1EG2A

Crystal structure of rhodobacter spheroides (n6 adenosine) methyltransferase (m.rsri)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
279
structure length
270
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structure of RsrI methyltransferase, a member of the N6-adenine beta class of DNA methyltransferases.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 90
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1eg2A00
3ER9A 1R6AA 4M37A 2P35A 2IDKA 5DM4A 1X1AA 2UYQA 5GM1A 3UA4A 4AZTA 5BW4A 4YUVA 2OXTA 2BR5A 3JWJA 4DQ0A 2ZIFA 5DRYA 5KVAA 3TM4A 4FR0A 5CVEA 2JHPA 3UJ8A 1Z3CA 3EGVA 3GDHA 3HNRA 2CKDA 3VYWA 3LPMA 1KYWA 1JQEA 2UYCA 3LCCA 3R9XB 4RYLA 2A14A 1Q0TA 4DM3A 1UFKA 3M33A 5EMLA 3FRIA 4E2XA 4POOA 2ERCA 4AUKA 3I53A 3TPZA 2KW5A 2BH2A 5FQNA 2G1PA 3QOWA 1L3BA 3PT9A 3GRZA 3BT7A 1XDUA 5GOZA 3M70A 4X61A 3UJ6A 4YUZA 4YMGA 2XYRA 3TLJA 2BR4A 3HCFA 4YUXA 1G38A 5HEKA 1KHHA 4EMSA 3RW9A 2JH8A 2HMYB 3E23A 3OFJA 3C6KA 1SUSA 1ZQ9A 2VS1A 1KXZA 3BWCA 3M6VA 2B9EA 2ZSUA 4E31A 2AOTA 3G5TA 2QM3A 2R3SA 4L7VA 3E05A 4OX9Y 4FS8A 3SXJA 2NYUA 1D2HA 1NW3A 3KPYA 3HP7A 5DM2A 1AQIA 3M6XA 3KKZA 5DSXA 5FADA 5HIJA 3RODA 5K0BA 5D1NA 4E32A 4A6EA 1XVAA 5DTMA 5EHIA 2GLUA 3FPFA 1VP9A 3ANXA 4OA5A 2ZVJA 5BP7A 3EVZA 1NV8A 4PCAA 2OB1A 2B3TA 3EMDA 1YZHA 3E7PA 3CJTA 3PX2A 1QZZA 4E2ZA 2Z6QA 2BR3A 1AF7A 2QRVB 3NWEA 2VDVE 5EG5A 5LQUA 3TOSA 1SKMA 2I9KA 1VBFA 3LGAA 4RTRA 1QAOA 3HVIA 2AOUA 2XYVA 3BWYA 3C0KA 3OZTA 5DT2A 3TM5A 1NBHA 1I1NA 1OR8A 4ER7A 4ER0A 3PFGA 4P7JA 3FUXA 5LQRA 4BLVA 4MHTA 2FHPA 5HOQA 3PVCA 5E1MA 3A26A 2VDWA 3KQMA 3UJ9A 3GIWA 3P8ZA 4RVFA 4RVHA 4HTFA 3P2KA 3HTXA 3HM2A 4ZTBA 3FYCA 2P41A 4G56A 4MQ4A 4QTUB 3FTFA 2K4MA 5EKXA 4ISCA 5T67A 1BC5A 5M5BA 1NW5A 3KQSA 5FHQA 5GP1A 3KQYA 4WVLA 4PGGA 3T0IA 4BLUA 4RSRA 10MHA 3UJDA 2IBSA 1G60A 4HH4A 4QDJA 1V39A 4R6WA 2WA1A 5EMJA 4C08A 2YTZA 2YR0A 1JR4A 3DXXA 1O54A 1IM8A 4EVIA 2AS0A 3EGIA 2CL5A 4X1OA 2ZZMA 1RI5A 3B89A 3NVMB 3FTEA 2ZW9A 3AXTA 3LDGA 3SVZA 3LCUA 3OE4A 1EQAA 3BWBA 2YXDA 2EJUA 5T6BA 3LDFA 2PX4A 5KS2A 2PX8A 3FTDA 3OPNA 4R8RA 4GF5A 5EPEA 1X1DA 4P7KA 3U81A 1SUIA 1TW3A 2Y1XA 5G02A 3BKWA 4PYOA 5K05A 4RTOA 4UOEA 2OY0A 5K0GA 5BXYA 3O7WA 2BM9A 4M38A 5DM0A 9MHTA 1P1CA 3SMQA 1EJ0A 3HEMA 5EHGA 5EZSA 3EVEA 3A25A 3BGIA 3KU1A 5HILA 3KQPA 2O06A 3HCEA 4C06A 3ER8A 2EX4A 1H1DA 2GAFA 2PKWA 2ZWAA 4GQBA 4F84A 5CUQA 5FTWA 5ICEA 2ADMA 4PYIA 3QV2A 2C7QA 4KW7A 3CVOA 2H11A 4RV9A 3LBFA 4DCMA 1R8YA 3KQOA 3G5LA 4ER6A 1UWVA 3MB5A 4C03A 3CJQA 1ZGJA 5F2OA 3R6TA 5FUBA 4Z2YA 1T43A 2UYOA 2HTEA 2V74B 2ZBQA 3KQWA 3AJDA 3VSEA 2Z6UA 5ICFA 3EEYA 2NXNA 5EEGA 4X60A 3EVGA 3FYDA 4RVGA 2JHCA 3G2QA 4KDRA 3P9CA 5K0LA 4MIKA 2P8JA 2VZ9A 3OE5A 3R3HA 4KIFA 1XTPA 2NXJA 3LDUA 3FUTA 1G8AA 1O9HA 3GRUA 1JQ3A 3WSTA 2IH4A 3OU6A 4CKCA 3B5IA 2ONZA 1FP2A 3DMHA 3HVHA 3CCFA 5F2KA 3FPHA 4FGZA 4C07A 2O0LA 3I9FA 1WXXA 4RTSA 1ZGAA 1G8SA 5U4XA 4DMGA 1JSXA 3EVFA 2EJTA 3IEIA 3EVAA 3OCJA 3S68A 3TKYA 4R05A 3UFBA 3V8VA 3KPWA 5GM2A 2QYOA 1KP9A 5CVJA 5E2AA 4RTLA 1BKYA 4GOLD 4HSGA 4IWNA 5CD1A 5ERGB 4RTNA 4QPNA 3PB3A 2YXEA 2ZCJA 1INLA 3GGDA 2QE6A 1BHJA 5EKUA 4C05A 3KR1A 3ORHA 4YMHA 3KR0A 1XJ5A 3E8SA 1ORIA 5GIPE 2GS9A 5EEHA 5GWXA 1P91A 2DULA 3OU2A 2HWKA 3GRYA 2AOWA 5ICCA 2AN5A 4CTKA 4RTPA 4GC5A 3MCZA 4XUCA 1FBNA 1SVUA 3KR9A 1PRYA 1NBIA 2P3QA 2FK8A 2DPMA 3REOA 4AX8A 3CC8A 4PIPA 5DXAA 2I62A 3MERA 2OYRA 1X1BA 2PX2A 3A7EA 3VC2A 4YV0A 3ERCA 1KPHA 3G7UA 5D1HA 5P8WA 3MTEA 5E8JA 5LQCA 3KPUA 2I7CA 1YFLA 5K0NA 3THSA 3P2EA 4DCGA 2PT9A 3FUUA 1NW8A 1ZG3A 4CXMA 2AOXA 4IV8A 4GOND 5EVJA 1JSZA 3LX6A 3PX3A 3Q7EA 5B1SA 5DSTA 3FRHA 4RTMA 5DRTA 3TRKA 4PYKA 4XUDA 5HIKA 2XVAA 3ELDA 4GC9A 4MTLA 5FQOA 3G8BA 4M36A 3ID6C 4C4AA 4PYNA 5BW5A 1VL5A 3PTAA 3JWGA 3NVKI 1JQDA 3R24A 3DH0A 4FSDA 3D2LA 3KHKA 1P1BA 2PWPA 3I64A 4MWZA 2AR0A 3RIEA 3GNLA 5K01A 5JUWA 3ELYA 5K0JA 5LSAA 4ER5A 3SX0A 5KYGA 5HIIA 5LR6A 1MJFA 1KPGA 3KQQA 3BZBA 3G8AA 1RI1A 3IYLW 4HC4A 2AVDA 4LECA 4U7TB 5CVUA 3B7PA 4HGYA 2XVMA 4OBXA 5GINE 2F8LA 1RJGA 4OQDA 3LL7A 1XXLA 4Y2HA 4QQNA 1D2CA 3PS9A 1N7JA 4E33A 4PONA 2AOTB 1YUBA 1NE2A 3JWHA 4GUAA 4RTKA 1QAMA 5CVVA 3FUVA 3A27A 3CBGA 4OA8A 1IY9A 3FPEA 4R6XA 4R8SA 1G55A 1QYRA 2O05A 2OPBA 3MQ2A 4K6MA 5LQNA 4FP9A 2ZTHA 1Q0SA 2NXCA 2AZTA 3M6UA 1VQ1A 3HA3A 4F85A 1HNNA 1JTEA 5ICGA 4RVDA 3NTVA 3SR4A 2C7RA 1X19A 5EZQA 2PVCA 1F3LA 3FUWA 1JG2A 2NXEA 2AOUB 3VC1A 3I58A 3LBYA 5E8RA 1U2ZA 2PXAA 1ORHA 3NW9A 5E9QA 3T7TA 1Y8CA 2PXCA 8MHTA 4PYMA 3T7SA 3HA5A 1SG9A 4PWYA 1D2GA 4E2WA 4HRAA 1EG2A 2YQZA 2FK7A 2AN4A 3MAGA 3TKAA 3TR6A 3LHDA 4E30A 1VIDA 2XYQA 4HTFB 1QANA 4IKPA 2B2CA 1DL5A 3GWZA 2CWWA 4CKBA 5EIWA 2ZBRA 5FHRA 5DX8A 4PINA 5K03A 1JG4A 1L1EA 3OFKA 3T7RA 3THRA 3G88A 1TW2A 1I9GA 1PJZA 4PYQA 2C7OA 5E2BA 4XCXA 3DXZA 3B3JA 4HGZA 2GA9A 1RJFA 2G70A 3BXOA 3GRVA 4GBED 2OO3A 4C04A 3OZRA 1WXWA 5IH3A 4M7RA 5FA8A 4BLWA 1VPTA 3P9NA 2IDJA 3LSTA 2IGTA 2O57A 4LG1A 2HV9A 2PX5A 4A6DA 2XBMA 1R8XA 3BUSA 2GPYA 2ZZKA 3P97A 5K0CA 1RI2A 1QAQA 3QOXA 2PLWA 4LWPA 4X41A 5E9WA 1G6Q1 3GXOA 4QPPA 4QVGA 4IV0A 2G71A 5DX1A 3EVBA 5LQKA 3GCZA 3NJRA 5C9ZA 3ELUA 3EEOA 1YZ3A 2G72A 3P9KA 5CCBA 5FWDA 1M6EX 2NP7A 4BY9E 2P40A 1JG1A 3LKDA 5CVDA 1EAMA 2N47A 3SSNA 3BGDA 1DCTA 4YV1A 4FSXA 4X63A 2NNWB 5DLYA 3CJRA 2JHAA 5EMMA 4EQZA 2QRVA 5EMKA 2O07A 3B3GA 4PCLA 1NKVA 4QQKA 2JG3A 3NDJA 4DKJA 5KQRA 1MHTA 1SQGA 2P7IA 4E2YA 3EVDA 1L9KA 3KQVA 3LECA 3NDIA 3OU7A 4LWOA 5E1DA 2UZ4A 5C1IA 4EKIA 4OBWA 3EPPA 4E70A 4YV2A 4U7PB 3DR5A 5HFJA 3UJAA 2LD4A 2ZULA 2FCAA 4RWZA 4Y30A 4PYJA 2ZLBA 1KR5A 2B25A 5DTQA 4F86A 3C3PA 2PY6A 4KIGA 5DTRA 4GEKA 5FULA 5E9JA 3L8DA 2ZIGA 3DLCA 2OZVA 1KPIA 3DLIA 3SGLA 2PT6A 2P7HA 1F38A 2IH2A 2ZIEA 2QY6A 5K8VA 1KYZA 3OZSA 1RJEA 4KRGA 3NMUF 4CTJA 3LCVB 5DM1A 2AVNA 1R00A 4O29A 4RX1A 3B3FA 2ESRA 2YX1A 3FPJA 5DXJA 1NW7A 1R18A 3UBTA 2JH9A 3HVKA 4P7GA 3EMBA 4DA4A 3A4TA 1RJDA 2P3LA 2EG5A 1HMYA 4GOMD 3CKKA 2IPXA 4DZRA 4P58A 3DOUA 3MHTA 5GIOE 1UIRA 3CGGA 3MCTA 5E1OA 2VDUE 3DTNA 3HCCA 2HR1A 7MHTA 1XDSA 3KR2A 5IKMA 2VP3A 3MGGA 4QDKA 2PJDA 3O31A 1JTFA 4XUEA 3F4KA 1VE3A 2FPOA 5FCDA 3M4XA 3UJ7A 4ATNA 3LKZA 5EQJB 3DUWA 3SM3A 5LQJA 2UYHA 4V0QA 5LQAA 3P9IA 1N7IA 2WA2A 1NT2A 3ELWA 2GH1A 3GU3A 1B42A 4GOOD 5DX0A 1M0EA 3KPVA 1BOOA 5DWQA 4RTQA 1AQJA 4YUYA 1N2XA 1WG8A 1YFJA 2GB4A 3HCBA 3O4FA 3M6WA 3GO4A 1SQFA 3SSOA 3FPGA 5MHTA 1JG3A 2PXXA 3DMGA 4B17A 2R6ZA 1EIZA 2WK1A 3GRRA 5E1BA 5EC8A 5FWAA 5C0OE 2PSSA 2YVLA 1RI4A 2ZWVA 3DULA 3GJYA 3BGVA 3G2MA 2V7EA 3IV6A 4OQEA 4PIMA 5T64A 3ME5A 4QVKA 1NV9A 4PNEA 4BP3A 4ER3A 3UWPA 2P1DA 2OBFA 3EVCA 3KPJA 3I5UA 1XCJA 5KQSA 1YB2A 2CMGA 3KQTA 4NECA 3C6MA 4EK9A 2JJQA 3PLAE 3MTIA 4PYLA 1EJ6A 1L3IA 4AZWA 4HG2A 5K0EA 3NWBA 3DXYA 1AV6A 3TMAA 4KDCA 5EOVA 4P7FA 1XDZA 2E5WA 5HIMA 3V97A 3EGEA 1NW6A 2AOVA 2B78A 2PV0A 5EIFA 5K0FA 3UA3A 2ZZNA 5H02A 3JWIA 1ZHFA 5HZMA 3FTCA 1O9GA 1VLMA 1RI3A 3C3YA 3IHTA 3H2BA 3PFHA 1WY7A 2HNKA 4FZVA 4RTJA 2IBTA 3AY0A 1FP1D 2IP2A 3K6RA 3UJCA 5FA5A 4BP1A 2I6GA 3K0BA 3HCDA 2P3OA 2Q41A 3P71T 1VP3A 3DMFA 3UJBA 3P2IA 2C7PA 2IH5A 1WZNA 5JR3A 1DUSA 1L3CA 3G89A 3HA7A 3HCAA 2PBFA 5CCXA 2PWYA 3AWIA 1TPYA 4QTTB 4DF3A 2Z6AA 5DPMA 4YUWA 1YF3A 2BZGA 2EFJA 5CIYA 4H0NA 5EGSA 4FT2A 4AZSA 3HVJA 1M6YA 2ZBPA 4CWAA 2IFTA 1P39A 3A7DA 2OKCA 2NP6A 2ZFUA 1XCLA 2FRXA 2G8NA 4CKEA 2FYTA 1IXKA 3G2OA 3X0DA 3G2PA 2CMHA 2OB2A 3Q87B 2AN3A 1X1CA 3TFWA 5K09A 1FPQA 2ORED 2YUIA 5CM2Z 3AXSA 3TQSA 4AZVA 2H1RA 4V0RA 4JXJA 4PGHA 1WS6A 3DP7A 4KVZA 4EKGA 1ZKDA 3R0QA 2BM8A 1FJXA 2Y1WA 4WXHA 2H00A 1R74A 2YXLA 2ONYA 2IIPA 5F2NA 4KWCA 3BWMA 3FZGA 4FT4A 3BKXA 3UZUA 1KIAA 3SSMA 2PGXA 1I4WA
chains in the Genus database with same CATH superfamily
4H0FA 5T41A 1O87A 3M83A 2IDKA 4BAGA 3I2IA 4B3RB 5EYPA 1ZRNA 3C1OA 2CY0A 4K9NA 1CUAA 4DRXA 4NY1A 5HKBA 5JAUA 2WV9A 4TX1A 1FMLA 5BPFA 3AVXA 4D3YA 3W5JA 4C22A 3KJHA 3KOOA 2R79A 5A0VA 2JI7A 3PBKA 1ZGZA 2P6NA 2VYNA 4YBZA 1Z3IX 3DFZA 4LI3X 5F33A 1F1JA 1HORA 3MBKA 5T4HA 1YZKA 2DHRA 4LRTB 4W9NA 4POOA 3G9XA 4LWQA 5DWVA 3OE7A 2IU3A 1Z38A 1GRCA 3MWEA 4UE6A 2WIGA 3JQ9A 3MXTA 3G2LA 2QPOA 4Y2PA 5FQNA 3K9HA 3LBNA 4N5LA 4IZIA 1H2EA 3WMFA 1N5MA 3NALA 3OA0A 1LEHA 4K88A 3R7WA 3ZHOA 3S2UA 2O7QA 2PZJA 1XLUA 2LV8A 1IJEA 1A2KC 3OEWA 4YALA 1JFSA 3A4MA 1GU0A 3G2IA 2PJRA 4XI9A 1US8A 2QHXA 1OD6A 2FR8A 4QU9A 2QF7A 5D6OA 3TGWA 4UE3S 3PRHA 5AM4A 4GWLA 2IUUA 3QLUC 3RRMA 2V9CA 2D6FA 1V96A 4L76A 5KX5F 4B6SA 4CDGA 2FEKA 2Q6TA 4P4SA 5FADA 2BFCB 5C1BA 2J3HA 4IS2A 4K86A 4RVUA 5DTMA 4FE7A 3VU9A 3VAYA 4L2IB 1I6KA 2V6JA 1AT1A 4Q3LA 1CJBA 1NXOA 1CDEA 4RPGA 4E2ZA 4G1BA 4QXAA 1ESZA 2Q0HA 3O9ZA 4L3OA 2QUIA 5IC6A 6PFKA 3EYWA 4DDWA 4MCAA 2Q50A 5G3ZA 1T4MA 4PZYA 5JOQA 3TM5A 5H5JA 4AG3A 5FV7A 4RQBA 2DU8A 3X44A 4HDRB 4EUEA 1K68A 2P4QA 4BIMA 3OX2A 4H0CA 1J7JA 4BFUA 1XU9A 3K20A 3G49A 1F48A 4HAZA 2VDOB 4I1IA 5FOSA 2OHGA 3CNQS 4FZJA 4OXIA 4HVLA 2V8BA 2ODEA 3RRXA 1PTKA 1FJGB 3EC2A 4BLUA 4PHGA 2ZJ3A 4IXMA 4XYMA 4P82A 1E99A 4HWSA 1TGVA 2J5XA 3FNFA 2VAWA 5EIHA 1XZAA 4ZXFA 3QE3A 3E1SA 5GJVC 4D9IA 4RTOA 3GYBA 1YRYE 3AV3A 3TUJC 1ZOSA 4PW0A 2DLCX 1OE0A 1UF9A 3GLUA 3LPLA 1QHFA 3WNBA 3G3EA 1O0SA 3LDGA 3ZCUA 1OY1A 3DBRA 2ES4A 1FVFA 3FCXA 2IHKA 5LZ9A 3KL2A 3LDFA 3B7WA 3ZE8A 2WP8J 2YRFA 4KGZA 3ZU3A 4JB2A 4C0QC 4RIEA 1MXFA 2AI1A 5ELLA 1FX1A 2HQSA 2D2FA 3MFYA 4IHJA 4R2WA 2BHRA 3O94A 2QTTA 3LGXA 1A71A 1NBME 3EZGA 5KVCA 2DFKB 1ZD3A 2CCJA 3CEHA 2I80A 3CUSA 3LDAA 3MWDB 2H7XA 2Z1MA 1AUOA 3H9JA 4KLRA 4CLRB 4XJSA 1EXDA 2J41A 1UKYA 2REBA 1P2VA 1S9DA 1R0SA 2JGIA 1WP9A 2CBXA 1XZ8A 4IDDA 3MIIA 3EZFA 3GVCA 4PTYA 1DMSA 1FDTA 2VR1A 1BFDA 4PNHA 1ISJA 2BBSA 1N8KA 2DLNA 1EDZA 2PA3A 2AC2A 2C97A 2H11A 2WT8A 2VEOA 3LBFA 3L46A 2MINA 4R98A 4KE6A 4ZFNA 5FLKA 2RGNC 5AVOA 5GGYA 3DLHA 1YHNA 3DBHB 2RHMA 3Q5GA 1THZA 2HU8A 3ZJ5A 1NDQA 3R6TA 4CMCA 3S8YA 4ZDIA 1XYYA 3H2ZA 1MB0A 2VHZA 1DAPA 1DI0A 1XU4A 3I2FA 4G63A 3HCNA 4NFYA 1X7HA 1O7JA 4XIJA 3UCEA 2B99A 1FFCA 1Y3BE 2GLXA 2ZRNA 4OFBA 1A8IA 1EG7A 1VLVA 4BIIA 2JDID 2QD4A 3KUCA 2R9VA 1GNSA 1RWXA 2WNSA 4KDRA 4Y6SA 4YCBA 3UHAA 3PEYA 2QLMA 3LX8A 1DLJA 3WGOA 1Q95A 4YI5A 4O2BB 1X7ZB 4B4VA 3NCTA 1R88A 4PRKA 4BFTA 1CD5A 3HNOA 1VC2A 3DWIA 3I76A 4KWEA 3B5IA 2Q5QA 3HVHA 4PLVA 5EJ4A 5JY1A 2AHOA 1P17A 1J0DA 3PNLA 2JF0A 3U4AA 3UTDA 1G8SA 2P9FA 1XJ0A 2VSYA 3FTNA 4R1LA 3GBSA 3T6KA 4ZO8A 1PNTA 2ZE6A 3GDGA 3DCIA 3KPWA 1Z6TA 5KSWB 2UUCB 4PAMA 5ESDA 2OGTA 3PUWA 3RU7A 4EY6A 4JGGA 3KTOA 3PB3A 4QDZA 5G0SA 3CPJB 3RG8A 4DB2A 3JD0A 4E2FA 4G2TA 3I45A 1H05A 4R1SA 1ZGHA 3AFGA 3OESA 1TD9A 3AFIA 3CG4A 4A0GA 1XTSA 3TZEA 3ZGYA 4GLOA 2VZEA 1CUWA 1RRKA 3WBKA 4FOPA 2E4ZA 3GJ6A 4MYRA 1J0EA 1LK7A 1M74A 1XI2A 1C9NA 2CDCA 3EDYA 2VBFA 4P2GA 3DT6A 4J4HA 2VJMB 3V4PB 5DCYA 3ZE6A 5JV5A 4KQ6A 5F7OA 1I32A 1SJ9A 3ES9A 3ET5A 4DZTA 1KA9H 2W6ID 5DWDA 1PV4A 1E32A 1BH2A 3JQFA 2J3MA 3OAAD 2MMCA 4IP0A 3ZPXA 2JLYA 4RKRA 3P2MA 1CRPA 5I01A 1Z4KA 3AIKA 1BKDR 2V3VA 2WYVA 1DKPA 3HZOA 2PX2A 3A7EA 3OC0A 4HFJA 4JUBA 2YHSA 1OIVA 1DIBA 4Q7LA 3RRJA 1EFAA 1GLNA 1OYVA 4RDHA 4Y0NA 1GTVA 4DV0B 4EB0A 1ISMA 1SK9A 1U7XA 3RFXA 3KSUA 4B46A 4ZTUB 1YFLA 3OUTA 1ZKMA 4I50B 4TZ0A 2G4LA 2GN1A 4Q9AA 3V7FA 1JFVA 1PR1A 2JAUA 1V5IA 2X9LA 4OAQA 4WT7A 1TMGE 3DGFC 4OHRA 4DSTA 2VP4A 4K5QA 1TJ3A 3DZHA 5T7BA 5KOYA 2JGEA 1B3BA 1TEXA 3KAPA 3NDBB 1NSYA 3ETCA 1EBUA 3NNDA 4Q5IA 1SBHA 1LRKA 4I1UA 2P9BA 3PRKE 1CF4A 4D42A 1RWPA 4MTLA 5HCNA 1NX6A 1MFZA 2O2IA 1DIOB 2LGJA 4EJ6A 3BFVA 4X6UA 4LGVA 4R84A 2W6QA 5BW5A 4QDTA 4WN9A 4YLGA 3TQFA 1GG2A 2RHCA 1NW9B 3NXKA 4QUEA 1MHPA 5K3EA 3D2LA 1FS6A 3PE6A 4A0SA 3HL4A 2C5BA 2J30A 3R75A 5JH7A 2BLNA 4QEDA 3SY8A 1Q3HA 3KDPA 3VH3A 4GPAA 3K1JA 1YBMA 1AM4D 2OAEA 4GL4A 4H35A 4KQHA 4UD2A 3VZSA 3U56A 1IN7A 1UC9A 2WTBA 4TV9B 4FDUA 3L77A 3BAFA 3RSOA 4G25A 4M87A 3UPUA 5EMHA 1YO6A 1U8TA 4TWZA 3WGGA 3A4VA 2QD3A 3N6VA 3P0FA 3VJRA 2P9CA 3EXEA 4KSBA 2FZKA 3NDRA 1GEGA 3LG2A 4EF5A 1ADJA 3COPA 3F7MA 4ARVA 3AM3A 3E1KA 5CJ2A 4B7XA 1YFZA 4JI5B 1HNNA 3PQ8A 4M1ZA 4KN8A 5ARCA 1OFVA 3U9TA 5FH9A 2VN8A 4LHZA 4URFA 1Z28A 2DPXA 2X3FA 3OMXA 421PA 1W7AA 2O1WA 4KSYA 1ONBA 1Z75A 2KM1A 4TRNA 2ZI4A 4ZAZA 1PX2A 1XEAA 1MR3F 3LKVA 5DN6D 1L1RA 1BO6A 2GBPA 4ZAXA 3OPVA 1TT5B 2XD9A 4M0EA 4PWYA 5C8ZA 4OI4A 4BO2A 2BGRA 2WUEA 4KMSA 2BV3A 1W4BA 2WUWE 3W1WA 1FXWF 3ETLA 2Z3VA 5KNBH 4MGIR 3TBFA 1W85A 3OWOA 1CNMA 1FU8A 1PHRA 2VPWA 1RADA 3E3OA 3TNJA 2R97A 4OHBA 4EZBA 5KREA 1GZ5A 3PUVA 5EHNA 4A03A 2E18A 5AR1A 2VTEA 2E4WA 1OAOC 4MB6A 5K4HA 3EXFB 4EYOA 3EXIA 4FW8A 3RVRA 3VOSA 5L7TA 2FN3A 3LUAA 2IKSA 1BRTA 2Q2NA 4M7RA 1V8DA 4RA6B 3D81A 3PNBA 4JEUA 1JYEA 2IOFA 2QGFA 2UZ1A 3BG5A 3GD7A 4LYJA 5CYFA 4MVJD 4RD0A 4C4ZA 2H2AA 3L07A 4FCTA 1EWRA 1R6UA 2OFXA 2FKNA 1C8BA 5TDHA 2WLSA 5F3WB 1B4DA 1IHYA 4QG7A 1A1SA 4K9RA 2OBMA 5AVTA 3W8RA 3T61A 1DAOA 1ZVVA 1SKYE 2CXHA 2XAUA 3JQEA 1NYQA 1TC1A 4TVSA 4JX8A 4HWPA 4UHEA 1M6EX 2QL5A 3GLKA 1Z5OA 1ZRMA 3SYLA 4J76A 3SX2A 2GWHA 2CCGA 3LKDA 2NU7B 4OGGA 5LN1A 1DCTA 1S2OA 3OJWA 1FRVA 3A28A 5HQJA 1A9ZA 2FFAA 1LH0A 4OJMX 3TGPA 3T94A 3IA7A 2BFPA 4F91B 4BMSA 1M7GA 1SB9A 3KT0A 4NESA 3ESDA 3WQBA 3MWFA 1ESEA 4G97A 3IQWA 1U2GC 2SHKA 3O21A 3Q1LA 4OQFA 1L9KA 3EIQA 5DB4A 3QIVA 4LWOA 2O8BA 2REXB 4G8JA 3B5EA 1DT5A 5C1IA 2HMSA 3K1AA 4HB2A 3H2HA 3M89A 4OBWA 1I2ZA 2PIDA 4U7PB 5ALRA 3ZH9B 3AKZA 1XAIA 4KIJA 2I4OA 4DLXA 1LBQA 2WWHA 3LWDA 3GNTA 3FYTA 4GX0A 1QX4A 2HI0A 2JA2A 3HKDB 4II7A 1YNOA 3A1TA 3QUAA 3TZCA 4MARA 3PR3A 1DQZA 1NQVA 2VJKA 4FCCA 1NURA 1VZ3A 3DLIA 4JL5A 4ESHA 1MXHA 1CT9A 1VJ5A 4HB0A 2QTNA 3GZNA 3KEMA 1TTTA 4BXOA 4J4TA 5EJGA 2HIGA 2XLCA 5GZ6A 3SHQA 4X3CA 5IYZF 1E4EA 1EE1A 3LCVB 1U2SA 4BGDA 1UZUA 2PK3A 5EXXA 1NT4A 1Y7HA 3FPJA 5AK4A 4YRBA 4ODIA 4JOBA 5HRAA 4JJIA 3N7TA 1QFSA 1SVOA 1OIWA 4CGYA 4W5NA 1ZRSA 5CBPB 4TVOA 4AUEA 1EH5A 2HJ9A 5ERYA 1GZVA 1H2XA 1TGYA 1KJ9A 1E9VA 1TJNA 1KZ7B 1ZPDA 2YFKA 3N0WA 4V0ME 3WK7A 4P0TA 3CPEA 1PT8A 3HCCA 3MUFA 3QOFA 3E5MA 1Q74A 2JLQA 1KWGA 2QT0A 3MGGA 4Z9XA 4MV0A 5COBA 1HV8A 3ADOA 1XEWY 3IDOA 4M4SA 5EQJB 4C0SA 1Y5MA 3N87A 3DFIA 4NJMA 1JE0A 4JSYA 1IAVA 2GM5A 4XWOA 5HRUA 2ROQA 3JPWA 1IHUA 3KPVA 1SCBA 5TEVA 1U3UA 4C5BA 2OXIA 5KTPA 4Y9RA 4P4GA 1UJMA 2A67A 1PWHA 1K9VF 2G5PA 2TYSB 2XUPA 3GPDG 3SSOA 2HA6A 2JGDB 4GQIA 1H1TA 2JG3A 2GKOA 2HQBA 1E2MA 2CMKA 3PICA 5T64A 3BIWA 4IIJF 3OPMA 1P7PA 1GQRA 4KX5A 2FR1A 1D6MA 2JLSA 3H8WA 4MSUA 4ZU3A 2PA0A 4JLDA 4LDPA 4UUPA 3USCS 2MJLA 4GKAA 2NTVA 1QRTA 4M83A 2VPYA 2CKMA 2ZJ2A 3DQPA 1C4XA 3PLAE 2XB2A 4Z4FA 2JGKA 4KZPA 3RGWS 4C4TA 3PLRA 2IZ1A 5BRJA 3O73A 2B78A 4N3AA 3IP7A 1ZN2A 3P2OA 2QVLA 2ZTUA 4I9FA 3LOPA 5E3IA 3S99A 2ATIA 3B7GA 3C43A 1XR3A 1XSEA 4YA6A 5TS2A 3FTCA 2VATA 2ZYUX 4Z3OA 3PFHA 3H2BA 4MVJF 4AKEA 4NX2A 1M5UA 3OBBA 1N36B 4DA9A 5BURA 5IX8A 4ZYYA 2WOOA 4NBRA 3OF2A 4FYJA 4XRGA 1SR8A 3DTVA 1C1DA 1Y9DA 2YN4A 2IH5A 1SOAA 3K32A 1XTRA 1DC8A 2D2EA 4YJ3A 4I9HA 4ZVVA 5CITA 1H2AS 1TM1E 3ZI7A 2XQKA 2Q99A 3R8CA 1K27A 4ENVA 1NVBA 2M1ZA 4G41A 4NZMA 4OXKA 5HHTA 3NFYA 1TT7A 1G3RA 1MB3A 3RRNA 4D74A 4BMOB 2OO5C 3A7DA 1OMOA 3NGMA 2A3RA 3Q5EA 4FS3A 3GLHA 2G9NA 4ZHSA 1M8JA 1ST2A 3ZR4B 1Z2PX 4J0FA 2JCGA 1A9YA 4IDFA 3ISTA 2QJWA 4FWTA 5DLQC 2GF2A 4JBGA 5IJ0B 1XT6A 3MHPA 1Z0AA 5M04A 3QKRB 5LP6A 4AZVA 1S8AA 4V0RA 3ZLBA 1JJBA 3COZA 3H0EA 3DAYA 1FFXA 1TQDA 3QI2A 5NLLA 4KYTA 3R0QA 1OFUA 1T9GS 2RGGA 4EHNA 3TG2A 3UT5B 5JZMA 1Y0BA 2Q0XA 4CLEA 3MRTA 4UAJA 4C1BA 5L3SA 3K1TA 5DBGA 4FDTA 1OWOA 1I4TD 1PDOA 1DP4A 2GK4A 2NM0A 3JSXA 3PQ2A 3TPCA 4D2IA 3ER9A 4X45A 4TLEA 4RE6A 3DYIA 2IHTA 4P7BA 5A7GA 3CLTC 2OXTA 3SR3A 2F4NA 2JVKA 5DRYA 5EP3A 1W94A 4BN0A 2FZVA 2SNIE 4ZJYA 3D0QA 3K15A 4R3UC 3UKOA 3VXKA 2HYIC 3ZW8A 5IF3A 3CM0A 3TLXA 1JQEA 4FHFA 3MRSA 3U3RA 2PUJA 6ABPA 2ERCA 2XTZA 3NLLA 2RIRA 1A96A 4YVFA 1W48A 4MVCA 3QX7A 2NVUA 1LPSA 1SEVA 1SVKA 4CCWA 2Q3HA 3ZY2A 1C0KA 1H8ED 1ULBA 3RRBA 1X7XB 3WLLA 1X7DA 3FF4A 2M32A 1H2ZA 4C88A 5K51A 4J2OA 2I2DA 1II8B 4UBLA 4XYBA 4CM4B 2NU6A 3G5TA 2JZCA 5H4HA 3WTCA 5JFOA 3HXKA 3D1VA 3O3MB 2QXYA 2BJHA 3SS9X 1RBYA 1R9NA 4LEIA 5KWIA 1QGUB 3S7ZA 4MKFA 2ZRIA 1GSHA 2FPIA 2EP5A 3LTNC 1EDDA 1Z7WA 2C5FA 2CL7X 4Y2GA 1FX0B 2GNAA 1UBMS 3GUHA 2KE5A 4O08A 4Q3DA 5JCJA 4MUAA 5F77A 2AZ4A 1BD4A 2P62A 4HNAA 2V6IA 5FAXA 1EPUA 3FPKA 3FDZA 3RT9A 2WKQA 1V1MA 3ZZTA 4I9UA 4WKBA 5D5HA 4PQRA 5J4LA 1RNLA 1MH9A 4GOKA 3PD7A 5TB5A 4UTVA 5LQRA 4LCJA 3R74A 3EZLA 2ZRDA 4IS3A 1RZRA 3DF7A 4LVUA 1VL8A 1ZGBA 3M82A 2N42A 3A26A 2VUUA 4QJ4A 2DBYA 3JTMA 4CRWB 1ZONA 3F3MA 4FMCB 2FZ4A 1V1JA 1SELA 2IYLD 5DT9A 2PQMA 1JHQA 1MQSA 1Y82A 2BF4A 5DSZA 4C01A 4DEVA 3A1NA 3BF7A 3AUUA 4ERNA 2O23A 3DOHA 1Y4ZA 2QTHA 4QOIA 5AJTA 2C3UA 3T3MB 4NARA 1G60A 4EEKA 1NVEA 3AUTA 4HLUC 3WYCA 3Q8MA 1R6VA 5DCWA 4O63O 4CU2A 5K8IA 1UFRA 2WA1A 5EMJA 2V7TA 1AZWA 3PC8C 2P9TA 4GMHA 4O5AA 5CLFA 1EUQA 2HEIA 5IAGA 4CLOA 4RAQA 5INTA 1N25A 2AS0A 4RH1A 4IWYA 1AMUA 4B6RA 2RCYA 3IPXA 3GMTA 2IEBA 5CNKA 4D8TA 2A0YA 1DZ3A 4FB5A 2X5XA 1VCHA 4P4SB 1B7GO 4ZVTA 1ZK1A 1BJTA 5JNWA 3GLQA 2GTPA 2ZYDA 1G2QA 1DJLA 4PBRA 4DYVA 4MGKR 4BQRA 1S3SA 3FTPA 1PSWA 3U7RA 1OI2A 1NU8A 3BMCB 4LQCA 1DIHA 3MS2A 3I8SA 1H3NA 2PZLA 2OD2A 3MWLA 4M38A 3QYFA 2QN9A 4X0EA 4XR4A 3VAAA 1MT3A 1NNI1 4AF8A 2HCTA 1AV7A 1KAGA 2BF7A 2ECFA 4YCDA 4IG4A 4Z0NA 2ZCVA 4BZPA 2WHQA 1PJ3A 4EEZA 2WYUA 5CDGA 5AUPB 1B8VA 1UOEA 3DONA 2C7QA 4KW7A 3WVNA 3WYNA 5FX2A 2AJBA 1OCEA 2X41A 1L7VC 2A9VA 5EWLB 5CB0A 1OI4A 4IXWA 2QENA 3RASA 2WAXA 3MCUA 2LPMA 4JJEA 1U0GA 1VYVA 2XCQA 2ZU0C 3D9QX 1DBVO 1T0IA 1J0AA 1VHJA 5A4MS 1G7RA 1QH1B 1ZBDA 3ANTA 3K72B 4J29A 4DIDA 3T1YB 2XYPA 2QUKA 3V4OA 1A27A 1BWQA 4A73A 3RVDA 4GT1A 1WBJB 3GI1A 1M2EA 3CUYA 1IOZA 1Y3IA 4HQFA 1DC6A 4IIVA 4OOFA 3KZMA 4XJVA 4YRFA 5JAIA 2OHJA 3JQ6A 1B0ZA 4KIFA 1BVUA 2CFCA 1E1QA 1Y3HA 4GZ5A 5ISMA 3OPXA 3DBRB 1CC1S 3A1EA 1ZLXA 1RM5A 5F2KA 4GPEA 2WJGA 3ANNA 3HXMA 1QFYA 4YB8A 1N75A 4KHPB 3LPCA 4IHJB 16PKA 1KJZA 3IUBA 1GRQA 1YA8A 3WLTA 4AMUA 4B76A 4F1KA 3CV3A 3KXKA 2O8FA 3QPUA 1FUEA 5ALZA 3WYGA 2Z2JA 3ZC3A 4EKYA 3WBBA 2I7XA 2GZHA 3VBEA 1DARA 1UBKS 1XVIA 5ERGB 3HZRA 3EDCA 3A3PA 3RUIA 4F92B 1H5UA 3KCQA 4JC4A 3T4UA 2BYTA 1PR2A 2QE6A 2I6SA 4JELA 3T12A 5HQTA 3NIWA 4G1FA 4WCDA 4WK6A 1A72A 1ICIA 4WV3A 3VNVA 4RMJA 3QU7A 2V54A 3VI4B 5EJ6A 1H8HD 2D4HA 3AR2A 1I0IA 1MP0A 2DHDA 2UKDA 5CLJA 4I5GA 3ZBTA 3RIGA 3EGXB 4D45A 4WFJA 4ZVOA 3TW0A 2Q5IA 2QTZA 3ONWA 1XMJA 3PIRA 5ECDA 3SQDA 2WAYA 4PZCA 3LLUA 2J0UA 2V7WA 3K9LA 5FWYB 1KEUA 1YC5A 3WO0A 5KNBA 2VWQA 4WBNB 1CEQA 1ZH4A 1WPRA 1NBIA 2XYGA 1B0AA 1SXGA 4XDGA 3V1TC 3VVBA 1RBQA 3CC8A 3HWRA 1IRIA 4O4IF 4UUMA 4D3FA 5JTTA 1I2AA 2PUBA 3NQ41 3CUTA 4V3CA 2HHJA 3S1AA 3WGVA 1VL0A 2O1EA 3R0IA 3O3NB 3IP1A 3BE4A 4WGFA 1OFUX 2P6MA 5C2JB 5IN4A 1PI3A 2VCYA 3NGLA 1MT0A 1Y4DE 3VR3A 3ZBPA 1R9MA 1WEHA 5BT8A 1GTRA 1WMFA 4LRQA 1SCJA 5KTKA 1R5BA 1XPUA 5SY6A 3K94A 1N1MA 1XDBA 2HYDA 3IDZA 1U6KA 3PGMA 4L85A 2J59A 4ZOLA 5AKGA 2GM4A 1DKOA 2O8CB 4GXNA 3GAMA 1EWTA 4Q3KA 4RSHA 1MN6A 3BORA 4RS4A 4A27A 5EQDA 5EJ7A 5I8PA 3KXIA 1T9BA 1QG4A 1ZIPA 3K53A 1V2HE 4MYDA 4U2GA 4E08A 1VL5A 3FHLA 3OICA 2PMBA 5ENZA 2J7KA 1F9EA 4OBBA 1IBMB 2K7FA 2DHEA 4KCGA 1YQXA 3RIEA 5IEJA 4LY9A 4OGFA 1N1EA 5LU8A 1ZY2A 4P86A 2OHHA 2YJZA 4UNSA 4D4MA 5K0JA 3LC0A 1IVNA 1CS0A 5LSAA 4ZT3A 4IIHA 1IB6A 3SX0A 5KYGA 4FHDA 2WZCA 2IZZA 3V1UA 3UNXA 5B2FA 1U2DA 3L7MA 4DABA 4I08A 1V8ZA 2QUHA 4HGYA 3O5AA 4GGMX 1MG0A 1OFHA 3LL7A 4JBWA 1TZ2A 4IG9A 2AXNA 3FPLA 3JZMA 2VQ6A 1Y8ZA 2AI2A 5K2OA 4LC1A 5CVVA 3W6UA 4PRYA 2MTBA 3UHOA 1KJ8A 1D9XA 3EX7C 3O8BA 4NABA 2VP9A 2O05A 2RC6A 2XW6A 1A4XA 4NBLA 1UPCA 1A77A 4L5YA 5CLIA 1E6LA 4KPFC 1QP0A 1OI3A 1VHDA 4DSOA 1LLDA 1AGXA 2WPDA 1X8XA 3EEIA 3PGJA 3FNHA 3RV4A 2CHUA 4BO3A 1KQFA 1MVOA 5KX5A 3OECA 4AB1A 2PVCA 1Y5RA 4FKMA 2VYQA 1I36A 5T4EA 4AYWA 5KVSA 2JJ2D 2COEA 4TL7A 3NW9A 4TTTS 3VU8A 3CEMA 4X64B 8MHTA 1E89A 3HJNA 4ZANA 4KAJA 3EUFA 4JT8A 2Z2IA 2QYTA 5KTYA 4BNYA 3D2CA 4PY2A 2ACKA 3EK2A 4Y2VA 4Q18A 5CB4A 2VDWB 2I3GA 4AWXA 4CW7A 4ZO7A 1KO8A 2OM2A 2POCA 3FKSA 3N2IA 4I81A 4LI0A 2HAEA 2F8MA 1N9KA 3LQFA 1MAAA 4EPYA 3WIBA 5IFKA 4BL5A 5FHRA 4G81A 2XOEA 2NX2A 1JG4A 2WC1A 4JP3A 5JH7B 5KJFA 4MW2A 4BMNA 3AM4A 4X24A 2XNJA 4ZK6A 3AB7A 4IF6A 5SICE 5F35A 4OEHA 1R4ZA 3IPLA 1NR7A 4DTCA 2XY4A 4GX2A 1SA0B 4JLOA 2XE8A 3I28A 2ZATA 4C04A 5LC1A 2AZXA 2H6EA 1KORA 4OQQA 4ZC1A 3PDWA 1N6PA 3BAZA 3QTBA 2RBKA 4EUFA 5LLDA 1QO0D 4G5FA 2BMJA 4DV1B 1FFHA 1EX7A 3BUSA 1CNEA 2GPYA 4KQWA 1QQAA 1PQWA 1RI2A 2B92A 2MIIA 2ZB7A 3ENVA 2J6CA 2KBEA 1TPZA 3GXOA 4JLSA 4LWPA 4BLQA 2B2XA 1Z9BA 4DS3A 3ZS8A 3AVVA 4OCZA 4FFNA 3ELUA 4AN1A 4UCWA 1NSTA 4Z5XA 4S24A 2YV5A 2WJIA 1R9GA 3JZIA 3NC4A 3ZLTA 4X65B 3DV0A 1U0EA 1JG1A 1OZHA 2ZIXA 3QHAA 1RAAA 3EC7A 4FIDA 1D4OA 1EAYA 2OHIA 2YINC 5DCUA 3ZDQA 1BS1A 1B1AA 1KFBB 5LD2B 4E3WA 4HYQA 3TX6A 4UTNA 5LP1A 3MK31 4AJ4A 3F5MA 1SUWA 3ZDBA 2UZ4A 2ZRKA 3RUPA 4MS4A 2ZBFA 1QONA 2E48A 2P8SA 4D6PA 1SCAA 4LCBA 2G80A 1QR2A 5JYEA 5MN6A 3NIFB 3IE0A 5AW9A 1TTHA 2YWHA 4LNAA 1EVQA 2A5FA 2Q1UA 2DHQA 3HJRA 3YASA 5DTRA 3GFRA 3WKBA 3OOSA 1WMSA 2BM1A 2ZYHA 3EXIB 5BSGA 1W36B 4NZOA 4L8VA 5EQTA 2P7HA 2XMZA 2QW1A 2GPJA 4TL9A 1OAKA 2AK3A 4JOSA 4C1NA 4BNXA 2E9SA 3ECSA 2OQ2A 4YMSA 1YQTA 1OX4A 1ADCA 1YCFA 5DO9A 3SXPA 4UE2A 4BNWA 1SN7A 3CE6A 3M6IA 4O6VA 4DCUA 4ZV7A 1MFPA 1UZLA 1II0A 2IZOA 5B12A 5K3OA 1BX0A 5BR8B 1MO2A 3PUZA 5B37A 3LJKA 3T1QA 1QMPA 3EAQA 3TTVA 1Z25A 5BWOA 4F7DA 1M76A 1Y81A 3OIWA 3RK0A 2A1UB 2ET6A 4XXHA 2A78A 1WSDA 4KGXA 4XB6B 3JATA 2EERA 3U44A 3MHTA 4Y1GA 4R7TA 7MHTA 1NRWA 2VAMA 1M1ZA 3C39A 2Z4RA 4IO0A 4DDUA 3AW9A 3MLBA 4INOA 3RBZA 1T2EA 4CI0B 4AUMA 4QDKA 5J4KA 1WJGA 1RQRA 2CJWA 3BXXA 2IQ5A 3S29A 3D0KA 5FCDA 1SQ0A 4JYMA 4KMOA 1RKVA 4R2KA 1KSFX 3TN7A 2DT8A 4TWBA 1TLTA 1GLVA 3EIXA 3GW8A 1B8OA 4G09A 4DMFA 1T6NA 3NWJA 3OZUA 4K0KB 1XF1A 1F2UA 4WI1A 4BVEA 4Z4QA 1KJWA 1O8BA 1K5HA 2RHGB 3A9CA 3HKCA 4P93A 3WMXA 2IEGA 5CFPA 1PT5A 1V8PA 1WW3A 3QMMA 3KTDA 5FWAA 4MKXA 1YCGA 3HBMA 4OQEA 1QCCA 5A3SA 2FQWA 2ODNA 3GVPA 2IUEA 2OCKA 3MPUA 4YP5A 2H2HA 2J0EA 3M1AA 3PNQA 1TZKA 1TQ4A 3G2HA 2WHYA 1FMFA 3RLFA 1LVGA 1YS1X 5M3BA 5LD2C 3TQTA 5AD1A 2AXQA 2FN7A 1E4EB 1E6CA 1QORA 4E31A 4ZJUA 1JNYA 2DH6A 1C1XA 2FVYA 1U7OA 1N9GA 2JKYA 2C54A 3A10A 4YH1A 4A3SA 1VGQA 3KSZO 3DMNA 1B3RA 4DXAA 1TVKA 3IMFA 2O2JA 3KC2A 3BL5A 1QP8A 1YF3A 3R0XA 3IEMA 3GJ5A 2B5VA 4M53A 4UBNA 5FORA 5CG1A 1WB6A 1NN5A 2FWIA 1U3TA 4J4BA 1VLMA 3THOA 3HUFA 1P19A 1LFDB 3VQTA 5DM70 3QE4A 3JTEA 4PZDA 1FDRA 3MW8A 4QUHA 1GFWA 1YCHA 1GAXA 2HSWA 2XCLA 2ONCA 1CUUA 3A6HA 4BKMA 4EGCB 3DLBA 1Y80A 2J6HA 1VP3A 3ASUA 5K3BA 5BY2A 3UJBA 2WWYA 3PP8A 5H81A 2VA9A 3L6CA 4KFCA 2QZZA 4R0NA 3VUEA 1DWPA 1N2CB 4C21A 4R51A 3DKKA 5ED0A 2XZLA 3MTAA 2BP7B 4US1R 4QBGB 2EIHA 3H1TA 4LCEA 5EGSA 2XQVA 4CEJB 4IQFA 2QG9A 4GX5A 2B20A 4CWAA 3QEAZ 4D3DA 3VNRA 4CKEA 1P0IA 1ZBQA 2UUPA 2NZJA 5F52A 2ZM6B 3I39X 3TFWA 3PC7A 3K71B 1BWRA 3HDVA 3IB3A 5HDQA 2IITA 4JXJA 4LYAA 1W5SA 4C4RA 4XLTA 1WS6A 4H4DA 4G0OA 4KVZA 3NHFA 2OXCA 3LC7O 4MUFA 1WZEA 1B1CA 3TSWA 4F9TA 1DOHA 3WK6A 1P73A 2YY6A 2R6AA 4KMRA 4DGSA 4JLKA 2WTUA 4M1OA 3WAGA 2EKBA 1EP2B 2ZI9A 3EMKA 4AMBA 4ZZ3A 3QU2A 3I6BA 4B4OA 2O0KA 4JLBA 4DCCA 4LKOA 4IJMA 4FX2A 1TAGA 1PG5A 3GH1A 1LDEA 5AVWA 5JDCA 2RGYA 3HR4A 3OZWA 1RP7A 3MUOA 3K3PA 2BL4A 5K3DA 4UM7A 3R9XB 3LCCA 1E9EA 2Z4TA 1IUOA 1GYRA 3QU4A 4YJ2F 3RADC 2LE0A 3QG1A 2YOHA 1WZCA 1C81A 3FHCB 3KWJA 2F1HA 3E7DA 4QOHA 4YJ3B 5B55A 1FXWA 4JEMA 1Z4PX 4X92A 1W2GA 5D84A 5BSUA 3DMRA 4GMGA 2PMEA 4B09A 1K5GA 3BT7A 5GOZA 4PNPA 2QPTA 5I9TA 4JD5A 2J33A 1CJUC 4B4DA 5SYMA 5TIIA 2SBTA 3OT5A 2E1RA 4PXAA 2NUBA 3C5CA 2OC4A 3L1JA 5IT9A 3OFJA 1C8LA 3ZJTA 1ODFA 3G8DA 4PSDA 4R2IA 2CDRA 3DFKA 4U00A 2R3SA 1XTTA 3OZVA 3P27A 2WD7B 3I8OA 3L41A 3QV1A 5LP6B 1FYDA 1Y5LA 2X8WA 3H7AA 4QOJA 3Q3GE 4FYYA 4O2AA 4HFMA 4HPJB 5DSXA 3V55A 5D1NA 3CSSA 3M4NA 4EATA 4PG4A 3SR0A 1H5QA 4ZPJA 3S44A 1P8AA 3LY5A 3HG7A 3D0OA 3VC3A 1RLOA 4RENA 5L3SB 3TOSA 3COJA 1Z7EA 2OESA 3PGXA 1M0SA 2WWWA 2ZJYA 3CUKA 3KYDA 3ZV7A 1WUKS 2W6IA 2E4VA 3HDJA 1T6BY 4I6EA 3IAM6 4EL0A 3H9CA 3OAAA 4Q4LA 1P7YA 2OECA 2VRCD 5FIUA 5G0VA 4MHTA 1NZFA 4RXTA 3ENKA 1LDNA 5KYXB 4H6XA 3BMNB 4TZ6A 3HWSA 5G40A 3JARA 4JXZA 3NUQA 2H1IA 4W5RA 4S0ZA 4IDQA 5CFOA 4D6XA 4KLCA 4KVAA 3J80A 1VJ1A 4P3OA 3PD1A 2BMAA 2V59A 2XH8A 4PC6A 3UXHA 3T5PA 3AHEA 4MYCA 3I9MA 4GM0A 3S4YA 1GKIA 1OHHA 2NVUB 1LUAA 4AF6A 5FFFA 1OLSA 5JT1A 1SH7A 1E2DA 1XQ1A 2HU2A 2NZXA 4PSUA 1FJHA 4A15A 2ZANA 3A11A 2WABA 4K6OA 4TYWA 4NU8X 4YP7A 1U8AA 3NVMB 2A35A 1X7YA 1DLIA 2F1OA 3WE7A 1XQXA 4N39A 1EQAA 1KKMA 4G86A 4JLUA 2C3PA 1RWWA 2EJUA 3AV0B 1KY2A 2AX4A 6REQB 3I2HA 5KS2A 2WU1A 1OREA 5LFAA 1FFBA 3MPOA 4LXIA 4TKVA 3IMEA 3C97A 5BWCA 2V6BA 1EIWA 1X1TA 4R81A 1Y3CE 3DCYA 5ALXA 1IAQA 2ORIA 3HKEA 2KI5A 3HEMA 4HNAB 4ZOBA 5AJHA 3VMMA 4BS9A 3FDZB 1ZN9A 4GDMA 1FDOA 3PHIA 1V1MB 1V11A 3C6ZA 1UKEA 3AR8A 1BZYA 3RS3A 4J0HA 3Q40A 1F5SA 1PUJA 1QDUA 3GT0A 4QAJA 4OHUA 4F84A 2A3NA 9ATCA 4CMEA 5ILQA 3IT1A 4TT3A 5ICEA 1UXJA 1SC1A 3TXXA 5JISA 1E6UA 2AMYA 2GARA 1FVOA 1LW7A 4HZUA 3AF3A 2A5GA 2FFQA 4B87A 3GCDA 3W8NA 4CU5A 4EKDA 5L95A 1J21A 3FPSA 1YASA 3E8XA 5F2OA 4OH7A 1VCIA 1JKJB 4RYDA 4XSVA 1VL1A 1DC4A 3B12A 1M1XB 4GI7A 3N7AA 4D0GA 4S2EA 5DN6A 2D2VA 1Z5WA 3ZKWA 2FN8A 1JMKC 2SCUA 3I3SR 121PA 2NO1A 1DFHA 1KQOA 3P9CA 3TNDA 5F98A 2IL1A 3WB1A 4MP8A 2AUMA 2QUBA 4WFIA 4IIJA 4ND8A 1O9HA 4GZ6A 2IH4A 1SOMA 2PS1A 2BUCA 1GGMA 2NT4A 1JWAB 1W96A 1KAMA 2RGBA 3DMHA 3AK4A 3ZOKA 1WF6A 2FWMX 1ZJ5A 4K6CA 3TOZA 4JI2B 3TNFA 4WCFB 1FQWA 1B16A 2LR0A 2VIIA 2Q7DA 1J2RA 1U8UA 2FRDC 5KNDD 4DWVA 3E9NA 4XJTA 1UR5A 3TZ6A 1WM1A 2WTEA 1SVIA 5IT5A 3HJAA 2V7VA 4GOLD 3NBUA 4HSGA 4YV7A 2G5GX 3H99A 1GUYA 5AVUA 2AYXA 4QHSA 3L92A 3N2GA 4LE2A 2CV2A 4HDQB 2YV4A 4KR7A 1E2NA 1JUDA 4K40A 4PG6A 1JEOA 2WP0A 3SEZA 3BERA 5BYKA 3E9ZA 3BWEA 5B3LA 2QT9A 3V2UA 3RDPA 4BNHA 2A4KA 3KLNA 4WZAB 4UEQA 4YXWD 1EK5A 2VHTA 2YFQA 3N7UA 4FR5A 3TINA 5GJBA 3PDIB 1A3CA 3QI7A 4PSKA 4UM5A 1OXUA 1YK0A 5E7JA 5E9AA 2AN5A 4A0FA 3ONVA 1S2NA 3BMXA 4MV5A 5CAEB 4GC5A 5IVHA 4MVJM 1DFIA 3TBKA 1OVMA 1HEUA 5ESRA 2P68A 1S4MA 2XNHA 4I46A 3ZV5A 3CRRA 3GUCA 4J16A 8ATCA 1ODIA 4C2BA 1G4AE 1V7CA 5M29A 2BHNA 2D5BA 3K4HA 3B6KA 4HJXA 2FQXA 5JAHA 2YV2A 4FEEA 1LGYA 4JR1A 1S8NA 3EOAI 4IRUB 4DCOA 1NQWA 5B1HA 1L0BA 5DEOA 4CXMA 4L95C 1RYHA 1ECCA 3PG5A 3QRWA 2X7HA 1D6JA 4GOND 3WX0A 2AT1A 4LJKA 3T3HA 3C16C 3Q9SA 4AN0A 3FLAA 2W0SA 3SZUA 5IZCC 1ORVA 1GUDA 4HQKA 4OY3A 3PHJA 3UUEA 4U1RA 3L9WA 1ZCFA 1RLTA 4XARA 3C4JA 2PD3A 1SCKA 3OJ0A 5YASA 3JQBA 1IYZA 3KHKA 1P1BA 2B1GA 3QXJA 5K01A 5BQOA 2JLCA 2Y27A 1ZD5A 3IDQA 3O95A 1A0OA 3FWNA 2A0KA 1VYHA 4GBJA 4XDHA 5AHRA 1S89A 4DNQA 4ER5A 4GDFA 1MJFA 3T1HB 3NTRA 2P75A 3V80A 1Q84A 2J87A 1Q7TA 2CHEA 4LECA 1D2AA 2HL6A 5CVUA 5AI8A 2XVMA 3F9CA 4MP6A 3KSBC 5BR4A 2ZSEA 5TS3A 1GT91 1X80A 2H52A 3JS5A 4AWAA 3PD0A 3FY4A 3KQHA 1V3QE 3KT6A 2WWXA 4IEFB 4QDOA 1RU3A 4DL9A 3J81k 1AA6A 4ZEWA 1NP6A 1RYNA 1SHUX 1B74A 5FPHA 3A70A 1SZCA 3DTTA 3CZ5A 3S2ZA 4KJZA 4OX9B 3T9DA 3B1FA 4G5QA 3OEHD 3ZNQA 5B3KA 1VSTA 3VNUA 4RO0A 3FNQA 5KOJA 1G0OA 1C1YA 4F2DA 2RHOA 3H13A 2UZ0A 3LO8A 2BHTA 2JLUA 2I29A 1QRRA 2BAGA 3H16A 5CK4A 4OP2A 1HYQA 2FJPA 2EW2A 2JEOA 3KVOA 2IWHA 1JDVA 2XGMA 4ZOLB 2HOQA 2EZ9A 2QTFA 3HY6A 3LW8A 4JASB 2F8SA 1BMDA 1K7CA 2O4UX 1GNRA 2GM3A 1D2GA 1GCGA 3HYSA 3OVMA 4FI3C 3MAGA 4Z53A 2IYXA 1Y37A 2GN6A 2W8BA 5DNWA 2CUKA 1DQNA 1NM5A 2B3DA 1QANA 2ZAMA 4LPSA 5H59A 1NPYA 4HYTA 4RF3A 4B80A 3UH0A 2CXRA 1FXUA 2C4MA 4H1WA 2BGGA 3A9UA 3QQ5A 3ROMA 1TM5E 5DHSA 3OFKA 1L1EA 2IIBA 1OFIA 5FL7A 3TQHA 4ASUD 3EARA 2E1PA 3U6BA 1CS0B 3R7AA 1H2YA 1VM6A 4AJIA 5CA1F 2M6LA 1NBOA 4D3XA 1NBMD 3B3JA 2Z1NA 3EQ8A 1CRWG 3GUVA 4TXNA 4XR9A 3K9WA 1H4VB 1HDGO 3ADPA 3V2GA 4D98A 1JIIA 3AKEA 1G21B 2BIFA 2V45A 4HBZA 3KVVA 5HBRA 5IAEA 1E9SA 1VPTA 2KWIA 2MT9A 2XRFA 3KU4A 3OCWA 4H7JA 4YP6A 1U2PA 2QJOA 1YJXA 3RUDA 2CZGA 3WOVA 5H8WA 1QV9A 1JHYA 5JEEA 3PI7A 4OK5A 2OCDA 1DC3A 1RHUA 2Z95A 2NO7A 2EBWA 3GX1A 4DCSA 4BB5A 4LXUA 3P9RA 1I4LD 5LQKA 3QK7A 2VHUA 3HZHA 1VIVA 5CJPA 4OUKX 5C9ZA 1C3OA 3LRTA 5ELXA 1YB1A 2V97A 3OQBA 4FDAA 1J09A 4KEAA 3UC5A 3W7AA 5A02A 1RWNA 1K06A 4QLOA 1NBAA 4M0MA 4TMKA 3WFJA 4YRAA 3ZV4A 2N47A 3DMTA 3UAYA 2Z8YM 4DYHA 3IGFA 2FW8A 1HZZA 1S8OA 2PMCA 4X63A 4F38A 3E9EA 1L4UA 3VNSA 1IN4A 2JZNA 4BVGA 1PJ2A 4RD4A 4DW8A 4EVQA 5KTTA 4L4RA 5LMZA 3HXPA 4LMBA 4KRYA 4JENA 3WJAA 4PCLA 1RPTA 1XFAA 1OPXA 3B52X 1SQGA 3FCAA 3EVDA 2OGWA 4QFDA 3U1TA 2HSEA 4WDQA 2HRCA 1GPWB 3OIFA 5L3VA 2GPTA 3AUSA 3CF6R 2HHAA 4Y6GB 2PBRA 1EFRA 2RG7A 3IOEA 3I4FA 2CFOA 1KWKA 2CNNA 4UVEA 4PVCA 1WA5A 4LZJA 2OUIA 4GOXA 3REQA 1XLTA 1G66A 4FEGA 1F51E 4QUGA 1YJBA 1JFLA 2YWFA 5ALTA 1CY4A 2VYCA 3EIFA 2YIVX 1J1ZA 2H1CA 4N5IX 5AW5A 4J91A 2GA8A 4UDXX 2XAAA 4FWBA 3NEYA 3PJEA 1RJEA 1J70A 1JHMA 1A2OA 2XMSA 4RD1A 2CLSA 3FLEA 3MTDA 7MDHA 4WK0B 3W7VA 2ATXA 4DEXA 3OT4A 3DNFA 4KH1A 5IWAB 4MMYB 4MWCA 3WB9A 1ISRA 5EKSA 3KEQA 2YJGA 2L2QA 3LK7A 2PZAA 4GQAA 3TQOA 4TLLB 4B3GA 2P27A 4RA9B 1PDWA 5G4KA 5F7ZA 1VG0B 3KJEA 1OW3B 4Q01A 1GR1A 4XGRA 4B2IA 4XWKA 1R6DA 3QVJA 1KY4A 1XQVA 2V7BA 3PQ6A 4MPJA 1IQRA 1H8EA 1RTKA 1TQ6A 2P5YA 2PJDA 4BQFA 3PNVA 2ONKA 4HDAA 1RQ7A 1CY2A 2QQGA 3K1ZA 1TI7A 1U4OA 3DUWA 4FGJA 4J94A 4KO2S 4R2XA 5LDDC 5LQJA 4LF7B 3BD7A 1W6UA 1GAJA 2RB4A 2YJ6A 1FLVA 4NICA 4GI3A 3VRHA 3M6FA 1GG9A 2JIDA 1Z68A 1PP4A 5A1JA 3QLVA 4JVLA 1MC8A 1SD1A 1IULA 1KSHA 2GCOA 4XA8A 4YUYA 2H1OA 5I8WA 1NDHA 4UFNA 3ICOA 8GPBA 1TVCA 3BE8A 1RC8A 3P9QA 4A2PA 1CQJA 1WEKA 2XGJA 1V8OA 2DPYA 4ZZ0A 2NSYA 2WK1A 3B51X 3I05A 2JGJA 1T9DA 4GHWA 3OJFA 4DLBA 5KVVA 3G2MA 3SFZA 3LYHA 1JJAA 4HEQA 1NV9A 3VYRB 2HT6A 1JLKA 3J7AC 1LTHR 1HK7A 1FUUA 3Q7TA 1RZ3A 1YB2A 3LFTA 4LGMA 3LF1A 2FHSA 3VGPA 2ZDGA 3KHTA 4B3IA 2JI9A 4RNDB 3DOFA 4JC8A 4A5SA 4QYIA 4O4IA 1HYGA 3ZHVA 3QELA 4JC5A 1P6QA 2PZMA 2WICA 1XDZA 5JNLA 5A7FA 1XZBA 2AOVA 5BOSB 3PNPA 3S81A 4YCMA 4KREA 3PHCA 4UEJA 4QARA 4HH0A 5I7EA 1Q15A 3U44B 3JATB 4FZVA 4X6YA 4LVNA 3QFSA 5J2UA 2QROA 1G18A 1V1RA 1RXWA 1WQ3A 1OBOA 4TLCA 2G6BA 1K4YA 1UP7A 4EY8A 1ORTA 2B0JA 1BNCA 1N3IA 1KH1A 4OM7A 4CFSA 1I4DD 1U8CB 4FE4A 3HYTA 1CB7A 3DMFA 3AKCA 5KYVA 1USUA 1O6FA 4NWIA 1VHTA 1ABEA 1LC3A 3NFRA 2ZSHA 3AUJB 1Y7IA 2Q1TA 3ENWA 4UU8A 2XCOA 4QTTB 1Y1LA 3RTGA 4ZYXA 1A76A 1IWPB 1HE2A 2PYDA 5HMMA 5EXDA 2AGVA 1L4KA 3MWYW 4H0NA 4ZQHA 1E1LA 1NXSA 3HKCB 5LBUA 5TPWB 1U90A 3ASYA 1B26A 4ZIRB 2IFTA 3CVYA 1O95D 1T9KA 1XZIA 4HH3C 4LYGA 5DK6A 4DJDC 1LPNA 3DE3X 5HK8A 4YQEA 1QLHA 1V5GA 3T4EA 1ND6A 1IHPA 1MZPA 4JU9A 2GN0A 3NH6A 2C1XA 3V1KA 1XTIA 3HUUA 3JPYA 3MFQA 3WK9A 1WUHS 1I7LA 3A06A 4Q4AA 3LE8A 4EJSC 3AG5A 3T52A 2WKRA 1DQRA 3T0GA 2NG1A 3NX4A 2IVFA 3AFMA 4GLBA 1YHYA 5F4BA 1N2GA 1T9CA 4DSUA 5F2NA 1PT6A 1B6GA 2NSDA 1CUDA 4BU0A 3QUBA 3M4JA 4DPMA 2XB9A 3WGQA 3K9NA 3R5XA 1C3VA 4RFSA 4QGAA 3B60A 1USIA 3BGOS 3CR3C 1DTWB 4M0LA 1LPPA 1OBVA 4F8JA 2ZIFA 4A2CA 4ND4A 4LX8A 2DBZA 3TM4A 3D4LA 4ZHQA 1E9DA 2FWAA 2OFOA 1EFHA 1PJSA 2H0RA 1VHWA 3O1JC 1ZXXA 4BQIA 2XZPA 1D07A 1TDJA 1VE9A 3WWEA 5BSHA 2WJZB 3ZHBA 4TYYA 1UFKA 5EMLA 1JG7A 2ID7A 2Y2UA 3Q5DA 4E2XA 1Y9ZA 1LWNA 1ZDMA 4ZCTA 2Q49A 2W6CX 3OMLA 4K8RB 4XE5A 2JB9A 3AR5A 1L3BA 4KKXB 1U2TA 4MWSA 3T3PB 3T3DA 1DIAA 1UPAA 1XG5A 1UPTA 2H4FA 3M5CA 3ZVRA 2RJOA 3DNMA 1NAIA 3STYA 4C0BA 2WJJA 3MINB 4RQAA 3TLJA 2XR1A 2RK4A 1IJBA 4HLCA 4BE9A 3E82A 4TKUB 3RW9A 2NVOA 4Q1CA 4US0R 3UUWA 3GLGE 4HEA6 2C00A 1VL6A 5CDFE 2C29D 2ZSUA 2RH5A 1J9ZA 5ITZB 3H5IA 4XTRA 3H11A 5JJCA 1GA1A 3SXJA 5CU7A 1EGQA 4AN4A 4MB2A 1P61B 4CHTA 2WVJA 3E70C 1T3SA 3CH4B 1KI3A 2OGZA 5JSKA 1LI7A 2ZGVA 4OU4A 4BRWA 5K9ZA 1Z2NX 4ZZ1A 1DU4A 2Z6QA 2Q3CA 3I73A 3CEAA 4JLMA 1BHSA 4LRXA 2VTBA 4M9QA 2PRKA 4TMXA 1E3EA 1NRXA 2CLKB 1I1OA 2XYVA 3MUNA 3WDKA 4E5VA 4V1CI 1I8TA 4MULA 1XRQA 5CURA 3VTZA 1HC7A 3MC1A 1QIEA 4ER0A 5BRNA 1TO1E 4S1VA 5CFMA 3P2JA 2HO4A 1J5PA 4PICA 1ZCAA 1M2HA 4L74A 4TTSA 2CLHB 1ULUA 1KYIA 5TLSA 1JX6A 2V7PA 3T0FA 1EGAA 4HX5A 4QYWA 4L6CA 3HCRA 1GNLA 1LB1B 1OB2A 3F5FA 1VSBA 3KZXA 4ISCA 4W82A 2W4IA 5KU1A 4HDNB 3KQSA 3SP1A 5A0TA 3SHVA 4P8RA 5HVNA 5DKFA 1DXQA 3RTAA 2WINI 4TTVA 5GV7A 2CNDA 1YVDA 1ID1A 2A9QA 1LVUA 4JLAA 4Q3EA 5FUVA 1WZ2A 3QVVA 1WV0A 2YL2A 4JI8B 4J6FA 5E3HA 1RWVA 1YMQA 4JBIA 1KSJA 1B8PA 1DS6A 2ZJFA 1FYEA 3D54D 1E98A 3E9YA 4IJ6A 1ULAA 4E15A 5KWJA 1FC0A 2FJ0A 4QLAA 1CQIB 5EL0A 5EPEA 1KTIA 3TXYA 3W6OA 1FXSA 1SUIA 2WHEA 5G02A 2GPAA 1NOJA 2FDRA 2DWCA 1C7IA 5I9LA 2G4VA 5K05A 4NCKA 5DNCA 4UHFA 1CPYA 1DWOA 4OM8A 3THWB 2Z8ZA 1RPZA 3Q1KA 1EJ0A 2Q9AA 2YNMD 3FGZA 1W1WA 3CZMA 4MV7A 3Q0EA 4XOUA 1EU1A 3D1LA 3KYDB 3U31A 1BWPA 3BOSA 2HQOA 2O06A 1SMKA 2Z9DA 2ZWAA 4HD8A 3EXHB 2YFYA 3RR2A 2W5UA 4RF2A 1SOWA 4MUMA 4O4JF 4BVAA 3A9RA 3WWDA 1G1AA 1HDEA 1BGXT 1RQPA 3CVOA 5I9BA 4DIOA 3PFNA 1QYWA 3BCRA 3KQKA 2DRIA 3OLQA 4D56A 3MB5A 4D4GA 3GNQA 1A98A 2MYUA 4JUDX 1OB5A 2FMFA 3FTQA 1LK0A 1GSIA 2R00C 3KOZA 4RJTA 3PPYA 1XFDA 3HU5A 3JQGB 2P30A 1TO2E 3AJDA 4E4TA 1UADA 3PE3A 4IXTA 4WA7A 2JJ2A 4D9JA 4YIHA 5JSZA 2OCYC 2Y71A 3K2IA 1XWFA 2OHXA 1M1YA 3CWZA 2ZB3A 3NTLA 3RVOA 5C35A 3AKDA 3BULA 3DOIA 1AN9A 4MW9A 3MTJA 3N0XA 3ABSB 4CL0A 1TF2A 2P2DA 1JQ3A 1AKWA 1NASA 1YS7A 2IC5A 2FV8A 3F78A 3G1TA 3EFHA 5KEIA 3I9V6 4Q1EA 1FP2A 4AO6A 3ZQUA 3ROFA 3M9LA 2C95A 4QNRA 2PUEA 2GAOA 3LA8A 4N4AA 2PU7A 4UHJA 3K0FA 5IYZB 4CV0A 3U3OA 3AI1A 1ZRHA 2E6UX 1T36A 5DASA 4MLPA 3WKDA 4Q9NA 1BRMA 2OCXA 2AFIB 2XWBF 3K0CA 3M0EA 4JH0A 3IV7A 5CX1A 2VPZA 3JXEA 4ZQFA 3SYNA 3MN1A 2XKJE 2F90A 3BD8A 1Z0ZA 3WICA 3WRYA 4R2HA 4YT8A 1QHSA 3PZBA 2QMQA 3PRJA 4KXYA 3QU5A 4ZYVA 1H6DA 1WB4A 4L4XA 5EKUA 4GBGA 5B2ZA 1Q3KA 1QO0A 2OVBA 5IM4A 2C4UA 3I12A 1D2MA 3PE4A 1RC0A 3Q72A 5I5GA 2GKGA 3WHPA 4YRMA 5FOUA 2VRNA 3IE2A 1EFDN 3L4BA 3R41A 4Q1AA 1RLMA 2DULA 3KZVA 5ES4B 1BDIA 1WUTA 1A5ZA 4HZUB 2GERA 2Q7XA 2RD2A 2F1RA 5A9TA 2QBYB 5GMOA 1WOMA 1R0RE 2ZRJA 4IHQA 3OQMA 1CXZA 1T2UA 2QPLA 4BMZA 2QEQA 1GZ6A 3U4GA 3VKVA 5EHZA 2GEUA 3M1YA 2VXCA 2P3QA 1TYZA 3BSFA 1OH8A 2GT1A 1HA3A 4LDRA 5C32A 1Q20A 2I62A 2X8AA 3GJXC 4P1ZA 1WPXA 4R9UC 1ZGCA 4YV0A 1PR6A 2YICA 5GONF 5HF5A 1T0PA 4FC6A 1W93A 1XC7A 4X7PA 2TECE 4IIJB 4O3MA 3EWSA 2ZJ8A 3O4HA 5HZHA 3HB4X 1GDDA 3EQZA 4NK4A 3AEUB 1NOIA 4Q15A 2W11A 2H07A 3WKCA 3LX6A 5TF0A 2NOAA 1L5ZA 1IQPA 3W2FA 1NC3A 1EFLA 1AXGA 1JHXA 2FPGA 4C9BA 4EMUA 1W29A 3CEPB 1H65A 1L5MA 3I09A 3FOEC 1NNLA 1N2BA 5I7FA 4FGKA 4U6SA 5KKNB 1RM0A 1PJTA 2WLTA 1S7GA 2OL4A 3ZQ4A 1U1GA 4FSDA 2C5EA 3B2NA 3MD9A 4RIHA 1XKQA 3F47A 2BEVB 3QWFA 1C9EA 1JR3E 2GN8A 4DUZB 1O6BA 4LXTA 5K0SA 1KH2A 2Z2KA 4H15A 4B8WA 4OMDA 3U3DA 4KWIA 1KPGA 3X2SA 3FOZA 4YJ2A 3MZ0A 1AKRA 1VE6A 3NIDB 5CJJA 1MQ9A 2X0KA 3B7PA 5D2CA 1IY0A 4F5YA 2IHNA 1PW5A 1D6SA 1M72A 3RYFA 4BLPA 1JE1A 4UW9A 1DINA 3L02A 2YUTA 3D0RA 3KIPA 1AJEA 4NCXA 1LDGA 1CULC 4OG2A 1GFSA 1A50B 4S1OA 3ZCTA 1G55A 1U0FA 4OI1A 4HY3A 4QGHA 2VH1A 1Q0ZA 3KUUA 1OA1A 4OLFA 1ZOLA 2EL9A 3QYJA 3A3YA 3CFYA 4UREA 5ALHA 5FNVF 4MS3A 5BV1A 4M55A 5AVVA 3WY9A 5HCIA 4F8YA 2ZOSA 3OZDA 2OK7A 3F3KA 5A5DA 1NOKA 4RVDA 2GVDC 4B6PA 3LMKA 1QP4A 3PQDA 4XEUA 1OSNA 1T2NA 1XPJA 1P5FA 2I2WA 4RK4A 2BZ0A 1TU3A 1FFWA 2HSGA 5CR9A 4YO8A 2FTKE 3BFPA 1E1MA 3GJQA 1JKIA 4IW3B 1XXHE 1IBKB 1PGPA 4M9XA 1TIPA 5JAMA 3D3JA 1Z83A 3IIJA 3RE1A 3D7SA 2Z2ZA 4NENA 4D0LB 3BL8A 1YQDA 4PHTA 5K20A 4EO7A 3B36A 3UMJA 3PPXA 2AMLA 3I9JA 3P4XA 1FW8A 1UOQA 2J9XB 4FNAA 5IDWA 5LNK6 1ZM2A 2E5FA 4B4UA 3GEIA 5K03A 2CXPA 4H17A 1C4KA 1C3XA 4DR6B 1UJ4A 3Q9UA 3IBYA 3K09A 4MR7A 5A05A 3FMVA 1Z5ZA 2C7OA 4CDRA 1GTMA 4BX8A 2FU5C 3N2KA 2BSXA 5E2BA 3VPFA 1P2GA 4ZC8A 2G70A 1IOWA 3PZRA 1Z35A 2FSVC 2OO3A 5AIBA 3ZVNA 1I6WA 5A0FA 4W5HA 1SIBE 3FVQA 5HGXA 2B35A 1X80B 2NXWA 4UM9D 5MN5A 2WFZA 2UZAA 4EFLA 2OCPA 4YMIA 2HK7A 2HV9A 3NG1A 4RSGA 1WU7A 3S2EA 3RYTC 4V0NA 3K31A 1C3JA 2D2IA 5JATA 1G7CA 1PBNA 3T1VA 3ST7A 5DX1A 3BJIC 2JBAB 3EPRA 5JNTA 2J9RA 3FMPB 3T3GA 4BO9A 4CUKA 5KOJB 1JDSA 2XDWA 2VQEB 4RBNA 2IODA 2DSTA 2UVQA 3L05A 3Q7SA 2Q45A 3VKHA 3ZY3A 2BKXA 2V9PA 3R3WA 3BGDA 3GBVA 4FEAA 1QS0B 4QSHA 3T38A 1OT5A 3F6BX 1RCTE 5C4GB 1K89A 2AEEA 1RDFA 3LUKA 4XGNA 2I4IA 3NJ8A 5ALKA 1PVVA 4HNUA 3GLVA 1F4VA 2V0CA 4G8BA 3MS4A 3TOXA 4B81A 1HYBA 1UBSB 2OGUA 1L8AA 3PENA 5F1OA 2W8BB 2OHOA 5JEDA 3EFEA 1TMYA 1DOZA 5F5XA 5MF6A 4M46A 4G1MB 1MH1A 1U02A 1UXGA 1E7MA 1Z0JA 2PUWA 3LP6A 4Z7NB 5IKOA 3AM1A 4XD7D 1L5WA 5ER9A 4LVOA 3JW8A 3UWDA 1MAUA 4D8YA 4ZDJA 2X1MA 4LAFA 4CEIB 2B8TA 1ULZA 1DAIA 3N8HA 1OPRA 2XUAA 2BCEA 2CXUA 2QZSA 3R09A 3R44A 2F17A 1F38A 2I65A 2WJ3A 4OXYA 3C1TA 4S04A 4FZ5A 4GO1A 1SG6A 3VMFA 4M6WA 4IEIA 3EBPA 3JZAA 3FHOA 4ESEA 1L4FA 4Q4CA 2FPPA 1FY2A 3LGSA 3L8YA 1YH3A 2HC9A 2BISA 3H1GA 3ND9A 3AU8A 3OO0A 3ZU4A 3LQ4A 5B7QA 1GPLA 2P0EA 1W88A 3H3FA 3ZZNA 4C4XA 1KOGA 1M1NA 3EMBA 3N2ZB 1U1CA 2OAP1 2ZXEA 4RKYA 2ZEJA 1ZMRA 4DJ5X 5HZKA 4CGZA 4IDGA 1U1DA 4ZPXA 3WLEA 3TTYA 3DTNA 3QPBA 3UC9A 1HX7A 2PO5A 3QF7A 2C61A 1CR2A 2C99A 1VG9B 3DGEC 1A8SA 2WJ4A 2OAQ1 3I9LA 2X40A 4BVBA 3UJ7A 4D99A 3LKZA 1EUYA 1ABFA 1XLVA 1MOSA 4V0QA 1PK7A 4BN4A 4HP8A 3P9IA 3CRW1 5LQAA 2ZKLA 3ILVA 2C8JA 3R5HA 4D8WA 3IVRA 3K8YA 2W6OA 4L22A 4RWEA 3D7KA 1BOOA 5G4LA 3UB2A 1QB7A 2YHBA 3O8OB 1Z22A 3AEZA 3WKAA 1UQUA 4RTQA 2B4TO 1GILA 2Q0SA 3WIEA 4DIBA 4Z0PA 1YFJA 3FVTA 4RH3A 1NI4B 1Z4LA 4X00A 3OCVA 3QPWA 4HAXA 2RK6A 5EC8A 4RMHA 3F4LA 2XUGA 4HN2A 5C0OE 3IRUA 4RLSA 4PIMA 3W06A 4F72A 1YIDA 4IIXA 1KOLA 4JB3A 2YHIB 2QNIA 3F7OA 3PC3A 1G8FA 1QVWA 3H65A 4Y9UA 4PNEA 2FQQA 1XD9A 4LFBB 2WSIA 3GFQA 4UBIA 2VRCA 2VFAA 3LF2A 5FKJA 1U5BB 4ZMBA 1WCV1 4AZWA 1SC4A 3Q85A 4J6EA 4ZAVA 5BN3B 1HFEL 2OENG 4NJEB 4A8HA 2ONJA 2PV0A 3ISVA 1P29A 1OYWA 3KD2A 4LMAA 4PS1A 2V4ZA 5G4KB 3Q7IA 5H02A 2Y2VA 3U39A 3OM0A 4YCSA 5HM8A 3AVPA 5TGZA 4IAOA 2W2QA 4OOEA 4R1PA 1AHPA 1R5NA 4JKYA 1WY7A 3NYIA 2IWRA 1MA0A 1NWCA 1OT3A 1Z07A 2HLNA 4DE5A 4PS0A 4WFKA 2Q41A 3C8HA 1SHTX 4NOJA 4DTIA 1Q5PA 1ZMOA 2PVPA 3CB2A 1MTZA 2RGWA 1WZNA 1PJ4A 4R8MA 1S2MA 4F6CA 4LUCA 3ROQA 2OV3A 4DSZA 4EBFA 1J8MF 4R2JA 4ZVPA 4Q4HB 2QW8A 3B6IA 1D4FA 4OJKA 2DX7A 2C77A 2I4MA 4O2LA 5DYNA 2W43A 2P2LA 2C2BA 1QPBA 3E3MA 1R0WA 1R16A 3OBIA 3A32A 3EGDB 2WWIA 4F46A 4X7BA 3V9PA 4EAQA 1RZVA 2G0NA 1XEXB 2X0JA 1Y1QA 1AS3A 3KFXA 4LZPA 2P4SA 5DW0A 3E1GA 3WLAA 2ORWA 3KJGA 5E2IA 4RACA 4YYEA 3TQSA 3MQFA 5KOHB 3GR6A 2WG2A 1A04A 1NDUA 2M1XA 4M86A 3U7GA 1GYQA 5T4FA 2I2CA 5LXTF 4CG3A 1QX3A 2ETVA 2OFWA 2QVCA 2G1AA 2PS3A 3OA2A 2K2QB 3ORYA 1VPEA 3VR5H 1VYUA 1OGYA 1HSOA 3L40A 4RM3A 3RUFA 1K3UB 4BZXA 5KU7A 1JLLA 5GM1A 1Q1EA 1B6RA 1SVLA 1X1AA 1Z06A 5IS2A 4CIDA 2CZCA 3JV7A 4YRPA 4JZKA 2QLNA 3EUAA 3R3XA 1V1RB 5IABA 2Q2VA 4DR3B 3P0EA 5JCPA 2D8MA 1P1IA 1P31A 2BI8A 3LCJA 3L79A 2QJFA 4WERA 1H1LA 4N6NA 4QFCA 4D97A 5EJEA 3ONNA 2XJ4A 1D7OA 1NI5A 2A14A 4AD8A 4U7FA 3ZK9A 4DM3A 1N34B 3RTCA 4WLUA 2GTIA 2X8JA 2WFAA 5KYWA 4UU1A 5LZ2A 4BEJA 1E2QA 1FLAA 4MVXA 4TQGA 2Q5EA 4YQFA 4YUZA 3I5XA 4BGVA 1G38A 2XF8A 1QBKC 1KMHA 2OK8A 3GAZA 2L42A 3RSQA 4CEHB 1I6MA 5AOAA 3OD5A 1MOQA 4J7UA 1RXUA 2H9AA 4IJUA 2ZSDA 4MR8B 4RHCA 5DYYA 5B1IA 5CYGA 1M8KA 2WUDA 2B36A 2QM3A 1J24A 1GFIA 2ZYWX 4OX9Y 2EFCB 1PCXA 1I2MA 2MYTA 3KYJB 3MS7A 4MAFA 4QYSA 4YRTA 3OZCA 4DA0A 4YWJA 1KS2A 4YJGA 3RODA 1EUCA 2WZBA 4CEHA 1WHTA 4DLTA 1TVMA 1X1SA 1GNPA 2JIOA 4DKXA 3KKQA 1CERA 4R9SA 2PGNA 2B5WA 1ARZA 3AEKB 3EEQA 3WC4A 5I5EA 2B3TA 5REQB 2IEZA 4Z3DA 2XMQA 1AF7A 2QRVB 4LDQA 3F9RA 4Z9BA 5EY5B 5ALSA 4JIMA 4L5CA 1JV2B 1HNWB 1Y4AE 1IK4A 4H7KA 4QNMA 1VCNA 4RFSB 4RIIA 4WKGA 4IXNA 3SE0A 4OBEA 3S5JA 2EKZA 3IJEB 3V8NA 1QYXA 1UBOS 3HB9A 4ROSA 4URVR 3TQIA 3VDNB 1Q2XA 1JDPA 1QHHA 4KFUA 1LKZA 1MEJA 1UFOA 2GZMA 3RWMB 2FSFA 4Q03A 2BI4A 5A6SA 4G84A 4LBWA 4G0XA 4HGRA 4P4TA 2NU8B 3EEFA 3HM2A 1VGRA 1V9SA 2R1TB 4CG0A 2F1KA 3CURA 3OIVA 2D0PB 1E3JA 3V3TA 4W8GA 2QL7A 4DIKA 3H5TA 1TEVA 4B6FA 5BOVA 4FIZA 4TZTA 1G5HA 2C04A 4PHCA 2XUKA 3RS9A 5JO0A 2BJVA 3NTQA 5DHAA 4MI1A 4MQMA 1I4EB 2GILA 3PHHA 3C6BA 2KPOA 1CRZA 3DXXA 3QLEA 1L4MA 4GXTA 3L0IB 4UMEA 1P0CA 4PX3A 3ACCA 4JWKA 3LCUA 4MNTA 2QVXX 4TLMB 3ML1A 5GOTA 4KIWA 1ZUIA 4UUNA 5EJIA 5HKOA 4F11A 4BFVA 4W5TA 1BDMA 1CJTC 3GLRA 3GPCA 4OHKA 5DVZA 2A0FA 1MRZA 221PA 2CLFB 4MZDA 3V1MA 5BXYA 3SN6A 1XQ6A 9MHTA 2EZ8A 1JSCA 2WJAA 4QQRA 2NQ2C 1PJ8A 1CJKC 3KYCA 5IKXA 5BN5A 5IWCA 4CM8A 2WAMA 2UDPA 2ZJ6A 3AB8A 1JVSA 2QW0X 3VJMA 3SQWA 4IVPA 1XPRA 1N2IA 1UJNA 2RBGA 5CUQA 2P6RA 2XSZD 1C2YA 4OV6B 1PQUA 1QRDA 3FB4A 4QGSA 1H0SA 1MX1A 3SXUA 1R8YA 4TUYA 4BO0A 2H1LA 1K2WA 3GDOA 4JS0A 3V5NA 2Q5HA 3ZX5A 3RSSA 3MWGA 2PSEA 4IUYA 4CCYA 2BBTA 2PWAA 1R10A 3E81A 4J7CA 5FUBA 1T3HA 3WHKA 2WG0A 4HXEB 2C2YA 2R6HA 4OK3A 4JWTA 1WMEA 4N5MA 2QS9A 2CMDA 4NCIA 4P80A 3P2YA 3L93A 3TSCA 1PS8A 2H1WA 1SCNE 1XRPA 2AWNA 1Q11A 1QTIA 4U0KA 1KI6A 3BA1A 1BE6A 4Z4EA 1T1GA 3P32A 2C57A 3LDUA 5BV2P 5K3FA 2WQ7A 3GRUA 4BUJA 1O94C 4CFYA 1MPXA 1C0PA 3HUEA 2GN9A 3NH9A 4H7HA 4INZA 4XPZA 4ONEA 4NNJA 3FRJA 1M3SA 4MWTA 5KJCA 4DMGA 4ASUA 3PX7A 5WRFA 3RUAA 3PEUA 4B4WA 4EHDA 2ZVPX 1KFCB 3LNTA 4UAVA 1E69A 3OC6A 4M0PA 3I37X 4TMYA 2C4HA 4ZT5A 5A9SA 1KP9A 1NJ5A 2X22A 3BQMB 1QU3A 2ZPUA 3WNVA 1IHOA 1HL3A 5DZSA 2PKXA 1P9OA 4PR3A 4BTEA 2B8EA 4DCNA 3VR2D 1UM9B 2PFSA