1EFPB

Electron transfer flavoprotein (etf) from paracoccus denitrificans
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVDELVGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Paracoccus denitrificans electron transfer flavoprotein: structural and electrostatic analysis of a conserved flavin binding domain.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
total genus 71
structure length 246
sequence length 246
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1efpB00
4G5YA 1M8KA 4HPWA 1O94C 4DDKA 1N75A 1KQOA 2DXIA 1WQ4A 3X1JA 2PXHA 1NUPA 3FG9A 1PFYA 3IMGA 3F3MA 2E89A 3UY4A 2DETA 3PRHA 2QJTA 5FO0A 3AL0C 1PFUA 2A1UA 3H97A 1JHDA 4ND6A 1IQUA 4MW5A 2A1TR 1OD6A 1YUNA 1GAXA 1NURA 1O96B 3OP1A 3ZGZA 1TQ8A 2YY5A 1A8HA 3FOCA 1OWLA 1LI5A 4EG6A 1IRXA 3CLRD 1WQ3A 3CLSD 1GTSA 1N1DA 3HMQA 1WXGA 2HMAA 2VXOA 4U63A 4R0NA 2O8VA 4MUNA 3MUEA 4XFJA 1VBNA 5LLTA 4A91A 3NBAA 3RHSA 2DUMA 2JANA 1FYDA 3PNYA 5HG0A 1TYBE 3AFHA 3FI0A 2I1LA 3PXUA 1O6BA 1IQ0A 1OWNA 1GPMA 3IOEA 3CLTD 1EUYA 4MVXA 5TGTA 1HYBA 3NV7A 2R5WA 4QRDA 1B6TA 4EG4A 4MUGA 5H7XA 4MW7A 3N2YA 4GRIA 3FNRA 2QJOA 1KH1A 4CDNA 4ZCTA 1Q15A 1QQTA 2CYCA 5TS2A 2PZBA 1PG0A 2A4MA 2H2AA 3G5AA 4MUKA 4OUDB 4AQ7A 3FY4A 2CT8A 1LI7A 2NZ2A 4MW9A 1N2JA 3RJZA 3TQIA 4X0EA 4ZT3A 3IVGA 3VGJA 1PFVA 2D54A 3UMVA 3C8ZA 1Q77A 1I2DA 1MBZA 2A7XA 1KR2A 1EFPB 3MLBA 1JIIA 1H3FA 1NSYA 2QTMA 4MUJA 4MWBA 5KHAA 4JXXA 3UK2A 2AZXA 3QE4A 3COVA 3AG6A 4DE5A 3X1MA 1WXEA 1PFWA 2J09A 2QUIA 3IODA 3G59A 1XJQA 2G36A 2WB2A 1COZA 1TYCA 1MB9A 2CYAA 3CVXA 1GTRA 2C5SA 1FFYA 3H05A 3SEZA 2WQ6A 4MVYA 1N77A 2BTEA 1ULHA 5DASA 3SEQA 3A04A 4S1OA 1WJGA 2DERA 3ZJUA 4MW4A 1N3LA 1H3NA 2CV0A 5H16A 2V0CA 3GUZA 2X3FA 2D13A 1R6UA 1KKUA 2PZAA 4I6GA 2E0IA 4KR6A 1EE1A 2GKSA 2QJFA 4K0RA 2IJGX 1J1ZA 2CV2A 3ZXSA 2CFOA 4XSVA 2Z09A 1JEDA 1WZ2A 4MVCA 4MUFA 1I6LA 2X0KA 3K32A 4J76A 4WSOA 2J08A 1ZH6A 1K97A 2OV4A 3A2KA 4Q93A 1U3CA 5K0TA 1VLHA 1TFUA 2CYBA 3KT0A 1T9GR 3Q4GA 1J09A 3IOCA 3M5WA 4MVWA 4TS1A 3UOWA 2AKEA 4MUEA 2QTRA 1WOYA 3MXTA 1U7DA 4DDHA 1MAUA 1IVSA 3HL4A 1WXFA 2XRZA 4ARIA 1PG2A 1R6TA 1MJHA 1M8PA 4UZEA 5KWVA 4YP7A 3N05A 3H99A 4ZT2A 4EG7A 1O95C 2X1MA 3ZUGA 4MUIA 3SYTA 2E21A 2QUJA 5J58A 1N2BA 2QUHA 3IUBA 1F4LA 1O96A 1M83A 3COWA 4QBTA 1KAMA 1BS2A 5DK4A 3JXEA 1QRTA 5FNZA 1NP7A 4ZCQA 1O95D 4ND7A 4EFKA 5IJXA 3FETA 3QTBA 1EUQA 2B7LA 4KPUB 3X1KA 5HUJA 4ZT7A 4CT0A 1YIAA 2EL7A 3CR8A 3HZRA 1T6ZA 1NUTA 1XNJA 3D6UA 1JZSA 4MW6A 3CA8A 4YP5A 4CDMA 1M8GA 1I6MA 4MULA 2A84A 5TEVA 1O5TA 1U0BB 3CVYA 4FZJA 3OTWA 3TQOA 1JIJA 4H3SA 1VL2A 4DNXA 2YXNA 4L2IB 4G6ZA 1N78A 4RPIA 4UZFA 4JZYA 4MW2A 4PBSA 5JBNA 3SZ3A 1G8GA 3DLAA 1JILA 3H9CA 1WXHA 4NATA 1U7XA 4YP6A 3BL5A 2CV1A 1KORA 1Q19A 3DV2A 3KFLA 4MUHA 3TZEA 2VTBB 2ZUFA 3GMIA 2A1UB 1JGTA 1O97C 2A86A 2H29A 1QNFA 2A88A 1KQPA 1NI5A 1XNHA 4HJXA 1IHOA 3FWKA 3L92A 5F23A 1QTQA 2VTBA 3IOBA 3FH0A 5J5AA 3ZIUA 1J1UA 4YBRA 3P0HA 3HGMA 3TNJA 1JZQA 2CSXA 3AIIA 4EF6A 4ZT5A 1JECA 5DB4A 1ZH0A 1J21A 4L2IA 1O0BA 4MLPA 1K4KA 2GOYA 3ND7A 2ZUEA 4I6JA 1N2HA 3ILVA 4ARCA 3RBAA 3ISJA 2IELA 1KQNA 4BWVA 1KAQA 1U3DA 4U8HA 4ZCPA 1N2EA 1S4MA 1O0CA 1OWOA 2E18A 5EKDA 1P7PA 1F9AA 4DLPA 1ILEA 4NAUA 1EFPA 1I6KA 1TYAE 3LOQA 3N9IA 3TS1A 4ZT4A 1GN8A 2YWCA 3FIUA 1MC1A 3MLAA 4ZCRA 4RUKA 2QTNA 3GLVA 1G59A 4MQ6A 2DLCX 4K03A 5K0SA 3RK0A 1QU2A 4MW0A 2J07A 4OUDA 1Y42X 2EJCA 5FO1A 3SDBA 4NZPA 3IVXA 3H9BA 1O94D 3QTTA 4R2MA 1YULA 5TEWA 1IQRA 1V8FA 2PFSA 3SZGA 2V0GA 1N2OA 1V47A 3KT6A 4J75A 4E1AA 1NZJA 1TEZA 1SURA 4ZT6A 2WSIA 1G8HA 3ZJVA 5J59A 2X1LA 2GM3A 1N2IA 1IH8A 2RE8A 1ZUNA 3CVVA 1EJ2A 3U1VA 1VBKA 3COYA 1T6YA 4U7JA 4OJMX 2WQ7A 1QJCA 1N2GA 1QRUA 3CLUD 3SP1A 1VBMA 3VRHA 4QREA 1T6XA 1RQGA 4MWDA 3DPIA 1TYDE 2DR2A 3UC5A 4PBTA 1NUQA 3AG5A 3FHJA 2BYTA 1F7UA 4G5FA 1KH2A 1JMVA 4XFDA 2J5BA 1NUUA 1X8XA 1QU3A 1NUSA 3RK1A 5AHWA 1R6XA 4EG1A 4I6EA 1K92A 1OWPA 3FDXA 3E27A 1M1ZA 4GU5A 4ZCSA 4AS1A 1IFXA 3VU8A 1MOPA 4HK4A 2PG3A 2RD2A 3KT8A 1O97D 1CT9A 1H3EA 2Z3VA 4EG3A 3LE8A 1KP2A 3LCJA 2DEUA 1MB2A 1GZUA 1OBCA 4P2BA 4DJAA 1UFVA 3CLUC 4EGAA 4F4HA 1JIKA 1G8FA 3N8HA 2PZ8A 4JFAA 3I05A 3PNBA 3NBKA 1Q11A 1WKBA 3K9WA 3ZJTA 2D5BA 3P0JA 2AG6A 1KH3A 2O5RA 5LFAA 1D2RA 3ELBA 3CVUA 4EG8A 1YI8A 1WXIA 2DPLA 2HZ7A 3IVCA 3S3TA 1GLNA 4Q16A 5HUHA 4MAFA 4NAHA 3INNA 3A4IA 1NYLA 3ND5A 1MRZA 2JAXA 4KR9A 3ND6A 5BNZA 2HGZA 4MWCA 1M8FA 4MW1A 4NDAA 3P0IA 3CVWA 4KPUA 4DDMA 3ZXIA 1X6VA 5LM3A 3G6KA 4JYZA 4KKVA 2OQ2A 3IMCA 5KCMA 2QUKA 4PBRA 3HFJA 3TZLA 4JXZA 1H1TA 1J70A 5DEOA 1XNGA 3RFFA 4CQNA 2CUZA 3IUEA 4F3RA 3CLSC 2TS1A 2PIDA 2NSYA 1YIDA 3Q10A 1OBHA 3KT3A 3Q12A 2Z08A 3P52A 1EFVB 2ZP1A 4EG5A 1YUMA 1EXDA 2J4DA 3IMEA 2IP1A 4NX2A 3IH5A 1QRSA 1KP3A 3DO8A 1J20A 3AKZA 4KR7A 3CLTC 4PY2A 1K4MA 3PNVA 1M8JA 4R2LA 2XRYA 1WY5A 2JA2A 1LW7A 1DNPA 2A1TS 2YWBA 3MMXA 1MAWA 1ZJWA 1EFVA 4WNYA 3CLRC 3COZA 5IHXA 4YMIA 1JEEA 1OWMA 3D6VA 3IDFA 1T9GS 1F7VA 4HJRA 3HV0A 3A05A 4MWEA 3L93A
chains in the Genus database with same CATH superfamily
3NTUA 3WFIA 1TVKA 1TIKA 1MW9X 2DRIA 2JIQA 2OHJA 1M6VB 2WAMA 4R69A 4X6YA 4CG1A 3F5QA 3L6BA 4QGHA 1UXKA 2PXHA 5JCXA 1I7SB 4A2PA 1MKYA 1RHJA 3IR7A 2FGKA 1WXQA 2Z4RA 2AXQA 3HKBB 4FN5A 4BNGA 3U3OA 4ZVPA 4RZHA 2W2VA 2FN3A 3R77A 4OHXA 1DG3A 5EIXA 1JFLA 4AROA 3P9XA 2XT9A 4ISBA 3UAOA 4MB6A 5IRCD 1CJTC 4PSVA 1NP3A 2O4UX 3HLKA 1RBQA 3BHJA 4AI6A 4XRGA 2QQ0A 4ZI2A 4AKHA 2QRPA 1PI3A 4WEOA 4ATNA 2WIJA 2I1WA 5BN4B 5IARA 1VSBA 3KJEA 3OEWA 2ADOA 3UK0A 4Q3DA 2PUBA 3MHPA 4I4IA 4MP8A 2R2AA 2Q07A 2MTBA 1WQ3A 1X1EA 2XCUA 3U17A 4HSGA 1R0WA 3G0CA 1DC4A 2LNDA 5SYMA 3TZQA 1EVZA 4R2JA 4JR1A 2WTBA 4HNRA 2ZJBA 2QAIA 4L28A 4RVFA 2XY4A 2A9RA 4XIJA 1AH2A 2ZRHA 3ZGYA 2HJGA 3ORHA 4Z0PA 3WYGA 5F5LA 2RB5A 1K8YB 4PZPA 5LQUA 4Z1MD 2BGIA 4JD5A 2PJZA 5BV1A 4H1UA 5EUMA 3FYHA 4DEVA 5H81A 3ERCA 1E96A 1KK1A 3C5WP 2O1WA 4LYEA 5IAKA 4BY9E 4F6RA 3W8NA 3P94A 3E9EA 3DCYA 1QZUA 4OHRA 1MCZA 3N58A 2C0QA 2DPHA 2YHUA 3QF7A 4AO8A 1N33B 1RI1A 1XPUA 2EX4A 2W6CX 2CLCX 4TT3D 3TCNA 3MOSA 4EG4A 1A7KA 4MUGA 3DLTA 3RM3A 5A3QA 4EHNA 1Q3HA 1AUVA 4AYWA 2I4NA 2JAQA 3OETA 3F96A 3G1WA 1QHYA 2EZUA 1WM1A 3BGWA 2HNKA 2XUGA 2H1WA 3U4QB 4Q03A 3IPXA 1VZ2A 1MT3A 2ODWA 3K72B 4KWEA 4MUKA 2F48A 2RBKA 1YS4A 1W5SA 3CB2A 5JS6A 3ODPA 1F38A 1U2DC 2HJ9A 2VYNA 3L8ZA 3O73A 4I1VA 1XTJA 3UJ9A 4C3OB 4HB0A 4OI0A 1LI7A 1VRVA 2Q49A 2IYVA 2AX3A 1JE1A 1MC8A 5BSHA 4BO0A 4UEOA 4UVGA 2XEDA 3DAHA 4E07A 4ZYUA 3VR4H 2E2WA 2ISCA 3CU5A 4BN5A 4D43A 1EKXA 1KR2A 1ZU5A 7REQA 2HSZA 2TRSB 2G4VA 3PF9A 3SQNA 2VPPA 1Z9BA 2A6PA 3TJMA 3U39A 1GKKA 5EINA 5BQPA 2XIQA 1YMQA 1YZHA 2O7RA 3QVTA 4N3BA 5CPBA 4R31A 5AW3A 1VJ0A 1Z28A 4LJ9A 4NJEB 1ZISA 4YQYA 3W06A 4AKEA 3M2PA 4I1OA 4S1WA 5GJVC 4ZMBA 2CMDA 4A1OA 5FA6A 2CYAA 4M89A 4B85A 4B3JA 2WB2A 4KZPA 1NBAA 1ND5A 1Y1RA 5KOJB 2JBHA 3ETEA 3PC2A 4F56A 2O57A 4LXUA 3LY9A 4GI7A 2NSJA 5H4HA 4CQMB 4DPKA 2CGEA 4ZQBA 5E6UB 1PYGA 2QRLA 3EXIB 4LGVA 1L5MA 4PR0A 3SMVA 3UB4A 1V3VA 3QFHA 1GKLA 3EZFA 1EWQA 2RHDA 2HF7A 2HFJA 3E0QA 3JPWA 4Q7MB 1ZD1A 5IEJA 3OSUA 1MRNA 4PRYA 3CRMA 4WERA 3RB8A 1KHHA 1H2WA 3HKBA 4R5HA 5TE9A 4ONEA 1E79A 2JLZA 3SS8A 2O14A 1PZMA 3SZOA 2FFJA 5GJWC 1F2DA 2CFOA 2BBSA 2C9YA 2I76A 2WTNA 3O03A 4MYSA 1JEDA 1Y6RA 3WRXC 5LU9A 2GB4A 4YECA 3RT1A 3BHMA 4G89A 5JNTA 1TVKB 1YZVA 2BMAA 3VZCA 2PX8A 2FSIA 2HBZA 3X0DA 1HO3A 3TAXA 2YHIB 5HW0A 1PGOA 4E94A 3ZU4A 3OESA 1CEEA 2WIKA 5L7YA 2OV1A 3NMUF 2WYIA 4MIKA 1FXWA 5FPQA 2QTFA 4RXTA 4ZTUB 1PT8A 4Y1RA 4EAAA 1QHSA 2QMEA 4REQB 2X2OA 1TFUA 1TZMA 2OO5A 4R81A 5ALHA 5D3QA 3IUYA 4HWSA 4X1OA 3AQ4A 1AGPA 5KYXA 5TQ0B 2YZGA 1GGKA 4NABA 5I8PA 1S7GA 1XRSB 4DDHA 4BUZA 1N5DA 1M2GA 3EEIA 4U6QA 4UUMA 5FBWB 5K3DA 4ARIA 3PX3A 3ICVA 1ECLA 3C87A 3T52A 1PT7A 1O4WA 4FOLA 2B4RO 2XWPA 4HF7A 2QNRA 4I66A 4JBHA 4KR0A 2KI5A 2R4QA 1BJKA 2HCRA 3EIXA 3HSYA 3I4CA 5C0OE 4BFCA 3DMPA 1I9GA 2JZCA 1X7YB 3PJFA 5DX0A 2BBWA 1D2GA 3H16A 5F1YA 3AIMA 1BRMA 4OLBA 4QBTA 2FPXA 3WI7A 1GCIA 1KAMA 4R1QA 3BL8A 4RXMA 1UIMA 3U7RA 2FZWA 1JT9A 4HWTA 3RLIA 3E8MA 1X1DA 4QXMA 4N8SA 3HZHA 3ROPA 3Q8LA 1RWNA 1YB5A 4HFRA 1M10A 1NPDA 1Z4NA 1P4SA 2BRUA 2ZYAA 2WYWA 2M9MA 3DGEC 3WB9A 1YS1X 1IK6A 3BKWA 3LW8A 3MCUA 4BQOA 3FPBA 2R4UA 1KRHA 4V0NA 2ZRCA 4DC9A 4F1WA 3G49A 1YE8A 4RORA 4LYHA 4X3OA 5DE3A 1FUIA 2ZJFA 5CNMA 5F7JA 4IIVA 1XNJA 3L8FA 1TADA 1V35A 2BM9A 3OZCA 4H59A 2O52A 4N5LA 3UM9A 3LHKA 2J3JA 4H1VA 4R4JA 2W4IA 2O07A 3DBHB 4G4SO 2QTVB 2W11A 3UWMA 1IZYA 3S40A 3PR3A 2Q9AA 2OGTA 3UWDA 1ZI8A 3NS7A 3GDWA 2PEZA 3DE4X 4RF2A 1RJ9B 1SUWA 2X1VA 4RH0A 5DGCA 3ZDBA 2J3HA 4QGAA 4X6UA 4Z9AA 1EEXB 5A06A 2FQYA 3H4VA 3RQSA 4WA8A 2FV8A 2HWYA 2KB0A 4PTYA 1Q0UA 3F7OA 1UQUA 3L43A 1XVAA 4R1MA 4RFSB 4N41A 3AI1A 2ZGVA 4QYMA 3VVLA 3DZKA 2HWXA 1CQWA 4CNBA 1OX6A 2C00A 5CDUA 5ICCA 2G72A 3B7WA 3DBIA 3K9LA 5JECA 2C7OA 2GPWA 1GA6A 1Q19A 3L01A 4MUHA 5EHNA 1EFTA 3U9SA 2A1UB 1L9KA 1MB3A 1O97C 1P0FA 2PJUA 2QN3A 1ZD2P 4P92A 4RK4A 3VSCA 4CIXA 1G21B 2VHWA 1QS0A 2K6GA 1T36B 3N1UA 3TLXA 3GJZA 5B55A 1P3DA 4DXDA 2XBLA 1GQOA 4WFKA 2ZCJA 4TLCA 3FWKA 2YVLA 5AM3A 1APBA 2XDQB 4LY6A 3PTZA 4AJ1A 4V3CA 4QO7A 1K68A 3NBZC 4A7PA 2E87A 3V46A 1TOAA 2Y1KA 4K6GA 1I2MA 5L3ZA 2VXYA 4D9KA 1RC1A 1H4QA 3AUYA 2WU0A 3T1NA 4AUMA 2CSXA 4TYPA 1H4TA 4N7MA 2GD2A 2GCGA 4N03A 3ZZMA 3GOQA 2FZ5A 1N9ZA 2C4KA 2OXFA 2PGNA 3CVJA 5DB4A 4F92B 1KA9H 3INYA 5KJCA 2FSPA 5ELLA 2L42A 1EP9A 1JPUA 2FWPA 3PGXA 1A0OA 4I6JA 3UJDA 4EHDA 1I0ZA 3RYHA 4BYGA 4XWOA 5CA0B 1ZK0A 1U2GC 3ANYB 2RGNA 3HKCA 4ZA2A 4HATA 1WY7A 3MJVA 2NNWB 2JKVA 4EL0A 3H2GA 3B38A 3GRKA 1PT5A 2X7JA 4BO4A 1YGYA 1GNPA 3CWCA 3EDCA 2HHJA 3OX4A 3PHCA 3DLHA 3MXOA 3NKVA 4U5XA 4AJEA 5TXGA 2K2QB 4KIWA 1RWXA 1W5BA 2JD1A 2I55A 1JBEA 1UKBA 3CJTA 4R68A 3ROMA 1N5MA 4RTPA 3O2JA 2YWCA 1OREA 4PNHA 1GGFA 2FPGA 3G9UA 1G59A 3ZIDA 2D7DA 3HXQA 2OD9A 4A0QA 1N4DA 1DKRA 2QNBA 4ON9A 2CCGA 4XVQA 4HN2A 5GONF 4KBFA 4FDLA 2HO4A 3D43A 4ZEOA 5LXTF 1IUKA 1KI3A 4PN7A 3H3JA 3KQSA 1KL7A 1AHPA 4HLCA 3F5FA 1ZESA 3LVRE 4IX9A 3DFIA 1VKNA 2O3SA 4U5QA 4DAEA 1QHXA 1L2TA 1V7ZA 1WW8A 4TVKA 4Y18A 3ELWA 2HUNA 2VKTA 1CQJB 1JQKA 2DLNA 3JD4A 5HM8A 2ZI9A 4OK3A 4O4HA 1NNI1 4QUEA 4EJ2A 2Q4RA 1ZGBA 2GKOA 3M4JA 4FR5A 3GZTB 2V0GA 4URZR 1N2OA 1NBWB 1Y3IA 1UIRA 1KVSA 2X6TA 4G41A 1WXDA 4TN1A 4XX0A 4QXAA 2Q3FA 4K6OA 4KAFA 4RA6A 1X7XB 4FKBA 3TZ6A 2MHCA 2FJUA 1N2IA 2NP7A 1EUCA 2P7HA 1LVGA 2Q29A 5AQEA 4DLTA 2JFVA 3PXXA 5DBFA 4C4XA 2I5PO 2X9GA 1JVNA 1YR1A 1VBKA 3FYUB 2W6PA 1GZ7A 4GLBA 4TKUB 1A9XB 4TQUS 2G0AA 3G02A 4DPLA 4YRAA 4ZVRA 3ENZA 1KMQA 1S01A 3AQIA 4IH9A 4JJKA 1LK5A 1TA0A 3ASYA 5E2AA 1P39A 2GUWA 3HVUA 3UZUA 4I5FA 4CM9A 5AVZA 4QREA 1QH9A 5C7IO 1LRKA 2PH7A 1A27A 4FJ0A 4KJXA 4LDZA 5BVHA 3CUUA 3AEUB 2AD1A 1HLDA 1XZCA 1T1SA 1PW7A 3IE0A 3IKVA 3AG5A 3QYAA 5HJ2A 4NCAA 4OJTA 7MHTA 4DCOA 1R2QA 4JMLA 5HMMA 3HXPA 3R41A 1L5YA 1OC2A 3C7AA 3KJNA 3UUEA 4D0RA 2HSDA 1DBQA 1OLXA 2WU3A 3EFBA 4WOJA 3UT5A 2HTEA 4IXTA 3TEFA 2R0QC 5L7TA 2QM8A 1YXMA 2AGVA 2IYOA 3H9UA 3NEJA 1XB2A 3JYNA 4I6EA 2PBRA 3TRKA 3W6OA 3WB2A 4DMRA 2C2XA 3NHUA 4ER5A 3EA5A 2EW2A 4QODA 4QHYA 5LP6A 3WO1A 2JH9A 1RXIA 3A6EA 3KD3A 3NAQA 3ZWDA 1WZUA 4C06A 4BQFA 3L6CA 1WTAA 4NJMB 2PG3A 4R3WA 2OXRA 2ZIXA 3KKMA 1RJGA 4TVOA 1CT9A 3V3KA 3E84A 1KDPA 3MMSA 2VHUA 5ALNA 4MR8B 1BYUA 4MVJE 2C4UA 1FUEA 3SF0A 1WQ1R 3LXRA 2OOSA 4GE3A 1X1SA 1YVEI 2ZBRA 3HWRA 1EE9A 1Z0AA 2FPOA 4IUYA 4J0DA 4O2AF 4B6RA 4QXRA 5J4YA 4PX9A 1J22A 2VJPA 4XQGA 5SYAA 3PNBA 1NDHA 2BISA 1QNLA 2M6KA 1KTIA 3VZRA 3Q3CA 3Q0EA 2Q4EA 3TINA 1ZD3A 2D5BA 2XKAA 4YP1A 3LPDA 4IMPA 1ZW1A 5A4AA 3OOEA 3PGA1 3UPUA 5H1YA 5U4QA 1QLHA 2NU6B 3IVRA 1XIVA 3JRWA 4BTVA 2CXTA 5DHPA 3TX2A 1QCZA 4QJIA 3C1TA 4KMRA 2I6FA 5CXSA 4NESA 3WQQA 4XCVA 1Q6ZA 1R8QA 1VIMA 1K6IA 1ZD8A 3LUKA 3NWEA 3P19A 4TLAA 4ZC8A 1GCGA 3U7EB 4B79A 3FDZB 1BQ3A 5K6RA 1YQQA 1TO1E 2B2XA 3I09A 3L05A 1CULC 3A37A 1YBMA 4UUBA 2K5UA 4US1R 3AU8A 1L6RA 1E3WB 1LFAA 1OZHA 1PZHA 2ZTUA 1XWFA 1X80A 2F43A 2Q27A 3KPYA 2E1PA 3LFUA 5JAPA 1AGNA 3FNHA 4KPUA 4NCNA 4UEWA 3TW8A 1X6VA 2WLTA 2IS6A 5H83A 4G9BA 1K6EA 1Q20A 2X7HA 5DNWA 1M2KA 3ONDA 1CEYA 3EH1A 4YMSA 4I8XA 3UJHA 2OP1A 1DEHA 4N47A 4LGMA 4JBXA 3U3RA 3QVGA 3JD1A 4QZVA 1U5AA 5CYFA 4JELA 3DCJA 3RFUA 2V0NA 1P1BA 1KMCA 4M49A 1JEQA 2A9JA 3Q10A 4CEHB 3WLHA 3QXJA 5D7BA 1KYIA 1SQSA 2Y99A 2AI2A 4LMRA 5AVVA 1WTCA 2Z08A 3P52A 1SXJA 2N75A 4BX0A 5T7BA 2VHVA 5CHYA 5FFMA 3A3PA 4KQJA 3G2HA 5KQPA 4OLAA 4JL5A 4BVLA 5GGXA 2I2DA 1P2SA 5CK4A 3NHBA 4C3UA 2ZT5A 5ALQA 4XD2A 2IH2A 4WIAA 5C1BA 5DHRA 1L8AA 3FROA 3OOWA 2CMGA 5E3IA 3OM9A 2WZCA 1FJXA 2YWJA 1JZTA 4P58A 4BL5A 5T4HA 2KBFA 2ZJ5A 4YXFA 1GN9A 1IJFA 1H2AS 1J00A 3QELA 3MWEB 2N9UA 4K28A 4BAUA 2AEFA 1GZHB 1G63A 2J0EA 3B3QA 5KC9A 1QMPA 1F0PA 4XM0A 2O7VA 3T12A 2PD6A 3UYKA 4HJRA 3UGJA 4LW8A 4U7WA 1W36B 3ILXA 1T2UA 3JARB 2C88A 3SVZA 4EYGA 1G4AE 3OEEA 3G2NA 4F7DA 5FR1A 1Z5ZA 2DXIA 4KUEA 1DINA 1QHHA 1O5IA 3PKIA 3Q2OA 3U62A 2C98A 4F5DA 3W8RA 4CPDA 3BIXA 3GRCA 2VP0A 4RY8A 4UUOA 5ALXA 3ZX4A 5LIPA 1BU5A 2HIHA 2F9FA 1NGSA 1PDVA 2C5GA 1J23A 1EDEA 2VCHA 4M9SA 3K70B 2XQFA 4Q7JB 3QSGA 2DFVA 1T6NA 4JLNA 4Z99A 2M6LA 2UV8A 1TM4E 4Z49A 2A1TR 2IKSA 2QEQA 4LECA 3EWIA 1S02A 1TEVA 3MGAA 4GQIA 5FPPA 2ZYIA 2YVKA 4Q1DA 3PGVA 4AECA 1C9JA 1AQNA 3R3ZA 4Y2XA 1ZOSA 1RBYA 3ZGZA 3H87A 1Q14A 4MS1A 2VH2A 4UTXA 3M5DA 3I9FA 1G5IA 3CW8X 1RXYA 2NVOA 4GZ5A 3TE6A 3VR2A 1HMPA 4JP5A 4EG6A 1MVOA 1IRXA 1H65A 2OCLA 3EXG2 5KINB 5TVGA 2IK8A 1O9BA 2QTWB 1XTKA 3TTVA 1TZKA 2SKCA 3QBEA 1DTEA 4RPKA 1G21E 4L5IA 1G4UR 3PQ4A 3BHIA 1KJNA 1QLJA 2P75A 4A91A 1I1HA 5DKFA 4FW8A 5DM70 3ZQUA 3A6LA 2WT9A 3HO1A 1ZMBA 4NBWA 4Q3NA 1TYBE 2PQ6A 3A2LA 4KV7A 4Q3BA 3FI0A 2DPYA 3E3AA 1NR1A 1G5TA 3PE3A 5HILA 4ZOLB 4AJ4A 1KFKB 2XZLA 1TQ6A 3GRRA 3IOEA 3DXFA 3CLTD 3QLVA 2J6BA 3USCS 1XPJA 4HDMA 5SICE 1KJYA 2IPMA 3OEHD 4LSMA 3I01A 5AK3A 1IC6A 2EFYA 2XAUA 1A9PA 1AHNA 4EQZA 3ZTWA 2AHOA 1AE1A 3ABZA 4I36A 3AJEA 3C0KA 4NBKA 1KH1A 3I8OA 2WTAA 4HN9A 4EP1A 1G64A 3FRHA 2CLFB 2R751 4DADA 4EQ6B 2PZBA 1PG0A 1SZCA 3AIKA 3AOGA 4Z53A 4BP9A 1ZM7A 3I6YA 1KYZA 5BXYA 5HTKA 3AHIA 4C0XA 2OECA 3LUJA 3TKLA 2J32A 2N1MA 2ZRDA 3UMBA 1EPUA 1JS1X 4G86A 3L0IB 1E92A 4MW9A 3TLJA 3RJZA 1UT8A 3AFNA 4PQEA 4JT9A 5JZ9A 3K5PA 4GM4A 5DSZA 2B4YA 4B3BA 2BZSA 4TQ9A 1I10A 2A0UA 1UODA 1SKMA 3Q41A 4GSYA 4RPGA 4ZQIA 1H42A 4P53A 1YNSA 1JIIA 3A9UA 3QJYA 4MUJA 2OQIA 1SBQA 2NU8A 4OHYA 1WNTA 1E6WA 3P9SA 3S7TA 3UK7A 5BN5A 4L5BA 2PRSA 3SOZA 1R4NB 2QZSA 3FPHA 4TT8A 1R5NA 3LKBA 4RABA 3NBQA 4Y2SA 1VI6A 2NO5A 2G28A 5JWHA 5B12A 4HQLA 3A26A 4BRWA 1XROA 4EKGA 5JZVA 5EJ8A 1B0AA 4Y2UA 1TYCA 3WIOA 4B3CA 3H05A 2FOIA 1VB5A 4XA8A 3SEQA 5JU6A 3VYUB 1A9QA 5LQAA 5D5HA 1NN1A 1XQYA 1SG0A 5B2EA 1U8AA 1WU7A 3OZ7A 4HDCA 1OFHA 1M6HA 3LYUA 1N3LA 4FYVA 2GZMA 4KGDA 2BHTA 3PQFA 4IVRA 4EGQA 2QVLA 1FA9A 4K81B 1ORTA 1TW2A 2V0CA 3DNFA 5F2OA 4F97A 4HNVA 4BXOB 1QTNA 2CCJA 1GPNA 3DR5A 5CR9A 5LZ5A 2GKSA 5IYZF 1I3LA 1VXRA 1THMA 2YJ3A 1A2BA 1J1ZA 2XB4A 3GVIA 1I5OA 1O1YA 3QF4B 4CF6A 1UMCB 3C5CA 4KOEC 3GFQA 3GK3A 1M67A 4GG1A 4JLDA 5J23A 5G1PA 2UUOA 4RY2A 5EIWA 4A2WA 4H18A 1S0UA 2W37A 2Q2VA 4OLHA 4IINA 4TT3A 5TQ2A 3CBGA 4U2EA 4ZARA 1SCDA 3PUKA 4DRYA 5I47A 1K97A 1KVRA 2F8TA 3A2KA 1S6YA 1U31A 3KRTA 4Q93A 4G1EB 3STWA 3A11A 3VR5D 4BAGA 4F2WA 1L0BA 2YJTD 2I7DA 5DDIP 5IXYA 1HX7A 2J0UB 2O2GA 1BCRA 4QQ8A 4W7IA 3WLNA 1P1CA 1TK2A 1E9AA 1WPQA 5L3QB 3ZV4A 1L7AA 2GFHA 3CS3A 5CB4B 2D1QA 1LPPA 3FMVA 4XIFA 621PA 4MH0R 4LSWA 2HCFA 3WYBA 3MXTA 4E5SA 1TJ3A 1U02A 3U7JA 1YR8A 2JIPA 1PFQA 1NX9A 2IP2A 3E03A 3E70C 3O8QB 3B3FA 1SQ0A 2YMMA 4KLRA 4GXQA 3PJRA 3K0FA 3T3NA 1C7RA 3H99A 3JQ7A 1FBNA 1XK6A 3LDHA 1T9KA 4HH1A 1WUYA 2YOHA 2K2WA 2MR5A 5AKHA 2Q3BA 2FDRA 4O4JA 1PT9A 1Q7GA 3NIWA 4N8EA 3VZDA 3L40A 3O38A 1M83A 2VEDA 3ZVRA 1IZ7A 4MMZB 2EZTA 3BXXA 2Z30A 1PZNA 3H04A 4UHKA 3HCPA 2A0YA 3AVTA 4PCLA 1S2DA 5IBPA 1K66A 3A10A 2X0NA 5AFSA 2IS4A 1FZTA 4Q48A 1MO6A 3CX4A 1MJ5A 3LHIA 4UM9D 2PUWA 1M3SA 1W5AA 3H7IA 3HVIA 2QS9A 3O94A 2EV9A 3FETA 1OPRA 1Q7BA 1T29A 1TPZA 1WF6A 1WU8A 1FF9A 5DI3A 1V1MA 1YI1A 2GYVA 4EPVA 4A0RA 1MEOA 1ZGAA 2NT4A 2IZ6A 5AJHA 4KE6A 1XTPA 3AR8A 1Z5GA 3JARA 5FV7A 5BV8A 5EQTA 4NZNA 2V6GA 3HADA 4FC7A 2AZTA 4F11A 2FYTA 4HQ6A 1FNDA 1DIGA 1PJLA 4LFCB 1KS9A 2GJAA 2HDWA 2LWIA 3D6UA 2RJ3A 1GM5A 2GD1O 1UFQA 2GWRA 4EIWA 1C4OA 4WY8A 1QOPB 2ZBEA 5BRAA 2IEBA 2W6ID 3GPCA 5CA1A 5C4GB 2CL5A 2XMPA 1U9ZA 4C4PA 3ZQ6A 2EFEB 2ECFA 1TLLA 3RIEA 2XD4A 4ID9A 4E13A 4EZBA 1ADCA 3HM9A 1C50A 5TQJA 3D3EA 1ILWA 3EVAA 1N6KA 1ZAKA 3CQ9A 2A5GA 4PIVA 1BHO1 1L1RA 3ENVA 4GO1A 5C51B 3MT7A 4RAOA 1Q3TA 2GNOA 3A6ZA 5I7SA 1YDEA 2F9LA 2P4UA 1D1PA 4C89A 2VPQA 3R7LA 5LD2B 4E46A 3KDAA 2AMLA 1WXHA 3H9CA 3KXLA 4XJVA 5IM4A 3WJ2A 3EYWA 2XNCA 5HUQA 3DV2A 2GRAA 1P2FA 3TQFA 5AK5A 3ZWCA 2PUAA 4E2ZA 1G6HA 4D4MA 2WU4A 5CVCA 2PWYA 3WLRA 4TV8F 1A5TA 4KJZA 2YBDA 3BJIC 3D7LA 3MWGA 5DM60 3GAFA 3OFSA 3RFTA 1Z3CA 4FYWA 4QLOA 4CM8A 3KS9A 2JVIA 1WXXA 3FPKA 2JJ1D 4DRXA 4JBYA 5DGXA 4ZPJA 3IOBA 5AK4A 4AJ9A 1EM6A 2EHDA 1SVNA 1XOIA 1DOHA 4QC2A 4X54A 1DC3A 4ENRA 4LHXA 4HLDA 1W8DA 3CCCA 4LDJA 3AIIA 2H08A 4M6WB 2ATEA 3JCZA 2AKAB 2HQRA 1UR5A 2ES4A 3FDZA 2VEOA 1E2LA 3AEQA 3PPXA 1GPYA 3I92A 1M66A 5CLJA 3HYNA 5EYPA 3M6IA 3I64A 3WLTA 3EF0A 3ZKWB 4V1CI 1JFTA 2R8YA 2X8WA 3ILVA 4QDTA 2Z5VA 1QGED 2XUOA 4HHEA 3VV2A 2OK7A 3HUFA 3WDSA 7GPBA 4DWJA 2C96A 1O4VA 3NTXA 2WYVA 3UHJA 1G38A 1G6KA 1JHUA 4KPEC 5FUBA 5HRAA 4AP5A 1P7PA 2B2NA 5GV8A 3H5LA 2J9FB 3AVQA 2FHSA 2YRWA 3H9QA 3TVYA 2Q3LA 5DMXA 3KZOA 1G3IA 3DAFA 1XVTA 3LBNA 1JIQA 3L0ZA 4FIZA 5F98A 4EHBA 3IALA 3JQFC 1YBHA 4HTAA 4ACBA 5KYVA 2UZ0A 2QTNA 3RVRA 3UATA 3AR6A 4F12A 1BAPA 2REBA 1EVYA 5ERXA 3W4JA 2WLSA 3A9SA 3SU8A 1OYVA 1TIBA 5CNKA 4NJMA 4PLVA 1YL6A 1HNNA 3I6BA 3LBFA 1ZR2A 3O1JC 5HE8A 2I2WA 1ZCJA 3DW3X 2O1EA 1U7UA 4XQCA 2I8CA 1XZIA 3EAGA 3RS4A 2C94A 5I4BA 3UH1A 2AXEA 4UEKA 1UKCA 3TW8B 4D8XA 1YD7A 1Z73A 4ALLA 2QMYA 3VSAA 1XDZA 3SIRA 3MILA 4G97A 4HN4B 5JO9A 2XZTA 2WNSA 2YV5A 4FQ5A 4O4JB 4W1SA 1F9EA 3V32A 5BY2A 3GLGA 3O7WA 1VMIA 1IQRA 1V8FA 3AX6A 4KIJA 1KI7A 4MXDA 3CF2A 3ZCSA 1XE3A 1M54A 1QUFA 2A4KA 2H1VA 2SCUB 1A8QA 3K9CA 4G4IA 4G5HA 4JLBA 4AK9A 5JR3A 5LMZA 1G9XA 3PPYA 3Q1LA 1PUIA 1D2NA 1Z4IA 2VTEA 2F64A 1M76A 1F60A 1BWSA 1DUVG 1P2UA 1YZYA 1Y33E 2GUGA 3B53X 3DBRA 3DLPX 3JU3A 3N2KA 4FYMA 4GMHA 2D0IA 4IGKA 1CUBA 2F1KA 4INOA 3RSQA 1FP4A 1JLRA 3NT2A 3R5TA 2P3LA 2X5KO 1AA9A 4KNWA 1NOJA 4LJSA 3UO8B 4CKCB 1NVKA 2QLNA 3IUNA 4W9NC 10MHA 2O5CA 1DBWA 5FWYA 4FHDA 3R20A 3ELUA 2GX6A 5JXIA 4EHAA 4OXRA 4RHXA 1XJ5A 4OHPA 5B4TA 3O93A 3AEXA 1OAOC 3UJ8A 1YVUA 3FF1A 2YJZA 4I5IA 4EYKA 3HJTA 2C8VA 3GOHA 4LNUB 2EOAA 4MWSA 1NRXA 4NPHA 3PFIA 1VHTA 1FDRA 2FFBA 4GFDA 4LJYA 1QFZA 4PW0A 2BCJQ 4LC1A 4RGQA 4XI9A 5LU8A 4GE0A 1ISGA 2NXJA 4ZCRA 2PHZA 1REQB 4DXAA 1L5FA 2PLAA 3FTCA 4RY9A 4WV3A 4EB3A 5JZSA 1NUUA 3H1TA 2GHTA 1OLUA 3AF3A 1Z4JA 1OXMA 3ZD9A 3QFTA 2XECA 5FWAA 1WB6A 1J8FA 1L7NA 4MDHA 2RHCA 3U19A 3ZDZB 2V1UA 3D6TB 4C7OA 1Q1NA 4NCBA 2DBYA 3SC3A 1Y8QA 1M1ZA 2IH5A 3H13A 4B3XA 4P4LA 5FTWA 3KJHA 2BFBB 2B36A 1CUYA 3IDSA 2B8TA 3O4HA 3L41A 3IBYA 3TR5A 3W5BA 4TQAA 4BZZA 3G9TA 3NAZA 4QJ4A 2IZZA 1RLUA 4ND3A 5DLEA 2B34A 3DMTA 1QTRA 3WXMA 1GNQA 1UFVA 5ILOA 4HFMA 3N3BC 1CXZA 1FY2A 2FN4A 1E0SA 3QG1A 4ZK2A 1Z5UA 3JD2A 4OHVA 5BSKA 1FVXA 3R6LA 4NEQA 2ZUWA 1VL5A 4JLOA 1Q11A 3EQ6A 3MSCA 3KR1A 4RLSA 2R7NA 1W88B 3KDSE 1QYVA 2VNAA 4BLRA 3WWEA 2YWGA 3HCRA 3VKWA 1BGXT 5H4GA 4X1IB 4B7CA 3OTOB 1YI8A 2A57A 4HB2A 3EGIA 4CF4A 5BYBA 3FTPA 3IVCA 1GTMA 1HDGO 1ADGA 2Z2KA 3FMFA 4Q5IA 2OWDA 4WCFB 1GLNA 3FUWA 2FWJA 4LXTA 4RQBA 4CUZA 5K3CA 3HFSA 4MP3A 3DXZA 1VL1A 1F14A 4PZAA 1P3JA 1H94A 2I7XA 4KR9A 4MROA 4JEHA 4MK4A 2C82A 4IS3A 3JQ8B 3M9WA 4WXMA 4XX1A 2G4CA 1ISSA 2HGZA 2ZWAA 3KKZA 3OJEA 2FPMA 3Q0IA 5JDCC 3SYNA 2X8AA 1N36B 5JBIA 2VHXA 3ETJA 1M1XB 1YVRA 5JUWA 4P2GA 3TIVA 4E88A 1L7XA 3ZXIA 2F3UA 3I2IA 3E5HA 1XAJA 2RGAA 1ACMA 3R5FA 1YQXA 4G8BA 4IJVA 4KVFA 4KUHA 3IBCA 4M54A 1NPTO 2ZI5A 4EABA 1LK7A 5DEOA 1YBVA 5AQ1A 2Y93A 4A23A 4ZFNA 2OSVA 5K5EA 3L8HA 1AQLA 3QLUA 3QPBA 1BWRA 2C2YA 1MJGM 4HWPA 2PIDA 3LAWA 5K9ZA 4WKNA 2V1XA 2ZRKA 2DBZA 1B8PA 1MR3F 3K8ZA 3OJCA 2QBYB 2BI4A 2EJVA 4IJKA 4OQYA 2O0LA 1FQKA 3C3JA 2BHSA 4G5XA 2OV2A 3EPPA 1H5NA 1MF7A 1G0NA 4MV7A 3U4HA 3AI2A 1DP4A 4LY0A 3HJRA 4BMVA 3QNWA 1SBTA 2DTDA 1IM5A 3H2HA 3AEKA 1Z7YA 1KAOA 1V7QA 3G2IA 1SU7A 2EW1A 3QKSA 2WE8A 4DDWA 2WABA 2KW5A 1C41A 1KZ9A 4DQKA 2XCRB 1THGA 1RXVA 2IGTA 3EZXA 1E1RD 4FWTA 2MINA 1XTUA 2WPDA 3PNVA 1E8MA 3PNQA 5DM0A 5AXBA 1PHRA 3C1UA 2CF6A 3GL9A 4YO8A 4K9NA 1LRLA 1XTBA 1JIVA 2CKDA 3QXHA 1JQEA 1GY8A 2BMEA 3AF1A 2BL4A 4WNYA 2J5RA 4I3HA 3TNYA 1AB5A 5LCXA 1SVWA 2ADFA 3CJRA 4YVFA 3WK8A 4HGYA 3C70A 4RYDA 4W5TA 4RZ3A 1T9GS 5B2ZA 3HKEA 4EAQA 4J0FA 3DKVA 3C3KA 1G19A 1C8KA 3VKVA 4EVRA 1N9GA 4X65B 3OBIA 4GVPA 1IM2A 1R50A 3LV8A 3ND9A 4D2IA 3S5UA 1E2IA 2G9UA 4UNNA 4CMIB 5I48A 4P3YA 4JYMA 5TV2A 2UYGA 1U2TA 5IN4A 2QSJA 1JQAA 3JRNA 3W3AD 1OH8A 4MS4A 5AM4A 3PRHA 2QJTA 2A1UA 5AW1A 2H9AA 4LFAB 5TX7A 1WXWA 3B89A 3LYHA 2RHHA 4HMOA 3AVWA 3JAKA 5FBKA 4N12A 4NFSA 1KQFA 5AOCA 2CJFA 2HN9A 3IIMA 1RVV1 3NYQA 4MRRA 2C5LA 3GJ3A 1N4AA 4BFSA 4ZAZA 4XM1A 2I65A 4Y2RA 1RQLA 4O4LF 1T43A 3GQVA 4OHOA 1ENPA 4Y6RA 2I22A 3R7WB 5BOSA 3UAWA 1ZWKA 2WM8A 3AF4A 3GXOA 3LC7O 1DRWA 4HNAB 2HA7A 1J8QA 4R9UC 3S0JA 4KB5A 3SZMA 1UK7A 5ITVA 3PHHA 4AURA 2JJ2D 1XLUA 1FVHA 3OO0A 2IE8A 2QMZA 4GC5A 2IW1A 3MK31 3SX2A 2B82A 1AVTA 4BVGA 3AUKA 3LC1O 5C9ZA 4DLYA 3UBTA 2DMRA 2H2DA 2IIVA 3ODGA 1JYSA 1C7ZA 1NNSA 2P79A 1WHTB 3R44A 2H9YA 4MGYR 4QDUA 3RDPA 3R7WA 4OHWA 1NVAA 1W88A 2GAIA 3FZEA 2OQVA 4F0JA 3TTSA 2BJHA 3UENA 1EGMB 5G41A 3PEWA 1YQGA 2JGJA 3QVUA 4IIUA 4J3NA 4LF5B 5DI9A 3AFHA 2R7LA 4D9MA 1AIPA 4Y3UA 2QKYA 3LQKA 5J2TF 2P0YA 3EYAA 3LBHA 2P62A 1AKTA 3THYA 1EUYA 2CNBA 3P9NA 2XVMA 4I4CA 4Q18A 4D97A 1EDDA 2BUBA 4IM7A 3T06B 2HR1A 3W7VA 1OKKD 5B58C 1D0SA 5CVJA 3H65A 4BECA 3C3DA 4IMRA 3SBDA 4MDYA 4C9BA 2Q9BA 3OLWA 1WSDA 3ZZTA 3LVBA 5K4AA 2UUAB 2XJ9A 4BNUA 3JYHA 3OM1A 2X2FA 1SK8A 2R00A 3DTYA 2QZZA 3VR6H 1Q0RA 3KOMA 3WFZA 3TPZA 2OORC 2JD2A 2FWAA 2ZB2A 5DWQA 1ZZGA 1AG9A 3EVNA 3RS2A 2V7QA 2ZXFA 4DV6B 1G6Q1 4QEKA 4M9ZA 4PLWA 2GFQA 3Q5DA 4X1YA 1H66A 2C8KA 3H84A 4KE7A 1ZVMA 3FPEA 5T4BA 4K6HA 4KQEA 2IIPA 1VSUA 3ZCRA 1CW2B 1PGQA 3GBSA 4R8MA 3R3XA 3V8VA 1PZXA 1T9AA 3IEIA 4ZQGA 3UMVA 4D45A 8GPBA 4M1TA 1VJTA 2VH5R 2ZIWB 5K2OA 3WBJA 4Q1EA 3DYBA 4LN1A 3U13A 2NUPA 2X4GA 3KZ1E 2OZEA 4NCIA 4Y6OA 3ESAA 4JGIA 1H3FA 1R0ZA 1UOQA 1VA4A 1BA2A 3MERA 4YRCA 1Y6GA 4FQ7A 3UK2A 1F8UA 3LPAA 3F1KA 3TE7A 4E4TA 1ZMTA 3S8YA 2JGEA 2RGXA 3FMOB 3JZIA 5F4ZA 4EJMA 4E4YA 3ELYA 4DYVA 1XCOA 1YS7A 2WHQA 3IODA 3NBUA 3B7GA 4D7AA 4HEHA 4HH3C 3M82A 4N5NA 2A9OA 1O77A 4EHKA 4KQ1A 3RU7A 1MTOA 1HE5A 1MP0A 2IYRA 5J2UF 3A2NA 2HK6A 4MVJI 4YX9A 3VPCA 5C4MA 5KOYA 4I1UA 3I9JA 4EY3A 1PJBA 3SCZA 1KEPA 2GI4A 1NMYA 3KYBA 4TOIA 3IIJA 4Y9TA 3BGSA 5IXSA 1N0WA 5C18A 3IEVA 4GKBA 4RKRA 1H3NA 3PLAE 2YJGA 4N01A 3TUIC 2FMHA 3SZLA 3V33A 2LV8A 4WW0A 1BEEA 4UM5A 4OMDA 4PHHA 4H7KA 5IT0A 2H5EA 4DLSA 1YCFA 2W90A 2V6JA 5L40A 4DLUA 1ORRA 1X9IA 2QN7A 2OXEA 5E1MA 1KEEB 3SD7A 3PEVA 4RVSA 4ZVLA 1SVSA 3JQQA 4XOIA 3JQBA 4C4YA 1PR2A 1W7AA 4CTKA 3DA8A 2IU0A 1MIOB 4I8IA 4C3ZA 5J63A 1R6AA 2YWEA 5CVUA 2BLLA 4EHLA 1EHIA 4XARA 1Y8RB 1TCCA 5SY4A 2FX3A 4GD3Q 4WESB 3QVOA 2QJRA 2C9MA 1L4FA 3AWIA 4ARSA 5AVSA 1YVDA 2QORA 3LK7A 4NVRA 3HFRA 4WZBB 2AC4A 2VZ9A 1AV7A 3EAFA 4ACAA 2L69A 2YN4A 3SHOA 2XI4A 3ZBQA 5HKBA 1G66A 3KT0A 1H2XA 1IIBA 2W2LA 3I1IA 1DEOA 2R3SA 3NHRA 1W59A 3T5BA 5DBHX 3VYTB 4UMFA 4JQCA 1EUCB 2FNAA 3DDSA 1BOFA 1MENA 1UBEA 2PCJA 3HVJA 1MAHA 4GPBA 1Q7EA 2IOFK 3D1JA 4MR7A 1XC7A 4GSKA 4URWR 4XX0B 2QF7A 4JP8A 2PX0A 3PENA 1RYNA 2FPKA 3JQCA 4X1KB 5EYPB 3U26A 3AYXB 4MWTA 1RZRD 5DYGA 4BNNA 4EG7A 1BHQ1 5EWJA 3F3YA 2GLXA 1V16B 1KBQA 2KYRA 2YJNA 3L8EA 1W0CA 3QVVA 1UXOA 4QAJA 4M9XA 2N3ZA 1R0YA 3IAUA 4NU0A 3SZRA 5JC8A 5LUAA 5ALFA 5ESXA 1I2AA 4WE3A 4JVLA 5I7VA 5H8WA 2HXGA 4WH0A 3HRHA 3N2GB 3A1FA 4Y2GA 4CN8A 2BFPA 1U0RA 2B8EA 4FUTA 4Z1MA 2VS1A 3FKJA 4IXDA 2JNWA 4G63A 1JYFA 3C6QA 1LSOA 2F17A 2IZ0A 4PPGA 4QOGA 5EE5B 1FSPA 1K6JA 4YYEA 2HHAA 3DNMA 4HPXB 3IDZA 3O3NB 1Q2UA 2ODNA 5HUJA 1PQUA 2FMKA 3KL4A 3DZFA 3O1LA 1V96A 3BMCB 1VSQA 4NKRA 5ALRA 4D6PA 1MDFA 4B7XA 4JI7B 4NDNE 1G291 5CJPA 1QGYA 1RJFA 2Y76A 4JOBA 2BTQA 4AY5A 3BD9A 5ICEA 1FFYA 3IHLA 1QVRA 3KUDA 4ILKA 5AHOA 3PQCA 2IPAB 2PZLA 1RXEA 3WK7A 1QP0A 1XD2A 2HZBA 4RPLA 4GL2A 4Q4JA 4QYSA 4WNIA 3IVMA 3EISA 3DEKA 4FDMA 4QU5A 5J5VA 4C2TA 4CLOA 3JVDA 2E5FA 2A84A 3I8XA 2BHRA 3UMMA 1HURA 4Q0MA 1HQYE 1QVAA 1UAYA 1OXVA 3VA7A 3M6MD 3OTWA 3CX3A 5D7NA 1ZCFA 2CXNA 3M83A 1YZ3A 3RYIA 5C1OA 4H9GA 5DNDA 5DBGA 3O7MA 5LMUB 1U9JA 1XZNA 4TPKA 5DULA 4Z4CA 5IT9A 3HYRA 4K3VA 4KIGA 2DULA 2MOKA 1Z62A 2O2ZA 3RTEA 1KBZA 4DMKA 4BNDB 1GRCA 2C3PA 4GBGA 5GVRA 3D4NA 3ZKAA 1V7CA 3OC0A 2X9QA 2O0JA 4Q9LA 5E0KB 3H8SA 2CV1A 4RZ2A 4CIDA 4F9FA 3QBJA 1H1DA 4FT2A 1IOWA 1J33A 2MYPA 3T3EA 5L4SA 1M1YE 4UQPA 2W70A 4NQZA 4IHKA 5B3JC 2VDOB 2I67A 1V5WA 1ML3A 4D0LB 5DTJA 4E14A 1L5RA 1GZ3A 3D0KA 1GDHA 2JLSA 3KUKA 3M4NA 3MFYA 1B3RA 1FYVA 3N75A 3PIIA 4OP1A 5AUQA 4D6YA 2H5IA 2A9PA 2R6ZA 3FCAA 3GJTA 4M1MA 5SZKB 3NCTA 1K27A 3SE7A 1ZCBA 2O3TA 2FU5C 5LC1A 5TMPA 3K94A 2NVUA 4Z9YA 4MDFA 2HKIA 1T1IA 2G4LA 3KC2A 2OKCA 4P84A 2RAVA 4UBNA 3D8SA 1SXQA 4NPAA 3VTFA 2WTXA 3RUEA 1LV7A 4AF6A 3KYCA 3EFEA 2P8SA 2A5YB 4UFNA 4ZMRA 4H16A 2XPCA 2ZUEA 5SYNA 2C9ZA 2FP3A 1KJ8A 4GOOD 4X8MA 2R9VA 1Q95A 3KTFA 3T61A 4O2BF 4A5SA 3V8RA 1YZUA 2AG0A 1RQNA 5EEHA 1XLVA 5HMLA 1HFWA 4B82A 2P5UA 3RHTA 2IEDA 3QUAA 5CLLA 4DLPA 2B37A 3I9OA 2BEUB 2R11A 2B92A 3JZMA 4LBVA 2OCAA 1L5WA 3JQRA 3ZTTA 1JDVA 3N9IA 4YCDA 1G7SA 1ECCA 2DFPA 1YU6A 1E61A 5DTRA 1O2DA 3WB1A 2AHRA 2P68A 2GZAA 2WHRA 1ESEA 4OQDA 1XEFA 4RD2A 2A33A 3K09C 2VAPA 1I2BA 1QG4A 1TF7A 2O7NA 3RLFA 4RD1A 2QL6A 4M0MA 5A2GA 1R64A 3FI9A 5KWEA 4RZUA 1OGJA 1QIGA 3Q6IA 3VNRA 2O8DB 4YDSA 1NG1A 3K0CA 1GPAA 5JSYA 3UIEA 2BPOA 1DIRA 2FCAA 4C07A 4MO9A 4NZZA 3WGVA 1HC7A 1NI4A 3C97A 2XVAA 3KJQA 1E0DA 4AMUA 4QLAA 1PEAA 4PEVA 1UFRA 1VHJA 4C30A 3UFBA 1JHMA 2DU8A 5FX2A 3W5DA 2IOYA 2PANA 3VYSB 4UTRA 2I87A 5KWJA 1QE3A 2AXNA 4O5AA 3AVXA 1TU0A 1Y82A 4NNPA 5CEFA 2PKYX 4DMMA 2O54A 1YQ9A 1NZJA 1LSSA 4KYVA 1QMGA 2JLRA 4L27A 5MFPA 1JG2A 2W8ZA 3IQWA 1UZMA 1MOZA 3D7RA 4QUIA 3EFHA 1F12A 3FE2A 4QOIA 3CLKA 1N0HA 2JCSA 1SU6A 4FFBA 4GMGA 2YCBA 3Q72A 4L9SA 2CF5A 4OBXA 4DIEA 4RMJA 1J8VA 4CMHA 3GUYA 4DLVA 5F64A 2LDXA 5ALLA 3QLEA 3ICCA 2VYVD 1LDYA 2UXBB 2G67A 1QRUA 2W0SA 3AERB 2BM8A 3VRHA 1TRKA 1JVSA 2AT1A 2CUNA 1RQ7A 2H31A 3VOAA 3AP1A 4ENTA 4WDRA 3ZU3A 2FQWA 4X7RA 2NQ2C 5AHXA 2E3JA 3I45A 3NKLA 3PQ6A 4CKYA 4OKIA 1ZC4A 4F5YA 3BILA 4MS3A 3HA3A 2VRCA 721PA 1YDGA 3AETA 2WM9B 1CQJA 3C2QA 3NHWA 3O4GA 2VOEA 1Y9DA 4PPNA 1XLTC 5HOQA 3AY0A 4KAJA 2B6NA 4PLYA 4RU1A 2ZBUA 3W77A 5AHWA 1FUYB 4AKSA 4BRSA 4C4RA 4IOKA 1Z56C 2R66A 3HP7A 5K3OA 1QIDA 1ZI9A 2H4XA 4NYJR 1KGSA 1TT5B 1AF7A 2WAYA 1OXSC 3AK4A 4QOEA 4YAUA 5K8LA 3BCSA 4MQBA 4ZWNA 2G08A 3LM8A 3AXSA 2XVZA 1XCJA 3C5HA 2G6TA 3UHFA 1VKOA 3KT8A 4OLJA 3TGLA 2QJWA 4JBWA 5KOJA 3X2EA 2Y66A 3B9QA 4B73A 4J1TC 4OBWA 1ESCA 1ZM4A 2V8OA 3HI6A 2O8BA 4KO8A 1RC8A 4RIEA 3TMKA 3LUGA 1JIKA 4DMHA 1WW3A 1S3GA 1XN4A 3WK4A 5BRNA 5M2QA 1KS2A 2ZS9A 1EX1A 3HJHA 3V5NA 4BIIA 5FCDA 5JEDA 5LA6B 2IS1A 4E2XA 3C14C 3QX9A 4CU2A 2ZDGA 3D6JA 3H42B 1KFBB 2IITA 3CHYA 3DE2X 4WFJA 4XCXA 5JHGB 1P7WA 3P0JA 4R2HA 2FR0A 4GPIB 2W5UA 3PXCX 5CA0A 2UVQA 5EXTA 3CVUA 4IFBA 4YGYA 1I1NA 5JC1A 1II8B 3MD9A 1PEYA 1H0RA 1NVMB 3OCUA 3TLEA 2VKQA 4J0IA 5IF3A 4GKJB 3PD1A 2FMUA 2D0PB 4XGKA 4TKVA 1E2UA 3ZU6A 5AI6A 4BBJA 1OILA 3AVYA 1U9CA 4K05A 2JHAA 1SEPA 1KGDA 1NAHA 3GPIA 5F3DA 1MJGA 1N1EA 2AS0A 1NQ5A 2QROA 1GZSA 4NE2A 3WP1B 3WVNA 1ABFA 1UT5A 2QT9A 5LZ4A 5ER6A 5FAXA 3INGA 5BW5A 1IHYA 2WHXA 2X41A 1T9BA 4X24A 3IE1A 2WAXA 1DPGA 3T35A 4QFBA 5FLXA 3L82B 4DL9A 2CFSA 2PMWB 2QGZA 4XJXA 4F7WA 4WZBE 2C2ZA 3NHPA 1EE2A 4HLUC 1DDOA 1RW4A 4DEYA 3WKDA 2CB0A 5ICSA 3AESB 3M49A 3RSCA 2PL5A 2J0SA 4XWTA 1YIDA 4JT8A 2H4JA 4KI0A 3WMXA 2QSUA 1L5OA 2IYNA 5LSAA 3HYCA 1ID1A 2P77A 2YX1A 2IYXA 4OB6A 4KREA 4LVNA 4BNVA 1TTHA 3BGVA 3LIIA 1EFVB 5JTTA 1GU0A 2BR3A 4PYRA 2J9FA 4XLZA 4IDNA 1I9CA 4HG2A 5MFZA 3WNVA 4IMIB 2XUJA 2YICA 1FFXB 3LPNA 3LA8A 3EVDA 3MBKA 4HYQA 4NOKA 3VNQA 4B4KA 1ZUWA 3Q7QA 3TTXA 5KYUB 3GFRA 1WP9A 1HH4A 2HRQA 3KPJA 2OKGA 1FDIA 1U1CA 4JLSA 2FEXA 5JXWA 3FGOA 2C7BA 3TXYA 2QPOA 3K2IA 3VXKA 3WXBA 3L7OA 3ABSB 3N74A 4DVGA 1VCIA 5KQRA 2XRYA 3F5MA 3E3LA 2OFXA 3AZPA 1ADFA 2RDMA 2TECE 1HZZA 2A1TS 3CLHA 4U7HA 3N86A 2ZB4A 4Z4HA 4UUPA 1FIUA 1ZJWA 2PGLA 3OA0A 3OZBA 4ABTA 3LWZA 3BMQB 1SUPA 2B8NA 1LEHA 4WHMA 3OJFA 1T5OA 2DWQA 1X94A 3PD0A 3PGLA 2GD6A 4G1VA 1G0OA 3TIXB 2FB9A 3CZAA 4YXWD 1U98A 4BLPA 4MOWA 1JLMA 3KWMA 4LZAA 4YMTA 4FEEA 4ZAXA 3MTGA 1WUHS 3MZ0A 1NW9B 3F9IA 2AC7A 5COAA 3X1JA 2P3OA 1S9DA 5HM6A 4HL6A 4ENWA 4X3PA 4ZZ0A 1JP7A 1DBIA 3W3AH 4L3OA 1DBPA 2IL1A 3M34A 1BRTA 5AI8A 3TBKA 3KV3O 1V37A 1XRNA 1AK2A 4I4TF 1VYHA 4QOSA 1NM5A 1Z88A 2QD4A 1ZXLA 2WVHA 4FVTA 2VF8A 3RRMA 3KLNA 1M2HA 1B74A 1WPXA 5CHEA 1TZBA 3K6SB 4TZKA 4YT5A 3T5MA 3L8YA 1JG6A 1TQ8A 2ZR8A 3PE6A 4BX8A 821PA 3GLRA 3KKNA 3DE7X 1KY5A 2W48A 4IDQA 1KI2A 5H3CA 1V1RB 3D8BA 3WQBA 4BNJA 2XE6A 4R2XA 1AK9A 5T8KC 4Z2AA 3BDAA 2CJWA 1GTSA 2D2XA 3DPSA 2R1TB 4ZO8A 4U63A 1KI9A 5EFOA 1U0EA 3P2EA 3MOIA 2RHWA 3MIIA 4MUNA 5DTIA 5LYYA 3QWHA 5JCOC 3AM1A 1JPVA 3V2GA 3VHRA 2JAHA 3FMPB 2VK1A 2Y1FA 3VV3A 3TIGA 1G8KA 3NNSA 1G3MA 4BP3A 5JFTA 3FDJA 1XEAA 2ACKA 2ZUBA 3N2KB 1NVVR 3QPDA 1SC6A 2WVJA 3OICA 5AVUA 2BFDB 1X1BA 2D62A 4GI2A 3G7UA 2IYPA 1IQ0A 1OI2A 3EH2A 3FD8A 3FLEA 3MCWA 1P80A 4JU8A 4XIGS 1NTRA 1WMAA 2E5WA 2SCUA 2EGGA 1JDPA 4V0MA 1LPMA 2IWHA 1DJPA 1VJ5A 2WFLA 4OGFA 3TW4A 1AD2A 2JIBA 4QGGA 4V03A 1I1OA 1K7YA 4DGQA 1NVBA 5EZQA 4DCMA 1SEVA 3KSZO 4IWXA 2QJOA 5AK6A 4F4UA 4E5KA 1Q15A 4QJ3A 4MV4A 1WW2A 1A82A 2E4AA 2P1ZA 5LP1A 2E9SA 3KFXA 4FMDB 2VNHA 1SUSA 5TS2A 2Q4BA 1XMSA 3ORSA 4KRYA 1NKSA 1N6NA 4GOJA 4QYWA 2H1FA 2OHFA 3PHIA 4LTMA 4MUYA 4TLDA 5CX1A 2DQSA 5K20A 5HK9A 3M6XA 1ST3A 3TQIA 3A1TA 2O2HA 2H92A 3LY7A 1GQRA 2D54A 3JR7A 4NE9A 4O0MA 4AJLA 2ZU6A 3C8ZA 4FGUA 2WJVA 3KB8A 3V4LA 3DHYA 2OC4A 4OIFA 4D02A 5CW1A 5BSRA 3A1DA 4CTOA 4CLXA 4M53A 1ZCAA 2P4EA 2W2XA 1U2PA 2WDZA 3AUFA 4KPGA 4F2HA 4ZICA 1S9HA 4YJ3B 2O2EA 3VI4B 2SICE 3JQDA 5KVCA 1G9TA 5FF9A 1WXEA 2QYTA 1QANA 5DBIA 3SY8A 2HAEA 3EGWA 2VCYA 4PC6A 4B9EA 3RJMA 5EZ5A 4A0FA 1BJTA 4RD4A 2FEPA 1GQQA 1HBJA 1A88A 1MB9A 2FEKA 1D1QA 2OG1A 3PBKA 4RWEA 3MC1A 5C4IA 5IDXA 1N5JA 2PUGA 3BIOA 1YZLA 3ENQA 4INZA 5B1SA 4HDSA 1DQSA 1JLSA 4GEGA 3C7KA 5C31A 5KYYA 1JJIA 5LXTA 1U2GA 4KU4A 1EK5A 2RGNC 1DFGA 3WISA 2JGDA 4CU5A 4L7VA 1MFPA 1M7BA 5BR4A 4CW7A 3IIIA 2DERA 1DAFA 3N7UA 2EFHB 1N8KA 2IRWA 5CFNA 3I76A 1GAEO 1RAAA 1T2AA 2QX8A 1XQ9A 3L7AA 3Q3EA 1M6EX 4LEIA 1IG3A 3RF6A 1SZJG 3WGIA 4QOJA 3FW1A 1D1TA 5E1DA 1U0GA 2HUPA 1BHSA 2JFBA 2RIRA 4B33A 3QJGA 3AW8A 3NBXX 3ZWYA 3W9SA 2DWOA 3PEUA 2VHZA 3FB4A 1YJBA 4WSOA 3V7YA 3ESZA 1W96A 3NHYA 2C97A 3N8NA 1J2TA 2Q1WA 1W25A 2DR3A 2YZ7A 4IGAA 4HVTA 4K9KA 4LGCA 4QARA 3KQKA 2V54A 1GKIA 4WXEA 1U2QA 4J1NA 4PICA 3BYZA 1M6WA 2F8SA 1DJLA 2ZSJA 4BVHA 1JFFA 2CD7A 3C6YA 4HDOB 3SLRA 5I6DA 4QDXA 1F20A 3AJAA 2Q5CA 5I51A 4MV5A 4QELA 5EHZA 3L4JA 1JNYA 4C78A 5B58T 1W87A 1L7DA 1OPXA 2OESA 1TJPB 3RBXA 5EJAA 1PBNA 1WXFA 3VJRA 2OPBA 5ITSA 2JI9A 1BMTA 2BFCB 5CXUA 2CFTA 2PKRA 2ZIVB 5E38A 3VR6A 3GLTA 5E0OA 4X64B 2JHFA 2X1MA 3GT4A 3TLZA 3GEDA 2E21A 1GVNB 3ZUGA 3A6PC 2QX4A 4BO7A 2H1CA 1PT6A 4KXVA 3RC8A 3NBMA 2HTFA 1BE0A 4BB5A 3O9ZA 4EW3A 3KKLA 2APJA 1UBLS 2OBYA 1G4HA 5L9AA 3P9IA 3LC0A 1VIAA 4FBLA 5KTNA 3RS3A 2V3CC 2BMWA 3A36A 3E1KA 3SBXA 4C01A 1YTUA 1L7BA 2EYUA 5B6PA 3OT1A 2QP4A 2ZG6A 3P9CA 1U6IA 2FUNB 2CHQA 3DUFB 2FK7A 1FDUA 3ESXA 4DJFC 3KYJB 1Y3HA 3NATA 1LBEA 3SJAA 4AICA 3BWXA 2DHDA 1XLWA 2C7VA 2PBLA 3TRFA 2Z9BA 4MLCA 1E59A 5J1SB 2RK4A 4FFSA 1NZFA 3PJGA 3N6XA 1MV5A 4FE4A 4PYKA 4WXYB 5KOHB 2OHHA 4V2UA 4JP3A 1SGWA 4J9VA 1T6ZA 5BVGB 1YJXA 1KWKA 2AZ4A 1LW6E 3MAAC 1LVHA 2ONKA 2OOKA 4R01A 2IUEA 3CF4G 3RTGA 5JV5A 1N32B 3B8HA 3CA8A 2BD0A 2D59A 1M1YA 2H7XA 4I3FA 3UGTA 1M2WA 2VUTA 1D8AA 1I6MA 3NPMA 1DKMA 2CEAA 1X13A 2PX5A 1FYEA 3Q3VA 4QQKA 4ZJZA 5DLPA 3IYLW 3CZCA 1C4KA 1QORA 3FCSB 3TOZA 1DAGA 2YWXA 5AW7A 4PYOA 4V24A 5FUVA 1US8A 4ZD6A 4KR3A 1Z36A 4OAQA 5FWDA 4YB8A 2G40A 5GJCA 3U48A 1PR3A 1U7WA 1TM1E 4YJ3F 2EBFX 3FOWA 4OYLA 4F5ZA 5TQ2B 5HKAA 1TAUA 3R2JA 1MZPA 3S1AB 2AJCA 3TZEA 4WASA 1NYRA 1HTWA 3RU2A 4TSRA 3K73O 1HE1C 3FNIA 2FCRA 1OU0A 3E7WA 3ASVA 2IU6A 3DAYA 1BSVA 4Z4IA 4YQEA 2VDLB 4OMUA 3A9RA 1CZRA 1HE4A 1PFKA 4HJXA 3DE3X 5HFJA 2XVXA 5KDLA 4BO9A 1OF1A 3B9RA 4TKLA 2YQ5A 1H4SA 1QK4A 4CKBA 4EKYA 5CYOA 4YBRA 5DXFA 5C7LO 3OOHA 4JJGA 1SN7A 4Q9NA 3F4LA 4RD0A 3U80A 2Y1XA 3LQQA 2FWBA 1LSUA 1CC1S 1RCTE 1VTKA 3NM4A 3ZLTA 5JXHA 2GARA 1QWSA 2GM5A 1JDBB 2JFWA 2WP0A 3AETB 4FP9A 3BSYA 4RHTA 4ZT5A 2I03A 1AC5A 1ZM2A 1JECA 5IG2A 4FWIB 1TVEA 3H6GA 2IPNA 2HHHB 4MV1A 1PIWA 4JL6A 4H7DA 3CIFA 3T7JA 5FOVA 5EKXA 3MRXA 3OIVA 1FX0A 4R2IA 2BELA 1S1CA 2EGHA 4M22A 4NMHA 5SV2A 2HD4A 2XITA 5KYXB 3NNDA 1FBTA 3RNLA 4DVJA 3FPGA 2R6AA 4UHDA 2AUTA 3CNOA 3KXIA 4UHCA 3UT6A 1Y5LA 1W9HA 2XW6A 1F9AA 4WY5A 2REXB 2Q0QA 4QG7A 1SXJB 4Y1GA 1IWBB 4HI0E 3R40A 2YCLA 3BB1A 1GN8A 1IWPB 2XJ4A 4GZ6A 3GN1A 4TYQA 5CT6A 4HT3B 5KQMA 1NDQA 2PX3A 3KOYA 3SEFA 2HK7A 3M33A 3EULA 2IIQA 2HT1A 3K71B 2XNDD 2RGBA 5DMHA 3AVOA 4FCWA 1QC5A 3HFGA 1ZL2A 5CBPB 1UUFA 4NV1A 3QOXA 3ZK7A 1T1JA 3I30X 1F8FA 1L4MA 4JZKA 1RI2A 3NJRA 3IAM6 4NCHA 2ZSDA 3FDIA 3S2IA 3SDBA 3ZYZA 2Y6VA 4BLSA 3VH4A 1QDLB 2LCFA 2I8LA 4DC0A 3LGXA 1ZUIA 3NU1A 1SOWA 4W63A 4PC1A 5CVEA 5AJXA 5JCZA 3B6ZA 2GXAA 3EVCA 3Q85A 4MYCA 3C48A 2HU5A 4PYMA 1NASA 5CGZA 2HFKA 4CM5A 1GFSA 4F4DA 5KTSA 1C2YA 2CZCA 3OKPA 3DONA 4NC9A 4X91A 2HQSA 4Z3KA 4NL4H 4K1XA 4YCSA 2HSGA 4PYNA 4CG2A 4JP1A 221PA 1GSAA 4ZTZB 3FVWA 3KSMA 2ZKIA 1TF2A 3SIPA 3HMKA 4MRNA 4E2YA 5EKSA 3U44B 2GK4A 2JLYA 2I3BA 4U9IS 2H1OA 3H11B 1J90A 1ZUNA 4LWOA 4NJEA 1UWVA 4F6CA 4J03A 4JYBA 1DZIA 2C31A 2Q1YA 4ZEXA 3IJPA 2KS6A 3ISTA 1Q44A 1CY0A 2WD8A 1GDTA 1PRYA 3C3AA 3DOJA 3JTEA 1H93A 4P8RA 3WWYA 4I5EA 1XZFA 2I99A 4N6OA 1KFCB 2ZOSA 3BE8A 3ADBA 3I53A 4ZKDA 3IAEA 3E7PA 2WIFA 3KHUA 5LIRA 3AINA 1RLOA 1BWQA 5L4NA 3EASA 3QPCA 2JLUA 2PZKA 5DZSA 2DT5A 1BW9A 5L3VA 1XTZA 1NSTA 4LCEA 4I14A 3WSWA 4C88A 3R3VA 2WRZA 5EMJA 3T5AA 2O4CA 1TVCA 1Z83A 2Z6UA 2XE4A 2NU9B 4DA9A 2INGX 3BAZA 1I51A 4XFDA 2BSQA 1E3MA 4EB8A 3FTQA 4KC0A 2HJHA 1E63A 1K06A 1ZLYA 2ZRNA 1ONBA 5F2EA 3WC4A 3ZI7A 4F06A 2IFTA 1TM2A 5KJ6A 1Y5IA 3BB3A 4UD6A 5ANRB 5A0VA 4WZAA 1XVUA 3TR0A 2G9ZA 1HG0A 2XTMA 3EZ6A 2JGDB 3FLAA 4KVAA 3FR8A 3AR5A 4L16A 5D85A 3VU8A 3GBPA 3SGLA 1MOPA 1NMZA 5KNLA 2GM4A 4LOKA 2QL5A 3FTNA 2F9MA 1NSFA 1KYXA 1JG7A 2A30A 3AIOA 3LT1A 5JIBA 1NFQA 1SR8A 1YZQA 4OX9B 4GP7A 3QUTA 4CL2A 1FJ2A 3CZPA 4U00A 1EZ4A 1OXBB 2XVYA 3QYFA 4CEJA 1NWCA 1KIAA 2J9XB 3UC9A 2PH3A 4KVZA 1PK8A 3OECA 4LBZA 2NVBA 5AVQA 4AJ2A 3OMLA 4UTOA 3E7DA 1AZTA 1C3OB 1PNTA 4P82A 1XL0A 4DBVO 4ENPA 4J6EA 3GJ4A 4O4JF 5BSMA 4B4UA 3ZJTA 3WNZA 2FXVA 1VLQA 1MVNA 3ZW8A 4PRZA 2IHYA 3AKEA 3ELBA 4RACA 2JDID 1LF0A 1M33A 3TLGB 3GLFE 4U2KA 2V5VA 4DM7A 4Q16A 4Q9KA 4DCGA 4MAFA 5H59A 4V0LA 2O23A 4DOMA 5L6MB 3IIKA 5JQGF 1VPLA 1OTHA 1CY1A 3FAZA 3HBAA 3HWSA 2JAXA 5CX1B 3SLKA 5JBQA 3FWYA 1JJ7A 2PR2A 3BMCA 3HB1A 3N07A 5LNK1 1VLJA 3GFBA 3II6X 4KQ9A 3URMA 4LJRA 3V4OA 1I1QB 3R8XA 4A8JB 4PSCA 2VCEA 3NUGA 1MGOA 1YB4A 2O2CA 3GG2A 3HEAA 3HYTA 3RVPA 4X97A 2QVXX 4NI5A 1DXYA 1HXHA 2AFVA 2G9QA 5KJEA 4L08A 4DQDA 2D0OB 5GV7A 5JCPA 1KJIA 1E2KA 2AG5A 3OOSA 4ZP1A 3A1EA 4JXZA 2B5OA 4X3CA 3GHYA 4Q02A 3MYYA 4IEIA 3A1CA 4HDNB 3PC8A 4JYAB 3IB3A 3EVTA 2CUZA 1R7RA 2H7YA 4FB5A 3TCXB 3D9QX 4ESOA 2CXRA 1E1QD 1PR4A 2VH1A 1EAYA 1IN6A 1HDYA 3MWEA 1UM9B 2F1JA 2HV9A 4P4TA 4TV9F 4AX4A 4CCYA 1FXWF 2V03A 2OILA 3OJOA 2VLIA 4XR9A 3I9NA 2F3PA 3GUUA 5H70A 2QD1A 4DHEA 1U8UA 1UPUA 4UE2A 1ODCA 3AKDA 5ICGA 3DO8A 2BKXA 1LF5A 3WL8A 4ZVQA 3THSA 2J0QA 1N8TA 3TOVA 3DPUA 2OT3B 4QM7A 13PKA 4LF4B 1QF6A 2HPAA 3PFWO 4XGRA 5DTEA 2C4VA 1M5RA 2VXBA 4HPJB 2I34A 2BFFA 4MWOA 1UJ5A 1A4IA 2FW8A 1NNUA 1I2CA 3B70A 3H2IA 2EARA 2ZBPA 5TMBA 4CLHA 2C57A 3K6SA 3U16A 1I4EB 3PWTA 4G1UC 4TS4A 5DYNA 3WFJA 3QH4A 4E70A 2EXXA 1U2DA 4F3CA 2IHJA 3HV0A 4P5EA 4EI9A 1WB5A 4OU4A 1LRJA 1IZ9A 2OBNA 4G5YA 2VSNA 3QKIA 2ST1A 1N75A 3NHAA 1L3IA 2XBMA 3L49A 3ZU2A 4YUXA 4G85A 3VBEA 3WGHA 1HFEL 4BJ1A 1AKVA 3F47A 4JVNA 1EP2B 2WU1A 3CUWA 1JU4A 3MOGA 4KODA 2QVBA 3HXKA 4PC3A 4UFOA 5LQNA 1RWVA 1PS8A 2CXUA 2XF8A 3AL0C 5FO0A 2VNJA 5FOWA 3GLUA 1NJ1A 2SKEA 2X86A 5KO2A 4P36A 3RSLA 1HE2A 2FUG1 3GRAA 4XYBA 2C99A 1BXKA 3D0RA 1NNEA 4JB8A 4LDNA 2W9XA 4G2NA 3ZWKA 3KLPX 1X7WA 3I2GA 3BPSA 1IHXA 1V4VA 2PGIA 2JLQA 4TWJA 4G5OA 2JS7A 2Q28A 1HR0B 4PFKA 2GWHA 2JFFA 3GP3A 3JZFA 1RHMA 3WK5A 2XUZA 3LZCA 1OZAA 3ZDQA 3R4CA 4LHSA 2G0NA 1ISFA 4DBZA 4Z51A 3A14A 3K1TA 3LKDA 3MCVA 4GPEA 4UNQA 4DUPA 3MD0A 4N49A 4BBAA 5EVJA 2ZBGA 4NSNA 3EE6A 2OBMA 2JGMA 5JO0A 4K88A 3V7FA 3AR4A 4JUCA 1CRWG 4FGWA 4TKUA 4ZDJA 1G7CA 4LK2A 5JZBA 1Y9AA 2EJWA 4CXMA 2PSFA 5A5EA 2HADA 1I3CA 4ER3A 3SMQA 3HDTA 2OAEA 1UJBA 3VR5H 3EN0A 4XW2A 3V6LA 1E1KA 2FN7A 3ZXYA 2ZYVX 4BMNA 2XQJA 4P4SA 3GD7A 4V0KA 2P5YA 3I9V6 5F5XA 1P74A 3ZJ4A 3GA0A 2EFJA 3AEYA 1BVYF 1N6PA 2BDTA 3HP4A 4M9RA 2G5GX 2VRWA 3O4IA 3BJRA 3AHGA 4IOJA 3S8EA 1J2UA 1L5SA 2RI1A 3BQMB 4HNGA 4JLJA 1DZ3A 3WAKA 1XWWA 4KNVA 2X7XA 2ANCA 1X2BA 3IAAA 4BB6A 4I81A 5DV9A 5G40A 2LRHA 1BNCA 4DHWA 3RWOA 2VTVA 4KTTE 8AT1A 2NTNA 2IBTA 3QE0A 4HQNA 5K0NA 2QUZA 3L1VA 2IQIA 2PRKA 1YF3A 1M7HA 3E82A 4NF2A 5ADWA 3VJKA 5ITZB 2RKWA 3E5MA 4H6VA 1BCSA 3HG7A 3JQ9A 1CDEA 4ZO7A 1QYCA 2Y4OA 3FUUA 1RU3A 3A4YA 2F1OA 1IY8A 4PNPA 1I2DA 2HSEA 3OD1A 3EXEB 3OVMA 3QRWA 3R0QA 1XR3A 4IFEA 3T0FA 3QQPA 1OI3A 3ZUPA 4R1TA 1NSYA 1K0FA 4K40A 4MRMA 4WN3A 3RIYA 3FYUA 1GUFA 1XA3A 4O08A 2V3WA 1U3UA 1KK2A 1DIOB 3AG6A 3DTNA 5DIZA 3IQEA 3F6SA 2PO7A 3BREA 3THXA 3I5AA 1X7XA 1YV9A 4OQXA 4PLTA 2AB0A 1O9GA 2H51A 3F6RA 2Z8YA 4UM7A 3V48A 1KKLA 2YXBA 3VHLB 2GN6A 1P2GA 3IA2A 2XXJA 4WXRA 4B8WA 5L51A 3S5JA 1HDOA 3UAXA 1EINA 4I5DA 4CLRB 4MVYA 4YH1A 1DB3A 2HT6A 3GFSA 3GZ4A 4FCVA 1ZPDA 4OOFA 1JDTA 3CMCO 3FWNA 4M9QA 1ZGCA 1POWA 3RROA 4XJTA 4RTSA 2NTEA 3A9WA 2EU8A 1PCXA 4IQFA 3ZJUA 1TT5A 2I66A 3NR2A 5H16A 2GPTA 4IDBA 1E60A 1W44A 2YVQA 1E79D 4D41A 2B69A 2X3FA 3IT2A 3CSSA 1W2GA 4LCBA 4L6AA 1EA5A 5KPDA 2G71A 2X6QA 4OVKA 4K0RA 3B1JA 3BN3A 2PUFA 2BV3A 2WUEA 3NGLA 4XSVA 1Q12A 2ZJOA 2YOGA 1YL7A 1HZJA 2Z09A 4AF7A 3JV7A 4JMPA 5CA1F 4TSKA 1NC1A 3EWAA 5JALA 3PFKA 1BOOA 5TDHA 2I80A 5E7QA 4UQOA 3K6KA 4MVJD 5HJ7A 2MIIA 4FM9A 4EENA 4Z9XA 4ZAFA 5JI2E 2I3DA 2PH5A 4QASA 4RFSA 3W3AA 3R6DA 3WGKA 1ZLXA 2XUHA 4NMMA 5BYAA 1JWBB 3O0TA 3A9CA 3FCOA 3WB0A 3PFBA 4NMWA 4EI8A 3M5WA 1Z2EA 4GZ3A 5K4GA 1FW6A 4B3TB 2XCTB 3KVVA 2OV6A 2Q62A 2ODAA 4DJDC 1U7DA 4JVMA 2NWQA 2O1SA 3DBHA 1QFMA 2PL1A 3EBLA 1QGDA 2XT0A 1R6TA 3HL4A 4JOQA 4Z6KA 4CDGA 1MJHA 3CBQA 1SQ6A 3GYGA 3T8YA 5L3SA 2WWYA 4YP7A 2RHJA 4EPTA 2E82A 3VO9A 2PMKA 4MV8A 1Q1QA 5A4JA 3BFKA 3NDJA 3RRXA 4PLCA 1Z39A 2JD0A 3F5SA 3HCDA 3WMRA 3B20A 4RTNA 1U63A 2TMYA 3PVCA 4YLGA 3C4JA 4D8TA 4ZAYA 3HUUA 1O96A 1E1DA 3MPOA 2A8YA 2FPIB 1U7HA 2D5LA 3WG9A 4E1VA 3C3EA 1GTL1 1KYQA 1Z2CA 3D8NA 3ACDA 3OHPA 4GI1A 2O8DA 2Z5LA 3KLOA 3D6NB 4P0TA 2ZYWX 2GFIA 4Q39A 4RKQA 5FJIA 4OO3A 2ZUSA 3U2QA 2VQDA 3ZVLA 1M75A 3DXXA 5EERA 5DNCA 3E1GA 5KNBA 2QV0A 1X7ZB 3AM5A 1UKAA 2WFZA 4I2VA 4P4SB 3OPQA 1FLAA 1JT2A 2WIAA 3IMKA 4P31A 1O6GA 5LYJA 4YAGA 1ZJ6A 3I1JA 1JDNA 2EL7A 2YW9A 4YP0A 4RNCA 2RKOA 1LXCA 3ONVA 1IPFA 3MF4A 5FKJA 2EKDA 4ZHQF 5HQTA 2VZLA 4R9NA 5DTMA 5IZ4A 4U8GA 5EI5A 1YZFA 1F1JA 2E49A 2KHZA 2WHYA 1R5JA 3LSYA 3MMZA 3CKYA 4LVCA 4NK4A 1KDZA 1A9TA 3EXHA 1QKIA 4G2TA 4BUCA 4D8WA 1XMJA 1MZVA 3DW1X 2QTVA 4F6LA 3TECE 1ESNA 5CM9C 1WF3A 3IAXA 1BE8A 2BIFA 4OFXA 4K9OA 2ZCVA 3REQA 1UDBA 1YWGO 2BFAA 1FOEB 3HS3A 5JSQA 2YXNA 3VH1A 4L2IB 4BQPA 3RFVA 3RFXA 2X0DA 2VBFA 5U9CA 3OHMA 4PE5B 2HO5A 2JHPA 3BG5A 4JZYA 4PQRA 3ZZUA 4YN3A 2OO7A 3GRYA 2JG3A 3SBEA 1UZNA 1SH7A 3TSAA 3BA6A 3S2GA 3L7BA 1BIFA 3U61B 4MR9B 2J9ZB 4XE5A 5JADA 1M2FA 1UEXC 3TTYA 4TL7A 3G8CA 2V6FA 2B8WA 3FGZA 3HBMA 1RMTA 3KOXA 3O4FA 2GCOB 4XSHA 4OAPA 2A88A 2I6SA 1F5SA 1YS2X 2UZIR 3QLJA 2VDVE 5G4LA 3UJCA 3WYEA 8ATCA 5K45A 2GSDA 3ICQB 2QX7A 1XZAA 3DJYA 2XD9A 2EYQA 4IW3B 4AM8A 1H9CA 4JUAA 1IHOA 4DLLA 3CUKA 2HOQA 4PSAA 3B6IA 6REQA 5J5AA 4TVSA 4DQUA 3FPAA 5EPOA 4DKJA 3NHSA 1XZDA 1YB7A 1DBRA 1JKMA 1BS1A 4BO6A 2VT3A 3ITDA 3TQCA 2ONYA 1QJ4A 4L07A 2DPXA 2ZWVA 1KOFA 1ZN9A 4GZMA 4YDRA 9LDBA 2OHXA 4MA4A 1MPTA 1FFHA 1LFDB 4P86A 4ESHA 1ES9A 1E2GA 1XP8A 4JH0A 3TRHA 2ZJZA 5JEEA 3LDFA 3QU7A 4LJ7A 5I9SA 3AB8A 3Q1KA 4B4VA 3KHTA 3UH0A 4JIGA 4ZGWA 3AP3A 3RBAA 2Q6TA 2ZUDA 4WL0A 4ARVA 4ZO4A 2JIZA 3QLUC 4UTVA 1DO0A 1B16A 3OCXA 2QX9A 1JAIA 3O6VA 4KK4A 4HRVA 2HWKA 2LD4A 2ZI4A 4WZ6A 2C5AA 2JI4A 3OLYA 5EJEA 1R10A 2H8KA 5JYEA 1Q74A 3S99A