1EG2A

Crystal structure of rhodobacter spheroides (n6 adenosine) methyltransferase (m.rsri)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
279
structure length
270
Chain Sequence
b'GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structure of RsrI methyltransferase, a member of the N6-adenine beta class of DNA methyltransferases.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 90
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1eg2A00
5CIYA 4EQZA 3GJYA 2XYRA 3CKKA 1R00A 5EG5A 3CJRA 2H1RA 3C6MA 2GH1A 3VC2A 4GC9A 5K0EA 1QANA 3ME5A 8MHTA 2ZWVA 5K03A 2H11A 4BP3A 2ZTHA 4Z2YA 3KR2A 1AQJA 4KDCA 4P7GA 4B17A 2ZBQA 4DQ0A 5EMLA 3KQSA 3HCFA 1FBNA 1NW6A 2E5WA 3G7UA 4RVFA 4WXHA 3DXXA 3NDIA 4A6DA 2PT6A 3JWJA 3THRA 2C7RA 1BOOA 9MHTA 3KPYA 2OXTA 2GPYA 3M6UA 4JXJA 3OFKA 3I58A 2PV0A 5E2AA 4NECA 2QRVB 4AZSA 2PXXA 4OX9Y 1UIRA 2B3TA 1JG3A 1FP1D 2VDUE 3KR1A 4GOLD 5EIWA 5EOVA 5G02A 4DMGA 5K0FA 1JR4A 2HWKA 4QQKA 3R0QA 1XDZA 1IM8A 2AVNA 2HV9A 2PX8A 2WA2A 1G55A 2PLWA 3M6VA 3PS9A 2FPOA 1TW3A 2AOUA 3P2IA 4RX1A 1ZG3A 1WY7A 2NXEA 3HP7A 5FADA 1I9GA 3PLAE 2Y1WA 3BUSA 2DULA 3FUUA 4IV8A 5HFJA 4HGYA 1P91A 2CMHA 2AOTA 3B7PA 3C6KA 1KPIA 2B9EA 2ESRA 2F8LA 3SGLA 3A27A 5DM0A 1QYRA 2EFJA 3DXYA 4HG2A 4MIKA 4CKCA 3G2MA 3HTXA 3DMHA 3EVDA 4OA8A 4M38A 5EIFA 2B2CA 1JQ3A 3GIWA 1PJZA 2O05A 4PGGA 2ZCJA 2XVAA 1XCJA 2EJTA 3NVKI 3KQMA 3A4TA 3P2KA 4U7PB 3B5IA 3U81A 2NP7A 4AX8A 1DUSA 5EHIA 3FTCA 1G6Q1 2B78A 1XDSA 2JHCA 1VPTA 2QM3A 1VQ1A 4PYLA 3MGGA 2G8NA 4PYNA 5E8JA 3TKYA 3UA3A 3MTEA 3G8BA 3WSTA 1JQEA 2PT9A 5EKXA 4BLUA 3FUVA 5CCXA 2BM9A 2IBSA 3DULA 1SQFA 1VBFA 2PY6A 3F4KA 1FJXA 2OPBA 3H2BA 4DZRA 3Q7EA 3MCZA 2JH9A 4EVIA 3B3FA 5DX1A 3HNRA 2P40A 2G71A 3I64A 1F38A 2OZVA 3E23A 1VP3A 3MERA 2H00A 3O7WA 5EVJA 2O06A 3BWYA 1KYWA 3BZBA 1D2HA 2BM8A 5GIPE 1QAOA 2V7EA 3BWCA 1ZKDA 1MJFA 2CKDA 5LSAA 5DX0A 5K0BA 3DXZA 2PXCA 3T7RA 3LKDA 3KKZA 1NKVA 2ZFUA 2YQZA 3C3YA 3FPFA 3UJAA 1KXZA 3CBGA 4E2WA 4L7VA 3Q87B 1YB2A 4P58A 1P39A 3OE4A 5CVJA 3BKXA 5DSXA 1D2GA 3QOXA 1O9HA 3UJ6A 3R6TA 2A14A 5JUWA 4V0QA 2BR5A 2NXJA 3KHKA 4GOOD 5CVUA 3KQOA 2AOWA 2EX4A 5FHQA 1P1CA 4X63A 4YMGA 3E8SA 3DR5A 3ELYA 4GUAA 5EZSA 7MHTA 5F2NA 3FPHA 3DMFA 1D2CA 3K6RA 5T67A 5K01A 3DH0A 4C03A 1RJFA 1I4WA 4O29A 2CMGA 3THSA 3TLJA 3LHDA 4RYLA 1EIZA 1TW2A 5GIOE 4IWNA 3UJCA 3DUWA 5ICEA 2YUIA 3NVMB 4QVKA 3C3PA 1ZGJA 3LL7A 4DCMA 4FT2A 3BWMA 4YUWA 5BW5A 1RJDA 1WG8A 1JTEA 3LSTA 1RI3A 3EGIA 3SR4A 3A26A 5LQJA 3HVIA 3P71T 5GM2A 3SX0A 3LECA 4FT4A 3FPGA 4EK9A 5CVEA 1NV9A 5E9JA 4M7RA 3A7DA 3PX2A 3IEIA 4C4AA 4P7FA 4QPPA 2G1PA 3BXOA 2AN5A 4RTPA 3KQYA 2I9KA 4PINA 1KPHA 5FHRA 5EKUA 3CJQA 1L3CA 4DKJA 4R6XA 4X60A 1M6EX 2ZZNA 4CWAA 3TRKA 2YVLA 4H0NA 4RSRA 4P7JA 3KPUA 2ZBPA 3TR6A 3FZGA 1SKMA 3RIEA 2QRVA 1HNNA 1FPQA 3DOUA 4OQEA 5E1MA 3LDUA 3OU2A 3GRVA 3G2PA 2CL5A 4ER7A 5DTQA 3HVKA 2ZIFA 3MB5A 5GP1A 2PX5A 3BGIA 3P8ZA 4MHTA 4RTRA 3IHTA 1L3IA 3FYDA 1SQGA 4HGZA 3SXJA 2C7PA 3R9XB 2AN3A 2AVDA 3NTVA 5HIKA 1G8SA 1P1BA 1BHJA 1R74A 4CKEA 2NNWB 2CWWA 2LD4A 4BP1A 5E1OA 2FYTA 5GWXA 2VP3A 2GLUA 3KQTA 4CKBA 2PSSA 2ZWAA 1KPGA 5E9QA 4BLWA 5LQRA 1EAMA 1NW7A 2NXCA 3AY0A 3EVAA 2UYCA 1L1EA 2WK1A 2OBFA 3P9IA 3D2LA 3FRIA 4ER5A 3L8DA 5DRTA 4PIMA 2V74B 3KU1A 2UYQA 3LCVB 3UJ8A 4YUZA 5EC8A 4ISCA 1XXLA 3T7TA 2PXAA 2IH5A 4GC5A 5ICGA 3GRYA 5EHGA 5F2OA 3GRZA 1NE2A 2EG5A 1RI4A 2XYQA 5FA5A 3HCEA 4X41A 3ELUA 4XUCA 4EKGA 3TFWA 3HEMA 4RTKA 4PYQA 4IKPA 4KDRA 5GM1A 2AS0A 2YXLA 3FPJA 1FP2A 2VDWA 2ZVJA 3GRRA 2OO3A 3KQWA 4KVZA 1TPYA 2IIPA 2P35A 3NMUF 2JHPA 1JSZA 1M6YA 1XCLA 4M36A 2GAFA 2YTZA 5F2KA 4LECA 5BP7A 4RTNA 4GF5A 4PGHA 1JSXA 3GDHA 4FZVA 4KW7A 4MTLA 1YZ3A 3FYCA 4CXMA 5KQSA 5EGSA 5DT2A 4C08A 3NW9A 4RTMA 3NDJA 5DTMA 3ER8A 5C9ZA 5JR3A 3HA3A 4ZTBA 5FULA 4FSDA 4BLVA 4E33A 3HCBA 1YF3A 3DMGA 3PFHA 2R6ZA 2ZIGA 4MQ4A 3JWIA 5CVDA 2EJUA 3CCFA 2ONZA 2QY6A 1X1BA 5EPEA 5IH3A 4QQNA 3LKZA 4KIGA 4FGZA 1KIAA 1RI5A 3BKWA 1Q0TA 3HCDA 5U4XA 5E9WA 3EVEA 2IPXA 1RJGA 2WA1A 1ORIA 5FTWA 2ONYA 5FWAA 2P8JA 1R18A 1KP9A 3A7EA 3OZRA 5H02A 4FSXA 1MHTA 3GU3A 3KQPA 5T6BA 3TMAA 1X19A 3O31A 4RTQA 2ZBRA 3AWIA 3EEOA 4FR0A 3QOWA 2O0LA 3ERCA 5E1DA 2AR0A 1ZGAA 2ZZKA 3V97A 1QAQA 3CC8A 5DX8A 3TQSA 3JWGA 4X1OA 3MQ2A 3T7SA 2XVMA 1JQDA 1F3LA 2C7OA 1IXKA 3SSNA 3TKAA 4IV0A 5EEGA 3HM2A 3X0DA 5BXYA 5M5BA 4DF3A 3ELWA 2P3OA 3LCCA 4FP9A 3OCJA 3G8AA 1X1CA 3HCCA 4E31A 4R6WA 2P7HA 1I1NA 4XCXA 5KVAA 4DA4A 2ZLBA 3G89A 4KIFA 1RJEA 1KHHA 2AOVA 2HNKA 3AJDA 4PWYA 4QDKA 4Y2HA 5DPMA 2YR0A 5E1BA 1YFLA 3FTFA 1IY9A 3GXOA 3E7PA 3HA7A 3JWHA 2KW5A 4QVGA 3UWPA 2JHAA 1O9GA 4E2YA 1QAMA 2PKWA 5MHTA 3EVBA 2I7CA 5DXJA 4RVGA 1JTFA 2GB4A 5EEHA 4KWCA 4CTKA 2Z6UA 1OR8A 3LDGA 1M0EA 2NXNA 3SSMA 2UYHA 2QYOA 1EQAA 3GNLA 4PYKA 2IBTA 4HTFB 2YXEA 1VIDA 3AXSA 1XTPA 4E2XA 3KR9A 1NW5A 3G5LA 2Y1XA 4LG1A 1Q0SA 3GGDA 3PX3A 1KYZA 4MWZA 3B3GA 5DSTA 3I53A 4AZWA 2P7IA 4QTTB 3CJTA 2N47A 3C0KA 3HA5A 4FS8A 3T0IA 3TM5A 1VP9A 1WZNA 2OB2A 2ERCA 2Z6QA 5LQNA 3MCTA 4DCGA 5D1HA 3GWZA 1JG2A 5FQOA 2O07A 4OBWA 4YV2A 1DL5A 3OZTA 3PVCA 1AQIA 5ERGB 1WS6A 4EMSA 3DP7A 5BW4A 2XBMA 2OYRA 4YV0A 2NP6A 5K0JA 5K0LA 1NW8A 2ZZMA 2AZTA 2P41A 2ZULA 3G2QA 1SG9A 2UYOA 3PT9A 1V39A 3QV2A 1AF7A 3P9NA 5K0NA 4PIPA 4E2ZA 5HIJA 5K05A 4CTJA 3FTEA 4QDJA 1R8YA 5C0OE 5K09A 2UZ4A 1L3BA 2VS1A 3EVGA 5EQJB 2G72A 3P97A 5GINE 1EG2A 2FK7A 5DM2A 3CVOA 2PWPA 5FA8A 2AOXA 1NV8A 4GQBA 2ZSUA 5HOQA 4RV9A 4GBED 5HEKA 5T64A 5HZMA 3PB3A 1QZZA 1R6AA 2FHPA 2IFTA 1JG1A 3O4FA 4XUEA 4F85A 5LQAA 3UJ7A 3UZUA 3VC1A 1YUBA 2IDKA 3LGAA 4E30A 4R8SA 2XYVA 3V8VA 1HMYA 4R8RA 4M37A 4WVLA 1VLMA 3OFJA 4AUKA 2BH2A 3OPNA 2JH8A 3BGDA 3R24A 4KRGA 4HC4A 4YMHA 3ER9A 1YFJA 5EMKA 1RI1A 1KR5A 1N7IA 4K6MA 4E32A 2P1DA 3ELDA 2IP2A 3UJBA 2P3LA 1WXWA 5CVVA 4OA5A 1WXXA 2O57A 2Q41A 2B25A 1XJ5A 2IDJA 3ANXA 4PYJA 5LQCA 2PX2A 2JG3A 2FRXA 4PCAA 1X1DA 3EVFA 3FPEA 4V0RA 5EZQA 3FTDA 1INLA 3DTNA 3LDFA 1NBIA 3LBFA 3FRHA 3KPWA 4AZTA 2QE6A 3BGVA 5FUBA 3AXTA 1XDUA 1PRYA 3B3JA 3I5UA 3EPPA 5E8RA 4HSGA 1L9KA 5DRYA 5GOZA 3OE5A 1EJ0A 10MHA 1VL5A 3KQVA 2GS9A 3B89A 3SM3A 1UWVA 2AN4A 3NWEA 4QPNA 2IH2A 2VDVE 4ER6A 4LWPA 1N2XA 5DM1A 3UA4A 5D1NA 5LQKA 5CD1A 4RTSA 4RVDA 3ORHA 4OBXA 3VYWA 2C7QA 5EMMA 2ZW9A 3OU7A 2AOUB 3EGEA 5B1SA 3KPVA 3UJDA 2PGXA 3UFBA 3G2OA 5KQRA 4E70A 3UBTA 3A25A 3M33A 1VE3A 3PTAA 3I9FA 2PVCA 2AOTB 3M4XA 5ICCA 1Y8CA 3EEYA 2I62A 3NJRA 1R8XA 1X1AA 3M6XA 2JJQA 1SUSA 1T43A 2K4MA 3SVZA 3MAGA 1O54A 3HVHA 5HILA 4GOMD 3FUTA 3RODA 1U2ZA 4POOA 1G38A 4HH4A 4G56A 1B42A 4PONA 4RVHA 3NWBA 2PBFA 5CM2Z 3HCAA 5KYGA 2NYUA 5CCBA 4ATNA 3P9KA 3RW9A 3SSOA 4BY9E 3LPMA 3DLIA 1YZHA 5K0GA 1AV6A 5HIMA 3FUXA 1RI2A 3OU6A 3IYLW 3EMBA 1ZQ9A 4A6EA 3BT7A 4RTJA 4DM3A 2HR1A 4YUYA 3DLCA 1G60A 4GEKA 4PCLA 5LQUA 2PX4A 4QTUB 3FUWA 3REOA 5IKMA 1H1DA 4ER3A 2GA9A 1EJ6A 3GO4A 5ICFA 3R3HA 1BKYA 3KPJA 3M70A 2ZIEA 3EVCA 4C07A 1ZHFA 1SVUA 2ADMA 3M6WA 4HTFA 1G8AA 3MTIA 2BZGA 3LCUA 3GRUA 2BR3A 5DWQA 2PJDA 2ORED 3G88A 3PFGA 3EMDA 3SMQA 1NW3A 4EKIA 4ER0A 2IGTA 2OY0A 3GCZA 4PYIA 2FK8A 2R3SA 4UOEA 4RTOA 4P7KA 5HIIA 4PYMA 3CGGA 3K0BA 4YUXA 2YXDA 4YUVA 3TPZA 4YV1A 3ID6C 3LX6A 1BC5A 4PYOA 5EMJA 4OQDA 4X61A 5FWDA 3OZSA 2PWYA 5K0CA 2YX1A 5DXAA 5KS2A 5LR6A 2IH4A 3TOSA 2Z6AA 5DTRA 2HMYB 4C06A 4F86A 5C1IA 3P2EA 4LWOA 4C05A 2P3QA 3G5TA 4C04A 3BWBA 2BR4A 3EGVA 3HVJA 4R05A 5FQNA 4HRAA 3IV6A 1N7JA 2G70A 1DCTA 1UFKA 3E05A 4GOND 5CUQA 2DPMA 2OKCA 2VZ9A 5DM4A 4F84A 4PNEA 3EVZA 3S68A 1SUIA 3KQQA 2OB1A 2I6GA 4RTLA 1Z3CA 3LBYA 5FCDA 5P8WA 5K8VA 3P9CA 1ORHA 5DLYA 4U7TB 2HTEA 4AZVA 3VSEA 1JG4A 1NBHA 3KR0A 4Y30A 3MHTA 3TM4A 5E2BA 1XVAA 4XUDA 2FCAA 4RWZA 3UJ9A 1NT2A
chains in the Genus database with same CATH superfamily
2PSHA 3II6X 4DUZB 1WDWB 2XB2A 1WXDA 3L7LA 4U02A 1ELOA 4QUJA 3LQFA 2GETA 4BVAA 1A8PA 1QHSA 3O8DA 2I78A 2Q4DA 4A10A 3TSOA 5ANRB 1G2PA 3M1AA 3FM9A 3FJOA 1N5RA 2JW5A 2ARKA 2FR8A 2GVZC 4IYJA 4J3NA 3WBFA 1AQJA 2O3JA 4TS3A 3TQSA 3ZWKA 5KOHA 1HZJA 2FN3A 1FSGA 3QTBA 4MKZA 4IUYA 2X5XA 4BUCA 5BR4A 4TWBA 4ZVVA 3G2NA 2GJKA 2HWUA 1NQOA 4US0R 4AN4A 2KBEA 4DSTA 1GLGA 2VZ0A 2F1KA 3CRRA 3OC0A 2AFHE 5DJ5A 2C8VA 1FFYA 2QRVB 1E3QA 2BE7A 3GCDA 4TMXA 4N39A 4QDXA 3AF0A 4HYQA 4AZSA 1GDTA 5JD4A 2VDUE 5LP6F 1P2TA 2X58A 3I4CA 3OC6A 3CW8X 4IXTA 1GZ5A 3M6VA 1CUSA 2PX8A 3EDQA 2AOUA 3GQBB 2NXEA 1UZLA 1X7GA 1RNLA 2W4MA 3NTXA 1VLVA 5HFJA 4KIUA 1ISSA 1P91A 2WNHA 1Z8NA 1P5FA 2X8BA 1PFWA 5IK2A 5BV2P 2CCGA 2ZAOA 1XQYA 5DM0A 3SDZA 2YCLA 1FTGA 2OD7A 5TS2A 3BAZA 4YCAA 3OZWA 2FPIB 2HY7A 3AUYA 3TTXA 5IAAA 4RV4A 3H1FA 4KI0A 4BFLA 2O05A 1NQXA 4O3MA 7REQB 5JRJA 2IY8A 1Y4DE 2FPPA 2VRWA 2FLWA 4K6OA 4TQ9A 1E2KA 1K0UA 4GXQA 3GZ4A 3Q11A 4BOYA 3ZH9B 5KWIA 1F60A 4E11A 2W58A 4H7KA 1YCGA 3QHPA 4LE1A 5JVDB 4G8CA 5C5EA 2ZI4A 1HUQA 1QYWA 3AEQB 3C1AA 4NBRA 4B6FA 1GGNA 3GPIA 5AJXA 3AUFA 4ETNA 3GG2A 3OKCA 1WCIA 4M8NE 1OH5A 2BKUA 2JFPA 4RK0A 1D8AA 3F6BX 1R16A 1R4NA 4OTZA 2B82A 4EYQA 5CFPA 1CTQA 3L8ZA 2P75A 4IAOA 1YASA 1H4QA 2WMNB 2R0QC 2PGLA 4CKWB 4BPRA 1FUUA 3IOMA 3BZBA 4R68A 1CUWA 1YZVA 2OSBA 1GRCA 5LSAA 4LV6A 4BKPA 1NQWA 2P0AA 3ZUPA 1Z2EA 2XNDA 4WBNB 5FEUA 2ADFA 4B2YA 1HH4A 3ZZNA 1PDVA 3ANSA 2WU4A 4YP5A 2BFFB 1HYGA 1KMHB 4HLQB 3AFGA 5TQ0A 2I6QA 2WDZA 5KYYB 5CH5A 3FPFA 4LCJA 1KXZA 1XRQA 4E2WA 4O1MA 4AMVA 1P9WA 2C4HA 1BDBA 1YB2A 4Q1DA 221PA 3BKXA 2ZI3A 1E66A 3B3AA 4GRIA 4MPRA 3E4CA 2YCBA 5C1DA 4GOOD 4YMLA 2GCNA 2HA0A 3AYXB 4UU7A 5DW3A 4O0MA 3NP9A 3SYKA 3NETA 3B6JA 1DUIA 5MFPA 2R8PA 3GT3A 3TZ6A 1GQYA 1U0SY 1WXGA 2QL6A 4WKPA 1T3ZA 2ZJ3A 1JXOA 1JU4A 2OAQ1 4JH0A 1CETA 2DVMA 2ZJOA 4F21A 3C3MA 4ANFA 1I7PA 1L7BA 1MEJA 2O2XA 4BMDA 1NI5A 2CF6A 2D1SA 2PUDA 1T9ZA 5JQWA 3UHAA 3HI6A 4KQJA 1B93A 4NZ9A 3LL7A 2QP4A 4MV6A 4EG1A 2TMDA 5IN5A 1WG8A 4QKQA 1JTEA 1NXWA 4G0OA 4MCJA 4X90A 3C4JA 1TX4B 1XXHA 2IELA 3D4IA 1S9DA 3FLEA 3LUPA 3GXBA 2A88A 2WU3A 4RJKA 3TQHA 1W85B 3SX0A 4HDKB 5DMHA 3FPGA 4AG6A 3OZGA 3PDIB 2XGMA 3MWGA 3TLGA 1ZICA 1QCDA 2P2SA 4M7RA 5HJ7A 3T9DA 1B15A 3U19A 4QPPA 2G1PA 2D7CA 4JCOA 1EQ2A 1PNVA 2VP5A 2JK0A 2J46A 2AG1A 1MT0A 1KPHA 2C5EA 1VXRA 3IXMA 4TTPA 1LJUA 2CVHA 2JVJA 1Z0JA 3BB1A 4H0NA 1RMQA 2WJHA 2VHXA 3LQQA 2JCXA 4JLKA 4L3WA 4KPFC 1XLVA 1T0IA 3H6KA 4ZAXA 5AM5A 3LO8A 5AXCA 4JVLA 2X8WA 4EYGA 5FOVA 2PMDA 4XGQA 4FMDF 3EJ6A 1SU4A 1RHKA 2DFDA 3LK6A 4C6TA 5CFLA 1UT5A 3C3XA 1PNOA 3AESB 1Z38A 2RD2A 2EGHA 1EA7A 2VTVA 5LOVA 1KI9A 1XMPA 2A5YB 4FYVA 4JR1A 4GL2A 3GFPA 4MP6A 3T3MB 5C80A 2XSZA 2Z5FA 4NRDA 3X1DA 1R88A 1ZW1A 4EGSA 2JFWA 1A2OA 2CCKA 3VTFA 2FYTA 3T35A 2NNLD 3ZZ1A 1V45E 4FZ5A 3K5IA 3JR7A 1JKMA 4A5OA 1FNNA 5A1JA 2ON6A 3M6LA 2NUAB 5HKKA 3ROPA 4UQLA 1E20A 1ZRMA 1CX9B 1Q16A 1XZAA 2V74B 3MT9A 3U40A 4BC1A 3T3HA 2AZ4A 1F2TA 1PS8A 3T5TA 5CFOA 5HG0A 2O6LA 4TTAA 2LCQA 2QNRA 5A7FA 3ELUA 3JX9A 1I4OA 1NPDA 1PT9A 1TYDE 1C3VA 4MS4B 3ESDA 2AS0A 3HEBA 3QOYA 5GM1A 1IPHA 4RMGA 3X3HA 3GLRA 2GM5A 1NUSA 2BHNA 4C9BA 4BV9A 4ECEA 1UJBA 1PZMA 2J3QA 2WVJA 2I3GA 4ZO4A 3QU7A 2O2SA 5EUCA 2DCMA 5CU7A 1ORTA 4I6GA 4EJSC 1CR0A 4GBMA 2WHPB 3GUYA 4OUDB 1R8QA 1YIOA 1KVTA 1ZWLA 5LMUB 4AURA 1NR7A 5KYWA 2XQIA 3VGPA 1Q11A 4HQNA 5K8IA 5NULA 1JBEA 1JG7A 2Q0QA 4BKOA 1UK9A 2JNWA 4EFNA 4K5QA 1TKAA 1ZGZA 1TC1A 2LTAA 1K5PA 1QTIA 3KKEA 3P0JA 4R81A 4L8YA 5JS1A 3DMTC 2D8MA 1Z3IX 1MD9A 3ND8A 4PLYA 2HIMA 3E7XA 1JSLA 4ZZ1A 3R0ZA 1UJ6A 4NOKA 4P22A 4HGRA 4F9EA 1HE3A 3D3KA 1DZIA 4RZ2A 1CUBA 3LA6A 2CGEA 1EX1A 1S3IA 3CSSA 2NG1A 2B99A 2GN4A 1QDUA 3ECSA 4HLDA 1Z7YA 4ACAA 1ABFA 4JVOA 5D2CA 1QHHA 4C7OA 4YMUA 3WOVA 1A69A 5CB4F 5GOTA 1V1RB 4S12A 1Q50A 3UM9A 3PK0A 1ZGAA 2PUEA 1R0XA 1SUWA 4TKLA 3ONVA 4EJMA 1F3LA 2IYOA 3Q5GA 4DCPA 4CCSA 1MIOA 4MV3A 3V1YA 3RRXA 1RXSA 1J56A 4ES6A 4Q6BA 3H17A 3CZ4A 4MYRA 5JECA 1A8SA 1JKIA 3O8LA 3GJQA 3OCJA 1J1IA 1KVSA 2P91A 4QOFA 3X2SA 2YWDA 3OOYA 3TO5A 5CHYA 4A2CA 1M3SA 3GJ0A 2PKEA 1UXJA 1EUCB 2QI9C 4TRNA 1D0VA 3A1FA 2RDMA 3C7DB 3DS8A 3CUSA 4H3KB 3QUQA 4J0HA 4N5LA 4PG6A 4PNHA 4FEYA 4RVNA 3FFBA 3IQHX 3ZDCA 1L6RA 1BKDR 4UVGA 3WQHA 1WABA 5CEFA 3EXG2 4FVTA 1M7GA 3HP1A 3ZJVA 1SD2A 1VI6A 1GG8A 1RYDA 1GLVA 2A0XA 2KLBA 3OTGA 4KWCA 3QWIA 2XYGA 2AB0A 2IEAA 1NAIA 1X7DA 2R2AA 3PNLA 5CX1B 3SZUA 3ZDXB 2AMYA 1B1CA 3VOAA 4KAJA 2FSGA 1E1CA 2I67A 2J9XB 5TMEA 3ZIAD 4HQ6A 1FZQA 3KO8A 2AX4A 4Y9DA 3RASA 1UOOA 1AA9A 2HEGA 4QU0A 1KH3A 2X5JO 4KQFA 4F97A 4QBHA 5CGQB 1Q0SA 1L8LA 5DGDA 4JUDX 3BB3A 4QUHA 3UK1A 5A3JA 2EP8A 5A5GA 8OHMA 1K1EA 1OXBB 2ATIA 3HZZA 3IL2A 4X62B 2W0MA 1JG2A 1N5MA 3O26A 1AB6A 3H11A 4M4SA 3EEIA 1M6VB 1GKKA 1N6PA 2AH5A 1G6KA 3LNCA 3D8TA 5BSUA 1NPYA 3GDOA 2JGFA 5ULLA 3C3KA 2FW0A 1TRKA 3PT9A 4ZPJA 1ZNZA 2WWFA 1VHTA 1GPDG 2RKOA 2DBVO 2FWBA 3OP4A 1XQVA 4J91A 2ZUFA 5JNTA 4Q9JA 1YTLA 5C0OE 1Z26A 1RRGA 3TWOA 4KQ1A 3EH1A 2C4WA 5L3SA 3H8WA 5KVVA 2AKEA 4GYJA 1QCCA 1IQPA 2Q50A 5A05A 3WFJA 2JK1A 2H18A 4N9WA 2XDQB 4CF6A 1H3EA 2B61A 5JZMA 4AUKA 5DN9A 5BWCA 2O5CA 2VQDA 4ZEMA 2PEZA 4JENA 3SZGA 2Z4RA 3VZSA 2VXCA 3ER9A 3AU8A 4GD3Q 4GH5A 4OXIA 2P1DA 3K09C 3Q15C 1OKKA 4CIWA 2B9VA 4I9GA 1ZD9A 1UIMA 2B25A 1TF2A 1XJ5A 4Z99A 4IUCS 1JEYA 1KTVA 3R3XA 2ZR8A 3O0TA 1NIPA 4HNRA 5IKOA 1WMAA 2C5SA 3A4MA 3FSRA 3AKDA 4HPWA 4V0RA 1Q44A 2PRIA 1S2LA 4XYEA 5E6SB 1ZEJA 2O8BB 4PQYA 1IBRA 4DRYA 2WHYA 4NYJQ 1MP0A 1XDUA 4FFNA 1XNGA 1XZGA 1Z6XA 4XLZA 4D9FA 2WU8A 4XOIA 1TUBA 1B1AA 1STOA 4QWWA 3OLVA 1EJ0A 4JQYA 10MHA 4LY9A 3NWEA 2HO4A 4E12A 1EUDA 1KK1A 2BN4A 1YBFA 3UAGA 2PUGA 1ZGBA 4LWPA 4Q1VA 1X42A 2CJXA 1U2GA 5J4KA 4G8DA 2X8AA 2PZFA 4X6XA 5FL7A 4D6PA 4WY2A 4PSKA 3GJXC 4WUTA 1IE3A 2CMFA 2JGMA 4R9NA 2QN8A 3A4VA 1H2FA 3AFOA 3OTWA 2W2VA 3M33A 4UXJA 1ZCBA 1RXCA 5JD3A 1PGOA 3WK6A 4CL0A 4MCAA 2CV1A 1M34E 3NRJA 4NU6A 5EN4A 2JJQA 3NBMA 2EWWA 2RH5A 3EUWA 3IH5A 3SVZA 3T9EA 1VCOA 2GNPA 5HILA 1GGKA 3BRWA 1D4FA 3RU7A 4G56A 1B42A 4BNDB 3GJSA 1I51A 4RVHA 4ZO6A 1COWA 4FFBA 4U3JA 4GNRA 1YDHA 3E35A 4NVRA 5IFKA 4XFJA 3LY9A 4FGWA 2NQ8A 5K0GA 1DQPA 4QM6A 3TECE 3ASZA 1NNUA 3KYJB 1ZQ9A 3RF7A 4K9QA 2V6IA 1BCSB 3GGJA 1KU0A 4DM3A 1DX6A 1T2DA 1UMKA 3VPGA 3A6FA 5ESWA 3QWBA 5JY6A 1VOTA 1WW8A 1C3JA 3A14A 4YROA 1XT6A 1RYEA 2O8NA 2PX4A 3BBPA 1MO5A 1VKJA 4QSHA 2XT9A 3UN1A 1U4OA 1GXSB 2GA9A 2VPIA 3K92A 2A0UA 1HDYA 2GTHA 3KX2A 1BKYA 3OZFA 1MMFB 1KHTA 1XQ6A 3NALA 4IIJF 3ZBUA 2E55A 1UZUA 2QJOA 4C07A 4INOA 5AWFC 4DR7B 3H99A 1B0ZA 2VUIB 4HTFA 1Q7TA 2ZRDA 3ZDQA 5I45A 3CVXA 1E7MA 3MELA 1TJYA 3Q98A 1SUBA 3SE0A 3LAWA 1L8XA 2CE7A 2FMIA 3SJ7A 4L8FA 4YUXA 3LX6A 1BC5A 4CQJA 4YRGA 1BNCA 3LC0A 3TJZA 2IYYA 2IEDA 3IIJA 3PGVA 1M1YA 4GOKA 3FWKA 2Z2YA 2GSWA 1U8YA 2O8EB 1ZUD1 1SKAA 2F2TA 4P4NA 5B7QA 5IYZB 1QPBA 4FGJA 2OKGA 2QM8A 4BZZA 1SUCA 2YH2A 2I4RA 1C8KA 3SIWA 5BOSA 1CZLA 1L4GA 4KWIA 4ZVLA 3IVRA 1TYEB 2O20A 3ANTA 5J2TB 1L7NA 3PKZA 4GAEA 5BUQA 4LPSA 1K3FA 1S6YA 2BTQA 4D9JA 4ZYWA 5KX5F 5L8VA 4R2WA 1T36B 4DR5B 3NHWA 1T3TA 2B8EA 1UZAA 5F3RA 1Y7PA 4K88A 4Y98A 2Z83A 3KLBA 2Q4RA 3CA8A 2FJPA 1JU3A 2ZYIA 3PEVA 2DSTA 3VYRB 1LTKA 3C98A 1TTPB 4EB6B 4EJ2A 2BPOA 1WPXA 1GZVA 3CT4A 3HXTA 3DC2A 3QTTA 5LM3A 2FQQA 5BNIA 2VOEA 3GRPA 1XMOB 2ZJ4A 1GTG1 3X44A 1VG0B 1E8NA 1JFLA 3C6MA 4IXWA 4QHYA 2LW7A 5K3OA 2EZ4A 4YJGB 3DBHB 4AM8A 1JAHA 5BQ3A 3U37A 3AEUB 1C30A 1O97C 4KDCA 4TTVA 5CDGA 1RWKA 2PR7A 3EGCA 2E5WA 3D3WB 4KXQA 4P36A 4F60A 1YTUA 4NSNA 4I3HA 3GG9A 1O3YA 3EQ2A 3FPLA 1X94A 2J9GA 1V8ZA 5IS2A 4HZGA 1K5HA 2YWBA 1LBIA 4A6PA 1SVWA 2NUPA 2Z9DA 4Y2JA 4CMIA 1FW6A 4F0JA 5DNUA 4B74A 3MLBA 1Y81A 3GZJA 1JG3A 3CPEA 1Z28A 4L95C 4F8EA 4DR2B 4DZTA 1E6EA 2FAXA 5AP9A 5I7FA 1SVLA 3B1WA 3BFKA 3KT6A 1P9OA 1MJGA 1JEOA 3M0EA 2CLOB 3STXA 1U4SA 3PS9A 3OQPA 3I92A 4NESA 3DO8A 3U39A 4U8HA 3X1YA 1KL7A 3AM4A 3KT8A 4H7PA 2PSEA 2QLFA 3FUUA 1SKYB 4IV8A 4J2HA 4Y6OA 3B1FA 4RNDB 1F8GA 2XVZA 1PQYA 1JS1X 3PI7A 1Y33E 4JNCA 4JYBA 3R7SA 3WLLA 3AKYA 5DNCA 5KNBH 4KWHA 1QONA 3VU0A 2Z8YA 3NYRA 4MIKA 3BMOA 1AURA 2Y99A 3U44A 2CVQA 3D2CA 3K7EA 1NMSA 1HGXA 4J2OA 5AUNB 5ETJA 3LQ4A 3OQ1A 4KIWA 3KB6A 1PJZA 4YP0A 4YRLA 3DZFA 4PGGA 5CT8A 3EQZA 4KGXA 2FE4A 3NVKI 3N39C 1IJEA 4DCJA 1Q3KA 2XRFA 4Z5XA 1XEWY 4AX8A 3RAEC 3AR8A 3FTCA 1DWPA 4R1OA 1OB5A 3HR8A 1TM4E 5F7JA 3WLIA 3HU3A 2BJWA 1QO0D 3KBBA 5K8JB 1QGOA 1VPVA 4IFEA 3GP8A 3MTEA 3QLVC 4YWHA 4KFUA 3VAYA 2PT9A 5C1BA 3NP7A 2DHCA 1N2EA 2I99A 4MVYA 3E84A 1OMOA 4O63O 4OLHA 5CM9C 4KOEC 5J4YA 3RWMB 4LIPD 2PUJA 1IXZA 1MN6A 2JH9A 3DMYA 3GLUA 1TK2A 4G01B 2P2DA 1E9VA 4DXAA 2Y05A 2P40A 3TZEA 5CBPB 3RT9A 2H59A 5LA6F 1WU7A 2O06A 3BWYA 1N5OX 4CIDA 4KUGA 5JAQA 4FWTA 2PJZA 2WD9A 4OOEA 5K9ZA 2PH3A 1Z7GA 3V4ZA 2TYSB 3WRWA 2NU7A 1DC4A 3PHIA 2A9RA 3IQGX 3LKDA 1XEFA 2FXVA 4P4UA 1T3LA 1AHPA 4KAXA 1ZISA 1WUHS 2QX9A 4WSOA 5A71A 3V2UA 5A4MS 1QQAA 3J81A 5ALKA 3OIFA 3BCRA 1K3UB 4LFBB 1HV8A 1MORA 4R7GA 1U2DC 3JZDA 6CHYA 1GPUA 1B8NA 1I2DA 2A33A 1E1QD 2MSCB 4CF3A 1HKUA 4B8YA 5FP0A 1L5RA 4TZ0A 4NG4A 3AILA 4UE2A 4WT7A 3ZOZA 2W6JA 4NBTA 3V32A 3GRAA 2XGOA 2NXWA 3ELYA 4GUAA 5A6SB 3AVYA 1XO1A 2WJYA 2J0UB 2LP4Y 2WD8A 2ZRNA 3DH0A 4S1WA 3KYCA 4I1YA 1WQ4A 5DCUA 3DZDA 1QTNA 4OB7A 1L5KA 1EE2A 3IALA 5FO0A 4EP1A 1FYVA 1QGZA 2C82A 1DJNA 1JDTA 3ORQA 4F5ZA 3GD7A 3ANLA 4UD2A 3K8ZA 1B16A 3BWMA 3ZJUA 1U5BB 3LSTA 4RQBA 1K8YB 3H97A 2BZ0A 3BXEA 4LQCA 2WIGA 1XTIA 1S3FA 1NQVA 2G9ZA 2Y0DA 5B1HA 4C7VA 3LECA 4NARA 5B1EA 5HIAA 4ND5A 2W6CX 3TB4A 1P6XA 2HBQA 2OORA 3E18A 3A7DA 5AM0A 5EIAA 2O3SA 1OVGA 2W2OA 4U5XA 3HB0A 5GTDA 4I81A 3QMPA 1Y6RA 3LLVA 4IZ6A 1E99A 1NUAA 2WJ4A 2C61A 5CJJA 5G41A 4CW7A 4ZDIA 4FGUA 2NVOA 2B7CA 3K9HA 4YT2A 2C07A 1NFRA 5IHPA 2QRVA 1JAZA 1I4DD 2NT3A 2X13A 2X1VA 3CCBA 3FDJA 4M9CA 4UM5A 4GPD1 5IDXA 4W5OA 2Q07A 3R41A 3WK4A 1UXOA 1YWGO 1QRSA 4TZ6A 4RZSA 4YXWA 2EGUA 5IZCC 4ZOLB 5FTKA 1WZCA 3HDQA 3P8ZA 4LYJA 1GFIA 3ER6A 1THGA 5DH9A 5E0KB 1DFGA 1CY4A 1GQOA 3GQBA 3ETJA 1W4LA 2JI9A 4X9XA 3TL2A 1ZNXA 2AVDA 2PL3A 3VR0A 3W2FA 4M8SA 1W0JA 3EXHC 3QU5A 4MVJD 2LD4A 4TM7A 4Y2VA 4Y9TA 4E94A 1CFZA 2YQ5A 1QGAA 3F96A 1OYOA 2IW3A 2GCOB 5E9QA 1ST3A 3AF6A 4OV6B 2FPIA 1TU0A 1L1EA 1QV9A 1VGVA 2OBFA 2WK1A 3FB1A 1TMKA 4MUBA 5H59A 3SPXA 1JNYA 4DMUB 3RKSA 4A27A 2FETA 5HMMA 3DOHA 2VQEB 4MCIA 5JJKA 4QPCA 4Y6SA 4YJ3B 3GFFA 4KJZA 3E3LA 5CFRA 4BNGA 3DFFA 3GLIB 4ZGGA 1H0SA 3HCEA 4RFVA 3AINA 4XUCA 4K26A 3JAWB 3T5CA 3HABA 2PR2A 1S2DA 1W5TA 4JKYA 4EBFA 4HGOA 1OH7A 4L9AA 1BXGA 4MLZA 1SZPA 4QXAA 1ZA1A 1WETA 1X80B 3D31A 5I9IA 5FR1A 2GAFA 3AUUA 3R7FA 4LZLA 4AJKA 2WU1A 4PGHA 1SU8A 2G09A 3L7CA 4KW7A 4V39A 4PAMA 4IV5A 4ND1A 3FYCA 3ON5A 4JBWA 4IILA 3CY6A 4LJAA 5EGSA 2P1ZA 2XZOA 3BL5A 3QEAZ 4QO7A 3ZW9A 2Y4NA 5KPJA 1IXYA 2YWGA 5JCOA 4H3SA 2HFKA 4EHFA 3PUJA 3TTWA 1DAHA 1X7YB 3EXAA 3NBKA 4D25A 1JQLB 1XOIA 2PKYX 3EB9A 2E9SA 1IY8A 1VJCA 4MHOA 4RK4A 3ZWOA 4WBNA 3H84A 4IKOA 3LXRA 5FPSA 1JMKC 3HDVA 1NF9A 3QLUA 4R9SA 1GEGA 3PUXA 2R1UA 1OROA 2WEKA 4KMOA 1XD8A 3CO5A 3SG0A 1JA9A 1P1RA 5TJHA 5BY2A 3HN2A 1EGQA 1EWKA 1EVQA 1F0NA 3CLKA 4PSDA 1XRPA 3RBXA 1U0FA 4II2A 1YB5A 5LKRA 2AKYA 3TEFA 4BV8A 1LV8A 1H93A 4D43A 1G291 4G23A 3COZA 2WZDA 3G2LA 1SC4A 2HREA 3GMSA 4TT3A 2EJBA 3QV1A 4LMPA 2P4UA 2VL7A 1SXGA 3MXTA 4NS1A 3MW8A 3IQXA 1JR3A 2BGTA 2D3WA 3NB0A 3DNFA 3X1WA 1SVKA 1QAQA 2XV1A 4M9UA 4HB0A 3RK1A 1I36A 1NFFA 2P9CA 3ZC3A 4WASA 3JQ9C 2H2FA 1V4VA 3RTDA 1QVVA 3X2EA 3PIDA 5BWBA 2GPJA 4DMHA 3QKIA 1GFWA 2BEWA 3ELWA 3L6OO 4QATA 5C31A 4EOGA 5HM8A 1A96A 1LC3A 3I39X 4D0NA 3IKMB 4YJKA 3FWNA 1U7XA 2PH5A 2I6FA 3WMGA 2IHBA 2PUBA 1I1NA 1VCNA 3AM3A 3VU8A 4EHLA 4Y18A 1W85A 3LBAA 1U7DA 1YBVA 3PA6A 4C0LA 4DA4A 3U3RA 1J9ZA 2DKOA 1KMMA 5BWMA 2Q3EA 5EMHA 1SHUX 4ZMSA 4ZOQI 1KC1A 2W2TA 3FHTA 2HDNB 4PPFA 1B7GO 3CNNA 3COYA 5KYXB 2JHAA 4KC0A 2HUNA 3VDMA 2AX3A 3MYRA 1SOWA 2WABA 3G9ZA 2A84A 4BB0A 4NCKA 2XGSA 5AJVB 3ZWXA 1E69A 3EDYA 4PLGA 1ODTC 4WN3A 3K9CA 1YE5A 4HDRB 5BRNA 1SEPA 1ZD3A 1U0TA 5KYNA 3PX3A 3HLKA 3DT8A 3B3GA 3C8UA 3ZGYA 3AESA 1XLTC 5AI4A 2N47A 2PYDA 2E4UA 4KYTA 2OVBA 4X92A 1KR2A 2ZJ2A 3MMSA 2H3HA 3IAUA 4U4AA 2HPAA 3HB4X 1DLIA 3P4UA 4B87A 1NVAA 3WFZA 1Z62A 2GZAA 1ZN7A 2VPYA 3JYPA 5ERGB 1O1YA 4W9NA 1TLFA 5F5XA 2YMLA 5DYIA 3ZCXA 1ZSNA 3QKTA 4BZPA 3IULA 2VTBB 2EHDA 5JHHB 1C0IA 3L1KA 2V58A 4ALMA 2NUAA 1AF7A 1EA5A 4TLLB 1WXFA 3WGYA 4F71A 4AWXA 2VP6A 1Z0DA 4BP8A 5K09A 2XT6A 3QITA 4NQZA 1FJHA 4V3CA 3C3CA 3MWEB 1USVA 2VF2A 4NR0A 2XWQA 3GN2A 1Y89A 1XF9A 3A10A 4N49A 4TUYB 4L07A 4XXHA 2FWAA 4J75A 2FFHA 1FNCA 5IEJA 1EGHA 3B2EA 1O95D 3JQAA 3QJ5A 1VJ5A 1J8MF 1Z6YA 2X14A 4MS4A 5A3VA 1XN4A 3VM6A 3R6DA 1JEDA 4EPYA 2OZLB 2G82A 5T3YA 4LSGA 3FETA 4Y7DA 1VE9A 1KVQA 3Q12A 5CCEA 4L5JA 5IH7A 1MO6A 3LQYA 1ZITA 2FJ0A 3W5VA 4IDEA 1DKNA 4Q6WA 2ZITA 4LMAA 5HKLA 1QRTA 4I55F 4FWIB 1XCMA 4IX1A 1PJAA 5DE3A 4X66B 3ELDA 5JW6A 3PC4A 4TYWA 2P3LA 1U0JA 2W4QA 1OTHA 2WHPA 4NP6A 3HB7A 3BSSA 1HORA 4I0WB 4OUDA 3S5UA 5ELXA 1NQ5A 3PR3A 5JH7B 4X6YA 4PFKA 4KE8A 3LM8A 4EA6A 1L1FA 2FMXA 3NS7A 4YJ2F 1KO8A 2OHVA 3FCEA 3HWX1 1KSJA 1SIBE 3W5IA 2G6BA 3NEJA 3G0GA 3B3JA 3I5UA 4J76A 4PANA 3M4JA 1A8HA 2C1EA 1PGPA 3DFIA 3DVSX 3N5KA 4OH1A 3U7QB 1YQWA 4RMHA 3QA3E 3UMFA 4EARA 2C97A 5IT5A 3RTGA 3SXPA 4EL5A 2XHZA 3BK1A 2GZMA 3OLCX 4WCFA 4HJXA 2AK3A 2VJYA 1URPA 4CPDA 5F23A 4OBXA 4OQNA 5D5PA 3ENQA 1T25A 1FXWA 1LPSA 4C0BA 3WTBA 1LLQA 1N5KA 2AWOA 2O7NA 1K7XB 2XUFA 2PE5A 5U1PA 2RHDA 1RHMA 1BE1A 4FC7A 3VR2A 2I1LA 3MAAC 3HKBB 4ZJPA 2EKQA 3KOXA 4WW0A 1V1RA 1G20B 5ICCA 4LA4A 3E22A 2WJGA 4XSGA 3INRA 3TRDA 3L77A 4AS3A 1A5BB 4PO9A 1QOQB 3AFNA 1J0EA 2XBLA 3RUCA 1YKGA 3QPBA 3QKRB 1ML4A 4D56A 2BGWA 3HVHA 1AG9A 1XFAA 2PQ0A 2QUZA 3KSBC 1RHRA 4Q15A 1M1UA 3KOOA 5FFFA 1SCNE 4GXNA 4YXFA 1DUVG 3H5TA 3TE7A 3W3AH 1PNRA 2NYUA 3BGWA 3KNZA 1RQLA 2FR1A 3ML1A 1J6UA 2PCLA 4LYYA 5K3FB 5KCMA 2W6MA 4P83A 1RD4A 3JD4A 2P6RA 4QGGA 3OU6A 1QE3A 3DDSA 2OBBA 1RYBA 1XROA 2D0DA 2F43B 3K1AA 4YLEA 1GKUB 1LSSA 5J5CA 4M7PA 1ADGA 1ZSYA 2AXEA 1XWIA 1OXSC 2MSKA 3QPCA 4JLUA 3IEVA 1GARA 1TZCA 1XKXA 3EXIB 2CXNA 3CLVA 3DKRA 1TZMA 3H5VA 4KHZA 4RD2A 4X1YB 4ER3A 3F3MA 3LFHA 2P6PA 1I7QB 4MJ3A 1Y9ZA 3ZI7A 1SFRA 4EVQA 1Z5WA 5CYFA 2OHOA 4JP8A 1DKQA 3EGOA 3VQTA 2QK4A 3QJGA 3UXMA 3U61B 1GVHA 2HF7A 4OP1A 3TUZC 1LC0A 4EI7A 5EUQB 4ZV4A 4UQPA 1P2UA 3I6IA 3FI0A 2IC5A 4LJ4A 4ODIA 1Y3IA 4YI3A 4OJNA 1JT2A 1E9FA 1X2EA 3I9MA 2G0TA 3KOYA 1NOKA 3U7IA 3Q3EA 2PX0A 4AJPA 1KGSA 5FWDA 4LZWA 4W6ZA 3FHLA 2YX1A 4ONEA 4Q3AA 3PXEA 1YRQA 2HMYB 3AVWA 2RB4A 4H1WA 2ID8A 4TSFA 2I54A 4NCXA 4P33A 4ARBA 1QV6A 1JHMA 1DT5A 4L0DA 3UK2A 4CTNA 1RMTA 3L0DA 2NV6A 2Z2IA 2O5RA 3URMA 4UNSA 2YMQA 5AXBA 4EO9A 2F64A 2UU9B 3AVQA 4M2LA 4KODA 2VJOA 2F8SA 1VYUA 3HFJA 1U8UA 2YHIB 5H82A 1BWPA 3MTBA 1WJGA 2X5OA 4PW0A 3WMEA 2R7MA 4I5IA 4AZVA 1ESMA 2CHVA 2A9KA 3AH8A 3E4DA 4JMPA 5GONB 1X3SA 4MR7A 3WGMA 1AZWA 1P1IA 3RS9A 1YR8A 3PJDA 2JI8A 5D6OA 2VYCA 2XTAA 3BZUA 4D9HA 1PSWA 1PS0A 2YVQA 4NATA 2X9LA 1P0FA 2IU4A 3GJYA 2EHJA 4KRFA 3UGJA 3GT7A 3LBNA 2NWQA 1M83A 3AWDA 5EG5A 3EMKA 3RVBA 1JIIA 2FOIA 3DF7A 4LNHA 4YRBA 2D5IA 5LIPA 2DWCA 1JMVA 1K6XA 1S0UA 1F48A 4M1QA 5C3UA 3SICE 2ILVA 1C7FA 4UHDA 4DQ0A 3HCFA 1H8HD 4WXHA 5L4NA 1I1QB 3ADCA 1JB9A 3OQVA 2HBRA 3MUEA 4A6DA 4IMJB 2O7SA 5K5EA 1E8DA 3THRA 4URVR 2O8BA 4LXTA 4MULA 4QUEA 5TVKA 1F17A 1GPBA 1SVNA 3WGLA 5K45A 1QIDA 4NECA 4O2BB 2F7SA 2MR6A 4GNKA 1RACA 3OICA 4CMEA 3TSAA 3AL0C 4WAUA 3SIRA 5LP1A 3GLQA 3B5EA 1M6HA 2BFNA 3ZI0A 2VZEA 1IEXA 3SJBA 1M5UA 5I4IA 3Q7RA 2WA2A 1JYFA 1G55A 2PLWA 3ZVRA 2VT7A 4ASUD 3H9EO 3IOCA 1YI0A 2V5UA 1XZIA 1FZTA 3JYHA 4PE5B 4BZWA 1GYQA 3HYLA 2WC1A 2QD1A 1G59A 3MIIA 1GDDA 3HU2A 4LSMA 5DW0A 3MBOA 3PSHA 2D1TA 4O08A 5CNKA 4BMXA 3PFCA 4EEKA 4EL0A 3GARA 1SKYE 1D5CA 3GMTA 3B12A 1AGNA 3OIDA 1DAOA 4QNNA 4WLNA 3X1MA 3RBVA 5JZ9A 3VAZA 5L3VA 3BEOA 1GOTA 2OGWA 5CIWA 2X3UA 2Y2VA 3LGXA 4N54A 4M38A 2JB9A 3ETHA 4FFMA 4P31A 4BCDA 3EGWA 4BNDA 1T9AA 1V3TA 4A2PA 4B6RA 1FNBA 1RMYA 4MWGA 4BEVA 2CYBA 5LYJA 2HHJA 3VKFA 2QN1A 4BMSA 4CGZA 2F3SA 3DOIA 2QM3A 1SB8A 3NFRA 4JOCA 3TOCA 2K7FA 3IJEB 4PYLA 4CT5A 1EESA 1Z5PA 1M8KA 5E8JA 3EF0A 3GL9A 1A82A 3PNSA 3OIUA 1V96A 1QRAA 4WKNA 4H15A 3SS9X 3C3DA 2LUOA 3E61A 4URUR 1ENYA 1Y8QB 2P6NA 2PRYA 1U31A 2DETA 5CNIA 5TGDA 4CLOB 4KNYA 3LXUX 4DREA 1D1QA 1DTWB 2BWJA 4G86A 1KKUA 1RLMA 3Q3IA 1CRLA 3P7MA 1BH2A 3E23A 2PU7A 1NNEA 4GXRA 3KQKA 3AL3A 1I3CA 4XYBA 2HV8A 1GTVA 3NGMA 4DB4A 3HJFA 1ZKDA 1FVFA 3L7YA 3WWYA 5C8YB 3DDHA 1IN5A 4PM4A 2R1TA 3FMFA 3AR4A 1T9GS 2EFDB 3OM1A 4RIEA 3KWFA 3KV3O 1YQGA 3PQ8A 4G4SP 1MQSA 2BEUA 3UKDA 2WMOB 2JFNA 3VH2A 3M6FA 3WLMA 1KMQA 3SQOA 3T41A 5IYZA 2C57A 5DSXA 5A7GA 3EIHA 3KSRA 1MLDA 1YMVA 4B7CA 1OLXB 2FZ4A 1FYFA 2WTAA 3D2BA 3EBLA 4GR5A 4AO8A 3T34A 1TVCA 1WU8A 3AR7A 3QHQA 5J2TA 2J3IA 1Z5GA 1VDMA 2FZ5A 4RVSA 1ENZA 4EHBA 3G68A 3DR5A 3EC2A 5E4FA 1E2LA 1J2UA 2CKMA 5K01A 2W2MA 1I4WA 3DOFA 4CLXA 3BHNA 1Z15A 4FQ5A 3WB9A 4EY6A 1N4AA 4BN5A 3E3MA 3DZGA 5K7SA 3DKKA 4QU8A 4PS1A 3QW2A 4L22A 2RE8A 2UUAB 1DT3A 2HDWA 3NBYC 4HDOB 3CURA 3VC7A 4EF5A 1SGWA 3KOUA 4FE4A 3DMTA 1Z7WA 1ISMA 4TRJA 4LQ4A 5CAEA 1CJVC 3HS3A 3I9V6 4WZAE 3EC7A 1N0HA 1RKVA 1BMDA 2WFAA 1ZIXA 3DBHA 4YJGA 3ZWQA 1V16B 1TADA 3AEUA 3TM5A 3H4IA 3U3OA 2ZI5A 1M8GA 4P7FA 3WDSA 2YN0A 4BNZA 1W29A 3KQYA 3IQWA 2WAOA 5T4HA 1ZW6A 3WSVA 4JI1B 3DVAA 3P26A 4N5DA 2PS9A 4X60A 1XDWA 4ZOBA 3VNUA 2YVLA 1HPLA 3W77A 4BQNA 1G7TA 1VSVA 3PGJA 3AQIA 2IIQA 1MOZA 2I7TA 4Q1BA 3PJGA 1UK7A 1QFZA 3DZJA 4HB2A 4DSNA 4M0DA 3N9IA 1IZ9A 1XIVA 3RC2A 4N76A 3WAGA 4ER7A 2JIDA 4OG2A 4CG1A 2BBSA 2DTEA 3FW1A 3KSDO 3Q0IA 4I9HA 4ZT3A 5IG2A 2PX5A 1FSPA 3BGIA 1P44A 3PPXA 1T5DX 2DP4E 2PX6A 3IHTA 3UKJA 2WKQA 3B52X 4R83A 5B36A 3WXMA 1L4YA 3E5MA 3X43A 1AKVA 4HWTA 3ICEA 4MB2A 2Q4TA 2G77B 3QJYA 3D3EA 4LV8B 1P18A 4PS0A 2GBGA 3CNBA 2NM0A 5L7TA 1RXYA 2J4DA 3I01M 1D2EA 1MRNA 1NURA 1TYBE 2HZBA 3FN4A 3V2IA 4DV4B 3KQTA 3WNZA 2FMUA 3CEHA 4B71A 4BLWA 4CEJB 1QO7A 5JMPA 3PQ2A 4MS3B 1BQ3A 4P32A 2WY2D 1I14A 4TV9A 4RCYA 2HIAA 3H9JA 1W49A 4Q4LA 4N03A 4UE6A 2QZ4A 1RC8A 1P5ZB 4FHDA 4HAUA 1J20A 2G7ZA 4F6CA 2NPOA 3GBVA 3T7TA 4CLRA 4GC5A 3G7SA 2YJ6A 3BL8A 4JQOA 5KB3A 1R15A 3CLUC 3FNEA 2QXYA 4EJFA 3DBOB 1RI4A 2O59A 2IA5A 2H29A 2OM6A 2N75A 4JCCA 1V43A 4OQPA 3HEMA 2EF1A 4CIXA 4KDRA 1Z0AA 1FF9A 2IYSA 2G07A 3GLIE 2WBLC 1TPYA 4URWR 4QFMA 5CW2A 5GMOA 5AQ1A 1AO3A 3QE9Y 4HS4A 5L3ZA 1LRLA 3VV3A 4IWYA 4GF5A 4TMZA 2BEKA 5CT9A 1JSXA 2H48A 4GE3A 5I8PA 2FOXA 2H1LA 5ALYA 1SCQA 3FNIA 4C08A 4D8UA 3FWYA 3RREA 3L8CA 2GJ8A 2CD7A 1J0CA 1ID1A 2HGSA 1THMA 5BN1A 5D86A 5TJ9A 4ML3A 1AMOA 4O6VA 3PFHA 2EFCB 2WW8A 2CDCA 2TRSB 3V2HA 3TR0A 4L5IA 4BBJA 1MX9A 3S55A 2CJPA 4DCUA 1BDHA 3ZJTA 1CDZA 5EPEA 1N36B 1CYDA 2BBWA 2P4SA 3UB3A 3ZXUB 3PE3A 3STHA 3B78A 3A1TA 4FFSA 4H0CA 4U9IS 5U4XA 2C96A 2IZZA 1G16A 2GK6A 2MSNA 1QHEA 1U3TA 4INPA 3KZMA 2GFQA 3QIAA 3NPAA 5ALFA 3HGTA 1WMFA 2R6R1 4FN4A 5FFMA 3MJEA 3RYIA 4X3PA 1Z82A 3WIEA 4ZK2A 5A6SA 5IVPA 4O0LA 4NQRA 2QJRA 1NU8A 3K09A 2ZWMA 3RYTC 2CT8A 3STUA 1JSRA 3GC6A 3PRJA 1XGKA 1QR2A 3EZNA 1I5RA 3L8YA 4ZRMA 1U3CA 4PICA 3QUAA 4TLBA 3GLHA 1Y34E 4RPCA 4KU4A 3MBKA 1PVOA 4Z3KA 2IYAA 3G7NA 2BD0A 4PC1A 3DONA 2DFPA 1G9TA 1LH0A 2H17A 3KB2A 1CIPA 1ORDA 2I6TA 3TI7A 4E5YA 1GL7A 4GX2A 3RUAA 1L7RA 4PWYA 1N92A 4KIFA 1CRQA 4NPAA 9LDBA 3ZV4A 4JJIA 5ADHA 3FTFA 2G5GX 4LOAA 3EYAA 3GRCA 5JE8A 2LKCA 1C9KA 1UC5B 1Z45A 3IUYA 3K72B 4N8EA 4XIGS 2WJVA 4P34A 1QZXA 4P4LA 5AI9A 3ZGNA 4IJQA 4ERXA 4E2YA 5HDQA 4MP3A 1X1SA 1IVNA 1VHJA 2WTMA 4H6WA 1DCFA 5DYGA 1Z47A 2X9NA 1Z13A 5D6NA 4B8ZA 3FDXA 3I6ZA 6ABPA 1G2IA 4RPHA 3D3QA 5A04A 4U2CA 4WFKA 3BQ9A 2XMZA 1SOVA 1XTPA 1GZUA 1KJIA 1OQAA 1U02A 1WDMA 3QMMA 4J6FA 4JUFA 2Y1XA 3AHFA 2HLNA 3IR7A 1Y82A 1O6BA 3PTZA 1EVLA 1YRWA 2NSYA 4FLFA 4I46A 4Q37A 4ZOLA 5FA6A 3CJTA 2Z5GA 3BXXA 4LW8A 1ACLA 5IAOA 3P2JA 3VMMA 2XODA 3LTNC 5CVTA 4X0EA 2JLAA 2YJTD 4MPDA 5FPYA 3S7ZA 2AKAB 1ISPA 1Q0PA 3CZPA 1R5NA 5E4YA 2W70A 3BBLA 3OF3A 4RKYA 1BRMA 1PEKE 2X2PA 3ONDA 4PBRA 1G3RA 4ETMA 5BQFA 2B0CA 3SY8A 5C5DA 2GCOA 3JWPA 4F5DA 2ZULA 4G1VA 1SG9A 3K6KA 2WUWE 3OX4A 4MQLA 4Q01A 4M1TA 2R11A 3WHIA 3G6WA 8ATCA 3GVCA 4DIBA 1Z7EA 4QDJA 3OCZA 3B8EA 1N8SA 3L9XA 4EJSA 1YUNA 2GCGA 1KXJA 3EPHA 1K2WA 4QUIA 3HYTA 3SHVA 2D5LA 2IUSA 1H9AA 4ZRNA 3I76A 4DLTA 5B30A 3NIWA 2BMWA 2GN1A 3OSZA 2XD9A 3K1JA 4JJ7A 2FV8A 1QZZA 4L7QA 4CM8B 3RV4A 3LUJA 1WBDA 3UZUA 2QQ0A 4OHUA 3VC1A 3OF2A 4LDAA 3O1JC 4S1OA 3TOVA 3VH1A 4YMHA 3BTOA 1G7RA 2C99A 2VLIA 2W0SA 4W5QA 4OLAA 1IIRA 1KR5A 1GUBA 3SIPA 3T9AA 4EUSA 3PKJA 4LRSB 3FTPA 1WXXA 5HP4A 2W2PA 5FYDA 3VVMA 2VUUA 1ODCA 1X7YA 4GGOA 5D7NA 1GL9B 4DYHA 3J80A 4CQLA 5CXQA 3FPEA 1RRKA 1AHNA 3G5MA 5HM6A 4GP9A 3FKSA 2VHYA 1OBOA 2VSQA 2OHGA 3FRHA 3ROEA 4E6PA 5K20A 5ECYA 2HX1A 1T1GA 3Q2OA 2AEJA 1C8VB 1Y0BA 3KEFA 4JAVC 4K9SA 4PY2A 2ISQA 3EULA 1VYVA 5UKDA 3U0BA 1PFGA 4Z7NB 1DRWA 4IG4A 2JFGA 1XK6A 1E9BA 3VDRA 1G3QA 5KVSA 3Q41A 1G98A 3KZNA 1K2VN 2JIBA 4ZAYA 3GLTA 4HN2A 3CZQA 4OKIA 1QDEA 1TAUA 3OLWA 3S0JA 1SUFA 4H1HA 3EGEA 3BYZA 3GPBA 4F3CA 1FP7A 4BB6A 4LVCA 4MUJA 1I0IA 4B7AA 2HHAA 2BDUA 2CHFA 2WG2A 1U0GA 3DZBA 3EWAA 4KSBA 1DXQA 2I62A 4K9NA 5JXGA 3I09A 1W36D 3NM4A 1PK7A 4ZI2A 1G20E 1PK8A 3QVGB 3QXSA 3D8HA 3P9PA 4RVCA 2C4KA 1YL6A 2DLDA 1X3LA 2J7PA 4G4SO 2AJLI 4J8PA 4TXLA 5DXFA 1XJ0A 1U2ZA 2FWIA 2GDJA 2VJKA 3I1IA 3L43A 1PIWA 4NIMA 4OH7A 2J32A 3B7WA 3TLXA 3PFBA 5KYGA 2HIHA 2KBFA 1X39A 5EXDA 4CIVA 1R0KA 5LP6C 5B2EA 4KXFB 1CHNA 4NULA 1JPJA 3BJZA 1TUGA 3S27A 4BY9E 2GZ2A 3HSSA 4RPLA 4A3SA 1RI2A 3AP3A 2W83A 3IQZA 4IHJF 2W22A 4A6EA 5JAOA 2PZEA 1Z4OA 1XVTA 4QEDA 1CLEA 3K5HA 3KCNA 4IJ5A 5KTKA 3HADA 2FN7A 3ANMA 4LZPA 3DOOA 2Q49A 1EG7A 1OOEA 4PSAA 5EINA 4R9VA 4D74A 2OO5A 2PZBA 1RRFA 1JBKA 2EDAA 5DFAA 4EUNA 5I5EA 1UBUS 1V8BA 3E9ZA 4MVJI 1PT8A 2HXYA 2ZIEA 3LC1O 4X8MA 1RRCA 1SVUA 1DRVA 4PSCA 3NDPA 4PTLA 1R4MB 1G8AA 2VRBA 1U2RA 5DNVA 1RT9A 3SMQA 3E2MA 2ORED 3G88A 2CLHB 3GCXA 3PFGA 4HDRA 4J0FA 1ZINA 4XB6B 4EKIA 1T5IA 1JSCA 3DTVA 3KHTA 2DTDA 2XLBA 3C97A 2BISA 4ID9A 5EMJA 3W7AA 3WZ2A 1Q6ZA 3WX0A 1E6CA 1JG6A 1IVSA 1ZESA 2R8ZA 5K51A 1Y4UA 2X22A 2W6PA 2WT8A 4UDXX 1VLHA 3G5TA 2QVLA 3D0KA 4RCVA 3W0LB 1N7JA 3A3YA 4ILEA 2WWWA 4OBEA 1DCTA 5GJWC 4CFZA 4LOLA 2H4XA 2DKNA 2UVPB 3ZZTA 3G0DA 2DUNA 3BG5A 3HJTA 3X2FA 1E5VA 4PC6A 2RHTA 4AIIA 4CV3A 4EYOA 2H7XA 3RVMA 2C5LA 1J2JA 2JFQA 4JP3A 4Y2RA 4EB3A 4DSUA 1EFAA 4B2IA 3JSXA 4QUGA 4OGLA 4E0BA 5FCDA 4TUYA 3NANA 4EHJA 1ETUA 1FMTA 1QIKA 3CWCA 1PTKA 3F4LA 1Q0QA 3O90A 1CUFA 1MEEA 2D2XA 2HTEA 3GCWA 4H59A 5LLDA 2G1UA 1CJSA 4PLTA 4UBJA 4JKOA 2OZLA 2QRNA 4L0MA 5K0BA 5KQGA 3WL6A 1OFUX 4JI3B 4RSHA 3VR6A 4RWZA 3REQB 4B4VA 2B4QA 3V5NA 4W6QA 1T6XA 3NRCA 4N6NA 4YT5A 3SCZA 3UCEA 1QX3A 2OENG 4FDTA 5ARCA 1KOLA 3IUSA 1HDEA 4BU1A 4RD3A 1AGYA 5K03A 3A2NA 4D96A 2E1PA 1LPOA 4RHUA 3VI3B 1U2DA 1PLJA 2HJ9A 3PLNA 1AUPA 1Z73A 3I9KA 3WRXC 1NW6A 3SX2A 1RPAA 3KCQA 3Q9SA 2JASA 3WIOA 2VATA 4A0QA 3JWJA 3KTDA 5LFAA 9MHTA 2QGNA 2XH8A 1SQ0A 3AEZA 1K5DA 3WLFA 1TCVA 2BDEA 3P0HA 4QUDA 3VU9B 3D6NB 4V0OA 3N7UA 5G1OA 5GJBA 4V1CB 2EIHA 2WU0A 2J0VA 5EIWA 2AHOA 4OU5A 5K0FA 5FL3A 1ODJA 2OOSA 2ZRQA 1W581 5BORA 3U9LA 1IDN1 3BF7A 5D01A 2XCQA 1EFVA 2YZGA 4JITA 4EBBA 4XZ3A 1CUJA 1VLZA 4WCDA 3HRIA 2CMHA 4IQGA 3WNBA 2UUPA 1KPIA 3U7FB 2Q3HA 3TD2A 3VBCA 3C5CA 5KIAA 5HTKA 4HEA1 4GPIB 1M54A 1Z36A 2X9VA 3MJVA 4CKCA 5C53B 1MTZA 3CNOA 4IS2A 1RWPA 2Z95A 4ZVRA 5AFSA 3TQFA 4WDRA 2Z2JA 3MBIA 4LVUA 2XMCA 3GIWA 4DIMA 1JR6A 3UCXA 3DKIA 5IJAA 4MUAA 4NBKA 1SBQA 5K3FA 3TZBA 2FZCA 3KQMA 5EMNA 1G21A 4EZIA 1W8IA 4OYYA 1QG0A 1SIUA 1DUSA 2IJGX 4FBMA 3BK2A 4IIYA 3KWJA 3WQRA 4DRXA 1VI2A 1UMBB 1CZHA 3EXEB 3JR3A 2F43A 1UDCA 2X1LA 2YBEA 3L6CA 4PLPA 3UV3A 1PJ8A 5EKXA 5BRJA 2VDRB 4FOPA 5IZCA 2IBSA 4J0IA 3ZU2A 1J1UA 1H8EA 1D9ZA 1Y3HA 2A1UB 2EWMA 2JJ1A 3V8EA 1S2MA 2N0SA 1XNQB 3OJFA 3MCVA 1U9YA 2O8CB 3UANA 1Y3AA 4MR8A 4ERNA 1QU2A 3EXHA 2H2IA 5AIAA 3GUVA 3JYQA 1PJSA 4FSHA 5HRAA 3BD9A 4QJ3A 3OBBA 4Q1CA 2X0EA 4HNAA 3UMBA 2ZKLA 3R6LA 4Q05A 5C51B 3NDBB 1G8PA 1IATA 4OQXA 3ZQKA 5A62A 2IYLD 5HK8A 3RWOA 2HSJA 2QN6A 1K0FA 3L9WA 3ZV7A 2PXCA 4XWYA 5AOBA 5KQMA 4UOQA 2HF8A 3RUDA 2J5XA 2B5OA 3Q2IA 5F78A 1Z16A 3ASUA 1T2AA 3MJTA 3N8NA 3VYUB 4DB2A 1RCFA 2XNJA 4UHHA 1UDAA 1GT6A 3IGFA 4OOFA 9GPBA 4GKAA 4YNBA 1LNSA 3DTYA 4R3WA 1UAGA 2QJTA 4H17A 4LYDA 2AT1A 4KFTA 2SICE 1ZH4A 4JGBA 1JDNA 1PT7A 3PNMA 4L8WB 4YMGA 1RHUA 4LBYA 2YHIA 2VT2A 3K6JA 4C03A 4G0VA 3BL6A 4J9UE 2E18A 3LHDA 3IP9A 3VHQA 1T26A 2HADA 1O57A 1BZYA 3G6KA 3QRWA 5ICEA 1J5XA 1VE7A 2IV3A 5ALOA 2P5TB 3DZIA 3I6YA 4HWOA 3FNQA 3PIIA 3PA8A 4R8MA 2JFFA 4ZC8A 5A3RA 4G5FA 1J2TA 3M6IA 3BN3A 3QYJA 3ZGVA 3NH9A 1UC8A 2YW9A 3S7TA 4M87A 1QVAA 1X8KA 1TOAA 2BEJA 1OLSB 1BX3A 1P1FA 5E9JA 1YQEA 2ZB4A 3WADA 1LS1A 3O8NA 2AMLA 1Z68A 4I1OA 4BX8A 4C4AA 1BW9A 2LR0A 5ILQA 1C4XA 1ZJ5A 3BSWA 4OXNA 2V3WA 2IXEA 4LHEA 1PUIA 2BGJA 5EWLB 1T9KA 5CHEA 3FSGA 3FZGA 3UPDA 4V38A 3NX4A 1DQRA 1JN0A 4HAXA 1IONA 1HNWB 4KREA 3QX9A 2RCNA 1SB9A 3B6ZA 1YJQA 2PBRA 1GNQA 3GROA 5E4TA 5SZKB 3PCRB 2OCLA 1QIIA 2QAGB 3JQ9A 3K16A 3B6IA 3DE6X 3L0IB 2AUNA 5ENDA 5EPUA 2V0GA 1TIKA 4JYZA 3DDZX 1VJGA 2IZ1A 3K1YA 2JGDB 2FPSA 4JHLA 3EGDA 2QSZA 2WLSA 1QVRA 3N2YA 4KP7A 1QF6A 4RELA 2IIVA 2FQ1A 3WIVA 3BREA 1KEKA 1BHJA 1LK7A 4RLHA 4KXNA 1BHO1 5EWJA 5I48A 4Z53A 1S8OA 3FXAA 4O2LA 3PGMA 3FB4A 5ECWA 2IEYA 5KNCD 2I4IA 4PGMA 9ABPA 4XSVA 1D4ZA 1TA4A 2YOFA 1Z18A 4L75A 2NXCA 2ZM6B 1UANA 5KKAA 3CH6A 2OZKA 3L8DA 1XZNA 1XWFA 2H7VA 3KU1A 1CEEA 3BRCA 1TU4A 2Q2NA 1P1HA 4KPEC 3Q4GA 2IH5A 2IPNA 3BJRA 3O91A 4Q0MA 2DQYA 1DFIA 2EG5A 3EISA 3UAWA 3B9RA 3DJYA 3K0FA 1V5EA 3FPBA 1PAUA 2B6NA 1OWPA 2DQ4A 2VFAA 3TFWA 4CF7A 1HM5A 4RL4A 2CV2A 1IG3A 4XVCA 3E70C 3MLAA 1Y8QA 4ZCIA 4KO1S 3PDJA 1XLTA 1JSZA 4HMQA 3Q7PA 1F3OA 4MW4A 3KWMA 3VR4D 1Z8FA 4N5MA 2F00A 4AJ9A 2V6MA 3ACDA 4YFVA 4G9EA 3D6TB 1WDTA 3RBAA 2ACVA 4G1CA 5K0ZA 2XNKA 1YZ3A 5DNWA 3ZHTA 3G9TA 2IYQA 3SDBA 4D5GA 1Z34A 2ONCA 1Y1TA 1D5WA 1X8XA 2Q9BA 3CYFA 4PBSA 3NDJA 2R6HA 5E2IA 4ZVQA 4RTMA 4KN6A 4B0OA 3WXBA 5BNZA 3HA3A 3DLBA 4B32A 1O08A 2XMSA 4FSDA 3SC3A 2BFEA 4DNFA 5AHOA 1E2MA 4C3UA 3OEHA 2ZIGA 3QOFA 1KRXA 4TWRA 1MC1A 2VPTA 3DHEA 4G84A 2WF8A 5ELLA 5JZVA 1G5HA 2FTKE 3VO8A 2EKLA 3DDWA 3Q40A 3I73A 1SOMA 5FTWA 4DTIA 3W04A 1A71A 5DIFA 2ZU6A 3SI7A 3BFPA 3DYBA 3OOJA 1CY2A 4ZYUA 3OZRA 1H4TA 3GZNA 1DQSA 2VT6A 3A1EA 2GF0A 3C4QA 3QXGA 1B73A 1X19A 1C7ZA 4FXOA 3AUXA 1I32A 1NSTA 4B6PA 2NT4A 1DOAA 3EN0A 1JLKA 2FX2A 1ARZA 3JVVA 1ECFA 4PZCA 3RAGA 5FPQA 3R5FA 5LYYA 1VCMA 4LWQA 1TTTA 1Q1NA 2C7OA 1IXKA 1AK1A 1NBMA 1PS9A 2NO0A 5EEGA 1XTJA 2PZJA 3VKWA 4DF3A 1A9YA 2P3OA 4EG8A 1TZKA 2RGYA 3DAFA 4L1KA 4F6LA 4GMXA 4K40A 1NP3A 1KYIA 1WKBA 2DX7A 4YAKA 2IX3A 3JZAA 5DI3A 1Z5NA 4U2DA 1JA1A 3IR6A 4IR7A 1C29B 4WBNF 3MOGA 1YFLA 3KEGA 4N7JA 1VPEA 5HX7A 4AU1A 1IUPA 1E3JA 3E7PA 3DF9A 4I4IA 1Q95A 3HDJA 4REOA 3TVYA 5ADVA 3ZU4A 4FX5A 4L2IB 4PN3A 1R9JA 1UR5A 3GFGA 1TXGA 4HADA 1HL7A 2GB4A 2J31A 3LRXA 4S1TA 1M0EA 3PLRA 2R7AA 3F67A 4PZPA 1QH8A 3QVKA 2ZYVX 4TSKA 2YYZA 4XB1A 2R6GA 3DCIA 3GNLA 1FTSA 4C21A 3EGXA 1P4SA 1Q14A 1WW2A 5JSZA 2G17A 4DBZA 1N2ZA 3TUJC 3UOWA 3OCCA 3E7DA 5G1NA 3IVCA 1ZEMA 4RKEA 4Z7JA 5BUZA 3TDNA 4JFRA 3EARA 5A4DA 3QFSA 4OMDA 4E88A 3T0IA 1XSEA 2DT5A 1ZUWA 1JTVA 1ULTA 2ZXEA 4V0KA 2N1BA 1U2EA 2FFRA 2OB2A 4QYIB 4ENRA 1VMKA 4C7BA 1JLSA 2FX3A 1PZEA 1F0KA 2XA1A 3GA0A 5AW6A 1CZKA 4IOKA 2YY7A 3WGNA 4ZHSA 1CUGA 3INTA 1DL5A 1Z2NX 3QKSB 4X1KA 3C8ZA 4ZQIA 4Z9XA 3COWA 4DS3A 2WICA 3U7GA 4MQBA 5AM1A 4QT4A 3THWB 2PK3A 3SEAA 3SVTA 2ZUSA 1IPFA 3GT0A 3ZN2A 4DLRA 4ZCPA 2XTMA 4BQQA 1U8AA 4MS3A 2O2HA 3OSUA 1MG5A 5BR8B 4G41A 1G7CA 1R8YA 2LGJA 1L3BA 2VS1A 4MVJH 3HXQA 4KAFA 2A2ZA 4QFCA 2RIPA 1EG2A 3GX1A 4R3UC 3ZCVA 3F47A 5FA8A 3AFHA 5HJ2A 1E0JA 3VR3A 1GWNA 2FZEA 3MJHA 1QM5A 1VPWA 2WWTA 2FWPA 2O2IA 1IWOA 3VSBA 2QG9A 3LZCA 3RQIA 3F5QA 5FOWA 3T0FA 3RYFB 2QZZA 3A6JA 4J4HA 3TW4A 3WYGA 3PXAA 1YUMA 2E37A 5BWNA 1TMYA 4WVLA 5DBFA 2BH2A 2F9MA 1WUYA 2RBEA 1HDGO 1U3FA 3NBUA 2FZWA 1VSUA 2PBZA 1N6KA 4AQYB 2PMCA 5EMKA 3IQDB 3E5RA 4YRSA 3TZLA 5D7BA 4AL4A 4ENUA 2R6FA 3CEJA 4I7EA 4OA5A 4PNPA 4WINA 5F35A 4TZTA 4QARA 3ANXA 5LQCA 3Q0TA 1O5OA 2H0RA 4L4ZA 4D44A 2DPLA 2RGNC 2VH2A 4DEYA 4MVJE 1NKTA 2PA0A 1K88A 2X15A 1SG0A 5EE1A 1XZDA 5FI5A 1H65A 2B37A 3VPBA 5FBVB 3DKPA 3PF9A 4HB4A 1GGVA 3HKEB 3ILSA 4S2EA 3ZWNA 2GI4A 1E6KA 2NZ2A 2GILA 4G4GA 4RK6A 1EYZA 3CIFA 1I3OA 4B35A 2B5VA 5LQDA 1UBJS 2PA3A 4YVFA 1L4MA 3UA4A 4EVRA 2FSIA 2J67A 2ERYA 4BNYA 4DWWA 4LF5B 3QA9A 1FW8A 3HR7A 5DGXA 4JYAB 3N6VA 1PJBA 4JWTA 1JQJC 1ZK4A 1C7IA 3O1HB 4LC0A 4JROA 2NUTB 3E2IA 4TWIA 2OG2A 1KDVA 2PD4A 1FE8A 5KQRA 4Q7JB 3OWXA 4IGIA 1ZRHA 3LX5A 3IQFA 4M0MA 1DO0A 3IDSA 2C5GA 4ZKEA 4R5HA 4IDGA 2BSAA 3K0AB 4QDZA 3QE0A 1NTOA 4DV0B 3CU5A 2YWHA 3VVBA 4DYDA 4BXOB 1QQBA 1MB2A 3RNOA 4ZT7A 3LT0A 3V7YA 1HMPA 3FZQA 2OAEA 2NN3C 1O6ZA 4TX1A 4Z86A 1G66A 3DE5X 3UHOA 5B4VA 2JCBA 3AONB 4PYRA 2IEGA 3D4LA 1SA0B 4A8TA 4A0RA 3NEYA 3PE6A 2LE0A 2WWXA 4HPJB 4J3JA 1FCJA 5EKDA 5SZJA 3UAZA 4MV1A 5CA1B 1SCIA 3F9IA 4D9NA 1Y9JA 4HGQA 2H54A 3DVLA 1LNZA 3K1TA 4G8JA 3IKTA 1Q7BA 4G5GA 4B34A 2HR1A 4YUYA 4RY0A 3H4MA 4M60A 3USES 4GEKA 1KS9A 1AKQA 3VPSA 4Y2TA 1B00A 1QG2A 4ND2A 2VEOA 2P9TA 4G36A 1UC9A 4GI1A 1LU9A 4MQUA 1A9XA 1PR3A 1VHWA 3DUFB 3GJ8A 2H31A 1V47A 5IEBA 5B6IA 2R96A 5AICA 1FXWF 1NDQA 5M2QA 3VX3A 4GX1A 2YY5A 4CR8A 3ROTA 3AFMA 1W4AA 2PJDA 2F1RA 2RGEA 3AYZB 4EO7A 1M2GA 4RTOA 4CT0A 2OY0A 3F4BA 1SK9A 4H35A 4TWAA 2PLNA 4WNIA 3ZE0B 3GP5A 2CUKA 1JIXA 2F8MA 3AUTA 5EJIA 1VA5A 4KQIA 3BX1A 4FMCB 3S28A 2IH4A 4M54A 3PICA 5LR6A 4A82A 3VPXA 2F90A 4RMJA 5C1IA 4KLRA 2ENUA 1TVMA 3OA2A 5HGJA 1FS6A 4O5OA 1RYFA 3F97A 2HK7A 1MEOA 3B13B 4OHOA 4WH0A 4DR1B 2DPMA 2ZYAA 621PA 3AGPA 1OFVA 5G4KB 3EVZA 4TV8B 4DLKA 5JT1A 4UM7A 1JFFA 1UJ4A 1UMCB 5FXMA 4D82A 2O2DA 5DHRA 3E9DA 3WLNA 4CTOA 1T3SA 2ICAA 1NYLA 2ZQ5A 5LD2C 3RVJA 4YWJA 1UF9A 4LDJA 3P19A 5EJ2A 4F93B 5LWHA 2ZWOA 2C2GA 3H0EA 5DLYA 4EAAA 2I80A 5MN4A 4CM8A 1U90A 1GN9A 3K9NA 3OT4A 3W4KA 4F04A 4DIOA 2VUTA 4E15A 2VG8A 5JDIC 3WY9A 3O5AA 4XUDA 2HQRA 4LGMA 4AF7A 4L73A 4OHRA 4WNYA 1H2XA 4XD2A 4K3VA 1T9BA 4ARIA 2GK7A 1QP7A 1MT3A 2RC5A 3ZLUA 2ZWVA 1IY0A 3IDFA 4BP3A 3GVXA 3MGBA 3ND7A 4DLUA 4YJFB 3FYSA 3IPYA 3RAJA 4H6PA 1CSEE 1VIAA 3KQSA 1HY3A 3O9MA 5K8LA 4KPYA 1J0BA 4LYEA 2DF8A 4I2NA 1CNEA 3ESCA 2IZ0A 4YP9A 5B53A 2XNCA 1M8PA 3H8JA 3KPYA 4EEZA 5HHTA 2CL0X 2VXBA 4PCVA 1AQNA 4YDRA 4NCBA 4Z4FA 1W8DA 1T6ZA 3TGPA 1R6UA 4K1LA 2C0CA 5HWSA 1IB6A 4MRVA 4K87A 4MPPA 3K96A 4KV7A 4PSVA 5F21A 1WOYA 2ZJ1A 3YASA 1JHPA 2BFCA 4BBZA 5KYUA 3OQBA 2VYND 2QMUA 1EEXB 4G2NA 3SYTA 1KARA 1QIJA 4NHEA 2HV9A 2IYWA 1N3YA 4FNOA 1EFKA 1VLQA 4AKEA 5CRIA 4ZO8A 1SBCA 1UH5A 2J6BA 4GQAA 4TKVB 2JF0A 4U7DA 5LLSA 3V4OA 3PLAE 4F45A 1K86A 1R0ZA 4QGAA 4XOUA 2XWJI 4Q7KA 4L57A 3QSGA 3JV7A 1PYGA 3O75A 5ESDA 5JLJA 1SU7A 2R8RA 4YRJA 3TZKA 4BFZA 1QYRA 3T5GA 1D6JA 4HG2A 1GA1A 1GR0A 1S3GA 3W78A 4XWWA 1AVTA 1E2DA 1NY5A 2FXIA 5IX8A 1Z2AA 3SM9A 1JQ3A 1DRUA 1K8XB 1U6JA 1WHSA 3ZBTA 8LDHA 3CVUA 4AP9A 4DTCA 1ZGGA 4RS4A 3BWEA 4R69A 4M89A 3CUEF 2EJTA 1LF0A 3PFNA 1C8LA 4U7PB 2NP7A 3N7TA 3AETA 4FE7A 1MA0A 4DFDA 2J3EA 3VZCA 1WM1A 1Y5LA 4JLVA 5LMCA 2CNBA 1KQ3A 4X91A 3AF1A 2V1XA 3FUVA 4MYTA 2QLLA 4OSPA 5J1SB 2OUIA 1A2BA 1FJXA 2OPBA 1U80A 2E4ZA 1BEEA 5CD9A 4GG1A 2SKDA 1RQ7A 1MVNA 4MO2A 4RJTA 1I8TA 2ZTMA 1BJKA 1DV2A 3KSZO 5EE3A 5L53A 2R84A 4M6WB 5AHWA 4IRMA 3HNRA 2C59A 3I64A 1R4MA 4G5SA 3TQIA 1H2RS 4WZBB 1W36B 3AR5A 1JHUA 1PDWA 2GT1A 3ABZA 4R01A 3S2GA 1U7WA 1MJFA 4GI7A 5LZ4A 1YGYA 3N8DA 4DEVA 4MI3A 1PJLA 1ODSA 5E3JA 4ZEVA 3JQQA 4HT3B 1PX2A 2YYYA 3FYTA 1NKVA 1U9CA 1X0VA 2PFKA 3C3YA 3ZY6A 4EX7A 1TVEA 2O9JA 3U1BA 3DR3A 3A9TA 3CH4B 3Q87B 3GLGB 1GGFA 2HBZA 1G5TA 3HY3A 3TTSA 3ZJ5A 5L4LA 1GLNA 4TMVA 4TQGA 3JPYA 2EC5A 4ZCLA 3WNCA 3V34A 3U4CA 5LYJF 1IM2A 1LW7A 2UVPA 4YRCA 3SU8A 3GFSA 3QBTA 1IWBB 1G3UA 1L5OA 3H65A 1VJ0A 3VISA 3COJA 4K9LA 2OTCA 6REQB 4BBAA 2YS7A 4LJYA 4MUKA 3K6RA 1OX4A 4C87A 4ARZB 3GF4A 2R4TA 4O29A 4MQ6A 2B36A 5LXTF 3VNSA 4P3XA 1TLTA 2W48A 2KS6A 2GM4A 4U9UA 4N48A 4II7A 5JCJA 5IJ9B 2ZUCA 5FJIA 1UEXC 2JFVA 4X94A 2EEZA 3T1VA 3REQA 1ZGJA 4WN9B 3W6NA 1A1SA 4QJ4A 3OMWA 4BLQA 4PNEA 2WPDD 1RI3A 5M29A 3W2GA 3U3ZA 5IM4F 1CWUA 2GF2A 2CUNA 3OZVA 1EWTA 3OD5A 1YS2X 1XZ8A 4FW8A 1GG5A 1QJCA 4Q39A 3OD1A 3OOWA 1F8XA 4L08A 3PX2A 1XMIA 4U2EA 2IE8A 1D1PA 4ZD6A 4QU9A 1XTRA 2QD5A 4DCVA 3KQUA 1KAGA 4L6CA 4NK5A 1L1RA 5IYZF 4RIGA 3K70D 3FOEC 5LBUA 1FMJA 1U1CA 1YHYA 3FDZB 6ADHA 2P2LA 2RGWA 1L6IA 1N0VC 4BUZA 1HSOA 1JX6A 1YQDA 4JLBA 2IHZA 3T4XA 3VU9A 2OCPA 1KJWA 2WFLB 2VJMB 1HOXA 1HNNA 5J2TF 3H7IA 4BGUA 4EHDA 5E1MA 4V1CA 4OHYA 2JAUA 5HCNA 1QE0A 1JLRA 2XOEA 4P93A 1O95A 4GMHA 3HVKA 4JBLA 2R6DA 3D1LA 3R5TA 1Y7IA 4WPGA 3FJYA 1ZMBA 1PUJA 2IZ7A 2UKDA 4NYMR 4QRIA 4YACA 1J4AA 4YAJA 3L01A 4M9RA 3BMQB 3FNRA 3N0XA 4TL7A 1BWSA 2HT1A 4JD5A 1HOTA 2JCVA 3UC5A 4U00A 2F55A 1WX1A 1CQZA 4Q3NA 4DQKA 1RAHA 4V0MA 1CJBA 3UCFA 4MMYB 1DCMA 1FYEA 3EYWA 4KV9A 4JEMA 3THXA 2XIQA 5AXDA 3L0PA 1NUPA 1FB5A 2VK4A 3PUZA 2FMTA 4ME6A 3HKCB 4DMMA 3Q3CA 5IDVA 3UJ8A 4KBGA 4AO6A 1ST2A 2H5JA 4HKTA 4KLZA 3O4IA 3WNDA 5HS4A 4CG3A 2EL7A 5EHGA 4CKEB 3KOMA 1C9YA 1YA4A 2WT9A 1UBMS 1NOJA 2AG5A 3WO0A 3FPKA 3UKOA 1RKUA 3LVRE 3OJWA 5JWHA