1EFPB

Electron transfer flavoprotein (etf) from paracoccus denitrificans
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
246
Chain Sequence
MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAETLRTALAMGADRAILVVAADDVQQDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQATFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVAPRLEVVSVREPEGRKAGIKVGSVDELVGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Paracoccus denitrificans electron transfer flavoprotein: structural and electrostatic analysis of a conserved flavin binding domain.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
total genus 71
structure length 246
sequence length 246
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1efpB00
1M1ZA 4MVXA 1DNPA 4ARCA 3DLAA 3KT0A 3TS1A 1K4KA 3MMXA 3FOCA 1J70A 3SDBA 2A1TS 2CYAA 3RFFA 2ZUEA 3NBKA 3DO8A 4DDHA 3SZGA 4K03A 1GZUA 1YI8A 2QUIA 5H7XA 1JIIA 1JEEA 1PFWA 1OD6A 2YXNA 3MXTA 3CVXA 1IQ0A 1KH3A 1N75A 4R0NA 4R2MA 4L2IA 1G59A 1KAMA 3F3MA 1N3LA 4DJAA 2DLCX 1TFUA 5HUHA 1IHOA 1T9GR 3NBAA 1TYCA 1OWLA 5LLTA 4EG4A 4NATA 3COYA 4KPUA 3KFLA 1M8PA 2HMAA 3VGJA 4MWEA 1N2HA 2WQ7A 2J09A 1JZSA 5EKDA 5TEVA 3LCJA 1VLHA 3N2YA 2Z09A 2CV0A 2GKSA 1NI5A 1Q77A 1T6ZA 3HFJA 3FHJA 3SEZA 3ILVA 2EL7A 4G5YA 1UFVA 3TZEA 4MUGA 4MW9A 2QUKA 3Q10A 1WY5A 1TYBE 3NV7A 4AQ7A 3P52A 3X1KA 2RD2A 1J1ZA 1OWPA 3COZA 3RBAA 3L93A 3IOCA 2DUMA 1MOPA 2I1LA 1XNGA 1F9AA 2D54A 1MC1A 2AG6A 4MW2A 3INNA 3VRHA 5J58A 1WXFA 2DEUA 1OWNA 2IELA 1N2IA 2E89A 3H9CA 1PFYA 2A1UA 2CSXA 4QBTA 1J21A 2BYTA 4MW4A 1IQRA 3OTWA 3IDFA 3SYTA 4HPWA 1V8FA 4F4HA 4NX2A 4MUNA 1MBZA 1EUYA 2O5RA 1FFYA 2IP1A 2DXIA 1O0CA 3A2KA 3AIIA 1NUQA 2AZXA 1JILA 1OWOA 1TEZA 5KHAA 4JXXA 3P0IA 2RE8A 5F23A 1O95C 4PBSA 1EUQA 1QTQA 1O97D 4YMIA 2Z3VA 4MVWA 1GN8A 1NUUA 4CDMA 2NSYA 3CVVA 3MLBA 1COZA 3CVUA 4NDAA 2QJTA 4ZCSA 2JAXA 4Q16A 3H9BA 3AL0C 3AKZA 4XFDA 4L2IB 1SURA 1NYLA 2PIDA 1H3EA 4MW0A 3I05A 1WXGA 4NAHA 3COWA 1EJ2A 1I2DA 2PFSA 1GAXA 2H2AA 3RK0A 1KQPA 4P2BA 3UC5A 4EF6A 4PBTA 1KQNA 2PXHA 4MQ6A 2QJFA 4KR9A 2GM3A 1ZJWA 1IH8A 1O94D 4MUKA 2QUJA 4EG5A 3ND5A 1M83A 2QTRA 4G5FA 3CLSC 1EFVB 1MAUA 3UY4A 3Q4GA 3N8HA 1QRTA 4HK4A 1HYBA 1F7UA 4OUDA 4KR6A 1PFUA 1BS2A 2PG3A 4ZT4A 4EG3A 3IVXA 1N2JA 1JEDA 1WKBA 1OBCA 2A86A 2CV2A 1A8HA 1ZH6A 2DR2A 3ZIUA 4J75A 2VTBA 3HL4A 3CLRD 2DERA 5FO0A 5KCMA 5K0TA 1H3FA 3CVYA 3UMVA 1O97C 1M8KA 4EFKA 2AKEA 1KORA 1WOYA 3UOWA 4U7JA 5IJXA 2JA2A 1P7PA 4JYZA 4KR7A 3IUEA 2YY5A 3D6VA 4MAFA 1QNFA 3LOQA 1RQGA 3FI0A 1GLNA 2PZAA 1R6TA 5JBNA 2E0IA 1O95D 1GPMA 4EG6A 1U0BB 2EJCA 3TQOA 3H99A 1JHDA 3MLAA 5K0SA 1X6VA 3CA8A 3QE4A 5HG0A 3QTTA 1U3CA 1LI5A 3FETA 3H97A 1N2GA 3UK2A 2E18A 5FNZA 3RHSA 1VL2A 1KR2A 1QJCA 2D5BA 4JFAA 3PNBA 3U1VA 3DV2A 3E27A 1O5TA 4MUIA 3ND6A 2QTNA 3IVCA 2CYCA 4MUJA 4ZCPA 1H3NA 3CLTC 4MWBA 4YP7A 3VU8A 4YBRA 3CLTD 5HUJA 4EGAA 3ZGZA 3IOBA 1WXHA 3P0HA 2TS1A 1MRZA 3RK1A 2CV1A 3CLRC 1T6YA 3SP1A 4CDNA 3RJZA 2DPLA 3CLSD 1WQ3A 4EG8A 2A4MA 1LI7A 2J08A 2X1LA 3Q12A 4MUHA 3G6KA 1M8JA 4GU5A 1JMVA 3DPIA 4E1AA 3FNRA 3M5WA 3IMEA 3K9WA 1VBMA 3CLUD 1MB9A 3A05A 1Y42X 1LW7A 4MW1A 1NUPA 3KT8A 4JZYA 1IQUA 1Q11A 3QTBA 2V0CA 1N2BA 4Q93A 5IHXA 1B6TA 3S3TA 3FDXA 2OQ2A 3ZJVA 2CUZA 2WQ6A 2BTEA 3A4IA 1ULHA 3IUBA 1CT9A 1KH2A 2X1MA 5J59A 1TQ8A 2ZP1A 3HV0A 1WZ2A 3IVGA 1NUSA 2WB2A 1PG2A 1PG0A 3K32A 5BNZA 1VBKA 4UZEA 3H05A 2HGZA 4A91A 1YIDA 2WSIA 4PBRA 2YWBA 1WXIA 4ZCTA 4U8HA 1ILEA 1GTRA 1O0BA 3FH0A 4QREA 2YWCA 1YUMA 1MAWA 3HZRA 2R5WA 1ZUNA 1M8FA 1H1TA 4MVYA 4ZT7A 2B7LA 2QJOA 1YIAA 2O8VA 4ZT2A 4MULA 1NURA 3ISJA 3PRHA 1KH1A 4MLPA 1MB2A 5TGTA 4ZT5A 4K0RA 1F7VA 3ZJTA 3MUEA 4ARIA 4RPIA 1I6LA 3D6UA 1U7DA 2A1TR 3AG6A 5TEWA 5DB4A 4ZCRA 1F4LA 4MWCA 4ZCQA 5LFAA 1KQOA 2CT8A 3FWKA 3FIUA 2QUHA 1TYAE 3TNJA 3C8ZA 2X3FA 3LE8A 4EG7A 4NAUA 4CQNA 1M8GA 2PZBA 4MW7A 1YUNA 2VXOA 4MW5A 3CR8A 1MJHA 1R6UA 3PXUA 4ZT6A 2J5BA 4UZFA 1N78A 1EXDA 3TZLA 3TQIA 1K92A 4S1OA 2J4DA 3IH5A 5LM3A 1OWMA 1N77A 4RUKA 4MWDA 2X0KA 1R6XA 4DDKA 3X1MA 1WQ4A 5AHWA 1IRXA 5J5AA 2QTMA 4G6ZA 1I6KA 1K4MA 5FO1A 3PNYA 1NUTA 1NP7A 3P0JA 3CVWA 3G5AA 1WJGA 4TS1A 4BWVA 1JIKA 2A7XA 2J07A 2H29A 5DASA 4X0EA 1QU2A 3FY4A 3ZUGA 5H16A 1KAQA 1KKUA 4FZJA 3COVA 4OJMX 3ZXSA 2ZUFA 3HGMA 4WNYA 1YULA 1N1DA 4I6GA 3CLUC 3AG5A 2A84A 1OBHA 4WSOA 3IODA 4MVCA 1NZJA 4H3SA 1J09A 1KP2A 1XNJA 2A1UB 1Q19A 3GMIA 4I6JA 4AS1A 1JECA 4HJRA 1D2RA 4HJXA 5DEOA 3KT6A 3IMCA 2D13A 1O6BA 2JANA 3N9IA 3FG9A 4KPUB 2HZ7A 3ELBA 1KP3A 1N2OA 2G36A 3GUZA 1QRSA 1O94C 4MUEA 1K97A 4MUFA 1J1UA 1QU3A 4J76A 3X1JA 1VBNA 3SEQA 4JXZA 1G8FA 4KKVA 1XNHA 4U63A 1QRUA 4OUDB 3L92A 5TS2A 2CYBA 2NZ2A 3G59A 3A04A 1ZH0A 3BL5A 4YP5A 3AFHA 1G8GA 1G8HA 1QQTA 3JXEA 2PZ8A 1GTSA 3IMGA 4DLPA 1IFXA 1I6MA 1X8XA 4QRDA 1IVSA 4F3RA 3ND7A 2VTBB 3GLVA 4I6EA 4GRIA 4DDMA 2C5SA 3KT3A 2DETA 1TYDE 1U7XA 4DNXA 3N05A 4CT0A 4R2LA 4XSVA 4YP6A 1V47A 1N2EA 1JIJA 2V0GA 4MW6A 2IJGX 2XRYA 4ND7A 2A88A 1U3DA 3OP1A 2GOYA 2Z08A 1WXEA 4ZT3A 1EFVA 2XRZA 1J20A 5DK4A 1EE1A 1JGTA 2E21A 1NSYA 2OV4A 4NZPA 1T9GS 3IOEA 4XFJA 4EG1A 1EFPB 1EFPA 3HMQA 3ZXIA 1Q15A 1JZQA 3ZJUA 1XJQA 3PNVA 1PFVA 1FYDA 4ND6A 2CFOA 1S4MA 1T6XA 3SZ3A 5KWVA 4PY2A 1O96B 4DE5A 1O96A
chains in the Genus database with same CATH superfamily
2WI8A 4XWAA 4ZVOA 1XDUA 3EPLA 1OTHA 2ODPA 1PAUA 2GETA 3D6AA 3DLAA 2LD4A 1XEXA 3KT0A 3EULA 2XDWA 2EJWA 3PUKA 5G4KA 3T1VA 3K0BA 3W06A 3TZKA 4LJRA 3RFFA 2VHXA 2CUKA 2E2WA 2ZJ2A 2FPRA 3HU3A 4AURA 2ZBUA 4HNUA 4ZIRB 2QR3A 3W05A 1V4BA 3P9ZA 1MOSA 1KBQA 1YI8A 4LHSA 5CFNA 2GASA 2QRKA 3DFFA 4QARA 4RK5A 5T57A 5HQTA 4M7RA 3ST7A 4D46A 4W1QA 1XK6A 4LCEA 5IM4A 1M1YA 5SY4A 5JANA 5KNDD 3IV9A 3UO8B 1KDZA 2WFAA 1C1YA 1KDTA 1VSBA 3HUEA 5K8LA 1OHHD 1IJBA 3KQKA 5I51A 3OZXA 2W6JD 4RK4A 5C52B 3S2GA 3K5PA 2YQ4A 3PPYA 4M60A 5DRTA 2C8JA 3S2SA 4J0DA 1R8QA 4YRCA 5I8ZA 1BS9A 5DYYA 1NXOA 3CMCO 3I6IA 1MRSA 2GN0A 1D4FA 1GILA 2PSHA 1JSLA 2WK1A 3WA6A 1SK8A 2CV0A 3M1YA 4QICA 2OO7A 3HCNA 5FNVA 3CSUA 3CWZA 1II8A 1RBQA 3HGTA 2F3UA 4HGNA 3CUYA 1B7GO 2IIQA 4GNKA 3WVNA 1TLFA 5HZHA 3U60B 5KVSA 2QUKA 4C0HA 4FKBA 1RKBA 2NTYC 4JITA 3VM6A 3WKCA 1UBSB 4MR9B 4D74A 4CU5A 4DTCA 2XGSA 3A2LA 3FHCB 2GJKA 3GLUA 3AT1A 3KZVA 3OU6A 3GRCA 2QDKA 5FEUA 1ZNZA 4Q1AA 4QO7A 1VDZA 3A1TA 4L73A 4UD2A 2ODQA 5HGXA 1NW5A 2ZYRA 3RHTA 4PIPA 3TSZA 5GIOE 2PJZA 4JP2A 3TVTA 9GPBA 3WGIA 2QLTA 3DEAA 4Q4AA 1KS9A 2ZG6A 2PNFA 5E7MA 4QBHA 4V24A 4WXPA 1N2IA 1FU8A 3PYXA 5HF5A 1KI6A 2GFIA 3SIXA 3KLOA 2LWIA 3T5BA 4OB7A 1QIGA 1X74A 3OIGA 1KDOA 4A16A 3IULA 4DA9A 2E4WA 1XF1A 5KNLA 4B3GA 1A8SA 3B1YA 1LZKA 2DT5A 1IQRA 2VDJA 2PBFA 4M0CA 5ALMA 4I4IA 1R5OA 3Q11A 1X87A 2PCJA 3OCJA 1AUQA 4XEHA 4BQIA 3PUYA 1PJ4A 1U80A 3WL5A 1P8JA 5BSKA 3KETA 3EXHA 3H1GA 3R74A 3SQNA 4E2WA 3QPDA 4Q4CA 1OA0A 4IM7A 4AUMA 3TNDA 2F3RA 4JN6B 3T38A 4UQLA 3NZEA 1TEZA 4V03A 4DMMA 2GN9A 2PX4A 4OGGA 2WWHA 2DQYA 3B1KA 1U5AA 3Q7SA 1JKJB 5AW8A 4EW3A 1TEVA 3LRXA 5EJIA 3L18A 2VC2B 4XXHA 1NDQA 3VR5D 1R6VA 3K0KA 2W2PA 4QNMA 5BUCA 4UU8A 3AW8A 2R97A 1N0HA 4PQYA 3ZV4A 2XTZA 3HZHA 3DMTA 4LGMA 3TSCA 3PGVA 3TFOA 5J4VA 1NQVA 2V6JA 3AL0C 1DQRA 4MRMB 1IPFA 1FJHA 3JVEA 2FFRA 4ZVQA 2VBIA 3VZPA 5ITWA 4UBMA 1TVCA 4Y0VA 3T94A 4IF4A 1ZN9A 1RWXA 4MPDA 3P8ZA 1I2DA 2O2SA 3OZFA 4PSKA 1TK3A 2GTPA 3BTSA 4EFDA 2ZIVB 1NYTA 3E22A 3K53A 4M8IA 6NULA 3FXAA 5KX5A 5MFZA 3R7NA 4BQPA 4MYTA 2IV7A 2PXHA 3LUAA 2XIJA 2CLOB 3BL6A 3TLGA 4BNYA 2X22A 3WDSA 5ICCA 1UXOA 4OAOA 1FU7A 4CIWA 3DH0A 2MCFA 1ZJWA 2BR5A 1O94D 1PT5A 4F1JA 1VM6A 2RHMA 5TRTA 4ZYVA 1JSZA 3G2LA 4KHPB 3ETGA 3LF1A 2ZWAA 5C53B 5LBIA 5IJ0B 2BDUA 3ECSA 4JROA 4WINA 4HXFB 1Q84A 2C9BA 3C98A 4Z7NB 4OREX 2W8BB 3W4KA 4AF8A 3ETLA 2ZJ6A 4UCFA 4CTOA 2Q6OA 4N5IX 1HURA 4BXOA 1ADJA 3Q5DA 2ZWPA 3IKJA 2HDOA 2HIMA 4IX9A 2HWXA 2O3UA 3MJCA 2FZKA 2O0HA 5K6RA 2ON6A 3Q8XB 4D4KA 1M2HA 4OHWA 4TV9B 3TSOA 3X43A 3L8MA 2Q4OA 2WG0A 1XZDA 3N0XA 3CLRD 4E33A 2VTVA 1RWNA 4FFOA 1W94A 4YAEA 3RUCA 3TIXB 2QQFA 4L8GA 1ONPA 2QUBA 1QF7A 4J43A 2Z2IA 2QN3A 3ABIA 2OKGA 4RADA 5EQDA 1M8KA 2IBMA 1XA4A 3DD1A 3X0DA 3DEHA 4GH5A 4HWSA 4LDZA 4EHDA 1WOYA 3IT1A 1UDAA 2YH2A 5EI5A 2R5FA 4IQGA 1P5ZB 3SLRA 3QVWA 1DDGA 5JFTA 5J3JA 2WQZA 3A9CA 3GF4A 1FUYB 3R7SA 4Z3KA 3L4KA 4DIKA 3HDQA 5ECWA 4BVFA 2ZB7A 4YO7A 1SBCA 4MAFA 3C15C 1JHVA 3CSDA 4P31A 3CUVA 4FT2A 1VZ3A 1Z5OA 3LOQA 3I1YA 4XTCS 1KL7A 2GBGA 2PH7A 1VE6A 4I1UA 4KZPA 4LC9A 4AG5A 2MT9A 3P2YA 3P1JA 4P2GA 2OESA 1QMPA 2OAP1 3BGWA 1O95D 5DHAA 4I9UA 4MV1A 3TTTA 1W88A 3ZCUA 5IT4A 3HP7A 4C4YA 1E3TA 1F8XA 4OF4A 1Y3IA 4F2HA 2X5NA 3QYJA 2QG6A 3SNKA 4J07A 2C92A 3E5HA 4QFMA 3GNLA 5BV8A 3VPFA 4E70A 1GRRA 1Z8HA 4OQFA 4KVAA 3MYRA 1SQFA 1HQYE 2X77A 1MZVA 1SKQA 1COWD 5CNIA 1TAUA 4F84A 2VT3A 1YZ3A 3M0EA 2JFUA 2CLKB 2Q6IA 1I0LA 4BQSA 2M1ZA 4M55A 1KP9A 2JGDA 4KQ6A 3OM1A 3OOEA 2Y1LA 4JEMA 4LY0A 1KA9H 2ORIA 3I01M 3RVOA 1SXPA 1P9LA 1X1RA 5BOSA 1J9EA 2NUBA 4Q4LA 3DKKA 2JGFA 2R751 3NBMA 1HLFA 5DWVA 5IZCA 1QG0A 4PICA 2IFTA 2R1VA 3N3BC 4H4EA 3ZNPA 4WZBE 2QRVA 2VQEB 3FM9A 4NJMB 2W2KB 1E2UA 1R4AA 1EP9A 3DW3X 3F5DA 3FPHA 4RLSA 2FW0A 1XZEA 4DG5A 4MJ7A 5I9MA 1F8FA 4FR2A 4GZ6A 4Z2YA 4W5RA 1W75A 1YK0A 1IATA 1ZM4A 3PPXA 1Q1NA 4GOLD 4WK6A 5KSYA 3SHWA 3T0GA 5K0GA 4RQAA 4N8DA 3L7IA 1KZHA 1FP6A 4PGMA 1GQYA 1NW8A 1LI7A 2XNDD 3MYYA 1ZNYA 3AUXA 4BXOB 4MTCA 1SQ6A 1KAHA 1SZCA 3GT3A 1SFRA 3C3KA 1ISFA 2IY9A 1KXJA 1F51E 3A10A 2OV8A 2A30A 4I5EA 2O3RA 2ZE6A 2AXPA 4NESA 1XRQA 1SZPA 2OD2A 3QVGA 4QFCA 3EA0A 5EJFA 5IHXA 1FMJA 1YQXA 4XJVA 4YRPA 3PWTA 4GGOA 4MMYB 4H7HA 2OQ2A 3RUEA 1Q2UA 4BC0A 2CCKA 2OBLA 2XNCA 4OH1A 2LDBA 5A71A 4PZLA 2V3CC 1Z8NA 1TQ8A 4QGGA 4LXHA 4AMZA 4TSFD 4L76A 5KYXA 2XTJA 3GRFA 1HG1A 3VHQA 3BJIC 4G65A 2Z8YA 1FW6A 2BP7A 3EXG2 2QE7A 3O95A 3ZDEA 2M98A 1KRHA 1WPGA 1BW9B 2VYVA 2XLCA 5I4CA 2CJFA 5JY6A 1YIDA 2PVCA 2GSDA 2ZQYA 4V1CI 1OZFA 4U7PB 1JB1A 1CW2B 5GQSA 1HE8B 1US8B 3DWGA 5A7FA 1WR8A 2F43B 2HWUA 2W8ZA 3K1ZA 4FOOA 1PL8A 3L4EA 1KI2A 1N0VC 1K6XA 3OPQA 4GBJA 3ZU2A 1OLXA 2XB8A 4UPEA 5E1DA 3PC7A 3WGGA 1NA5A 4LS3A 4CF4A 4RTSA 1JPUA 4WACA 1KZ6A 1WE2A 4D99A 1I01A 2GH1A 3Q7IA 4F9TA 3JW8A 3T7EA 3KM0A 1HE2A 2B92A 4TMKA 4UVDA 1YJ5A 3KR1A 3AVOA 4MYCA 2OV6A 3HBNA 4ZT5A 5A2GA 2ZZNA 3MCAA 1RAAA 4R01A 3AKYA 3L6RA 2GPBA 4TTAA 5JOQA 3TDMA 1QHSA 4HY3A 3WYBA 1CF2O 4FW8A 5KYYB 1L8OA 1SKBA 5JAQA 4UE6A 4B81A 2BEUA 3LWDA 3MHPA 3GT7A 5K8UA 4QECA 4YRDA 2JFQA 2O7SA 3H5IA 1SUSA 2WIKA 3E2PA 1G7CA 4V1CA 3R9IA 1LPBB 1NW6A 3RBXA 5JJCA 3AVPA 4EG7A 1T1GA 2W2XA 3IT0A 4YAGA 1OIWA 1QRAA 4L0MA 3V3TA 1M8GA 2CL7X 3IAS6 1AXRA 2DFKB 4G1FA 4MW5A 2QWXA 3WK7A 3CR8A 5J23A 1GGJA 4X8HA 2VH1A 2WJ4A 3RRBA 5EIEA 2B3TA 4BP3A 1OXSC 1RU3A 1RTTA 2V97A 3VPCA 3RADC 3O5AA 1SBZA 1XCPA 3GT4A 1WHSA 3C5VA 4HDAA 4IIJF 4QYXA 1S8NA 1FL9A 3IT3A 4G89A 5EPEA 1DKNA 4RVGA 4LOKA 1D1PA 4R1UA 3ZGYA 1O89A 4Y1FA 4C4OA 1SVUA 3VDXA 1Y7IA 3BFJA 3MWGA 2V1XA 3KYJB 1WQ4A 4D3DA 4RORA 1X2BA 1BHQ1 2RHCA 3VR6A 1BH2A 2FMUA 3AL3A 2QN7A 3DZKA 2F2TA 5H02A 5CDTA 1WVGA 5LYYA 3MIZA 3AKCA 4G01B 1YZQA 3T3DA 3PD7A 1BKYA 2OGSA 4E46A 4F2WA 1GCAA 2GN4A 3DJFA 3UMSA 1JNXX 5AHXA 5DKFA 3RVMA 1VXOA 2QE7D 1TKRA 3GZNA 1IDOA 1WXXA 4QOHA 5EJ6A 3DDHA 3U49A 5JO0A 5LXTF 2I0FA 3CLUC 2ONJA 1WTCA 3OMLA 3KR2A 1O5OA 1E2JA 2HF7A 2QX7A 2R4QA 4GOXA 2QX8A 2EJTA 4IJQA 3TLEA 1DKOA 4H3SA 3IO5A 3I5XA 2CHFA 1SXQA 2X9GA 2ZRHA 5AK6A 3QBVA 3O8OA 1PR0A 4DB2A 3FDZB 4IW3B 2JIOA 3TMAA 1AQJA 3IMCA 2PBLA 3OWXA 4MWSA 4X3OA 2VP9A 3FTQA 4C06A 1X8KA 2P6NA 3DO6A 1OLXB 4YC7A 5HZGA 4LJLA 2XYGA 1KP3A 2IYSA 3NONA 1NPDA 3FFTA 1G2QA 4LQDA 1AUXA 3VHLB 2JAQA 4LE0A 3CUSA 3A3YA 2OLJA 3RROA 4BVGA 1VKJA 2OTCA 1LV8A 1IWPB 5FI5A 2VTKA 3TQRA 1QU3A 1K97A 1I14A 4Z1MA 4DPMA 1ZI6A 5TLSA 3DOIA 1NL3A 4KL8S 2CXSA 4GMHA 2P62A 5AKIA 5I8PA 1IVNA 5DTQA 1O58A 4F4UA 5KDDA 4IYRA 3LGSA 1KTIA 1KAEA 1A77A 5TF0A 4PXAA 2OCPA 2J87A 2VZEA 3ZQJA 4H1UA 4PLTA 3DZDA 1P0MA 3V7UA 1YDEA 1FMCA 2OO5C 3HG7A 1G20A 2PSFA 2J6HA 4F72A 3V5NA 4B2LA 4EO9A 3JATA 4ZHSA 2G0NA 2ZTLA 1KVRA 1XCMA 1KQ3A 2V65A 4MB0A 1DCKA 1F12A 5AP9A 4YH1A 3A70A 2ILTA 4L72A 5ALIA 3MINB 3GLVA 2CLSA 4HH0A 2BFFA 2HREA 2ODTX 3EZNA 5HTKA 4QTYA 5FV4A 5HGJA 3KT3A 2QUAA 3I83A 2EBHX 2V6FA 1PZNA 1U5CA 1AT1A 2PGDA 1W1IA 3AUJB 1B1CA 4X3CA 5JNTA 2VJOA 1PSDA 4LJYA 3O4IA 1BH6A 3GK3A 3KKNA 4V0MA 2OHVA 3GLTA 1M10A 3AX6A 3PGA1 1DUIA 2FXIA 2PM8A 1HKUA 3ANXA 3H17A 4OIFA 3U81A 4YECA 4BVBA 1Z9BA 3NIGB 2NPFA 2C59A 5M29A 1TTQB 3AUUA 1KYYA 2VSQA 1DHTA 3NHMA 3W2TA 5C1PA 5CDSA 1CY1A 4HDRA 3P2KA 2H7YA 3O8BA 3ZPXA 2Z0MA 3HCEA 3T7DA 4BNGA 1EQ2A 5DK4A 1XTJA 4WFQA 1NG9A 2Y9MB 3GJXC 3JD4A 4D4LA 3KPUA 4Z49A 3VNUA 4QJ3A 4B6QA 4YRSA 3N6VA 2H0QA 4J6EA 3H18A 4A9AA 3IS3A 2JLYA 1S3IA 3TO5A 4ENSA 2OV4A 1TMKA 4V39A 1XZQA 3VZQA 1EVZA 3L0OA 3VOAA 2PRJA 1FVFA 2A8YA 3PXXA 4TLEA 3HMQA 3B7PA 3HXQA 5BNIA 4R83A 2B36A 3ZXIA 1YBMA 1PTJA 3UEOA 2ZBRA 2VSNA 4IIJB 3B89A 2YYYA 3GEDA 4BE4A 3UHPA 3PE6A 1T8UA 1R50A 2CFOA 5B64A 1R0KA 1ZJ4A 1JEQB 4P8RA 2QDXA 3L7DA 4OU5A 1XEAA 2WJAA 4HAZA 4P4LA 3G1TA 4Q37A 5E1BA 1JF8A 2JLSA 2DWOA 3AEZA 5FB3A 3WJ7A 2E87A 3HDVA 3A28A 2RHJA 4DLTA 4E32A 2UVQA 1ENOA 4DZRA 3OPYI 1C1XB 4UM9B 4MKZA 4ALLA 2BZ0A 4JI7B 4DRXA 1EXWA 3IBGA 1ZRHA 1DUVG 1Z0JA 3R7AA 1XPUA 1C3OA 2IVZA 5ALGA 3V4FA 5H7XA 3OPMA 3DC7A 5EQJB 4DLBA 4D9IA 2BIFA 2GD1O 2C0QA 3QV1A 5AM0A 1KKLA 1IXKA 3P9SA 3ZZUA 2J30A 1DWPA 1XG5A 1KETA 4FMCF 1EVJA 4N4AA 1KAMA 3ZWBA 5MGNA 1FW8A 2YQZA 3GCZA 3WY9A 2M9MA 1TFUA 2RCNA 3HYTA 1AHIA 3HR8A 1C29B 2WJIA 2CNWD 1X70A 2D3WA 4UPDA 1XA3A 1SWVA 1XTUA 4FJ1A 5GZ6A 2FG7C 3ILYA 4WOJA 1JNYA 3KZCA 5LOVB 3HSSA 4G1BA 2ZUWA 4HAIA 4YT4A 1Z63A 3M6XA 2PYZA 4C7JA 2Q62A 5TEVA 4TS3A 2XB4A 1W5AA 2BFCB 1HDGO 2H4FA 2VLBA 3KNZA 5GONA 3DCYA 2HKIA 4XIJA 2CNOA 1AUOA 2IU6A 2QORA 4UU1A 3RM3A 1ZVJA 2O8BB 5A9SA 4AMGA 1FNMA 4R7TA 3I9NA 1JVSA 5FBQB 1NKTA 5EXSA 2A0YA 5H3HA 5ETJA 3JYLA 1H05A 2BELA 3IAHA 4E5VA 1WY5A 2G4VA 1JHXA 3LPLA 4TVOA 3TW4A 5B3JA 4YEDA 2F7SA 1JSXA 3R7FA 1JLKA 3A4VA 1M73E 2LDXA 3VR5A 3S44A 1KYZA 4RIGA 3ANYB 4A27A 2CWDA 3D1VA 4C04A 5C46F 3KLNA 2D54A 3R0QA 1HH4A 4KIWA 2VP0A 4FDLA 1OU4A 1YQ9A 4FQ7A 3R24A 5GV8A 2GO1A 2XUJA 4EUFA 5J58A 1Y1QA 2CLDX 4ZVRA 2VNHA 3GRKA 1FOEB 1E9EA 1P4SA 2JGEA 3N8DA 4M9RA 5FBZA 4CIVA 3ZE9A 2OBYA 4OKSA 1PN3A 5LBUA 3DL4A 3VPGA 3NEAA 3RFUA 1NHGA 1WDWB 2XWQA 3TLBA 3M1LA 4HVAA 5DMXA 4DCUA 1Z82A 3QNWA 1IXSB 1WSDA 4IRXA 2BFBB 4MW4A 3GL9A 1DRJA 1G1AA 3CW9A 5H5JA 2YYSA 4Z0HO 3LOUA 1LWNA 5IKOA 5THXA 4WY2A 4TMXA 2HK6A 4TUYA 1Z5GA 3GAZA 4FPXA 4M98A 3GEMA 3LPCA 4PPQA 2CHUA 2RC6A 3RKUA 3WGMA 1JEQA 4D0SA 3K9NA 3IILA 5JWRA 1V8DA 2FHSA 3GFFA 5A1TA 1V1JA 2HSDA 1MQAA 2FF5A 1VRWA 3GARA 4G9BA 4O4LA 4BLPA 4BQNA 1FS6A 4F85A 3GLHE 3LBIA 3DE6X 3M3HA 5CNJA 3RQSA 1PBNA 3BZBA 1O97D 4DY4A 1C1XA 3IX7A 4IDQA 5ENVA 4F2GA 1AQNA 3GXBA 2OCGA 2AK2A 4U02A 4ZRNA 4RK7A 4YVFA 3V4VB 1XLTC 4ZVLA 2HSGA 8AT1A 3KLBA 2BV3A 4N5HX 2FQQA 4QDJA 1K75A 3LSYA 4MVJD 4PQEA 3VR2A 4ADSG 4YRAA 1EM8B 2NVOA 5JW6A 3D4LA 2BI8A 2LXNA 3JARB 3L6CA 1JI3A 1RQNA 2JB9A 1PS8A 1J25A 4HMQA 5K2MA 5HPYB 5EJ7A 1VE1A 1YOVA 4KWHA 3DCNA 5JECA 2WUEA 2UXDB 3A1WA 4QLAA 5EMMA 5A5FA 2OHXA 4RY8A 4UMEA 3WWPA 4P53A 3KJFA 4QRIA 1RWPA 3H84A 2WU8A 4O4IA 5TNXA 4TROA 2WF9A 1S7CA 2Q4RA 2ADFA 2G09A 2N3ZA 1A2KC 2P3QA 4L0QA 3E2IA 4JLNA 4B3RB 3F6PA 3OIDA 1I0IA 1YS7A 4GP7A 1RD4A 4Q9AA 1PLLA 1GEGA 1WMBA 3OT4A 4FYVA 4PGAA 1UFOA 5I9TA 3VVMA 1FFHA 4FOTA 5A9RA 1OB2A 4DW8A 3H9QA 3LTEA 1OFIA 1IMOA 1G4UR 3TL3A 3HL0A 1EFVB 4KDFA 1MAUA 3V1LA 4D80A 4QTXA 1E3QA 2QTTA 1I4DD 3P7MA 5CG1A 1SNYA 4AKGA 4RX1A 3VNQA 4U6NA 4CFYA 1SCNE 1KEEA 1QZTA 3THXB 2DPGA 4QDOA 4DJEC 2RAUA 4DBZA 3V48A 4DXHA 2P9TA 2NZWA 4RF5A 4RVDA 3ZHOA 3OETA 3QW4B 3AU8A 3L0IB 3ZH2A 1E6MA 4O4JB 5DYNA 4P7FA 1R3DA 3O1JC 3R0IA 1KZ9A 3UQZA 4FFMA 3RSLA 2XGJA 1E2NA 1L7AA 3U40A 3TECE 2Z2JA 2F67A 3PKJA 4DCOA 3OCYA 4JJGA 1HLDA 3H1PA 1XTPA 1G66A 3JAWB 1VSUA 1S1CA 2PL5A 1F3LA 4P4GA 3PFFA 4Q4JB 5DYIA 3ZCXA 3P9NA 4RWZA 1VG8A 2JG3A 4YFYA 2FMXA 2ZJ3A 1DAFA 2P9ZA 5ARBA 2DZDA 4GMGA 3FNIA 4M6WA 4TS9A 5I7AA 3W5IA 5IJ9A 4OLAA 4QU9A 1E2BA 2B30A 3T4PA 1UK8A 3BXXA 2ZSEA 4HFJA 1KAGA 5CIWA 4LSGA 4BNMA 5BVGA 3B9BA 2QM0A 1ZI8A 1R4ZA 1GT91 3W1VA 4E5PA 2X0NA 2GHQA 5P21A 1KHTA 3GA5A 4K9NA 4KLNA 3CINA 3RIMA 3VR4A 5JAHA 3KE8A 3ESYA 1Y9ZA 1PJTA 2EGUA 4IDBA 1YZYA 2GZHA 5EFZA 1VCIA 3PGMA 1IZZA 3T34A 2PGLA 4LKOA 2P5TB 1V16B 4D96A 3LKVA 4EH1A 2RGUA 2BGRA 6LDHA 2ZYVX 1AB5A 3Q9NA 1I5RA 4X7RA 1ESZA 4OM7A 3GFBA 1H2ZA 2P1DA 3EEIA 3FBTA 5EUCA 4DNFA 1LI5A 1E59A 2O9JA 2X2FA 3FETA 3Q5EA 4WN9B 5CJPA 5ES4B 5DO9A 2OCYC 2WOOA 2W2VA 3DCJA 4Y2YA 2DFTA 4YRFA 4TPKA 3K6KA 4UHBA 5AI8A 4CKBA 2J1LA 1Z4PX 3AHHA 2I8AA 1J5XA 3GROA 3P2EA 4RTQA 1EP2B 2W11A 2BHRA 4MUIA 3NDIA 1JDUA 3DMYA 3GAAA 3LC2O 4D8XA 2X42A 3VTKA 3ZK8A 2IHNA 1DXHA 4M21A 4RIHA 3FX2A 2XNKA 2P67A 3PDIB 2QKYA 3EDYA 4FNAA 4LXXA 3CVOA 4LY9A 2O8CA 1XMOB 1FZQA 4NOMA 1EFAA 1Q0RA 3M9WA 3N1UA 7ADHA 3HCFA 4JZKA 1VJGA 2VKQA 3UHFA 4ZREA 3GLFB 2YKGA 4RK6A 2DPLA 4DMHA 4GPD1 4DANA 2ZBFA 1CUVA 2PKWA 3SQLA 3WRYA 2YFQA 2W00A 4AX4A 1ZJ6A 2I4OA 1XAGA 3OLVA 4UMVA 2X8WA 1CZUA 3KB1A 4JUCA 2BFPA 4E1AA 3G2HA 2AOXA 2ZRBA 3WP0A 1P0IA 4GE3A 4XGRA 4E08A 1JL3A 1DO2A 1PX2A 2JF0A 1OFUX 3MOIA 3QHQA 4O4JA 3RG2A 3UAWA 3ZG6A 4DR6B 2CNDA 3VU3A 4JZYA 1ZM7A 4WKNA 1DJMA 5DLPA 1RLIA 2NXNA 3AHIA 3DTTA 2VSOA 1MX1A 2EKDA 2Z6UA 4FYHA 4YJ3F 2XH8A 5JXGA 4AP5A 4DMFA 2B5WA 4A2WA 1GCIA 3CUTA 5CNKA 1CQJB 1NC1A 1XJWA 3MJVA 4FHCA 4N01A 4IVQA 4JSYA 4HEJA 2XE4A 4M46A 2QW1A 4EA9A 1WW2A 3ECCA 3Q6NA 4ZAWA 2F3QA 1I33A 5DBIA 1WZ2A 1OYVA 3UK0A 3AIMA 1ISPA 2JFFA 2WWFA 3NGXA 5CYFA 5F1KA 4X9XA 3RARA 3TTWA 4DWJA 2AN9A 4C4XA 3KSRA 1YA4A 2O23A 3FPJA 3JU3A 3PFIA 1C7JA 1XJCA 2WYOA 4HQ6A 5A7GA 1OOEA 3K71B 2J5KA 4BO0A 1CEYA 2YWBA 1JEJA 1QORA 1IM5A 5K2OA 3GD7A 4O6VA 2NPOA 1XCLA 3ENWA 4ND2A 4RETA 3G2PA 4FVTA 2B9EA 3QVXA 3TB6A 1ONBA 3UK7A 4Q02A 1HKHA 5AXDA 1C1HA 3KVRA 4ZT7A 5IH3A 3UMRA 1OB5A 1HQCA 3KUXA 2EHJA 3AFOA 1VP9A 3LBHA 5EMNA 4IL5A 4P36A 4Q7QA 1Z13A 1NVEA 1RFGE 1UMDA 2XRFA 2O8FB 1Z34A 1KOJA 4LYDA 5TGTA 5U4QA 4RH0A 2WZCA 3UB3A 3GJ7A 3ZJTA 4HGPA 2CVHA 4H0FA 2BT4A 5DNDA 3B8EA 4GYYA 2VRWA 1Q2XA 5FTLA 1NLZA 2A0XA 1UQTA 2RMKA 4KFTA 1AC5A 1CUJA 1K7CA 2PUGA 1O03A 3O1LA 4N7JA 1FDVA 3D9QX 3R1IA 4UW9A 3SXJA 4XD7D 4D7AA 3W8DA 3G17A 3FWKA 2VDQB 3MW8A 5AMXA 5FH9A 5FUMA 2C5HA 2GZSA 3NHSA 4AJLA 2CF6A 4Q1VA 2PGAA 1SVIA 4V3CA 3ZI4A 5EP3A 5LMUB 4KFCA 3N07A 3AHDA 3PXUA 1MJHA 1BMFA 2G1JA 4OHZA 4EJ6A 1ODLA 3PEUA 2MYPA 2CE7A 1Q3HA 3HYLA 4FINA 3SFZA 1U81A 3IE1A 2BGGA 1AD2A 1JDBC 1Q0ZA 1WL8A 1XFAA 3IH5A 5HZKA 2IZZA 3DBVO 2FW8A 1DARA 5EEGA 2YWJA 4LUCA 2A33A 3HJAA 4EYEA 2AG1A 3CZAA 3VU9B 4IG4A 3NRJA 4DNQA 1DG1G 3NM6B 4QHYA 4C7KA 3M6IA 1ZA1A 2J6BA 1IIRA 1P5FA 3KAQA 2PT9A 1I6KA 1F60A 2BFDB 1YFZA 2NSLA 4JBYA 3TG2A 5G1OA 3K0EA 3I9JA 3LUJA 4Q7MB 2R1TB 3W78A 3PHGA 1WMDA 3SVZA 2EKBA 2YMLA 3BAFA 2BTOA 3EVZA 4FZJA 1UWKA 4JYBA 1DCMA 4XQCA 4F92B 1QVZA 3KDPA 1GUZA 1VPDA 2GI4A 5FL7D 2PZMA 1O9HA 2QQ5A 5KREA 1JQAA 1J2RA 4UMFA 3B5EA 1AOXA 3U44A 4X54A 4OIMA 3ZXXA 3E3MA 1N6OA 1H4SA 1BFUA 4K6HA 4Y2GA 2HQ1A 1GGNA 1HTBA 3ROEA 4YONB 4AVYA 3G2MA 2GVDC 1C7ZA 2FSVA 3KCQA 4F4FA 4ZGBA 2RGBA 2ZI5A 4EPRA 3WNBA 2N0SA 2OLEA 4MKFA 1GSHA 2OXEA 3BAZA 3M6LA 3N9IA 1MHPA 2D59A 3KV1A 1E5LA 3HXOA 2P4UA 3LU1A 4ZC1A 1GZ3A 3LC7O 1XLWA 2HLPA 1N2OA 4RMNA 1R16A 4DF3A 4Z4EA 4NNPA 1Y8AA 3JSXA 2GHRA 2GKOA 3VAZA 2QI9C 4KBYA 4EWLA 1M72A 2UZ3A 3D3WA 3GJ6A 4M7OA 3HWRA 3DPSA 5JI3E 5TJHA 5ECYA 1I2CA 4U5QA 1Q6ZA 4TVKA 1A5SB 3KEMA 1YA8A 4UOQA 5AI0A 2BMDA 1IEXA 4WEQA 1JX6A 1ONNA 4QQKA 1P77A 2NV2B 3IIIA 3WSVA 5CITA 3W9YA 4MX8A 2C5EA 4TXHA 4L7VA 3KSUA 1QO7A 3BSWA 1Q7BA 4LOAA 5I6DA 4MDFA 1K5DA 1Z3CA 4OL9A 3TINA 3CTMA 5DLQC 3DBHB 2O1WA 3AFHA 9ABPA 2GHIA 2FGKA 2QN8A 1Z4KA 2BHSA 4IDGA 4IEFB 2XF2A 4PPFA 4YJKA 5ELLA 5JS6A 1F6DA 2PRYA 1XALA 1W5FA 1R0ZA 1A2BA 1I3MA 3S7TA 7REQA 1DC8A 2PS9A 2HY7A 3G9UA 2EEZA 4X85A 4B3DA 2DETA 1GQSA 2XE6A 4WAUA 5CK5A 5JSZA 4K0KB 2WAAA 1QC5A 4JB2A 3BMOA 1KJYA 3DOCA 2WTNA 1PS0A 2QAGA 2ZTVA 4XYMA 1ZFNA 2CJWB 5CVDA 1SKMA 1QK3A 1QOZA 1H8ED 3PCRB 4LVOA 4LX0A 5C1IA 1FUIA 2HA2A 4ZOLF 5T6MA 1Y0BA 4RO0A 3X2FA 1NRWA 2A59A 1R3UA 2I3BA 3C6KA 3IAFA 5JAIA 3H2KA 4GZLA 4JJAA 4YP0A 3K1TA 3LXRA 4I8IA 5U4XA 4BLOA 4N0PA 1U98A 3SVTA 1RQXA 3NEJA 2G70A 1WS6A 5C8YA 1RLMA 5CFPA 3FMFA 3JZIA 2VRCD 1J56A 2WBLC 1JEOA 4QGSA 3KB2A 2XQVA 4QPDA 2ZOSA 1NULA 2ZWOA 1VJCA 4L8YA 4QUDA 5IDXA 1EFPB 1B6RA 1RC1A 2AJCA 3RRMA 2Y71A 4JI4B 1BWRA 1R8XA 2W6ZA 1LC0A 4WVFA 1AGXA 3ICCA 4E03A 2R96A 2WJ6A 3VDRA 1HE1C 1RHMA 1MC4A 3S6JA 2XUPA 4HB4A 2NN3C 3EQZA 4B44A 1NWHA 2IODA 4OJQA 2PMCA 5DBEX 3UKOA 3VQTA 4D42A 3HC7A 3ABRB 4EJSA 5AW0A 1FFXB 1OPXA 2C2ZA 1BYIA 5A4KA 2L2QA 2VH2A 3FWPA 1YQQA 2CK3A 3MCZA 1TVKA 3JY6A 1I9GA 3NIDB 1KY2A 4F45A 4BE9A 2BMWA 5SZKB 4UBOA 2GZDA 5L6LB 3K3PA 1T3ZA 3TBFA 1LPNA 1UPAA 2K4MA 3BB1A 1PL0A 2ZB3A 4JHLA 2ZYWX 4G5OA 3IBYA 4LMRA 5AKGA 3V8MA 3ZCPA 5CA0B 3FPBA 2RHHA 5DHPA 2IP4A 3TJZA 1V41E 2EW8A 521PA 1P2TA 3BD6A 1TC2A 1GPJA 5FLEX 3ZU4A 1V4VA 4B7CA 3K8OE 2A9KA 1LJ8A 3IUMA 3DTVD 1R0RE 1CIJA 2HHAA 3HNRA 4Q3CA 1CB0A 3NTXA 4LSWA 3MWKA 4PSVA 3NWBA 4XEUA 5CFMA 5GZ3A 1JFTA 4AXBA 4K28A 2C4KA 2JLUA 3EN0A 4PAOA 2H3HA 2R47A 4TYQA 5L7YA 2UZ1B 4CN8A 5FTWA 3C39A 4BWFB 1L7MA 3ESZA 4QASA 2R86A 3RTGA 3D8BA 1EFLA 5CT8A 1RYHA 1MN6A 4UFPA 4K9PA 1XMSA 4L07A 4P9NA 1QDLB 3HBFA 3JQQA 3V6LA 2FPGA 3Q40A 2GVNA 1W9MA 5FT9A 2YHSA 2OHOA 3CU5A 3DV0B 4XPIA 1G7SA 1YS2X 3BMOB 1GKYA 4OQEA 4XX1A 2CXQA 1AU9A 3C70A 3PA8A 1T1JA 4Y6QA 4A8JA 4DHEA 5I48A 4AQ7A 2QW0X 1V11A 5CVUA 3QUTA 3O3CA 1Y1SA 1PR3A 1YAHA 4KQ9A 4BNHA 1UBOS 4F12A 2HIAA 1VRVA 2WT9A 5CA1F 2YV3A 1VYVA 4UOEA 1NZFA 4OKNA 4NCAA 3LIPA 2V7QD 2V7PA 2P77A 1KZ4A 1BSVA 3B53X 3DTNA 2O7QA 4MWGA 4TTQA 2GN8A 4UCQA 3U62A 2AA3A 4OI0A 1E9VA 4QX6A 3FFWA 1ISIA 2X2OA 3ENZA 1UZLA 4PRYA 1AKEA 3IXMA 4O2AF 3MGBA 3VH4A 5CM9C 4X95A 1KSFX 1T0BA 3EAQA 3OIYA 4XX0A 3A6DA 2QM3A 4YRQA 3TOSA 3RWOA 2BYTA 5FYQA 3OTWA 2YQ5A 3O9VA 4H7IA 4HPWA 4M49A 1QRRA 4TV8A 4XB2A 2OM6A 3FPKA 5FHRA 1FDTA 3R6DA 4DCTA 4QUJA 3R3SA 1F0NA 1M3SA 3QFRA 4U2KA 5EZYA 4MB2A 1KI9A 1E3SA 2PTGA 1TCCA 2PL3A 3P0IA 3BTVA 4PANA 3UUWA 4ARBA 3SK0A 3AR5A 3E3OA 3C6QA 1X7YA 2H1HA 1GN8A 4HQFA 4DC1A 1IEWA 3DDSA 1CNEA 2H54A 2DU8A 3FCUB 3PB3A 2C3OA 5CP8A 1M66A 5AUNB 1H5NA 1COZA 1PQWA 2C4MA 2VTEA 4JBXA 2G06A 4S1NA 3EWNA 2P9QA 5CEJA 2QJTA 5JEEA 1QM5A 1MT3A 2WHEA 4D9MA 1TPYA 3EYWA 5LQDA 1X7GA 2PUFA 3K73O 2XVMA 1YRHA 4P6VF 5B3LA 1M7HA 4JUFA 4R6WA 3RVQA 3ZIDA 1B3BA 2QV0A 1WXGA 1P39A 2GD6A 4FOPA 1QONA 4PGFA 1XF9A 2PFSA 2ZTUA 4H27A 5AK3A 4H9GA 1HORA 2OYRA 4NRDA 4FLMA 3RK0A 3OPVA 3CE9A 2CDNA 4D9GA 1IRIA 1HNNA 1I4OA 4UU7A 1UAGA 1SN7A 3N86A 3LA8A 1FUEA 5ALNA 1N4AA 1VGVA 2VATA 2B4TO 2UZ1A 5EWLB 3U61B 1YR1A 4TUYF 5E2AA 5FBWB 2Z1DA 5JO9A 3SQOA 1BVHA 2VNIA 3CEAA 5FPPA 1IL0A 3KV3O 1W96A 3EGDB 4L51A 3QIVA 5JCZA 1DXQA 3A6ZA 2B3DA 1K7YA 2D0DA 2ZAGA 1K7EB 1X38A 1ODFA 2CMGA 1PUIA 1E1MA 1WDTA 2HJWA 4C7BA 1F7UA 1ZLYA 2ZCUA 3OX2A 1ZOPA 4IHAA 4GE0A 3I76A 5LWHA 2GPWA 3F98A 3F67A 5IDYA 3VV3A 1GA6A 2FUKA 3HJCA 4PVCA 4N1AA 5IU6A 4WN3A 5BMVA 4ZCMA 5HR5A 3HDTA 4E12A 1RYZA 1LDYA 2ZKIA 3FCCA 5BN4A 2NAPA 2YHAA 4PQFA 1PNQA 1PVVA 1X80A 4NHEA 4BECA 5ADHA 4GZMA 3UMVA 1UJNA 3RHFA 1JMKC 2J0EA 5KEIA 1CUYA 1IMJA 4M0KA 5CLFA 3MT9A 2EBWA 3MJRA 4CIBA 2J3HA 1XD2B 4ZQFA 1GPUA 2WJPA 2C58A 1T3GA 1K1EA 1EXNA 2QPLA 3L6BA 4LK3A 5DNCA 4B4UA 2G8NA 1QH8A 2FZGA 4LXYA 3OX4A 4CYMA 1T5TA 4IUDS 1B23P 2FPLA 4X1YB 3GHHA 2NVUB 1II0A 1QP8A 2IDZA 5KQLA 2H5LA 3A8TA 4UM9D 1ECGA 4OQLA 3QUSA 2E5FA 4K40A 3IBSA 4IKPA 2V3VA 1OKKD 4QD3A 4JBIA 2C7VA 4YTEA 4A8HA 3BULA 3IQZA 3E7DA 1XMVA 3QXXA 3PLAE 3U0BA 1WCV1 1AG9A 4TRMA 2GJAA 2WZQA 3E81A 2F9LA 1Y63A 5DN9A 5ECGC 2IF0A 5IBPA 1L4BA 1SKYE 1YZFA 3ZIAA 4Y6RA 2D1QA 3JALB 1JG2A 1FS4A 1QHHA 2JFNA 3FTPA 5KNBA 4XWWA 2NNLD 2E18A 4L8VA 3RF7A 2TMGA 3DOEA 1KK1A 4KMSA 4CPDA 4I4LA 1ZK4A 3GCXA 4MKGA 3U3RA 2Y0EA 2X3UA 1RPTA 2ACVA 3EVTA 1RM3A 3IDAA 4RLFA 4J2TA 1BVUA 2GEFA 2DKOA 4CF7A 3VYSB 1ZL0A 4BQEA 4F3TA 3WADA 2ODNA 1KQFA 2VAWA 1MABB 2ZIGA 4GGPA 4IJUA 3S1SA 1D2AA 2J45A 1Z36A 3NASA 5TQ0A 1JA9A 4OHFA 3L6EA 3EGXA 1XTKA 4NULA 2I2CA 2VAVA 5D6NA 1XKTA 3T7CA 3FCAA 3LH5A 1SVKA 1VSTA 5KNCA 4DLZA 2P9BA 4BKMA 3GAMA 1HYQA 3CLRC 3I01A 3RUDA 1UJBA 1ADCA 2VK1A 4RMJA 2UZAA 4LI3X 3RRFA 5ED4A 2TSYB 4UUNA 1TX4B 1K2WA 2PEZA 3NVDA 5L3ZA 5KYUB 4TYPA 4BASA 2Q3CA 1DFGA 1T5DX 1WWKA 2OC4A 3GDHA 3NAMA 5HCUA 5D86A 3D4OA 4C1NA 3CF4G 3HGQA 4NBSA 2YXEA 4LY6A 1JQJC 1R6BX 1WPQA 2HN9A 1P7CA 4J0HA 5KNDH 4DBLC 3ZWDA 3EFOB 1Z33A 2IYPA 2RGAA 3MGAA 5F3RA 1NUPA 4Z9YA 4DIOA 4Z8XA 1E3WB 1TRHA 2PWAA 2V4MA 3BYZA 3UGQA 4B5LA 1NBEA 2Z57A 1LK5A 2WJ3A 3DQPA 1RJ9B 2O2CA 2VBGA 2YICA 4ITUA 2H5EA 2B4QA 1ZA2A 4MQLA 4URUR 4TT3D 4HQ0A 4B82A 2BTEA 4LJAA 1STOA 3T9EA 1ZGGA 4LWOA 2ZKLA 5K45A 2X1MA 3QYFA 4BQOA 3T3NA 1E4VA 3FDIA 1R10A 2I6UA 1UAYA 2W5UA 2D2XA 3AR2A 1PG2A 1XD2A 3DUWA 2XDQA 3JPWA 3JQRA 3O9ZA 4IRMA 3V2GA 1K08A 2JEYA 1MG0A 3EG9B 1L5KA 5BNZA 4DMUB 3Q3HA 5CBPA 3G02A 2SECE 4FQ5A 1TMYA 1VMIA 3TAXA 3UTCA 2QT9A 4C2BA 4UXHA 4EGQA 4DRZA 2VCEA 1G16A 4PYIA 2X8LA 1QFSA 2P41A 1UAAA 4UZSA 4C76A 4CZ2A 5JHGB 5JAMA 2YRFA 1VCNA 3CJRA 2DPXA 2JAOA 1J7KA 3L1JA 3NJ8A 1SVSA 2G0TA 5ELMA 3BEOA 3E5RA 3Q0EA 5FOXA 5HIMA 3VTFA 4TWIA 3PX3A 4EY6A 5HS6A 4JP3A 4U6SA 4BE7B 5T64A 3PRHA 2V9CA 4GKVA 3LCUA 1YU9A 1E5TA 2H9AA 1MB2A 3CB2A 3JD2A 5DPMA 1UPBA 3VPAA 3ZD9A 4G8BA 4R1NA 1VYUA 2ODWA 1TQHA 2VWPA 3M81A 3PC4A 4BO3A 4RPIA 3FGNA 3L1IA 2A58A 3UA4A 2XZDA 3SC6A 4KREA 1CB7A 2JVKA 4BO9A 1MRNA 1VMAA 1QP7A 3L43A 1Z18A 1F4PA 2Q5CA 2RGWA 4DV6B 2ZUSA 5SZHB 4DMRA 1CRZA 1H0SA 1DKPA 5IAKA 3BH6A 4B6RA 5C8YF 3U3ZA 3P0EA 5KYNA 3HEMA 1EGVB 1KK0A 2BI4A 3I4LA 3L0CA 3W5SA 1JKMA 4M53A 4KXVA 1O1YA 1LVGA 1C3XA 1Q1BA 1WZUA 1V5IA 3QMWA 5TMPA 1FB5A 1PJQA 3ED1A 2ZITA 3KWFA 3HJBA 3LDFA 4UBKA 2FX5A 3VDQA 5JQGA 5KOJB 2ZAYA 3VVLA 5DHUA 4MUYA 1S2NA 3LDHA 4HNHA 1CUGA 3EZYA 4QOJA 5AJHA 3EMKA 3ABQB 5AW3A 1KO4A 2PA0A 3SMVA 2LVBA 2AC7A 2QBYB 2X40A 3M1IA 2EKQA 5G3ZA 2W2KA 4I55B 4ND8A 1V25A 3KQQA 3TAHA 2FRDA 5CXUA 2X2PA 5HUQA 1DMRA 2Z83A 4HDSB 3K7EA 3BFPA 4TS1A 1EFDN 3LCMA 1QU2A 5KU7A 3LC1O 3Q6IA 3AGPA 4J1QA 4P4SA 5AK5A 5K6TA 3ID6C 2PUDA 3E9NA 4N3NA 3E9ZA 2VH5R 2VOEA 3UXYA 2I3DA 4J03A 4OHXA 2QRPA 2PX2A 4UDXX 1ZXLA 1YULA 4Z3DA 5C7LO 4AY6A 2HT6A 3M4ZA 4A26A 3PUVA 3ZV5A 4URHA 4GLBA 1C9DB 2CUTA 3R7DA 1L1RA 3EG9A 3FFXA 4RM2A 3WKAA 1PFQA 2FZ5A 3KXIA 4Q1FA 5HF6A 1QF9A 3GLIE 5IKXA 2NP7A 2NADA 1EHCA 4X90A 1PT8A 1XO1A 3PHHA 2A1UB 2CFCA 4FZRA 2IQ5A 3R0JA 3ZD8A 3U09A 1BGVA 2JVJA 1IJFA 2IIBA 3D2AA 3DOHA 3RS0A 5DN6D 4R54A 2TMDA 2XCOA 1W0JD 1PT7A 1YZKA 1SRQA 3EXIB 3HVIA 4RSRA 4TTJA 3NMUF 2XUDA 3LT1A 5HCIA 1IHPA 3SS8A 2AFIA 4IIFA 1Y8RB 4W9NA 4YREA 5BSTA 3RLIA 5B7GA 2GJ9A 2VJMA 2G36A 3L0PA 1QFZA 2P6RA 5LWQA 4U00A 2D8AA 3RC3A 2JFWA 3WK9A 4JJ6A 3OKAA 5FULA 3D7LA 4RTNA 4K9MA 5G02A 4I8DA 4EVSA 1A3CA 1D5WA 1OZGA 2H16A 4RIEA 5C35A 5JS8A 4KG7A 1GYQA 2PUAA 1NQXA 1YU6A 5F3WB 2OWDA 4RULA 3BDAA 4XLLA 5CH3A 4BVJA 2J9FA 1K06A 1G20E 4OUDB 2P6PA 3WKEA 1KO1A 2EAUA 5KVVA 1A8IA 1XL1A 5CD9A 2O52A 2WT8A 3ELWA 3JQ6A 1SQ0A 4YJ3B 3IHKA 1Y37A 4XI9A 1IZ9A 2AUMA 3F7OA 1JLHA 1Z7GA 1JI0A 1IFXA 2CLLB 3UT6A 1AKMA 2BUAA 4GDFA 1TA9A 3NNNA 4I36A 3ZEAA 1RXIA 2BGIA 2WMDA 1B8UA 4MQEB 3PNSA 1DOAA 1UC8A 4B6SA 3L7KA 3IR7A 1SOVA 3PFNA 2NPIA 3P26A 4QE3A 2LIVA 3G9TA 1P80A 4QIHA 4MS4B 2J5XA 2BJVA 4RQBA 1FFGA 2YZNA 2NZYA 3LHKA 1JAXA 4PC1A 3SN6A 4BUCA 2GXSA 3FI9A 4URFA 1HMYA 3A7DA 2BR3A 4FLFA 3ER8A 4YK7A 2PX6A 1B43A 3MFYA 1K3FA 1V6SA 4I55A 4ND8B 4ZQCB 1LK0A 2FG5A 1G3IA 4UU0A 5GAJA 5AVWA 3FOAA 3ER6A 4PSAA 2XRZA 4U9IS 3TE6A 5EHXA 1NBMA 4C78A 1TUGA 4BLQA 3FJOA 4CCAA 2ID7A 4BO2A 1JXMA 1RAHA 4P4SB 4I5DA 3WO1A 1P0PA 3ZY6A 2CNLA 4P54A 3PTZA 4BWYA 1D07A 4CCWA 1GM5A 2QY6A 3ZGOA 3EUAA 4L8LA 4D9EA 1S6YA 3OHMA 1MB3A 1Z45A 3GYBA 3I3SR 4LYEA 1SOWA 1KHHA 2P4EA 3L06A 3RC1A 2YR0A 2X0FA 5LN1A 3JQCA 2GTHA 1E3LA 2HWWA 3O75A 1XJQA 4QUKA 4UDYX 3HJFA 1PK9A 2YTZA 3LQKA 3Q88A 3PLRA 1IWBB 5ALTA 1AF4A 5ITZB 1YD7A 1L7QA 3KXKA 2C42A 4QOFA 3NWJA 4DLSA 4ZQGA 3W90A 3F73A 3FMPB 2FH5B 1O96A 1K0FA 2X8JA 2O57A 1S8OA 3NHYA 2FPIB 3DB2A 3NHPA 4MVXA 3UK6A 3JD0A 5M04A 1GPNA 2REOA 3CNNA 1RJFA 3FMOB 3QU9A 1FXWF 2WTEA 3GVIA 3R4CA 4O4HA 5F5LA 4O3FA 3L8EA 4LHEA 3I5MA 3UWKA 2JLCA 4FI3C 3GLSA 1LPMA 3GCDA 1AKVA 1G18A 1NBMD 2XCSB 1PLJA 4DILA 1VJTA 2IUSA 3DMPA 3Q7QA 3UXMA 3H2HA 1V95A 2Q6KA 1PFWA 3LNCA 1OD6A 3ZI7A 1RE0A 1RYFA 1W52X 2YHIA 5DK6A 4ACBA 4C5AA 4D98A 4E7PA 4F4IA 4MZXA 5E6UA 2HBYA 3CVXA 2HUNA 4R0NA 4R2MA 4QPJC 2BGKA 2RHDA 3RYHA 2HJ9A 4UARA 1X8JA 2RK6A 3O8OB 1GPAA 4JLJA 2VYCA 4IXNA 3N2KB 2EX0A 4CRWB 3NBAA 3HYNA 1OWLA 3A31A 5LLTA 4TT8A 3VDNB 4B3SB 4MGKR 3IDQA 5AWFC 4X97A 2PFGA 4MWEA 2JRLA 3H8JA 4WY8A 4XW2A 1N2HA 3K31A 4YJ3A 1O0SA 1VLQA 1ZD1A 3R9XA 4AS3A 1XTSA 2QR2A 3B38A 1VPLA 3CIFA 2CMFA 1HDYA 3A9UA 3OPXA 4B76A 4DDWA 3N0RA 5EJMA 4O4JF 4DM4A 1V39A 2G8LA 3KHTA 4F2PA 4XIGS 3GJYA 4N5NA 2VT2A 1PHPA 3AV0B 4QU0A 3MC1A 2C0PA 3DLPX 1FLNA 1U3WA 1VL0A 1K8XB 5FORA 1SHJA 1Z47A 3NV7A 2VL7A 3O91A 5FRDA 4WXMA 4ZA2A 1YF3A 4H3KB 1UM9B 2CLIB 3NPMA 1BJKA 1QR6A 3FYCA 5HM8A 1PD1A 2CLMB 2O1XA 3VC7A 4C87A 3PQFA 3ZZTA 1E2IA 4Y6LA 2I1LA 3VKFA 1NY5A 5EXEA 2JZCA 2CSUA 3JQBC 4GQAA 1Z8DA 4RGVA 3LI2A 1EWYA 2Y77A 4FN5A 1ZQ1A 4J2OA 4RH1A 4O2LA 5AT1A 4NV1A 4CCYA 1AKWA 2AMFA 4JQOA 2QVBA 2IELA 1W0JA 3KZKA 3EEFA 1KMHA 1IULA 1LPSA 2FN3A 2IYOA 1CVLA 3BK1A 3PKZA 3KHKA 3O7WA 5DN6A 3OMWA 3QI2A 1X3LA 5IM5A 2P2DA 2A35A 4G0ZA 2DHCA 1K5GA 2JJ2A 4BIMA 4RVFA 2NMVA 1PJLA 4YAOA 3FDFA 4NL4H 1JALA 3M6VA 3M49A 4B4DA 4CQMD 1UM8A 1O7JA 3GYGA 3JRNA 5DHQA 1N5MA 2WTMA 4ESHA 1XDGA 3RK4A 3PNLA 5KPDA 5K99A 4JELA 1PR5A 3QVTA 2PYIA 1LBHA 3ZEIA 3K2IA 3MS2A 2I1VB 1JLSA 1A8QA 1Q7CA 1Y80A 1ZN8A 4PG5A 2DCUA 4LX8A 3NAGA 3R3JA 1V8PA 1U8YA 3KKLA 4RY0A 3BXHA 3DJYA 3H1FA 2ACKA 2JHAA 2WU4A 1Z4JA 1NBIA 4U9UA 5GM2A 4YAUA 4J94A 3BWYA 1ONOA 4OGKA 1J2YA 3OUTA 2WNHA 1G20B 3J81k 1AN9A 3R5SA 4NS4A 4R31A 4AG6A 3ZZ1A 4Q16A 3N2GB 2IXGA 4PW0A 5KTTA 3IKTA 2OV3A 3L05A 4QPNA 1LFDB 3WWYA 2CL0X 3EQ6A 5EKXA 1F2UB 3JQDA 4EHJA 5AVOA 3CX8A 4KRFA 2DMRA 1II9A 3MINA 1EJ2A 2PHZA 4QSMA 3NYWA 4R2HA 1GGMA 1NDHA 5GP1A 3LIIA 2P79A 3T9AA 3OU7A 4BX3A 3ZHVA 1VMDA 3GLGB 2X1HA 2HJRA 3R0ZA 4OATA 2VBFA 4E07A 4ENQA 2J85A 5AJZA 5CAEB 3AY7A 3P0RA 2GYYA 4IIUA 2DQKA 5EPOA 3OZTA 4UAGA 2X8AA 1W0CA 2ZB2A 4I4CA 5A1JA 2G4LA 2V5UA 5LJIA 4HDRB 1C3LA 1N1EA 1XVAA 1ZX1A 3JR7A 3BBLA 3CUKA 3ZY5A 5JIBA 4XJXA 5TMBA 2R1UA 1ETHA 3C3AA 3PDHA 1FNSA 2O6LA 1N5OX 3DV9A 1FX1A 4BFWA 4BP8A 1RW4A 4GICA 3A58B 3D1JA 1WB9A 2W6ID 4EG3A 1SC1A 2PU5A 3AJAA 5IKPA 2ODBA 2Q2QA 1YC2A 4EB0A 3D3QA 3REQA 2XI4A 3GA0A 4CKZA 4RKRA 3UJ6A 2CV2A 3HDJA 2QY9A 3FOFC 3MSCA 3RR2A 2QK4A 2Y1XA 2ORED 3DZFA 3HH8A 3AUAA 3ZS8A 1WV0A 1U28C 3IAUA 4M1MA 3UJPA 4AY5A 1G0NA 3TZCA 3A6HA 5DW0A 3SKXA 3HEAA 3QKSB 4PE5B 2DERA 4FONA 3BB4A 3LYLA 1KMHB 2GMWA 4GPBA 4RVCA 1A8UA 3BH7A 2GEKA 2JFGA 4Y9SA 2Z04A 4GRDA 2EYUA 1S89A 4QELA 3EPPA 3M82A 1GFWA 3UMCA 5IRCD 3HJNA 5AUQA 1N5LA 1KORA 3L8GA 4N3BA 4RHYA 3TIIA 2BW0A 3VAAA 1BIFA 3KZMA 4F3NA 2D5CA 2QJWA 4L95C 2JC3A 1JAHA 5FUVA 4KOAA 3PHLA 3S81A 1N2CA 2SKEA 1Z0DA 1GYRA 4X5OA 1E77A 1Q7EA 1JBQA 2ZRGA 3FE2A 5J9FA 4QQRA 2O0KA 1QNFA 2AYYA 3TLZA 4RVOA 1HDCA 2BFEB 1GLNA 5FBVB 3BDIA 3AQIA 4MKHA 3QNUA 4RD1A 2B8WA 2POCA 3SNHA 1PWEA 5CT5A 4PQGA 3NC1C 4TTIA 1W4LA 4EG6A 5C37A 3W5AA 5BR8B 4BEJA 1IN1A 3HXLA 1WG8A 1ZK3A 3PQ5A 4HVCA 3OZBA 5K0SA 1EB9A 4KXQA 3TIVA 5LQNA 5LMZA 4Q7KA 1ZVVA 1I3KA 1R0WA 2IXTA 3L0BA 5JMTA 2ZLBA 2QSYA 4H60A 4O4LB 2FN8A 3T06B 1YC5A 3F8SA 4K1XA 1VL2A 1QF6A 1ZK2A 1U3FA 2IPAB 1YZVA 3AU9A 3G5LA 2G6TA 3LPNA 4ZTZB 1DQZA 5KVAA 3DNMA 5C2JB 3PTAA 3PXEA 4RTPA 2QP3A 1NIPA 1HBJA 2WKWA 5IF9A 5D7BA 5DI3B 5J47A 5KNCD 3UAOA 2O3QA 1GFSA 2IZOA 1B00A 3MOSA 3HJGA 3ZDDA 4YQYA 3SF0A 1HV8A 5BOVA 4YAKA 4K6FA 1E2FA 1T36B 5T4BA 3GEPA 3OQIA 4NZOA 3R5XA 4E14A 4C4TA 2GT1A 4ZZ1A 1N7JA 2ZK7A 3PEYA 2PRSA 3N5KA 3L7YA 2GRAA 1JSCA 3MAJA 3RJZA 1M5RA 3FN4A 5FWXA 2WUWE 3MAGA 2PO7A 4R84A 3OZCA 1DCFA 1IDN1 1V96A 4MUHA 1CD5A 4QJBA 1A04A 3Q12A 2GBIA 1M8JA 1DP4A 4MI3A 3WOVA 5AXBA 5F33A 2C9ZA 4EHHA 2BEWB 4DA4A 4MWTA 1UT8A 3VYRB 3ZIAD 2FETA 1VL5A 1Y5LA 1E9FA 3C48A 1VBMA 3CUUA 1CRQA 1EUDB 4IDDA 3OBBA 1N1GA 4MCJA 5JH7B 2XBLA 2ZRCA 4PZEA 1JHAA 2BFBA 3G0GA 4BRWA 4EJFA 5DNUA 2VFAA 2J9ZB 4A0QA 1N2BA 3OLYA 4TWAA 4Q93A 1B6TA 1QH9A 2FZCA 1KEUA 1IIBA 2CDBA 3DE4X 2ZRDA 4MAAA 2NXWA 3QYPA 4ROSA 4HDOB 4Z7JA 3FCOA 2XQIA 3VU1A 3KVYA 4Q4HA 1ULHA 2CXUA 3IALA 4QUAA 1EZZA 2VP5A 1VPVA 2YWGA 1L7PA 2JI8A 4IGIA 4JOBA 5BO5A 1UMCA 8ATCA 5KTMA 5LSAA 5EMLA 2GD0A 1XRSB 4DUZB 1SHTX 4WUTA 1GRQA 3O8QA 4FYPA 4Z86A 1ESDA 5HCNA 4EB6A 5I3CA 5THKA 1T5IA 1JYSA 1SU4A 4LYAA 3TMKA 5K8JB 3VHXA 3ZWMA 1DPGA 4HRYA 3M9XA 4K8RB 3ZHSA 3DAHA 3EDRA 4TQUS 1ZMBA 1GVHA 3ACBA 3WGNA 2E5LB 3KX2A 3HE3A 4ZKEA 4YQEA 4UPVA 3WBKA 1OFVA 3TI9A 2AZTA 3K9GA 5TT1A 3KK0A 3WRXC 4YRBA 4MVYA 1U0TA 4KP7A 1ZO8A 1YACA 3NYIA 4K9DA 5THQA 4ETWA 2B7LA 4MVJM 5HDQA 3V2HA 4W5OA 1EFCA 2BLNA 2DFDA 3F6RA 3INTA 1NP6A 1DGQA 3ISJA 4AQYB 3ZNNA 3WYCA 1DIOB 4O1IA 2ZI4A 1SELA 1FJXA 2XTAA 2H48A 4DZTA 3GVCA 4DCVA 1GVNB 1VIYA 2DBRA 1IB0A 3KP1A 1E6KA 3UUEA 1PL6A 3DZBA 2A1TR 4INOA 4HYEA 2VAPA 4LRSB 5CNMA 4GQIA 4QPZA 3RVNA 1PJCA 4DWVA 1OV6A 1INLA 4KGZA 1FFEA 4I3GA 5DB4A 2Y27A 1DB3A 3QE0A 1XTBA 4R3NA 4ZCQA 1MX9A 5LFAA 2VP6A 3IUPA 3B1ZA 1C81A 3OOSA 2ZJ1A 4X8LA 3FMGA 3VNAA 3LCRA 3LZDA 2VZLA 1NRXA 3EA5A 2J7KA 3MWDA 4JQCA 4PWYA 5AVXA 1PQUA 3DKIA 1FE8A 4TZTA 4ONEA 4CBVA 2WIGA 4H17A 5FWXB 1EXDA 2I8LA 1BX0A 3TZLA 2ALJA 2BZSA 1JE0A 4MI1A 4TKUB 4RJJA 4TWBA 4WKBA 3TL6A 4HGYA 2IH2A 2VHWA 1QSGA 2WIFA 4W1RA 3JVUA 5EE1A 1Y3HA 3OT1A 4FC6A 2PZJA 5A3QA 2YJ3A 4EYKA 3N70A 3TZQA 3X1MA 1XCBA 1HZJA 5AHWA 5IJ9B 2F4VB 1Q0PA 1B73A 2DUUA 1I9CA 1GQOA 3ZU3A 4PZUA 3P0JA 1HL7A 2OZVA 4Q15A 4RY2A 4JK3A 4ZOAA 4RDCA 3WG9A 3IDZA 3ZY3A 1QYXA 2P65A 3U48A 2AG5A 4X0EA 4EB8A 4KPEC 1OFHA 3WGHA 1E2GA 3RFVA 4Q1BA 2XVXA 4GXNA 4E31A 1HLGA 4JHXA 2Z58A 1OVGA 2FEWB 3HU5A 2RI1A 4U0JA 3U9TA 4TYMA 4NMHA 4WNYA 2AMLA 2DHDA 5FPKA 3WZMA 1NVUQ 2CL6X 2UYGA 4YRLA 2YNMC 4OBBA 1P9WA 3GRZA 3GEHA 3KRTA 4IIYA 3M83A 2DTDA 3FTEA 1Q57A 4HAVA 3DDNA 4KXLA 2XAAA 4D25A 5TX7A 3CN7A 3H3JA 1SCBA 1MAVA 3KKEA 3MSXA 3WL6A 3ZCVA 4N76A 4C7OB 2FPXA 3BSSA 4QQ8A 5GZ1A 2GLTA 4RS3A 4CF5A 2FPWA 3FFBA 4PS1A 2AEFA 1EDZA 4RY9A 3LW7A 1GGFA 4QWWA 5DEOA 2B1GA 4HCJA 2C4VA 3MBIA 3WAGA 1E1QA 4KPUB 1YWGO 5IF3A 4DCCA 5IJWA 3B5IA 1J6UA 3R6WA 2VHEA 2ZAOA 3HCOA 1CZRA 4K6MA 1TCVA 4UTVA 3OOWA 3PFCA 2ZJFA 3PXDA 1GUYA 2HV8A 2H8KA 4B83A 3CZMA 4X45A 3X1JA 1KO7A 1QTRA 1S3GA 3C6MA 1QKKA 3LPMA 1PNTA 4FDMA 3RTDA 3PDIA 5BNFA 1G8FA 4GOND 1W5SA 2I5PO 4IS3A 2XVYA 3MEQA 2JW5A 2W43A 4MYSA 3WAJA 1HFKA 5L4SA 2AOVA 2H17A 1V7PC 2OGZA 2ZJAA 1U9IA 5LQJA 4EY5A 2J0QA 3LDUA 5TS2A 2CYBA 1K7FB 1UINA 3KUKA 4TKZA 4G1MB 1OE0A 2DUJA 1WSWA 4CFZA 2R4TA 1JHYA 2FX2A 2VSFA 2WA1A 4Z4HA 1Q0TA 5AHRA 4GBGA 1URPA 1G42A 1QP0A 3UPDA 1UADA 3LX6A 3KQPA 1ECPA 3MWDB 5HQ3A 1P29A 5KOHA 2Y67A 1NXVA 2I2DA 3DTVA 3UIEA 1RMQA 2W93A 3OJ0A 1TYDE 1XQWA 4DNXA 1PGNA 5JXHA 2UVPB 1TUBB 1A8PA 4IQ0A 4Y2XA 3EXEA 3GHYA 5ESXA 1P1CA 4N0EA 1EJ6A 2OUKA 3C7KA 3V8PA 4DBVO 1JFFB 1QBKC 1C4XA 1WB5A 2P40A 1JIJA 3DLCA 3P9IA 4M9CA 3TEJA 3AP1A 2YRXA 2IZ0A 2QQGA 3PHBE 4I46A 4ND7A 5BW6B 4ZAXA 2FUG1 4MMZB 2GOYA 4OHPA 4A03A 1V45E 2VP2A 1XZFA 1RZ3A 3CH5A 2W58A 1F5SA 4I4NA 1EE1A 1JGTA 1XCJA 2PLRA 3LLUA 4BEVA 1R1DA 4JI0B 2BCEA 3K72B 5AM3A 2JCVA 3O2QB 1WZNA 4NEGA 2QU8A 2CK3D 3KJZA 2VHJA 4KE7A 4KIGA 4ZIRA 4EG1A 4PR0A 5E1MA 1PWYE 2EZ4A 2ZSAA 4B7XA 3NNSA 2O8DB 1GTVA 4CGYA 4JH0A 1E4EB 3ELUA 1BTOA 5GVSA 1SCKA 3RVKA 4MGZR 3VU9A 4C05A 4P7GA 4ND6A 3C1TA 2XWPA 3H86A 2WJVA 2WWYA 1KZGB 2I6FA 2XV1A 1KY5A 2YWFA 4PRLA 4ZQIA 2GXAA 1LZLA 5L3VA 1JU4A 2WG1A 1ABEA 1XX6A 2CUNA 4RQTA 1H0KA 3EQ9A 2E6UX 4HEHA 5AJYA 3ZN2A 2Q7XA 2C3PA 3GDGA 2WSSA 3UCXA 2ZUEA 1M34A 1QVVA 1H6DA 1B6GA 1ESMA 1ZIPA 1RM5A 2NXJA 4FHFA 4L28A 4Q1EA 4R6XA 5F64A 2AK3A 3HJHA 1CR4A 3W6OA 4BZXA 3SQWA 4HX2A 1ORDA 4HLQB 1JEEA 2IV2X 1AE1A 1JQ5A 1II8B 1BO6A 1RBMA 2J0UB 2PA3A 1XMPA 3IKMB 3D8HA 4FN4A 4IDCA 4KQGA 4V0LA 5BSUA 4XQ0A 3QVLA 1ZPDA 1GADO 1NE2A 3OZSA 1U2GA 4CNBA 1W5TA 1YCDA 2GZMA 4WPGA 1FTSA 1SEPA 5BWOA 4IV0A 1LV7A 2H9YA 4PN7A 2VUTA 5CXQA 3T7KA 1UJ4A 2PKYX 2X0RA 1RHKA 2RCYA 3GGPA 3HPQA 4G2TA 1Y6RA 1QG2A 3IESA 1RYYA 3W5VA 3U5ZB 2R6JA 4QU8A 4M9SA 1Z25A 4J29A 1TFRA 4MHTA 4R1QA 2Y1GA 4HN9A 1YZLA 1SUIA 2Z2ZA 5HQ3B 3C97A 3CWCA 4TXMA 3A9VA 4J4TA 4IQ4A 2AN5A 1QYVA 4DR1B 4IBOA 3BWXA 3TOVA 5JNVA 1OYOA 2MU1A 5BRAA 2C8VA 4WKPA 4E09A 1NNLA 3Q10A 1GY8A 4W9RA 1LX6A 4Y2HA 4B3HA 1YRLA 4HTAA 5KJEA 4DEVA 4EJSC 2EDCA 2PXAA 3EPRA 4ZO4A 4UBJA 3R6GA 2AE1A 4AJJA 2R79A 1Y8QB 2DUMA 1QHYA 4NJEA 1TADA 2YC4C 1E0KA 5DNYB 2PS3A 3EB9A 1ZU5A 2Y1OA 3D0KA 2P27A 4RJIA 3IV6A 1OREA 1NFRA 1U8CB 1XGKA 2VSXA 3E9CA 3BKWA 3EZ2A 2YV5A 1G19A 3S2YA 2HA0A 3F96A 2FK8A 1K3TA 4K26A 2CE2X 5T67A 4KNWA 2UKDA 3C24A 1D7OA 2L19A 3WLSA 1EG2A 1J21A 3H5WA 2DFPA 4O08A 3ZDRA 4CQMA 2O8DA 3TR0A 3TKYA 4IEIA 3L7NA 3PEVA 3IDFA 2O05A 5BQ5A 3R40A 3C16C 3E0QA 3L6OO 1QO9A 2J9YB 4B3XA 1GPYA 2CLHB 1D7AA 1PEYA 2V4ZA 4G9GA 4GPIB 4R81A 5FI0B 2DXIA 4QDUA 4JD5A 1NUQA 3ASYA 1XKQA 2HF8A 1RIIA 3TR6A 3WOHA 3A2KA 5DV9A 5KHAA 1LDGA 4ENVA 3ZW7A 5CCEA 1EI9A 4EY7A 2XQGA 2Y99A 3IT2A 3OSZA 1N33B 2EKZA 4HN4B 4AIRA 1N6KA 2NVBA 5AW1A 3DUFB 1L8AA 2A4KA 2H4WA 2VCYA 2YNMD 3EUFA 1TM4E 2AB0A 1ZZEA 2R6FA 3BK2A 1JV2B 1NX9A 3MLBA 1ZSNA 2ATXA 2PAAA 2QNIA 2GF9A 3STWA 4YAFA 5KTNA 5J2UB 4MJ3A 3EODA 1HEIA 3ACDA 2HEIA 2XZPA 3PQ7A 4IJVA 3FUCA 2FA9A 1T8RA 3O47A 4FJ0A 4IDAA 3H16A 5AW4A 3I05A 3FCXA 3KSZO 1FFXA 3P20A 3R09A 1UPUA 1XDZA 4PF1A 2KHZA 1JH9A 5DEIA 5CJ2A 1QGAA 3CNLA 4FBGA 2FUG6 2H2AA 3CRNA 3UC5A 4Z1OA 3UJ3X 1P3Y1 1MA0A 2BONA 2GPAA 5G1NA 3K0CA 1NQ5A 1N5JA 2COEA 1NG1A 3G8CA 4TV9A 1DZIA 2Z2YA 2IX3A 1UJ6A 4F38A 1XOIA 4MIEA 4UFOA 2RBKA 3K0SA 1BKSB 1RQLA 3RVLA 4J9VA 5EJ8A 2TRSB 4D9HA 3GMTA 4L50A 4AMVA 1E0AA 2OZPA 1L7BA 3IAM1 3IDOA 4IHKA 2DY1A 1D0SA 4OQYA 1L7XA 2PD4A 2Q5LA 5CA1B 3DS8A 1U0SY 3LY5A 5DP1A 1HYBA 3TSWA 5C8YB 3PP8A 5KHLB 3GGOA 2EDAA 1L9KA 2OBXA 4KR6A 4UUBA 3NWOA 4NI5A 4JYMA 4EBFA 4ZDWA 1AS0A 3PHIA 1EM6A 2YYAA 3M8KA 4M7PA 4BLVA 3QXGA 1DI0A 1Y5NA 2Y6VA 2OQIA 3GVPA 3UTDA 1Q1AA 3HVUA 4KNYA 5DGCA 1SXJC 2O2YA 4PHFA 2A7QA 4DT1A 2A57A 1E7SA 3C8UA 1JB9A 3JTMA 1OVMA 1D8AA 4PLPA 4Q12A 1JT9A 3UOGA 5EZSA 5LDDC 1DIAA 1OV4A 4QDZA 5HOQA 1ZZGA 4R98A 5BQOA 4D79A 2I7TA 4AT1A 4CI9A 1P31A 4QYIB 5FAXA 1Q5PA 3X44A 4BRUA 4X1KA 1TVKB 1HT2E 1G21B 3HADA 3P2OA 3AILA 5C8VA 1HQKA 3FHOA 4KR7A 3RAJA 2O5VA 1UJMA 1RMYA 3EC1A 4NIMA 3TI7A 3WL8A 1DJPA 5FFMA 4EPXA 4EPVA 3Q8WA 1CWUA 4GSKA 1T2FA 4QG3A 4XFKA 4BV9A 2R65A 1E5QA 1USIA 2NT3A 4HBGA 4BBPA 4BRSA 3BJEA 4RZSA 1IG0A 1E69A 4E15A 1MIHA 1ISRA 2NXCA 2QD3A 2R3SA 1CU1A 2VHTA 2GZAA 1MZPA 1JE1A 3LMKA 3ETHA 2PZLA 5CCDA 4D4JA 1Q14A 4OMDA 3PC6A 2R7LA 5H83A 1E3JA 4RA9A 5ADUS 3IDSA 2FFJA 2PH3A 3C5WP 4YRZA 1BHO1 5J2UA 2GA9A 2W2MA 3IQIX 2PBZA 1YOBA 4LI0A 3RC7A 4F04A 5KB3A 3L40A 4GUAA 5FA6A 4RF2A 1N2GA 2B82A 5EZYB 1WNTA 1KR2A 3BHIA 3D81A 4B8YA 2P68A 1U8ZA 4ZYLA 4NC9A 1QGUB 3V1MA 2XPCA 5KUTA 1O5TA 3Q15C 5I47A 2UUAB 4FKZA 3ZNOA 4XPIB 3HYSA 3QVGB 3IVCA 4QNRA 4ZCPA 2F1HA 4E4TA 4HI0E 4PR3A 3URMA 3WTCA 2P9HA 3EF3A 2X7HA 2HM7A 4K3UA 5DI9A 1W4RA 5IG2A 4GMFA 2P6OA 4YV2A 1W46A 4ZAYA 3LBAA 4B2IA 2I29A 4V0OA 3ZWKA 2EYQA 4ZJZA 1LRKA 1QHNA 2ILVA 5B1EA 1XTZA 1PT9A 3P5BA 4FMPA 2ENWA 2ORYA 4NH4A 1Z2PX 5DYTA 3FZGA 1NVTA 3PVCA 3Q3IA 3THYB 1JMVA 1QUFA 1WB6A 1C4KA 2NACA 3CURA 3DPIA 3F6CA 1VKNA 3FNRA 3OIVA 5TB5A 4CL8A 3L07A 1T0UA 5BVHA 4KAJA 3KALA 1W48A 4BU0A 1QTNA 2DPHA 3QWFA 4FNMA 4QDKA 4BQRA 4FFVA 3N53A 1LKZA 3OOYA 1Z2NX 5IFKA 4AIIA 1XPOA 3EQ2A 4U7DA 4B17A 5JZSA 1J0XO 1GUDA 1TCUA 3A4LA 1UCFA 2SICE 3A36A 1NT4A 3BA1A 2E4ZA 3QX8A 4HN2A 4LNUA 5KJ6A 1H1DA 1I3CA 2IK8A 3PQCA 3SF8B 1MOZA 4BNUA 4KO3S 4II7A 3HV0A 5B37A 3MRSA 4A23A 4YCMA 3BCRA 1D09A 1NUHA 4RLQA 4D0RA 1CY7A 2K7FA 3NTLA 2CZQA 2YMMA 1Z5WA 2I7CA 4B3FX 3HUTA 1VJRA 4QAQA 3VO1A 5K01A 4HTFB 5ADVA 1A9XB 2WSIA 2BFMA 2WUGA 1GDTA 1XMJA 3CCCA 3I9OA 5AICA 1DBVO 4J1TA 4M8SA 2R00A 1Y3BE 1HZZC 1T1IA 2FE4A 2GAOA 3CRRA 4TL9A 4X6YA 3JWEA 3NYRA 4FI3F 4DCGA 1X0XA 3BSFA 1EDOA 3A27A 5A03A 4GD3Q 5CR9A 3ZWVA 3ANNA 3HR7A 5TDHA 3GGSA 1Y98A 2Q3JA 4PFKA 5TV2A 1MEEA 1XQ9A 2H1LA 1A7AA 2O8VA 4AWXA 4LHXA 4DVGA 5FBRB 1FFWA 3B3JA 1H1LA 1S1MA 4GC5A 2XOEA 3P19A 1W9HA 2P78A 4CFSA 2VPPA 2HHHB 1JG4A 3E3LA 2YVAA 1WHSB 4Z7OB 1EVKA 3RKRA 2A9OA 2JFOA 4FFSA 4XOUA 3F97A 2OD7A 3AG6A 3NBYC 1XRRA 3ENNA 5CM2Z 1E8DA 4WZ6A 3T9BA 2O2IA 1ZD8A 5GWXA 4EF4A 2WTUA 3AVXA 4GM4A 1JMYA 3LXMA 4NOKA 3LE8A 3UMBA 1E89A 3QOFA 5K3OA 4HKTA 2NU8A 2JIDA 5FF9A 1N6PA 1GL6A 5HILA 4DIFA 4E4RA 3E61A 1O2DA 4CMEA 3QWBA 4PC6A 3DKRA 1T9ZA 3HB9A 5FNVF 5JZOA 1KGDA 1XPJA 1AGPA 4JLAA 4QSHA 1FU4A 4IHJB 4WE3A 2EWWA 5JMOA 2OK7A 3L8FA 4MV6A 4LZWA 3HFGA 1AA9A 4H1VA 1IZ8A 1N77A 1TK9A 3THYA 4PO9A 1AMOA 4HS4A 1BDJA 5B4TA 1G9XA 4IV5A 2AN4A 1MABA 2VDLB 5BVHB 4O25A 1JBEA 2FEPA 3U2QA 4MGHA 4MVJA 1DAMA 4H6VA 4TTPA 3K9FC 3SSOA 2V45A 1KVQA 5FO1A 5M7EA 1NM5A 4XWKA 3E9MA 1EAMA 2V55B 1M2FA 5BR1A 2WTXA 4P34A 5JAOA 4L5JA 1B42A 5FKJA 4W7SA 3HR4A 4G41A 1YJXA 3ZC3A 2O2XA 4L4RA 1R2QA