1EGOA

Nmr structure of oxidized escherichia coli glutaredoxin: comparison with reduced e. coli glutaredoxin and functionally related proteins
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
pubmed rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1egoA00
1H4OA 5ECKB 1GUHA 2PERA 1K0CA 2YP6A 2MMOA 4POBA 1TRWA 3P90A 2MYGA 4ECBA 5F05A 3GKMA 2NTOA 2MMZA 2R5GA 1TRSA 4DSQA 2JU5A 1UA5A 1JHBA 4EVMA 4EDYA 1X5DA 3ZFLA 3FZAA 5ECRB 3BOAA 3D5JA 3HKRA 3EE2A 3O76A 6GSTA 1EOHA 3Q6OA 1EP8A 2OA7A 3F0IA 3F3QA 1NHYA 4OO5A 2FLSA 2IMIA 3D4MA 1TI1A 2LJAA 4WF4A 4K6XA 4XTSA 3FW2A 1N2AA 3RBTA 3GX8A 4CHSA 2OE0A 1R5PA 3F6DA 4MJEA 1F9MA 4J56E 4JR6A 4OFNA 2P0GA 2HZEA 3IAS2 2JZSA 3E0UA 2R2JA 5COHA 5IM9A 4AGSA 8GSSA 3D21A 4PUFC 3APQA 5DALB 1SK0A 1MDKA 1THXA 5JCWA 3DGQA 2JSZA 4KW6A 4NMUA 5IPGA 4F2IA 2BTOT 5HR3A 2P5QA 1XOBA 2C0DA 3EWLA 3KH7A 1PQNA 3A5WA 1WWJA 3G7IA 2A2RA 5DVBA 3F4TA 2WZ9A 1ABAA 2D2ZA 1PD21 2GZYA 3IAM2 3ZRDA 4ZB6A 3K8NA 3LFLA 3WT1A 3GMFA 5DQYA 4HDEA 2TRCP 4DSRA 3N5OA 4CDOA 2VOCA 3GSTA 4GSSA 2H0IA 2A4VA 2DJ0A 3GTUA 2M46A 1B48A 4I6XA 4JE1A 4PQIA 2LJRA 2B5XA 4K1FA 3L0HA 1MDJA 1LBKA 3TJGA 1XW6A 1SENA 1YZXA 5DBQA 4KDUA 2HRNA 1Q98A 2GQMA 1AQVA 5GAND 2XBIA 3LGCA 3CTFA 3GKKA 2F3MA 4AJ6A 2H72A 4MABA 1YJ6A 3GUSA 10GSA 4G10A 4X43A 4N0ZA 4POLA 4I2TA 4K2DA 1G0TA 3C8EA 1F6MC 1JFUA 2E2MA 2WULA 4K8MA 2F51A 4F03A 4Q5RA 2BMXA 3EINA 3HY2A 2R4VA 3FR9A 4OD7A 2IMFA 4LL1B 1FHEA 4IW9A 4GWRA 4PXOA 1PA3A 2B7KA 2XHFA 1T8EB 5D93A 5ECOB 3L9SA 5DCHA 2VCWA 1WJKA 2GQLA 2OJLA 1Z3EA 1R7HA 2QC7A 3TRXA 5B8BA 3P8WA 1ST9A 1QFNA 2L5LA 4EF0A 4LLRA 3EURA 3GRXA 2VM2A 2OE1A 4OCEA 1O73A 4L0WA 1M0UA 2VD0A 1FAAA 1GSDA 2YWMA 1TU7A 5AIXA 1AC1A 4D73A 1YEXA 4LA1A 1SK2A 4BWSA 4HZ4A 1YEPA 3GYKA 2VL2A 3IDVA 2JADA 1RW1A 4O5RA 3HVVA 1FG4A 2HZFA 5B7CA 5LCZA 2GGTA 1EGOA 3H4KA 1KEBA 5ECQB 4YQMA 3KTBA 3LYKA 3M1GA 3UJ1A 4KCAA 1PL1A 1PL2A 2FWEA 1FW1A 1XFLA 3WGEA 2WGRA 2VM1A 4FYBA 2CX4A 1ON4A 2FGXA 1OKTA 4JRRA 2YWOA 3A2VA 4HJMA 2J9HA 1U87A 4IBPA 3TJJA 4MP4A 1U88A 2YV7A 2V6OA 5CRWA 1A2MA 3DRNA 4MMMA 1USBA 3LSZA 5IMFA 1A2LA 1Z7PA 5B6MA 1AUCA 3D22A 2YN1A 3ZMKA 1GTIA 3EVIA 5KN2A 3W8SA 1Q4JA 2PWJA 4L8EA 3GH9A 1K0DA 3IBHA 3LJRA 3ED3A 5AN1A 3AY8A 3ME7A 4HJ2A 4N30A 3PGTA 1TJDA 2I4AA 2LNSA 2C0EA 5KN0A 2MBSA 4MH3A 1AW9A 1YKCA 3QFAC 1PSQA 1PKZA 2PUKC 4BL7A 2VCTA 2YV9A 2YANA 5IIZA 3QR6A 5DCGA 2E0QA 1HYUA 1EZKA 1JZRA 1XVWA 4IN0A 1GRXA 5J9CA 1PX6A 1M9AA 4O32A 1GTAA 1GWCA 3CMIA 1MEKA 2WS2A 1MD3A 3HYPA 3CRTA 3L9VA 1SL0B 3HCZA 1TOFA 1BEDA 1TK5B 1ERTA 1WMJA 4G9HA 4IVFA 4KX4A 4MJCA 4HU7A 2YNXA 5JCGA 3SBCA 2B5EA 3C1SA 3IA1A 3O3TA 4LMWA 3BBYA 1THOA 3FK8A 2VL3A 4XRDA 5DAKB 4TRXA 2R37A 5D9VA 1QQ2A 1LJRA 18GSA 4KCEA 3TKSE 5GAPD 1ERVA 2JZRA 5ECLB 1J0FA 2LKUA 1XWGA 1O8XA 2OADA 1FVJA 4YAVA 1A0FA 1F3BA 2M80A 5H5SA 2VIMA 4JEDA 4XS4A 2ALBA 4NHZA 1Y6EA 2AB6A 2CVBA 1IYHA 2PPTA 1BYEA 4RUVA 3FKFA 3TB2A 2K8SA 4ILFA 2YJHA 2VAFA 3GL3A 1GNWA 1B4PA 3GL5A 2V1MA 5JCUA 3NZNA 1OKDA 1V57A 1GSSA 2HT9A 2DSAA 4AF2A 1ZMAA 2IFQB 5CRHA 2ON7A 2GS3A 3H93A 1QK8A 2IJYA 2C3QA 3C73A 3LG6A 1K0NA 1OC9A 4JR4A 4XCSA 4NWYA 2IWTA 3HJOA 3HXSA 2M72A 3ZMLA 4G2EA 2CQ9A 1A23A 3UVTA 3GFKA 4TW5A 2H01A 3HZ8A 4V1Ap 4XRAA 3G7YA 2LV3A 4EL1A 1T7PB 3KMNA 5IMZA 3FHKA 2YOIA 5D9XA 3EU4A 2HSYA 3ZREA 2LSTA 4IJIA 3PINA 2F9SA 1SKSB 1SU9A 5ABRA 2G0FA 3O6TA 4EO3A 4MDCA 4MZCA 1S3CA 1PMTA 4OMVA 4ZILA 1J9BA 2X8GA 3FY7A 3ZFBA 2P31A 1HQOA 2VCQA 2AYTA 5KN1A 1JLVA 4MZWA 1WPIA 4Q5QA 2I3YA 1JZWA 4GCIA 2RUFA 4NV2A 3VWXA 2JSYA 3KTLA 1B9YC 4MZBA 4PGTA 2CVDA 2LJKA 2NDOA 4PNFA 4PURA 5A5KA 3LXTA 1TW9A 5GSTA 2CV4A 2IMKA 3IXRA 4I8BA 4KGIA 2V32A 1F3AA 3RHBA 2B5YA 1V40A 5L71A 2WJUA 4OCFA 3QPMA 4IQ1A 2WCIA 5KEJA 2HE3A 4HQSA 4XIHA 3QDNA 2H1BA 3DVXA 5EL8A 1V98A 1O7UA 4EE0A 1AQWA 5ELGA 3HVSA 5HQPA 4MH2A 5FHIA 5DALA 3CYNA 1VF1A 5ECMB 5CP1A 2VL9A 5CNWA 2NPBA 6GSYA 3CXGA 1Z6NA 6GSXA 1X9SB 1WE0A 3I69A 1XW5A 1A2JA 1GNEA 3FZ5A 2MMAA 3UIWA 2TIRA 3CSIA 5JWQB 2VCXA 3L78A 4TKYA 1OVNA 2DJ2A 3RPPA 1SD8A 1S3AA 3LYPA 1QXHA 3TJBA 3KM6A 5D9WA 1NW2A 3HA9A 1WP0A 2FCHA 3LEFA 3V1WA 3GKNA 3UOMA 1PGTA 1OYJA 2G2QA 4TR1B 3ERFA 3L4NA 4ECCA 2E7PA 1H75A 4NV5A 5D73A 2IPAA 5D96A 2KP1A 5J41A 4FO5A 3F3RA 3WD6A 3D4TA 2GDRA 1WOUA 3VWVA 2H30A 5C04A 3QAVA 4KDYA 1ACVA 19GSA 1TDIA 5IO0A 1VF2A 3M3MA 2CAIA 4RQRA 4EXJA 4ECJA 3KP8A 1DSBA 4XS6A 2B6MA 3GSSA 2L4CA 1PKWA 2DMLA 5B8AA 1C72A 1K3LA 2YJ7A 1XOAA 3VPTA 4TR4A 2O7KA 5G31A 1GH2A 1F37A 3UMAA 2L59A 1OE8A 2PU9C 3A2WA 1VF4A 3GA4A 3VWWA 1HD2A 3LORA 3KGKA 1YF0A 4EDZA 1XW9A 1UVZA 5KN3A 5A4UA 2IL3A 2CVKA 5D9TA 4ZL8A 3MDKA 5IMVA 2GT6A 1DE2A 2XPDA 1URMA 4MPFA 3VLNA 2RUEA 4FYCA 4O7HA 2R3XA 1GSFA 4WBRD 5D8IA 4HOJA 2L5OA 2GSQA 5IOWA 4POMA 2DBCA 3F6FA 5AISA 5ECIB 2KP2A 3QOUA 3BCKA 2X8HA 5EVOA 3GV1A 2L6DA 3GIXA 4RQXA 4XS1A 4EKZA 3VURA 5HR0A 4NHWA 1XZOA 3TKSC 1U3AA 3IR4A 1DBYA 1QMVA 1XIYA 3C7MA 4N11A 3F9UA 1BX9A 4ACSA 4G19A 2LRTA 1B4QA 1X5CA 3KJYA 4DSSB 3RAZA 2H6XA 2VCZA 4TXOB 2JL4A 3DYRA 2CA8A 4WETA 2HI7A 3E3EA 4E8EA 1EEMA 4POKA 4MF5A 3J7Yb 2PBJA 1SK1A 1RK4A 1BAYA 4OFMA 1NM3A 3TOUA 2XPEA 6GSUA 4L0UA 4WR4A 3MSZA 3VI7A 1JZOA 2LEGA 1RQMA 2FWGA 1B8XA 3UBLA 3MNGA 2OKAA 1ML6A 3VWUA 3TRPA 3D0ZA 4N10A 5CREA 3M9JA 1M99A 3TJFA 3EU3A 2VCVA 17GSA 2H8LA 2C0FA 1TI3A 2AAWA 1MTCA 4MF7A 5IPHA 4H86A 3IK7A 2LRCA 1T00A 3U6VA 3D6IA 1SKRB 1G7OA 2HFDA 4IELA 5JWOB 2FWFA 2H76A 3VI5A 2K8VA 1LU4A 5F07A 3UBKA 3IHQA 3Q19A 1TRUA 3M0FA 1MD4A 4GQFA 2GZZA 5G30A 3WGXA 12GSA 3LXZA 5HR1A 2H1AA 1ZCPA 4YH2A 4EUYA 1X9WB 4WEYA 3TUEA 2NVLA 2KOKA 2V6KA 1U3IA 3FRCA 2MZCA 3UVHA 1G6YA 3KXOA 2VO4A 2H6ZA 3A3TA 1WRYA 2C3TA 14GSA 4IGJA 2HRFA 1GLQA 3C71A 3A2XA 2P5RA 5DAKA 1SJIA 3IRAA 4J57E 4MLYA 2PGTA 3FEUA 4Z7XA 4KUNA 2DC5A 4YQUA 4L5OA 2GSTA 5HR2A 4HS1A 1HNBA 3HD5A 3NOFA 4HZ2A 1K3YA 1PX7A 4JU5A 3QFBC 4V2MA 5F06A 1X9MB 1XWBA 2DLXA 5E59A 1QGVA 3EMPA 4PQHA 2PN8A 1UN2A 4OFTA 4EC0A 1XWKA 1EV9A 1GUMA 2KHPA 4NAXA 5A4WA 3DD3A 1W89A 3H1NA 1R5AA 2WRTA 1HNAA 4AJ7A 3DEXA 2IFQA 3ERWA 1M2AA 5DJLA 4WKWA 3TOTA 4ML1A 1K3OA 1UC7A 3P7XA 3M8NA 1HNCA 4OO4A 2OBIA 4BVYA 3IE3A 4ZB8A 5ENUA 2GVPA 1GSUA 1TP9A 1I5GA 3BD2A 1TXXA 1OAZA 4NPBA 3VPQA 3TDGA 2DJKA 1KNGA 4QQ7A 4ZL9A 1YY7A 2H19A 2O8VB 4JZQA 1O85A 2H1GA 3DWVA 2YCDA 5ECPB 4PUAA 4MPGA 1V2AA 3N9JA 3ME8A 3US3A 2X8CA 3DIEA 1TRVA 2QGVA 2LRNA 2O89A 1VRSD 3TGZA 1ZZYA 2HYXA 1K0MA 2DMMA 2IN3A 1GSYA 5CRGA 4PX1A 1E6BA 5CO3A 3U5RE 4MJBA 4IQAA 4Q5FA 4KB3A 2WB9A 4GQCA 1Y25A 2H66A 5F8BA 2RIIA 3W8JA 1YKAA 2H0GA 5ID2A 5AGYA 2AV4A 4V2NA 4ID0A 3NIVA 4TR3A 4DEJA 1TU8A 2OE3A 5CYYA 2C3NA 5J3RA 3VK9A 1XPVA 3QAGA 3CRUA 1M2DA 4TR0A 11GSA 5E4WA 1JLWA 1FB6A 1SYXA 2DIYA 2ZNMA 3CBUA 1ERWA 1R4WA 5ID2B 4WBJA 5AIVA 1O81A 2X64A 4I5QA 4F9ZA 4K7IA 3TCOA 2LS5A 1YDKA 4O92A 1SJZA 1K0AA 3QD9A 1EEJA 2XC2A 1XVQA 3CTGA 3EYTA 3KIJA 4HU9A 1M7TA 3F4RA 2DJJA 1V9WA 3KMOA 1R26A 1T4ZA 3HJMA 4LL4B 2WFCA 4TN8A 5LNKe 2JACA 3QAWA 7GSSA 3CSJA 2TRXA 1KBNA 3R2QA 2CZ2A 4YQVA 4YAPA 2C80A 1EOGA 3UL3A 3GNJA 1XBSA 2MMNA 3TKSA 2K18A 3KZQA 5ECSA 4BWQA 2YZHA 3TRQA 4F0BA 3GHAA 4TVEA 4IJ3A 1K0BA 1VGLA 5FT3A 1QUWA 1T3BA 1XCCA 3J7Yk 1SKWB 1JZDA 3TJKA 3IOSA 5HFKA 1CQGA 3FYGA 3IV4A 4ZL7A 2YWNA 4WF5A 2I81A 4GTUA 1Z6MA 2A2SA 1Z9HA 3JCML 2IMDA 5ECNB 1EGRA 2DJ3A 2DIZA 3HJPA 1F2EA 4TR1A 4ECIA 5LD0A 4E8HA 2B7JA 4FYUA 4TOPA 5FWGA 4L5LA 1Z7RA 2HZEB 1FO5A 3APOA 2HNLA 3E9JB 3C1RA 3ZL5A 5A4VA 4F0CA 2OACA 2ZCTA 4KAEA 2IIYA 4FH8A 2L4QA 5HFGA 4X0XA 2C0GA 2EIRA 2RLIA 4KDXA 4BPYA 1OC3A 5J5NA 3EMXA 4AJ8A 1A0RP 5H5QA 6GSSA 1ILOA 4NXIA 2F8FA 3WYWA 2N5AA 3HVXA 2EIQA 4WR5A 1O6JA 2QSIA 2EIOA 3FR6A 1SL1B 1FB0A 1SJ6A 1A8YA 3DVWA 1GL8A 2H73A 4KSMA 1M2BA 2B1LA 3GKXA 3EC3A 3HDCA 2FY6A 2VUPA 4BVXA 4ULXA 3SWLA 1BJXA 2HSHA 3ISOA 2O85A 2GQKA 3MAKA 1EWXA 5ELAA 1T4YA 2VLVA 1I9DA 2FD3A 1M9BA 5IO2A 4K0GA 3BJ5A 3I9V2 3ZITA 1XWCA 3GTUB 4MCUA 4KH7A 3M9KA 4IS0A 4HQZA 2H70A 3MWHA 4DVCA 1FOVA 3KP9A 1AIUA 1XWAA 4I2UA 2FA4A 2AHEA 2LUSA 2CT6A 2GLRA 2N5FA 3ZVJA 3Q18A 3FR3A 4ZBDA 4DSSA 1OE7A 2B3SA 2X99A 4TXOA 3LQ7A 2PVQA 2KUCA 3IC4A 2V2GA 3BCIA 1GSQA 2GSSA 5HFIA 5IMCA 2GT5A 2OBKA 1U6TA 5INYA 4QL7A 2GSRA 2MBTA 4MJAA 4FIWA 2VD1A 5J4UA 2FA8A 2CAQA 2K6VA 2I1UA 2K9FA 2Z9SA 5DDLA 4TXVA 4Q5NA 3GN3A 4GSTA 1IYIA 4ZBBA 3GURA 1GTBA 2FWHA 9GSSA 5G5EA 4BA7A 1J08A 1O8WA 2LQQA 1T1VA 3H8QA 5G1KA 2HXKA 2LTKA 4HI7A 2VLTA 4KE3A 3IK9A 3UARA 1ERUA 2GZPA 3S9FA 3PR8A 2F8AA 3RHCA 3QCPA 3VFIA 2LNTA 4D73B 3TKPA 4ML6A 3CSHA 1X0RA 3WGDA 3KH9A 1AXDA 2EC4A 2RM6A 1PRXA 3W6GA 3UAPA 3GX0A 2ES7A 1ZGNA 3ZTLA 4KA0A 4X1UA 4MK3A 1NHOA 1B9XC 4QL9A 5ECHB 2YZUA 3F8UA 1SYRA 3UEMA 1N8JA 1W4VA 3LWAA 4GLTA 5IMDA 2H1DA 2YPMA 3TKQA 2H75A 3KEBA 2V41A 5CAXA 2FUG2 3DXBA 3ZVJD 1CQHA 4OWYA 5J9BA 3IPZA 2RM5A 2GTUA 4GRFA 2AJQB 4KNDA 3ZIJA 1DE1A 3RPNA 2YWIA 1GTUA 2JZTA 2PMTA 4ISDA 2FNOA 1G7EA 4JBBA 5H5RA 2N5BA 2O87A 3ZZXA 2J23A 1GSEA 3APSA 2IMEA 1VF3A 2L57A 3G9BA 5C00A 2REMA 3I6AA 1OC8A 4K7NA 3TKRA 1KTEA 1BQ7A 2CZ3A 1SL2B 5IOXA 1ZOFA 4RI6A 5JWRB 2H71A 2I9HA 5B6NA 2H6YA 4GXZA 2PVOC 1K0OA 20GSA 3DMLA 1SD9A 5G5FA 4GSNA 4ZXGA 4XHMA 1S3DA 4K9ZA 5EY6A 1BG5A 3KCMA 2AUVA 4CW9A 4IP1A 4K0NA 1PN9A 3P2AA 1A24A 4F82A 4WXTA 2KLXA 5F0GA 4IP6A 4ZIJA 3ZLPA 4J2FA 5CRDA 3H79A 2E2GA 5GZZB 3L9UA 5DJMA 1FVKA 2HLSA 1EP7A 2C4JA 22GSA 2LQOA 5GSSA 5DQSA 2BJXA 5IQYA 1TK8B 3FZ4A 16GSA 3ZIVA 1Z5YE 3F4SA 1GP1A 1TTZA 1EV4A 4PNGA 4KSOA 1YF1A 3ZYWA 1AAZA 3Q74A 2ZUPA 3HHVA 4V1Ag 5EPFA 2L6CA 3QMXA 3WT2A 1X5EA 1GLPA 2VL2C 6GSVA 3I43A 4RI7A 5IMAA 4ZB9A 4N0VA 4XS4B 1GUKA 1AQXA 3ERGA 2B1KA 3KD0A 2QKEA 2H74A 4ZBAA 2DJ1A 2H0HA 4I97A 2ON5A 2R6KA 4HEA2 1WIKA 3PH9A 1YQ1A 1GULA 4HUAA 1E2YA 4GF0A 1XXUA 3F63A 1ZL9A 1V58A 3RDWA 1TK0B 3HZ4A 4IKHA 3DKSA 2CX3A 2FHEA 4MF6A 4MA9A 4K7OA 1OC9B 3G7JA 1ZYQB 1TKDB 2VLUA 1G6WA 2C8UA 1ZYEA 13GSA 2C1YA 4LMVA 4V2LA 1NSWA 3OR5A 6GSWA 3FZ9A 3GH6A 5G2ZA 4P3YB 2WDUA 2XBQA 1MDIA 1A8LA 1DUGA 4IHUA 2NBSA 5G1LA 4PQ1A
chains in the Genus database with same CATH superfamily
1H4OA 5BMUA 5ECKB 1GUHA 2PERA 1K0CA 2YP6A 2MMOA 4POBA 1TRWA 3P90A 2MYGA 4ECBA 5F05A 3GKMA 2NTOA 2MMZA 2R5GA 1TRSA 4DSQA 2JU5A 1UA5A 1JHBA 4EVMA 4EDYA 1X5DA 3ZFLA 3FZAA 5ECRB 3BOAA 3D5JA 3HKRA 3EE2A 3O76A 6GSTA 1EOHA 3Q6OA 1EP8A 2OA7A 3F0IA 2DKIA 1NHYA 3F3QA 4OO5A 2FLSA 2IMIA 3D4MA 1TI1A 2LJAA 4WF4A 4K6XA 4XTSA 3FW2A 1N2AA 3RBTA 4ICYA 3GX8A 4CHSA 2OE0A 1R5PA 3F6DA 4MJEA 1F9MA 4J56E 4JR6A 4OFNA 2P0GA 2HZEA 3IAS2 2JZSA 3E0UA 2R2JA 5COHA 5IM9A 4AGSA 8GSSA 3D21A 4PUFC 3APQA 5DALB 1SK0A 1MDKA 3MIXA 1THXA 5JCWA 2HSMA 3DGQA 2JSZA 4KW6A 4NMUA 5IPGA 4F2IA 4USSA 2BTOT 5HR3A 2P5QA 1XOBA 2C0DA 3EWLA 3KH7A 1PQNA 3A5WA 1WWJA 3G7IA 2A2RA 5DVBA 3F4TA 2WZ9A 2R0PA 1ABAA 2D2ZA 1PD21 2GZYA 3IAM2 3ZRDA 4ZB6A 3K8NA 3LFLA 3WT1A 3GMFA 5DQYA 4HDEA 2TRCP 4DSRA 3N5OA 4CDOA 2VOCA 3GSTA 4GSSA 4K5SA 2H0IA 2A4VA 2DJ0A 3GTUA 2M46A 1B48A 4I6XA 4JE1A 4PQIA 2LJRA 2B5XA 4K1FA 3L0HA 1MDJA 1LBKA 3TJGA 1XW6A 1SENA 4K5RA 1YZXA 4KDUA 2HRNA 5DBQA 1Q98A 2GQMA 1AQVA 5GAND 2XBIA 3LGCA 3CTFA 4EIQA 3GKKA 2F3MA 4AJ6A 2H72A 4MABA 1YJ6A 3GUSA 10GSA 4G10A 4X43A 4N0ZA 4POLA 4I2TA 4K2DA 1G0TA 3C8EA 1F6MC 1JFUA 2E2MA 2WULA 4K8MA 2F51A 4F03A 4Q5RA 2BMXA 3EINA 3HY2A 2R4VA 3FR9A 4OD7A 2IMFA 4LL1B 1FHEA 4IW9A 4GWRA 4PXOA 1PA3A 2B7KA 2XHFA 1T8EB 5D93A 5ECOB 3L9SA 5DCHA 2VCWA 1WJKA 2GQLA 2OJLA 1Z3EA 1R7HA 2QC7A 3TRXA 5B8BA 3P8WA 1ST9A 5BRTA 1QFNA 2L5LA 4EF0A 4LLRA 3EURA 3GRXA 2VM2A 2OE1A 4OCEA 1O73A 4L0WA 1M0UA 2VD0A 1FAAA 1GSDA 2YWMA 1TU7A 5AIXA 1AC1A 4D73A 1YEXA 4LA1A 1SK2A 4BWSA 4HZ4A 1YEPA 3GYKA 2VL2A 3IDVA 2JADA 1RW1A 4O5RA 3HVVA 1FG4A 2HZFA 5B7CA 5LCZA 2GGTA 1EGOA 3H4KA 1KEBA 5ECQB 4YQMA 3KTBA 3LYKA 3M1GA 3UJ1A 3FMWA 4KCAA 1PL1A 1PL2A 2FWEA 1FW1A 1XFLA 3WGEA 2WGRA 2VM1A 4FYBA 2CX4A 1ON4A 2FGXA 1OKTA 4JRRA 2YWOA 3A2VA 4HJMA 2J9HA 4KF9A 1U87A 4IBPA 3TJJA 4MP4A 1U88A 2YV7A 2V6OA 5CRWA 1A2MA 3DRNA 4MMMA 1USBA 3LSZA 5IMFA 1A2LA 1Z7PA 5B6MA 1AUCA 3D22A 2YN1A 3ZMKA 1GTIA 3EVIA 5KN2A 3W8SA 1Q4JA 2PWJA 4L8EA 4Z2RA 3GH9A 1K0DA 3IBHA 3LJRA 3ED3A 5AN1A 3AY8A 3ME7A 4HJ2A 4N30A 3PGTA 1TJDA 2I4AA 2LNSA 2C0EA 5KN0A 2MBSA 4MH3A 1AW9A 1YKCA 3QFAC 1PSQA 1PKZA 2PUKC 3LW9A 4BL7A 2VCTA 2YV9A 2YANA 4K2XA 5IIZA 3QR6A 5DCGA 2E0QA 1HYUA 1EZKA 1JZRA 1XVWA 4IN0A 1GRXA 5J9CA 1PX6A 1M9AA 4O32A 1GTAA 1GWCA 3CMIA 1MEKA 2WS2A 1MD3A 3HYPA 4BL7B 3CRTA 3L9VA 1SL0B 3HCZA 1TOFA 1BEDA 1TK5B 1ERTA 1WMJA 4G9HA 4IVFA 4KX4A 4MJCA 4HU7A 2YNXA 5JCGA 3SBCA 2B5EA 3C1SA 3IA1A 3O3TA 4LMWA 3BBYA 1THOA 3FK8A 2VL3A 4XRDA 5DAKB 4TRXA 2R37A 5D9VA 1QQ2A 1LJRA 18GSA 4KCEA 3TKSE 5GAPD 1ERVA 2JZRA 5ECLB 1J0FA 2LKUA 1XWGA 1O8XA 2OADA 1FVJA 4YAVA 1A0FA 1F3BA 2M80A 5H5SA 2VIMA 4JEDA 4XS4A 2ALBA 4NHZA 1Y6EA 2AB6A 2CVBA 1IYHA 2PPTA 1BYEA 4RUVA 3FKFA 3TB2A 2K8SA 4ILFA 2YJHA 2VAFA 3GL3A 1GNWA 1B4PA 3GL5A 2V1MA 5JCUA 3NZNA 4FQUA 1OKDA 1V57A 1GSSA 3PPUA 2HT9A 2DSAA 4AF2A 1ZMAA 2IFQB 5CRHA 2ON7A 2GS3A 3H93A 1QK8A 2IJYA 2C3QA 3C73A 3LG6A 1K0NA 1OC9A 4JR4A 4XCSA 4NWYA 4BVYB 2IWTA 3HJOA 3HXSA 2M72A 3ZMLA 4G2EA 2CQ9A 1A23A 3UVTA 3GFKA 4TW5A 2H01A 3HZ8A 4V1Ap 4XRAA 3G7YA 2LV3A 4EL1A 1T7PB 3KMNA 5IMZA 3FHKA 2YOIA 5D9XA 3EU4A 2HSYA 3ZREA 2LSTA 4IJIA 3PINA 2F9SA 1SKSB 1SU9A 1S3RA 5ABRA 4CY6A 2G0FA 3O6TA 4EO3A 4MDCA 4MZCA 1S3CA 1PMTA 4OMVA 4ZILA 1J9BA 2X8GA 3FY7A 3ZFBA 2P31A 1HQOA 2VCQA 2AYTA 5KN1A 1JLVA 4MZWA 1WPIA 4Q5QA 2I3YA 1JZWA 4GCIA 2RUFA 4NV2A 5KOWA 3VWXA 2JSYA 3KTLA 1B9YC 4MZBA 4PGTA 2CVDA 2LJKA 2NDOA 4PNFA 4PURA 5A5KA 3LXTA 1TW9A 5GSTA 2CV4A 2IMKA 3IXRA 4I8BA 2A4HA 4KGIA 2V32A 1F3AA 2HRKA 3RHBA 2B5YA 1V40A 4G0KA 5L71A 2WJUA 4OCFA 3QPMA 4IQ1A 2WCIA 5KEJA 2HE3A 4HQSA 4XIHA 3QDNA 2H1BA 3DVXA 3HVNA 5EL8A 1V98A 1O7UA 4EE0A 1AQWA 5ELGA 3HVSA 5HQPA 4MH2A 4X4JA 5FHIA 5DALA 3CYNA 1VF1A 5ECMB 5CP1A 2VL9A 5CNWA 2NPBA 6GSYA 3CXGA 1Z6NA 6GSXA 1X9SB 1WE0A 3I69A 1XW5A 1A2JA 1GNEA 3FZ5A 5KOXA 2MMAA 3UIWA 2TIRA 3CSIA 5JWQB 4Z2UA 2VCXA 3L78A 4TKYA 1OVNA 2DJ2A 3RPPA 1SD8A 3A5IA 1S3AA 3LYPA 1QXHA 3TJBA 3KM6A 5D9WA 1NW2A 3HA9A 1WP0A 2FCHA 3LEFA 3V1WA 3GKNA 3UOMA 1PGTA 1OYJA 2G2QA 4TR1B 3ERFA 3L4NA 4ECCA 2E7PA 1H75A 4NV5A 5D73A 2IPAA 5D96A 2KP1A 5J41A 4FO5A 3F3RA 3WD6A 3D4TA 2GDRA 1WOUA 3VWVA 2H30A 5C04A 3QAVA 4KDYA 4HSCX 3MYDA 1ACVA 19GSA 1TDIA 5IO0A 1VF2A 3M3MA 2CAIA 4RQRA 4EXJA 4ECJA 3KP8A 1DSBA 4XS6A 2B6MA 3GSSA 2L4CA 1PKWA 2DMLA 5B8AA 1C72A 1K3LA 2YJ7A 1XOAA 3R3EA 3VPTA 4TR4A 2O7KA 5G31A 1GH2A 1F37A 4BIKA 3UMAA 2L59A 1OE8A 2PU9C 3A2WA 1VF4A 3GA4A 3VWWA 1HD2A 3LORA 3KGKA 1YF0A 4EDZA 1XW9A 1UVZA 1PFOA 5A4UA 5KN3A 2IL3A 2CVKA 5D9TA 4ZL8A 2R0GA 3MDKA 5IMVA 2GT6A 1DE2A 2XPDA 1URMA 4MPFA 3VLNA 4PTSA 2RUEA 4FYCA 4O7HA 2R3XA 1GSFA 4WBRD 4BVXB 5D8IA 4HOJA 2L5OA 2GSQA 5IOWA 4POMA 2DBCA 3F6FA 5AISA 5ECIB 2KP2A 3QOUA 3BCKA 2X8HA 3GV1A 3GIXA 2L6DA 5EVOA 4RQXA 4XS1A 4EKZA 3VURA 5HR0A 4NHWA 1XZOA 3TKSC 1U3AA 3IR4A 1DBYA 1QMVA 1XIYA 3C7MA 4N11A 3F9UA 1BX9A 4ACSA 4G19A 2LRTA 1B4QA 1X5CA 3KJYA 4DSSB 3RAZA 2H6XA 2VCZA 4TXOB 2JL4A 3DYRA 2CA8A 4WETA 2HI7A 3E3EA 4E8EA 1EEMA 4POKA 4MF5A 3J7Yb 2PBJA 1SK1A 1RK4A 4CY8A 1BAYA 4OFMA 1NM3A 3TOUA 2XPEA 6GSUA 4L0UA 4WR4A 1XG8A 3MSZA 4Z2TA 3VI7A 1JZOA 2LEGA 1RQMA 2FWGA 1B8XA 3UBLA 3MNGA 2OKAA 1ML6A 3VWUA 3TRPA 3D0ZA 4N10A 5CREA 3M9JA 1M99A 3TJFA 3EU3A 2VCVA 17GSA 2H8LA 2C0FA 1TI3A 2AAWA 1MTCA 4MF7A 5IPHA 4H86A 3IK7A 2LRCA 1T00A 3U6VA 3D6IA 1SKRB 1G7OA 2HFDA 4IELA 5JWOB 2FWFA 2H76A 3VI5A 2K8VA 1LU4A 5F07A 3UBKA 3IHQA 3Q19A 1TRUA 3M0FA 1MD4A 4GQFA 2GZZA 5G30A 3WGXA 12GSA 3LXZA 5HR1A 2H1AA 1ZCPA 4YH2A 4EUYA 1X9WB 4WEYA 3TUEA 2NVLA 2KOKA 2V6KA 1U3IA 3FRCA 2MZCA 3UVHA 1G6YA 3KXOA 2VO4A 2H6ZA 3A3TA 1WRYA 2C3TA 14GSA 4IGJA 2HRFA 2DKHA 1GLQA 3C71A 3A2XA 3CQFA 2P5RA 5DAKA 1SJIA 3IRAA 4J57E 4MLYA 2X4AA 2PGTA 1FOHA 3FEUA 4Z7XA 4KUNA 2DC5A 4YQUA 4L5OA 2GSTA 5HR2A 4HS1A 1HNBA 3HD5A 3NOFA 4HZ2A 1K3YA 1PX7A 4JU5A 3QFBC 4V2MA 5F06A 1X9MB 1XWBA 2DLXA 5E59A 1QGVA 3EMPA 4PQHA 2PN8A 1UN2A 4OFTA 4EC0A 1XWKA 1EV9A 1GUMA 2KHPA 4NAXA 5A4WA 3DD3A 2R0CA 1W89A 3H1NA 1R5AA 2WRTA 1HNAA 1ZYPA 4AJ7A 2HRAA 3IHGA 3DEXA 2IFQA 3ERWA 1M2AA 5DJLA 4WKWA 3TOTA 4ML1A 1K3OA 1UC7A 3P7XA 3M8NA 1HNCA 4OO4A 2OBIA 4BVYA 3IE3A 4ZB8A 5ENUA 2GVPA 1GSUA 1TP9A 1I5GA 3BD2A 1TXXA 1OAZA 4NPBA 3VPQA 3TDGA 2DJKA 1KNGA 4QQ7A 4ZL9A 1YY7A 2H19A 2O8VB 4JZQA 1O85A 2H1GA 3DWVA 2YCDA 5ECPB 4PUAA 4MPGA 1V2AA 3N9JA 3ME8A 3US3A 2X8CA 3DIEA 1TRVA 2QGVA 2LRNA 2O89A 1VRSD 3TGZA 1ZZYA 2HYXA 1K0MA 2DMMA 2IN3A 1GSYA 5CRGA 4PX1A 1E6BA 5CO3A 3U5RE 4MJBA 4IQAA 4Q5FA 4KB3A 2WB9A 4GQCA 1Y25A 2H66A 5F8BA 2RIIA 3W8JA 1YKAA 2H0GA 5ID2A 5AGYA 2AV4A 4V2NA 4ID0A 3NIVA 4TR3A 4DEJA 1TU8A 2OE3A 5CYYA 2C3NA 5J3RA 3VK9A 1ZYNA 1XPVA 3QAGA 3CRUA 1M2DA 4TR0A 11GSA 5E4WA 1JLWA 1FB6A 1SYXA 2DIYA 2ZNMA 3CBUA 1ERWA 1R4WA 5ID2B 4WBJA 5AIVA 1O81A 2X64A 4I5QA 4F9ZA 4K7IA 3TCOA 2LS5A 1YDKA 4O92A 1SJZA 1K0AA 3QD9A 1EEJA 2XC2A 1XVQA 3CTGA 3EYTA 3KIJA 4HU9A 1M7TA 3F4RA 2DJJA 1V9WA 3KMOA 1R26A 1T4ZA 3HJMA 4LL4B 2WFCA 4TN8A 5LNKe 2JACA 3QAWA 7GSSA 3CSJA 2TRXA 1KBNA 3R2QA 2CZ2A 4YQVA 4YAPA 2C80A 1EOGA 3UL3A 3GNJA 1XBSA 4A5PA 2MMNA 3TKSA 2K18A 3KZQA 5ECSA 4BWQA 2YZHA 4YKGA 3TRQA 4F0BA 3GHAA 4MNNA 4TVEA 2QA2A 4IJ3A 1K0BA 4G0LA 1VGLA 5FT3A 1QUWA 1T3BA 1XCCA 3J7Yk 1SKWB 1JZDA 3TJKA 3IOSA 5HFKA 1CQGA 3FYGA 3IV4A 4ZL7A 2YWNA 4WF5A 2I81A 4GTUA 1Z6MA 2A2SA 1Z9HA 3JCML 2IMDA 5ECNB 1EGRA 2DJ3A 2DIZA 3HJPA 1F2EA 4TR1A 4ECIA 5LD0A 4E8HA 2B7JA 4FYUA 4TOPA 5FWGA 4L5LA 1Z7RA 2HZEB 1FO5A 3APOA 2HNLA 3E9JB 3C1RA 3ZL5A 5A4VA 4F0CA 2OACA 2ZCTA 4KAEA 2IIYA 4FH8A 2L4QA 5HFGA 4X0XA 2C0GA 2EIRA 2RLIA 4KDXA 4BPYA 1OC3A 5J5NA 3EMXA 4AJ8A 1A0RP 5H5QA 6GSSA 1ILOA 4NXIA 2F8FA 3WYWA 2N5AA 3HVXA 2EIQA 4WR5A 1O6JA 2QSIA 2EIOA 3FR6A 1SL1B 1FB0A 1SJ6A 1A8YA 3DVWA 1GL8A 2H73A 4KSMA 1M2BA 2B1LA 3GKXA 3EC3A 3HDCA 2FY6A 2VUPA 4BVXA 4ULXA 3SWLA 1BJXA 2HSHA 3ISOA 2O85A 2GQKA 3MAKA 1EWXA 5ELAA 1T4YA 2VLVA 1I9DA 2FD3A 1M9BA 5IO2A 4K0GA 3BJ5A 3I9V2 3ZITA 1M3JA 1XWCA 3GTUB 4MCUA 4KH7A 3M9KA 4IS0A 4HQZA 2H70A 3MWHA 4DVCA 1FOVA 3KP9A 1AIUA 1XWAA 4I2UA 2FA4A 2AHEA 2LUSA 2CT6A 2GLRA 2N5FA 3ZVJA 3Q18A 3FR3A 4ZBDA 4DSSA 1OE7A 2B3SA 2X99A 4TXOA 3LQ7A 2PVQA 2KUCA 3IC4A 2V2GA 3BCIA 1GSQA 2GSSA 5HFIA 5IMCA 2GT5A 2OBKA 1U6TA 5INYA 4QL7A 2GSRA 2MBTA 4MJAA 4FIWA 2VD1A 5J4UA 2FA8A 2CAQA 2K6VA 2I1UA 2K9FA 2Z9SA 3EPTA 4TXVA 5DDLA 4Q5NA 3GN3A 4GSTA 1IYIA 4ZBBA 3GURA 1GTBA 2FWHA 9GSSA 5G5EA 4BA7A 1J08A 1O8WA 2LQQA 1T1VA 3H8QA 5G1KA 4EIPA 2HXKA 2LTKA 4HI7A 2VLTA 4KE3A 3IK9A 3UARA 1ERUA 2GZPA 3S9FA 3PR8A 2F8AA 3RHCA 3QCPA 3VFIA 2LNTA 4D73B 3TKPA 4ML6A 3CSHA 1X0RA 3WGDA 3KH9A 1AXDA 2EC4A 2RM6A 1PRXA 3W6GA 3UAPA 3GX0A 2ES7A 1ZGNA 3ZTLA 4KA0A 4X1UA 4MK3A 1NHOA 4O5UA 1B9XC 4QL9A 5ECHB 2YZUA 3F8UA 1SYRA 3UEMA 1N8JA 1W4VA 3LWAA 4GLTA 5IMDA 2H1DA 2YPMA 3TKQA 2H75A 3KEBA 2V41A 5CAXA 2FUG2 3DXBA 3ZVJD 1CQHA 4OWYA 5J9BA 3IPZA 2RM5A 2GTUA 4GRFA 2AJQB 4KNDA 3ZIJA 1DE1A 3RPNA 2YWIA 1GTUA 2JZTA 2PMTA 4ISDA 2FNOA 2X49A 1G7EA 2QA1A 4JBBA 5H5RA 2N5BA 2O87A 3ZZXA 2J23A 1GSEA 3APSA 2IMEA 1VF3A 2L57A 3G9BA 5C00A 2REMA 3I6AA 1OC8A 4K7NA 3TKRA 1KTEA 1BQ7A 2CZ3A 1SL2B 5IOXA 1ZOFA 4RI6A 5JWRB 2H71A 2I9HA 5B6NA 2H6YA 4GXZA 2PVOC 1K0OA 20GSA 3DMLA 1SD9A 5G5FA 4GSNA 4ZXGA 4XHMA 1S3DA 4K9ZA 5EY6A 1BG5A 3KCMA 2AUVA 4CW9A 2A2PA 4IP1A 4K0NA 1PN9A 3P2AA 1A24A 4F82A 2UZ8A 4WXTA 2KLXA 5F0GA 4IP6A 4ZIJA 3ZLPA 4J2FA 5CRDA 3H79A 2E2GA 5GZZB 3L9UA 5DJMA 1FVKA 2HLSA 1EP7A 2C4JA 22GSA 2LQOA 5GSSA 5DQSA 2BJXA 5IQYA 1TK8B 3FZ4A 16GSA 3ZIVA 1Z5YE 3F4SA 1GP1A 1TTZA 1EV4A 4PNGA 4KSOA 1YF1A 3ZYWA 1AAZA 3Q74A 2ZUPA 3HHVA 4V1Ag 5EPFA 2L6CA 1M3IA 3QMXA 3WT2A 1X5EA 3IC8A 1GLPA 2VL2C 6GSVA 4G0IA 3I43A 4RI7A 5IMAA 4ZB9A 4N0VA 4XS4B 1PN0A 1GUKA 1AQXA 3ERGA 2B1KA 3KD0A 2QKEA 2H74A 4ZBAA 2DJ1A 2H0HA 4I97A 2ON5A 2R6KA 4HEA2 1WIKA 3PH9A 1YQ1A 1GULA 4HUAA 1E2YA 4GF0A 1XXUA 3F63A 1ZL9A 1V58A 3RDWA 1TK0B 3HZ4A 4IKHA 3DKSA 2CX3A 2FHEA 4MF6A 4MA9A 4K7OA 1OC9B 3G7JA 1ZYQB 1TKDB 2VLUA 1G6WA 2C8UA 1ZYEA 13GSA 2C1YA 4LMVA 4V2LA 1NSWA 3OR5A 6GSWA 3FZ9A 4YKFA 3GH6A 5G2ZA 4P3YB 2WDUA 2XBQA 4O5QA 1MDIA 1A8LA 1DUGA 4IHUA 2NBSA 5G1LA 4PQ1A
chains in the Genus database with same CATH topology
1H4OA 5BMUA 5ECKB 1GUHA 2PERA 1K0CA 2YP6A 2MMOA 4POBA 1TRWA 3P90A 2MYGA 4ECBA 5F05A 3GKMA 2NTOA 2MMZA 2R5GA 1TRSA 4DSQA 2JU5A 1UA5A 1JHBA 4EVMA 4EDYA 1X5DA 3ZFLA 3FZAA 5ECRB 3BOAA 3D5JA 3HKRA 3EE2A 3O76A 6GSTA 1EOHA 3Q6OA 1EP8A 2OA7A 3F0IA 2DKIA 1NHYA 3F3QA 4OO5A 2FLSA 2IMIA 3D4MA 1TI1A 2LJAA 4WF4A 4K6XA 4XTSA 3FW2A 1N2AA 3RBTA 4ICYA 3GX8A 4CHSA 2OE0A 1R5PA 3F6DA 4MJEA 1F9MA 4J56E 4JR6A 4OFNA 2P0GA 2HZEA 3IAS2 2JZSA 3E0UA 2R2JA 5COHA 5IM9A 4AGSA 8GSSA 3D21A 4PUFC 3APQA 5DALB 1SK0A 1MDKA 3MIXA 1THXA 5JCWA 2HSMA 3DGQA 2JSZA 4KW6A 4NMUA 5IPGA 4F2IA 4USSA 2BTOT 5HR3A 2P5QA 1XOBA 2C0DA 3EWLA 3KH7A 1PQNA 3A5WA 1WWJA 3G7IA 2A2RA 5DVBA 3F4TA 2WZ9A 2R0PA 1ABAA 2D2ZA 1PD21 2GZYA 3IAM2 3ZRDA 4ZB6A 3K8NA 3LFLA 3WT1A 3GMFA 5DQYA 4HDEA 2TRCP 4DSRA 3N5OA 4CDOA 2VOCA 3GSTA 4GSSA 4K5SA 2H0IA 2A4VA 2DJ0A 3GTUA 2M46A 1B48A 4I6XA 4JE1A 4PQIA 2LJRA 2B5XA 4K1FA 3L0HA 1MDJA 1LBKA 3TJGA 1XW6A 1SENA 4K5RA 1YZXA 4KDUA 2HRNA 5DBQA 1Q98A 2GQMA 1AQVA 5GAND 2XBIA 3LGCA 3CTFA 4EIQA 3GKKA 2F3MA 4AJ6A 2H72A 4MABA 1YJ6A 3GUSA 10GSA 4G10A 4X43A 4N0ZA 4POLA 4I2TA 4K2DA 1G0TA 3C8EA 1F6MC 1JFUA 2E2MA 2WULA 4K8MA 2F51A 4F03A 4Q5RA 2BMXA 3EINA 3HY2A 2R4VA 3FR9A 4OD7A 2IMFA 4LL1B 1FHEA 4IW9A 4GWRA 4PXOA 1PA3A 2B7KA 2XHFA 1T8EB 5D93A 5ECOB 3L9SA 5DCHA 2VCWA 1WJKA 2GQLA 2OJLA 1Z3EA 1R7HA 2QC7A 3TRXA 5B8BA 3P8WA 1ST9A 5BRTA 1QFNA 2L5LA 4EF0A 4LLRA 3EURA 3GRXA 2VM2A 2OE1A 4OCEA 1O73A 4L0WA 1M0UA 2VD0A 1FAAA 1GSDA 2YWMA 1TU7A 5AIXA 1AC1A 4D73A 1YEXA 4LA1A 1SK2A 4BWSA 4HZ4A 1YEPA 3GYKA 2VL2A 3IDVA 2JADA 1RW1A 4O5RA 3HVVA 1FG4A 2HZFA 5B7CA 5LCZA 2GGTA 1EGOA 3H4KA 1KEBA 5ECQB 4YQMA 3KTBA 3LYKA 3M1GA 3UJ1A 3FMWA 4KCAA 1PL1A 1PL2A 2FWEA 1FW1A 1XFLA 3WGEA 2WGRA 2VM1A 4FYBA 2CX4A 1ON4A 2FGXA 1OKTA 4JRRA 2YWOA 3A2VA 4HJMA 2J9HA 4KF9A 1U87A 4IBPA 3TJJA 4MP4A 1U88A 2YV7A 2V6OA 5CRWA 1A2MA 3DRNA 4MMMA 1USBA 3LSZA 5IMFA 1A2LA 1Z7PA 5B6MA 1AUCA 3D22A 2YN1A 3ZMKA 1GTIA 3EVIA 5KN2A 3W8SA 1Q4JA 2PWJA 4L8EA 4Z2RA 3GH9A 1K0DA 3IBHA 3LJRA 3ED3A 5AN1A 3AY8A 3ME7A 4HJ2A 4N30A 3PGTA 1TJDA 2I4AA 2LNSA 2C0EA 5KN0A 2MBSA 4MH3A 1AW9A 1YKCA 3QFAC 1PSQA 1PKZA 2PUKC 3LW9A 4BL7A 2VCTA 2YV9A 2YANA 4K2XA 5IIZA 3QR6A 5DCGA 2E0QA 1HYUA 1EZKA 1JZRA 1XVWA 4IN0A 1GRXA 5J9CA 1PX6A 1M9AA 4O32A 1GTAA 1GWCA 3CMIA 1MEKA 2WS2A 1MD3A 3HYPA 4BL7B 3CRTA 3L9VA 1SL0B 3HCZA 1TOFA 1BEDA 1TK5B 1ERTA 1WMJA 4G9HA 4IVFA 4KX4A 4MJCA 4HU7A 2YNXA 5JCGA 3SBCA 2B5EA 3C1SA 3IA1A 3O3TA 4LMWA 3BBYA 1THOA 3FK8A 2VL3A 4XRDA 5DAKB 4TRXA 2R37A 5D9VA 1QQ2A 1LJRA 18GSA 4KCEA 3TKSE 5GAPD 1ERVA 2JZRA 5ECLB 1J0FA 2LKUA 1XWGA 1O8XA 2OADA 1FVJA 4YAVA 1A0FA 1F3BA 2M80A 5H5SA 2VIMA 4JEDA 4XS4A 2ALBA 4NHZA 1Y6EA 2AB6A 2CVBA 1IYHA 2PPTA 1BYEA 4RUVA 3FKFA 3TB2A 2K8SA 4ILFA 2YJHA 2VAFA 3GL3A 1GNWA 1B4PA 3GL5A 2V1MA 5JCUA 3NZNA 4FQUA 1OKDA 1V57A 1GSSA 3PPUA 2HT9A 2DSAA 4AF2A 1ZMAA 2IFQB 5CRHA 2ON7A 2GS3A 3H93A 1QK8A 2IJYA 2C3QA 3C73A 3LG6A 1K0NA 1OC9A 4JR4A 4XCSA 4NWYA 4BVYB 2IWTA 3HJOA 3HXSA 2M72A 3ZMLA 4G2EA 2CQ9A 1A23A 3UVTA 3GFKA 4TW5A 2H01A 3HZ8A 4V1Ap 4XRAA 3G7YA 2LV3A 4EL1A 1T7PB 3KMNA 5IMZA 3FHKA 2YOIA 5D9XA 3EU4A 2HSYA 3ZREA 2LSTA 4IJIA 3PINA 2F9SA 1SKSB 1SU9A 5ABRA 4CY6A 2G0FA 3O6TA 4EO3A 4MDCA 4MZCA 1S3CA 1PMTA 4OMVA 4ZILA 1J9BA 2X8GA 3FY7A 3ZFBA 2P31A 1HQOA 2VCQA 2AYTA 5KN1A 1JLVA 4MZWA 1WPIA 4Q5QA 2I3YA 1JZWA 4GCIA 2RUFA 4NV2A 5KOWA 3VWXA 2JSYA 3KTLA 1B9YC 4MZBA 4PGTA 2CVDA 2LJKA 2NDOA 4PNFA 4PURA 5A5KA 3LXTA 1TW9A 5GSTA 2CV4A 2IMKA 3IXRA 4I8BA 2A4HA 4KGIA 2V32A 1F3AA 2HRKA 3RHBA 2B5YA 1V40A 4G0KA 5L71A 2WJUA 4OCFA 3QPMA 4IQ1A 2WCIA 5KEJA 2HE3A 4HQSA 4XIHA 3QDNA 2H1BA 3DVXA 5EL8A 1V98A 1O7UA 4EE0A 1AQWA 5ELGA 3HVSA 5HQPA 4MH2A 4X4JA 5FHIA 5DALA 3CYNA 1VF1A 5ECMB 5CP1A 2VL9A 5CNWA 2NPBA 6GSYA 3CXGA 1Z6NA 6GSXA 1X9SB 1WE0A 3I69A 1XW5A 1A2JA 1GNEA 3FZ5A 5KOXA 2MMAA 3UIWA 2TIRA 3CSIA 5JWQB 4Z2UA 2VCXA 3L78A 4TKYA 1OVNA 2DJ2A 3RPPA 1SD8A 3A5IA 1S3AA 3LYPA 1QXHA 3TJBA 3KM6A 5D9WA 1NW2A 3HA9A 1WP0A 2FCHA 3LEFA 3V1WA 3GKNA 3UOMA 1PGTA 1OYJA 2G2QA 4TR1B 3ERFA 3L4NA 4ECCA 2E7PA 1H75A 4NV5A 5D73A 2IPAA 5D96A 2KP1A 5J41A 4FO5A 3F3RA 3WD6A 3D4TA 2GDRA 1WOUA 3VWVA 2H30A 5C04A 3QAVA 4KDYA 3MYDA 1ACVA 19GSA 1TDIA 5IO0A 1VF2A 3M3MA 2CAIA 4RQRA 4EXJA 4ECJA 3KP8A 1DSBA 4XS6A 2B6MA 3GSSA 2L4CA 1PKWA 2DMLA 5B8AA 1C72A 1K3LA 2YJ7A 1XOAA 3R3EA 3VPTA 4TR4A 2O7KA 5G31A 1GH2A 1F37A 3UMAA 2L59A 1OE8A 2PU9C 3A2WA 1VF4A 3GA4A 3VWWA 1HD2A 3LORA 3KGKA 1YF0A 4EDZA 1XW9A 1UVZA 5KN3A 5A4UA 2IL3A 2CVKA 5D9TA 4ZL8A 2R0GA 3MDKA 5IMVA 2GT6A 1DE2A 2XPDA 1URMA 4MPFA 3VLNA 4PTSA 2RUEA 4FYCA 4O7HA 2R3XA 1GSFA 4WBRD 4BVXB 5D8IA 4HOJA 2L5OA 2GSQA 5IOWA 4POMA 2DBCA 3F6FA 5AISA 5ECIB 2KP2A 3QOUA 3BCKA 2X8HA 3GV1A 3GIXA 2L6DA 5EVOA 4RQXA 4XS1A 4EKZA 3VURA 5HR0A 4NHWA 1XZOA 3TKSC 1U3AA 3IR4A 1DBYA 1QMVA 1XIYA 3C7MA 4N11A 3F9UA 1BX9A 4ACSA 4G19A 2LRTA 1B4QA 1X5CA 3KJYA 4DSSB 3RAZA 2H6XA 2VCZA 4TXOB 2JL4A 3DYRA 2CA8A 4WETA 2HI7A 3E3EA 4E8EA 1EEMA 4POKA 4MF5A 3J7Yb 2PBJA 1SK1A 1RK4A 4CY8A 1BAYA 4OFMA 1NM3A 3TOUA 2XPEA 6GSUA 4L0UA 4WR4A 3MSZA 4Z2TA 3VI7A 1JZOA 2LEGA 1RQMA 2FWGA 1B8XA 3UBLA 3MNGA 2OKAA 1ML6A 3VWUA 3TRPA 3D0ZA 4N10A 5CREA 3M9JA 1M99A 3TJFA 3EU3A 2VCVA 17GSA 2H8LA 2C0FA 1TI3A 2AAWA 1MTCA 4MF7A 5IPHA 4H86A 3IK7A 2LRCA 1T00A 3U6VA 3D6IA 1SKRB 1G7OA 2HFDA 4IELA 5JWOB 2FWFA 2H76A 3VI5A 2K8VA 1LU4A 5F07A 3UBKA 3IHQA 3Q19A 1TRUA 3M0FA 1MD4A 4GQFA 2GZZA 5G30A 3WGXA 12GSA 3LXZA 5HR1A 2H1AA 1ZCPA 4YH2A 4EUYA 1X9WB 4WEYA 3TUEA 2NVLA 2KOKA 2V6KA 1U3IA 3FRCA 2MZCA 3UVHA 1G6YA 3KXOA 2VO4A 2H6ZA 3A3TA 1WRYA 2C3TA 14GSA 4IGJA 2HRFA 2DKHA 1GLQA 3C71A 3A2XA 2P5RA 5DAKA 1SJIA 3IRAA 4J57E 4MLYA 2X4AA 2PGTA 1FOHA 3FEUA 4Z7XA 4KUNA 2DC5A 4YQUA 4L5OA 2GSTA 5HR2A 4HS1A 1HNBA 3HD5A 3NOFA 4HZ2A 1K3YA 1PX7A 4JU5A 3QFBC 4V2MA 5F06A 1X9MB 1XWBA 2DLXA 5E59A 1QGVA 3EMPA 4PQHA 2PN8A 1UN2A 4OFTA 4EC0A 1XWKA 1EV9A 1GUMA 2KHPA 4NAXA 5A4WA 3DD3A 2R0CA 1W89A 3H1NA 1R5AA 2WRTA 1HNAA 1ZYPA 4AJ7A 2HRAA 3IHGA 3DEXA 2IFQA 3ERWA 1M2AA 5DJLA 4WKWA 3TOTA 4ML1A 1K3OA 1UC7A 3P7XA 3M8NA 1HNCA 4OO4A 2OBIA 4BVYA 3IE3A 4ZB8A 5ENUA 2GVPA 1GSUA 1TP9A 1I5GA 3BD2A 1TXXA 1OAZA 4NPBA 3VPQA 3TDGA 2DJKA 1KNGA 4QQ7A 4ZL9A 1YY7A 2H19A 2O8VB 4JZQA 1O85A 2H1GA 3DWVA 2YCDA 5ECPB 4PUAA 4MPGA 1V2AA 3N9JA 3ME8A 3US3A 2X8CA 3DIEA 1TRVA 2QGVA 2LRNA 2O89A 1VRSD 3TGZA 1ZZYA 2HYXA 1K0MA 2DMMA 2IN3A 1GSYA 5CRGA 4PX1A 1E6BA 5CO3A 3U5RE 4MJBA 4IQAA 4Q5FA 4KB3A 2WB9A 4GQCA 1Y25A 2H66A 5F8BA 2RIIA 3W8JA 1YKAA 2H0GA 5ID2A 5AGYA 2AV4A 4V2NA 4ID0A 3NIVA 4TR3A 4DEJA 1TU8A 2OE3A 5CYYA 2C3NA 5J3RA 3VK9A 1ZYNA 1XPVA 3QAGA 3CRUA 1M2DA 4TR0A 11GSA 5E4WA 1JLWA 1FB6A 1SYXA 2DIYA 2ZNMA 3CBUA 1ERWA 1R4WA 5ID2B 4WBJA 5AIVA 1O81A 2X64A 4I5QA 4F9ZA 4K7IA 3TCOA 2LS5A 1YDKA 4O92A 1SJZA 1K0AA 3QD9A 1EEJA 2XC2A 1XVQA 3CTGA 3EYTA 3KIJA 4HU9A 1M7TA 3F4RA 2DJJA 1V9WA 3KMOA 1R26A 1T4ZA 3HJMA 4LL4B 2WFCA 4TN8A 5LNKe 2JACA 3QAWA 7GSSA 3CSJA 2TRXA 1KBNA 3R2QA 2CZ2A 4YQVA 4YAPA 2C80A 1EOGA 3UL3A 3GNJA 1XBSA 4A5PA 2MMNA 3TKSA 2K18A 3KZQA 5ECSA 4BWQA 2YZHA 4YKGA 3TRQA 4F0BA 3GHAA 4MNNA 4TVEA 2QA2A 4IJ3A 1K0BA 4G0LA 1VGLA 5FT3A 1QUWA 1T3BA 1XCCA 3J7Yk 1SKWB 1JZDA 3TJKA 3IOSA 5HFKA 1CQGA 3FYGA 3IV4A 4ZL7A 2YWNA 4WF5A 2I81A 4GTUA 1Z6MA 2A2SA 1Z9HA 3JCML 2IMDA 5ECNB 1EGRA 2DJ3A 2DIZA 3HJPA 1F2EA 4TR1A 4ECIA 5LD0A 4E8HA 2B7JA 4FYUA 4TOPA 5FWGA 4L5LA 1Z7RA 2HZEB 1FO5A 3APOA 2HNLA 3E9JB 3C1RA 3ZL5A 5A4VA 4F0CA 2OACA 2ZCTA 4KAEA 2IIYA 4FH8A 2L4QA 5HFGA 4X0XA 2C0GA 2EIRA 2RLIA 4KDXA 4BPYA 1OC3A 5J5NA 3EMXA 4AJ8A 1A0RP 5H5QA 6GSSA 1ILOA 4NXIA 2F8FA 3WYWA 2N5AA 3HVXA 2EIQA 4WR5A 1O6JA 2QSIA 2EIOA 3FR6A 1SL1B 1FB0A 1SJ6A 1A8YA 3DVWA 1GL8A 2H73A 4KSMA 1M2BA 2B1LA 3GKXA 3EC3A 3HDCA 2FY6A 2VUPA 4BVXA 4ULXA 3SWLA 1BJXA 2HSHA 3ISOA 2O85A 2GQKA 3MAKA 1EWXA 5ELAA 1T4YA 2VLVA 1I9DA 2FD3A 1M9BA 5IO2A 4K0GA 3BJ5A 3I9V2 3ZITA 1XWCA 3GTUB 4MCUA 4KH7A 3M9KA 4IS0A 4HQZA 2H70A 3MWHA 4DVCA 1FOVA 3KP9A 1AIUA 1XWAA 4I2UA 2FA4A 2AHEA 2LUSA 2CT6A 2GLRA 2N5FA 3ZVJA 3Q18A 3FR3A 4ZBDA 4DSSA 1OE7A 2B3SA 2X99A 4TXOA 3LQ7A 2PVQA 2KUCA 3IC4A 2V2GA 3BCIA 1GSQA 2GSSA 5HFIA 5IMCA 2GT5A 2OBKA 1U6TA 5INYA 4QL7A 2GSRA 2MBTA 4MJAA 4FIWA 2VD1A 5J4UA 2FA8A 2CAQA 2K6VA 2I1UA 2K9FA 2Z9SA 3EPTA 4TXVA 5DDLA 4Q5NA 3GN3A 4GSTA 1IYIA 4ZBBA 3GURA 1GTBA 2FWHA 9GSSA 5G5EA 4BA7A 1J08A 1O8WA 2LQQA 1T1VA 3H8QA 5G1KA 4EIPA 2HXKA 2LTKA 4HI7A 2VLTA 4KE3A 3IK9A 3UARA 1ERUA 2GZPA 3S9FA 3PR8A 2F8AA 3RHCA 3QCPA 3VFIA 2LNTA 4D73B 3TKPA 4ML6A 3CSHA 1X0RA 3WGDA 3KH9A 1AXDA 2EC4A 2RM6A 1PRXA 3W6GA 3UAPA 3GX0A 2ES7A 1ZGNA 3ZTLA 4KA0A 4X1UA 4MK3A 1NHOA 4O5UA 1B9XC 4QL9A 5ECHB 2YZUA 3F8UA 1SYRA 3UEMA 1N8JA 1W4VA 3LWAA 4GLTA 5IMDA 2H1DA 2YPMA 3TKQA 2H75A 3KEBA 2V41A 5CAXA 2FUG2 3DXBA 3ZVJD 1CQHA 4OWYA 5J9BA 3IPZA 2RM5A 2GTUA 4GRFA 2AJQB 4KNDA 3ZIJA 1DE1A 3RPNA 2YWIA 1GTUA 2JZTA 2PMTA 4ISDA 2FNOA 2X49A 1G7EA 2QA1A 4JBBA 5H5RA 2N5BA 2O87A 3ZZXA 2J23A 1GSEA 3APSA 2IMEA 1VF3A 2L57A 3G9BA 5C00A 2REMA 3I6AA 1OC8A 4K7NA 3TKRA 1KTEA 1BQ7A 2CZ3A 1SL2B 5IOXA 1ZOFA 4RI6A 5JWRB 2H71A 2I9HA 5B6NA 2H6YA 4GXZA 2PVOC 1K0OA 20GSA 3DMLA 1SD9A 5G5FA 4GSNA 4ZXGA 4XHMA 1S3DA 4K9ZA 5EY6A 1BG5A 3KCMA 2AUVA 4CW9A 2A2PA 4IP1A 4K0NA 1PN9A 3P2AA 1A24A 4F82A 2UZ8A 4WXTA 2KLXA 5F0GA 4IP6A 4ZIJA 3ZLPA 4J2FA 5CRDA 3H79A 2E2GA 5GZZB 3L9UA 5DJMA 1FVKA 2HLSA 1EP7A 2C4JA 22GSA 2LQOA 5GSSA 5DQSA 2BJXA 5IQYA 1TK8B 3FZ4A 16GSA 3ZIVA 1Z5YE 3F4SA 1GP1A 1TTZA 1EV4A 4PNGA 4KSOA 1YF1A 3ZYWA 1AAZA 3Q74A 2ZUPA 3HHVA 4V1Ag 5EPFA 2L6CA 3QMXA 3WT2A 1X5EA 3IC8A 1GLPA 2VL2C 6GSVA 4G0IA 3I43A 4RI7A 5IMAA 4ZB9A 4N0VA 4XS4B 1PN0A 1GUKA 1AQXA 3ERGA 2B1KA 3KD0A 2QKEA 2H74A 4ZBAA 2DJ1A 2H0HA 4I97A 2ON5A 2R6KA 4HEA2 1WIKA 3PH9A 1YQ1A 1GULA 4HUAA 1E2YA 4GF0A 1XXUA 3F63A 1ZL9A 1V58A 3RDWA 1TK0B 3HZ4A 4IKHA 3DKSA 2CX3A 2FHEA 4MF6A 4MA9A 4K7OA 1OC9B 3G7JA 1ZYQB 1TKDB 2VLUA 1G6WA 2C8UA 1ZYEA 13GSA 2C1YA 4LMVA 4V2LA 1NSWA 3OR5A 6GSWA 3FZ9A 4YKFA 3GH6A 5G2ZA 4P3YB 2WDUA 2XBQA 4O5QA 1MDIA 1A8LA 1DUGA 4IHUA 2NBSA 5G1LA 4PQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4O A;  5ECK B;  1GUH A;  2PER A;  1K0C A;  2YP6 A;  2MMO A;  4POB A;  1TRW A;  3P90 A;  2MYG A;  4ECB A;  5F05 A;  3GKM A;  2NTO A;  2MMZ A;  2R5G A;  1TRS A;  4DSQ A;  2JU5 A;  1UA5 A;  1JHB A;  4EVM A;  4EDY A;  1X5D A;  3ZFL A;  3FZA A;  5ECR B;  3BOA A;  3D5J A;  3HKR A;  3EE2 A;  3O76 A;  6GST A;  1EOH A;  3Q6O A;  1EP8 A;  2OA7 A;  3F0I A;  3F3Q A;  1NHY A;  4OO5 A;  2FLS A;  2IMI A;  3D4M A;  1TI1 A;  2LJA A;  4WF4 A;  4K6X A;  4XTS A;  3FW2 A;  1N2A A;  3RBT A;  3GX8 A;  4CHS A;  2OE0 A;  1R5P A;  3F6D A;  4MJE A;  1F9M A;  4J56 E;  4JR6 A;  4OFN A;  2P0G A;  2HZE A;  3IAS 2;  2JZS A;  3E0U A;  2R2J A;  5COH A;  5IM9 A;  4AGS A;  8GSS A;  3D21 A;  4PUF C;  3APQ A;  5DAL B;  1SK0 A;  1MDK A;  1THX A;  5JCW A;  3DGQ A;  2JSZ A;  4KW6 A;  4NMU A;  5IPG A;  4F2I A;  2BTO T;  5HR3 A;  2P5Q A;  1XOB A;  2C0D A;  3EWL A;  3KH7 A;  1PQN A;  3A5W A;  1WWJ A;  3G7I A;  2A2R A;  5DVB A;  3F4T A;  2WZ9 A;  1ABA A;  2D2Z A;  1PD2 1;  2GZY A;  3IAM 2;  3ZRD A;  4ZB6 A;  3K8N A;  3LFL A;  3WT1 A;  3GMF A;  5DQY A;  4HDE A;  2TRC P;  4DSR A;  3N5O A;  4CDO A;  2VOC A;  3GST A;  4GSS A;  2H0I A;  2A4V A;  2DJ0 A;  3GTU A;  2M46 A;  1B48 A;  4I6X A;  4JE1 A;  4PQI A;  2LJR A;  2B5X A;  4K1F A;  3L0H A;  1MDJ A;  1LBK A;  3TJG A;  1XW6 A;  1SEN A;  1YZX A;  5DBQ A;  4KDU A;  2HRN A;  1Q98 A;  2GQM A;  1AQV A;  5GAN D;  2XBI A;  3LGC A;  3CTF A;  3GKK A;  2F3M A;  4AJ6 A;  2H72 A;  4MAB A;  1YJ6 A;  3GUS A;  10GS A;  4G10 A;  4X43 A;  4N0Z A;  4POL A;  4I2T A;  4K2D A;  1G0T A;  3C8E A;  1F6M C;  1JFU A;  2E2M A;  2WUL A;  4K8M A;  2F51 A;  4F03 A;  4Q5R A;  2BMX A;  3EIN A;  3HY2 A;  2R4V A;  3FR9 A;  4OD7 A;  2IMF A;  4LL1 B;  1FHE A;  4IW9 A;  4GWR A;  4PXO A;  1PA3 A;  2B7K A;  2XHF A;  1T8E B;  5D93 A;  5ECO B;  3L9S A;  5DCH A;  2VCW A;  1WJK A;  2GQL A;  2OJL A;  1Z3E A;  1R7H A;  2QC7 A;  3TRX A;  5B8B A;  3P8W A;  1ST9 A;  1QFN A;  2L5L A;  4EF0 A;  4LLR A;  3EUR A;  3GRX A;  2VM2 A;  2OE1 A;  4OCE A;  1O73 A;  4L0W A;  1M0U A;  2VD0 A;  1FAA A;  1GSD A;  2YWM A;  1TU7 A;  5AIX A;  1AC1 A;  4D73 A;  1YEX A;  4LA1 A;  1SK2 A;  4BWS A;  4HZ4 A;  1YEP A;  3GYK A;  2VL2 A;  3IDV A;  2JAD A;  1RW1 A;  4O5R A;  3HVV A;  1FG4 A;  2HZF A;  5B7C A;  5LCZ A;  2GGT A;  1EGO A;  3H4K A;  1KEB A;  5ECQ B;  4YQM A;  3KTB A;  3LYK A;  3M1G A;  3UJ1 A;  4KCA A;  1PL1 A;  1PL2 A;  2FWE A;  1FW1 A;  1XFL A;  3WGE A;  2WGR A;  2VM1 A;  4FYB A;  2CX4 A;  1ON4 A;  2FGX A;  1OKT A;  4JRR A;  2YWO A;  3A2V A;  4HJM A;  2J9H A;  1U87 A;  4IBP A;  3TJJ A;  4MP4 A;  1U88 A;  2YV7 A;  2V6O A;  5CRW A;  1A2M A;  3DRN A;  4MMM A;  1USB A;  3LSZ A;  5IMF A;  1A2L A;  1Z7P A;  5B6M A;  1AUC A;  3D22 A;  2YN1 A;  3ZMK A;  1GTI A;  3EVI A;  5KN2 A;  3W8S A;  1Q4J A;  2PWJ A;  4L8E A;  3GH9 A;  1K0D A;  3IBH A;  3LJR A;  3ED3 A;  5AN1 A;  3AY8 A;  3ME7 A;  4HJ2 A;  4N30 A;  3PGT A;  1TJD A;  2I4A A;  2LNS A;  2C0E A;  5KN0 A;  2MBS A;  4MH3 A;  1AW9 A;  1YKC A;  3QFA C;  1PSQ A;  1PKZ A;  2PUK C;  4BL7 A;  2VCT A;  2YV9 A;  2YAN A;  5IIZ A;  3QR6 A;  5DCG A;  2E0Q A;  1HYU A;  1EZK A;  1JZR A;  1XVW A;  4IN0 A;  1GRX A;  5J9C A;  1PX6 A;  1M9A A;  4O32 A;  1GTA A;  1GWC A;  3CMI A;  1MEK A;  2WS2 A;  1MD3 A;  3HYP A;  3CRT A;  3L9V A;  1SL0 B;  3HCZ A;  1TOF A;  1BED A;  1TK5 B;  1ERT A;  1WMJ A;  4G9H A;  4IVF A;  4KX4 A;  4MJC A;  4HU7 A;  2YNX A;  5JCG A;  3SBC A;  2B5E A;  3C1S A;  3IA1 A;  3O3T A;  4LMW A;  3BBY A;  1THO A;  3FK8 A;  2VL3 A;  4XRD A;  5DAK B;  4TRX A;  2R37 A;  5D9V A;  1QQ2 A;  1LJR A;  18GS A;  4KCE A;  3TKS E;  5GAP D;  1ERV A;  2JZR A;  5ECL B;  1J0F A;  2LKU A;  1XWG A;  1O8X A;  2OAD A;  1FVJ A;  4YAV A;  1A0F A;  1F3B A;  2M80 A;  5H5S A;  2VIM A;  4JED A;  4XS4 A;  2ALB A;  4NHZ A;  1Y6E A;  2AB6 A;  2CVB A;  1IYH A;  2PPT A;  1BYE A;  4RUV A;  3FKF A;  3TB2 A;  2K8S A;  4ILF A;  2YJH A;  2VAF A;  3GL3 A;  1GNW A;  1B4P A;  3GL5 A;  2V1M A;  5JCU A;  3NZN A;  1OKD A;  1V57 A;  1GSS A;  2HT9 A;  2DSA A;  4AF2 A;  1ZMA A;  2IFQ B;  5CRH A;  2ON7 A;  2GS3 A;  3H93 A;  1QK8 A;  2IJY A;  2C3Q A;  3C73 A;  3LG6 A;  1K0N A;  1OC9 A;  4JR4 A;  4XCS A;  4NWY A;  2IWT A;  3HJO A;  3HXS A;  2M72 A;  3ZML A;  4G2E A;  2CQ9 A;  1A23 A;  3UVT A;  3GFK A;  4TW5 A;  2H01 A;  3HZ8 A;  4V1A p;  4XRA A;  3G7Y A;  2LV3 A;  4EL1 A;  1T7P B;  3KMN A;  5IMZ A;  3FHK A;  2YOI A;  5D9X A;  3EU4 A;  2HSY A;  3ZRE A;  2LST A;  4IJI A;  3PIN A;  2F9S A;  1SKS B;  1SU9 A;  5ABR A;  2G0F A;  3O6T A;  4EO3 A;  4MDC A;  4MZC A;  1S3C A;  1PMT A;  4OMV A;  4ZIL A;  1J9B A;  2X8G A;  3FY7 A;  3ZFB A;  2P31 A;  1HQO A;  2VCQ A;  2AYT A;  5KN1 A;  1JLV A;  4MZW A;  1WPI A;  4Q5Q A;  2I3Y A;  1JZW A;  4GCI A;  2RUF A;  4NV2 A;  3VWX A;  2JSY A;  3KTL A;  1B9Y C;  4MZB A;  4PGT A;  2CVD A;  2LJK A;  2NDO A;  4PNF A;  4PUR A;  5A5K A;  3LXT A;  1TW9 A;  5GST A;  2CV4 A;  2IMK A;  3IXR A;  4I8B A;  4KGI A;  2V32 A;  1F3A A;  3RHB A;  2B5Y A;  1V40 A;  5L71 A;  2WJU A;  4OCF A;  3QPM A;  4IQ1 A;  2WCI A;  5KEJ A;  2HE3 A;  4HQS A;  4XIH A;  3QDN A;  2H1B A;  3DVX A;  5EL8 A;  1V98 A;  1O7U A;  4EE0 A;  1AQW A;  5ELG A;  3HVS A;  5HQP A;  4MH2 A;  5FHI A;  5DAL A;  3CYN A;  1VF1 A;  5ECM B;  5CP1 A;  2VL9 A;  5CNW A;  2NPB A;  6GSY A;  3CXG A;  1Z6N A;  6GSX A;  1X9S B;  1WE0 A;  3I69 A;  1XW5 A;  1A2J A;  1GNE A;  3FZ5 A;  2MMA A;  3UIW A;  2TIR A;  3CSI A;  5JWQ B;  2VCX A;  3L78 A;  4TKY A;  1OVN A;  2DJ2 A;  3RPP A;  1SD8 A;  1S3A A;  3LYP A;  1QXH A;  3TJB A;  3KM6 A;  5D9W A;  1NW2 A;  3HA9 A;  1WP0 A;  2FCH A;  3LEF A;  3V1W A;  3GKN A;  3UOM A;  1PGT A;  1OYJ A;  2G2Q A;  4TR1 B;  3ERF A;  3L4N A;  4ECC A;  2E7P A;  1H75 A;  4NV5 A;  5D73 A;  2IPA A;  5D96 A;  2KP1 A;  5J41 A;  4FO5 A;  3F3R A;  3WD6 A;  3D4T A;  2GDR A;  1WOU A;  3VWV A;  2H30 A;  5C04 A;  3QAV A;  4KDY A;  1ACV A;  19GS A;  1TDI A;  5IO0 A;  1VF2 A;  3M3M A;  2CAI A;  4RQR A;  4EXJ A;  4ECJ A;  3KP8 A;  1DSB A;  4XS6 A;  2B6M A;  3GSS A;  2L4C A;  1PKW A;  2DML A;  5B8A A;  1C72 A;  1K3L A;  2YJ7 A;  1XOA A;  3VPT A;  4TR4 A;  2O7K A;  5G31 A;  1GH2 A;  1F37 A;  3UMA A;  2L59 A;  1OE8 A;  2PU9 C;  3A2W A;  1VF4 A;  3GA4 A;  3VWW A;  1HD2 A;  3LOR A;  3KGK A;  1YF0 A;  4EDZ A;  1XW9 A;  1UVZ A;  5KN3 A;  5A4U A;  2IL3 A;  2CVK A;  5D9T A;  4ZL8 A;  3MDK A;  5IMV A;  2GT6 A;  1DE2 A;  2XPD A;  1URM A;  4MPF A;  3VLN A;  2RUE A;  4FYC A;  4O7H A;  2R3X A;  1GSF A;  4WBR D;  5D8I A;  4HOJ A;  2L5O A;  2GSQ A;  5IOW A;  4POM A;  2DBC A;  3F6F A;  5AIS A;  5ECI B;  2KP2 A;  3QOU A;  3BCK A;  2X8H A;  5EVO A;  3GV1 A;  2L6D A;  3GIX A;  4RQX A;  4XS1 A;  4EKZ A;  3VUR A;  5HR0 A;  4NHW A;  1XZO A;  3TKS C;  1U3A A;  3IR4 A;  1DBY A;  1QMV A;  1XIY A;  3C7M A;  4N11 A;  3F9U A;  1BX9 A;  4ACS A;  4G19 A;  2LRT A;  1B4Q A;  1X5C A;  3KJY A;  4DSS B;  3RAZ A;  2H6X A;  2VCZ A;  4TXO B;  2JL4 A;  3DYR A;  2CA8 A;  4WET A;  2HI7 A;  3E3E A;  4E8E A;  1EEM A;  4POK A;  4MF5 A;  3J7Y b;  2PBJ A;  1SK1 A;  1RK4 A;  1BAY A;  4OFM A;  1NM3 A;  3TOU A;  2XPE A;  6GSU A;  4L0U A;  4WR4 A;  3MSZ A;  3VI7 A;  1JZO A;  2LEG A;  1RQM A;  2FWG A;  1B8X A;  3UBL A;  3MNG A;  2OKA A;  1ML6 A;  3VWU A;  3TRP A;  3D0Z A;  4N10 A;  5CRE A;  3M9J A;  1M99 A;  3TJF A;  3EU3 A;  2VCV A;  17GS A;  2H8L A;  2C0F A;  1TI3 A;  2AAW A;  1MTC A;  4MF7 A;  5IPH A;  4H86 A;  3IK7 A;  2LRC A;  1T00 A;  3U6V A;  3D6I A;  1SKR B;  1G7O A;  2HFD A;  4IEL A;  5JWO B;  2FWF A;  2H76 A;  3VI5 A;  2K8V A;  1LU4 A;  5F07 A;  3UBK A;  3IHQ A;  3Q19 A;  1TRU A;  3M0F A;  1MD4 A;  4GQF A;  2GZZ A;  5G30 A;  3WGX A;  12GS A;  3LXZ A;  5HR1 A;  2H1A A;  1ZCP A;  4YH2 A;  4EUY A;  1X9W B;  4WEY A;  3TUE A;  2NVL A;  2KOK A;  2V6K A;  1U3I A;  3FRC A;  2MZC A;  3UVH A;  1G6Y A;  3KXO A;  2VO4 A;  2H6Z A;  3A3T A;  1WRY A;  2C3T A;  14GS A;  4IGJ A;  2HRF A;  1GLQ A;  3C71 A;  3A2X A;  2P5R A;  5DAK A;  1SJI A;  3IRA A;  4J57 E;  4MLY A;  2PGT A;  3FEU A;  4Z7X A;  4KUN A;  2DC5 A;  4YQU A;  4L5O A;  2GST A;  5HR2 A;  4HS1 A;  1HNB A;  3HD5 A;  3NOF A;  4HZ2 A;  1K3Y A;  1PX7 A;  4JU5 A;  3QFB C;  4V2M A;  5F06 A;  1X9M B;  1XWB A;  2DLX A;  5E59 A;  1QGV A;  3EMP A;  4PQH A;  2PN8 A;  1UN2 A;  4OFT A;  4EC0 A;  1XWK A;  1EV9 A;  1GUM A;  2KHP A;  4NAX A;  5A4W A;  3DD3 A;  1W89 A;  3H1N A;  1R5A A;  2WRT A;  1HNA A;  4AJ7 A;  3DEX A;  2IFQ A;  3ERW A;  1M2A A;  5DJL A;  4WKW A;  3TOT A;  4ML1 A;  1K3O A;  1UC7 A;  3P7X A;  3M8N A;  1HNC A;  4OO4 A;  2OBI A;  4BVY A;  3IE3 A;  4ZB8 A;  5ENU A;  2GVP A;  1GSU A;  1TP9 A;  1I5G A;  3BD2 A;  1TXX A;  1OAZ A;  4NPB A;  3VPQ A;  3TDG A;  2DJK A;  1KNG A;  4QQ7 A;  4ZL9 A;  1YY7 A;  2H19 A;  2O8V B;  4JZQ A;  1O85 A;  2H1G A;  3DWV A;  2YCD A;  5ECP B;  4PUA A;  4MPG A;  1V2A A;  3N9J A;  3ME8 A;  3US3 A;  2X8C A;  3DIE A;  1TRV A;  2QGV A;  2LRN A;  2O89 A;  1VRS D;  3TGZ A;  1ZZY A;  2HYX A;  1K0M A;  2DMM A;  2IN3 A;  1GSY A;  5CRG A;  4PX1 A;  1E6B A;  5CO3 A;  3U5R E;  4MJB A;  4IQA A;  4Q5F A;  4KB3 A;  2WB9 A;  4GQC A;  1Y25 A;  2H66 A;  5F8B A;  2RII A;  3W8J A;  1YKA A;  2H0G A;  5ID2 A;  5AGY A;  2AV4 A;  4V2N A;  4ID0 A;  3NIV A;  4TR3 A;  4DEJ A;  1TU8 A;  2OE3 A;  5CYY A;  2C3N A;  5J3R A;  3VK9 A;  1XPV A;  3QAG A;  3CRU A;  1M2D A;  4TR0 A;  11GS A;  5E4W A;  1JLW A;  1FB6 A;  1SYX A;  2DIY A;  2ZNM A;  3CBU A;  1ERW A;  1R4W A;  5ID2 B;  4WBJ A;  5AIV A;  1O81 A;  2X64 A;  4I5Q A;  4F9Z A;  4K7I A;  3TCO A;  2LS5 A;  1YDK A;  4O92 A;  1SJZ A;  1K0A A;  3QD9 A;  1EEJ A;  2XC2 A;  1XVQ A;  3CTG A;  3EYT A;  3KIJ A;  4HU9 A;  1M7T A;  3F4R A;  2DJJ A;  1V9W A;  3KMO A;  1R26 A;  1T4Z A;  3HJM A;  4LL4 B;  2WFC A;  4TN8 A;  5LNK e;  2JAC A;  3QAW A;  7GSS A;  3CSJ A;  2TRX A;  1KBN A;  3R2Q A;  2CZ2 A;  4YQV A;  4YAP A;  2C80 A;  1EOG A;  3UL3 A;  3GNJ A;  1XBS A;  2MMN A;  3TKS A;  2K18 A;  3KZQ A;  5ECS A;  4BWQ A;  2YZH A;  3TRQ A;  4F0B A;  3GHA A;  4TVE A;  4IJ3 A;  1K0B A;  1VGL A;  5FT3 A;  1QUW A;  1T3B A;  1XCC A;  3J7Y k;  1SKW B;  1JZD A;  3TJK A;  3IOS A;  5HFK A;  1CQG A;  3FYG A;  3IV4 A;  4ZL7 A;  2YWN A;  4WF5 A;  2I81 A;  4GTU A;  1Z6M A;  2A2S A;  1Z9H A;  3JCM L;  2IMD A;  5ECN B;  1EGR A;  2DJ3 A;  2DIZ A;  3HJP A;  1F2E A;  4TR1 A;  4ECI A;  5LD0 A;  4E8H A;  2B7J A;  4FYU A;  4TOP A;  5FWG A;  4L5L A;  1Z7R A;  2HZE B;  1FO5 A;  3APO A;  2HNL A;  3E9J B;  3C1R A;  3ZL5 A;  5A4V A;  4F0C A;  2OAC A;  2ZCT A;  4KAE A;  2IIY A;  4FH8 A;  2L4Q A;  5HFG A;  4X0X A;  2C0G A;  2EIR A;  2RLI A;  4KDX A;  4BPY A;  1OC3 A;  5J5N A;  3EMX A;  4AJ8 A;  1A0R P;  5H5Q A;  6GSS A;  1ILO A;  4NXI A;  2F8F A;  3WYW A;  2N5A A;  3HVX A;  2EIQ A;  4WR5 A;  1O6J A;  2QSI A;  2EIO A;  3FR6 A;  1SL1 B;  1FB0 A;  1SJ6 A;  1A8Y A;  3DVW A;  1GL8 A;  2H73 A;  4KSM A;  1M2B A;  2B1L A;  3GKX A;  3EC3 A;  3HDC A;  2FY6 A;  2VUP A;  4BVX A;  4ULX A;  3SWL A;  1BJX A;  2HSH A;  3ISO A;  2O85 A;  2GQK A;  3MAK A;  1EWX A;  5ELA A;  1T4Y A;  2VLV A;  1I9D A;  2FD3 A;  1M9B A;  5IO2 A;  4K0G A;  3BJ5 A;  3I9V 2;  3ZIT A;  1XWC A;  3GTU B;  4MCU A;  4KH7 A;  3M9K A;  4IS0 A;  4HQZ A;  2H70 A;  3MWH A;  4DVC A;  1FOV A;  3KP9 A;  1AIU A;  1XWA A;  4I2U A;  2FA4 A;  2AHE A;  2LUS A;  2CT6 A;  2GLR A;  2N5F A;  3ZVJ A;  3Q18 A;  3FR3 A;  4ZBD A;  4DSS A;  1OE7 A;  2B3S A;  2X99 A;  4TXO A;  3LQ7 A;  2PVQ A;  2KUC A;  3IC4 A;  2V2G A;  3BCI A;  1GSQ A;  2GSS A;  5HFI A;  5IMC A;  2GT5 A;  2OBK A;  1U6T A;  5INY A;  4QL7 A;  2GSR A;  2MBT A;  4MJA A;  4FIW A;  2VD1 A;  5J4U A;  2FA8 A;  2CAQ A;  2K6V A;  2I1U A;  2K9F A;  2Z9S A;  5DDL A;  4TXV A;  4Q5N A;  3GN3 A;  4GST A;  1IYI A;  4ZBB A;  3GUR A;  1GTB A;  2FWH A;  9GSS A;  5G5E A;  4BA7 A;  1J08 A;  1O8W A;  2LQQ A;  1T1V A;  3H8Q A;  5G1K A;  2HXK A;  2LTK A;  4HI7 A;  2VLT A;  4KE3 A;  3IK9 A;  3UAR A;  1ERU A;  2GZP A;  3S9F A;  3PR8 A;  2F8A A;  3RHC A;  3QCP A;  3VFI A;  2LNT A;  4D73 B;  3TKP A;  4ML6 A;  3CSH A;  1X0R A;  3WGD A;  3KH9 A;  1AXD A;  2EC4 A;  2RM6 A;  1PRX A;  3W6G A;  3UAP A;  3GX0 A;  2ES7 A;  1ZGN A;  3ZTL A;  4KA0 A;  4X1U A;  4MK3 A;  1NHO A;  1B9X C;  4QL9 A;  5ECH B;  2YZU A;  3F8U A;  1SYR A;  3UEM A;  1N8J A;  1W4V A;  3LWA A;  4GLT A;  5IMD A;  2H1D A;  2YPM A;  3TKQ A;  2H75 A;  3KEB A;  2V41 A;  5CAX A;  2FUG 2;  3DXB A;  3ZVJ D;  1CQH A;  4OWY A;  5J9B A;  3IPZ A;  2RM5 A;  2GTU A;  4GRF A;  2AJQ B;  4KND A;  3ZIJ A;  1DE1 A;  3RPN A;  2YWI A;  1GTU A;  2JZT A;  2PMT A;  4ISD A;  2FNO A;  1G7E A;  4JBB A;  5H5R A;  2N5B A;  2O87 A;  3ZZX A;  2J23 A;  1GSE A;  3APS A;  2IME A;  1VF3 A;  2L57 A;  3G9B A;  5C00 A;  2REM A;  3I6A A;  1OC8 A;  4K7N A;  3TKR A;  1KTE A;  1BQ7 A;  2CZ3 A;  1SL2 B;  5IOX A;  1ZOF A;  4RI6 A;  5JWR B;  2H71 A;  2I9H A;  5B6N A;  2H6Y A;  4GXZ A;  2PVO C;  1K0O A;  20GS A;  3DML A;  1SD9 A;  5G5F A;  4GSN A;  4ZXG A;  4XHM A;  1S3D A;  4K9Z A;  5EY6 A;  1BG5 A;  3KCM A;  2AUV A;  4CW9 A;  4IP1 A;  4K0N A;  1PN9 A;  3P2A A;  1A24 A;  4F82 A;  4WXT A;  2KLX A;  5F0G A;  4IP6 A;  4ZIJ A;  3ZLP A;  4J2F A;  5CRD A;  3H79 A;  2E2G A;  5GZZ B;  3L9U A;  5DJM A;  1FVK A;  2HLS A;  1EP7 A;  2C4J A;  22GS A;  2LQO A;  5GSS A;  5DQS A;  2BJX A;  5IQY A;  1TK8 B;  3FZ4 A;  16GS A;  3ZIV A;  1Z5Y E;  3F4S A;  1GP1 A;  1TTZ A;  1EV4 A;  4PNG A;  4KSO A;  1YF1 A;  3ZYW A;  1AAZ A;  3Q74 A;  2ZUP A;  3HHV A;  4V1A g;  5EPF A;  2L6C A;  3QMX A;  3WT2 A;  1X5E A;  1GLP A;  2VL2 C;  6GSV A;  3I43 A;  4RI7 A;  5IMA A;  4ZB9 A;  4N0V A;  4XS4 B;  1GUK A;  1AQX A;  3ERG A;  2B1K A;  3KD0 A;  2QKE A;  2H74 A;  4ZBA A;  2DJ1 A;  2H0H A;  4I97 A;  2ON5 A;  2R6K A;  4HEA 2;  1WIK A;  3PH9 A;  1YQ1 A;  1GUL A;  4HUA A;  1E2Y A;  4GF0 A;  1XXU A;  3F63 A;  1ZL9 A;  1V58 A;  3RDW A;  1TK0 B;  3HZ4 A;  4IKH A;  3DKS A;  2CX3 A;  2FHE A;  4MF6 A;  4MA9 A;  4K7O A;  1OC9 B;  3G7J A;  1ZYQ B;  1TKD B;  2VLU A;  1G6W A;  2C8U A;  1ZYE A;  13GS A;  2C1Y A;  4LMV A;  4V2L A;  1NSW A;  3OR5 A;  6GSW A;  3FZ9 A;  3GH6 A;  5G2Z A;  4P3Y B;  2WDU A;  2XBQ A;  1MDI A;  1A8L A;  1DUG A;  4IHU A;  2NBS A;  5G1L A;  4PQ1 A; 
#chains in the Genus database with same CATH topology
 1H4O A;  5BMU A;  5ECK B;  1GUH A;  2PER A;  1K0C A;  2YP6 A;  2MMO A;  4POB A;  1TRW A;  3P90 A;  2MYG A;  4ECB A;  5F05 A;  3GKM A;  2NTO A;  2MMZ A;  2R5G A;  1TRS A;  4DSQ A;  2JU5 A;  1UA5 A;  1JHB A;  4EVM A;  4EDY A;  1X5D A;  3ZFL A;  3FZA A;  5ECR B;  3BOA A;  3D5J A;  3HKR A;  3EE2 A;  3O76 A;  6GST A;  1EOH A;  3Q6O A;  1EP8 A;  2OA7 A;  3F0I A;  2DKI A;  1NHY A;  3F3Q A;  4OO5 A;  2FLS A;  2IMI A;  3D4M A;  1TI1 A;  2LJA A;  4WF4 A;  4K6X A;  4XTS A;  3FW2 A;  1N2A A;  3RBT A;  4ICY A;  3GX8 A;  4CHS A;  2OE0 A;  1R5P A;  3F6D A;  4MJE A;  1F9M A;  4J56 E;  4JR6 A;  4OFN A;  2P0G A;  2HZE A;  3IAS 2;  2JZS A;  3E0U A;  2R2J A;  5COH A;  5IM9 A;  4AGS A;  8GSS A;  3D21 A;  4PUF C;  3APQ A;  5DAL B;  1SK0 A;  1MDK A;  3MIX A;  1THX A;  5JCW A;  2HSM A;  3DGQ A;  2JSZ A;  4KW6 A;  4NMU A;  5IPG A;  4F2I A;  4USS A;  2BTO T;  5HR3 A;  2P5Q A;  1XOB A;  2C0D A;  3EWL A;  3KH7 A;  1PQN A;  3A5W A;  1WWJ A;  3G7I A;  2A2R A;  5DVB A;  3F4T A;  2WZ9 A;  2R0P A;  1ABA A;  2D2Z A;  1PD2 1;  2GZY A;  3IAM 2;  3ZRD A;  4ZB6 A;  3K8N A;  3LFL A;  3WT1 A;  3GMF A;  5DQY A;  4HDE A;  2TRC P;  4DSR A;  3N5O A;  4CDO A;  2VOC A;  3GST A;  4GSS A;  4K5S A;  2H0I A;  2A4V A;  2DJ0 A;  3GTU A;  2M46 A;  1B48 A;  4I6X A;  4JE1 A;  4PQI A;  2LJR A;  2B5X A;  4K1F A;  3L0H A;  1MDJ A;  1LBK A;  3TJG A;  1XW6 A;  1SEN A;  4K5R A;  1YZX A;  4KDU A;  2HRN A;  5DBQ A;  1Q98 A;  2GQM A;  1AQV A;  5GAN D;  2XBI A;  3LGC A;  3CTF A;  4EIQ A;  3GKK A;  2F3M A;  4AJ6 A;  2H72 A;  4MAB A;  1YJ6 A;  3GUS A;  10GS A;  4G10 A;  4X43 A;  4N0Z A;  4POL A;  4I2T A;  4K2D A;  1G0T A;  3C8E A;  1F6M C;  1JFU A;  2E2M A;  2WUL A;  4K8M A;  2F51 A;  4F03 A;  4Q5R A;  2BMX A;  3EIN A;  3HY2 A;  2R4V A;  3FR9 A;  4OD7 A;  2IMF A;  4LL1 B;  1FHE A;  4IW9 A;  4GWR A;  4PXO A;  1PA3 A;  2B7K A;  2XHF A;  1T8E B;  5D93 A;  5ECO B;  3L9S A;  5DCH A;  2VCW A;  1WJK A;  2GQL A;  2OJL A;  1Z3E A;  1R7H A;  2QC7 A;  3TRX A;  5B8B A;  3P8W A;  1ST9 A;  5BRT A;  1QFN A;  2L5L A;  4EF0 A;  4LLR A;  3EUR A;  3GRX A;  2VM2 A;  2OE1 A;  4OCE A;  1O73 A;  4L0W A;  1M0U A;  2VD0 A;  1FAA A;  1GSD A;  2YWM A;  1TU7 A;  5AIX A;  1AC1 A;  4D73 A;  1YEX A;  4LA1 A;  1SK2 A;  4BWS A;  4HZ4 A;  1YEP A;  3GYK A;  2VL2 A;  3IDV A;  2JAD A;  1RW1 A;  4O5R A;  3HVV A;  1FG4 A;  2HZF A;  5B7C A;  5LCZ A;  2GGT A;  1EGO A;  3H4K A;  1KEB A;  5ECQ B;  4YQM A;  3KTB A;  3LYK A;  3M1G A;  3UJ1 A;  3FMW A;  4KCA A;  1PL1 A;  1PL2 A;  2FWE A;  1FW1 A;  1XFL A;  3WGE A;  2WGR A;  2VM1 A;  4FYB A;  2CX4 A;  1ON4 A;  2FGX A;  1OKT A;  4JRR A;  2YWO A;  3A2V A;  4HJM A;  2J9H A;  4KF9 A;  1U87 A;  4IBP A;  3TJJ A;  4MP4 A;  1U88 A;  2YV7 A;  2V6O A;  5CRW A;  1A2M A;  3DRN A;  4MMM A;  1USB A;  3LSZ A;  5IMF A;  1A2L A;  1Z7P A;  5B6M A;  1AUC A;  3D22 A;  2YN1 A;  3ZMK A;  1GTI A;  3EVI A;  5KN2 A;  3W8S A;  1Q4J A;  2PWJ A;  4L8E A;  4Z2R A;  3GH9 A;  1K0D A;  3IBH A;  3LJR A;  3ED3 A;  5AN1 A;  3AY8 A;  3ME7 A;  4HJ2 A;  4N30 A;  3PGT A;  1TJD A;  2I4A A;  2LNS A;  2C0E A;  5KN0 A;  2MBS A;  4MH3 A;  1AW9 A;  1YKC A;  3QFA C;  1PSQ A;  1PKZ A;  2PUK C;  3LW9 A;  4BL7 A;  2VCT A;  2YV9 A;  2YAN A;  4K2X A;  5IIZ A;  3QR6 A;  5DCG A;  2E0Q A;  1HYU A;  1EZK A;  1JZR A;  1XVW A;  4IN0 A;  1GRX A;  5J9C A;  1PX6 A;  1M9A A;  4O32 A;  1GTA A;  1GWC A;  3CMI A;  1MEK A;  2WS2 A;  1MD3 A;  3HYP A;  4BL7 B;  3CRT A;  3L9V A;  1SL0 B;  3HCZ A;  1TOF A;  1BED A;  1TK5 B;  1ERT A;  1WMJ A;  4G9H A;  4IVF A;  4KX4 A;  4MJC A;  4HU7 A;  2YNX A;  5JCG A;  3SBC A;  2B5E A;  3C1S A;  3IA1 A;  3O3T A;  4LMW A;  3BBY A;  1THO A;  3FK8 A;  2VL3 A;  4XRD A;  5DAK B;  4TRX A;  2R37 A;  5D9V A;  1QQ2 A;  1LJR A;  18GS A;  4KCE A;  3TKS E;  5GAP D;  1ERV A;  2JZR A;  5ECL B;  1J0F A;  2LKU A;  1XWG A;  1O8X A;  2OAD A;  1FVJ A;  4YAV A;  1A0F A;  1F3B A;  2M80 A;  5H5S A;  2VIM A;  4JED A;  4XS4 A;  2ALB A;  4NHZ A;  1Y6E A;  2AB6 A;  2CVB A;  1IYH A;  2PPT A;  1BYE A;  4RUV A;  3FKF A;  3TB2 A;  2K8S A;  4ILF A;  2YJH A;  2VAF A;  3GL3 A;  1GNW A;  1B4P A;  3GL5 A;  2V1M A;  5JCU A;  3NZN A;  4FQU A;  1OKD A;  1V57 A;  1GSS A;  3PPU A;  2HT9 A;  2DSA A;  4AF2 A;  1ZMA A;  2IFQ B;  5CRH A;  2ON7 A;  2GS3 A;  3H93 A;  1QK8 A;  2IJY A;  2C3Q A;  3C73 A;  3LG6 A;  1K0N A;  1OC9 A;  4JR4 A;  4XCS A;  4NWY A;  4BVY B;  2IWT A;  3HJO A;  3HXS A;  2M72 A;  3ZML A;  4G2E A;  2CQ9 A;  1A23 A;  3UVT A;  3GFK A;  4TW5 A;  2H01 A;  3HZ8 A;  4V1A p;  4XRA A;  3G7Y A;  2LV3 A;  4EL1 A;  1T7P B;  3KMN A;  5IMZ A;  3FHK A;  2YOI A;  5D9X A;  3EU4 A;  2HSY A;  3ZRE A;  2LST A;  4IJI A;  3PIN A;  2F9S A;  1SKS B;  1SU9 A;  1S3R A;  5ABR A;  4CY6 A;  2G0F A;  3O6T A;  4EO3 A;  4MDC A;  4MZC A;  1S3C A;  1PMT A;  4OMV A;  4ZIL A;  1J9B A;  2X8G A;  3FY7 A;  3ZFB A;  2P31 A;  1HQO A;  2VCQ A;  2AYT A;  5KN1 A;  1JLV A;  4MZW A;  1WPI A;  4Q5Q A;  2I3Y A;  1JZW A;  4GCI A;  2RUF A;  4NV2 A;  5KOW A;  3VWX A;  2JSY A;  3KTL A;  1B9Y C;  4MZB A;  4PGT A;  2CVD A;  2LJK A;  2NDO A;  4PNF A;  4PUR A;  5A5K A;  3LXT A;  1TW9 A;  5GST A;  2CV4 A;  2IMK A;  3IXR A;  4I8B A;  2A4H A;  4KGI A;  2V32 A;  1F3A A;  2HRK A;  3RHB A;  2B5Y A;  1V40 A;  4G0K A;  5L71 A;  2WJU A;  4OCF A;  3QPM A;  4IQ1 A;  2WCI A;  5KEJ A;  2HE3 A;  4HQS A;  4XIH A;  3QDN A;  2H1B A;  3DVX A;  3HVN A;  5EL8 A;  1V98 A;  1O7U A;  4EE0 A;  1AQW A;  5ELG A;  3HVS A;  5HQP A;  4MH2 A;  4X4J A;  5FHI A;  5DAL A;  3CYN A;  1VF1 A;  5ECM B;  5CP1 A;  2VL9 A;  5CNW A;  2NPB A;  6GSY A;  3CXG A;  1Z6N A;  6GSX A;  1X9S B;  1WE0 A;  3I69 A;  1XW5 A;  1A2J A;  1GNE A;  3FZ5 A;  5KOX A;  2MMA A;  3UIW A;  2TIR A;  3CSI A;  5JWQ B;  4Z2U A;  2VCX A;  3L78 A;  4TKY A;  1OVN A;  2DJ2 A;  3RPP A;  1SD8 A;  3A5I A;  1S3A A;  3LYP A;  1QXH A;  3TJB A;  3KM6 A;  5D9W A;  1NW2 A;  3HA9 A;  1WP0 A;  2FCH A;  3LEF A;  3V1W A;  3GKN A;  3UOM A;  1PGT A;  1OYJ A;  2G2Q A;  4TR1 B;  3ERF A;  3L4N A;  4ECC A;  2E7P A;  1H75 A;  4NV5 A;  5D73 A;  2IPA A;  5D96 A;  2KP1 A;  5J41 A;  4FO5 A;  3F3R A;  3WD6 A;  3D4T A;  2GDR A;  1WOU A;  3VWV A;  2H30 A;  5C04 A;  3QAV A;  4KDY A;  4HSC X;  3MYD A;  1ACV A;  19GS A;  1TDI A;  5IO0 A;  1VF2 A;  3M3M A;  2CAI A;  4RQR A;  4EXJ A;  4ECJ A;  3KP8 A;  1DSB A;  4XS6 A;  2B6M A;  3GSS A;  2L4C A;  1PKW A;  2DML A;  5B8A A;  1C72 A;  1K3L A;  2YJ7 A;  1XOA A;  3R3E A;  3VPT A;  4TR4 A;  2O7K A;  5G31 A;  1GH2 A;  1F37 A;  4BIK A;  3UMA A;  2L59 A;  1OE8 A;  2PU9 C;  3A2W A;  1VF4 A;  3GA4 A;  3VWW A;  1HD2 A;  3LOR A;  3KGK A;  1YF0 A;  4EDZ A;  1XW9 A;  1UVZ A;  1PFO A;  5A4U A;  5KN3 A;  2IL3 A;  2CVK A;  5D9T A;  4ZL8 A;  2R0G A;  3MDK A;  5IMV A;  2GT6 A;  1DE2 A;  2XPD A;  1URM A;  4MPF A;  3VLN A;  4PTS A;  2RUE A;  4FYC A;  4O7H A;  2R3X A;  1GSF A;  4WBR D;  4BVX B;  5D8I A;  4HOJ A;  2L5O A;  2GSQ A;  5IOW A;  4POM A;  2DBC A;  3F6F A;  5AIS A;  5ECI B;  2KP2 A;  3QOU A;  3BCK A;  2X8H A;  3GV1 A;  3GIX A;  2L6D A;  5EVO A;  4RQX A;  4XS1 A;  4EKZ A;  3VUR A;  5HR0 A;  4NHW A;  1XZO A;  3TKS C;  1U3A A;  3IR4 A;  1DBY A;  1QMV A;  1XIY A;  3C7M A;  4N11 A;  3F9U A;  1BX9 A;  4ACS A;  4G19 A;  2LRT A;  1B4Q A;  1X5C A;  3KJY A;  4DSS B;  3RAZ A;  2H6X A;  2VCZ A;  4TXO B;  2JL4 A;  3DYR A;  2CA8 A;  4WET A;  2HI7 A;  3E3E A;  4E8E A;  1EEM A;  4POK A;  4MF5 A;  3J7Y b;  2PBJ A;  1SK1 A;  1RK4 A;  4CY8 A;  1BAY A;  4OFM A;  1NM3 A;  3TOU A;  2XPE A;  6GSU A;  4L0U A;  4WR4 A;  1XG8 A;  3MSZ A;  4Z2T A;  3VI7 A;  1JZO A;  2LEG A;  1RQM A;  2FWG A;  1B8X A;  3UBL A;  3MNG A;  2OKA A;  1ML6 A;  3VWU A;  3TRP A;  3D0Z A;  4N10 A;  5CRE A;  3M9J A;  1M99 A;  3TJF A;  3EU3 A;  2VCV A;  17GS A;  2H8L A;  2C0F A;  1TI3 A;  2AAW A;  1MTC A;  4MF7 A;  5IPH A;  4H86 A;  3IK7 A;  2LRC A;  1T00 A;  3U6V A;  3D6I A;  1SKR B;  1G7O A;  2HFD A;  4IEL A;  5JWO B;  2FWF A;  2H76 A;  3VI5 A;  2K8V A;  1LU4 A;  5F07 A;  3UBK A;  3IHQ A;  3Q19 A;  1TRU A;  3M0F A;  1MD4 A;  4GQF A;  2GZZ A;  5G30 A;  3WGX A;  12GS A;  3LXZ A;  5HR1 A;  2H1A A;  1ZCP A;  4YH2 A;  4EUY A;  1X9W B;  4WEY A;  3TUE A;  2NVL A;  2KOK A;  2V6K A;  1U3I A;  3FRC A;  2MZC A;  3UVH A;  1G6Y A;  3KXO A;  2VO4 A;  2H6Z A;  3A3T A;  1WRY A;  2C3T A;  14GS A;  4IGJ A;  2HRF A;  2DKH A;  1GLQ A;  3C71 A;  3A2X A;  3CQF A;  2P5R A;  5DAK A;  1SJI A;  3IRA A;  4J57 E;  4MLY A;  2X4A A;  2PGT A;  1FOH A;  3FEU A;  4Z7X A;  4KUN A;  2DC5 A;  4YQU A;  4L5O A;  2GST A;  5HR2 A;  4HS1 A;  1HNB A;  3HD5 A;  3NOF A;  4HZ2 A;  1K3Y A;  1PX7 A;  4JU5 A;  3QFB C;  4V2M A;  5F06 A;  1X9M B;  1XWB A;  2DLX A;  5E59 A;  1QGV A;  3EMP A;  4PQH A;  2PN8 A;  1UN2 A;  4OFT A;  4EC0 A;  1XWK A;  1EV9 A;  1GUM A;  2KHP A;  4NAX A;  5A4W A;  3DD3 A;  2R0C A;  1W89 A;  3H1N A;  1R5A A;  2WRT A;  1HNA A;  1ZYP A;  4AJ7 A;  2HRA A;  3IHG A;  3DEX A;  2IFQ A;  3ERW A;  1M2A A;  5DJL A;  4WKW A;  3TOT A;  4ML1 A;  1K3O A;  1UC7 A;  3P7X A;  3M8N A;  1HNC A;  4OO4 A;  2OBI A;  4BVY A;  3IE3 A;  4ZB8 A;  5ENU A;  2GVP A;  1GSU A;  1TP9 A;  1I5G A;  3BD2 A;  1TXX A;  1OAZ A;  4NPB A;  3VPQ A;  3TDG A;  2DJK A;  1KNG A;  4QQ7 A;  4ZL9 A;  1YY7 A;  2H19 A;  2O8V B;  4JZQ A;  1O85 A;  2H1G A;  3DWV A;  2YCD A;  5ECP B;  4PUA A;  4MPG A;  1V2A A;  3N9J A;  3ME8 A;  3US3 A;  2X8C A;  3DIE A;  1TRV A;  2QGV A;  2LRN A;  2O89 A;  1VRS D;  3TGZ A;  1ZZY A;  2HYX A;  1K0M A;  2DMM A;  2IN3 A;  1GSY A;  5CRG A;  4PX1 A;  1E6B A;  5CO3 A;  3U5R E;  4MJB A;  4IQA A;  4Q5F A;  4KB3 A;  2WB9 A;  4GQC A;  1Y25 A;  2H66 A;  5F8B A;  2RII A;  3W8J A;  1YKA A;  2H0G A;  5ID2 A;  5AGY A;  2AV4 A;  4V2N A;  4ID0 A;  3NIV A;  4TR3 A;  4DEJ A;  1TU8 A;  2OE3 A;  5CYY A;  2C3N A;  5J3R A;  3VK9 A;  1ZYN A;  1XPV A;  3QAG A;  3CRU A;  1M2D A;  4TR0 A;  11GS A;  5E4W A;  1JLW A;  1FB6 A;  1SYX A;  2DIY A;  2ZNM A;  3CBU A;  1ERW A;  1R4W A;  5ID2 B;  4WBJ A;  5AIV A;  1O81 A;  2X64 A;  4I5Q A;  4F9Z A;  4K7I A;  3TCO A;  2LS5 A;  1YDK A;  4O92 A;  1SJZ A;  1K0A A;  3QD9 A;  1EEJ A;  2XC2 A;  1XVQ A;  3CTG A;  3EYT A;  3KIJ A;  4HU9 A;  1M7T A;  3F4R A;  2DJJ A;  1V9W A;  3KMO A;  1R26 A;  1T4Z A;  3HJM A;  4LL4 B;  2WFC A;  4TN8 A;  5LNK e;  2JAC A;  3QAW A;  7GSS A;  3CSJ A;  2TRX A;  1KBN A;  3R2Q A;  2CZ2 A;  4YQV A;  4YAP A;  2C80 A;  1EOG A;  3UL3 A;  3GNJ A;  1XBS A;  4A5P A;  2MMN A;  3TKS A;  2K18 A;  3KZQ A;  5ECS A;  4BWQ A;  2YZH A;  4YKG A;  3TRQ A;  4F0B A;  3GHA A;  4MNN A;  4TVE A;  2QA2 A;  4IJ3 A;  1K0B A;  4G0L A;  1VGL A;  5FT3 A;  1QUW A;  1T3B A;  1XCC A;  3J7Y k;  1SKW B;  1JZD A;  3TJK A;  3IOS A;  5HFK A;  1CQG A;  3FYG A;  3IV4 A;  4ZL7 A;  2YWN A;  4WF5 A;  2I81 A;  4GTU A;  1Z6M A;  2A2S A;  1Z9H A;  3JCM L;  2IMD A;  5ECN B;  1EGR A;  2DJ3 A;  2DIZ A;  3HJP A;  1F2E A;  4TR1 A;  4ECI A;  5LD0 A;  4E8H A;  2B7J A;  4FYU A;  4TOP A;  5FWG A;  4L5L A;  1Z7R A;  2HZE B;  1FO5 A;  3APO A;  2HNL A;  3E9J B;  3C1R A;  3ZL5 A;  5A4V A;  4F0C A;  2OAC A;  2ZCT A;  4KAE A;  2IIY A;  4FH8 A;  2L4Q A;  5HFG A;  4X0X A;  2C0G A;  2EIR A;  2RLI A;  4KDX A;  4BPY A;  1OC3 A;  5J5N A;  3EMX A;  4AJ8 A;  1A0R P;  5H5Q A;  6GSS A;  1ILO A;  4NXI A;  2F8F A;  3WYW A;  2N5A A;  3HVX A;  2EIQ A;  4WR5 A;  1O6J A;  2QSI A;  2EIO A;  3FR6 A;  1SL1 B;  1FB0 A;  1SJ6 A;  1A8Y A;  3DVW A;  1GL8 A;  2H73 A;  4KSM A;  1M2B A;  2B1L A;  3GKX A;  3EC3 A;  3HDC A;  2FY6 A;  2VUP A;  4BVX A;  4ULX A;  3SWL A;  1BJX A;  2HSH A;  3ISO A;  2O85 A;  2GQK A;  3MAK A;  1EWX A;  5ELA A;  1T4Y A;  2VLV A;  1I9D A;  2FD3 A;  1M9B A;  5IO2 A;  4K0G A;  3BJ5 A;  3I9V 2;  3ZIT A;  1M3J A;  1XWC A;  3GTU B;  4MCU A;  4KH7 A;  3M9K A;  4IS0 A;  4HQZ A;  2H70 A;  3MWH A;  4DVC A;  1FOV A;  3KP9 A;  1AIU A;  1XWA A;  4I2U A;  2FA4 A;  2AHE A;  2LUS A;  2CT6 A;  2GLR A;  2N5F A;  3ZVJ A;  3Q18 A;  3FR3 A;  4ZBD A;  4DSS A;  1OE7 A;  2B3S A;  2X99 A;  4TXO A;  3LQ7 A;  2PVQ A;  2KUC A;  3IC4 A;  2V2G A;  3BCI A;  1GSQ A;  2GSS A;  5HFI A;  5IMC A;  2GT5 A;  2OBK A;  1U6T A;  5INY A;  4QL7 A;  2GSR A;  2MBT A;  4MJA A;  4FIW A;  2VD1 A;  5J4U A;  2FA8 A;  2CAQ A;  2K6V A;  2I1U A;  2K9F A;  2Z9S A;  3EPT A;  4TXV A;  5DDL A;  4Q5N A;  3GN3 A;  4GST A;  1IYI A;  4ZBB A;  3GUR A;  1GTB A;  2FWH A;  9GSS A;  5G5E A;  4BA7 A;  1J08 A;  1O8W A;  2LQQ A;  1T1V A;  3H8Q A;  5G1K A;  4EIP A;  2HXK A;  2LTK A;  4HI7 A;  2VLT A;  4KE3 A;  3IK9 A;  3UAR A;  1ERU A;  2GZP A;  3S9F A;  3PR8 A;  2F8A A;  3RHC A;  3QCP A;  3VFI A;  2LNT A;  4D73 B;  3TKP A;  4ML6 A;  3CSH A;  1X0R A;  3WGD A;  3KH9 A;  1AXD A;  2EC4 A;  2RM6 A;  1PRX A;  3W6G A;  3UAP A;  3GX0 A;  2ES7 A;  1ZGN A;  3ZTL A;  4KA0 A;  4X1U A;  4MK3 A;  1NHO A;  4O5U A;  1B9X C;  4QL9 A;  5ECH B;  2YZU A;  3F8U A;  1SYR A;  3UEM A;  1N8J A;  1W4V A;  3LWA A;  4GLT A;  5IMD A;  2H1D A;  2YPM A;  3TKQ A;  2H75 A;  3KEB A;  2V41 A;  5CAX A;  2FUG 2;  3DXB A;  3ZVJ D;  1CQH A;  4OWY A;  5J9B A;  3IPZ A;  2RM5 A;  2GTU A;  4GRF A;  2AJQ B;  4KND A;  3ZIJ A;  1DE1 A;  3RPN A;  2YWI A;  1GTU A;  2JZT A;  2PMT A;  4ISD A;  2FNO A;  2X49 A;  1G7E A;  2QA1 A;  4JBB A;  5H5R A;  2N5B A;  2O87 A;  3ZZX A;  2J23 A;  1GSE A;  3APS A;  2IME A;  1VF3 A;  2L57 A;  3G9B A;  5C00 A;  2REM A;  3I6A A;  1OC8 A;  4K7N A;  3TKR A;  1KTE A;  1BQ7 A;  2CZ3 A;  1SL2 B;  5IOX A;  1ZOF A;  4RI6 A;  5JWR B;  2H71 A;  2I9H A;  5B6N A;  2H6Y A;  4GXZ A;  2PVO C;  1K0O A;  20GS A;  3DML A;  1SD9 A;  5G5F A;  4GSN A;  4ZXG A;  4XHM A;  1S3D A;  4K9Z A;  5EY6 A;  1BG5 A;  3KCM A;  2AUV A;  4CW9 A;  2A2P A;  4IP1 A;  4K0N A;  1PN9 A;  3P2A A;  1A24 A;  4F82 A;  2UZ8 A;  4WXT A;  2KLX A;  5F0G A;  4IP6 A;  4ZIJ A;  3ZLP A;  4J2F A;  5CRD A;  3H79 A;  2E2G A;  5GZZ B;  3L9U A;  5DJM A;  1FVK A;  2HLS A;  1EP7 A;  2C4J A;  22GS A;  2LQO A;  5GSS A;  5DQS A;  2BJX A;  5IQY A;  1TK8 B;  3FZ4 A;  16GS A;  3ZIV A;  1Z5Y E;  3F4S A;  1GP1 A;  1TTZ A;  1EV4 A;  4PNG A;  4KSO A;  1YF1 A;  3ZYW A;  1AAZ A;  3Q74 A;  2ZUP A;  3HHV A;  4V1A g;  5EPF A;  2L6C A;  1M3I A;  3QMX A;  3WT2 A;  1X5E A;  3IC8 A;  1GLP A;  2VL2 C;  6GSV A;  4G0I A;  3I43 A;  4RI7 A;  5IMA A;  4ZB9 A;  4N0V A;  4XS4 B;  1PN0 A;  1GUK A;  1AQX A;  3ERG A;  2B1K A;  3KD0 A;  2QKE A;  2H74 A;  4ZBA A;  2DJ1 A;  2H0H A;  4I97 A;  2ON5 A;  2R6K A;  4HEA 2;  1WIK A;  3PH9 A;  1YQ1 A;  1GUL A;  4HUA A;  1E2Y A;  4GF0 A;  1XXU A;  3F63 A;  1ZL9 A;  1V58 A;  3RDW A;  1TK0 B;  3HZ4 A;  4IKH A;  3DKS A;  2CX3 A;  2FHE A;  4MF6 A;  4MA9 A;  4K7O A;  1OC9 B;  3G7J A;  1ZYQ B;  1TKD B;  2VLU A;  1G6W A;  2C8U A;  1ZYE A;  13GS A;  2C1Y A;  4LMV A;  4V2L A;  1NSW A;  3OR5 A;  6GSW A;  3FZ9 A;  4YKF A;  3GH6 A;  5G2Z A;  4P3Y B;  2WDU A;  2XBQ A;  4O5Q A;  1MDI A;  1A8L A;  1DUG A;  4IHU A;  2NBS A;  5G1L A;  4PQ1 A; 
#chains in the Genus database with same CATH homology
 1H4O A;  5BMU A;  5ECK B;  1GUH A;  2PER A;  1K0C A;  2YP6 A;  2MMO A;  4POB A;  1TRW A;  3P90 A;  2MYG A;  4ECB A;  5F05 A;  3GKM A;  2NTO A;  2MMZ A;  2R5G A;  1TRS A;  4DSQ A;  2JU5 A;  1UA5 A;  1JHB A;  4EVM A;  4EDY A;  1X5D A;  3ZFL A;  3FZA A;  5ECR B;  3BOA A;  3D5J A;  3HKR A;  3EE2 A;  3O76 A;  6GST A;  1EOH A;  3Q6O A;  1EP8 A;  2OA7 A;  3F0I A;  2DKI A;  1NHY A;  3F3Q A;  4OO5 A;  2FLS A;  2IMI A;  3D4M A;  1TI1 A;  2LJA A;  4WF4 A;  4K6X A;  4XTS A;  3FW2 A;  1N2A A;  3RBT A;  4ICY A;  3GX8 A;  4CHS A;  2OE0 A;  1R5P A;  3F6D A;  4MJE A;  1F9M A;  4J56 E;  4JR6 A;  4OFN A;  2P0G A;  2HZE A;  3IAS 2;  2JZS A;  3E0U A;  2R2J A;  5COH A;  5IM9 A;  4AGS A;  8GSS A;  3D21 A;  4PUF C;  3APQ A;  5DAL B;  1SK0 A;  1MDK A;  3MIX A;  1THX A;  5JCW A;  2HSM A;  3DGQ A;  2JSZ A;  4KW6 A;  4NMU A;  5IPG A;  4F2I A;  4USS A;  2BTO T;  5HR3 A;  2P5Q A;  1XOB A;  2C0D A;  3EWL A;  3KH7 A;  1PQN A;  3A5W A;  1WWJ A;  3G7I A;  2A2R A;  5DVB A;  3F4T A;  2WZ9 A;  2R0P A;  1ABA A;  2D2Z A;  1PD2 1;  2GZY A;  3IAM 2;  3ZRD A;  4ZB6 A;  3K8N A;  3LFL A;  3WT1 A;  3GMF A;  5DQY A;  4HDE A;  2TRC P;  4DSR A;  3N5O A;  4CDO A;  2VOC A;  3GST A;  4GSS A;  4K5S A;  2H0I A;  2A4V A;  2DJ0 A;  3GTU A;  2M46 A;  1B48 A;  4I6X A;  4JE1 A;  4PQI A;  2LJR A;  2B5X A;  4K1F A;  3L0H A;  1MDJ A;  1LBK A;  3TJG A;  1XW6 A;  1SEN A;  4K5R A;  1YZX A;  4KDU A;  2HRN A;  5DBQ A;  1Q98 A;  2GQM A;  1AQV A;  5GAN D;  2XBI A;  3LGC A;  3CTF A;  4EIQ A;  3GKK A;  2F3M A;  4AJ6 A;  2H72 A;  4MAB A;  1YJ6 A;  3GUS A;  10GS A;  4G10 A;  4X43 A;  4N0Z A;  4POL A;  4I2T A;  4K2D A;  1G0T A;  3C8E A;  1F6M C;  1JFU A;  2E2M A;  2WUL A;  4K8M A;  2F51 A;  4F03 A;  4Q5R A;  2BMX A;  3EIN A;  3HY2 A;  2R4V A;  3FR9 A;  4OD7 A;  2IMF A;  4LL1 B;  1FHE A;  4IW9 A;  4GWR A;  4PXO A;  1PA3 A;  2B7K A;  2XHF A;  1T8E B;  5D93 A;  5ECO B;  3L9S A;  5DCH A;  2VCW A;  1WJK A;  2GQL A;  2OJL A;  1Z3E A;  1R7H A;  2QC7 A;  3TRX A;  5B8B A;  3P8W A;  1ST9 A;  5BRT A;  1QFN A;  2L5L A;  4EF0 A;  4LLR A;  3EUR A;  3GRX A;  2VM2 A;  2OE1 A;  4OCE A;  1O73 A;  4L0W A;  1M0U A;  2VD0 A;  1FAA A;  1GSD A;  2YWM A;  1TU7 A;  5AIX A;  1AC1 A;  4D73 A;  1YEX A;  4LA1 A;  1SK2 A;  4BWS A;  4HZ4 A;  1YEP A;  3GYK A;  2VL2 A;  3IDV A;  2JAD A;  1RW1 A;  4O5R A;  3HVV A;  1FG4 A;  2HZF A;  5B7C A;  5LCZ A;  2GGT A;  1EGO A;  3H4K A;  1KEB A;  5ECQ B;  4YQM A;  3KTB A;  3LYK A;  3M1G A;  3UJ1 A;  3FMW A;  4KCA A;  1PL1 A;  1PL2 A;  2FWE A;  1FW1 A;  1XFL A;  3WGE A;  2WGR A;  2VM1 A;  4FYB A;  2CX4 A;  1ON4 A;  2FGX A;  1OKT A;  4JRR A;  2YWO A;  3A2V A;  4HJM A;  2J9H A;  4KF9 A;  1U87 A;  4IBP A;  3TJJ A;  4MP4 A;  1U88 A;  2YV7 A;  2V6O A;  5CRW A;  1A2M A;  3DRN A;  4MMM A;  1USB A;  3LSZ A;  5IMF A;  1A2L A;  1Z7P A;  5B6M A;  1AUC A;  3D22 A;  2YN1 A;  3ZMK A;  1GTI A;  3EVI A;  5KN2 A;  3W8S A;  1Q4J A;  2PWJ A;  4L8E A;  4Z2R A;  3GH9 A;  1K0D A;  3IBH A;  3LJR A;  3ED3 A;  5AN1 A;  3AY8 A;  3ME7 A;  4HJ2 A;  4N30 A;  3PGT A;  1TJD A;  2I4A A;  2LNS A;  2C0E A;  5KN0 A;  2MBS A;  4MH3 A;  1AW9 A;  1YKC A;  3QFA C;  1PSQ A;  1PKZ A;  2PUK C;  3LW9 A;  4BL7 A;  2VCT A;  2YV9 A;  2YAN A;  4K2X A;  5IIZ A;  3QR6 A;  5DCG A;  2E0Q A;  1HYU A;  1EZK A;  1JZR A;  1XVW A;  4IN0 A;  1GRX A;  5J9C A;  1PX6 A;  1M9A A;  4O32 A;  1GTA A;  1GWC A;  3CMI A;  1MEK A;  2WS2 A;  1MD3 A;  3HYP A;  4BL7 B;  3CRT A;  3L9V A;  1SL0 B;  3HCZ A;  1TOF A;  1BED A;  1TK5 B;  1ERT A;  1WMJ A;  4G9H A;  4IVF A;  4KX4 A;  4MJC A;  4HU7 A;  2YNX A;  5JCG A;  3SBC A;  2B5E A;  3C1S A;  3IA1 A;  3O3T A;  4LMW A;  3BBY A;  1THO A;  3FK8 A;  2VL3 A;  4XRD A;  5DAK B;  4TRX A;  2R37 A;  5D9V A;  1QQ2 A;  1LJR A;  18GS A;  4KCE A;  3TKS E;  5GAP D;  1ERV A;  2JZR A;  5ECL B;  1J0F A;  2LKU A;  1XWG A;  1O8X A;  2OAD A;  1FVJ A;  4YAV A;  1A0F A;  1F3B A;  2M80 A;  5H5S A;  2VIM A;  4JED A;  4XS4 A;  2ALB A;  4NHZ A;  1Y6E A;  2AB6 A;  2CVB A;  1IYH A;  2PPT A;  1BYE A;  4RUV A;  3FKF A;  3TB2 A;  2K8S A;  4ILF A;  2YJH A;  2VAF A;  3GL3 A;  1GNW A;  1B4P A;  3GL5 A;  2V1M A;  5JCU A;  3NZN A;  4FQU A;  1OKD A;  1V57 A;  1GSS A;  3PPU A;  2HT9 A;  2DSA A;  4AF2 A;  1ZMA A;  2IFQ B;  5CRH A;  2ON7 A;  2GS3 A;  3H93 A;  1QK8 A;  2IJY A;  2C3Q A;  3C73 A;  3LG6 A;  1K0N A;  1OC9 A;  4JR4 A;  4XCS A;  4NWY A;  4BVY B;  2IWT A;  3HJO A;  3HXS A;  2M72 A;  3ZML A;  4G2E A;  2CQ9 A;  1A23 A;  3UVT A;  3GFK A;  4TW5 A;  2H01 A;  3HZ8 A;  4V1A p;  4XRA A;  3G7Y A;  2LV3 A;  4EL1 A;  1T7P B;  3KMN A;  5IMZ A;  3FHK A;  2YOI A;  5D9X A;  3EU4 A;  2HSY A;  3ZRE A;  2LST A;  4IJI A;  3PIN A;  2F9S A;  1SKS B;  1SU9 A;  5ABR A;  4CY6 A;  2G0F A;  3O6T A;  4EO3 A;  4MDC A;  4MZC A;  1S3C A;  1PMT A;  4OMV A;  4ZIL A;  1J9B A;  2X8G A;  3FY7 A;  3ZFB A;  2P31 A;  1HQO A;  2VCQ A;  2AYT A;  5KN1 A;  1JLV A;  4MZW A;  1WPI A;  4Q5Q A;  2I3Y A;  1JZW A;  4GCI A;  2RUF A;  4NV2 A;  5KOW A;  3VWX A;  2JSY A;  3KTL A;  1B9Y C;  4MZB A;  4PGT A;  2CVD A;  2LJK A;  2NDO A;  4PNF A;  4PUR A;  5A5K A;  3LXT A;  1TW9 A;  5GST A;  2CV4 A;  2IMK A;  3IXR A;  4I8B A;  2A4H A;  4KGI A;  2V32 A;  1F3A A;  2HRK A;  3RHB A;  2B5Y A;  1V40 A;  4G0K A;  5L71 A;  2WJU A;  4OCF A;  3QPM A;  4IQ1 A;  2WCI A;  5KEJ A;  2HE3 A;  4HQS A;  4XIH A;  3QDN A;  2H1B A;  3DVX A;  5EL8 A;  1V98 A;  1O7U A;  4EE0 A;  1AQW A;  5ELG A;  3HVS A;  5HQP A;  4MH2 A;  4X4J A;  5FHI A;  5DAL A;  3CYN A;  1VF1 A;  5ECM B;  5CP1 A;  2VL9 A;  5CNW A;  2NPB A;  6GSY A;  3CXG A;  1Z6N A;  6GSX A;  1X9S B;  1WE0 A;  3I69 A;  1XW5 A;  1A2J A;  1GNE A;  3FZ5 A;  5KOX A;  2MMA A;  3UIW A;  2TIR A;  3CSI A;  5JWQ B;  4Z2U A;  2VCX A;  3L78 A;  4TKY A;  1OVN A;  2DJ2 A;  3RPP A;  1SD8 A;  3A5I A;  1S3A A;  3LYP A;  1QXH A;  3TJB A;  3KM6 A;  5D9W A;  1NW2 A;  3HA9 A;  1WP0 A;  2FCH A;  3LEF A;  3V1W A;  3GKN A;  3UOM A;  1PGT A;  1OYJ A;  2G2Q A;  4TR1 B;  3ERF A;  3L4N A;  4ECC A;  2E7P A;  1H75 A;  4NV5 A;  5D73 A;  2IPA A;  5D96 A;  2KP1 A;  5J41 A;  4FO5 A;  3F3R A;  3WD6 A;  3D4T A;  2GDR A;  1WOU A;  3VWV A;  2H30 A;  5C04 A;  3QAV A;  4KDY A;  3MYD A;  1ACV A;  19GS A;  1TDI A;  5IO0 A;  1VF2 A;  3M3M A;  2CAI A;  4RQR A;  4EXJ A;  4ECJ A;  3KP8 A;  1DSB A;  4XS6 A;  2B6M A;  3GSS A;  2L4C A;  1PKW A;  2DML A;  5B8A A;  1C72 A;  1K3L A;  2YJ7 A;  1XOA A;  3R3E A;  3VPT A;  4TR4 A;  2O7K A;  5G31 A;  1GH2 A;  1F37 A;  3UMA A;  2L59 A;  1OE8 A;  2PU9 C;  3A2W A;  1VF4 A;  3GA4 A;  3VWW A;  1HD2 A;  3LOR A;  3KGK A;  1YF0 A;  4EDZ A;  1XW9 A;  1UVZ A;  5KN3 A;  5A4U A;  2IL3 A;  2CVK A;  5D9T A;  4ZL8 A;  2R0G A;  3MDK A;  5IMV A;  2GT6 A;  1DE2 A;  2XPD A;  1URM A;  4MPF A;  3VLN A;  4PTS A;  2RUE A;  4FYC A;  4O7H A;  2R3X A;  1GSF A;  4WBR D;  4BVX B;  5D8I A;  4HOJ A;  2L5O A;  2GSQ A;  5IOW A;  4POM A;  2DBC A;  3F6F A;  5AIS A;  5ECI B;  2KP2 A;  3QOU A;  3BCK A;  2X8H A;  3GV1 A;  3GIX A;  2L6D A;  5EVO A;  4RQX A;  4XS1 A;  4EKZ A;  3VUR A;  5HR0 A;  4NHW A;  1XZO A;  3TKS C;  1U3A A;  3IR4 A;  1DBY A;  1QMV A;  1XIY A;  3C7M A;  4N11 A;  3F9U A;  1BX9 A;  4ACS A;  4G19 A;  2LRT A;  1B4Q A;  1X5C A;  3KJY A;  4DSS B;  3RAZ A;  2H6X A;  2VCZ A;  4TXO B;  2JL4 A;  3DYR A;  2CA8 A;  4WET A;  2HI7 A;  3E3E A;  4E8E A;  1EEM A;  4POK A;  4MF5 A;  3J7Y b;  2PBJ A;  1SK1 A;  1RK4 A;  4CY8 A;  1BAY A;  4OFM A;  1NM3 A;  3TOU A;  2XPE A;  6GSU A;  4L0U A;  4WR4 A;  3MSZ A;  4Z2T A;  3VI7 A;  1JZO A;  2LEG A;  1RQM A;  2FWG A;  1B8X A;  3UBL A;  3MNG A;  2OKA A;  1ML6 A;  3VWU A;  3TRP A;  3D0Z A;  4N10 A;  5CRE A;  3M9J A;  1M99 A;  3TJF A;  3EU3 A;  2VCV A;  17GS A;  2H8L A;  2C0F A;  1TI3 A;  2AAW A;  1MTC A;  4MF7 A;  5IPH A;  4H86 A;  3IK7 A;  2LRC A;  1T00 A;  3U6V A;  3D6I A;  1SKR B;  1G7O A;  2HFD A;  4IEL A;  5JWO B;  2FWF A;  2H76 A;  3VI5 A;  2K8V A;  1LU4 A;  5F07 A;  3UBK A;  3IHQ A;  3Q19 A;  1TRU A;  3M0F A;  1MD4 A;  4GQF A;  2GZZ A;  5G30 A;  3WGX A;  12GS A;  3LXZ A;  5HR1 A;  2H1A A;  1ZCP A;  4YH2 A;  4EUY A;  1X9W B;  4WEY A;  3TUE A;  2NVL A;  2KOK A;  2V6K A;  1U3I A;  3FRC A;  2MZC A;  3UVH A;  1G6Y A;  3KXO A;  2VO4 A;  2H6Z A;  3A3T A;  1WRY A;  2C3T A;  14GS A;  4IGJ A;  2HRF A;  2DKH A;  1GLQ A;  3C71 A;  3A2X A;  2P5R A;  5DAK A;  1SJI A;  3IRA A;  4J57 E;  4MLY A;  2X4A A;  2PGT A;  1FOH A;  3FEU A;  4Z7X A;  4KUN A;  2DC5 A;  4YQU A;  4L5O A;  2GST A;  5HR2 A;  4HS1 A;  1HNB A;  3HD5 A;  3NOF A;  4HZ2 A;  1K3Y A;  1PX7 A;  4JU5 A;  3QFB C;  4V2M A;  5F06 A;  1X9M B;  1XWB A;  2DLX A;  5E59 A;  1QGV A;  3EMP A;  4PQH A;  2PN8 A;  1UN2 A;  4OFT A;  4EC0 A;  1XWK A;  1EV9 A;  1GUM A;  2KHP A;  4NAX A;  5A4W A;  3DD3 A;  2R0C A;  1W89 A;  3H1N A;  1R5A A;  2WRT A;  1HNA A;  1ZYP A;  4AJ7 A;  2HRA A;  3IHG A;  3DEX A;  2IFQ A;  3ERW A;  1M2A A;  5DJL A;  4WKW A;  3TOT A;  4ML1 A;  1K3O A;  1UC7 A;  3P7X A;  3M8N A;  1HNC A;  4OO4 A;  2OBI A;  4BVY A;  3IE3 A;  4ZB8 A;  5ENU A;  2GVP A;  1GSU A;  1TP9 A;  1I5G A;  3BD2 A;  1TXX A;  1OAZ A;  4NPB A;  3VPQ A;  3TDG A;  2DJK A;  1KNG A;  4QQ7 A;  4ZL9 A;  1YY7 A;  2H19 A;  2O8V B;  4JZQ A;  1O85 A;  2H1G A;  3DWV A;  2YCD A;  5ECP B;  4PUA A;  4MPG A;  1V2A A;  3N9J A;  3ME8 A;  3US3 A;  2X8C A;  3DIE A;  1TRV A;  2QGV A;  2LRN A;  2O89 A;  1VRS D;  3TGZ A;  1ZZY A;  2HYX A;  1K0M A;  2DMM A;  2IN3 A;  1GSY A;  5CRG A;  4PX1 A;  1E6B A;  5CO3 A;  3U5R E;  4MJB A;  4IQA A;  4Q5F A;  4KB3 A;  2WB9 A;  4GQC A;  1Y25 A;  2H66 A;  5F8B A;  2RII A;  3W8J A;  1YKA A;  2H0G A;  5ID2 A;  5AGY A;  2AV4 A;  4V2N A;  4ID0 A;  3NIV A;  4TR3 A;  4DEJ A;  1TU8 A;  2OE3 A;  5CYY A;  2C3N A;  5J3R A;  3VK9 A;  1ZYN A;  1XPV A;  3QAG A;  3CRU A;  1M2D A;  4TR0 A;  11GS A;  5E4W A;  1JLW A;  1FB6 A;  1SYX A;  2DIY A;  2ZNM A;  3CBU A;  1ERW A;  1R4W A;  5ID2 B;  4WBJ A;  5AIV A;  1O81 A;  2X64 A;  4I5Q A;  4F9Z A;  4K7I A;  3TCO A;  2LS5 A;  1YDK A;  4O92 A;  1SJZ A;  1K0A A;  3QD9 A;  1EEJ A;  2XC2 A;  1XVQ A;  3CTG A;  3EYT A;  3KIJ A;  4HU9 A;  1M7T A;  3F4R A;  2DJJ A;  1V9W A;  3KMO A;  1R26 A;  1T4Z A;  3HJM A;  4LL4 B;  2WFC A;  4TN8 A;  5LNK e;  2JAC A;  3QAW A;  7GSS A;  3CSJ A;  2TRX A;  1KBN A;  3R2Q A;  2CZ2 A;  4YQV A;  4YAP A;  2C80 A;  1EOG A;  3UL3 A;  3GNJ A;  1XBS A;  4A5P A;  2MMN A;  3TKS A;  2K18 A;  3KZQ A;  5ECS A;  4BWQ A;  2YZH A;  4YKG A;  3TRQ A;  4F0B A;  3GHA A;  4MNN A;  4TVE A;  2QA2 A;  4IJ3 A;  1K0B A;  4G0L A;  1VGL A;  5FT3 A;  1QUW A;  1T3B A;  1XCC A;  3J7Y k;  1SKW B;  1JZD A;  3TJK A;  3IOS A;  5HFK A;  1CQG A;  3FYG A;  3IV4 A;  4ZL7 A;  2YWN A;  4WF5 A;  2I81 A;  4GTU A;  1Z6M A;  2A2S A;  1Z9H A;  3JCM L;  2IMD A;  5ECN B;  1EGR A;  2DJ3 A;  2DIZ A;  3HJP A;  1F2E A;  4TR1 A;  4ECI A;  5LD0 A;  4E8H A;  2B7J A;  4FYU A;  4TOP A;  5FWG A;  4L5L A;  1Z7R A;  2HZE B;  1FO5 A;  3APO A;  2HNL A;  3E9J B;  3C1R A;  3ZL5 A;  5A4V A;  4F0C A;  2OAC A;  2ZCT A;  4KAE A;  2IIY A;  4FH8 A;  2L4Q A;  5HFG A;  4X0X A;  2C0G A;  2EIR A;  2RLI A;  4KDX A;  4BPY A;  1OC3 A;  5J5N A;  3EMX A;  4AJ8 A;  1A0R P;  5H5Q A;  6GSS A;  1ILO A;  4NXI A;  2F8F A;  3WYW A;  2N5A A;  3HVX A;  2EIQ A;  4WR5 A;  1O6J A;  2QSI A;  2EIO A;  3FR6 A;  1SL1 B;  1FB0 A;  1SJ6 A;  1A8Y A;  3DVW A;  1GL8 A;  2H73 A;  4KSM A;  1M2B A;  2B1L A;  3GKX A;  3EC3 A;  3HDC A;  2FY6 A;  2VUP A;  4BVX A;  4ULX A;  3SWL A;  1BJX A;  2HSH A;  3ISO A;  2O85 A;  2GQK A;  3MAK A;  1EWX A;  5ELA A;  1T4Y A;  2VLV A;  1I9D A;  2FD3 A;  1M9B A;  5IO2 A;  4K0G A;  3BJ5 A;  3I9V 2;  3ZIT A;  1XWC A;  3GTU B;  4MCU A;  4KH7 A;  3M9K A;  4IS0 A;  4HQZ A;  2H70 A;  3MWH A;  4DVC A;  1FOV A;  3KP9 A;  1AIU A;  1XWA A;  4I2U A;  2FA4 A;  2AHE A;  2LUS A;  2CT6 A;  2GLR A;  2N5F A;  3ZVJ A;  3Q18 A;  3FR3 A;  4ZBD A;  4DSS A;  1OE7 A;  2B3S A;  2X99 A;  4TXO A;  3LQ7 A;  2PVQ A;  2KUC A;  3IC4 A;  2V2G A;  3BCI A;  1GSQ A;  2GSS A;  5HFI A;  5IMC A;  2GT5 A;  2OBK A;  1U6T A;  5INY A;  4QL7 A;  2GSR A;  2MBT A;  4MJA A;  4FIW A;  2VD1 A;  5J4U A;  2FA8 A;  2CAQ A;  2K6V A;  2I1U A;  2K9F A;  2Z9S A;  3EPT A;  4TXV A;  5DDL A;  4Q5N A;  3GN3 A;  4GST A;  1IYI A;  4ZBB A;  3GUR A;  1GTB A;  2FWH A;  9GSS A;  5G5E A;  4BA7 A;  1J08 A;  1O8W A;  2LQQ A;  1T1V A;  3H8Q A;  5G1K A;  4EIP A;  2HXK A;  2LTK A;  4HI7 A;  2VLT A;  4KE3 A;  3IK9 A;  3UAR A;  1ERU A;  2GZP A;  3S9F A;  3PR8 A;  2F8A A;  3RHC A;  3QCP A;  3VFI A;  2LNT A;  4D73 B;  3TKP A;  4ML6 A;  3CSH A;  1X0R A;  3WGD A;  3KH9 A;  1AXD A;  2EC4 A;  2RM6 A;  1PRX A;  3W6G A;  3UAP A;  3GX0 A;  2ES7 A;  1ZGN A;  3ZTL A;  4KA0 A;  4X1U A;  4MK3 A;  1NHO A;  4O5U A;  1B9X C;  4QL9 A;  5ECH B;  2YZU A;  3F8U A;  1SYR A;  3UEM A;  1N8J A;  1W4V A;  3LWA A;  4GLT A;  5IMD A;  2H1D A;  2YPM A;  3TKQ A;  2H75 A;  3KEB A;  2V41 A;  5CAX A;  2FUG 2;  3DXB A;  3ZVJ D;  1CQH A;  4OWY A;  5J9B A;  3IPZ A;  2RM5 A;  2GTU A;  4GRF A;  2AJQ B;  4KND A;  3ZIJ A;  1DE1 A;  3RPN A;  2YWI A;  1GTU A;  2JZT A;  2PMT A;  4ISD A;  2FNO A;  2X49 A;  1G7E A;  2QA1 A;  4JBB A;  5H5R A;  2N5B A;  2O87 A;  3ZZX A;  2J23 A;  1GSE A;  3APS A;  2IME A;  1VF3 A;  2L57 A;  3G9B A;  5C00 A;  2REM A;  3I6A A;  1OC8 A;  4K7N A;  3TKR A;  1KTE A;  1BQ7 A;  2CZ3 A;  1SL2 B;  5IOX A;  1ZOF A;  4RI6 A;  5JWR B;  2H71 A;  2I9H A;  5B6N A;  2H6Y A;  4GXZ A;  2PVO C;  1K0O A;  20GS A;  3DML A;  1SD9 A;  5G5F A;  4GSN A;  4ZXG A;  4XHM A;  1S3D A;  4K9Z A;  5EY6 A;  1BG5 A;  3KCM A;  2AUV A;  4CW9 A;  2A2P A;  4IP1 A;  4K0N A;  1PN9 A;  3P2A A;  1A24 A;  4F82 A;  2UZ8 A;  4WXT A;  2KLX A;  5F0G A;  4IP6 A;  4ZIJ A;  3ZLP A;  4J2F A;  5CRD A;  3H79 A;  2E2G A;  5GZZ B;  3L9U A;  5DJM A;  1FVK A;  2HLS A;  1EP7 A;  2C4J A;  22GS A;  2LQO A;  5GSS A;  5DQS A;  2BJX A;  5IQY A;  1TK8 B;  3FZ4 A;  16GS A;  3ZIV A;  1Z5Y E;  3F4S A;  1GP1 A;  1TTZ A;  1EV4 A;  4PNG A;  4KSO A;  1YF1 A;  3ZYW A;  1AAZ A;  3Q74 A;  2ZUP A;  3HHV A;  4V1A g;  5EPF A;  2L6C A;  3QMX A;  3WT2 A;  1X5E A;  3IC8 A;  1GLP A;  2VL2 C;  6GSV A;  4G0I A;  3I43 A;  4RI7 A;  5IMA A;  4ZB9 A;  4N0V A;  4XS4 B;  1PN0 A;  1GUK A;  1AQX A;  3ERG A;  2B1K A;  3KD0 A;  2QKE A;  2H74 A;  4ZBA A;  2DJ1 A;  2H0H A;  4I97 A;  2ON5 A;  2R6K A;  4HEA 2;  1WIK A;  3PH9 A;  1YQ1 A;  1GUL A;  4HUA A;  1E2Y A;  4GF0 A;  1XXU A;  3F63 A;  1ZL9 A;  1V58 A;  3RDW A;  1TK0 B;  3HZ4 A;  4IKH A;  3DKS A;  2CX3 A;  2FHE A;  4MF6 A;  4MA9 A;  4K7O A;  1OC9 B;  3G7J A;  1ZYQ B;  1TKD B;  2VLU A;  1G6W A;  2C8U A;  1ZYE A;  13GS A;  2C1Y A;  4LMV A;  4V2L A;  1NSW A;  3OR5 A;  6GSW A;  3FZ9 A;  4YKF A;  3GH6 A;  5G2Z A;  4P3Y B;  2WDU A;  2XBQ A;  4O5Q A;  1MDI A;  1A8L A;  1DUG A;  4IHU A;  2NBS A;  5G1L A;  4PQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...