1EG2A

Crystal structure of rhodobacter spheroides (n6 adenosine) methyltransferase (m.rsri)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
279
structure length
270
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RsrI methyltransferase, a member of the N6-adenine beta class of DNA methyltransferases.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
molecule keywords MODIFICATION METHYLASE RSRI
total genus 90
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1eg2A00
3P9CA 4AZSA 2BH2A 3T7RA 4CWAA 1AQJA 1RI2A 3HCFA 3B3JA 3MCTA 3P2EA 1JSZA 3P97A 4EVIA 4C4AA 2AOXA 3DOUA 2EJTA 3I53A 3G5TA 3TM5A 2JH9A 5DPMA 4E2ZA 3MGGA 5HIKA 5CVJA 2PT6A 3DP7A 5EMLA 1NBHA 1KYWA 3C3PA 3KPVA 3MTEA 1D2CA 2EFJA 4RVGA 4GBED 3EGVA 4Z2YA 4HSGA 1XJ5A 5IH3A 5C1IA 3LL7A 5EIWA 5CVUA 3UJDA 3NWEA 3UZUA 2JG3A 4PYIA 3HP7A 3GRYA 1SKMA 8MHTA 4RTRA 5F2OA 1AF7A 4EKGA 5EZQA 3PFGA 3R9XB 2DPMA 1AQIA 2XVAA 4V0RA 2I6GA 3BKWA 4YUYA 3CC8A 1JR4A 1RI4A 1YUBA 3EMBA 3KR2A 4PIMA 1EG2A 2Q41A 1D2HA 1IY9A 2NNWB 2OB2A 2YR0A 3E23A 3HVHA 3KPUA 3NJRA 4E2WA 2AS0A 4RSRA 3QOWA 2WA2A 4R8SA 4FP9A 2ZTHA 3G88A 3GO4A 3FPHA 3HNRA 4YV2A 2P7HA 3A26A 1X1CA 3GU3A 3AJDA 3HCDA 4FR0A 3LGAA 4RTJA 1X1DA 3A4TA 4G56A 3X0DA 5FADA 1KHHA 4GOND 3UA4A 3MERA 2ZBPA 4RX1A 3DMHA 2V74B 4HH4A 1FPQA 4HGYA 5HILA 3DUWA 5ICEA 1R8XA 3ER9A 3JWHA 5LQAA 2EX4A 1NV8A 3KU1A 2NP6A 1KPIA 3QOXA 3T7SA 3KQWA 2P3QA 3TLJA 5EPEA 3A25A 5F2NA 3KQQA 1EJ0A 5JR3A 3CGGA 5T6BA 2EG5A 1X19A 2OZVA 3LDGA 2C7RA 4BLVA 5DLYA 1JTEA 1QAQA 5E2AA 3R0QA 3EEOA 2DULA 4DA4A 4AZVA 2PV0A 2I62A 2JH8A 3M4XA 4PYNA 5FHRA 4RVHA 4C05A 4ER6A 3EMDA 3LHDA 1JG4A 1F38A 4OX9Y 5K05A 2B2CA 3CJRA 3DH0A 3ID6C 4IV8A 2G8NA 4QQKA 5E1BA 3DMFA 3KPWA 4YUWA 3HCEA 4RTLA 1ZHFA 3VYWA 3EVFA 5E8RA 5E9WA 5EKUA 5FTWA 3RW9A 1NW8A 1XTPA 3NDJA 4X61A 1BOOA 3FRHA 5B1SA 3RODA 4BLUA 3HEMA 1KPGA 4DQ0A 3NVKI 4PGHA 2PY6A 4KW7A 1KYZA 2FPOA 3FUUA 3V97A 3P9KA 3OCJA 1G8AA 4FSXA 2IIPA 3PTAA 4ER5A 2FHPA 1XDUA 4AZWA 5LQCA 2ZWVA 5LQJA 1RI1A 1VBFA 1WXXA 4OA5A 2YXEA 3BGVA 5E1MA 2P7IA 2ZIEA 5K0FA 2PWPA 3EGEA 3Q87B 1R6AA 4BP1A 1P91A 4PNEA 1F3LA 2Y1XA 1FBNA 4P7JA 1ZGJA 4KIFA 5KYGA 4NECA 2AOUA 3SX0A 1RI3A 1VE3A 5CIYA 3TMAA 2GS9A 4DCMA 1H1DA 4E70A 5P8WA 1EIZA 2ZWAA 5ICCA 4BY9E 1JTFA 2VDWA 5E1OA 3BT7A 3PS9A 2OKCA 2UYQA 3MQ2A 3OFKA 5EMMA 2NXJA 3TM4A 2ESRA 1DUSA 5BW5A 3DXZA 3OZRA 1RJFA 4MHTA 3AXSA 3UJ6A 2NXCA 2BR4A 2AN4A 2B9EA 3LBFA 3TOSA 3SM3A 4RTOA 2Z6AA 1T43A 3DTNA 4CKCA 1EJ6A 2YUIA 4IV0A 1RJEA 2AOVA 4LWOA 3KKZA 2ZCJA 1P39A 3LDUA 2N47A 2P35A 3AXTA 2P40A 5DM4A 1AV6A 1N7JA 3V8VA 2R6ZA 2BR5A 2ZBQA 4AZTA 2Z6UA 3KQSA 2PT9A 1QANA 5ICGA 3EVDA 1P1CA 3UJBA 1NW3A 3EVEA 2ZZMA 2ADMA 5DM1A 2JHCA 2BM8A 1VLMA 4HTFB 1NW7A 3MB5A 2AOUB 2WK1A 4PYKA 2IBSA 5K0NA 3GRVA 2I9KA 1SUIA 1L3IA 2NXEA 3FPJA 3P8ZA 4U7PB 2IP2A 2B78A 3WSTA 2XBMA 2K4MA 2QE6A 3EVGA 4OQEA 4AUKA 2ORED 3PB3A 5CM2Z 2IBTA 3SSOA 3UJ8A 5K09A 3D2LA 3B3FA 3DLCA 3L8DA 2AOTB 3CBGA 2C7OA 2PXAA 4P58A 2QY6A 5GIOE 3GRRA 4H0NA 3AWIA 4RTMA 4AX8A 3EEYA 2HWKA 2CMGA 4HGZA 4PIPA 4R6WA 5FQNA 2XYRA 3T0IA 2NXNA 3HA3A 1G6Q1 3ER8A 1JSXA 4R8RA 2HR1A 2YXDA 5DX1A 1I4WA 4KIGA 4M7RA 2PSSA 2ZFUA 2PLWA 3B5IA 3BXOA 3PT9A 4U7TB 2AVNA 4P7KA 2IH5A 1I9GA 2AN3A 2YQZA 3CJQA 3OU7A 2WA1A 3FUWA 3TQSA 1R74A 2ZLBA 3CVOA 4CTJA 3IEIA 4YUXA 1INLA 2PXCA 2HTEA 3C3YA 2ZVJA 4MTLA 1G60A 4YMHA 3CCFA 1NKVA 3HA5A 5DSTA 1XVAA 5JUWA 4POOA 3M6WA 1BHJA 3LDFA 3BKXA 2PVCA 3M6XA 4M36A 3KQMA 2PGXA 3TKYA 3KQVA 3SSNA 5DXJA 3ELYA 2HNKA 2LD4A 3HCBA 3HVIA 4PYOA 1Y8CA 5KQRA 2VDVE 3TRKA 1VIDA 3GGDA 1SVUA 1TPYA 3IYLW 5F2KA 1HMYA 4F86A 1O54A 4DKJA 2PBFA 3FPGA 2AOTA 3UJAA 5KQSA 5E1DA 3FUTA 1SG9A 2B3TA 3BUSA 5LQKA 3O4FA 3S68A 3BGIA 2G72A 2JJQA 9MHTA 5HOQA 1OR8A 4LWPA 3GWZA 4L7VA 1ORHA 1X1AA 1YB2A 3NVMB 3SR4A 3KR9A 3G2OA 2OB1A 3JWIA 4GF5A 4QPNA 5BW4A 3UJ9A 3GRUA 3F4KA 5E2BA 2HMYB 3B3GA 3C0KA 4HG2A 3NWBA 2BM9A 1JQEA 1NV9A 2B25A 3P2KA 4MIKA 3GNLA 3P9NA 5EIFA 2G70A 2FCAA 1VPTA 2OPBA 3GIWA 3LBYA 1ZQ9A 3ERCA 3SXJA 2H00A 2QRVA 2IDJA 5ERGB 5BXYA 1R18A 5DX0A 3T7TA 5C9ZA 3NMUF 4MQ4A 3RIEA 5E9JA 3NTVA 5DSXA 5EMKA 1Z3CA 2XYQA 4GOLD 3C6MA 4FGZA 4KDCA 1N7IA 5K01A 3ELUA 5K0JA 3UBTA 1FP2A 2UYOA 1KPHA 3G8BA 5DTQA 1MJFA 2I7CA 1XXLA 4WVLA 1VP3A 1YZHA 2XYVA 1R8YA 4OQDA 1QAMA 3DLIA 4RWZA 5DWQA 4ER7A 3FYDA 4CKBA 3A7DA 4XCXA 3OPNA 4PYJA 2IGTA 3LCCA 4CXMA 2C7PA 5H02A 2ZULA 4X41A 1B42A 2O57A 3HCAA 1WS6A 4OBWA 1WXWA 5GOZA 3K0BA 2FRXA 2P3OA 5HFJA 4M37A 1EQAA 5K8VA 3FPFA 3KPJA 1QAOA 3CKKA 5FWAA 5CD1A 1KP9A 1P1BA 4PONA 5FUBA 3U81A 3EPPA 4E30A 2CMHA 1R00A 3FUVA 3K6RA 3BWMA 3M6VA 3M33A 2ZZKA 4RYLA 1FJXA 2PX4A 4RVFA 1JQ3A 1ZG3A 4E31A 1DL5A 1WY7A 3OFJA 4HC4A 5GM2A 5K0LA 1N2XA 5K0GA 1YF3A 3DMGA 3HVJA 4QDKA 4E33A 2NYUA 3C6KA 4ISCA 3LSTA 5FHQA 1IXKA 3EVAA 3OU6A 5K03A 2VP3A 2IDKA 3BWBA 1WZNA 1Q0SA 3JWJA 4FT2A 2IH2A 4QVKA 2E5WA 4A6DA 2UZ4A 5MHTA 5FULA 4XUDA 1I1NA 3P71T 3GCZA 5CUQA 4GC9A 3G2QA 4HTFA 2FK8A 2VDUE 4QDJA 4IKPA 2GH1A 5FQOA 4R6XA 1QYRA 5EC8A 4GOMD 2IFTA 2OY0A 3DULA 5CVEA 2KW5A 1QZZA 2CWWA 3LCVB 4QTTB 4YUVA 4YV0A 1D2GA 1SQGA 3ME5A 5LQNA 5EHIA 2ZZNA 3FYCA 4F84A 3FPEA 3ELWA 3Q7EA 2FYTA 2FK7A 3KQOA 1JG1A 5FA5A 3B7PA 5HIJA 1L3BA 2PWYA 3OE5A 4X63A 3MCZA 1NE2A 1SUSA 4M38A 2JHAA 4FT4A 2C7QA 2QRVB 3H2BA 5DXAA 2YXLA 3P9IA 4XUCA 4DCGA 4E32A 1G8SA 3KQPA 1M6EX 4FSDA 4R05A 5LR6A 3AY0A 3THSA 4YMGA 1V39A 5EOVA 3LKDA 3ANXA 5GP1A 2P3LA 5KS2A 5CCXA 4PWYA 1IM8A 3LPMA 3GRZA 4PYMA 1VP9A 3EVCA 3I5UA 5GM1A 1YFJA 2O05A 4QVGA 2AN5A 3IHTA 3OU2A 4KDRA 4PCAA 3THRA 4B17A 4RTPA 3HCCA 2AVDA 4O29A 2PX2A 3KQTA 3I64A 3FTDA 4K6MA 4ZTBA 5EG5A 3R24A 4HRAA 2VS1A 1JG2A 4F85A 2GLUA 4DMGA 5K0BA 4GUAA 4MWZA 1G55A 1WG8A 2CKDA 4PGGA 3TFWA 4EK9A 1FP1D 4OBXA 4RTNA 3DXXA 4RTKA 2IH4A 4C08A 1ORIA 1VL5A 3EVBA 5CVDA 2UYHA 4RV9A 3R3HA 4WXHA 4QTUB 3SGLA 1BC5A 3LECA 3A27A 3TR6A 5DX8A 2GA9A 5E8JA 3R6TA 3PX2A 5E9QA 1L3CA 5EEGA 4FS8A 2QYOA 3KQYA 4JXJA 5D1HA 5U4XA 4X1OA 2G71A 3REOA 4XUEA 2PJDA 1RI5A 5DM2A 3GDHA 4X60A 5EVJA 3IV6A 2Y1WA 1O9HA 2OXTA 2XVMA 3KPYA 4GC5A 4GEKA 5FA8A 5IKMA 5LQUA 3SSMA 4EMSA 3HTXA 3G2PA 1KIAA 10MHA 3FTFA 5EMJA 2G1PA 2ZW9A 4PYQA 3NW9A 2Z6QA 3E05A 1PRYA 4KVZA 1RJDA 1L1EA 5LSAA 4GQBA 4QPPA 1RJGA 3FTEA 2ERCA 3CJTA 4PYLA 2NP7A 4LECA 3B89A 2ONYA 3E7PA 4BP3A 2EJUA 5DRTA 3BZBA 1YFLA 3JWGA 1SQFA 3UA3A 1JG3A 3PVCA 4KWCA 4KRGA 4CTKA 3TKAA 4DM3A 4DZRA 3QV2A 4UOEA 2O0LA 2PKWA 3EVZA 1X1BA 3HA7A 3ORHA 1M0EA 1G38A 2GB4A 2PX8A 3DXYA 3KR1A 2PXXA 4RVDA 4YUZA 4RTSA 4RTQA 2BR3A 3G89A 2HV9A 4QQNA 4GOOD 1EAMA 2OO3A 5C0OE 1NW5A 5G02A 2H11A 5KVAA 3UJCA 5DT2A 3DR5A 2OYRA 3TPZA 3PLAE 5DRYA 7MHTA 1Q0TA 2AOWA 3OZTA 3KHKA 4FZVA 1ZKDA 1UFKA 3BGDA 3FTCA 1XCLA 3O31A 4P7GA 3BWCA 5D1NA 4C04A 4ER3A 5CCBA 2UYCA 1XCJA 3G2MA 3HM2A 2GAFA 1ZGAA 2ZIFA 5K0EA 5GIPE 2VZ9A 5CVVA 2PX5A 5BP7A 3LKZA 3M6UA 2JHPA 3MTIA 3VC2A 2GPYA 3G8AA 5LQRA 3BWYA 1MHTA 3FZGA 5EKXA 4Y2HA 1TW2A 2A14A 1UWVA 4OA8A 5EHGA 5EGSA 4LG1A 1NBIA 1KXZA 1L9KA 1VQ1A 3GXOA 5HEKA 4DF3A 1UIRA 2OBFA 1JQDA 2CL5A 2AR0A 4Y30A 1TW3A 2ONZA 4C06A 3KR0A 4PCLA 4V0QA 5EQJB 1BKYA 3O7WA 3FUXA 4CKEA 1NT2A 5FWDA 2ZIGA 3NDIA 3FRIA 2H1RA 5FCDA 2O06A 5GWXA 4ER0A 2R3SA 4C07A 1NW6A 2ZSUA 3G7UA 2YVLA 3HVKA 2IPXA 3M70A 3SMQA 5EEHA 1XDSA 2AZTA 4PINA 5HIMA 3PFHA 3VSEA 3G5LA 3A7EA 3I9FA 1PJZA 4YV1A 2YTZA 5DM0A 1XDZA 3SVZA 2O07A 2F8LA 3UWPA 2P1DA 2V7EA 5HIIA 3VC1A 5DTMA 4E2XA 5GINE 3GJYA 3OZSA 2YX1A 1YZ3A 5ICFA 3LX6A 5HZMA 3UFBA 3P2IA 3PX3A 5T64A 5M5BA 3UJ7A 4BLWA 4IWNA 2P41A 2ZBRA 4EQZA 1DCTA 4C03A 1U2ZA 3MHTA 2P8JA 4EKIA 3MAGA 5T67A 3EGIA 3OE4A 3ELDA 2BZGA 3E8SA 1KR5A 4A6EA 5K0CA 3I58A 4ATNA 4P7FA 3LCUA 4E2YA 1O9GA 5EZSA 1HNNA 1M6YA 5DTRA 2QM3A
chains in the Genus database with same CATH superfamily
5ILQA 4FI3F 4B6PA 2YINC 4Z9YA 1LLCA 1RI2A 3DLHA 5CT8A 1M0SA 2FP4B 1LTKA 1QGUA 3C87A 4BNFA 4MV6A 2XUPA 2Q5IA 3RRYA 2IXGA 2QTNA 2ZRMA 1U8YA 1U7WA 3C3DA 4OUKX 3VO9A 3WYGA 3SZLA 1PI3A 1O3YA 3MM4A 3O47A 1YS7A 4XA8A 1JFSA 5TJ9A 1N5IA 2X4IA 3HJUA 3W2IA 1UOOA 3NWEA 3QM1A 5EUQB 3D6FA 2J6IA 2OENG 3WLNA 1N1MA 2FEMA 3EN0A 1U4SA 3RIYA 3SF8A 3VTFA 1QF6A 1YB4A 1L7RA 4ZGGA 4UVIA 1ARZA 1UKEA 3VA7A 3PX7A 4QT0A 2DB3A 4PU0A 3U1VA 3V8PA 3WDMA 2JGRA 3TSOA 1JFRA 3BJMA 4TV8B 2OORA 4V0NA 1RPNA 5DSZA 3OSUA 4IZOA 2ILTA 2IX3A 3FPHA 3MNFA 1D0VA 1OXKB 5A71A 1JIIA 4EA9A 2WPDA 3MOGA 3QX7A 2BKVA 2EFGA 3RADC 1P45A 4OQNA 4HDKB 1U8AA 2O8FB 4GOND 1NMSA 4L78A 4WLVA 4AJ4A 2RH4A 4D26A 1FTWA 1FPQA 3KSUA 4H1UA 2RMKA 4YH1A 4G0ZA 4WNAA 1Y34E 4EA6A 1QVZA 5LQAA 2JKZA 4R1NA 5CRIA 1RZRA 1JFTA 2C5LA 4J29A 2XMCA 3KQWA 1KJIA 2YMPA 3SD7A 4A8JA 3ZZ1A 1SHUX 1K92A 1P2UA 1T35A 1ODJA 1WMSA 1X87A 3AX6A 3V7WA 1IVNA 4R0NA 1TZCA 4GI1A 1JL3A 4J03A 1VIMA 2NO6A 1S96A 1M9NA 3AKEA 4BVKA 4D79A 4GVXA 2IYNA 1NDHA 4Q37A 1L5VA 2IEDA 1N0VC 1ZJJA 3EEOA 4DA4A 1RXIA 3SZUA 2ZUFA 1PFGA 1KH3A 1Z4NA 4YXWD 4GSLA 4KO8A 1GG9A 3BEDA 4I4CA 1IE3A 4D82A 3U7GA 1D6NA 4YPFA 1SBYA 3CJRA 2GEUA 5CEJA 3C6QA 4FHZA 2VSYA 1QHYA 2BSQA 5GJVC 4CQNA 1XJCA 1O57A 2A3NA 4D4LA 1EWVA 2VJLA 3IOYA 3VVMA 3ROGA 2FZEA 2VK2A 3RAPR 3TIXB 3NVDA 4H7IA 1E9AA 1H8EA 2QI9C 3NVKI 3WLHA 3WV5A 2RJ3A 4H3HB 2LWIA 4C5AA 4II2A 3D7MA 3IB6A 3PEEA 4JJ7A 1L5MA 1RM0A 2Z57A 1BEUB 3DOJA 4KLZA 2F4VB 2RHHA 5HE8A 2AQIA 1S5PA 3CLUC 4M86A 1E3TA 2EF0A 5TPWB 2C5BA 3WMFA 3OZXA 3WQHA 4XQEA 1E7WA 5AT1A 5BSTA 2K6GA 1IQPA 3LQ1A 2ECKA 2XDQA 4RCYA 1FFEA 3QRWA 4UHHA 1FBNA 5KQMA 3PUWA 2ID7A 2OV2A 2XUHA 3KKPA 4JROA 1ZD2P 4MVYA 2FPPB 1UFOA 4AMBA 3LTEA 5I7OA 1E62A 1EXDA 2P77A 4I4LA 3DWIA 1QIHA 1RQPA 3KTOA 4JC8A 3KL2A 5KJEA 1ZBQA 2HAEA 3B9QA 3TOCA 3ZVKA 2UZIR 2FZLA 4NYMQ 2E6UX 4XR9A 4JI6B 3RU2A 1BU8A 2FAXA 4INZA 1AXRA 5INTA 2CFCA 2W70A 3FI0A 2K2QB 4MHTA 4DTCA 2IEYA 2NXCA 5A3SA 1T4CB 3IQHX 3HWWA 2C98A 1GCOA 5AHRA 2Z2ZA 4V02A 5AKXA 2NVUB 4C1NA 4CV1A 3FR7A 4NZPA 2V4MA 3VGJA 4Y2UA 5JMPA 2YVAA 4J2HA 5YASA 5JAHA 4HWGA 1D5CA 1RZ3A 4RIIA 3NNNA 2WVAA 4FGUA 2P40A 5LPNA 3IP6A 2VRCD 1GPLA 1QB8A 2O2EA 3IT0A 4Q82A 4Q02A 2F7SA 2DPHA 3KLOA 1R9GA 5FKJA 4RZHA 4TRRA 3DVAB 3HPQA 3IQFA 3TNYA 1W36B 1HG0A 1RTKA 4MVJG 4RLFA 3SBOA 1YMQA 4CL0A 1JXMA 4HTFB 4PEVA 3U1BA 1XRNA 3DCJA 1O2DA 1TCUA 4LVCA 4P1ZA 5K0NA 4WBSA 3S2SA 3ZV3A 2FZGA 3DD5A 3QPWA 4Q4AA 3QVSA 3UT0A 1TRKA 1CJBA 3BWEA 3TW6A 3WSTA 3UXYA 1Q91A 1E9FA 2ZSDA 3I12A 4YROA 4YRCA 3U3OA 4E5YA 1VKRA 1M2GA 1NA5A 4G5GA 1P1FA 3VJLA 3KSBC 2GESA 1X15A 4H0NA 1DCMA 5AVXA 2BE9A 2W2OA 4AX8A 5E0KB 4HGZA 1SGWA 4L3WA 1PHRA 1U6IA 1N2JA 1ODKA 1OY1A 3INGA 2W42A 3A6PC 3GJZA 1BRTA 1JHYA 2DWPA 1IATA 2HU7A 1MPTA 3GAMA 4YC7A 1OFUX 3MTQA 3TCNA 4F5WA 3FJOA 4KX3A 3QVGB 4Q21A 1GGVA 4TMTA 4AUNA 3D2AA 3N7TA 4PPGA 4ETWA 1S0UA 1UZMA 4FX5A 1ZY2A 1QIGA 3TDMA 1GGNA 2FSPA 2XE4A 4I1VA 5DZSA 1LBTA 4Z1MD 3AONB 3C3YA 3K6KA 2GYVA 4MTLA 1C9YA 3JTMA 1H2HA 5TVGA 1U7UA 2H0QA 1NZJA 1SRQA 2QYSA 1Y3FE 1S7CA 2RHTA 4X64B 5F23A 4NMWA 3HS3A 4HBGA 1U2QA 4IWYA 1SXGA 3EXFA 3RFUA 4PX3A 1G291 5CR9A 4BCBA 1E3MA 4PO9A 1U1CA 2VK4A 1WCV1 1QE0A 5T4HA 1C8BA 5A2QA 1DEXA 1EP3B 3F6BX 1IY2A 1E5TA 4E11A 3ZX5A 2UU9B 1HMYA 2XYPA 2BFFA 4J0EA 3OX3A 3QZUA 2O19A 3QLTA 4Q9NA 2B4AA 3FUTA 1UMBA 1P33A 1DTEA 1Z9BA 3MBIA 4B31A 3IERA 3AY7A 2EL7A 4S1PA 2PYZA 3DDSA 4HR7A 3S68A 4YRGA 2G72A 4W1QA 1U9CA 2FA9A 1ZCBA 1OHHA 4G0QA 2J5RA 3BH6A 1HE3A 1MX9A 2PH7A 4ZAVA 4EHHA 5FFFA 5KYYA 4EY3A 1BEZA 3KR9A 4TYNA 1B16A 1C3JA 1OPRA 3S5JA 5IJ0B 4JOQA 2FGKA 1CG6A 2QROA 4QOIA 3QYPA 2HMYB 3PC6A 5CBKA 2YIDA 1CD5A 4WINA 1JQEA 5HS6A 2HXYA 3AVTA 1PR4A 4YPOA 4F97A 2QXTA 4PBTA 5GZ6A 4LOHA 3ZKAA 3KJEA 3VRHA 2NSJA 2XOEA 3L7NA 4ZQFA 5BSEA 1JKJB 1SUFA 4LF7B 2JJ2A 4FTWA 3V8NA 2WAMA 3MUNA 1AG9A 4XGQA 1E0AA 4HVAA 1H6DA 3DAYA 5E6RB 2H51A 3H7IA 4IJVA 1VIAA 5K0JA 1JAXA 3MXOA 4WAUA 3ZGNA 1DKQA 4BO3A 1JH8A 3I2YX 1EXWA 5BXQC 1S3GA 4QSMA 4MQMA 1QAMA 3DLIA 5EWJB 3TJZA 1O89A 3ZPXA 5BR1A 1TIKA 3X1MA 1CRQA 3P9PA 3R3ZA 1TF2A 3TTSA 3OO1A 4PYJA 4CIWA 4ABTA 1MIOB 1FNNA 3HCAA 5HDBB 3BILA 1XJ0A 1ZIXA 5A2GA 4J16C 3ACCA 4AJ2A 5CYFA 3BCUA 2YJNA 4YJ3A 4AQ7A 5JXWA 1PGJA 3OWXA 1SEVA 3ICVA 1UWKA 1VL8A 1U2SA 2NVOA 3K0FB 5FUBA 4ERXA 5J47A 1O94C 2I9KA 1E9CA 3BWMA 4UFOA 4IZHA 3ZQUA 4AXXA 1FJXA 4GMDA 2PX4A 3EXEA 4TROA 4EFKA 3P4YA 4ZCQA 5K8IA 1DJOA 2B20A 4O0LA 1VOTA 2DYKA 1XYYA 3CNBA 3P52A 3HVJA 4KZKA 3I9OA 1GPNA 3F5SA 3K8QA 3KUXA 2J32A 2QUJA 5FLYA 4CEHB 5A03A 3M1AA 3HB4X 2VQSA 3I01A 3ICPA 1JDUA 1WPXA 1H3EA 5HF6A 1K63A 1OAOA 1F6BA 2HJVA 3BE6A 3I8SA 3DDCA 5CUQA 3TL2A 1X7XA 3PG5A 3QE0A 5AW7A 5FQOA 1D4ZA 2D2IA 1E2LA 1FFXB 4G9BA 3CUUA 3TQCA 4BNGA 4RPIA 4DRZA 3R9KA 3QXXA 2DTDA 3SYLA 3SIWA 4A10A 4F1JA 3IOBA 1EE1A 2OLJA 3WGIA 1PJ3A 3BB4A 5EXPA 3DUFB 3ZXXA 4MV4A 1XXHB 4JFRA 2YFKA 1LXCA 3IMFA 4ZEOA 1P74A 3K0KA 2MSLA 5EIXA 4J1QA 2G83A 4K6HA 4PSUA 4Y3UA 3SR0A 2BHTA 4UD2A 2L69A 3F8SA 2XUQA 1ESZA 1JQKA 3Q72A 1XRLA 2QRVB 4R7ZA 3AVUA 1ZMXA 2NPOA 4BKPA 3P19A 4HFJA 1LZLA 3LVRE 2AUNA 2D5AA 1YHYA 2VHJA 1FNBA 3OJ0A 4X85A 4P80A 3DT9A 3PC3A 4GKAA 4TN1A 1NX6A 2IF0A 2AR9A 4W5OA 1F8GA 4KR9A 4ZWNA 3T5CA 1D1SA 3TB6A 4HBZA 4BQFA 2C83A 4IBOA 1EFVB 5IU6A 1VFPA 3BGWA 1USWA 4LUCA 4M1ZA 3TDKA 4IOLA 1WKCA 3V42A 1NF9A 1CEXA 1UDWA 4DSZA 4OO3A 2QR2A 3VZDA 1Z26A 2WAOA 3DKKA 2NTVA 3I04M 3ZVLA 3ZU3A 1GFIA 2VXYA 1MDFA 2G5TA 1Y42X 2CKDA 3TFWA 1VHQA 3UN1A 4HY3A 1MABA 1CR1A 1VCOA 2QMOA 3IIEA 3N39C 1PZFA 2MSKA 1A1SA 1CK4A 1KZ9A 5DEIA 4V0KA 5ALDA 4YP6A 4BGIA 2C2XA 3EEIA 5IVPA 4OKIA 4KXYA 5ALGA 1FSZA 3RFCA 2C4WA 4MV1A 5I7HA 1B3BA 3L2OB 2YS6A 3RVPA 3A10A 3ZG6A 2AWNA 2HGZA 3UTCA 5IJ9B 5LIPA 3OT5A 3V3TA 3KQYA 2ZJ2A 4LZOA 4V2IA 4YQEA 8ABPA 4XUEA 2JLRA 3HPRA 2J6BA 4DWJA 4X60A 1E9RA 1JN0A 5LYJF 2L2QA 1YQXA 1KVTA 4TQGA 5FYQA 4EO4A 5FA8A 4P22A 3LUKA 1VM6A 4LSZA 3A06A 3DONA 1CE8B 1JYFA 5M7EA 2WBLC 3AUJB 3A4LA 4R5HA 3H3JA 4HS4A 5KNCA 1NHWA 1I13A 1SZDA 1MF7A 4K6KA 5K6AA 1ULZA 2A9RA 1PRYA 1EFDN 2G0TA 5GV8A 3LUFA 3ITDA 4OJKA 4AB1A 3UYLA 3ZBUA 4QXQA 1CXZA 1T0PA 2C92A 1XZLA 2QRPA 3OOWA 3WNDA 5F51A 2ZYGA 3VR6H 1RYNA 1D7AA 1VLJA 4BNHA 1COWD 4JLBA 1SQFA 1ZCJA 3IEKA 3ZE0B 5B2EA 1OIXA 4YY3B 1AKRA 2VAVA 2JGJA 3ZC3A 3EASA 3O38A 3OUTA 3UVEA 4JBGA 1P2FA 3BXPA 4QULA 2BSAA 2JGKA 3EIWA 1GQSA 3FNQA 3WQRA 2PXXA 1CRLA 5CYGA 2DQKA 1YMVA 1WPQA 4IHJF 4V38A 4WWHA 5DHUA 1LTQA 2IXAA 2B5VA 2BR3A 4RIEA 1EE9A 3P0RA 3P9QA 2NU8A 3W4IA 1GGMA 4CIAA 5JXIA 3OM1A 1TUEA 1UAGA 5B4TA 5JSUA 5THXA 1PQUA 2XDYA 3AT1A 4BEJA 4EAQA 3FB1A 4QHTA 2UKDA 2H92A 4AO6A 1AT1A 1UADA 4BUJA 1HPLA 1ZKDA 2YV4A 3PQDA 4C04A 3WB9A 3T5DA 4MROA 1B2LA 4PTLA 5AWFC 1YTUA 2NUBA 4YLGA 1MO4A 1DIOB 2ZJYA 3R6WA 3A9TA 3RUCA 2JCXA 5AVVA 2PD4A 4B3IA 1FDSA 2Q0QA 1K06A 2QTLA 4CUZA 3NX4A 1NWHA 1W2HA 3BWYA 1JG7A 3Q7QA 1P7PA 5K3FA 3OCZA 1N2EA 3GEHA 1U2GA 3BF8A 2R8YA 2FWJA 4IIJA 4PSVA 3WV4A 4FZ3A 2Y1DA 2CL5A 2Q0XA 3TR5A 1CS4C 1CFJA 2NZ8A 3LUPA 5AKIA 4UFPA 5CA1B 4G97A 2SKDA 4C06A 4Z4QA 1J25A 2VPZA 2HK9A 4FIDA 5IZCA 2VH1A 4FILA 1Y98A 1R3UA 1FUYB 2WSYB 1P8JA 3C6BA 1TQ8A 4NYIR 2GPWA 2ZSUA 4O59O 4DAEA 1HRKA 2V7TA 2C29D 3DQZA 3K70B 2YV5A 4GOJA 2A0XA 2IEZA 4DMLA 1V41E 3OLQA 2V7VA 1H5QA 3A7EA 3FVTA 4JYPA 4NSNA 4DVJA 4DR1B 5IHXA 3OOJA 1YBMA 2XKBA 4K9RA 1KMHA 1DV2A 4I5FA 4OP3A 3V34A 4PCUA 4FYKA 3UWPA 3HNOA 2R6FA 3ZLTA 3STHA 4C4PA 2WIAA 4FN5A 5TSDA 4F0JA 1T6ZA 3OZSA 3WGZA 1BRMA 3WIEA 1T6YA 4PSDA 3QIVA 1I1QB 2HIMA 5DLDA 1XLWA 4FWIB 3T9DA 2FN7A 1Z33A 3N0TA 1ETHA 4NARA 2VHTA 5T64A 1X7YB 4OHPA 1DXQA 1THZA 1HDZA 2OAGA 3N2ZB 5G41A 4AYWA 2COEA 2R79A 1IN1A 2FQQA 2ZB4A 3L8HA 4OD0A 3ZCVA 4DV6B 1MGOA 2WZCA 1R88A 5C37A 4RAQA 5DGTA 1NJ8A 4YMUA 1IBCA 1FU4A 4I2NA 2H6EA 3L05A 3L7MA 1II8B 4QARA 1XWIA 4MQLA 3JS5A 2PBLA 2PX3A 1D1TA 3CZQA 3HBJA 5DGXA 3WMGA 3T7RA 1SXIA 2ZGVA 3L1KA 2N1BA 2B5OA 1C7FA 1JSZA 1BDMA 3H9GA 2OK7A 2XMPA 4XVRA 5LM3A 2GCEA 3U7IA 3AVWA 1Z8FA 2D4HA 2QWXA 4FFRA 4NBUA 2EDCA 2Q2VA 1G7SA 3GJRA 5EI5A 1UK9A 2Y4NA 5B6JA 5ALQA 2D5BA 1XCGB 4RVGA 1BWRA 4HUTA 3T06B 1IUNA 2UZ3A 1KHTA 1ORDA 1HLDA 5BNFA 3CURA 2P6OA 2PV7A 4HLDA 3CH7A 2PQMA 4DV2B 5D84A 2X9NA 4DCCA 4LJYA 1CVIA 1P80A 1RC1A 1ZCZA 2WP0A 3F46A 4CKZA 1F9EA 3QVVA 1JHMA 1TK2A 3GGGA 2C7OA 2QLMA 1E5XA 3GBSA 4U00A 3RGWS 4FYYA 5CA0F 3E23A 3AIOA 3NJRA 4NIMA 4RGVA 1DKRA 1ULUA 1Q0ZA 4LPKA 4DILA 4YMSA 3HQ4O 1ZNQO 2XTJA 1VTKA 2FN8A 3DNMA 3NIWA 4GPEA 5JHHB 5FI5A 4Z4IA 1OC4A 3R5HA 4GPD1 4OGLA 1K75A 3UAOA 3DDUA 5CNIA 1JT9A 1K08A 2W6CX 4C0WA 1HURA 4ZCTA 3S40A 3GRCA 4BNYA 2DVMA 5EE1A 3QP9A 3V1TC 1HTTA 1R8XA 3ZHYA 1XQ9A 3M6FA 1ID1A 2CNBA 3PPWA 4M8LA 4KN8A 4JUFA 3ZE1B 4CLXA 2YWFA 3T7SA 3WDSA 5EHZA 1Z29A 3CPSA 5K3DA 5BSRA 1E3LA 1WXIA 2ZBUA 4QO7A 2WWIA 4JOBA 4TS3A 2ODTX 2RI1A 1EUCA 2W93A 2QAGA 1Y5LA 3D0RA 2KBFA 3V1KA 3B6EA 3S5UA 3UB3A 1O0CA 1ZK4A 1C7QA 1ZNYA 4HVCA 2R1UA 2BEUA 4L50A 4QYMA 2IRWA 4E08A 5IKEA 3M2PA 1KSJA 4HXGA 4K2HA 3PI7A 4TGLA 4K3UA 4QFCA 1QTQA 1KEUA 1ZHFA 1Q22A 2XAAA 3RW9A 3LOPA 4YASA 2NZYA 4ALLA 3IVGA 4OQPA 1E7MA 3O5AA 1FE8A 4A9AA 4R3UC 4D4KA 2D7DA 2G82A 1OTYA 3LX4A 1N6NA 3QFCA 1DKLA 1V2GA 2GHTA 2TMYA 2JFYA 4KPEC 3WYBA 2HQ1A 3R4CA 3VR0A 3EPKA 4NV0A 3OHPA 3TAUA 1PV4A 4HF7A 3W5AA 5JDCC 3K70D 4TZKA 3EPLA 2PS3A 4X44A 2O50A 3LVFO 3NTRA 3Q2IA 1TAGA 3RIXA 4HGPA 3I0ZA 4L0MA 1GP2A 1J7JA 1A8QA 3X1KA 4E88A 1M7GA 4A1FA 5EE0A 4K6GA 2R1VB 1XZNA 4KGXA 3ABZA 4KGDA 2CHEA 5JY6A 4ARIA 1QPBA 2O3UA 4ITRC 4FJ1A 3FGPA 4LI3X 3NGXA 2X13A 2NSDA 2GI4A 2ZSBA 5BRAA 5BYBA 3PXEA 1ZJ4A 3RSZA 4CDMA 2RHGB 2HPVA 2ZVQX 3B1FA 4I7EA 5CMLA 3RS8A 4A2PA 1U63A 1CETA 2ZRFA 3TQOA 3RPEA 1W30A 4ITUA 3WL6A 1E1RA 1X77A 1YRLA 3UJ6A 1VL0A 3RO7A 2GETA 5CB4B 2Q46A 4I3GA 4DIBA 1Z37A 3TQHA 2LCFA 3ZXUB 1P7WA 1Q1EA 1Y1RA 4M9UA 4MUBA 4IV0A 5ED4A 1SBHA 2JATA 2NVUA 4NYMR 1XPJA 1NRJB 2C20A 5TVKA 2WPNA 2QB5A 4RHEA 1G5IA 4JIMA 3RSOA 3T4UA 5C4IA 3KFLA 3DYVA 1P7VA 2R6ZA 1OREA 1H23A 5FIUA 1P18A 3BRWD 5IC4A 4LZPA 1P3DA 3RARA 4DV5B 3ZIAA 1GKUB 3AU8A 4MRMB 1PLLA 3EVDA 1XO1A 5F7JA 1MKYA 1Z74A 2C2YA 1QHEA 2VXCA 4RKFA 4TMFA 3OC0A 2V7GA 2B92A 4J6EA 3TS1A 4KKVA 4MMXB 2X3UA 3LAWA 3MB5A 3CN9A 3PC2A 1ZD1A 3MTGA 2VZEA 3KT6A 4FFWA 1U99A 2Z9DA 2P2ZA 1PS0A 2B78A 2VQ6A 4IIJF 5ALJA 6YASA 1VL6A 3H9CA 4LOKA 1O4WA 3W6UA 1NGSA 3FTPA 3I92A 1U2TA 2DR2A 3JQDA 1G18A 1PS9A 4LY3A 3ES9A 3EOBI 4G1FA 4JP2A 2BFCA 5DTIA 1JU3A 4IL5A 1UDCA 3PRJA 3SJUA 1NF2A 1M1ZA 2A2ZA 2LIVA 3IJ5A 3W3ZB 3W8EA 1J1IA 4ZYXA 3TQQA 4AG3A 5CX1A 1DBVO 1WA5A 1V8OA 2PSSA 4MVJM 4U7TB 3ZLBA 1YRBA 1JDJA 4EVSA 5JBQA 3E3LA 4Q47A 1ZGZA 2ZB8A 4PLFA 4RD3A 1J0EA 1IG0A 1SB9A 3I05A 3IEIA 5KTTA 2QP3A 1R5NA 3NBMA 5JEDA 3HGTA 3LA6A 1AX9A 1ADBA 4GP9A 3C3EA 3WHLA 3HA5A 1GZVA 1VKNA 3M8KA 3STXA 3B85A 4BE4A 4R0MA 1O77A 3G6KA 5KREA 2PUJA 4JLUA 2CUZA 3LHKA 2FZ4A 2I87A 3A1SA 3EC2A 4GWLA 1W49A 4M36A 1N34B 1CSEE 2C5FA 3H75A 2ZRAA 3IP3A 5BV1A 1PD0A 1JR3D 3BICA 4G6ZA 5GAJA 1X7DA 5K0SA 5KNCH 4Z8XA 1XRPA 4JKYA 1NIPA 1NC3A 1TPYA 1FMCA 4AKEA 4BASA 2XDWA 3FPGA 1RXYA 3HY3A 3UMSA 5LC1A 3R7WB 4UUAA 5AM4A 5GONA 3SSAA 1H4SA 2OPHA 2BF4A 2ZSKA 4RH0A 4E94A 1OR8A 2BMWA 2P27A 3FVWA 3GWZA 1UP4A 3IP5A 4Q9LA 4D57A 2KWIA 2ZIWB 2ODAA 2HEGA 4RPKA 3F0TA 2CE7A 4DMHA 5KVCA 2AG5A 5IKXA 3UJ9A 5JJCA 3S1LA 2X8LA 3K32A 5JYEA 4NU5A 3O2SB 2OMEA 5FPKA 1M2NA 3S2FA 2RJNA 3HU5A 4Z0HO 3GIWA 3IUMA 3KLPX 4BKMA 5KTMA 2QGNA 4IXNA 3ZWMA 2I2DA 3F5MA 3ZU5A 2EJBA 1K4KA 2IDJA 1N3BA 3K72B 3OKAA 4X7PA 1XG5A 3UK7A 4D3ZA 1R18A 1IYZA 4TRJA 2QG6A 3RYIB 3NUGA 3IDQA 2CXUA 4PZCA 1NBMD 1OU0A 3BHIA 1P5JA 4URUR 5EMKA 3T12A 3VR4A 3QH4A 5IXSA 2VRBA 2WKPA 4UUMA 1RLTA 1OKKD 1R6BX 2X2PA 4P31A 1SBTA 5FF9A 3WSVA 4CF3A 3EXFB 4JIGA 1GIAA 4BKUA 2I7CA 2F62A 5DULA 4Y6OA 3QF4B 1C8LA 4BS9A 4D81A 1A9RA 4ER7A 4FZJA 2OD2A 1OBFO 2PQ2A 1AOXA 4RA6A 4JD5A 4DC9A 2D3TA 3EJWA 5IJ9A 4TQUS 5JJ5A 5JRDS 1B6TA 4N5LA 4Y6PA 2XYHA 4OPMA 4MYDA 4S24A 4UUNA 821PA 2VBGA 2X8JB 1E1KA 5K3CA 4RC9A 4PZZA 1WV1A 3Q0EA 3C3CA 2EEZA 3JAMA 2IHBA 3GRPA 4KL8S 1EVYA 4RD2A 3M6VA 1TNDA 3M33A 2I71A 4I1OA 4UMDA 2O2IA 5THQA 2PWBA 2VHQA 3PDJA 3CONA 4AZ3B 2FW6A 3DYBA 1VPEA 4P5DA 2NO1A 1XU4A 4JUBA 5K0GA 3G2HA 5FOVA 2G6BA 1YF3A 4JUAA 4MH0R 4BUZA 4F2DA 1PDWA 2HDNB 1A4IA 4M1WA 5HTKA 1S3SA 4RHYA 1U5CA 4UU8A 3OEWA 4ZYUA 3VQTA 2HK7A 1S2DA 2VYVA 3OU6A 5I7WA 4KTVE 2M9MA 1AB5A 2Q9UA 3ESDA 3JWJA 4HFMA 5CNJA 5CB8A 2IH2A 2YN4A 1Y5MA 4UEKA 3K1ZA 4HTFA 3B82A 4IXDA 4PNHA 5KX5F 3AEKB 4H3SA 1O96B 3TTUA 3X44A 1J2YA 1QYRA 1CUJA 4FMPA 4RF2A 2WZQA 4JBWA 1W29A 3TBFA 5A6SB 3ZIAD 1J0CA 1L1FA 3L6EA 3GDOA 5A7HA 1GRNA 4P3XA 1XFAA 5LQNA 5MFZA 4X65B 4Q9JA 1C0LA 1VC2A 4I1IA 4KYTA 3CX8A 1KETA 1DKPA 4ZI5A 2B8TA 4HDNB 4QU9A 1DG3A 4Y2RA 1BYIA 4B5LA 3IAXA 4QASA 3NRCA 2DCMA 5HQTA 1LPPA 1M2VA 1ZLXA 4QUHA 1SAYA 3F7NA 3L1JA 4JI1B 3T15A 5M29A 4W63A 7REQB 1HFJA 1YOVA 1JJIA 1PR2A 4GD3Q 4IHJA 3KZKA 4US2R 4I4NA 1VB5A 4X6YA 2P75A 3KXDA 3WISA 1T8UA 2YWEA 3LZDA 4JBHA 4WGGA 2FSVC 5IZ4A 2QTFA 5CCXA 4R98A 4S35A 1R6VA 2YYSA 3M49A 3CSDA 3KSMA 4NCNA 4PCAA 5C52B 3PFCA 4Y7DA 3I64A 3NP9A 4LQ4A 1NVMB 3A31A 4M0UA 1MOPA 4NE9A 1E66A 4GXNA 4N54A 1KVRA 4G5YA 3IQXA 3SG0A 4TWAA 4DMGA 5K0BA 1L1QA 2RHLA 4RMJA 5BQOA 1TTPB 1PYOA 3FB4A 1MMFB 2FR8C 3I4CA 3PQEA 4BCCA 1U6JA 1CY7A 2QVGA 4TKZA 2EBFX 5BUSA 4AKIA 2UYHA 1YK1A 1QDUA 1UWCA 3D5QA 5LA6A 2QRUA 3HN6A 3QWBA 3GJ7A 4QTUB 1BS1A 4K46A 1B8VA 3MWYW 1OYVA 4P53A 1E7QA 2QYOA 1EB8A 1EDZA 3QA3E 4HPJB 4NH4A 4GT1A 5D01A 5DM2A 2TYSB 3H3FA 3REQB 4D9MA 3HCNA 4GLLA 1U1DA 1G7CA 2JNWA 4ALNA 4KC0A 2BKXA 1SKQA 2Y1WA 4ZT2A 3G2NA 4AY4A 2Q1WA 1G3RA 3E48A 2F43A 1WMBA 1YGPA 2B34A 4XRRA 4ESOA 3UFXB 2DKFA 2P4EA 5AKGA 4JQSA 3JQAA 4NTZA 1O6GA 3F5QA 3FTFA 2D8AA 2MYUA 5ITWA 5EUMA 3WYDA 4YFYA 2ZCVA 3GCDA 4F4DA 2H2GA 1R4MA 3BB1A 3KC2A 5EHNA 4GLBA 3H4TA 5C2JB 1V1JA 1PWYE 1F3OA 2R8BA 3B3AA 4EPVA 4W7IA 3AEQA 1PJSA 1N5DA 1QCDA 2NSLA 1T5OA 3F6YA 4C7BA 5A9RA 4WXYB 5JCXA 2HZBA 1BQ4A 4H2DA 3DBVO 4H9GA 3AHCA 2O2SA 3H8VA 2ZI6A 2R84A 3MB8A 3J81A 1TPZA 1KZHA 3KR1A 3HUEA 5IT0A 3PIRA 4L3OA 1I7SB 4HTAA 3TFOA 1JR3E 4UHBA 1PQPA 3ED1A 1WWKA 2VJDA 2QGFA 1H65A 1R27A 3DL4A 3UT6A 4BVBA 2ALJA 3RGGA 1C0KA 2X4LA 2OK8A 1Q0TA 4ZANA 1E6WA 2AW5A 3C97A 5JHGB 3BWCA 4D97A 2AC7A 1E0JA 2ARKA 3BBPA 2R7AA 3DTYA 3ETJA 4NULA 3VYRB 3E9MA 3HXPA 4C0KA 1MABB 2ZIFA 4DSOA 2OCLA 2QM8A 3ENNA 1ZHHA 5CVVA 4IOMA 4DABA 1KEPA 1U0NA 3DMRA 1U8TA 1X42A 3NH6A 1G2IA 2AIRA 3IBTA 5FOXA 4DQVA 3FZEA 1C3XA 1SUBA 4JYBA 4KWEA 3OD1A 1QB7A 2X2EA 3GXOA 4MQ6A 4R1SA 1OFHA 1M2HA 2P68A 3UCFA 5CNMA 3GEIA 1PV2A 1ZGCA 1KOFA 1K2VN 3HGQA 4MVXA 4V0QA 3DLPX 4EG5A 3FUXA 3AF6A 4LHEA 2H16A 3GT3A 4LJ7A 5FWDA 3BFXA 4NKRA 3ONWA 4X6XA 3BE5A 5A4DA 2F1OA 1CUFA 1MX3A 3QLVA 4AY5A 4C07A 2Y93A 3KDSE 4TV9B 4UM9B 2RGNA 3MCWA 1M6HA 2VPXA 1UKYA 1YL5A 1V47A 3AFMA 4UARA 5C8DA 4IPTA 2DUUA 1UDRA 4YI5A 1W0JA 5JSYA 1IEQA 2Z83A 2OM6A 3MCAA 4MKFA 2ZR7A 1XXHA 3DPSA 5HIMA 3BRCA 4M0MA 1PJZA 2FUG6 2XNJA 2XV1A 1VPDA 2YBDA 3KZ1E 3O0DA 1NUQA 5A4FS 1HEIA 2A0YA 1M66A 4PLGA 3SZMA 3GJQA 4FUTA 1KJ8A 4ZN6A 1MJHA 3QHQA 1JWAB 1YE5A 2E48A 1T6NA 1BX0A 2AK2A 2EQ5A 4LHVA 3IOMA 4R2WA 2QPOA 5I45A 2GCOB 1U3UA 1W9MA 2YDXA 4A7PA 4ARAA 1RRMA 5DBGA 3O8QA 4C88A 1CF9A 3GZNB 3T1HB 1SKYE 5DV9A 3PITA 3RC2A 3SMVA 5BSFA 1A7AA 3PR1A 3ZWOA 4A6EA 5K0CA 4LTMA 3HXOA 4ATNA 4Y6QA 5FI0B 3ADBA 2V3VA 4QQ8A 1JHQA 2P6NA 3C98A 5DYIA 3W1WA 2PUTA 3NV9A 3BJZA 2VKQA 2Z2JA 4WCVA 4CLDA 5JS8A 1U4NA 3H6KA 5CVCA 3P9CA 3LLUA 2ZS9A 4DS3A 3VSBA 1FYFA 5TT0A 1T4CA 1VSTA 2P5TB 1M67A 1J9ZA 1QIKA 4PG5A 1Q21A 4AUMA 4C4AA 5LDDC 2ORIA 4P0QB 1AK2A 2M1ZA 4IXWA 3Q10A 5ERYA 4BDSA 4P5PA 2D2FA 3IQEA 5BOVA 4KAJA 1S2MA 4RFVA 5LZ5A 4KFTA 1N8NA 4TN5A 4NQRA 3BMQB 3NB0A 1T5IA 3IJEB 4HSGA 4K1LA 3P9RA 4B43A 5BYAA 4IDFA 1H9CA 4FYXA 4M88A 3HP7A 1ZJ6A 2ZYAA 3N0WA 2Q3JA 3NPMA 4Q7MB 3K1YA 4BNXA 1K7CA 2JDID 1YUMA 4DR2B 1ISHA 1KI8A 2ZWPA 3TOZA 3BX1A 1JW9B 3HM9A 5BR7A 2XVAA 1AZLA 4W9RA 2JPDA 1GTMA 1JR4A 1YUBA 2FEPA 3EMBA 1XU9A 3HKEB 3KR2A 1SCKA 4G9GA 2VOJA 4U0KA 5JTUA 5CAEA 2XNCA 1QTNA 4MPTA 2FCRA 3DFZA 1D6JA 3IT3A 2G09A 3ANLA 3R3VA 3D8RA 4YV2A 5EPUA 3WKBA 1H42A 3CW9A 5JADA 3OPYI 1KR2A 5CGQB 5CW1A 2C9BA 1A4UA 2C1ZA 4QREA 3CNLA 3GRAA 5LP6A 1W93A 1ATIA 5J4VA 4JS0A 1HQDA 3O7MA 3HV2A 2XVYA 3FGOA 3R8XA 3FF4A 4HH4A 1OXUA 2QBYB 1JHRA 1T2NA 1QKKA 3SHOA 2OVBA 3MLBA 3PGKA 1T5HX 3VJRA 3TIIA 3QF7A 1J1ZA 4HN2A 5LZ4A 3BSYA 1XC7A 3ZDZB 3UQZA 2PLFA 3L6RA 4KN9S 2DFNA 3I5XA 4NF2A 2C7VA 3X1JA 3AR3A 4RENA 3EF0A 3P9YA 3EC1A 4IGIA 3R0QA 2YZ2A 4DQUA 2PV0A 5CXQA 2XW6A 4C05A 3USCS 3C5HA 4ER6A 1JEYB 5JECA 1O08A 4DKXA 2VF5X 5K05A 1GLNA 2ZJ6A 3M4NA 1SOUA 2RGXA 4O4IB 5JLAA 1DDOA 3KPWA 3SK0A 4DPLA 3SC6A 5IBRA 2YMMA 4DW8A 4MTCA 2DFPA 1CUCA 4M9ZA 1B0AA 2CHVA 4ESVA 2NOAA 1WR8A 1J2JA 2XQVA 4PFSA 1VJ0A 3FNBA 5I9TA 1QQ5A 4JT4A 4ZDWA 4D92A 3V97A 1E5DA 2OEPA 4IDQA 1JH9A 2WIBA 2QQ0A 3GVCA 3RHZA 5G0TA 3L49A 2IYWA 4ZT6A 3TFQA 1C1DA 5F7ZA 4XWTA 3RT1A 5AW1A 5JAIA 4FE3A 1Z8NA 3BSWA 2H1OA 3QVGA 1K7FB 3TZQA 1FQOA 3EGEA 3O8LA 3B6MA 3IPYA 3TJRA 4WDQA 4KQWA 1PR9A 2HADA 4JI3B 1LV7A 2O52A 4JBLA 4NECA 3ZY6A 4X94A 1CR6A 4EGQA 5IDWA 1VE3A 1R3DA 1QHNA 1U04A 1ITZA 2LRHA 4NU0A 3HLKA 4KQMA 4OKNA 1N3YA 3HJTA 1TZ2A 4OXKA 4DBLE 4FFMA 4TSFA 2JB9A 4OI2A 4CIDA 4FQ7A 3L5OA 3PFWO 1RKVA 2VSQA 2XNHA 4M0DA 3EH1A 1NN3A 2ZYSA 4MJXA 4ZCPA 4BATA 5BW5A 5C80A 1V8BA 4PNZA 3D8TA 2NADA 1CF2O 3VOTA 4JYAB 4LK3A 1DFIA 2QMUA 4KWIA 1ADGA 3DZBA 3HVUA 4MUKA 2I6FA 1NXVA 5LOVA 1RJEA 1C1XB 4ZVLA 2UUAB 2PVPA 2FQ1A 1VYUA 2G7ZA 1TO6A 1FUEA 2FFQA 2QAGB 3WNBA 4DCPA 2CVHA 2OO7A 2ZPTX 1Z56C 3FPLA 3KLNA 3BJEA 4K40A 3M6LA 1IRXA 3OZEA 5FBHA 2JFPA 1P2SA 1UFRA 1LRJA 2ZRNA 4WW0A 4D8TA 4EMUA 1DINA 3ZJ4A 2PZMA 2VJMB 2YZMA 1P72A 1L5FA 1OGYA 3N07A 3AM3A 3NHMA 5AKJA 2OSBA 3GLTA 4LKRA 1GPAA 3QY9A 5E95A 1KFBB 3VU1A 5AK5A 4R2JA 4PHGA 3MGAA 3AC0A 4Y9DA 2AJLI 2FN4A 3SLGA 3ZNQA 1NBMA 3A3PA 4AK9A 1QRDA 2DT5A 3SE0A 2B82A 4DHWA 1XMIA 2BCJQ 1Z4QA 2RK6A 3DLCA 3IHLA 3LQRA 2VQ3A 3Q7PA 2ZBFA 4GPZA 4HEHA 2FMKA 1O94D 1NBAA 5E4FA 5SZJA 4BO4A 2ZE8A 4O1IA 4WEOA 2PR2A 1K0UA 2XJ4A 1UKCA 4R31A 3U48A 3VI3B 2ZJ3A 1WHTA 5CCEA 5K8UA 1T25A 4JWTA 1NXXA 2UDPA 1DLJA 1Y3IA 1ZGGA 2P8SA 5LKRA 1DT5A 2DERA 1L7OA 3OZIA 5KDLA 3GLSA 4XTCS 3SY8A 4LDQA 1P62B 4M1QA 4LXTA 2HC9A 2B4YA 3LVBA 4FYHA 3NP7A 4INJA 4DQKA 3LWDA 2QJOA 2G1KA 4XB6B 4F60A 3D31A 4DXAA 1QVRA 5F5LA 3QVTA 3MQ4A 3ROXA 2OXEA 1OWMA 2CZQA 4JR2A 2YCBA 1BHJA 3LDFA 2O2CA 1ENZA 1KOJA 1STOA 1U5BB 1CUUA 1RM5A 2I0FA 4MRPA 4ZRMA 1VXRA 2JJ1A 1T8YA 2HBQA 4TKLA 1DJLA 2H3EA 3NHFA 4JSTA 2OHGA 3LRTA 4PAWA 1QIEA 3IDFA 4X66B 2X5OA 3GGDA 1T3LA 4O4JF 1E1DA 5CNKA 4IYRA 4MZDA 4N48A 2P0EA 1BCSB 4DGQA 1EVJA 1T2FA 3QFFA 3QFSA 4EA7A 3BUSA 1T4MA 4Z5XA 3O4FA 1U31A 4BNDA 4O33A 5L3VA 1FY2A 3AUXA 2WTXA 4FBGA 1PIWA 2UXBB 4AO7A 5K3OA 4Y2JA 1KJ9A 5JYCA 1YB2A 1I1OA 5DIFA 1PT7A 3BWVA 4WOBA 1JDNA 2QTMA 4YT8A 2V54A 5K9ZA 1LY1A 2IYAA 3IVCA 3VOSA 3F4KA 2WG0A 4QUJA 5E2BA 4HG2A 3HKBB 1I4TD 4Q1BA 3KVRA 4AN4A 3P9NA 3EHEA 2AQ8A 2OPBA 1KI9A 3CNNA 2Z5VA 1RC0A 3PSHA 1SC3A 3NBFA 3ORFA 2RD2A 2VYCA 5ERGB 2Q0HA 4KLRA 4KKXB 2WFLB 4A6PA 3U37A 4J1SA 4N65A 4JJ4A 1A9PA 5GADl 2FPKA 3K1TA 1CU1A 4RA9A 5DSXA 2DG2A 3EGXA 5F7OA 4OXQA 4S2UA 3JALB 4KDCA 4D74A 1P1JA 3C7DB 4HMQA 3V1UA 1RHUA 1MJFA 5G4LA 3S7ZA 4BQEA 4NMMA 2HA0A 3CG4A 3O92A 4XGKA 5ITZB 2QN1A 4H6VA 4RK0A 1EVEA 4WQMA 5H7XA 5LVAA 3OZFA 3TZHA 4XCXA 5ALLA 2DPGA 2YHIA 4O02B 5ED0A 2FWMX 4OY3A 3CEHA 4RU1A 5IPFA 4OAPA 4UAUA 4B3HA 1QIMA 4CIYA 3AR8A 3QEJA 1HETA 2GN0A 4MIEA 4YWJA 3QE9Y 1DWOA 3ORYA 5AVZA 2O7NA 1OI2A 3AI2A 1CZOA 1PLJA 3BCHA 2J0UB 1K6MA 1SCUB 2EBHX 3C6XA 4I9NA 3UHFA 1N6OA 2C3PA 3PFNA 2UVQA 1HEYA 1KTIA 4CM6A 3VKWA 3OQIA 2QT9A 4HNRA 2WKWA 4IEFB 1L8XA 3TLEA 2JI4A 4EB6A 1JHZA 2H8KA 4Z0TA 4D99A 5JS1A 4DIUA 2Z8YA 2DGDA 5CH3A 3K9HA 3W9UA 4G23A 4TTSA 4GU5A 1BMTA 5TARA 1UBRS 2W0SA 3JY6A 3LSTA 3TGWA 5DGHA 4MRSA 1QK3A 5FHQA 5H81A 5TQ2A 7ADHA 4ETIA 1E2NA 4EZIA 1G16A 3ZBQA 2V5AA 1I6KA 4PF1A 3A2NA 3K8ZA 5EY5B 3HKBA 4A8HA 2I7TA 3DTVD 3WS7A 1F2VA 1UMBB 5DCWA 3LZ6A 3H6GA 3HJGA 1TADA 2C0CA 5DYWA 4MDFA 1DWQA 1SCIA 4GOMD 3KVOA 5JPDA 3QWIA 4M0CA 2F55A 2HSJA 2FW8A 4BVAA 3BF7A 4NS1A 1N6LA 5FBQB 1QZZA 2GK3A 3BZWA 3OICA 5EWLB 4DR4B 4QKQA 1WQ4A 1PEDA 3EIEA 3K5WA 4IJ6A 4WEQA 2QLNA 4HCJA 2ZYUX 4B2LA 1N57A 3H19A 5H82A 4F84A 5AFSA 5KPJA 4L0DA 3BXEA 1L2TA 3BMXA 3QTTA 2Y6UA 1DKNA 1IBKB 1YZKA 4IG4A 3MCZA 3AF5A 3EIQA 1RWBA 4FOPA 2ICAA 4FT4A 5TR9A 1DOHA 3IBSA 5KNDA 2UUOA 1M6EX 1ZU4A 1MO2A 3DA8A 3H04A 4LVUA 4O3FA 2VHXA 1ONBA 3CR3C 1UBMS 3CF6R 1XEXB 1US8B 1CULC 5KS2A 2IHYA 4HEA6 4B6FA 1H0KA 3GC6A 1QO0D 1DOAA 4ZI7A 1BXZA 1F0YA 2Z43A 3W05A 4KMMA 4L3VA 1JEDA 3OP1A 1VSUA 2BUCA 3CLVA 3DG9A 3GJ4A 4LY9A 2DPYA 2MSCB 3LE8A 3SQXA 2IV2X 1KK1A 3FTDA 4ZYVA 1USVA 3RBZA 3AL3A 2TMKA 2H4JA 5JCZA 1D2EA 2CHQA 5I5EA 1J8DA 2BGKA 1EQUA 4KRYA 1BNCA 3K09A 1AUQA 1TRHA 4EUFA 4RTKA 1G21E 1ORIA 3C3XA 1ZAKA 4OH7A 3TCKA 3PZRA 4U7DA 1ECBA 2QM0A 4RV9A 3RFVA 4AX4A 4DMKA 2X15A 3V3KA 4BO6A 2Q3EA 2F67A 4PVDA 4BO2A 5M04A 1E0DA 3SQMA 4MA5A 5HF9A 1FYWA 1MZVA 1SKAA 2EBWA 3N5CA 5E9QA 5JI3E 5JPCA 3W90A 1P9WA 2QPLA 2FEOA 4KQIA 5NULA 1AXGA 2I2BA 3AERB 4CLEA 5ESXA 4EY6A 2PJDA 4PXSA 4XX0B 2HUNA 2FR8A 1USIA 3ML1A 4WL0A 3PEFA 3KT8A 5FB3A 1A2QA 5IUNC 2JBAA 2WMYA 5LQUA 4FFLA 1Z8HA 1SU8A 2FP3A 1X7ZA 1YVRA 3M83A 3V8BA 5DBEX 4MEAA 3VNUA 2CLKB 3G2PA 1H0HA 2QTVA 2F1IA 3HV0A 2YJ4A 1GPMA 4LRQA 5ER9A 1GR1A 1J7KA 4G0PA 1DC5A 4GGMX 1BVUA 4UVEA 1CZKA 3FSRA 1EHYA 2JGDA 4LJLA 5JTTA 4JI2B 2RE8A 3R3JA 2C0QA 4KPUA 3LNCA 4AP6A 2GZHA 2X76A 4C9BA 1PKXA 3Q1KA 1M34E 1SVOA 4WSOA 3V8QA 3CF4A 1ZVKA 4PFQA 5JQGA 4YQFA 2PH1A 2G1AA 5FPQA 4AROA 3N2LA 4J1TA 3J7AC 3JQFA 3UB2A 1A50B 1P5ZB 4KU4A 3RVSA 3G68A 5C4GB 6REQA 3QYAA 2H1VA 3KT3A 4KI7A 1SWWA 1V8PA 4H4CA 3WL7A 2HV9A 2ZSEA 3OCYA 1KYVA 4PC2A 5K8TA 5U9CA 1EAMA 2JIRA 2QRJA 3G7NA 2H11A 1XLVA 1Z28A 4U6SA 5T6MA 2NAFA 1IWOA 1AQNA 2EL9A 3L84A 4RLSA 3M5CA 4D8XA 4GYWA 1I7NA 4MVJI 4EG0A 4CU2A 1EK6A 1NVFA 4PZPA 5D86A 3DHYA 5TQJA 3V4SA 3OQIB 1CVLA 1J20A 2VFAA 4JBNA 3QPUA 1IQ0A 3P0IA 1THMA 3M1YA 4C0JA 4BQRA 5DNUA 4CEIB 1BVRA 1V45E 1QPZA 4ITVA 1L5ZA 3QXCA 1IZZA 3OIDA 4CNBA 5BWBA 2BUAA 1IHYA 4UEJA 1TFRA 2WNIA 4MYSA 4N5NA 1TW2A 4OA8A 2BVNA 3FD8A 1T6XA 1GNQA 1JXQA 2ETXA 5DI9A 1D0SA 1G21A 4DSTA 2YMQA 3WYNA 2BW0A 3RE1A 2PHZA 1TW3A 1QX3A 4EW1A 1RADA 1SC6A 2VJBA 1Z5VA 2P9TA 1XNRB 2OCDA 1DP4A 2DHDA 1R10A 3EIHA 2XZDA 4HVTA 1A7UA 4C43A 4UBJA 3FOBA 4HNVA 4L9WA 3FLMA 2O06A 4RETA 3FOFC 4JJEA 1C2YA 4LYYA 2AMYA 3ETHA 2VTBB 3FWYA 3MZ0A 4G81A 3UOWA 2GWHA 2RBEA 4L57A 4MVJP 4OMDA 3S28A 5L45A 4RK7A 4QGFA 1QSGA 2XDQB 4QOGA 2VDOB 1ZI8A 3IJPA 4ODIA 1HE4A 2J5XA 3QYFA 2H29A 4ENTA 1XWWA 3O90A 5HIIA 4KREA 1R4ZA 2I55A 2J3QA 4XAQA 2F3SA 4LDPA 1W9HA 3GJYA 4IDHA 2IEGA 1GPJA 3A9RA 4TPKA 5DLEA 3ZQ6A 3BTSA 5GJCA 1ADFA 1SIBE 4FDAA 3B20A 1S8NA 4WFQA 3PX3A 3VTKA 4MLDA 3ESXA 4ND3A 1AZTA 4BLWA 1WAMA 2II6A 3FZYA 1E8NA 1TT7A 1NOJA 3OIGA 2WD8A 3G49A 3PIDA 3QPAA 4ACBA 1P4HA 5CAEB 2I2FA 4BQSA 4IDAA 4M0FA 2DX7A 3GGCA 1A7KA 3K0AA 5LIRA 3TZLA 1Z0IA 4ND5A 1PUXA 2PAFA 4Q9DA 2PL9A 1YA4A 2QNRA 4ZTZB 2C42A 2A8YA 4DLRA 4NJOA 5JBIA 3GCWA 4PAGA 1B4DA 2HY7A 3R75A 2YJ3A 4IIXA 2W2PA 4DV7B 5BNIA 2G04A 2I3BA 3HCFA 3B3JA 1Q50A 1QZTA 4UMFA 1QC5B 4QPDA 3L8FA 3FVRA 2CDRA 2WD9A 1A96A 4BV9A 1GEEA 1JRLA 3VR4D 3WXBA 2UUPA 2OILA 3NONA 1Z2DA 4H17A 3QW4B 2IPLA 5K0TA 1FS5A 3VR5H 3U4MA 3PJFA 1FTYA 1Z6AA 2G4CA 5H80A 3B1ZA 1Z5WA 2XZTA 1NP7A 5HUHA 4GPAA 3FMOB 4NAVA 3MGKA 1SKMA 1BJRE 8MHTA 2HHJA 1B3RA 1SU4A 3CVJA 5DE3A 4DOMA 2VPIA 4V0RA 3NJ8A 1X39A 3FIUA 3RSFA 2XXAA 3AHDA 2VCEA 1IHUA 3L6DA 1M5UA 3JVVA 3ZWPA 2YWDA 2GPJA 1NUSA 1CUAA 3R7BA 3H4VA 1IJFA 5K5EA 2AS0A 2ZRHA 1FS4A 2CJPA 3WC4A 3H18A 1Y6GA 3EXHB 1DI0A 1FDRA 1XTZA 3T34A 1I2CA 3A26A 1B41A 1UJNA 4G5FA 5E7JA 5JZ9A 1M6VB 2ID8A 2QTTA 2C2MA 1QZUA 3V4FA 3HCDA 1UMCB 1ZISA 5C18A 3OIYA 1TEHA 4K2AA 1NQUA 3FYTA 2ACWA 1BHO1 1G6OA 5HILA 1A9XA 3EW9A 5LYYA 2X6RA 3AJEA 1MPXA 2UYGA 1NXPA 5F78A 2NO5A 4RPGA 1O95A 4BHTA 4CKWA 3KOMA 5IS2A 4RD4A 3NHKA 4LF6B 4NBNA 1GPKA 2CFIA 2E4UA 3RFFA 3ZDQA 3TMYA 5DMXA 3PJDA 2D06A 2O8CA 3K4HA 3RSGA 1JTEA 1E2DA 7YASA 2JLCA 2AFHA 3C3JA 3G23A 1DHTA 5ALKA 1SKYB 4PYNA 4F11A 2IYQA 2O7QA 2JCYA 2RHRA 3AF2A 3MRXA 2PUCA 1M6NA 1YR7A 3RKUA 4DCVA 1Q16A 3IEXA 4IJ5A 4DIFA 2WV7A 2ZUWA 3AMVA 4MPJA 3CLTD 2WJ3A 4ZGWA 4DIDA 4URYR 1U2PA 3A6DA 3NKVA 1D0IA 2QIPA 5E8RA 4MGHA 2H2IA 3TVDA 2BELA 1LC3A 1C3LA 1M8KA 4JI0B 3LD9A 1UBHS 2N1MA 4UMEA 5KX5A 5IH7A 1MOSA 3DLTA 4B3SB 4N49A 1VMAA 3I32A 4E22A 2HJ9A 1BE6A 1G8FA 1TL7C 1WVIA 1HH4A 2YN0A 4NVRA 1TZJA 3QE2A 3MLAA 3P0HA 3AESB 4EUEA 1SD1A 2PGJA 3NTXA 4LIPD 2ZUVA 4F2WA 5FLXA 2GF0A 1B74A 2GJ8A 4QFMA 1VBFA 3Q9SA 2JHGA 1GSIA 1IIBA 4YGYA 4L4ZA 4PQGA 2ZE5A 5BORA 1ILEA 2YNMA 3IV9A 3OQOA 1RRVA 4BP1A 4J6FA 4N3AA 5JSZA 3MJFA 1JLSA 4PNEA 4GKKB 4WN9A 5PGMA 4WY8A 5A1TA 3K71B 4UBKA 1SBNE 1ZGJA 4CGYA 2TMDA 4Q0MA 5H4GA 5KYGA 2WUEA 1GUBA 2Q8NA 2M6RA 5EZ6B 4BNUA 5A04A 1H2XA 5IEJA 1Q19A 1CLEA 3ENQA 3M1IA 4X8LA 5KTKA 2UYQA 4IVRA 1X94A 4IX9A 4NC9A 5T3UA 4W99A 1FMJA 5DYNA 5FBRB 5IT4A 1M2WA 5EMHA 1RJFA 2NIPA 4RJ2A 1TDJA 3NC4A 5C8YF 2RGRA 5IDQA 4P0TA 3K9LA 3NYIA 4BO0A 1R4NB 1T43A 3QEMB 1EJ6A 4KVGA 3WRVA 3IH5A 4MQ5A 4BNMA 4AWBA 3HHPA 2N47A 2P35A 1I32A 2H54A 1QHFA 3L8YA 1P2GA 3DTVB 2BR5A 1Z6XA 1HORA 3REQA 3N2NA 4M1EA 1RQRA 4YMLA 1P1CA 3IFSA 4I08A 4P8RA 3UUFA 4LC0A 1N7HA 2B1RA 1RMYA 3OLWA 4PW0A 1IHOA 4F9EA 2C2HA 1DBSA 4RDCA 5EKSA 3RC7A 4UQPA 4WT7A 3ZKWA 1NW7A 5A5EA 3S8MA 5HNKA 3PT5A 3FY4A 3R3SA 3DZFA 1RQLA 3CEJA 5KTOA 5HJ2A 3P2YA 1E9DA 2QHXA 4N3CA 1O97D 2P9CA 3PXXA 2PGLA 3UJ8A 1YK0A 2RGWA 2VHYA 1NJFA 2WVGA 1RAGA 3CBGA 1BZYA 1X9GA 4Y9SA 3SOZA 4ZZ0A 4NFLA 3SJ7A 4C2BA 2QAJA 3W9YA 2FFAA 4IS2A 3EEYA 2DQ4A 1YFKA 3HA3A 3ZWQA 1XXHE 2GZ3A 3A05A 1GITA 3EOAI 3NIDB 1WB4A 1K9SA 2BTQB 2WF7A 4M7RA 4TXNA 5IJXA 2PLWA 3LQQA 3GP8A 2PPVA 2Q9BA 3ZH2A 4GZ3A 4ZEWA 2O23A 2VF8A 3RFTA 1HT0A 1O8BA 1R50A 3SXPA 4EO7A 3P4UA 2CVFA 3TD2A 4AQYB 4F3RA 1JLMA 5PNTA 3I6MA 4KH1A 1AN9A 5L3SA 3HJFA 4UHCA 1CEEA 3M81A 4BVGA 3PUZA 4PQYA 5DKFA 1ACLA 4BJ6A 1XVAA 3C5WP 5EIOA 1FOEB 4LRTB 2VDKB 3WYFA 4G25A 2P69A 1FFDA 4FN4A 1RTTA 3K2BA 5JO0A 1RXVA 2PVCA 4QOSA 2PGXA 2G1JA 4DNQA 1SCQA 3HCWA 1ZNWA 1R0KA 3O2JA 4JCOA 4KV7A 2IBMA 1Q74A 4CLRB 3Q8MA 2OBMA 1QG4A 4JR1A 4MAMA 1VIDA 5BV7A 4C6TB 3ONEA 3C1UA 4Y0VA 3JQ7A 1BMFA 5I9MA 4KNWA 2OCXA 5K4GA 4DKJA 5JJLA 3RDPA 5J3JA 4JOSA 3M4YA 4CJXA 4X97A 5AOBA 3WLIA 2JJQA 9MHTA 2AD1A 3AUKA 2OHVA 1VSQA 3GUUA 3DOHA 3VPXA 5FT9A 2C99A 2IYYA 4O63O 5FWYA 2I22A 3GQVA 4U7JA 4WLOA 1W25A 2XH8A 5B30A 3IHKA 2AZ4A 4PQRA 4KSCA 5HS4A 3HZOA 5L6LB 4AZ3A 5BRJA 1E7SA 2VDMB 2BHRA 3GNLA 1AK1A 1I2MA 1Y81A 2HSZA 2H9YA 2ISQA 1RWNA 1MV8A 1Z0ZA 2CK3A 3RRJA 3GLHB 5BN5B 5F35A 5K0ZA 4UUPA 4DC1A 1F5NA 1QFXA 3W7VA 5C9ZA 2IF2A 3CE9A 2GF2A 2JI7A 2L42A 1LBHA 4O2AB 1IVYA 1U0RA 4WHMA 2ZETA 4L22A 3NTVA 3O95A 2EU8A 3QPCA 4L5AA 1V35A 3KKEA 2GHRA 4GOLD 1NQVA 3K0CC 1N7IA 4EVQA 5K1ZA 3ZD8A 2J4FA 1LDMA 1YXMA 2AX4A 4UEWA 3A2LA 3TVTA 3FWKA 1J8VA 3EE6A 3RTBA 3II6X 5JS2A 3UAWA 3CLRD 1E6KA 3B9BA 4L73A 3V5NA 5ECYA 4I81A 1Z5GA 4TT3A 2PA0A 3VR5A 1QQAA 3A7DA 4OBEA 2R00A 3SAJA 2QRHA 4ZOLA 1XNJA 4TTIA 4BO1A 1PWXA 1CNFA 1G66A 2QDXA 4OBWA 2GBFA 3LX8A 2WTNA 4V3CA 5EJ8A 4O2LA 4WLNA 4Y2PA 4BQQA 4CQMD 2DUNA 1Z45A 3KPJA 2QZ4A 4P82A 2X1VA 4LPSA 2J3LA 1QBKC 1TVMA 3DUFA 4JKOA 3TN7A 4AJHA 3LT5A 3RTEA 2Q7OE 2UUBB 3E9ZA 3K53A 2PWAA 2O20A 2Q5EA 3EDRA 3GZTB 1QV7A 2IS1A 1BEEA 3ESBA 5CH5A 1HDGO 3TLGB 1PT6A 1DX6A 3D7KA 3CUWA 3DMGA 1Z16A 3NJ4A 4E33A 1BE8A 1CQXA 1GWNA 4ISCA 1AS3A 3NHPA 3L8MA 2BM0A 4WI1A 5BY2A 3K0AB 4RPJA 2VXBA 1VJTA 3C8MA 3G0GA 4OHCA 5LXTB 3BWBA 1WZNA 1KAGA 4IIFA 2J08A 1OI4A 1ZM7A 2A5GA 4PCVA 1BA2A 3DFKA 4EQ6A 1U2DC 3DLBA 2FGJA 2ZBEA 3LCRA 4QDJA 1CY0A 4HX9A 4JB8A 1Q7EA 1ODFA 4UW9A 2JKYA 2GH1A 1H66A 1GL3A 4YCDA 1N5MA 4DBLC 2X5NA 3TRIA 5EJEA 2AFHE 2WUGA 3O8RA 2DR3A 1NASA 1SC4A 3LG2A 5F4BA 3VV2A 3BH7A 3I61A 4OGFA 1BSVA 1PEAA 3QHPA 4MQFA 2XNSA 4W5QA 2CV1A 1Y82A 1RFLA 4G86A 4V2UA 4KUEA 1Z36A 1P9NA 1N4AA 2OXIA 2Q27A 3T7AA 5AVQA 3GFPA 3H97A 4JP5A 2VUTA 4WZZA 3DV9A 3UFXA 5LLTA 3UF0A 3SVLA 4YQYA 1E7RA 1CDDA 1SUAA 2YFQA 4R05A 4RF5A 4QLBA 3OCUA 2Y0BA 4D56A 5ITZA 1PNVA 2BFAA 1EWYA 1WO8A 3FJYA 4F92B 1RJ9A 2DECA 2R62A 2QVCA 3PXGA 4J75A 1OT3A 3OTQA 1WBBA 3TE7A 2AVDA 2C8JA 3KOUA 3MWEA 1GRQA 5F7XA 4CLOB 2OV4A 1KWGA 1MT0A 3R24A 2VS1A 4Q03A 3ND5A 1JG2A 5E38A 3Q12A 4L95C 1EDOA 4LXYA 5EIAA 4ZVPA 4K9LA 5GV7A 2Q4EA 1NQWA 1Z39A 3WXMA 1NVGA 4YCCA 3UUEA 5CYPA 1Y48E 5H70A 4C08A 3PV0A 1YRWA 4F7DA 4ZYWA 1EESA 1EWTA 4MEJA 5AVSA 1K7SN 4R9VA 4Q3OA 4IGEA 1K86A 4OI1A 3THXB 4RFSA 5AHKA 4WXHA 2JAPA 4ISBA 3INTA 3SGLA 3LECA 5KVVA 1EM8A 1W85A 3TR6A 3RUPA 1W1IA 4XD7D 2XQIA 2FQWA 5BQXA 5HBRA 3KWMA 4TLBA 1CJVC 1ORRA 3D8SA 5AJWA 3HXKA 1HK7A 2Y9PB 1NONA 2A7XA 4OKSA 1DG9A 2VP5A 5ESWA 1J99A 1O7JA 4MR9A 1P19A 1KY3A 2QU8A 3JD1A 3CBQA 3Q8KA 1O9HA 5C7OO 2ZYHA 1JEOA 1XTSA 3CS3A 3MXTA 3PFFA 1GPWB 3TRDA 2RHDA 2GT1A 1OAAA 1CTQA 3ZNNA 2JFUA 2PU5A 3NGMA 3Q6NA 1ONOA 4XGNA 1N33B 5EAIA 2I34A 2C5HA 3GH3A 5AJVB 5F98A 1RJDA 1W19A 1CHDA 3OF2A 4GQBA 1QH0A 4I8IA 3HKCB 4QPPA 3THWB 3FTEA 1IDN1 2XRFA 2NUPB 1NJ5A 1J0XO 3RSSA 5B3JC 4TVSA 4JVSB 3GGOA 3O3MB 3VH1A 5A6SA 1TUIA 2W2MA 1OX4A 4DPMA 2C88A 4WCFA 1U4OA 1AZSC 1UFQA 2H7CA 5EE3A 3W6ZA 2R8OA 1H4QA 2PKWA 3T1QA 5AUQA 1JLRA 2QR3A 3HC7A 1GZSA 3KKQA 2Z3ZA 3OH8A 3TXAA 2GB4A 4F4JA 3K92A 4IO1A 2W00A 1IONA 2VJPA 4RWEA 5JALA 3ADDA 1NXQA 3I2JA 4QGAA 2J7PA 2QN2A 3FFTA 1NT4A 2EKLA 3AG5A 4Y0NA 3TPZA 4ZYYA 2V7WA 1UMKA 3H2YA 4ZALA 3DKIA 4BFYA 3IAS6 1YVUA 2QLJA 2NW6A 4XQ9A 3KHKA 2IHZA 3QOYA 3EYWA 3WWOA 1YCHA 2IWHA 3UK0A 4ZCIA 1OW3B 2Q50A 5D1NA 2WB2A 5JIBA 3C8HA 1HBJA 2NUAB 1N1EA 2CWDA 4MWGA 3H1TA 4X7RA 2VDQB 4UNPA 3MTIA 1GHTA 4QOJA 3TIFA 4DLTA 1DAPA 2WDPA 3L4SO 1L4KA 2DRIA 2IITA 2IV7A 4B3JA 1LDBA 4ZICA 3E7DA 4OK3A 1VG8A 1FQKA 3CRNA 2QQGA 2AG6A 4H3VA 3Q8WA 1RYZA 3JYLA 4U3JA 4D4IA 4WRRA 3EZGA 3TTXA 1SZJG 1ZINA 3LY9A 3O2NA 4IDDA 5G0SA 5ENZA 3PEWA 2YMLA 5KOYA 2CVPA 1DB3A 3AIMA 3DL0A 1YJQA 2YIVX 4WERA 3G3EA 1Y7TA 2NZVG 4TM7A 2HPAA 3HDHA 4QWWA 1QFJA 2M6KA 4GUDA 1A2BA 2EFDB 4HN4B 3IAM6 3PHLA 3M70A 1KGDA 3F8TA 4KBFA 4ZC1A 4KR3A 3WTCA 3R7LA 1LF0A 2K87A 2UV8A 3HLTA 4TTAA 4YGXB 4GDMA 4BOYA 3B1JA 5IT9A 2ZSIA 4DLXA 3K9CA 5DM0A 3O73A 1GG2A 4RH3A 3TLMA 3S44A 3LC2O 3Q7TA 2WUWE 3JCZA 1B8PA 2YX1A 5BSWA 2C0PA 2CFRA 3KL4A 2FDCA 1RHMA 4Q15A 1M34A 5ERXA 5HZMA 2OD9A 2BYTA 3JYOA 3O0TA 4F6CA 1U2ZA 3DNPA 2IS4A 1XMJA 1ZPDA 4C3OB 2CDCA 2W9XA 1E3DA 3OJLA 3ELDA 2NO9A 2IELA 1Y7HA 2VBFA 2DQZA 3DF7A 1WRBA 2J0VA 2F3QA 1I3OA 2O8NA 2VAWA 3AQ4A 3LBIA 4WZBB 4ZAWA 1W75A 3PE6A 2IU3A 3AUAA 2AEMA 1B1AA 5DI3A 1M1YB 3HB0A 3N8GA 4HB0A 4HB3A 2EVWX 4WOKA 1T5DX 5GOTA 5H3HA 1NKTA 4BKRA 1Y1QA 4ZEXA 1N8KA 2PJZA 3ORQA 3QJ5A 4RKYA 4YR7A 1ES9A 1DC8A 1HE8B 3AUSA 1DRVA 3E9EA 1EX9A 2AFIB 3WJ1A 1DG1G 2IUFA 3SHQA 1LFDB 2PVSA 3I53A 3SC3A 5JFGA 2ERXA 1Z4LA 4II3A 3QBTA 4E2ZA 2EEPA 4MAFA 2CE2X 4Z53A 3DGFC 2IZ5A 3CRQA 4KR0A 1IUPA 2CFOA 1X6VA 5AKHA 1KI7A 1NZFA 2XAUA 4PE5B 4RY0A 3PWSA 1YJ5A 3WKAA 4EG1A 2FLVA 2YOHA 4GLOA 2O14A 2Z2IA 1L4LA 2ZSJA 4N6GA 3JYPA 4MR7B 3SVZA 3ROZA 2CYAA 3HYRA 2O8DB 2J9XB 1A9YA 4LZZA 3LK6A 4U7WA 2IIVA 2HA2A 2YFHA 5J2UA 1TTTA 3ZYZA 4OMCA 4PIMA 1VGQA 3VZSA 2RHOA 3L0DA 2NNWB 1HE5A 1X1QA 2YR0A 3T9EA 3WFJA 4D4MA 1JWLA 1BJKA 1EYZA 1O5TA 2AYYA 4LXXA 4C7OA 3Q3CA 2QD2A 4I6EA 3WMWA 1AHNA 1E32A 1U8XX 3R6GA 4QG7A 4V0SA 3I8XA 2X8WA 4YAEA 3Q2KA 3ABRB 3HNRA 4LCBA 4B83A 4DCOA 2FPWA 1E5VA 3AKZA 3V4VB 3U4HA 1CBUA 2IXFA 4GI7A 4OHRA 4D3YA 1CRPA 4ZVKA 1KE2A 3Q15C 3EMVA 4PAQA 4IH9A 2R66A 3OESA 1NR5A 1XMSA 1V3TA 1Z7WA 3DOCA 1RPTA 3BCRA 5G4KA 4D3FA 1YNOA 1C50A 3FETA 3ITEA 1GYQA 1KPIA 3KUDA 4I1SA 4IGFA 5HZKA 2Q4RA 1H05A 1K4MA 4XKJA 1TM1E 2X7XA 2ZKIA 3RHTA 4G0MA 2IHVA 3A6FA 3UT5B 4E07A 3KJNA 2X7JA 3RBXA 1EVIA 1G98A 4YJ2F 7GPBA 1Z63A 2C7RA 1ADYA 1I7LA 1WPRA 3L8GA 3Q0TA 4NU6A 4V1CB 4Z3OA 2XCUA 3KZMA 2DULA 3AQIA 3H3XA 4EPXA 4RFLA 1XNQB 4PGAA 3ZW7A 2QL7A 1FUUA 1B00A 4KXVA 2B69A 3A1EA 3CUTA 3H0EA 3DH0A 4N47A 3RQSA 3K0SA 1Y33E 1RRKA 2OO5A 5JAQA 5JS6A 2XZPA 3DMFA 3FRJA 1Q7RA 1JQAA 4FMCB 3O8BA 4I4IA 4MUMA 5CTJA 3H9UA 3H13A 3I28A 4HNAA 3I2IA 3Q1LA 3C70A 3EXG2 5TC4A 1G3UA 1YO6A 3HEMA 4NEQA 4KLCA 4GBJA 2FMFA 2F1JA 2HDWA 2XD4A 3KHUA 3I09A 1ZR2A 4B8ZA 3HZHA 1G8AA 1AUVA 1FQJA 2R4UA 3KAQA 1TM5E 3OF5A 1G5PA 4TXHA 4EPRA 1DU4A 5KSPA 4JP1A 3ZHRA 1QFYA 4EP1A 5LQCA 2YXEA 1TKCA 3A1VA 1FSGA 2CMDA 1ZW6A 5K0FA 2IE0A 1EGMB 1RQ7A 4R1QA 3MJDA 3U62A 1QG2A 5BQFA 5JDIC 3KZCA 3PKZA 3FYSA 1EWKA 1XRQA 4JQYA 5DDIP 3WL5A 3U40A 3HB1A 3E81A 5E1OA 2FW0A 5JDIA 2EYUA 4IH4A 4OJYA 1JHXA 4HK4A 4HN9A 4RVUA 3KJXA 5FBWB 4DY4A 4KMOA 5ESDA 1MQ9A 4DZTA 3P4XA 4ND7A 1ZH6A 1X8JA 1CHNA 3SICE 3OG9A 5CPFA 4BN4A 3AXSA 3OM9A 4AW9A 1NIJA 4TLLB 4YLYA 1GRRA 4RA6B 5EIBC 5EJAA 5A4IS 3KE8A 1MQ8B 4RZQA 1VJ5A 4LWOA 2YWJA 5AXCA 1R8SA 2J5BA 3Q3JB 4F12A 1AV6A 4G4SP 4HPXB 3LUGA 1N7JA 3ZCSA 2XGSA 1L5WA 3M6IA 3NRJA 3WAJA 1TQ2A 5SZHB 1KY4A 3UJBA 3TZBA 4NY1A 1YVPA 1VJGA 2QVXX 2PMBA 4NZ9A 4IO0A 1DS6A 3OA2A 5DM1A 4Y6LA 5HJ7A 2OE2A 2Y66A 2QN3A 5KAPA 3VVBA 4FD3A 1V7PC 2QMQA 1FDVA 1P2BA 1SD2A 1SUIA 1JMKC 3FPJA 3W5DA 2FVYA 5AHWA 4OQEA 1OF1A 1DPGA 2PA3A 3IS3A 3LL4A 1CUHA 3D2LA 4PTYA 3L8DA 4KMSA