1EG2A

Crystal structure of rhodobacter spheroides (n6 adenosine) methyltransferase (m.rsri)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
279
structure length
270
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RsrI methyltransferase, a member of the N6-adenine beta class of DNA methyltransferases.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
molecule keywords MODIFICATION METHYLASE RSRI
total genus 90
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1eg2A00
2XYVA 3KQPA 3UJCA 2JG3A 3A27A 4CKCA 4A6DA 1JG4A 3M4XA 4RWZA 2PX8A 2WA2A 2XVMA 2ZWAA 1FP1D 3BZBA 4KRGA 5CVVA 5DM0A 1WXXA 4YUZA 1KHHA 3KQWA 3BWYA 3OZSA 2P1DA 3EVZA 1ZHFA 4HH4A 5K01A 3PFGA 2XVAA 3AJDA 2ZVJA 3AXSA 4H0NA 4FR0A 5E1BA 5EZSA 2P35A 1KP9A 4EVIA 1SUSA 2EX4A 2PXCA 2CWWA 5DLYA 2B2CA 3PFHA 3G5LA 3HEMA 3LCVB 3LDUA 2GB4A 5DXAA 5EKUA 4Z2YA 3TKAA 5M5BA 2HTEA 5F2NA 4XUCA 1Z3CA 1RJDA 3FTDA 3GCZA 5C1IA 4QVGA 2AOXA 3SX0A 5DT2A 3LBYA 3MB5A 3Q87B 4FP9A 1YF3A 3TM5A 1ZKDA 1SQGA 3EVCA 4KDCA 1XJ5A 2PY6A 3FTEA 5EC8A 2F8LA 3B3FA 3HA3A 2CKDA 2ZSUA 5EIFA 4DM3A 3I9FA 1NV8A 4IWNA 2PKWA 4QQNA 4WXHA 5CD1A 3EGIA 4GC9A 4X60A 5CVUA 5U4XA 2G1PA 2PWYA 4BLWA 3DTNA 5CCXA 2ZTHA 3G88A 5ICCA 5T67A 2ZZKA 1VQ1A 3EEOA 1BOOA 1N7IA 4FSDA 3KR9A 3MCZA 5FA8A 2UZ4A 5HEKA 5K0LA 4E32A 1IXKA 2OB1A 2WA1A 3ME5A 4LG1A 2HR1A 1L9KA 3GRUA 4ER7A 5DXJA 1L3BA 3P97A 5DX0A 5EMMA 3R9XB 2QE6A 1PJZA 4OQEA 2OB2A 4FT2A 4FT4A 4RTPA 4GC5A 1TPYA 3LGAA 3KPVA 5E9WA 4P58A 5EVJA 3O4FA 2YXEA 3P9IA 1XDUA 2EG5A 3A4TA 3DXXA 3QOWA 4ER3A 4RTQA 3FPGA 1VPTA 4HG2A 3NWEA 5ICGA 5CIYA 4GF5A 4ER5A 2Y1WA 1TW2A 3CGGA 4M36A 4PIMA 5F2OA 5ICEA 2H00A 2HWKA 4HGZA 4QTUB 3KQTA 3EMBA 3THRA 1MHTA 1JQ3A 2QRVB 4F86A 4DCMA 3I58A 1JSXA 2UYHA 5EKXA 2ZZMA 4YUWA 1XXLA 4R8RA 5IKMA 3THSA 2OPBA 5ICFA 2ZIFA 1L3IA 4OX9Y 1ORHA 2B78A 5HOQA 4PYJA 2GPYA 3TLJA 5JUWA 5GIPE 5FQOA 2IDJA 1T43A 4LWOA 4PYNA 5K03A 5LQNA 1EQAA 2BR5A 2GAFA 1UFKA 3NDJA 3TKYA 1R6AA 5LQAA 2NXEA 5GIOE 4MIKA 4RV9A 5CM2Z 3NVKI 2BR3A 1XDSA 4C08A 3ERCA 3UZUA 2B25A 5HIKA 4QVKA 4E30A 4QPNA 2G8NA 3CKKA 4RTNA 3P9CA 3KPWA 5EMLA 3LSTA 4CKEA 5HFJA 4X61A 1NBIA 2BZGA 2EFJA 2H1RA 3M6WA 3P2IA 4FGZA 5CUQA 4PCAA 3VC2A 1XVAA 1XTPA 3GRVA 3TOSA 3IEIA 2FK8A 2JH9A 2ZZNA 3GU3A 1SUIA 1B42A 3LHDA 5DM1A 2FHPA 2IIPA 3DMFA 4EKIA 1WZNA 3HP7A 2AS0A 3X0DA 2ONYA 4M7RA 4P7JA 2QM3A 3HCFA 1X1AA 5K0NA 2IPXA 3BUSA 2GLUA 3LX6A 3NJRA 3GRYA 3NVMB 4QTTB 3UWPA 3MHTA 4PYIA 4P7FA 3LCUA 3OPNA 1FP2A 2P7HA 4GQBA 2PBFA 3HM2A 3CBGA 1SVUA 2ZBPA 2ORED 2PX5A 3GJYA 5FHQA 5BXYA 2CMHA 5K0BA 3EGEA 1UIRA 2AN5A 3OFKA 3LKDA 2XBMA 5H02A 1RJFA 5EMKA 4PWYA 1H1DA 3KQOA 3KPYA 3QOXA 4M37A 2PV0A 3S68A 2BM8A 3PX3A 3SM3A 3FUTA 1O54A 2P3OA 3DR5A 3TFWA 4R6XA 4EMSA 3PX2A 4OA5A 4RTRA 3DUWA 1EJ0A 1KPGA 2UYOA 3G2QA 3G7UA 4YV1A 3QV2A 3FPJA 3EEYA 1JQDA 1YZHA 4RVFA 2I7CA 3UJ8A 5GM2A 5EHGA 1WXWA 2VDWA 3EVDA 5GOZA 3HTXA 3CVOA 4YUVA 2JHCA 2NXCA 3O7WA 3GDHA 4O29A 3L8DA 4PGHA 1AQIA 4DA4A 3ORHA 4X1OA 3LDGA 1DCTA 1L1EA 1VP9A 1WY7A 2YUIA 3G8AA 2ONZA 1I4WA 2R6ZA 3KQSA 1F38A 3DXZA 3ELDA 4BLUA 3ER8A 3R0QA 3HCAA 2AN3A 3LDFA 1KPHA 3M6XA 5FADA 5FA5A 3ER9A 1ZG3A 2O07A 4QQKA 5K0FA 4R6WA 1X19A 4YUXA 1PRYA 3C3YA 3KR1A 3M6VA 3P71T 3LECA 4ER0A 2O06A 1R18A 2P40A 3ELUA 1XDZA 1D2HA 1N7JA 3OE4A 3BGDA 2CMGA 4L7VA 2VS1A 5LR6A 5GINE 2O05A 3SXJA 4AZVA 2AZTA 3UFBA 5E9JA 2NP6A 1NV9A 4PYMA 5BW4A 4M38A 5DTRA 2Z6AA 4CXMA 4GUAA 4HTFB 3GO4A 4DQ0A 3HA7A 2XYQA 4C05A 5KQRA 4DKJA 3TM4A 10MHA 4OA8A 4OBWA 4KVZA 4R8SA 2OXTA 5LSAA 3BGIA 4X63A 3SSOA 2GS9A 5FULA 3H2BA 4RSRA 5E1OA 3UA3A 5K0JA 3IHTA 1IY9A 4PYOA 3I53A 5CVJA 3T7TA 2ZIEA 4OQDA 3E7PA 1DL5A 1QAQA 2ZBRA 4B17A 1YB2A 2ZWVA 2PGXA 1KYWA 3AXTA 5EOVA 3R24A 4KDRA 2IBTA 1JTFA 5T6BA 4PGGA 3GRZA 4HGYA 1G8AA 2PLWA 3BWCA 2OZVA 4WVLA 4EKGA 1R74A 2KW5A 4RTOA 4UOEA 2ERCA 3P2KA 1XCJA 3MQ2A 5ERGB 5C9ZA 2BR4A 1VBFA 3IV6A 5E1DA 4ZTBA 3T7SA 1FPQA 3NTVA 1G55A 1I1NA 4C4AA 4AZWA 5FWAA 5HZMA 5KYGA 2C7QA 3G8BA 4YMGA 3PLAE 1ZGAA 3BXOA 1O9GA 3HCEA 4X41A 5DTMA 2I62A 1JG3A 3E23A 3Q7EA 3LPMA 3KPJA 4E2XA 5K8VA 4YV2A 2DULA 5CCBA 2EJUA 3SR4A 5HIIA 2YX1A 3TPZA 3MGGA 5DM2A 2QRVA 4MHTA 3KR0A 4GBED 5HIJA 1QAMA 4FSXA 3PTAA 1JTEA 5LQKA 5D1NA 2G72A 2EJTA 3RW9A 1Y8CA 1P1BA 3OU2A 4HRAA 4LWPA 1RJEA 5FCDA 2I9KA 3A25A 8MHTA 5E8JA 3TRKA 1RI5A 5CVDA 4F84A 2ZLBA 1YUBA 5EZQA 1JG2A 3EVAA 4R05A 2ZIGA 3MAGA 3K0BA 3UBTA 3OE5A 3A26A 2O0LA 5DSXA 4JXJA 1KPIA 3EMDA 4LECA 3VSEA 1VLMA 3FPEA 5LQCA 2HMYB 4HSGA 4EK9A 1NW3A 3HVJA 2OYRA 4RTMA 4PYLA 2AR0A 1N2XA 3E05A 3FUWA 2GH1A 2JHAA 1P91A 2G71A 4E33A 2VDUE 3FUXA 5MHTA 5CVEA 3UJ6A 3A7DA 4FS8A 4PYQA 2NP7A 3EPPA 4RX1A 5K0GA 3ELWA 4EQZA 4IKPA 1QYRA 5EEHA 2PWPA 2JH8A 1KXZA 2PXAA 1D2GA 2PVCA 4F85A 4MQ4A 3HVHA 5LQRA 5DRTA 4QDJA 4RYLA 3FRIA 1NT2A 3R6TA 5IH3A 3M70A 3OZTA 3SSNA 2XYRA 2ZFUA 3EVFA 3KKZA 2FYTA 4A6EA 2OKCA 1G60A 3HVIA 3T7RA 3C3PA 4BP1A 3OZRA 2IBSA 3CJTA 4CTJA 2WK1A 1ZQ9A 4QPPA 3SVZA 3BWMA 1NW7A 3HNRA 3I5UA 1FJXA 5KQSA 1IM8A 2PX4A 4PINA 3BKWA 1XCLA 3KHKA 3GXOA 3KPUA 5B1SA 2B3TA 5D1HA 3VC1A 5K05A 3V97A 2Z6UA 2K4MA 3ID6C 1KYZA 3KU1A 5E8RA 2PXXA 3BGVA 4PYKA 2O57A 2YXLA 3SMQA 3PB3A 1AQJA 5LQUA 3B3JA 2Y1XA 4GOND 4RTJA 2PT9A 3DP7A 3EVBA 5DX1A 3TQSA 3JWIA 2IH4A 1P39A 2IDKA 2QYOA 3AY0A 3FYCA 4Y2HA 2YVLA 3B3GA 2P8JA 5KVAA 3JWGA 1INLA 2AVNA 2YTZA 3FZGA 3M6UA 3P8ZA 2IGTA 3D2LA 3PVCA 4RTLA 3GRRA 5KS2A 3GIWA 4C03A 4E2WA 2UYQA 3ELYA 4GOOD 3V8VA 3F4KA 4HC4A 4KIFA 1L3CA 4KWCA 1FBNA 4ISCA 3DMHA 5EGSA 2IH2A 2N47A 2ZCJA 1R8XA 1BHJA 5T64A 5FHRA 1BKYA 4FZVA 2P41A 3DLIA 1AV6A 2DPMA 2FPOA 5C0OE 1SKMA 3FRHA 1YZ3A 3LCCA 5E2BA 5GP1A 1G38A 2NNWB 4E2YA 2CL5A 2ZULA 4NECA 1QAOA 4V0QA 4GEKA 1V39A 2QY6A 3MERA 5K0CA 2V74B 2NXNA 3DMGA 4GOMD 2FK7A 3FYDA 3DULA 5DRYA 3JWHA 1QANA 1Q0SA 3LKZA 3G2MA 4KW7A 4ATNA 2PJDA 3B7PA 3FPHA 4PIPA 3CC8A 2ZW9A 5EMJA 3REOA 4ER6A 1Q0TA 3HCCA 3BKXA 2IP2A 3CJQA 3BWBA 2JHPA 4XUEA 3RODA 4BY9E 2AVDA 2G70A 5G02A 1TW3A 3OU6A 3A7EA 3FUVA 4XUDA 3GNLA 1RI3A 3ANXA 4BLVA 2LD4A 3GWZA 3IYLW 4K6MA 2OY0A 2PSSA 3NDIA 3PT9A 2AN4A 1RI1A 4MTLA 5K0EA 5FUBA 3G2PA 1R8YA 4BP3A 4YV0A 5DX8A 1AF7A 2JJQA 2P3QA 3KQMA 4RTKA 4G56A 1O9HA 3CJRA 1MJFA 5DPMA 5DWQA 2A14A 3SSMA 4CKBA 3NMUF 1QZZA 2OO3A 4P7GA 4QDKA 1EJ6A 3FPFA 3HCBA 3DLCA 3FTCA 3OFJA 1EAMA 1EIZA 1NKVA 2P3LA 4U7PB 4PNEA 3MTEA 2PT6A 5HILA 5DM4A 2FCAA 4MWZA 5EHIA 2P7IA 2YQZA 3FUUA 1X1CA 2V7EA 4GOLD 4PONA 1G6Q1 5E9QA 4U7TB 3MTIA 5DTQA 5K09A 5EIWA 2B9EA 2HNKA 3G2OA 3M33A 1JR4A 2E5WA 3NW9A 2VDVE 1M6YA 3R3HA 4OBXA 5FWDA 4E31A 4YUYA 3JWJA 3TR6A 3UJ7A 1BC5A 4IV8A 2AOTB 2IFTA 3P9NA 4C07A 2GA9A 4RVGA 2C7OA 3UJDA 3G5TA 3UJ9A 5F2KA 2AOUB 3KQQA 3B5IA 5FQNA 4RVDA 2BH2A 3K6RA 3O31A 3P9KA 4POOA 3LBFA 3NWBA 3OU7A 4KIGA 4CTKA 4DMGA 2YR0A 3LL7A 1SG9A 4RTSA 1RI2A 2VZ9A 3FTFA 1KIAA 3C6MA 2Q41A 4DCGA 1RI4A 1NW8A 3AWIA 1D2CA 3DXYA 4XCXA 3B89A 3BT7A 1WS6A 1R00A 3G89A 1VE3A 2VP3A 3I64A 3KQYA 4V0RA 2NYUA 3CCFA 2UYCA 4IV0A 2ZBQA 3P2EA 4DZRA 1VP3A 1JQEA 1KR5A 1NW5A 5DSTA 2AOVA 3DOUA 1OR8A 2Z6QA 4PCLA 4CWAA 3SGLA 3RIEA 4YMHA 3EGVA 3KQVA 2AOWA 2YXDA 5HIMA 5GM1A 4C06A 5FTWA 2C7RA 1DUSA 1M6EX 1VIDA 4P7KA 2H11A 3TMAA 2PX2A 1U2ZA 2BM9A 4E70A 5LQJA 1P1CA 1G8SA 2C7PA 5BW5A 5JR3A 1JSZA 4HTFA 5E1MA 3HCDA 1VL5A 3E8SA 1HNNA 2R3SA 3C0KA 1YFJA 2OBFA 3OCJA 3EVEA 2ADMA 1X1BA 1X1DA 2NXJA 3UJAA 7MHTA 2IH5A 3VYWA 1ORIA 4Y30A 4AZSA 5EPEA 3UJBA 4C04A 1M0EA 1NBHA 5EEGA 1SQFA 1JG1A 2AOTA 3EVGA 1ZGJA 1HMYA 2ESRA 5E2AA 4AZTA 3MCTA 1NE2A 1RJGA 4AX8A 5EG5A 1NW6A 5BP7A 1YFLA 4RVHA 1UWVA 2AOUA 3DH0A 3U81A 9MHTA 1EG2A 3T0IA 5P8WA 1F3LA 3GGDA 3UA4A 3WSTA 1WG8A 3KR2A 1I9GA 4DF3A 2HV9A 2I6GA 3HVKA 5EQJB 4AUKA 4E2ZA 5GWXA 2FRXA 3HA5A 3PS9A 3C6KA
chains in the Genus database with same CATH superfamily
2Y1LA 1EVZA 3TEFA 3LQ4A 4CKCA 2Z4RA 1YQEA 3M4XA 2YL2A 4M0EA 3U31A 4IV5A 1OX4A 4RQAA 4CM8B 2C3YA 3NHPA 3AF5A 4MP6A 2WVJA 5DYNA 1G2IA 3LYHA 3DHNA 1PZGA 5EWJB 4X8HA 3UWSA 3BFJA 2XI4A 2A9QA 4H0NA 5BRJA 1T5HX 5LDDC 2H57A 3KXIA 3HMKA 4JX9A 1ND5A 2X8JB 3I2YX 4N0QA 1Z18A 4UFNA 2V0NA 5DK4A 3GLIA 4IRXA 1TEZA 1YXMA 2XWQA 3K70C 5FNVB 2Y1CA 4PSDA 3WYEA 1QKIA 4TV8A 3DE6X 2ZU6A 4D4HA 4ZQCB 1X2EA 1MOSA 3UAXA 1MABB 5IJ0B 2GUGA 2B4TO 1S2OA 3TQQA 1ETUA 2FPMA 1QH0A 3JQ9A 1ZUD1 3VC7A 4K9QA 5ALTA 1Y8RA 5JQGB 2D2VA 2F55A 3EVCA 5BUCA 4FYMA 1H1LA 2PY6A 4RORA 4AJLA 1HDOA 4LYEA 3ZYZA 2EX1A 5A4FS 1FZTA 1CQWA 3I9NA 2QPOA 4LE0A 2SECE 1WXGA 3NXKA 1G291 3W3AH 1R0ZA 2F3TA 4A4DA 4NMWA 1BX0A 1D2RA 1L2TA 1NZFA 1WCXA 2H0AA 3OH8A 2J30A 3ZYCA 5LU8A 4MDFA 1LK5A 5JY6A 2RI0A 2IOFK 2UZ4A 1DQPA 3I9OA 5A3JA 1BN7A 4A0QA 3GRUA 1X94A 2PRSA 3BD9A 5DXJA 5DX0A 2Q4TA 3EC1A 1WMAA 3TH5A 5FBHA 2O8BA 2I6FA 4Z9YA 2C9DA 1IBLB 2QGFA 4B81A 2P65A 5IKPA 1N78A 5E9WA 2ZYRA 2VP9A 1T35A 3QMMA 3ZD8A 3C1TA 3VR6D 3WYAA 1W1WA 3DXXA 4TRRA 2F3SA 1BG6A 3FPGA 4PFJA 1UDCA 1GQ2A 4E6EA 3ER8A 2FRDA 4LHEA 3M81A 3B1JA 3L0CA 3F5SA 5KDDA 1H2FA 2WABA 1WPQA 4DR3B 1XMXA 3EHDA 3KQLA 3BSFA 4HGZA 5YASA 5LB4A 1I30A 1I9CA 2AZMA 2JIZD 2VWGA 3OESA 3R7SA 4PZDA 5JS7A 2P78A 3G7NA 3OQ1A 2A78A 2C5GA 3AT1A 4PC3A 4DC1A 3C5HA 5EXPA 2BGTA 1C8KA 2H16A 4RQBA 2IITA 4HWGA 121PA 3GUVA 2BI7A 3AL3A 1JZTA 3T8YA 2JLRA 3IO3A 3TOXA 3GJ3A 1GZUA 4ZOBA 4AQDA 3IAAA 1XQ9A 3FI9A 1GGKA 3OQBA 1U1CA 5AI9A 1ZINA 2F9MA 3K20A 3NALA 4LWOA 4PYNA 4WDRA 5AR1A 4B3FX 1REQA 2CLOB 1Z74A 5MN4A 2IOQA 4QWMA 1M67A 2PSEA 1TU4A 3LFTA 4N8DA 2V98A 5JMWA 1J8YF 1DX9A 2C8KA 1Q5PA 3CWQA 1BKSB 4KQGA 4URZR 2JW5A 3RU9A 2EJBA 1N6OA 2LUOA 2AFHA 3EGWA 4UAUA 1NBIA 5JCOA 2F64A 3M6WA 3VC2A 4D92A 3IFSA 3GAAA 4X6XA 4ZQHA 3QEJA 2NQ2C 1SKAA 4B0PA 4KWEA 1V11A 1J07A 1JJAA 1IPEA 5DM1A 4BFWA 1PFVA 3GCDA 3VPDA 3G0CA 1T3GA 1E89A 1VB3A 3HP7A 3WWCA 1P3Y1 1SY7A 3W1WA 3UGJA 4IAOA 2ONYA 3GRKA 3HCFA 3QHPA 2IUFA 3G68A 1IOWA 3K8YA 3NJRA 3VR5A 5MF6A 1CDEA 2P7HA 4OLAA 2R7KA 1MVNA 4CLHA 1PZXA 2APJA 2WIGA 1TQDA 4DCVA 1L4FA 4DV7B 3EZFA 1XROA 2YHBA 2QMQA 1TVEA 3C3XA 2AN5A 3ROFA 1U3DA 3WAJA 1U63A 1WJGA 1M2VA 5BSKA 4UDOA 1NXQA 1NSTA 1MOQA 1QCZA 4F2HA 2AI1A 2DU8A 2Q0XA 4KGXA 4AVYA 4DE5A 3UGTA 3CNHA 4MQBA 5BWBA 3C1AA 4Y98A 4EGFA 5C51B 2C2KA 2UYOA 2WTUA 3IQEA 2ZT7A 3C15C 3EEYA 2EFEB 4LYYA 1UEXC 2G9NA 4A2CA 3AF1A 7AT1A 5HR5A 4IJWA 4I5IA 1RAAA 1JIQA 3HFSA 4L6IA 4YUVA 1U2PA 3RGWS 1KA9H 2FR1A 2HIMA 4N40A 3IAHA 4P8RA 4X1OA 3KZVA 3FB4A 1SA0A 4CM3A 4A6XA 4LY9A 3ANMA 4TMXA 3LVFO 1MMFB 4DYHA 3ELDA 1TD1A 4PZAA 4MDYA 3GT3A 3UK7A 3ZR4B 1YL7A 2ZJ8A 1U8AA 3LPAA 1K8YB 5KNDA 4DAEA 3BE5A 1ZG3A 4UAJA 1OH8A 2CFIA 2RDMA 3KTAA 3PNSA 4JEMA 4NH0A 1NUPA 2AWOA 3DZGA 1ZMOA 4BEVA 1VLHA 3RBXA 5EL0A 1E9FA 1TA4A 5EJIA 3ZV6A 1NQTA 5GINE 1TYBE 2OP0A 4OYRA 2IDZA 2EBHX 4BQQA 1NV9A 2DMRA 2XQGA 5JNLA 3IJEB 4CMKA 4Z3OA 3FPBA 4FKZA 4UBLA 4MDHA 4Y0NA 3B9BA 1Q74A 1YA8A 1B1AA 5D3MB 3WIDA 4AKTA 3KAQA 3H9UA 10MHA 4OA8A 1KEVA 3FOBA 1S2DA 1XTIA 2F9LA 1KYXA 3E48A 4FC7A 1V6AA 2ZATA 1BWSA 1FPMA 1A96A 1MQAA 3C45A 4FX2A 4KL8S 1XZDA 3GA0A 4D4IA 1IY9A 1VKRA 3T7TA 2W2OA 3TRDA 3WICA 5ES4B 1JNYA 4XR9A 1J9ZA 3DL2A 1YDFA 2HGZA 5FWYA 4P5DA 3UICA 1DEOA 1IVSA 3LHFA 5ED4A 4D74A 2FW7A 3H5TA 3QFRA 4J1NA 1TYDE 5JAOA 4NK5A 4BU0A 1WHSB 2LKCA 1ST3A 2ZYGA 1RCTE 4PGGA 4EI9A 1ZMBA 2OZVA 3DVSX 1DIOB 3KETA 2D7JA 2HHLA 1C3OB 4O1IA 2V7QA 4I1IA 1QH8B 4XGQA 5FI0B 4W5RA 2B1RA 1B15A 4PLPA 2QLMA 2CC2A 3T7SA 1CDDA 2PO7A 1YRLA 2OHGA 2XNSA 4LQLA 4RFLA 4LGYA 2C7QA 1JR3A 3FDZB 5CTJA 4AJKA 3CVXA 5FLEX 1OT3A 3IDSA 2WKQA 4IYJA 1LZKA 5B1IA 1O96B 5HKAA 3L7AA 3T0GA 7YASA 1L5FA 3PEYA 4EHJA 2ZS9A 1BU8A 1D8AA 4GYWA 4OFBA 1OPXA 3LS2A 3WMRA 4J6EA 3QXXA 5KNLA 2ZXEA 3CLRC 4G0OA 2FQXA 1UEIA 1Y8RB 3H17A 2C29D 2PGJA 1MO5A 1JEOA 3LWBA 3SHTA 4NNJA 1SOUA 3M49A 3HY3A 1H1LB 4OIMA 4ZARA 1SG6A 4BZXA 2YFYA 1YUBA 4DRXB 3D6HA 3K0EA 1QHSA 1Y4SA 1VE6A 2I8CA 4XWYA 4BZZA 2GASA 5E7JA 3H5IA 3FZYA 4EH1A 2FE4A 2HJRA 4MWEA 3ZV4A 1V8DA 2I67A 4QUGA 4GKAA 3QPBA 1O96A 4JI5B 4KAJA 3BCSA 3C3BA 2VDUE 1CG6A 2I6XA 4YVFA 5CGQB 4ZCLA 1L5YA 1LDEA 7REQA 2IYPA 1VCHA 1THMA 2ZJAA 1NN3A 2HADA 4NICA 4R51A 5CYFA 3VU1A 3ZGOA 3ELWA 5DCWA 3PC7A 1JU4A 1X15A 3HDTA 1LFAA 2OGSA 3VDXA 2WSIA 3ZY6A 2BDTA 1I0LA 4YFVA 2H4FA 4D9BA 3AOEC 5JNRA 1OVMA 3AILA 1RT9A 3BORA 2ZYAA 4Q7EA 1SHUX 4FPXA 2A9KA 4FXPA 1J4AA 2FYTA 2Y05A 3LY7A 1EBBA 2V6MA 4MRSA 4CL2A 3U09A 3U0VA 4KPYA 4KTVE 4DLSA 3PA8A 4NOMA 4Q7JB 4ZOEA 2OTCA 1NJ5A 2E6UX 3ONWA 2VBIA 2QGNA 4HAXA 3CX4A 1FRFS 5TR9A 3IUSA 2Z98A 3T95A 5FOVA 3MBKA 1GVNB 2OV3A 1U3FA 3DHVA 1IM8A 4BO4A 3KSDO 5ER9A 1TT5B 2XUZA 3SKVA 1XTKA 4E07A 4LCEA 3IUPA 3ZU4A 5K05A 3KAPA 3LQFA 4XLLA 2BM1A 3VVMA 3ZWCA 3K8ZA 1TCCA 1C8LA 3M3PA 5DGTA 2W4QA 3GAMA 3OOWA 4UZSA 1E61A 2G7MC 4RVSA 5FAKA 1HLDA 4NZNA 1G8PA 4EARA 3R8FA 1HX7A 1N2CB 3RYCA 2P91A 4UHFA 4Q1CA 3JWIA 4DM4A 4L2IB 1ECBA 3AX6A 3DAYA 3E35A 3R5SA 1N8NA 4M1MA 5F35A 3A05A 4F7DA 5FFFA 5B6JA 1BE1A 3GIWA 2PSHA 3JR3A 4IDCA 1DHRA 3ZCQA 1QZUA 3CXUA 4RLQA 3JVVA 3SYRA 3WIUA 3GLFE 1PJAA 4OFXA 4HQFA 3OE1A 1C2YA 4MWOA 2GQ0A 3ETJA 3DBIA 3DV0A 1PN3A 2EC5A 2FQQA 1P33A 2YY7A 2N47A 4TT3D 1P4SA 2JAOA 5DBIA 5T64A 3RTBA 2DG2A 3EDCA 4JGIA 4TV9F 4LF4B 2A59A 3M1LA 2X6RA 5HYVA 3DEHA 2PKEA 3BXXA 1FTGA 1VL1A 5LMUB 3WAKA 1BDHA 3FRHA 5EIHA 1JAYA 3AQ4A 1L7VC 3R0JA 1RM3A 2QZ4A 5DO9A 1SPXA 5T8KA 3UCFA 1UBLS 1YGYA 3VR6A 2MWMA 4YX9A 1I7QB 1HOTA 3FN4A 3HYLA 3RFVA 4EENA 1A9XA 5IM4F 4ZT6A 4NOKA 5E6UA 3LA6A 1XLTA 2ZE7A 1Q1QA 1X3SA 5FBKA 3V80A 3R7AA 3MINA 1LWNA 3DTTA 3TK1A 4WESA 4C78A 2HQOA 1DNPA 1D1TA 1D0SA 3MT8A 4LOLA 1F06A 1YRYE 4EA6A 2CKMA 2VRCD 2RMKA 3W2HA 1E2JA 4D44A 2AV6A 3BMOB 2AH5A 2HLNA 1G9SA 2VJAA 3NCHA 1OVGA 3A7EA 4ZZ1A 5H3HA 3L1VA 2Q9CA 4JITA 4EDHA 1ZK2A 4GMHA 1GZ5A 2PSSA 2LTAA 3RU7A 2BISA 4DLAA 2R87A 1Q7TA 5L4SA 2Y99A 1I32A 3PK0A 4ZRNA 2E89A 4S1OA 2B7BA 1O9HA 3H7AA 1OILA 5DLQC 3SY8A 3FWNA 5I4KA 1QX3A 3NMUF 4BO5A 3KKEA 4PPGA 5CVCA 1OBOA 4B3RB 5CYOA 1SHKA 1S0UA 2IP4A 3PCRB 3AKCA 3DLCA 4L8GA 5JYEA 4FZRA 3KDSE 4N6OA 2XUOA 2WQ7A 4GE3A 1DBQA 3COSA 2BFBB 3I3SR 5JIBA 1UODA 4X3PA 3FUUA 1UBOS 1XVUA 1QVWA 3C3CA 4NYJQ 4K87A 2BEWA 2BHRA 4AY4A 2IA5A 5IUJC 1OH5A 2N46A 2J3JA 3KKMA 4DQXA 2GGSA 2X0RA 4LYAA 2UVPB 4EZEA 4EUFA 3G8YA 4TL9A 3U44A 4LSMA 4NBWA 4QG7A 4I2VA 3KK0A 1AC5A 1CUZA 5EUMA 2CB9A 3B70A 3V9AA 4DEVA 4EYOA 5A3VA 4A15A 3W8NA 4TYWA 2FSUA 1E0KA 3COZA 5I7OA 1C7RA 2NU6B 3LBFA 2EJWA 2NSJA 3GJSA 1RLUA 2NT3A 3NWBA 4UM9D 5CJJA 2ODTX 1V8PA 2HU7A 5C8YF 5JD3A 3FSJX 3IEPA 2QU8A 3HJGA 1HDGO 2NQTA 4BMYA 3R40A 3RYHB 4MYHA 4RENA 1SK9A 2FEKA 2OUKA 3UT5B 2XTJA 2UYCA 1XMJA 3BMCA 2BMAA 3U4QA 4W8HA 3MJHA 1QGUB 5K2OA 3SU8A 1Q11A 1JQEA 1Q83A 3KZ1E 3X1XA 2FJUA 3PUKA 4EHLA 3D5TA 1ESDA 5IJWA 4BTLA 1GTG1 4MZDA 1BX1A 3EYWA 3HR4A 5LUBA 1UQUA 2DAPA 1GGNA 3F8WA 2NIPA 4I1YA 5AVTA 1U5BB 5AKHA 3ZZTA 4ZIRA 2FVYA 2OOKA 5FLXA 2BM9A 1E4EB 2FSHA 2HY7A 2ZITA 4ILKA 5ADHA 2HEGA 4DLBA 5AESA 1B8PA 3SQWA 1OWLA 2H1IA 4K6FA 3AY3A 1EB8A 4C22A 3BICA 3F73A 1FTWA 2ECFA 4O63O 4C6TA 5HKKA 3EXEB 3ISJA 3LUGA 4MUMA 3NRCA 4U2KA 2ADMA 3DVQX 4JDUA 1V48A 3JRXA 4DV4B 3KU4A 4R8KA 3STTA 1AM4D 4C04A 1C7QA 1QG4A 1HO3A 1UJBA 2J3HA 4TS9A 1PHRA 1DVRA 3HWWA 4XPZA 2BVNA 3IUJA 2DC1A 5J4HA 3KL2A 3DBRB 3ROKA 2XUDA 1A8HA 3E6AA 4ZRDA 1H8ED 2J3DA 3SZGA 3BE6A 4GMKA 2EP5A 1AKQA 4ZQBA 5E6UB 1QHYA 4KR3A 1MXFA 3DAFA 1DAKA 1AX9A 1O97D 3PXUA 4TOIA 4DIDA 1PVDA 2AUMA 4B4WA 1E2UA 4IMJB 1TU3A 4A2PA 1G6HA 4I5EA 5BUSA 4Z4CA 2PRYA 2GLXA 4DL9A 4MUBA 5C31A 2XYVA 3U16A 4UHDA 4IL5A 4URWR 4MVYA 2HA6A 2VZLA 3TLXA 3QKSB 4AO6A 4AU1A 2FWJA 2PH7A 3PD7A 4HQRA 4UBKA 2ZJBA 4W82A 4LA4A 1YB6A 3SFZA 3RVRA 2I1VB 2QUIA 2QP4A 2RHCA 1Y3HA 2IU0A 4ALJA 4KQFA 2G67A 4L9RA 2J0SA 5J43A 1BH6A 2OGZA 2DBQA 2WRZA 5ESWA 1IAVA 1QRDA 3QVXA 3A11A 5IAEA 4C2UA 2W48A 5AKLA 4DPKA 2ZM5A 2RFLA 2AFIE 4YRLA 2HTEA 5F2NA 1THZA 5B58C 5L53A 1NLZA 1M1YE 5C1IA 2N42A 3K9BA 1RPZA 2WAMA 1TGYA 4B6PA 4NJMB 1LPOA 4DDUA 2EX0A 2N1BA 3MB5A 5K1ZA 2RGXA 4PBRA 4HDSB 3SCZA 4WLOA 4DWJA 1DTEA 4ENQA 5FLYA 2YJGA 5AM3A 4MVXA 4WADA 5EE5B 1RE1A 1IOZA 3ONEA 3ZC3A 3LU1A 4ESEA 4G4SP 3FH0A 1U28A 5BYJA 1N7IA 1XL0A 4YQFA 1ANKA 1J39A 3OT4A 3W1EA 2OB1A 3DE4X 3VVBA 1YTUA 4FHEA 1O5IA 2XQIA 4ER7A 4YGXB 3WJAA 3BX1A 1F14A 4BRSA 1J49A 4HSEA 5LYYA 1BH2A 3IMCA 4OUDB 4KO3S 3SFVA 2QKYA 3WSVA 3VR2D 3C4JA 3ZWYA 4WBXC 3GDGA 2OXIA 1ISSA 3A4TA 2NOAA 3F8SA 5IAAA 2ZRNA 4TL7A 3TFOA 1Y5MA 4ACAA 4EX6A 1NY6A 1FRNA 1CB7A 2JEYA 1DG3A 1M34A 1GT6A 1LPMA 3DMRA 1EQUA 3U3XA 4EB3A 4YPOA 4TV9A 1XF9A 2IS1A 3Q0TA 4GL4A 2V54A 4Z4EA 4X1KA 2UZAA 4BJ5A 4XDYA 3RH0A 3THRA 1GKUB 2H2WA 4N54A 4DJAA 4F86A 3V1MA 3A70A 3UQYS 4Q4HA 2DJIA 3I58A 3TW8A 1VKHA 1RDFA 2VAXA 1R8SA 1GGVA 3IBGA 4J2OA 4JI3B 1PSWA 1ZICA 2XA9A 3MMXA 4EKYA 4YUWA 1H5NA 2HH9A 3HN7A 4UQLA 3PZBA 4PXAA 4R81A 3H9QA 5HUHA 4KMMA 1KFBB 4EX7A 2PSJA 1CE8B 3ZTYA 2GPYA 5LPNA 4N8EA 2C31A 4FGJA 4NU5A 2AW3A 1RXVA 1DTSA 2IZOA 3N6XA 2EFDB 2CDCA 2NUBA 4KMSA 5ESXA 2H2AA 3D31A 4BTEA 1XDSA 5DDIP 5HRAA 3K9FC 1RBQA 2RAVA 1GRNA 1S9HA 2CF5A 3MW8A 5IVHA 1XTTA 4BFZA 5CUQA 2GN6A 4D82A 2QVXX 4DR1B 1VPLA 1YDMA 3QTBA 1XVAA 1KMCA 2F1RA 1ZSYA 4KXLA 1I2ZA 3IT2A 4I5FA 3W3ZB 1ZJWA 4FW8A 5D87A 1QONA 2CMFA 1KQOA 4PAMA 2WWWA 5J4LA 2FGKA 3IAEA 4YJ3A 4LZPA 3RTGA 2DPXA 4N3GA 2CVQA 2J08A 3KJGA 3KT3A 1CJCA 4RFVA 4EG4A 4AJ1A 3TB4A 3DT6A 1FMCA 4D3FA 3QU4A 2IPXA 1ZRSA 4L5JA 3IQFA 5HKOA 2QTAA 2W83A 3VR4A 3M9XA 4L0QA 4RZ2A 4HDKA 1TZCA 2CDRA 2IPOA 3N70A 4KOAA 4NS4A 5DBFA 3VOTA 1ZH8A 2VDNB 5JNUA 1GGMA 1GNSA 2CDAA 3I37X 5E7QA 5DF1A 3W5SA 4CLOB 5KAPA 5CT8A 5LB2A 3ZWDA 1O5OA 5H02A 3SK0A 4ERXA 2ERXA 4TKLA 4H9GA 1TVKB 3PSAA 1CY4A 1R50A 3V32A 4CCAA 1I2AA 1P5ZB 4UPVA 1IXRC 5EJAA 4M49A 3DQZA 4YCSA 4Q47A 1H2XA 3DP9A 5KZMB 2JJ2D 1UJNA 1G7RA 1U3CA 1AKEA 1Q7BA 4DABA 4YV1A 2PVSA 4YP5A 4C7JA 3NGLA 1SQSA 4G1MB 1U8ZA 3DB2A 3TTWA 2YYYA 2L18A 3I42A 5BWCA 4ND1A 4JCCA 3OZIA 4JGBA 1E2NA 2HV8A 4G0NA 5CRIA 2PG3A 1CTQA 4N01A 2FU5C 5L3QA 3HKEA 1V9SA 1JEYA 3JD4A 2YUIA 5FI3A 4JFAA 2NO0A 5HKBA 2R6ZA 1NQWA 1CU1A 2WQZA 4ZOLA 3IUEA 3THYB 1I7SB 3M6XA 1H1TA 1UK7A 3B5JA 5T4HA 1PZFA 1OHHA 1Q2XA 2X0NA 4IBOA 4OI4A 4V3CA 4B79A 4EHIA 1TC1A 1EM8B 4MR7A 1A69A 1XL1A 1Y34E 1FMTA 3F97A 1L5QA 3ELUA 3JATA 4P3XA 1XCBA 1W96A 1QRAA 3RIHA 4EJFA 5C5EA 1ZGBA 1U1IA 1KVQA 4GP7A 1KOLA 4BX8A 1IE3A 4M38A 1OLXB 4GUAA 3ZVRA 3HYCA 3QXGA 3Q7PA 1K0UA 1IN1A 3BH6A 2YXBA 5BT8A 1RPTA 1M2VB 2ORYA 4K2HA 4MUKA 4Q82A 3TLAA 3PWZA 1SHZA 4KUHA 1P7WA 1OXXK 2QSZA 4KIJA 2J32A 2EBUA 1A8UA 4TL6A 4CMCA 3JTMA 3ZHOA 4IF6A 1QRTA 2BP7B 2KJQA 1WV0A 4NE9A 3FI0A 2GZAA 3V4RA 1YMQA 2ZIEA 3OZCA 2C5EA 5AW1A 1J7JA 4LZJA 2P5SA 2ZBRA 2ZREA 3BMNB 3GPIA 2J59A 4WKOA 1KYWA 2P4UA 4RXUA 3MCAA 3IDQA 3VJKA 3GRPA 2NSYA 3N6VA 3EGXB 4KWHA 4WI1A 3BEDA 3KZKA 1SBCA 4JJ6A 1YKGA 1D4FA 2VP6A 2W6IA 4BIMA 4MA0A 3KX2A 3L1UA 1XRNA 3PGVA 3F78A 2B1JA 4KK4A 5JI3E 4XX0B 2AN9A 2BN4A 2WZCA 2G28A 2YDXA 4GWGA 2WMYA 5ERGB 4F38A 4ZTBA 5LOVA 3QKSA 1NYRA 4UEWA 3SDSA 3NTVA 1R5OA 3O9MA 3A1EA 1Y8QA 4M87A 5FOXA 3BFKA 2CUNA 3VO8A 4U6SA 1IMOA 3E81A 5CDSA 4C7XA 1MB3A 3VU0A 4JL5A 4NF2A 1ZLXA 2XCTB 1ZR4A 4BNNA 5CCBA 1Z4IA 2EJUA 1RJWA 4G0QA 1Z6TA 3LDHA 4GSKA 4GBED 4HPJB 3D3EA 4ZYVA 1F8FA 4EBBA 1PS0A 3ABRB 3BTOA 3ZG6A 1SIBE 4XGNA 4DMMA 1GG9A 2I9KA 2I33A 3QLVA 4HNHA 4LC1A 1HF3A 1TTQB 3PCXA 4MWBA 1V45E 4O4LF 5AI6A 3TAUA 4BMPB 2BAGA 3ENNA 1RI5A 2IXAA 2XE7A 2YZNA 3KTDA 4GI1A 2FSVC 3WQQA 4M7WA 2N75A 2L82A 5L7YA 4MKZA 4E5UA 2P9GA 1DI0A 2I2CA 2HJGA 4PCUA 1U4OA 1BA3A 2NSLA 1JLLA 4KODA 1TRKA 4ND7A 1JDSA 1VLMA 1X7ZB 3FF4A 2ARKA 4V3BA 2LV8A 2E85A 2AA3A 2BFDB 3HVJA 3MS4A 4XB6B 1LGYA 4PYLA 4UUAA 5J9FA 1VFNA 1Z0FA 3EUWA 4ZK2A 1ISPA 3HU5A 2PSFA 1ODJA 4L4XA 3TCKA 4KACA 4TSRA 5BWOA 3KQNA 4MCHA 4RX1A 2R6FA 2K6GA 2LDBA 2ZYDA 1YT5A 3GJ0A 4MK4A 1N2BA 5EJ2A 4RTRA 2M98A 4KYUA 5IG2A 4NENA 1WKVA 3KFXA 1PBNA 4XSGA 4UU1A 4TWIA 3H9EO 1NVMB 5MDHA 3R6TA 3MSCA 1P0PA 2Q5LA 4REMA 5ALRA 1IEXA 1P2BA 1T0PA 4Q7QA 1U0BB 1JEYB 3KYBA 3SSNA 2V3VA 1G3QA 1FUEA 3CFYA 2G4VA 4L85A 4XQ0A 3DMYA 5EUCA 2R66A 2VSYA 3SEFA 2MINA 1RKXA 2TS1A 5KDOA 4ZT3A 4CUZA 3H1FA 4OQNA 3UAOA 4Z49A 1Y7LA 3L0BA 1T0HB 3V7NA 3BKWA 4OHPA 5HSGA 3OSUA 1DV2A 2X0EA 1P77A 3L4KA 4N0MA 4DSOA 4CKWB 1EMDA 1RCFA 4XCVA 3SMQA 2C2OA 3HL4A 3BTUA 3O91A 3UW3A 1C0IA 2PLNA 3MJCA 4KXNA 1KE2A 5HF8A 3RJTA 4D8VA 3T9FA 3B53X 3RS8A 4MIYA 3LT4A 3PITA 3PVSA 4GQAA 3TIXB 5KUTA 5KJEA 2KBEA 4LMRA 2IZZA 4XVHA 3IC5A 4TV9B 1Q6YA 2X9VA 4HDMB 5JXIA 3B36A 5KS2A 2VNIA 2YNMC 1COWA 1QS0B 2Z2XA 3KSZO 4UHEA 5EE1A 1L5KA 3JQ9C 3KYDB 1UMBA 1MVLA 1PJ8A 2DPGA 3A32A 3P32A 4JLAA 1KI3A 1RAGA 3CH7A 5H1YA 4AS2A 4D56A 1O95C 3NM5A 1E6EA 1Y5NA 2PZLA 3KB1A 1N57A 1SOWA 5EJGA 3KM0A 2PUAA 1QXSA 1CE8A 3PEVA 2ALJA 4MW1A 1SVMA 3B1ZA 1D9ZA 3OZWA 3FNHA 2VYNA 3ENQA 5I5EA 4CIYA 4I4NA 3M34A 3Q1LA 4HNAB 1AG9A 2I71A 3RKSA 5IDYA 4GOMD 3FYDA 1J42A 1XFAA 3AV3A 1ZUIA 5FDFA 2VSQA 3ZWKA 821PA 5TMDA 2XE6A 3MS7A 4ALIA 1H65A 2HHJA 4NAUA 2AEEA 2C3MA 2WWRA 2GNAA 2ZSJA 5JMPA 2OGWA 2GEBA 1JR2A 5DV9A 4KK3A 4AJ4A 1EFTA 3T12A 3RFUA 4PG4A 3B5EA 5AI0A 4Y7DA 4CQJA 2PUVA 3C2QA 4QQRA 1UDAA 4NULA 4XUDA 4NBNA 1KO7A 4HZUB 4M54A 2NUTB 3NT5A 4LDQA 2HBQA 1E4VA 4DIMA 4DQLA 1K5HA 3JQCA 2WE8A 3F5MA 1MO6A 2Q2QA 3G2PA 1QIDA 2ZJ1A 1P7PA 4CZ2A 1MJFA 1A95A 3P0HA 3DWIA 2A88A 4Y18A 1QZZA 1Z47A 5KOJA 1PGNA 1KK2A 3D7MA 4U7PB 3U3RA 2BFPA 3VNUA 2QN3A 2M9MA 2PT6A 3RFXA 1TIBA 1V16B 2FVXA 2QDXA 2YWXA 4JOBA 4Q1DA 2WSYB 1ID1A 5CDYA 1H5UA 4IOMA 1XRLA 1G6Q1 4F3CA 3CZ9A 3SBXA 2V5AA 2WD9A 4Q3KA 4KVGA 1QCYA 1A9ZA 1QIHA 1FYDA 2GUWA 3M33A 1U5CA 4LNHA 5A7HA 2YY6A 4J0EA 1QP7A 3QZUA 5JCOC 1YI1A 4RIGA 1FSZA 2FG5A 4NQRA 1SMKA 2DKNA 1GADO 4HZUA 2P68A 4E31A 4EG8A 1AU9A 4EY4A 5GJCA 3O4HA 4CDGA 5L3QB 1F1JA 2FN7A 2O5CA 4MLDA 1J2RA 1ISHA 3N0TA 5F2KA 3D3QA 4FIDA 1AA6A 2XUKA 3KVYA 1E63A 3WBJA 3KUCA 3LRXA 2ODAA 1P0QA 5G1NA 2DB3A 2O0MA 3W34A 3DPUA 3E2PA 2PL1A 1CQXA 5FOSA 3QLUC 4LW8A 3WLJA 3NAQA 5AJUA 1DJNA 3W9BA 2VJMB 3IERA 3LK7A 4EJ0A 3V3KA 1WEHA 2H48A 1LB1B 4H4EA 4EUHA 2VH2A 1V8BA 2NO7A 1M83A 3EQ7A 1NAIA 1VP3A 3WL8A 2B6HA 3EWSA 5F2EA 4KOEC 3KDAA 3TBHA 3AGPA 1E5TA 3ZLVA 1OR8A 2UZIR 1W75A 4MVJA 4I50B 1X9GA 4K40A 2IEAA 1PL6A 3GEHA 3NNDA 3GZTB 4O4HB 4URYR 4QYIB 3C70A 1B73A 2QHXA 2WU0A 3FTPA 4A8JA 4C06A 2H4HA 2XRYA 2ZRPA 5SICE 1IM2A 4UCFA 1ZJ4A 3T5MA 3TMAA 1JF8A 5FF9A 2H9IA 5D84A 4JLDA 1YJXA 2WTXA 5BW5A 2XB6A 4D0NA 3NB0A 2ZAMA 3K0AA 3HYTA 3OCJA 1CB0A 3GEBA 5E0OA 1Z6ZA 4HPXB 4LYFA 4MVWA 4PIVA 1XZGA 3OEHD 4LWZA 5I8PA 4PNPA 4RD2A 2F48A 3L2OB 5H81A 4TLMB 2XZPA 5BOVA 2I0FA 2MHCA 2B1GA 3EHEA 1GZ3A 1MJHA 3OSZA 3Q98A 4TKUB 5DMXA 2IZ1A 3ROEA 4RVHA 2A35A 4IIHA 4CIDA 5EJ7A 1JYEA 5JRZA 4MMYB 3FETA 3DM9B 4L4RA 2WUWE 2X5XA 1DE0A 1ZCJA 3DWEX 3E5MA 1HG1A 2VDLB 3LW7A 4DF3A 3NHJA 3ND5A 3UT5A 3WWDA 3D6NB 2ZRIA 1XCOA 4MI6A 4FFSA 5IT0A 1W0JA 4BKQA 2VTBA 3EYAA 1BZYA 1JG4A 1ZXLA 2BGKA 3B38A 2ZVPX 5DM0A 4PRZA 3MOSA 4DCPA 2DKOA 3GFTA 1SKYE 3HB7A 3Q3GE 3BA6A 3OZSA 4YCDA 4DSNA 5H5JA 5LZ4A 1KJYA 2QMHA 3D5EA 4QL3A 5KQGA 1T8SA 1ZK0A 4HWTA 1DKNA 2BMWA 2PGAA 3AZPA 2MMCA 3A6FA 1ZIYA 2GBIA 1WSAA 3WDMA 1LDBA 1I10A 2CCKA 4Z2YA 5EKUA 3PJEA 3A9UA 1S8FA 3ITDA 4RQUA 4YAOA 4RHUA 3FTDA 5DNEA 4MAMA 4BCDA 1KJQA 1AQNA 1W4CA 4QM6A 2HF7A 1ZN9A 4FFOA 3DMNA 5EXXA 3GPLA 2Q5CA 3OI7A 4WTOA 1N6IA 1NV8A 2FZWA 1GNVA 1K7FB 1HQKA 3PJGA 4TRJA 3INTA 3A0RB 2H7CA 4K3VA 3H97A 3WZMA 3L84A 1XG5A 3CUUA 1YTLA 4DIBA 3GZJA 5LU9A 3G49A 3KVVA 4XDGA 5TE9A 1N75A 1PFUA 4NDNE 3SJUA 1K2WA 2WNHA 3QI7A 4K9NA 3AYZB 4O08A 1T4BA 3DBHA 3IMEA 3NAGA 2JD2A 4HTAA 3LPLA 3X1DA 1AN0A 2C9OA 4QODA 4OQQA 4IZIA 5DKFA 4EWLA 1NTOA 1P0IA 1X1QA 2JEZA 4I8IA 3GPDG 2HX1A 4RTPA 4IMRA 2BC9A 2V5UA 3KE8A 1VHQA 2X15A 3FJOA 3QVKA 1R0RE 4Q15A 5ERYA 4TTVA 1ENPA 3KPVA 1F7VA 1W581 2GHTA 4DMHA 4H1HA 3O4FA 2CJPA 3VNRA 3KT0A 3GJXC 5GMOA 2X4LA 1KERA 3SF8B 1P2UA 4H4CA 3MXOA 4YCAA 4UMEA 3JARB 4JBXA 3UMMA 2AK2A 2Y1WA 3EIQA 5TRTA 1V26A 2QW1A 3LYLA 3NBAA 2AMVA 1K8XB 3KYIB 3QUBA 1M76A 1N6LA 3D59A 2QRVB 2WMOB 3QVUA 4PCVA 1K5GA 4YLGA 1LA2A 3A4LA 5AM1A 2UYHA 3JQBC 4R0VA 2Y71A 3OF5A 3OOYA 5CFQA 3I2HA 1JWBB 5EERA 3EQZA 1YJAA 1AB6A 3IAXA 4P92A 4DOMA 1ZCFA 3PENA 3G2HA 3VV2A 3WMWA 2PAAA 4C14A 3KAJA 4KQMA 2REXB 1T43A 3CT4A 2B3DA 2JIDA 2QRZA 2XWPA 3LMKA 1JAXA 1UFKA 1KVRA 1R6AA 2O3TA 1DV1A 2A4MA 3D6MA 1CRZA 3CONA 3E18A 3LY8A 5LA6B 3SF8A 1CEEA 5K4AA 3ZK9A 4IHAA 4WKPA 1Z8NA 3NOOA 4YMIA 4IDNA 4BJ6A 5I7VA 2X5JO 3GNTA 1HFEL 3NOVA 4O02B 1RC8A 1YFZA 1RLTA 2I65A 1T8WA 1Z2DA 2O6HA 2Y0DA 1KFKB 3HBMA 2NYRA 3U4IA 4JA2A 1DT5A 1TUBA 4YRBA 4LRQA 1BMQA 3I34X 3M5WA 4TRNA 4A03A 3UB4A 4BC0A 3NC0C 1KJZA 1UKZA 2AEJA 3KVRA 3LCRA 1LSSA 2EF1A 3PUVA 4JKOA 3R9WA 3K9CA 1IHDA 3DSRA 1HYHA 3SICE 2O2ZA 2R1TA 1TQ6A 2GN0A 1RBMA 1Y5RA 2DFNA 3E1KA 4FYVA 4B83A 1X1AA 1BA2A 4QUEA 2JFFA 3IJPA 3LGSA 1B26A 4MA5A 1VE1A 3LX6A 1R64A 1FNDA 1G17A 3D3JA 3F2VA 4EUNA 2H0RA 4PYIA 3DE0X 4PSAA 3WLTA 4NZMA 1SCDA 1KY4A 3WLLA 1G4UR 2QTGA 4ARIA 1KAGA 1HT1E 2VXOA 2OOSA 3TIFA 1YIAA 3QLTA 5BXYA 5K0BA 2KB0A 1KGDA 3FDFA 3L6RA 5KTNA 1YDWA 1LZLA 4JC8A 4IEEA 4B7ZA 4X1IA 1TO6A 5IKEA 1DIRA 3L6CA 3KPYA 4JBYA 1E1KA 2HDWA 2Z5GA 4M37A 4EJSB 1L7RA 2DBZA 2W8BB 2WWTA 5D5PA 1VJ0A 3PX2A 5A2QA 4BB9A 3E3MA 3OPYB 4HH1A 1UBCA 1JAZA 1CKEA 1GA1A 2GYVA 2YRXA 4KQ9A 1U80A 3BE4A 3DW3X 1MD9A 4X8LA 2OAP1 1YFKA 3KEMA 5LVAA 3Q3EA 4G0UA 1IXZA 1C4WA 1NUAA 1VBKA 2ZI9A 4KDEA 4R1PA 4YTEA 1M8GA 3UYLA 1V7CA 1Q6ZA 4YYZA 1W46A 3P4YA 1W85B 2YOHA 5L3SA 1XNGA 5BYAA 3Q41A 3L9XA 1TK2A 4MUFA 4L28A 3CLSD 1PX2A 4DV5B 4R9RA 1Y89A 3LDGA 1YQDA 2QRUA 5FBRB 2AX3A 3CEJA 1RHJA 1W36B 2G1KA 2FWRA 3CT6A 1FDOA 3WWYA 5AXBA 2J5RA 1I3KA 3K0CA 4MVJI 4YCBA 3F9IA 1U4NA 4GBJA 2IF2A 1EM6A 1T5SA 3KL4A 3OJLA 1OGIA 4J3NA 1RKQA 1YNSA 1EIWA 1PG0A 1Z4OA 3AHEA 3OE4A 2OD2A 3PEFA 2R00C 2IXGA 5KSOA 1EWQA 5G40A 3L41A 1L4BA 3H18A 4TMYA 1FXUA 1RZ3A 4EI2A 4WBNF 1GPUA 3RVQA 1BFUA 4WOPA 5ERXA 4DKJA 4M0PA 4X6YA 2CLLB 5ADWA 2OXTA 1UINA 4RF2A 3CS3A 5T7BA 4Z3DA 3VDMA 3WWOA 1USKA 1SEPA 1D6MA 2QTNA 3CW9A 4YNBA 4KI7A 3SQOA 2PL3A 3WNQA 4C0XA 4ZDKA 3CEMA 4K86A 1VCNA 4U2FA 5IT5A 1RZRA 5J4VA 1OKKA 4B6SA 3E7PA 1YB2A 3A9WA 5EJEA 2X1VA 1VHTA 4W5HA 3ETNA 1Y81A 1FFCA 3RBAA 16PKA 4CLDA 4B43A 2W4MA 3DW1X 1QFZA 4KPUB 4KV9A 2X14A 3ZJ5A 5B57C 1XKLA 3LXXA 1KKUA 5KSZA 3NWPA 1F0NA 4Z4GA 1IRIA 1J2UA 2N0SA 2NUPB 1W36D 2W6JD 5L7WA 2IZ7A 1HETA 1NRWA 1Q91A 4LJAA 1NATA 5HZMA 1ZWKA 1W52X 3THYA 2R8YA 2K5UA 4NV1A 4DXHA 1UJMA 3MD9A 3FJYA 4B6OA 4E2XA 2I87A 5DM70 1KAMA 3IQGX 1ZDMA 4KXVA 4EYEA 4YAIA 1I5RA 4ARAA 2UZ0A 1EWRA 4JP3A 2CLKB 4B33A 1UKEA 2HZBA 3HP1A 4WEOA 3RUDA 2KI5A 2W9XA 1JIUA 2FHSA 1QE5A 1RJEA 4ZYWA 4FFPA 3EK2A 5G1OA 1HNWB 1Y1LA 2XXJA 2QRHA 5TX7A 4I5GA 4MYSA 4IEFB 2G3YA 2NLOA 2XMBA 1OXUA 1UM9B 2Q49A 1S02A 3L93A 4EW3A 1DC7A 3K1YA 1NMEA 2C2WA 3QUQA 3AEYA 3UBTA 1OJLA 3CWCA 3OQIB 4AZ3B 4JXJA 1OMOA 3EGXA 2VOJA 1DRJA 1EX9A 2MYPA 1PTJC 1YRWA 4RTMA 4ZTZB 3GQVA 4A8HA 1UC9A 1T8YA 4E33A 4PZYA 1R27A 3CZQA 1EINA 4MAAA 2JNWA 1W88A 1KKMA 1TT5A 1OFTA 1AUVA 1U1DA 4U6QA 3AFNA 1M7BA 1UJ6A 4IKPA 1Q50A 3QM1A 2JH8A 4OV6B 4RZSA 2XHEA 3EZ7A 3KEFA 2B21A 2C3PA 3DOEA 2C84A 4JBGA 3TFQA 5IC6A 3MGKA 3Q7IA 3ZU2A 3R9IA 4RK6A 3VR1A 2D74A 1LLCA 1P2TA 3IXMA 5BNFA 3ZHTA 3MMZA 4Z8YA 3AY6A 3EPLA 1YOBA 1QJCA 3FOEC 2WB2A 2D1QA 1GGHA 1FFYA 3KWFA 2M6RA 4B44A 5IMSA 3VJRA 2AXQA 4RIIA 2WF6A 3HO1A 4LVUA 1QHNA 2VR1A 3T3EA 4ES6A 1SUWA 8ADHA 3IBTA 1W88B 2W7TA 3O7MA 5CFMA 4B7XA 5DLEA 4HZGA 4UD6A 4OB6A 3E82A 3SC3A 1DZIA 1N2SA 1VPVA 2G5PA 1S89A 5LIRA 2Q5IA 3CGWA 1XD8A 3JASA 2R79A 3B3JA 1B43A 3GBSA 3QV1A 2CLIB 2PT9A 2LIVA 3E5HA 2GM4A 4FLEA 3AY0A 2IDKA 4WJZA 3LRPA 3H11B 3FG9A 2RKOA 3VAYA 1DTWB 1GPAA 4R83A 3D8NA 2PFSA 3L8CA 1G7CA 5BRNA 1ML4A 1VLQA 2X76A 1E60A 3OZFA 1KK1A 1II8A 2XGGA 3DL0A 1OREA 1JFLA 1C3LA 3QIAA 4KIWA 1UIMA 3F4KA 4QG3A 1D1PA 4DWVA 3DQQA 1Z5UA 2BMDA 4L3OA 4YCLA 2WQ6A 1CJTC 1FDIA 1T9BA 1TO1E 4N5IX 3RG2A 3TG8A 2FMHA 2HCFA 4P2GA 4L27A 2R8BA 5BSVA 1GZ6A 2GYYA 1OIXA 2YHIA 1U1EA 2EL9A 1M9NA 2GPSA 3N8NA 1V1MB 2IRWA 3WK9A 5J4KA 1G38A 4LQCA 4LXYA 1G1AA 5DLPA 3RF6A 3BIOA 3KOOA 1QAOA 4E4RA 2UVDA 2NVOA 5K0CA 1DWOA 2VP4A 2V74B 3IDZA 5AK0A 1L7AA 1VKNA 2DHQA 3QKUA 3THWA 2XW6A 2VP2A 1TKCA 2QUZA 3T1HB 2A1UA 2FLKA 2NQ8A 2Y76A 4CKWA 3Q8LA 1SXPA 2F00A 1X7WA 3V4SA 3W2GA 4ATNA 4F56A 2R0QC 4KJXA 3EVTA 5AKJA 3SDBA 1V3TA 3FDJA 4LSZA 5DT9A 3BB1A 2CHEA 2X5OA 4OL9A 1K6MA 1GCAA 3DV9A 3L8MA 1MC8A 1NUUA 2WWGA 4D9KA 1SUDA 5H82A 2JCGA 1CNMA 1Z82A 2MSNA 4O8CA 6NULA 5IULC 1M1UA 1ZYUA 1E96A 2CLDX 2IPNA 1S9DA 4IDEA 2QTRA 5L3ZA 1E9BA 2WMNB 4WL0A 2B1IA 1JQ5A 4AWBA 3KFLA 1WSWA 2R2AA 1ILEA 2ECQA 3H16A 1L5SA 2DGDA 4QTYA 3JAMA 1IZYA 4BO1A 3LBIA 3U1VA 4KP7A 4C0KA 4NSNA 2ZPUA 2WNSA 2UUOA 2XAAA 2ZJ6A 3DDHA 4G0XA 5E7MA 5EGNA 3T4XA 1NUHA 1VL8A 4PQYA 3W6PA 3E5NA 5FOTA 4B4DA 2GFIA 4FZJA 2HNBA 4I3FA 4Q18A 4CV1A 5ISMA 2PK3A 4ZVMA 3GLHE 1R5BA 1GUBA 1SVWA 3IP1A 4TVOA 1ESZA 2DUUA 4I7EA 3IOYA 1W76A 4X20B 3RSLA 3ZTTA 4KQIA 5C5IA 3ESQA 4U7DA 2D5IA 3EXAA 2PU5A 4KFSA 3T41A 1AV7A 4BUCA 5C7YA 4NARA 1V0JA 3AB7A 1IFXA 3HR7A 2B7LA 1N6RA 3L8FA 3D0KA 3NW9A 2QT1A 5DIFA 1Z8FA 5EYPB 3UJ7A 2WHYA 2HIGA 4F3KA 5CAEA 5MFPA 2C7GA 1S5PA 5ILQA 1V6SA 3FXAA 3RFTA 2PMWB 1IZ0A 1AQYA 5F1PA 2G1JA 4FDMA 1XJQA 3N39C 1RVDA 1UWKA 5JZBA 3T9AA 4LKOA 3K6RA 4Q1VA 3VH4A 1ZGZA 4JOSA 5TGDA 4KIGA 4CTKA 2CUTA 1P19A 2F62A 2JFOA 3HVRA 1YJCA 2VZ9A 3LOQA 4I4TF 3C6MA 4I0WB 1QF7A 4K8RB 2XMSA 3MFQA 3DXYA 4YJFA 1PIWA 1HFWA 1B4DA 2B30A 1IN6A 3K6JA 4NTZA 3CCFA 4IV0A 3DNMA 4YP9A 4GX0A 4TMTA 1VSTA 2IKSA 4Z0PA 3BBPA 3IBCA 4XRRA 3TR5A 1ILWA 1YZQA 3GHYA 4IG9A 5ALGA 3H11A 4DBLE 4ZT7A 1LW6E 4G07A 3WXMA 1NXOA 4UTPA 3K5IA 3RPEA 4PG7A 3V8BA 8ATCA 4DNQA 2PO5A 5AI5A 4PS1A 1VIDA 1LPBB 4YQZA 4C0AC 1VYTA 4WZZA 1E9AA 1CR1A 3W05A 2V4ZA 3ODGA 2ZQYA 4G8JA 5TPWB 1SXIA 4G2NA 4E7PA 4CN8A 5K3SA 1ZC3A 4D02A 1TA0A 3SC6A 4E6PA 4RABA 5KREA 4RE5A 4DYVA 4EQ6B 4RVUA 4IIVA 5DCYA 4LC0A 5BXQC 4QEDA 1A8IA 1GTL1 2P79A 1P0FA 1Z83A 3ABQB 3HCPA 4Y2QA 1KSFX 2OKGA 4GG1A 1WZEA 2Z8XA 3RS5A 5JCPA 5J2UA 2PMFA 1B8UA 1NL3A 5EEGA 5BWMA 5LKRA 4DUYB 2OD7A 2IYEA 1ZGJA 2JGJA 2ESRA 4D8UA 2DPHA 2A1IA 1Z6PA 3SNKA 3TVYA 1PP4A 3A36A 4X44A 3U81A 4AG3A 4NU6A 3AEUA 3F6PA 4GVPA 3GGDA 4MR8B 3USZA 3H5VA 1OD6A 4YUAA 4GAEA 4WEQA 4E2ZA 1CHDA 1QBGA 3K5WA 2FRXA 4MUJA 1GKLA 1UJ5A 3Q7SA 5K20A 4UBJA 2QLFA 2HJHA 1FFHA 4ZVKA 3GQBB 3N2EA 2ZWAA 1G21E 1Z4JA 3N7TA 2LIPA 1KHHA 2JCYA 1XD9A 5AW3A 1D4OA 2IPLA 4HH4A 1ZHFA 4EVSA 5HRUA 2XCRB 1N34B 1ZW1A 4V38A 2ZB4A 4FR0A 1RLMA 1U1FA 1O6GA 4O3MA 2B34A 1SRRA 1HT3A 2NO5A 2EX4A 1HZZA 1XTVA 5HJ5A 1OWNA 2GB4A 3ZVLA 4ZAVA 1B8NA 1PV2A 4WY8A 2O3SA 1T2FA 2HSZA 1RIIA 3G8DA 3SZMA 1AF4A 3AFGA 1MT0A 1RHRA 3C8DA 2D0PB 3DDNA 3FVTA 1I80A 2Y9MB 3LBYA 1WSBA 4H7FA 4NBKA 1ZKDA 4AMVA 4F3YA 1G59A 4EB6B 4E5DA 4OMFG 3AR4A 5EC8A 4BYMA 3Q40A 5CA0F 3QF7A 3O83A 4QQNA 1CIPA 3G2LA 3EGIA 3OOHA 4L7QA 2BFEB 4LXHA 1QGOA 1M2KA 1F2VA 1EK0A 2BBTA 2WLTA 1CV2A 4PZLA 5D6NA 4C5AA 5LP6A 1XRQA 4BMVA 2ZKIA 2ISCA 4AP6A 4BL5A 4YP7A 3DNFA 1TLTA 1Y9EA 5HEKA 5K0LA 4E32A 1IXKA 4LY3A 4FEAA 4BWGA 4EF4A 1UT5A 5C46F 2Q29A 4LF6B 3H99A 1L3BA 1UH5A 4LISA 1COZA 2AFHB 1YU6A 1Q57A 2VKQA 3G2NA 3L7KA 4RHFA 3T61A 5JZ9A 4EHFA 3R9XB 2WSLA 1USUA 1V95A 3LGAA 1DCFA 3DO5A 2Z4SA 2ZS7A 4QUKA 5IK2A 3WGZA 5SYNA 2G9ZA 4R3NA 1IATA 5AQEA 1MX9A 4M7PA 3SX2A 4ER3A 1GA6A 4U9UA 5REQB 3E0XA 3TMYA 1XZAA 1OCEA 4Q9AA 3AEKB 1WHSA 3MWEB 4TTJA 1MVOA 2PGIA 1LPPA 3PNLA 1APBA 2QJTA 2ZEJA 3FVQA 3BZWA 5DHAA 2WSBA 3DQPA 4M8LA 3WGVA 5CEEA 4BO3A 1TK3A 1EFVB 4QJBA 4IGEA 3H9CA 1PUIA 5MGNA 2ZZMA 4DG9A 1PYOA 5TJ9A 1WU7A 5G4KA 1QYDA 2VPYA 2Z5FA 3DZFA 4QYTA 2VF2A 4AS1A 3ER6A 2WSSD 4UNPA 3SQDA 3F7TA 1XPUA 1VDZA 2PA3A 4TKZA 1EQAA 2BR5A 2VG8A 4QELA 3IDFA 3LLCA 3JS5A 5AKIA 4ZVNA 2ZR9A 4MIKA 4KX3A 2FH5B 5EQDA 5AIBA 1A3CA 3OF3A 3U3ZA 3ND6A 5DNDA 4RL6A 4C08A 2VQ6A 4NYIQ 3ZU3A 2IEZA 1CVRA 1SULA 1YKSA 1C0PA 3FVVA 3KPWA 4CKEA 1N5OX 5AKGA 2RGNC 5HFJA 3FNIA 5KCMA 4AS3A 4CGYA 3NR2A 4DMRA 3TLGB 2YHIB 1DKMA 3GAFA 1YC5A 1XTPA 2I1LA 3EJ6A 2ZU0C 3IEIA 4RELA 3FUCA 2JAHA 3TSAA 4DSZA 2WPNA 3HXPA 3M3HA 1SUIA 5EIEA 4MR8A 1N25A 1LNSA 3NPAA 4OY3A 1WXQA 1YVPA 3MHPA 2AG0A 4QARA 1JPNA 3MGCA 2AMLA 3D5QA 3OMLA 1D04A 2B82A 4D99A 1J8QA 1DELA 3L8HA 4MGYR 4F6CA 4KN6A 3VR3D 3MHTA 3O9VA 3DUFA 4NX2A 4EUSA 3LCUA 5AKEA 1EK6A 2Q5QA 1CWUA 2VLIA 4L9WA 3SZLA 4DTCA 2XD4A 3NHWA 5ECYA 2ORED 1VRWA 2R8RA 1MX1A 4DBVO 3HB1A 1XE3A 3UWKA 1PQ4A 3GEDA 2FFQA 2ZM6B 5BN4A 2O1EA 2SNIE 2XVXA 4FLFA 4QPDA 5BMVA 1EX6A 3SM3A 4PLWA 1TUEA 2FEAA 3TFWA 1R4AA 1GKKA 1F8GA 1A77A 2ID8A 3BL5A 3DAOA 1IN8A 1SU8A 3DEKA 3QPCA 4IQ0A 3SSAA 4Q1AA 4WZAE 1NVFA 4QU0A 4V0ME 4TRMA 1MEJA 2GNPA 3Q72A 5EHNA 5GM2A 3S2ZA 5GOZA 3MGBA 3Q4GA 4RZXA 3TNFA 4H6WA 3MVEA 4NS1A 3EDMA 4I50F 3VISA 2AC7A 4GI7A 3DE1X 2ZBDA 4JR0A 3N8DA 1YK1A 3TOZA 5AVRA 4Q9LA 1M6WA 3EX7C 1RLJA 1QRSA 1ZMXA 3M6IA 3RABA 4AYWA 2HHAA 4OK3A 3KCNA 3WI7A 4D2IA 5B3JC 4N7MA 4ZZ3A 4LGCA 2WILA 3I32A 2VH5R 3JQRA 4MS1B 4RY2A 1TUGA 3BD6A 5FADA 4JROA 4B09A 5JYCA 2Z1NA 3UC5A 3LBHA 4CCSA 3JQ8B 5HBRA 5LD2C 2FPSA 2DWQA 3KV3O 4XIFA 4DS3A 3L0SA 1IZ8A 3JQQA 4GPD1 4OYLA 2PS0A 4KFRA 4L7VA 1HI9A 3UK0A 1MQSA 1L8AA 3II6X 4Q9KA 5A4DA 3VR4H 1AUOA 3C5VA 4FMDB 4UAGA 4X45A 4OU5A 1XD2B 1VGRA 1HDEA 3ZEIA 4OH1A 5LNK6 4Y9SA 2NO1A 1AHHA 4FM9A 1E3MA 4Q9IA 2V4UA 3PKIA 1ACMA 3RSCA 2ABWA 2FFBA 4MLPA 1L7DA 5LFAA 4EPWA 4ZVRA 3OLVA 2PHZA 1TB4A 1NR7A 1P7YA 2R8XA 4JR1A 2RHOA 2PAFA 1PK8A 3OLQA 4MGZR 4NU0A 1AGYA 4E5YA 1XHLA 3G17A 3REQA 4MV4A 6ABPA 2RKBA 4XLTA 5FL7A 1NN1A 2OORA 1E6MA 1E1CA 3OTIA 5IYZA 1E3DA 1WCWA 3RRFA 4CETA 2J6BA 4AMGA 3STWA 2ZWMA 1P1FA 1FZQA 3PTLA 5KJ1A 1J5XA 4QZVA 2ZTMA 2KW5A 1R8QA 2CNWD 3H3XA 1NF8A 4G9EA 2VYCA 4JELA 2KLBA 4YFYA 3V1UA 2LCFA 3C3KA 1KTIA 4BNYA 1GIAA 4HVAA 3L6UA 1FFXB 4M89A 3F3SA 3G8BA 2JLBA 3AR3A 3IB3A 1QYIA 4KAAA 3ILXA 5BWNA 5KX5A 1LLUA 1B8OA 1A8QA 1PKEA 1DBWA 2EFHB 2WINI 3RC9A 4JI0B 1DBRA 1UBMS 4C20A 1HTBA 1QGED 2JHFA 1NFQA 2DULA 1QKKA 4X6UA 1JW9B 2HBZA 2Q1SA 2CFCA 1CFZA 3ZE1B 2ZTUA 1N6KA 4Y1RA 3ZIAD 4EYSA 4H59A 3QYPA 2X0JA 4I1RA 4JKIA 4RE6A 4WKBA 4PN7A 2Q5EA 2G72A 2EJTA 3BIJA 5TJHA 1OGJA 3RW9A 1EXVA 2EAUA 1X0VA 1OWOA 3NORA 4M1TA 5C1PA 3QYAA 1WOYA 4LKRA 4LV6A 3P2JA 5CVDA 5B1SA 1IG0A 3K0FA 1GLNA 3M9LA 5JROA 4YASA 4R7GA 4QGAA 1E18A 1T9GS 5EZQA 3U3MA 4BMOB 2EIXA 4UTVA 3TSZA 2ZIGA 4UM8B 2PEYA 4EL5A 3P4XA 4NV0A 2GD0A 4HAWA 4QU5A 4TUYA 2PD6A 1ATZA 3BRCA 5C5DA 1YVRA 3GH1A 3JD0A 1LVGA 2UVPA 4K3UA 4ZC8A 4IR7A 2XKBA 4KPUA 4R7ZA 4LOAA 3ZI0A 1TQ2A 3RU3A 2GH1A 2XIJA 1BEEA 3ORFA 1MC4A 5DISB 2HO4A 3OX3A 5CVEA 2VHYA 1VIMA 1KY3A 1VJRA 3MQ4A 4FS8A 5I7AA 5DI3B 4HEA6 3URMA 1TQHA 3RHTA 2CXPA 3RSHA 5DZSA 2IUYA 1J0XO 5HCNA 1ECGA 1LDNA 4ECEA 3QXCA 1O0BA 3DONA 3UOAB 1Z17A 2PXAA 2NSHA 3TPFA 1J2YA 1EA7A 4EJ2A 4Q9HA 2VDQB 3TQHA 3PYMA 3UAGA 4BDSA 3HKCA 1TQ4A 2PR2A 2XOEA 1TM5E 3RIMA 1WTCA 3AR8A 1KEEA 4P54A 2W6JA 1H4VB 3OCCA 3OZTA 5AUNB 4FD2A 1J33A 2CE7A 3HVIA 1WHTB 3ROPA 5KTKA 3CSDA 4R2IA 1SHLA 4OF4A 3RS4A 4B3SB 5DHSA 1R6BX 5DNAA 2G9RA 3RSSA 5FEMA 1XWFA 3UHOA 3UXEA 1CK4A 1N9KA 1ZZEA 5HTOA 2YJ3A 2YV1A 3G02A 2G04A 4MRAA 4I1VA 2E18A 3KP1A 4G4GA 1RZRD 1CZNA 1XIVA 1CZOA 1KWKA 1O08A 4AICA 5K51A 4QD3A 4H2DA 2D2IA 2YXLA 1PYDA 3HFJA 3E70C 3PE4A 4JLNA 3O2QB 3ZY5A 3PC3A 1XNQB 3JZAA 4RTJA 1EGHA 3GNQA 1DO2A 1Z2PX 1PJ2A 4AF6A 4ENRA 3FFTA 4MI3A 3ZS9A 3FYCA 5A03A 1L6RA 3BRQA 4Y2HA 1NNSA 4JUCA 1X7HA 5AFSA 4TXHA 2YCBA 3BMOA 4B7CA 4DIOA 2YVUA 2RG1A 3L7JA 4GX1A 4V1CA 2DF8A 1U4SA 3GLUA 1EUYA 2GFQA 3LP5A 1H05A 3PI6A 1Z0DA 3PDIA 4HF7A 4M2LA 5F5LA 1T4GA 2L42A 4QGGA 1TEXA 4G3XA 4MJLA 4B46A 4R9VA 5ELMA 2OPHA 1ONSA 2IH2A 5FV7A 3T3OA 3G6KA 5FHRA 1U9ZA 1BKYA 3ZW8A 5AXCA 1BVUA 2BGJA 1J23A 2QU7A 1L4GA 5C0OE 4EY8A 2WAOA 3I6BA 4RM2A 2ZRHA 3MCVA 1OBVA 2NNWB 3AM3A 3KHUA 3RK0A 2RCYA 1LK7A 3H0EA 4FMCB 3UH1A 1BNCA 1V39A 2VJBA 1Z0AA 1DSSG 2A5YB 1EVEA 2Q21A 3G5AA 2I4MA 1ZW6A 2TYSB 3RIYA 3TGWA 4KR0A 3D8TA 3LBNA 1KDOA 3PQDA 3FDXA 3CZRA 2VJDA 1BE6A 4JB3A 2CXSA 3PGKA 2ZROA 2FAXA 3CC8A 3FPHA 3PC6A 3MAJA 3ORSA 4HAZA 1JEDA 2HJSA 1UK9A 4M0LA 3CY6A 3I05A 3MWKA 3KSAC 1PJCA 2GBFA 8ABPA 3EY4A 3AVVA 1E7WA 3QVMA 4NYMQ 1NLMA 4RA6A 4H16A 4B45A 3KB6A 3L7BA 3OTOB 2EQ5A 4TM7A 4C88A 2CBGA 3NBKA 2D06A 2G70A 1SOAA 3O1IC 5I3ZA 1C9NA 4MH0R 1KC1A 2J7PD 3DHYA 1Z0KA 3SP1A 2OY0A 3U3KA 4AYTA 2BKUA 2ZSEA 1CY6A 1U2DA 1WDMA 4HP8A 3EDRA 1ZBQA 3LCMA 4TWBA 3W8EA 5CEJA 5CITA 2QSUA 1C0LA 1Q3TA 4CKBA 4O5OA 1Z7GA 3H5RA 3JVEA 1MB9A 2WW8A 4K9SA 1FLVA 2OO3A 5JBNA 1SEVA 4RM3A 2H65A 2NYAA 3ZWVA 1YJ8A 2ONCA 4EHAA 4KVAA 5DI3A 3IL2A 3TZCA 1IM5A 2MT9A 4JVLA 2YIDA 4JU9A 3AVOA 4KYIB 3WK5A 4AKGA 2I4RA 1NNI1 1HE2A 3C87A 3KZCA 2IC5A 3KJQA 2B9EA 3C5EA 2CD7A 5BT9A 3DKRA 4H15A 2ZRCA 1V5EA 3K2BA 3L6OO 1ZM9A 3I2IA 4HNRA 4OBXA 2W42A 1DKLA 4JQCA 4EKEA 4P33A 1ODTC 3BJEA 3EWIA 4IV8A 2D1SA 4C07A 4DDMA 5AD1A 2P2GA 2QP9X 4CMEC 2GCPA 3KUKA 2AOUB 5E9AA 2CBXA 4L08A 2PN1A 1QGZA 3EZXA 1EFHA 3FWPA 3Q6IA 1KJJA 1UBKS 4CM9A 1GG8A 2OZLB 3B9RA 3P45A 3K5HA 4B4UA 5JY1A 4RTSA 1JSCA 1G2QA 4MV5A 2EYQA 2OGUA 1G20A 2A0YA 5EY5B 3SC2A 1PJ4A 4JP8A 2JBHA 4KKXB 3G89A 4NNOA 3NHBA 4V0RA 3ZWPA 1CY1A 1MA3A 1NAHA 3S2FA 1AQJA 1EXMA 2PZJA 4YMSA 4FOLA 4YR9A 3BF7A 3K73O 3ZQKA 3E2MA 1R4NB 5IC5A 2RCNA 3LPCA 3A6HA 3OTQA 3NIBA 4GX5A 1YDEA 4FFBA 4MLZA 3EBOA 5CDFE 2JBWA 3MRVA 4EG5A 5GM1A 3GLIE 2O4CA 3WNBA 1QZTA 3A9SA 3LTNC 5FNVA 3KEQA 3TZEA 2ZJ0A 1GCOA 4W6ZA 1PFWA 2BY4A 2A84A 2HA4A 3Q9LA 1F2UA 1VSVA 5FNVF 1SU4A 2A5GA 2A5FA 2ZWOA 2GAAA 2W93A 4TWAA 2CF6A 4C0QC 1GP2A 1DOHA 1K3FA 3DZCA 3GWGA 4ND4A 4LMPA 3OZVA 4F4FA 2JJ8A 3D6TB 3HU2A 3UJAA 3H8VA 2W2LA 2VOEA 3HEAA 2CNKA 4L57A 4BWVA 3DBLB 3R2JA 4M9RA 5SZKB 2C4NA 2FI1A 3ROTA 4JLOA 1UWVA 3FA2A 3IPXA 3MWDA 1FP4A 1EG2A 2GZDA 1GPBA 1C8BA 2HA2A 2OFOA 1BXGB 3LNCA 5ALWA 2A0WA 3GUUA 3KOYA 5LN1A 3QITA 1AMNA 1A2OA 1I2DA 1O89A 2X86A 2D8AA 2YFQA 4Q01A 3HVKA 3H3FA 3IIKA 5IJZA 2F8TA 1EDDA 4FMCF 1NBME 4K9RA 4J1TC 3BHJA 2JS7A 3KSRA 1EUCB 3MCUA 3LH5A 4HO1X 1PDOA 5CLHA 4DREA 1EZZA 2AJLI 1ZITA 4RS4A 1M3SA 2Y93A 2IJGX 1U5AA 2ONJA 2QNIA 3TYXA 2RHRA 3I52A 4B3CA 1BKDR 1HE5A 5FV4A 3FW1A 1KK3A 1FLNA 1Z68A 3OIGA 4JP2A 3CU5A 4BAZA 5EZSA 2RBEA 2P35A 4LAFA 4WESB 1M34B 3EA4A 1E2MA 4WV3A 4BQEA 2ZUFA 3BXGA 1QOQB 1U7HA 4J16A 1ONPA 2B2CA 4KFUA 1T1GA 3LCVB 3P0EA 2VDKB 1H2YA 1VDMA 3TGPA 4RFSB 2TMGA 5KVCA 1N4DA 1E4OA 3SHVA 4BNDA 5KYWA 4KQ6A 1XRSB 6REQA 2O48X 4TZ0A 4BAUA 5F76A 4QUBA 2A5LA 4DM3A 3GZ4A 4JLJA 9GPBA 3OHMA 5F3RA 5T3YA 3AJ9A 4W8GA 2V59A 4ILEA 4PSUA 4Z2AA 5KKNB 2JLXA 1C8VB 4BLWA 1FUKA 4F0JA 3B48A 3CRW1 1MB4A 2ZZKA 4WUVA 1M1NB 4DA6A 2OECA 1U2GA 2WFZA 1F9AA 2VHWA 3O74A 4NG4A 1GV1A 2G07A 3MCZA 1MEEA 2KYRA 2V7WA 4QFMA 4CG1A 2ZRQA 2D5AA 2PH3A 2OGTA 1BS2A 3K72B 1JBEA 1VM6A 4TMVA 4IINA 4CT5A 1KRWA 4F97A 3WMEA 5KNBD 3EPHA 3I04M 3RYFA 1IYZA 5JVDA 4UDXX 3WYCA 1DAOA 1J24A 2BP7A 3A1DA 1CVIA 3EULA 3NEJA 4FT4A 4HWOA 4PO1A 5EXTA 1OH7A 2GLTA 1SXJC 1PZHA 1HRDA 2F1IA 2OCBA 2QVCA 2DT8A 3P9IA 1XDUA 2R62A 1W4BA 2DHCA 3L7DA 5LA6A 4M9SA 4B34A 1A9YA 2BKLA 4JVSB 2POCA 5DGHA 5ILGA 4BKPA 3MGAA 1H6BA 3TLMA 4HUTA 5ICEA 3CGGA 3QTTA 5F3WB 3CF0A 3SYTA 1N2EA 4AG6A 3DC2A 5HKLA 2FF5A 5LQDA 2EEPA 5CJ2A 3MZ0A 3O4JA 1V7ZA 1TUBB 3AP2A 3HBJA 1SD5A 1WW3A 3QIVA 5AJXA 3TDNA 2B0JA 1VMDA 4YJHB 3OA2A 3I83A 3TQIA 3L7OA 3DEYX 3RT7A 3CZCA 1MNAA 2ZIFA 2A1TS 4QOHA 3IVRA 3PFBA 4EY5A 3Q88A 5HOQA 1U9IC 4N5HX 5JUWA 4XPIB 4ZTUB 1U3TA 2IDJA 2LR0A 3V33A 2M1XA 2PX6A 2Y1KA 3HZOA 4KGVA 1IDN1 3I73A 3DGEC 1ZJYA 3GDOA 4RF3A 1V43A 2F2TA 2OC9A 3IIEA 1GFIA 3ZZNA 4WUTA 3EOAI 2CHVA 2QS9A 1FSGA 3DFUA 3TX6A 2WKPA 3P9CA 2VPTA 3D6AA 4TXNA 3VRHA 4EW1A 5K3DA 4O6VA 1QNFA 1L4MA 3PPIA 3DZKA 2XZOA 1NJ8A 1I3MA 2HCTA 2YHUA 3ROMA 3VH2A 2J5KA 1BU5A 1I3NA 2A67A 1IWPB 4QXAA 3GU3A 4G81A 4KO1S 4EPYA 2BRUC 5J2TF 3QPUA 4DCJA 5K9ZA 1UZNA 3HABA 1A72A 2O7NA 1ORRA 4PZPA 3ZXIA 3CVUA 3QX3A 5HM6A 3IP3A 1UQTA 4LV8B 4UNQA 1KAHA 3UWPA 1A9XB 1V8FA 1UBHS 3M4JA 4XM2A 3RM3A 2IW1A 2DBRA 3OPNA 3SOZA 2L0XA 4DLLA 1PX0A 5H8WA 3LWNA 1TU0A 3GJYA 4NEQA 4BLQA 1C30A 1TECE 2W2NA 1OYOA 2R11A 4J2HA 1JBQA 2RGCA 1YZTA 2XYGA 5ALDA 1Y7TA 3QOXA 1G42A 1U6IA 4H18A 3GLIB 4FZ3A 5AXDA 5P21A 4LI3X 1PQYA 1ZESA 4H17A 3O6VA 1JLSA 2YY5A 4OA5A 5K6RA 3DWGA 3VTZA 4BP9A 1KPGA 1FDRA 2REQB 3HNOA 1E7RA 3OWHA 4Y6QA 2ZAIA 4HV4A 1SHTX 3CUSA 3A2MA 1CZHA 3UJ8A 4LRWA 4NY1A 3COVA 1DMSA 2CBZA 2FWMX 1N3YA 2YS7A 3O7WA 4KCGA 5JSZA 3I72A 2AJBA 1QIIA 2OT3B 1T4CB 1SUCA 4HRVA 4BP8A 4G0MA 2TMKA 2CVOA 2W6QA 1C30B 4KAFA 4XWAA 4C3OB 1SK8A 5INTA 2BEUA 1CJMA 1G64A 4RH0A 3WJ7A 1SQ5A 2FN3A 4CDNA 2IKQA 4D41A 3OKFA 3A9CA 1YB5A 3P71T 1F48A 4ZP1A 3F98A 5IM4A 2J6CA 1WP4A 2W90A 4P7BA 1GUYA 1ZSVA 3BGDA 3NBQA 1D6SA 3QMVA 4CCYA 4YRSA 1NX6A 1PTKA 2R1ZA 2QVBA 2GEUA 4AZVA 2E4WA 3E1SA 3I04A 2E49A 4ESOA 2O3QA 3UHAA 4ECAA 4BO7A 4HTFB 3GO4A 2O8CA 3O8QA 2XYQA 4NR0A 2P69A 2D59A 4OMDA 4UTRA 2VT7A 4X71A 1TM4E 4F45A 3GZNB 4Q3BA 3RRBA 1T26A 2PLFA 4DLUA 5EIBD 2DSTA 3ZVKA 4A36A 4BNUA 4TLDA 2ODNA 4E5NA 4YALA 4C4YA 1Z5PA 2AJTA 3GUZA 3IMGA 4WCDA 5E1OA 3CCCA 4EQZA 4FI3C 3VPCA 3NFYA 3UENA 2PR7A 2TRSB 2DXIA 4JLVA 4CMGA 1P1RA 3UUFA 1FNCA 1WULS 4UREA 4LXQA 5CH3A 2XPCA 3D8RA 2G9UA 4HUJA 4I6JA 1NGSA 1HPLA 3WP0A 5AICA 4BXOA 2XOKA 1P4GA 2KX7A 3EXHA 4B1FA 2A7QA 5JATA 4Q39A