZ7A 3NOVA 2C2ZA 2IUEA 3TKLA 1LTKA 2QVBA 2DQ4A 3AR4A 3T3OA 1N9GB 4L2IA 2QTAA 5JQGA 3MFQA 4TTRA 5J4YA 3V4RA 2VP0A 3L6EA 1AE1A 1RWPA 3A11A 4M55A 4MR7B 1IZ9A 3HVIA 2YH2A 2PS9A 3GU3A 3RB8A 1QHXA 4G0NA 2KX7A 3GN1A 2ZB2A 1MU0A 1L8OA 5E0KB 3I32A 1DAHA 1EFTA 4R69A 4RNDB 1ZWLA 2OR3A 1HDXA 1C29B 1XNHA 3G1UA 1WU7A 2AXQA 2VUIB 1OAAA 2VH1A 2PBZA 2J3MA 3CEMA 3H0CA 3P7MA 1X7HA 4PZZA 4P2BA 4AX4A 3N28A 5JC8A 1MN6A 1MO2A 2ZITA 1YC5A 5AKGA 3AI2A 4CM1A 5LDDC 5JDCA 4YT4A 4ZHQB 2IJGX 1ISIA 2PWPA 1DI0A 4ARCA 1CR0A 4MKHA 1D1SA 3Q72A 5FADA 5GPBA 5T64A 3TM4A 4P1ZA 1EVQA 4TRJA 1OJ7A 3QVGA 2IH4A 1VYUA 3IAEA 1R8YA 4AZ3B 5C8XA 3OFVA 3T0FA 4ZCIA 1FPMA 2A1TS 4JLAA 1EFPA 1HNXB 4E7OA 1FP6A 3HJBA 4R68A 4X0EA 3HU3A 3LS2A 1IEWA 4AP6A 3P9NA 1Q5PA 5LQKA 4TTJA 3NM6B 2J0VA 4ECAA 4UATA 2C03A 1MXFA 1I2CA 4JKOA 2RH5A 1M2HA 4MW4A 1F4VA 3L0IB 3FYCA 3TPFA 1VIAA 1SA0B 1DARA 1O5TA 2NO9A 3R09A 4U7GA 2UYHA 4LISA 1AKWA 4TMXA 5FF9A 2AW3A 2VFAA 3KB8A 2JFZA 1BDJA 1MEJA 5ECYA 4GZ6A 3TLXA 1T9CA 2GCNA 1DRUA 1CC1S 4O2BF 1AHPA 3PXXA 3HLTA 4WOPA 4RTNA 1KMCA 1QFJA 1MFZA 1X9IA 2JW5A 3O3CA 3VDRA 2NN3C 3OHPA 3M5DA 2RONA 5DTIA 2KQUA 4KYUA 2OGWA 4UBNA 1Z15A 2FU5C 3EZ6A 3Q4GA 4QNMA 2R84A 4WQMA 1JDVA 3TRFA 5LMZA 1SU8A 1U94A 4M88A 4Z5XA 2RHBA 4DPKA 4FMCF 4FCTA 2AGVA 2F90A 1R0SA 2ZRAA 3H4VA 3AFNA 1QMPA 2ZI9A 5AW7A 2CYAA 4I36A 4Y98A 3SIPA 3QPWA 3SHFA 3VMMA 1ZHFA 2IPLA 3D43A 3C6KA 5JAHA 1P18A 1S8FA 3KHKA 4MR9B 3RS3A 1ONBA 1U8EA 1EP3B 3DF9A 5D51S 1K7FB 5KVAA 1S01A 1I7QB 4KXQA 4BXOA 3KEGA 1W75A 2WVGA 2WAMA 4EG3A 1ECCA 3CBGA 1W76A 1OUMA 3MJHA 4Z9AA 3RC1A 1HOTA 2AWNA 3I83A 1IM2A 2HJRA 4IGEA 3ZZ0A 4DDVA 1XZMA 1A8PA 5I8WA 3D5TA 1PR3A 4TKMA 5CT6A 4MPTA 3TSYA 4RSRA 5CPBA 3WE7A 5HRCA 4R1SA 2O4CA 4F71A 5JXGA 1MMFB 3HN2A 3KT6A 2BKAA 4LXTA 4KWHA 2GB4A 5DNDA 4OI0A 4OHVA 4QBHA 3UVEA 4MARA 1IWOA 4WKPA 2VWPA 3M70A 2X3FA 5BW6B 2AHOA 1Z7BA 1E7QA 5GIOE 3LUGA 3PRJA 1Z0SA 3BUSA 5K1ZA 4H4EA 1O89A 2ZJBA 1I4WA 1OLXA 2H48A 2PSEA 2YXDA 4KDRA 2XXJA 3F4KA 4E88A 1CUVA 3F8WA 2B78A 3GLIB 3Q7PA 4PNHA 4KMSA 4YQYA 1TLLA 2FF7A 4BFSA 2Y4OA 4L9RA 1GAQA 1CY1A 1FBTA 3ADPA 3KLPX 4KQHA 5EZ6B 4ZT4A 2QUBA 5ENDA 3T52A 5J2UA 2IE0A 1KI6B 1AZTA 1TMGE 1YR7A 2JH9A 5ALOA 4ZIRA 3JR7A 4ZJZA 2XMBA 2E85A 3HB1A 3L1HA 1RI2A 4NFLA 1AA9A 1JSLA 4TXLA 3RSFA 3WQQA 5BSGA 3TF5A 2RK6A 3AT1A 2WKWA 4EZIA 2YOHA 1KH3A 1G0OA 2G0NA 4NR0A 4LZOA 3TUJC 1G8SA 2JEOA 1RQXA 3Q40A 4R1PA 1GRRA 4IFBA 1FBNA 4RDXA 5AW1A 4BQRA 2DUNA 2QTMA 1TCBA 3FBWA 3V6LA 3T5TA 3ZS8A 4LFBB 1JV2B 2WVAA 3N2KB 1XQXA 3R9XA 5REQB 2WTXA 3N74A 1FE8A 5BUCA 1MW8X 3WMXA 4B2LA 3LU1A 2JGRA 2BI7A 1O6FA 1GN9A 3I2FA 3SEAA 2ZUWA 1NMQA 4K9MA 5H5JA 3UUFA 1H1DA 4EA6A 3UFXA 1V43A 2J3LA 4LXXA 1UEIA 1ZVKA 3E4DA 2P2CA 1BU5A 2IEAA 4I81A 4LC0A 3C8HA 1RYHA 1C9DB 1TMOA 4Y0VA 1YIOA 1L5MA 1YZKA 2A3NA 2CLSA 4KIJA 4XD7A 3THOA 2PUWA 2E1RA 2HA4A 4NEGA 5K0LA 3W5HA 2WU1A 4WNCA 3ZDQA 4ARVA 4J6EA 3M1IA 2ZBFA 2GK7A 1GCGA 2GDJA 2WM2A 4R9VA 3GPDG 2VAMA 4Z7QB 4HUQB 1DP4A 4MLDA 4RQBA 3VPDA 8ADHA 5I6DA 1PHRA 3DBOB 3DWFA 5K3CA 2C59A 2V7QD 1THZA 4KXWA 5FEMA 4XYBA 3R2JA 3GO4A 3A0UA 4EAAA 1PR9A 2QRHA 2FPPB 2IYTA 3ZHCA 1M8FA 1YRWA 4CV0A 4CLXA 3INGA 4PWZA 4TOIA 2C9YA 1NC1A 1R10A 3J80A 4NCAA 2WTUA 5I8ZA 5HSGA 4TL7A 4QLBA 4BRWA 2IUSA 3DHWC 1R9MA 4UTZA 4TT8A 4URHA 3T41A 1E9AA 2Q6KA 5FO0A 4HPWA 5EKTA 2BTQA 1A8SA 1NY6A 5FBWB 2O6HA 4W1QA 3RWOA 1C1DA 4GIBA 3U6KA 2VXBA 4BB6A 4NS1A 1FNDA 1DJQA 2P6NA 1IN5A 4HDMB 3HP7A 1V1RA 1YFKA 1U28C 2IVZA 3PDJA 2FK7A 4PHGA 1UKVY 5KVCA 3ZXSA 3CVOA 1TYEB 3KJQA 3JQ7B 3C4QA 4FR5A 4G4IA 1U8FO 2HEGA 1RWOA 3JSXA 3STVA 1PBTA 1N78A 2ZUTA 3Q3EA 5A3VA 4ENVA 1I1NA 5LXTA 2G5CA 4QARA 1UJ6A 1EUYA 5FTJA 1B4DA 1D2RA 3C7DB 3CZ5A 4LTDA 3L1JA 1EWQA 3I4FA 3A25A 4B74A 5CFRA 1IMOA 4OXKA 5B30A 3SBOA 3PCRB 4ESOA 2QN6A 1ICIA 4PIVA 3QLUC 1G55A 2UUAB 4YMGA 1E3IA 4BLWA 3D8UA 2P90A 2Y9PB 2DSNA 1G3UA 2M6LA 1R4AA 2PU7A 4FNGA 1ZEJA 4KE8A 3V8EA 1FYWA 2NV0A 2NTEA 4DV0B 1NVVQ 3RFXA 2E6UX 3HV0A 4XLTA 2N0SA 3BFVA 1MT0A 5LB2A 3GGCA 2FWPA 3P9RA 1FX0B 1K6MA 2BR4A 5JZSA 2XLBA 3H2YA 4MB6A 1PSDA 2PXHA 5LIPA 1M54A 4OUKX 4M21A 1N2JA 1UFRA 1J1UA 3NHZA 4LY0A 5H4HA 1DU4A 3B60A 3EIOA 1Z7GA 1QB8A 2EWMA 2PGAA 3DDUA 1LD3A 2WF5A 4IFTA 1FP1D 4UHEA 2P77A 4IJQA 3FOEC 4E4YA 1RYYA 4GPEA 3R5SA 3U3XA 1DHRA 5MFZA 1Y3BE 3A58B 5LNK6 1AGNA 3NC0C 1G63A 3EGOA 4YRGA 1FRVA 3WSTA 5DK6A 5JH7B 4B6GA 4KQWA 2YHIB 4EY6A 3PQDA 1WP9A 3CX3A 3ED5A 1E7SA 3FY4A 4MUNA 5EP1A 2XCOA 4I50A 1SGWA 3U1TA 3RJMA 1T43A 1MO6A 2OHHA 1Y4ZA 5EIAA 4ACBA 2J3KA 4QREA 5HEKA 1P0PA 2Y1OA 3LCUA 5FI5A 3VA7A 1XSEA 3AI3A 3R76A 4L8VA 4MKFA 3L0DA 2W11A 1KOJA 3IEPA 4OQMA 3PTLA 1H4TA 2QJRA 3FMFA 3ZKAA 621PA 4G65A 5A4IS 5LOVA 2UUPA 3ZEIA 4GLJA 2JHCA 2H8GA 4IVPA 1U5CA 2ZVPX 3NKLA 1V11A 4HGNA 2Q2QA 2R1VA 4W6ZA 1JEYB 3VQTA 4GRDA 2ORIA 1LKZA 1Q15A 3OOHA 5JZ9A 5EGNA 1J7JA 3I58A 2HKIA 1IQ0A 3OZUA 4OLJA 2IY7A 4C76A 2Q1UA 1KY3A 4CCYA 4F85A 2VPQA 3G9UA 4MDYA 4Y8VA 1P0MA 4BYGA 1OT5A 4IZIA 2FRDC 1ORHA 2VA8A 4KQKA 2E4AA 1Y5LA 3A3PA 3D7SA 1UP4A 3DOCA 1T2NA 3IVXA 3ULKA 4II3A 5EHIA 3FNEA 3R3JA 3QVTA 5AQ1A 1WNTA 3L2OB 3JVDA 5KX5F 5EJ5A 1DOZA 4GAEA 1JDBC 3N53A 4GKAA 3A4YA 4MQUA 1JU4A 4IX9A 5CLHA 5AKLA 2RHMA 2ZIFA 1ZOLA 1YZHA 2JJ2A 2VQSA 5CLQA 1OMOA 3HUFA 1RP7A 4RIFA 4IGAA 5IULC 4IJUA 3K70B 3CINA 3NM4A 4RM2A 4GOLD 3RTGA 4DIFA 2ZJ4A 4O33A 4IJ5A 2PIAA 4C78A 4BNTA 2CZQA 4AQ7A 1P9RA 2PMFA 2D5AA 2HPHA 4HLCA 2IZ0A 1B26A 3B82A 4TMZA 4GVPA 3L6RA 1ZSNA 3C0KA 3ZGVA 1SCUA 4KSBA 5CX1A 4DR5B 1WXQA 3HHPA 4XB6B 2IPMA 4LXGA 1CEQA 3TLGB 5E1OA 4TMTA 2EXXA 4KR3A 2V58A 5BO5A 5BURA 4H0CA 4GKVA 4I5FA 4XQEA 4KO2S 3V1NA 1I32A 3QMWA 1O8BA 3GRZA 3HKBB 3OFNA 3E7XA 2E4XA 2IU4A 4P4SA 3EQ9A 1CZRA 5CX4A 3UICA 4ARZB 1OVGA 4EEKA 4L28A 4FFBA 2ZROA 1DIBA 1XVTA 3TQQA 3PFNA 3I6BA 5LYJB 4NK5A 4UXIA 1EGMB 3B70A 3MQ4A 4MLZA 4OEHA 2CLOB 1EDZA 5K8VA 1ZH4A 3ER9A 3OZIA 3L5OA 4DHWA 2PLFA 2X7XA 3DZ8A 3EWNA 2PIDA 4RY2A 2AUTA 4XFJA 4YIKA 1M5RA 4KFCA 3GJ3A 1I80A 3DAGA 1DCFA 1QIJA 4I1PA 3Q11A 1IBSA 3EFOB 2BM8A 4LUCA 1M1XB 3HJTA 2A86A 1ADJA 1DG1G 1DX6A 1GPJA 1PBNA 1XZJA 3JATB 3LOQA 4YB8A 2DC1A 1XEWY 4HZUB 1QR6A 2AFHA 4HDNA 4J2OA 2ECQA 2KLBA 1KFBB 1D2EA 2YASA 3AOEC 4FXOA 4ATNA 2ZRJA 5FI1B 2JLXA 2D5IA 1EB8A 1S7CA 3ITNA 1JZTA 3PFBA 3TLCA 1EUQA 1P81A 5BUZA 1B1AA 2GLTA 2C2GA 3U4IA 1KU6A 4B44A 4LQLA 1S9HA 2HCFA 5TEVA 1GT6A 1IN6A 3LYAA 1N6LA 4J0IA 2BE7A 4NPCA 1H0KA 1D6SA 1OAKA 1DKUA 1X8KA 1B14A 3FMGA 1SZCA 1DIRA 4QPDA 1Z4PX 2ZRCA 4K86A 4OYLA 1KIFA 2J7PD 2OD9A 2DBQA 1JG3A 2QTNA 3O1LA 4MYDA 5HM8A 1Q1EA 4IWXA 5H59A 3L8YA 4EHIA 5B64A 4MI3A 2XTMA 4Q15A 2HA3A 1XKXA 1FYFA 2AQIA 4INZA 1G18A 3EPRA 4HLNA 1DC5A 1IB6A 4M60A 1XF9A 5DLDA 2BCGY 1OREA 1QIFA 3OIGA 3PDIB 1V5IA 3K73O 1LRJA 3HDYA 4ZO7A 4YR9A 1G6KA 3V2GA 5CK5A 4IBOA 1P0CA 4G0MA 1KI1A 2YDXA 1IOLA 1L0BA 5EWMA 4ASUA 4K2AA 1J00A 5JRDS 3QITA 3L8HA 4EJSA 2ZUSA 1J70A 4AUNA 4RH1A 1J39A 5JS6A 4CXMA 3RM3A 1ACJA 4D6PA 3U44A 1LGYA 4JT2A 3N0WA 4AMYA 4RVUA 4BO6A 1A5TA 3NKVA 4Y2UA 4GNKA 3WMRA 3NBKA 5C9ZA 2G6TA 1GADO 1E18A 2C8KA 1SG9A 1MTOA 3BFJA 4IKPA 2VTEA 1IXYA 5BPFA 2Z43A 4IP0A 4OP3A 3AVYA 3CVYA 1NBWB 3JWEA 3JYNA 2BUCA 4YIHA 3OQ6A 1G1MA 3CU5A 2JGEA 5G02A 5HFAA 4E1AA 5JY1A 5DNYB 1SKAA 4PANA 2HU8A 2JCGA 4NEQA 5SYNA 4ZDWA 4DCNA 3DFZA 3K0HA 4CLOB 2I3DA 1E8NA 1QVWA 3O92A 1EFVA 1RDFA 3G2OA 1G3RA 2X9VA 3H9CA 2ZQYA 5IVDA 1Y1PA 3KJIA 4YLGA 4PCUA 4BWGA 3IVGA 1N6PA 1UIMA 1IYZA 2D13A 3HCFA 1H8HD 3SNKA 1NC3A 1OU0A 4NEHB 3P8ZA 2OO5A 3QBVA 4LOKA 5D85A 4EG4A 3SKXA 2B4TO