1EH7A

Methylated human o6-alkylguanine-dna alkyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
161
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
total genus 41
structure length 161
sequence length 172
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh7A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh7A01
3RKYA 4HX8A 2P7CB 3E6BA 2EA4A 1HW1A 1RUNA 3V4GA 2L02A 1B9NA 2DQLA 2ZNYA 1SFUA 1L3LA 1XMAA 1T2KA 1TLHB 5JHUA 1ZG1A 5DCMA 4ENMA 1KU2A 4HZFA 1BI1A 1SFXA 3HRSA 4HLYA 4CXFA 4KN4X 1LJ9A 2YPRA 1YW9A 1J75A 2P5KA 2XROA 4A0XA 2VXZA 3ISPA 3ECHA 1V4RA 4MNUA 4A6EA 3KZZA 3LQRA 4E70A 5E8GA 2H27A 2G7HA 1FNNA 3ZN0A 3H3UA 1J0RA 1R23A 2XHKA 1P4AA 2DK8A 1SD6A 3WODF 3GFLA 2NYXA 4CICA 2Q8KA 5ICEA 1O7LA 2E7WA 3HRUA 3CO6C 4RGUA 2LF8A 1G3TA 1R00A 1K78A 1LB2A 2FBIA 1DDNA 1PDNC 3F6OA 1ON2A 2FE3A 2R7FA 4RGSA 3F23A 1WKMA 4U7BA 4LG0B 3CUQA 1BI3A 3E6MA 2ZFWA 3R0AA 3RI4A 1MD0A 4EJTA 3DXJF 4F7ZA 4BH9A 4FHTA 2HYFA 4EGYA 3E6CC 2ESNA 2V1UA 5TJJA 3ROUA 1MZBA 2EV5A 3W6KB 1C0WA 3CJNA 1YLFA 2EWNA 2QQ9A 4YFNF 1T39A 1D8KA 4ESFA 4IVNA 3KETA 4M73A 3WE2A 2HTSA 4G6DA 5IT3A 1BJAA 2HYGD 3HTUA 4HX7A 4B09A 3HYIA 2VBZA 2EFPA 2L54A 4M72A 3ZMVA 1FOKA 4I0BA 2R3SA 3N4MA 1D3YA 4GXOA 3JSOA 1ZLKA 1Z1DA 2ZJ2A 3VFZA 3OV8A 5D6FA 2QWWA 3FXUA 3FMQA 4DQ2A 3LA7A 2JPBA 1XB4A 2AXLA 1X3UA 2PG4A 1BOAA 4P9FA 4ENJA 1RZ4A 1H9GA 2XUBA 4ASNA 3EQLF 2QVOA 3QU6A 3GZ5A 1FBUA 4P5OA 2XV4S 2RDPA 4WCGA 2QBYA 4RAYA 3GWZA 4MTEA 5FGMA 1LNWA 1I27A 4H0EA 2QM3A 1PP8F 4R1HA 2P5LC 1TBXA 5L3GA 2UWMA 4G8XA 1XGOA 2BBYA 4PGGA 4EM2A 2QZ8A 2K4JA 3ZMUA 2WTEA 4JQFA 2KJBA 1XGSA 2ZMEB 3DKWA 3V7RA 1HW2A 2IW5A 5D5XB 2AS5F 3RYPA 5A2QK 4I0AA 2XRNA 2IPQX 2FBKA 3WGHA 3LQQA 3HSRA 4EJOA 5FFZA 2V6CA 1ZHFA 1KA8A 4JBAA 3DP7A 1ZARA 3JTHA 3K1NA 1U2WA 2V79A 2K4BA 3K1MA 4MGRA 1QZZA 3HSFA 2UXNA 4AVPA 1S7OA 5D5WB 3H92A 4HV6A 4TV7A 4LK0F 3BP8A 2DBBA 3LA3A 3DFGA 2K27A 4S04A 2IT0A 3TGNA 1UCRA 5DYMA 3IWFA 2FF4A 1YO5C 3F8BA 3DPTA 3J80Z 1VTNC 2BYVE 2CSOA 5CVJA 3VEPA 1IRFA 3DF8A 1JXSA 3VB2A 1HBXG 2F5DA 1D8JA 2NNNA 2QYOA 2VN2A 3TKYA 1TQIA 5AIQA 1IXRC 1E17A 3ULQB 5CJ9A 3GXOA 1IN7A 5L3DA 2EK5A 4JK1X 3RTRA 5FO5A 2DI3A 3WTVC 1FBSA 5CYVA 4RAZA 4KA4A 3RJPA 4HYEA 2PMUA 4XSXF 3L7WA 4A2UA 2Y0MA 5D4SA 3IHUA 4G94A 3M9AA 4Z2YA 5LGTA 2GA2A 2Q0OA 2RN7A 4UVAA 2FMLA 5HS8A 1H9TA 3TDUC 3ZP5A 4OIOF 5JFRA 1EH6A 3CO7C 2ELHA 1ZRFA 4HOBA 3BPVA 1LQ1A 2RC4A 4Q47A 4P9UA 1JGSA 3JTGA 3EUHA 3T8TA 5FD5A 5LBQA 2PQ8A 4XRFA 1QGPA 1J2XA 4XSZF 5LEJA 3L00A 4O5VA 3IC7A 4Q4ZF 4RGXA 5KK1A 5DUIA 2IJLA 2F5FA 5E20A 3OOPA 3JW4A 2JRTA 4WXHA 3V7CA 5LRSA 1LDJA 1R1VA 1U5TA 1TQPA 4IHTA 1AWCA 3I5UA 2QBYB 5D8KB 1RNLA 1I6XA 4P96A 1DP7P 2MC3A 1B1BA 5IT9K 1KU9A 4LB5A 4RB2C 2GIVA 3CUOA 1TQMA 2O0YA 3QU3A 1IAWA 2W85A 2L3DA 4NB5A 2CWEA 4G9YA 2XASA 4KN7X 1WQ2A 3KLNA 5F1RA 2V1DA 3KFWX 3HRTA 3MEXA 4LLLA 1OYIA 1F5TA 4LMYA 3F3XA 4L9TA 1K78B 3IWZA 3WTSC 1BBYA 5K5RA 2OZUA 1XSXA 2P5VA 5H6RA 1FYMA 1UB9A 2MBFA 2FU4A 4YIIA 1FX7A 3WTTC 5JI6A 4ESBA 3T1BA 1W7PB 1T98A 3C3WA 3NQOA 3BDDA 5HS9A 1CF7B 5TRDA 5E18F 1K79A 2E7XA 1R22A 1B6AA 3WTUC 2XAHA 5LRRA 1ODDA 1B9MA 3ZQ7A 3GVAA 3GUDA 4IHSA 3EYYA 4QLCU 2CG4A 3C18A 2HTJA 3ECOA 1I5ZA 5H20A 4LLGF 1GXQA 1YYVA 3TDZC 3GO5A 2EA2A 3F6VA 4A0YA 3KEOA 4UNOA 3KP7A 2FOKA 3O2PE 1YFHA 3GF2A 1STZA 1LVAA 1MJ9A 4ENNA 3IKTA 3R61A 3I64A 5HDKA 1WI9A 1SMYF 3DPLC 4A5NA 1WSUA 4I02A 1B59A 3JSPA 4BHPA 5CVVA 1LEAA 2EFOA 3ABUA 4OINF 2STTA 4I2OA 4IRGA 3FM3A 4ZYEA 3I58A 4EM1A 1DUXC 3ERED 1QNTA 2RGVA 3GZ6A 2NS0A 1IN5A 1TNTA 2K02A 1ZLJA 1XMKA 4AIHA 3E3VA 4IPAA 1EH8A 1XN7A 3SXYA 1W7PA 2VOPA 2DU9A 4N9HA 2QUFA 5FLXK 3O3KA 4M6YA 1IF1A 1LDKB 5LHHA 4BAYA 3LWFA 4HAMA 5EEHA 2VBYA 1G3SA 2HQRA 4HF0A 1S3JA 4XLPF 4I7HA 1ZYRF 3EETA 3ZMTA 5DDGA 1XSVA 3Q5FA 2YR2A 4NHJA 2NRAC 3BPXA 5ILVA 2GAUA 4BHCA 1Y0UA 2FEZA 3BY6A 2VT3A 2FMYA 2DT5A 1BM9A 1YTYA 4LD5A 2DPUA 3REOA 3B73A 5BMZA 5ED4A 1G6NA 1G4DA 4CGZA 2VODA 2L4AA 1KQ9A 3W6JB 3U9GA 3I59B 3ZMDA 1IXCA 1EH7A 5LEKA 3F72A 3BOQA 1OYYA 4YFKF 3B02A 1GXPA 2M8EA 5BOXA 2F2EA 4HF2A 1REPC 3R0JA 5FFXA 3E97A 3L2CA 3S2WA 2PLYA 1W7PD 3BZ6A 5FB2A 2H94A 1P2FA 2PJPA 4S05A 1FC3A 5D6EA 1K6OA 5HS7A 1OPCA 4WF2A 4M9SA 2MD5A 4M74A 4L9JA 2VBWA 2GQQA 2VE9A 1QBJA 1RI7A 5DUKA 4G6QA 1J7KA 1KQ0A 3M1EA 4EJWA 4EMSA 1SD5A 1SAXA 1QQIA 3KZYA 2BEOA 2JZYA 1AOYA 2HFHA 3PQJA 1ZREA 2LSOA 2OBPA 3IRRA 4CDGA 1P6RA 2ETHA 3J81K 4MTDA 4Q5SF 2DTRA 3GW2A 1J9IA 2X0LA 1IXSB 2JTVA 3CDHA 4GO1A 3WGIA 4O3MA 3D0SA 1IZ1A 4HBLA 4NQWA 3T5XA 3HSEA 2O6GE 2J5PA 3CLOA 4HLXA 3JAMZ 2CGPA 3WTXC 5J8FA 2F5CA 4RGRA 4AWXB 4ON0A 2KIMA 2RQPA 4U88A 3GLXA 5K5OA 2ESHA 2ZKZA 4R8HA 5BPIA 1ZN2A 2C6YA 4L5JA 1R1TA 4RS8A 1R1UA 3GFIA 2RV8A 5BPDA 4OMYA 1QO0D 4LLNA 4BQAA 3WE3A 2KIFA 3CTAA 2O61A 1SD4A 3F8MA 3KP5A 1F9NA 4K2EA 3QRFF 3E5QA 2ACJA 1TTYA 1R36A 1IUYA 1FP2A 1YG2A 1U5TB 1UFMA 4KUMA 4G7ZF 1HXDA 3DQVC 2DW4A 2Z33A 5EEGA 1GVJA 3L9FA 4N9IA 3BWGA 4I98B 1W5SA 5L3CA 2X4HA 3MZHA 3F22A 4ZH4F 3L09A 3QP6A 1HKQA 2V1XA 2DPDA 4RB3C 3BJ6A 3F21A 1Z9CA 4CYDA 1O57A 1ULYA 3R4KA 4BYYA 1R5GA 1U78A 3Q9SA 3PQKA 3G3ZA 4R79A 4XLNF 4WXDA 3FM5A 3V8LA 2K7LA 1B4AA 4EQQA 1Z05A 1S29A 1USTA 1MJAA 3EDPA 5CVRA 4EGZA 2E1CA 1V3FA 2V9VA 1K7AA 2GWRA 3GFJA 3WU1B 4L9NA 1JE8A 1BIBA 2IVMA 4EVIA 3E6DA 3MQ0A 4FX4A 3KE2A 3TQNA 1MKMA 4LJZF 4OIPF 1HQCA 1IN6A 4L18B 1KU3A 4IF4A 3K1PA 2E1NA 3WG9A 3JAMK 4U0YA 2DK5A 4L0YB 1BN5A 4DNCA 5HOOA 4OIQF 4L0ZB 2D1HA 3TOBA 5FD6A 3ABTA 3MFKA 1S7AA 1S8NA 2HOEA 1O3RA 2EV6A 2XAJA 2A6EF 3WTZA 4MEYF 1YW8A 5L3FA 1FP1D 2VBXA 4M9ZA 5KVRA 5DCMB 2QENA 3KEQA 3GYHX 4LFUA 2DFIA 2KIUA 1BIAA 4BHBA 2P7VB 4KIFA 4G7HF 2FRHA 4EJVA 2UZKA 2EFNA 2RNJA 1ONVA 1IRGA 2MLGA 2EB7A 5A2QZ 4PGHA 3ZMZA 4OOIA 2W24A 3KP3A 1Q1HA 5DCFA 4A5MA 2P8TA 1A04A 1FZPB 4KICA 1Z6TA 3HOTA 2EV0A 3C7JA 3KLOA 3PFIA 3SQNA 5ILUA 1TNSA 4IRIA 4WX9A 5LHGA 2DLLA 1D5VA 3FHZA 1TW3A 1U5TC 5L3BA 5AIPA 2FNPA 1WWXA 3RKWA 4HA8A 2ZXJA 3FZVA 4CO8A 1W5TA 2CW0F 1T38A 1SD7A 3U2RA 2NNYA 3M8FA 3SZTA 3TO9A 3BJOA 5LGUA 4L9VA 3Q9VA 4WXCA 2A07F 4WWCA 4AIKA 1BI0A 4I01A 2Q2EA 2YSRA 1H0MA 1QPMA 3NRVA 3TO6A 4HDVA 2L4MA 4AD9A 2XGXA 3I54A 1UHMA 1ZGJA 3M8EA 2PI0A 4HX4A 4UV9A 5DD8A 2XIGA 2OD5A 3KP2A 3HIFA 5D4RA 1KYWA 4KT5C 4KYWA 3RPUA 1R58A 1HSJA 3H3ZA 2Z5UA 1BI2A 3MWMA 2IRFG 2B0LA 2YU3A 3ELKA 4KMUX 4O6JA 3C1DA 2Z3YA 3QPHA 4IRHA 5HLGA 4BXUA 3K2ZA 1QZYA 2H6BA 2ZNZA 4ZYGA 1PUEE 3HUGA 1RUOA 5ERIA 3F8FA 4ESJA 3K69A 2KJCA 1ZGAA 2XKPA 3V8JA 3WTWC 4AIJA 2M87A 3TOAA 4M71A 1U8RA 2XKOA 3FXQA 2PBIA 5F64A 2JT1A 2LDUA 3U1DA 2A69F 2XAFA 2QLZA 2A61A 1CGPA 1FYKA 2RVCA 3QPTA 3SFZA 2ZMEA 1XCBA 4ETSA 1ZH5A 1LDDA 2PFBA 2VT2A 3M7GA 4IXAA 3GEZA 2M1BA 2LKPA 1L0OC 4MQ9F 1YS6A 3IKVA 4D0PA 2IP2A 5DV5A 3FMSA 3K9TA 1OYWA 2M30A 1IN4A 1P92A 1YQAA 2M5WA 1J5YA 4FT8A 2VONA 2GXGA 2D2WA 4UV8A 1KYZA 2QQBA 2D1VA 4Y13A 4GYIA 3GX4X 4WK8F 2OZ6A 1O7FA 5D8LB 4HV5A 3HHGA 1KQ8A 2A6HF 3P7NA 3SHFA 2BE5F 2GXBA 3T8RA 2MH9A 2YX4A 4UUVA 2G9WA 4HQEA 4U0WA 1XDUA 4HQMA 3CUQC 3GFMA 3HTSB 5ILSA 4A6DA 2KKOA 5E1XA 4MEXF 5LLQA 3BROA 1T0FA 4MHGA 4UXNA 2RKHA 4I09A 5AONA 5JVTA 3R6SA 2A5YB 2K86A 3EYIA 1XDSA 3I4PA 4RB1A 2WV0A 4FX0A 3RYRA 3P9IA 1BC7C 5D5VB 4PDKA 3RIRA 4ZZLA 3O6BB 2WWYA 3IL2A 1FSHA 3T0YA 2OU2A 2GZWA 1G3WA 5J6XA 2P6TA 4Y15A 2W84A 1XGNA 2HZTA 3FXRA 4KIGA 3NEUA 1JHFA 2P6SA 1SFEA 5HLIA 2LNBA 3KP6A 5DEQA 1MJBA 4YG2F 2O8XA 4LGWA 2FQ3A 3G73A 1FSEA 5FLXZ 4KNYA 1RIOH 5E1ZB 2LF7A 2UXXA 1T6SA 3ZPLA 2D45A 2EFQA 2Z9OA 4YIFA 1E2XA 3ML6A 2PEXA 2A3SA 5CVIA 1OKRA 3HHHA 3VOEA 4M9XA 3ZMSA 1GHCA 1MDMA 3AAFA 1XCVA 4OU0A 3D5LA 2G7UA 5LHIA 1EV7A 4IJAA 4G7OF 1JHHA 1OMIA 3P9CA 4GCVA 3LAPA 2MH2A 2Z99A 1U3EM 5F6FA 3VODA 1UHWA 3J80K 2O3FA 2CYYA 3RPQA 3SZPA 2TDXA 5HVQC 1FYLA 3P9KA 5IT9Z 3MAJA 3MCZA 4UVCA 1FBQA 5HLHA 2ADUA 2WC2A 1ON1A 4GYGA 4HW0A 5E1WA 4LG0A 4QWQA 4EM0B 3DV8A 2PMHA 1TW2A 2OA4A 4ZZDA 5CLSA 1SMTA 3IRQA 2HWVA 2OQRA 1HKSA 2KRFA 2CO5A 4LK1F 1W4MA 4ZYDA 1LEBA 4B8XA 5ICCA 2FNAA 5HDNA 4U7DA 3V7SA 4M6XA 5K1YA 2H09A 2BV6A 1O3SA 2H6CA 3LA2A 2COMA 5JR3A 4LB6B 1IN8A 1G3YA 1HSTA 4YFXF 2M45A 1J59A 3WU0A 1P4XA 1FWZA 1XSDA 2QQAA 4KIBA 3KCCA 1DPUA 1ZRCA 2R7DA 3I53A 1KU7A 2STWA 3LFKA 4P55A 1R7JA 4N0BA 3RDIA 5L3EA 6PAXA 2HEOA 1F4KA 4EJUA 5ICGA 3R60A 1S6LA 2O03A 3TO7A 1CF7A 2ZO4A 1NHAA 1OR7A 2DO7A 4ZYHA 1P4WA 2ISYA 3F8CA 4Q48A 1XD7A 1Z6RA 2CQKA 2BGCA 2HKXA 3KP4A 2HDCA 1F1ZA 2VE8A 1O3TA 3MZYA 1BC8C 1IW7F 3BJAA 1XGMA 5LGNA 4CHUA 2NAZA 3J81Z 4EV0A 3QAHA 2W25A 2OQGA 1ZRDA 2DAOA 1I1GA 2HKOA 1FT9A 3HRMA 3I0TA 4MQVA 1O3QA 5HDGA 1I1SA 4XBFA 4GGGA 1FY7A 3CUQB 2A68F 4OMZA 2ZCWA 4ENKA 4KDPA 2F5EA 1ZG5A 3J7AO 3F8NA 5DD4A 3FMRA 4BNCA 2ZBKA 1HW5A 4A0ZA 2FA5A 2XAGA 2EFWA 1Z7UA 1MDMB 3E5XA 2OAZA 2HR3A 4U0VA 3LAJA 1ZG3A 3I71A 1FPQA 3QOPA 4A12A 2IA1A 1YS7A 4PCQA 3I59A 2XVCA 4CZZA 4L5IA 2HQNA 1YW7A 2Y48A 2VC1A 2ISZA 4Y17A 2MLKA 2YX7A 3COAC 2JPCA 1U6GA 2VC0A 3E5UA 5ICFA 1USSA 5H6QA 5BS6A 4PZJA 4KMFA 5E17F 2FBHA 3FX3A 3WTYC 2P4WA 5BQTA 4UVBA 1Z91A 2VOOA 2W57A 1YIOA 2IA0A 3N97A 3WGGA 5D5UB 2FXAA 4HF1A 5J8CA 3QP5A 2PN6A 2CFXA 3HOSA 2MA3A 4UHTA 4RB0A 1PP7U 1DPRA 3FF5A 2DQRA 1FLIA 1R5HA 4OIRF 4HDUA 5E8IA 1MGTA 2J5OA 3FWEA 2HGCA 5CVUA 1ZAOA 4KFCA 2JSCA 2HS5A 3DEUA 3RKXA 2GA1A 2FSWA 2EJRA 2XAQA 1KGSA 3ZN1A 3K0LA 3V8KA 5K5QA 3LSTA 2IA2A 1HKTA 1WRJA 2L01A 2Y75A
chains in the Genus database with same CATH superfamily
4XL9A 4YEJA 1YOVB 3RKYA 4HX8A 2NOGA 2P7CB 1MMAA 3E6BA 4A3EJ 2EA4A 1Y1VJ 4M3EA 2H8RA 4LIVA 1HW1A 1LFUP 5IP7J 1RUNA 4DMIA 3BR3A 2ZFUA 3V4GA 5GTHC 1TF6A 2JN6A 4F9BB 3DCFA 5C44J 3IP4B 2L02A 4C30A 1B9NA 4J19A 2DQLA 4BQNA 2ZNYA 3FISA 1SFUA 1L3LA 3G1OA 3S3NA 1X6FA 1XMAA 5JVGF 4CUGA 1JJ6C 1T2KA 1TLHB 3KYDB 5JHUA 1ZG1A 2OJED 2FOWA 3KZIC 5DCMA 4DIQA 4R2CA 5LL6R 2CV0A 4ENMA 1KU2A 2YRMA 4HZFA 4NBQA 3S8PA 1SFKA 1HDDC 1BI1A 1SFXA 1EA3A 1X19A 4E6KG 2EN7A 1AKHB 2AQEA 3HRSA 2Y9YA 4QIWN 4HLYA 3V42A 4CXFA 5CQGA 4KN4X 2L9SA 3TQMA 1LJ9A 2YPRA 1YW9A 2ZXHA 4DOZA 1J75A 2P5KA 2XROA 4A0XA 3DPUA 2VXZA 3QYEA 2Y2ZA 2EJ4A 2ZJRF 3ISPA 3ECHA 1HNZE 3H9QA 1V4RA 4XRSG 2QA4I 2DMUA 4MNUA 2A5WA 4A6EA 3HEFA 4R2AA 2JVHA 3KZZA 3LQRA 3FBIB 4E70A 5E8GA 2H27A 2G7HA 3GTQJ 3O8GA 2M4KA 5J47A 1FNNA 5J4YA 2OC6A 3ZN0A 1MBHA 1A36A 2IBDA 1R5ID 3H3UA 4RM3A 5DS9A 2DJNA 4XR6A 4JI4E 1J0RA 1R23A 5E3MA 4RBOA 1V54H 2XHKA 1Z3YA 1OCOH 2X48A 4U87A 1P4AA 2HVSA 2DK8A 3IH2A 5M5XJ 4A3DJ 1LFPA 1SD6A 2EL5A 3WODF 3GFLA 2NYXA 1VQPI 2QF7A 4CICA 2Q8KA 3C2GA 3GTOJ 5ICEA 3Q0WA 2WBUA 3HZJA 1O7LA 4M2ZA 2E7WA 3NARA 4XOTA 3HRUA 2R7ZJ 4XK4A 1X49A 1UN6B 3CO6C 2JRMA 4RGUA 1N36E 3KPHA 4NZVA 1QRYA 1G3TA 2LF8A 5A2QC 1R00A 1T95A 1K78A 2MC4A 1RETA 1LB2A 1R4NB 2FBIA 1S72I 5IPAA 1DDNA 1U9NA 1PDNC 3F6OA 3BTIA 2EIKH 1ON2A 2FE3A 3JCUC 1RC7A 2R7FA 4RGSA 3F23A 1WKMA 2EPOA 4U7BA 4LG0B 3CUQA 4WFTA 3S2DJ 2OUMA 2DMIA 4DV5E 3GMEA 1EJ9A 3TL4X 1BI3A 3IWCA 3OMLA 3E6MA 4IOAF 3BC8A 1HC8A 1P7IA 4UUTA 2ZFWA 2WAQN 3R0AA 2JOXA 2K3FA 3RI4A 1MD0A 1VQ9I 4EJTA 2KPMA 3DXJF 4F7ZA 3K4KA 4BH9A 4FHTA 3K4LA 2HYFA 4W97A 2ID6A 3BG9A 4NDLA 4Q35B 3KYCB 4EGYA 3K4JA 3E6CC 3S17J 1I39A 2ADRA 3K6QA 1RESA 2ESNA 2V1UA 5TJJA 3ROUA 4FCYA 1MZBA 2EV5A 3W6KB 1C0WA 1G59A 3CJNA 1YLFA 2EWNA 4HNTA 2QQ9A 4YFNF 2EMXA 1T39A 1D8KA 4ESFA 1I50J 4IVNA 3J80C 3KETA 2FTXB 3ERMA 1DGCA 4M73A 2HTSA 3WE2A 4G6DA 5IT3A 1BJAA 2HYGD 3HTUA 4HX7A 4B09A 4C2UA 4BBSJ 1PJTA 2NVTJ 2EPRA 3HYIA 2LLKA 1BR2A 1MBGA 3HC7A 2VBZA 2EFPA 2KZGA 3OL3A 2Y0SN 2L54A 3GCMA 4M72A 1SVLA 3ZMVA 1FOKA 1IRZA 4I0BA 2R3SA 1SAUA 4DYRA 3N4MA 1D3YA 4GXOA 1U0JA 3JSOA 1MBKA 2EPUA 1ZLKA 1Z1DA 2ZJ2A 3VFZA 3S3OA 3I3LA 3OV8A 5D6FA 2LUQA 1FTZA 3MSWA 2QWWA 3FXUA 2BOLA 4J00A 3FMQA 2R5YA 4DQ2A 3LA7A 2JPBA 1XB4A 2AXLA 4R8OA 1LUJB 4PJLA 1X3UA 2PG4A 1BOAA 4P9FA 1XX5A 4ENJA 1RZ4A 1H9GA 2XUBA 2O5RA 3CDIA 3HOXJ 4ASNA 3EQLF 1V5GA 4XLAA 2QVOA 4E7LA 1YI2I 2M9AA 4JYAE 1S9HA 3GBGA 2EOFA 2KIQA 3QU6A 5EG0B 3GZ5A 1FBUA 2EMIA 4P5OA 2XV4S 3VYUB 2RDPA 4WCGA 2QBYA 4RAYA 3GWZA 4E7KA 4MTEA 1X58A 2KONA 5FGMA 1LNWA 2KHMA 1I27A 1W5CC 5KCMA 4H0EA 2DOFA 1JUMA 4NQWB 5B1BH 2QM3A 1PP8F 1QU6A 5A69A 4R1HA 1RC9A 2P5LC 3ZQFA 1TBXA 5L3GA 5EDNA 2UWMA 4G8XA 1RKTA 1XGOA 4CCJA 2BBYA 4PGGA 4EM2A 1D1CA 3BG6A 3L2QA 2EM3A 2QZ8A 2EOJA 4LF9E 5K7FA 4PJMA 3DTKA 2XF5A 2B3TB 2K4JA 1HOMA 3BZCA 3ZMUA 2WTEA 1OCTC 3BR2A 3ZRGA 1OCCH 2OTLI 4JQFA 2KJBA 1XGSA 2ZMEB 3DKWA 2V1NA 3V7RA 1HW2A 2IW5A 4F91B 4DV7E 1LE8B 5DTDA 5KL4A 5D5XB 1N34E 2AS5F 3RYPA 4WSGA 3NWSA 1UAAA 5A2QK 4I0AA 3A0HC 2BZTA 2XRNA 2IPQX 2FBKA 2M0CA 3IAM2 3WGHA 1VFCA 1B8IB 2RS7A 3LQQA 3HSRA 1PKPA 1AH5A 4EJOA 1IQSA 4JI2E 4UUSA 5FFZA 2V6CA 2R7XA 1Y56A 1ZTRA 3ABKH 3OS1A 3ZOBA 3HG9A 1ZHFA 3EUAA 1KA8A 2M4GA 3BG3A 2Q8UA 4JBAA 3DP7A 1ZARA 3JTHA 3K1NA 4H4KC 4F9AB 2B7EA 4KWYA 2DXIA 1U2WA 1UZCA 2V79A 1Y8QB 2E36A 2LOOA 2VL8A 4HEIA 1KYQA 4MFEA 2K4BA 3K1MA 3PJRA 4MGRA 1QZZA 4XIDA 3HSFA 2UXNA 4BY7J 1IG7A 4AVPA 3F6GA 1S7OA 2YTDA 1QVUA 5D5WB 3ONQA 1VI0A 1FJLA 3IAS2 2E72A 1TT5B 3H92A 4HV6A 4AUXA 4TV7A 2E60A 2MFZA 3I55I 3FK6A 4O43A 4LK0F 2DOEA 2L8TA 4BQOA 3MZ8A 1HLVA 3PM1A 4N4OB 4V2FA 3BP8A 2DBBA 3BF2A 3LA3A 2M0MA 3CDLA 3DFGA 2K27A 1PUFA 3VYTB 3A01A 1DGWY 4S04A 1MNDA 3ESWB 2IT0A 3TGNA 9ANTA 3QODA 1OJLA 1UCRA 3BTLA 2EOIA 5DYMA 3IWFA 2FF4A 1YO5C 3F8BA 2LKXA 3X2QH 4IZZA 1NEIA 3DPTA 3J80Z 2OTJI 1VTNC 2BYVE 2CSOA 3JAMC 5CVJA 3VEPA 1X6HA 2EM7A 1FIPA 2B9DA 5EJCA 4Y33A 2EL4A 1IRFA 4X66E 3DF8A 1YRNB 3H5NA 1JXSA 3VB2A 2W48A 3K7AJ 3S1RJ 1HBXG 4FK5C 3A0BC 3NAUA 1X47A 2F5DA 1D8JA 2NNNA 2EIJH 4YELA 1NK2P 4TUIA 1A1LA 3EQ1A 2BW3B 3A1YA 3VSKA 2QYOA 2JPAA 2GOMA 1PDAA 2VN2A 3TKYA 5FLVA 1TQIA 2GHFA 5AIQA 2L7ZA 1IXRC 3K6GA 1E17A 2P81A 3G1MA 5FROA 2JVGA 1K4TA 3BR6A 3ULQB 5CJ9A 3VSLA 4BUPA 3GXOA 1IN7A 1V5FA 3BZKA 5L3DA 2EOEA 2EK5A 2CQQA 4JK1X 3RTRA 5FO5A 2DI3A 1FBSA 3WTVC 3CMAI 2CUEA 5CYVA 3JRCA 1IBME 3DU6A 4P1WA 2QSHX 4RAZA 4KA4A 3RJPA 4NUBA 4M0VA 4HYEA 2MW8A 2PMUA 4XSXF 1UELB 2V87A 2ELZA 2JQ7A 3L7WA 2HDDA 4A2UA 2Y0MA 3H5RA 2LFBA 2ZB9A 1WJBA 3G1LA 5D4SA 3TEDA 5CPRB 4DGWB 4ZDOA 2LT7A 3IHUA 4G94A 4ZJZA 1X1PA 2Z16A 3M9AA 4Z2YA 5FKMA 2R5ZB 1A6QA 5LGTA 4IHYA 2VF1A 2GA2A 4C3JJ 3LSRA 2EPPA 2Q0OA 2RN7A 4UVAA 1Z77A 2FMLA 2LUPB 4RAFA 1JGGA 2LRSA 4FE4A 2CPNA 5HS8A 2EMBA 1H9TA 2WY8Q 2YUSA 3TDUC 3ZP5A 4OIOF 5JFRA 4R2EA 1EH6A 5IOZA 2DMYA 3CO7C 2ELHA 3B6CA 2LE2A 1ZRFA 1O0WA 4HOBA 4AM3A 3BPVA 1LQ1A 3S14J 3BTJA 2DMNA 2RC4A 2NXNB 4Q47A 4P9UA 1JGSA 3JTGA 3EUHA 3BQYA 3T8TA 2KDOA 5FD5A 2DA3A 3DLLF 2EMLA 2HQ5A 5LBQA 2PQ8A 1ZU1A 4XRFA 3HL2A 3AG3H 2YTJA 1QGPA 1J2XA 3DF6A 3FIGA 1P9QC 2CFOA 2KISA 4XSZF 2E1MC 3JREA 2VQLA 3UR3C 5LEJA 3RCOA 2R7OA 3L00A 3QOEA 2EMAA 4O5VA 3IC7A 4Q4ZF 3C6KA 4FE7A 4DBRA 3PIPF 4HTGA 1GDTA 2NUGA 4RGXA 5KHDA 3CP8A 5KK1A 4AU7A 5DUIA 2IJLA 1UHSA 2M34A 2F5FA 1UJ8A 1AU7A 1NCSA 5E20A 2DFEA 3OOPA 4XKWA 2EMWA 2DMQA 3JW4A 5F08A 3JRDA 2JRTA 5HODA 4WXHA 3V7CA 5LRSA 2RREA 3TBIA 4Z6YA 1LDJA 4CYCA 1R1VA 2PMZA 1U5TA 1TQPA 3OYAA 4BE0A 2BY0A 3OSGA 1AWCA 4IHTA 3AUZA 1PVEA 3I5UA 2EN6A 2QBYB 4C3HJ 2V85A 2ZM6E 1P47A 4FETA 5D8KB 1RNLA 1I6XA 4P96A 4BGDA 1DP7P 2CS3A 3HGGA 5EYRA 2MC3A 1B1BA 3S1MJ 3Q0VA 2CV2A 1MNMC 5E3NA 2LJUA 5IYCJ 2BHYA 4C9YA 1QPIA 5IT9K 1GTKA 1KU9A 1OR7C 4LB5A 2EPLX 4RB2C 2GIVA 1HF0A 3CUOA 2VLAA 5E3LA 1BW6A 4MLOA 1IV6A 1TQMA 2DT6A 2O0YA 2X51A 3OYBA 3QU3A 1WJCA 3S15J 2X85A 1IAWA 2W85A 2L3DA 3S16J 4NB5A 2F4OB 3BG5A 1R9TJ 2EMGA 3H0DA 2CWEA 1WH5A 1T56A 3HJEA 4G9YA 2XASA 4ZYAA 1XNQE 4KN7X 2IGKA 2YRKA 1WQ2A 3CMEI 2DMTA 2JWTA 3CJQB 3KLNA 3OY9A 1FOXA 4BQQA 4CCLA 5F1RA 2NVXJ 1VZ0A 2V1DA 3DLAA 4BE1A 1IGNA 1PUFB 1X4PA 1ETKA 1RR7A 5KNLA 2Y69H 1X5WA 3KFWX 3HRTA 4M3BA 3LOCA 3A2KA 2L9RA 3K70D 2I8DA 3MEXA 4LLLA 4BBYA 4RDUA 1LLMC 4CCMA 1PYVA 2CT1A 1OYIA 4BC7A 3W3CA 3TW7A 1YSAC 1A1HA 2EPKX 1F5TA 2COBA 4LMYA 2X1CA 3F3XA 4L9TA 1K78B 2LTPA 3IWZA 1MBEA 3WTSC 1BBYA 1N3GA 1G2HA 1Z67A 5K5RA 1W0UA 2OZUA 2YTQA 4B3RE 2DJIA 1XSXA 2P5VA 1BJZA 2F6CA 5H6RA 1FYMA 1UB9A 2MBFA 2FU4A 2EINH 3IV5A 4IO9F 3CCUI 4IX7A 4GEQB 2EM2A 1Y0NA 5AE3A 4F2JC 1JK2A 4XOPA 3DTIA 4YIIA 1FX7A 3VK6A 3WTTC 2BY1A 5JI6A 4CSWA 1SANA 3MD2A 3KX2A 1A1JA 3L2VA 4YIRX 3T1BA 4ESBA 1JK1A 4V2GA 1W7PB 2CQNA 1GV5A 1T98A 1GUUA 2MYSA 3C3WA 3NQOA 2FGGA 4OWRB 5IP6A 3BDDA 5HS9A 2MABA 1CF7B 3SDBA 1G8XA 5TRDA 5E18F 2CW7A 2X9DA 1WCMJ 4HNUA 3A02A 1EF4A 2ODRC 4XNFA 1NTCA 1K79A 5FKNA 1D0XA 2E7XA 4DUZE 4DV6E 5IXMB 1R22A 3QPSA 1TP4A 3OYKA 2M4IA 1B6AA 2L2OA 2HNHA 4BU2A 3WTUC 2XAHA 2XSJC 5LRRA 1ODDA 4E7JA 3KIOA 4ZDLA 1B9MA 3ZQ7A 2EPZA 2VKVA 3IH3A 4KJZA 4HG2A 2OV7A 4X64E 3GVAA 3CCMI 3GUDA 4LFCE 3M07A 4IHSA 3C2HA 1DU6A 3C2BA 1P7JA 2R7UA 1A35A 2YTNA 3EYYA 4QLCU 1E3HA 1A1IA 2CG4A 2DB2A 3C18A 1J09A 2HTJA 3ECOA 2HI3A 1ETQA 1I5ZA 2DDAA 2K85A 3Q0UA 5H20A 1S7EA 4LLGF 5EG0A 1GXQA 2JUGA 4RHBB 1YYVA 4BXFA 2ENAA 5FLMJ 3TDZC 3GO5A 3M1CA 1BA5A 2XSDC 2HHHE 2EA2A 3F6VA 4A0YA 3KEOA 4UNOA 3KP7A 2FOKA 2EILH 3O2PE 3IH4A 4ZTFA 4J01A 4BL0B 2O9LA 5A6AA 4JI5E 1YFHA 4FASD 1RRJA 2ELKA 4R2SA 2L3CA 3GF2A 1STZA 1LVAA 4IKFA 1MJ9A 2L9VA 4ENNA 1EKEA 3IKTA 5H2FC 2CV1A 2EN3A 3R61A 1Q1VA 3I64A 2E19A 5HDKA 2LH9A 1VQOI 1W36C 1WXRA 2IEKA 1WI9A 1SMYF 3DPLC 2ZSHB 3TP3A 4A5NA 2H1LA 1WSUA 3C6MA 4I02A 1SFOJ 5KL7A 3OYLA 2LREA 2W7NA 2UUZA 4NHRA 3SJMA 1B59A 1VNDA 5F1JA 5KAFC 2CQ7A 4BHPA 3JSPA 4LF5E 2M7AA 5CVVA 1LEAA 4LIUA 1VQMI 2EFOA 4B3AA 3ABUA 4II2A 2Q2EB 4OINF 2STTA 4I2OA 3F6HA 4IRGA 2HVRA 4IJDA 2FQ4A 4RLFA 1FJGE 3FM3A 4ZYEA 3I58A 4EM1A 1DUXC 3ERED 4DKKA 3CC7I 2EQ0A 4Y7NJ 1QNTA 1ZELA 1JTYA 2HQAA 2RGVA 3CMMA 3GZ6A 2NS0A 3H09A 3J81C 1IN5A 4XKVA 3SYTA 2B63J 4DV3E 1TNTA 2K02A 1IO2A 1ZLJA 3ASOH 5FKKA 2RTXA 2V7FA 2EQ3A 2MKNA 1FOWA 2A6TA 2M3AA 4B47A 3VPRA 1XMKA 2XB0X 3S93A 1GV2A 3E3VA 3FXMA 4AIHA 1MMDA 4V19K 1UILA 4G12A 4IPAA 1EH8A 1H88C 2KRCA 1XN7A 3SXYA 2K9NA 1ETOA 2EN2A 1W7PA 3OYDA 5FKOA 5CKTA 1KJKA 2VOPA 1BR4A 2DU9A 4N9HA 2QUFA 1V55H 1LE8A 3ADLA 1XMOE 3IWBA 5FLXK 3O3KA 4M6YA 3LSKA 3ZR8X 1JKRC 1IF1A 1FMVA 1LDKB 5LHHA 4BAYA 3S2HJ 1WHNA 3LWFA 1B72B 3BBGA 4HAMA 1J5EE 4AYBA 5EEHA 1B72A 4I99C 2XPUA 2V86A 1KZHA 2VBYA 1G3SA 2HQRA 1IMUA 3W2WA 4HF0A 2WCC3 1S3JA 4XLPF 3B6AA 4I7HA 1ZYRF 4FQGA 2Y9ZA 4WYQB 4PJNA 3EETA 2EOQA 1YPNA 1A6IA 2WB1N 2E2HJ 3ZMTA 5DDGA 1XSVA 3Q5FA 3PNVA 3K4NA 1XG1A 4D7NA 2YR2A 1DU0A 4NHJA 5IYDJ 2NRAC 5C3EJ 4A3JJ 4M3GA 2JOBA 3BPXA 1TT0A 5ILVA 2GAUA 4BHCA 1A1GA 1ENHA 2K9MA 2DYRH 2O7OA 4I6ZA 1YITI 1ETXA 3MKLA 3A03A 1Y0UA 2FEZA 3BY6A 2YSOA 1A31A 2GLIA 2VT3A 2KLOA 4G6TB 4DR1E 3J7YJ 1JUSA 2FMYA 2DT5A 2EP3A 2YPNA 1BM9A 4UB6C 1YTYA 4LD5A 2DPUA 2Y31A 2AQFA 3MVPA 2WB1A 3REOA 3B73A 5BMZA 3VYRB 5ED4A 3AKZA 1G6NA 2XB5A 1E0EA 1YJ9I 1G4DA 1YJNI 4CGZA 4JX5A 1R49A 1FKAE 2YU9J 2VODA 4E4HA 2L4AA 1QVTA 4LF6E 1Y6IA 3OIQA 1KQ9A 4OAYA 3W6JB 1BBGA 2EPNA 1IDZA 2XRLA 3U9GA 3PSIA 4R2PA 4K0KE 2WAFA 5LD2C 3I59B 3ZMDA 4CYCB 1IXCA 1EH7A 1PJQA 5LEKA 1UG0A 2KFDA 3T1YE 4UY8I 2NVYJ 3F72A 3BOQA 1OYYA 4A3IJ 4YFKF 1Z3XA 3B02A 1GXPA 1WHQA 3C4TA 2M8EA 5BOXA 1IRXA 4XKBA 3W2AA 1ETVA 2MC6A 3K4BA 2F2EA 2BB8A 2B7VA 4HF2A 1REPC 4QSHA 4LTYA 1X3CA 3R0JA 2LTSA 1X1CA 1T0FC 3OMYA 5FFXA 2UU9E 3E97A 1D1BA 1QHGA 3L2CA 2V83A 3S2WA 2PLYA 1W7PD 3BZ6A 5FB2A 2H94A 3H9GA 1P2FA 3SEQA 1HNXE 2PJPA 5EZHA 4S05A 2LBFA 1B69A 2RSIA 2KOUA 1FC3A 5D6EA 5IV8B 1K6OA 3QYFA 1OPCA 5HS7A 4D7MA 1B8IA 4X0GA 4WF2A 3ABLH 4CCKA 2FJ1A 2LRDA 4M9SA 5IWAE 2MD5A 4M74A 1K6YA 4L9JA 2VBWA 2Z2SB 4LITA 2E34A 2GQQA 2WY7Q 2YS9A 2VXDA 2KP6A 4OAZA 1ZGWA 2VE9A 1QBJA 1RI7A 1VQ6I 5DUKA 1YJWI 4G6QA 1J7KA 2M8GX 1KQ0A 3M1EA 4EJWA 5F3WA 3QWLA 5F27A 4EMSA 3OS2A 1STUA 1SD5A 3JRFA 2NA2A 1SAXA 1QQIA 2VKDA 5FRNA 3KZYA 2BEOA 2HYJA 3WU2C 4F93B 1O4XA 2JZYA 4D5CA 1W1WE 1AOYA 2JR1A 1XMQE 2HFHA 5DM6F 3PQJA 4R03A 3PIOF 4PSXA 2DLKA 1KONA 1LFBA 2DA5A 3K10A 1ZREA 3VYXA 4W1UA 3CJTB 1XPXA 2GLOA 2LSOA 2OBPA 3IRRA 1PJSA 4CDGA 2W1OA 2R76A 1P6RA 3FXLA 2ETHA 4DBQA 4Y4RA 3J81K 4MTDA 1XTAA 4Q5SF 2K5CA 2JJ7A 1MMNA 4JI8E 1WGXA 2DTRA 2UV1A 2VQCA 3GW2A 1J9IA 2OCEA 2X6OA 1HNWE 2L7FP 5C4XJ 2X0LA 1K4SA 1IXSB 2PJRA 2RSMA 4NC7A 5T6JA 2JTVA 3CDHA 3GTPJ 2LO3A 1H89C 1YYOA 4GO1A 3ZQQA 3WGIA 4HEA2 3ABMH 2LR8A 2VASA 4O3MA 3D0SA 3ECRA 1IZ1A 4HBLA 4NQWA 4A3LJ 3T5XA 3CMYA 2AXTC 3HSEA 4XLCA 2O6GE 2EMFA 2J5PA 1YUJA 3CLOA 4HLXA 4HSTA 4IL6C 3JAMZ 1N78A 4C2TA 2CGPA 2EM0A 3WTXC 2GPIA 5J8FA 5LMUE 2F5CA 4M3FA 4RGRA 5BNGA 4AWXB 1ZBTA 4ON0A 4R2QA 2KIMA 2RQPA 2MC5A 1L4SA 4M30A 2YTPA 4DV2E 3LLHA 4U88A 2AO9A 3GLXA 2MKDA 2D9HA 5K5OA 2ESHA 2ZKZA 2EZHA 4R8HA 2KHXA 5BPIA 2HOTA 1JKQC 2DN0A 1ZN2A 5GAGJ 2JA2A 2C6YA 2VIXA 4AQYE 4L5JA 2OCCH 1R1TA 1R1UA 4RS8A 3MKYB 3CF5F 3C4BA 3GFIA 2K9LA 2RV8A 4QTRA 5BPDA 2LP0A 4OMYA 1QO0D 3FXOA 3MMYB 2KIFA 3WE3A 4BQAA 1X4OA 3CTAA 4LLNA 1SD4A 2O61A 3F8MA 4I8OA 3KP5A 1F9NA 4K2EA 3QRFF 3E5QA 2ACJA 1TTYA 1R36A 1IUYA 1GZ6A 2V4JC 2EOMA 3MN2A 4DV0E 1FP2A 1YG2A 1T08B 4X6AJ 1U5TB 1VQLI 3PNTA 1UFMA 4KUMA 4G7ZF 1HXDA 2X1DA 3DQVC 4BE2A 1FOYA 3GTGJ 3HPSA 2DW4A 2UUBE 2I10A 2Z33A 2EPAA 2VI6A 4N4RB 5EEGA 2L3JA 1GVJA 4IHXA 2VJIA 3L9FA 2KQRA 4N9IA 3BWGA 2V88A 5GAHJ 3JR9A 4I98B 2R1FA 1W5SA 2EMKA 5L3CA 2X4HA 3MZHA 2EOHA 2LD5A 1OLTA 3F22A 1SVOA 4ZH4F 1A5JA 4PJJA 3L09A 3QP6A 3K4MA 1HKQA 2V1XA 2DPDA 2H1KA 4RB3C 2E1MA 2ZMEC 3BJ6A 3F21A 4BY1J 1Z9CA 4CYDA 1O57A 1ULYA 3R4KA 2WA0A 4BYYA 1QHHD 3DKXA 4F6NA 5K7ZA 2L9NA 2ENHA 2QCOA 1R5GA 1U78A 2QKMB 3Q9SA 4I76A 1D1AA 3M4OJ 3PQKA 1TL8A 3G3ZA 3D5SC 3HOVJ 4R79A 3LSIA 4XLNF 4WXDA 3FM5A 3V8LA 2K7LA 3KEYA 1B4AA 3HDDA 5B3SH 1HCRA 4EQQA 1Z05A 1S29A 4PFPA 2YTGA 1USTA 1GQEA 1MJAA 3EDPA 5CVRA 5FRMA 4EGZA 4JOMA 4IQJA 2E1CA 1V3FA 3K4CA 2R7QA 3QYBA 2V9VA 1K7AA 4LOCA 3S1NJ 2GWRA 3ZGKA 2EBIA 1JKOC 4LF7E 1TN9A 4NXNE 2HC5A 2L33A 3ZOQB 3GFJA 3WU1B 4L9NA 4HSRA 5F0FA 4DZJA 3J7ZI 1JE8A 4JI3E 1X1AA 1BIBA 3Q3SA 4RLQA 4JP0A 3JU0A 3UNGC 2ZXWH 2IVMA 4EVIA 3E6DA 3MQ0A 1IBLE 4FX4A 3KE2A 2EMZA 3MHSC 3JRIA 1YRNA 2YTOA 3TQNA 2JYAA 2E71A 1MKMA 2ZJQF 2YT4A 5DNYA 1G2DC 3LMMA 4LJZF 3OS0A 4OIPF 5FJ8J 5E79C 1HQCA 1IN6A 1D0ZA 3I4NJ 1WPKA 4A3GJ 2LVHA 1VQNI 2UUCE 4L18B 1TWGJ 4F3QA 5AC5A 1KU3A 2N3HA 4IF4A 4IHVA 2VE7C 3K1PA 4IS1C 4B44A 1APLC 3PUFA 1VF9A 2E1NA 4GFBA 3BG7A 5J1UA 2MDRA 3WG9A 3PUBA 2EORA 1QA6A 3TP0A 3RMPA 3JAMK 4U0YA 2DK5A 4GKJE 4P7DA 2XGDA 4L0YB 1BN5A 3CC4I 4DNCA 3OYNA 2JWOA 2JMWA 5HOOA 1RPWA 4OIQF 4L0ZB 2D1HA 3TOBA 2IS2A 4BC9A 5FD6A 3ABTA 3U1KA 1AA7A 4ZDPA 4ABZA 3MFKA 2BBGA 1S7AA 1XNRE 1JTXA 1S8NA 4X9JA 3OYIA 2HOEA 1O3RA 5B1AH 2NS8A 1T8IA 2EV6A 2XAJA 2R7RA 2A6EF 3WTZA 2R7VA 2DFHA 4MEYF 1YW8A 2X6WA 5L3FA 2LKSA 1FP1D 2VBXA 4M9ZA 4B3ME 3OYFA 5KVRA 5DCMB 5JHFA 3DWLE 2QENA 3KEQA 2F4IA 2VKHA 3FKJA 1MSEC 1X1DA 3NWTA 5EZGA 3GYHX 3T1HE 1ERDA 1MH3A 1IQOA 4F92B 5HNHA 2JA8J 4LFUA 2DFIA 2KIUA 1BIAA 4BHBA 4A3CJ 2P7VB 2MG4A 4FISA 4KIFA 3A01B 4G7HF 3FXJA 4AIDA 2FRHA 4EJVA 4XLFA 2UZKA 2DODA 2HDWA 2EFNA 4PSWA 4DR6E 2RNJA 1ONVA 1IRGA 2MLGA 1ZR9A 2EB7A 5A2QZ 3E7LA 3MKWB 4PGHA 3ZMZA 2A25A 4OOIA 2IAIA 1G2FC 2W24A 3KP3A 1Q1HA 5DCFA 4A5MA 1JJ8C 2P8TA 5F0CA 4BJ5C 3RZDJ 2VRDA 1A04A 1I3AA 3FKIJ 3OSFA 1WZ2A 1FZPB 4KICA 4GDFA 1Z6TA 3HOTA 2EV0A 5TISC 5FKLA 4BS9A 2UUAE 3C7JA 1MNEA 3KLOA 3ZQCA 4EATA 3PFIA 2XF6A 3THNA 3SQNA 5ILUA 3JRGA 1TNSA 2AHQA 2E2JJ 4IRIA 4LF8E 4WX9A 5LHGA 2KDZA 1YYKA 2DLLA 4BKXA 1D5VA 3FHZA 3UKGA 3HTXA 1TW3A 2HXOA 2LYCA 3DBHB 3J7AG 2YTEA 2L7KA 2JUCA 2DA1A 1U5TC 2QSFX 5AIPA 2FNPA 2RAEA 5L3BA 3CCVI 2V6EA 1WWXA 3BR0A 3RKWA 5C4JJ 1HR0E 3PO2J 2DLQA 3EPHA 4HA8A 2YRHA 2ZXJA 1WHUA 3FZVA 2B7TA 1JI8A 2VPRA 2XGCA 3LFUA 4BJTA 4CO8A 2R0QC 1W5TA 2CW0F 1IJWC 2HVQA 3M99B 5GADJ 4PK4A 3VWBA 3A4CA 1SD7A 1T38A 3U2RA 2MGQA 1RMDA 2NNYA 2D5VA 5IT9C 2GXAA 1I94E 5TSEA 3L1PA 3M8FA 5A6JA 2HPMA 3SZTA 4XORA 3TO9A 3P5JA 4ANJA 3L2WA 3BJOA 4X8WA 2QKLB 1Y39A 5LGUA 1OCZH 5DM7F 3OYCA 3J7Yp 3VYSB 4KITB 4L9VA 3Q9VA 1U8BA 4WXCA 1X2NA 4JX6A 2A07F 1AAYA 4WWCA 4AIKA 2EWLA 2K9QA 1W0TA 4J8ZA 1BI0A 3HPHA 4I01A 2Q2EA 4OOGC 2FX0A 2YSRA 2EOYA 1H0MA 2MD0A 1QPMA 3NRVA 3HPZA 2EE8A 3TO6A 1UBDC 4HDVA 2L4MA 2BY3A 1LPQA 1F43A 2V26A 4AD9A 4CZCA 3TMOA 2WADA 4C2MJ 2XGXA 4B1RA 3I54A 3JRBA 3GZNB 2MDGA 1UHMA 3BQZA 3RSNA 2NUFA 1ZGJA 2XC7A 3M8EA 2PI0A 4HX4A 4UV9A 5DD8A 2XIGA 2OD5A 3KP2A 3HIFA 5D4RA 3OWTA 1TF3A 3G2BA 1KYWA 3OOUA 4KT5C 2LK2A 4A69C 3RKQA 4KYWA 1I3QJ 2EIMH 3RPUA 1R58A 2WAEA 1HSJA 4KISA 3H3ZA 1ETWA 2Z5UA 1BI2A 3CJRB 3MWMA 2IRFG 2HJJA 2VJ5A 2PRTA 2B0LA 2YU3A 5IY5H 2V89A 1DI2A 4F6MA 4IEJA 3ELKA 4KMUX 4L5NC 2FD5A 2W4SA 2CH0A 3C1DA 4O6JA 2R7SA 3S32A 1ZR2A 3P1XA 5AASA 2Z3YA 3QPHA 4IRHA 5HLGA 3HOWJ 4BXUA 1IV8A 2ME0A 3FXKA 3K2ZA 1QZYA 2H6BA 2ME6A 2ZNZA 4ZYGA 1PUEE 4D5FA 3HUGA 4HRIA 3H3VK 1RUOA 4ITVA 4LU9A 2I13A 5FLXC 1MEYC 4F54A 1Z21A 5ERIA 2CUZA 3CCSI 3F8FA 4ESJA 2B9SA 1XMXA 1BOBA 3E1SA 3K69A 2KJCA 1ZGAA 2XKPA 3VDXA 3V8JA 3WTWC 4AIJA 2M87A 4AVZA 1F36A 1OCPA 3TOAA 1R4MB 3PL8A 4M71A 2EM6A 1U8RA 2XKOA 3FXQA 2PBIA 4MO7A 4O4KA 5IOYA 2JA7J 2YU8A 4L8NA 2V9PA 2DOAA 1N33E 2VPLA 5F64A 2JT1A 3J7AY 2LDUA 1YIJI 3LL7A 4CH7A 4XQFA 1WVRA 1XS9A 1ZAAC 1YX5A 2FUG2 3ASNH 3FK7A 2E5ZA 3U1DA 2A69F 2XAFA 2QLZA 2A61A 5KL5A 1R71A 5EEAA 1CGPA 2R7WA 1FYKA 2EM5A 2RVCA 1JT6A 1NG6A 3QPTA 4D1QA 3ZQHA 1ORKA 1IUFA 3SFZA 3OYJA 3L2UA 4NNJA 2ZMEA 1XCBA 2VQGA 4ETSA 4F55A 1ZH5A 4E7ZA 1LDDA 1Z7LA 2PFBA 1E3PA 2VT2A 3M7GA 4JI1E 4IXAA 2VUMJ 3GEZA 4S0HB 2WBTA 4XMYA 3BIDA 2M1BA 2JP9A 2LKPA 1L0OC 4MQ9F 5F04A 1YS6A 3GTLJ 3IKVA 2E1OA 4JI6E 2LG4A 4D0PA 2IP2A 5GPCA 3DJWA 4DW6A 4WSPA 5DV5A 1DGRM 2E5NA 2XGEA 4M3DA 5LFAA 3OIPA 4XM3A 3OR1C 3FMSA 2KT0A 4AYBN 3K9TA 1OYWA 2NOJB 2LY9A 2M30A 2G0EA 3K70C 2JA5J 3AL0B 1IN4A 1P92A 2EM4A 1YQAA 1AKHA 2M5WA 2CTDA 2E35A 1J5YA 1VQ8I 2HOSA 4FT8A 3SFIA 1DP3A 2X1EA 2CSHA 2DMPA 3PFYA 2JY9A 2VONA 5IP9J 2ODRD 2D2WA 2GXGA 4UV8A 1KYZA 3CP2A 2QQBA 2D1VA 4KHPE 3W2VA 4Y13A 3DTEA 3HKZN 4GYIA 3GX4X 3LSJA 4YRVA 4WK8F 2OZ6A 1O7FA 3FDYA 4X1EA 3ZQGA 4CCOA 5D8LB 2H8WA 3HHGA 4HV5A 1KQ8A 4PUSA 2QEXI 2A6HF 4DJAA 4RMNA 1GLNA 3P7NA 3SHFA 1BR1A 2BE5F 2LJHA 2GXBA 2KZVA 3M8JA 3T8RA 2F4MB 2MH9A 1BW5A 3DBLB 2YX4A 3OL4A 2X6XA 4NC8A 3GTMJ 2EOZA 2JXPA 5B5EC 2Y0SA 4UUVA 2F8BA 1YX3A 2G9WA 4HQEA 4U0WA 2L2MA 1XDUA 1MMSA 2VJJA 4IOCF 4HQMA 1WJPA 1WJEA 4CA0A 3CUQC 3GFMA 3HGYA 3CCRI 3HTSB 1XC5A 4LFAE 5ILSA 1BBOA 4II3A 1ZKGA 1TZLA 4A6DA 2K4VA 2ICWG 1X2MA 2KKOA 5E1XA 2K3PA 2GM4A 4MEXF 4MLQA 4DUYE 2M9HA 4JX4A 2YZTA 5LLQA 4R2DA 2LY2A 3BROA 1T0FA 4MHGA 2R93J 5F0HA 1N25A 4UXNA 3BCAA 2IGMA 2RKHA 3DKYA 4I09A 3CQZJ 2IS6A 2EMYA 5AONA 1WI3A 5J40A 2FV4B 5A6BA 5CQEA 1FEXA 5JVTA 3R6SA 2A5YB 2K86A 3EYIA 3LSPA 1XDSA 3I4PA 3MKZA 4RB1A 1NK3P 3THOB 3HB9A 2WV0A 2R7TA 2WZOA 4FX0A 3RYRA 1J26A 1WJAA 3HOYJ 3D1NI 2E1MB 3P9IA 5EF6A 4PJ0C 3HOZJ 2DA6A 1BC7C 3G6EI 5D5VB 4PDKA 3RIRA 3E0JB 3BT9A 4ZZLA 2EZKA 2ID3A 3O6BB 2WWYA 3IL2A 1FSHA 3T0YA 3AG2H 2OU2A 2DT7B 4A93J 4B3SE 2GZWA 1X3ZB 3IWDA 1G3WA 1TWHJ 3ZQLA 3FIWA 1R6RA 2P6TA 5J6XA 1X6EA 2VQHA 3H5AA 4Y15A 2W84A 2NABA 2YU5A 4A3MJ 4XLEA 1XGNA 2HZTA 1IBKE 3FXRA 5EGOA 4GRIA 4BDYA 3MHHC 3QQAA 4BXXJ 4KIGA 5B66C 1EKZA 3NEUA 2OPTA 1JHFA 2P6SA 2HU9A 1SFEA 2F48A 2HZDA 5HLIA 2EN4A 2LNBA 2V9KA 4B4CA 2HPIA 3JRAA 2N3GA 4KZSA 2LVSA 3ZQIA 3EPLA 3KP6A 5DEQA 1MJBA 3AV0A 1UMQA 4YG2F 1SC7A 2O8XA 4JV5E 4LGWA 4JI7E 2FQ3A 3G73A 1FSEA 5FLXZ 4KNYA 1MSFC 1RIOH 2LY1A 2EL6A 2F4VE 2EM9A 5E1ZB 2KMUA 2LF7A 2VQEE 2UXXA 2H36X 2EH3A 1T6SA 2DA7A 3CF2A 4DYQA 3ZPLA 2D45A 2EFQA 2Z9OA 1BB8A 2ZC2A 4YIFA 1E2XA 3ML6A 1WFXA 2PEXA 4XN3A 1AHDP 2YSPA 2VQFE 3HQ1A 2A3SA 4DR7E 2LCEA 4BEHA 5CVIA 4BCAA 1F2IG 1X1BA 1OKRA 3HHHA 3H9JA 2CJJA 3VOEA 4M9XA 2P0WA 3L2RA 2DTZA 2HOAA 3ZMSA 1GHCA 3CCJI 1ZQ3P 2DA2A 1MDMA 5M3MJ 1ETYA 4XONA 2LC2A 3AAFA 4BEHB 4RA2A 1JT0A 1XCVA 3ADJA 4DR4E 4OU0A 3D5LA 2G7UA 5LHIA 4L5EA 1EV7A 1H8AC 4YY3E 4IJAA 3RQ4A 4G7OF 4FTHA 2Z1DA 2EZ6A 1JHHA 1OMIA 3P9CA 4GCVA 5K7HA 3LAPA 2EQRA 2Q1ZB 4EEFG 3OYMA 1GT0C 2MH2A 2Z99A 3OYEA 3G4SI 3BCBA 1U3EM 5F6FA 1NH3A 3VODA 1UHWA 3J80K 1FMWA 1FTTA 3BR1A 1CQTA 2O3FA 1BL0A 2CYYA 3RPQA 3SZPA 4HNVA 4UUSB 2TDXA 5IYBJ 2NUEA 5M3FJ 3DU5A 5HNFA 1X3WB 3WHBA 5HVQC 1FYLA 2R4GA 3CCQI 3P9KA 3CCLI 5IT9Z 3MAJA 3MCZA 3H35A 4UVCA 2DFFA 1FBQA 1YZ9A 5HLHA 2ADUA 3CCYA 2JK3A 4D9JA 1NG7A 4NXME 4E7HA 2WC2A 4BACA 1ON1A 3LSMA 3LSHA 2V8QB 4GYGA 4HW0A 3ZCOA 1ZR4A 1OCRH 1N32E 5E1WA 4LG0A 5TGTA 4QWQA 4EM0B 5JLWA 4BMJA 5KL6A 1A1KA 2DYSH 3DV8A 2K9SA 2VJ4A 2ECCA 2BHZA 1TW2A 2PMHA 3S3MA 1ZBQA 2WBMA 3BGHA 3FBNB 2OA4A 1N77A 2VB6A 4ZZDA 5CLSA 1SMTA 3D5RC 2R5ZA 5CFFE 3IRQA 2EZIA 3ZXSA 3ADIA 2HWVA 5M5YJ 2OQRA 1HKSA 4XLHA 1IDYA 2J7JA 2KRFA 2CO5A 4LK1F 4TUGA 5AE2A 3I56I 4XRMA 1W4MA 4ZYDA 1LEBA 4B8XA 2L92A 2XF7A 1D5YA 4X65E 5ICCA 2FNAA 5HDNA 5M5WJ 2LBFB 2JVAA 2CUJA 5ADZA 4U7DA 3V7SA 2VKEA 5J1YA 1SEUA 3GTKJ 1M1EB 4M6XA 5K1YA 2N8XA 1JUPA 1Y1WJ 2H09A 3QG5C 3BLYA 2BV6A 1O3SA 3S1QJ 2E2IJ 4BJ6C 3M3YJ 3EUHC 1ACIA 2H6CA 2JA6J 1T4LB 2UXBE 5AE1A 1MBFA 1GVDA 3LA2A 5GAEJ 1T4NA 2COMA 2DGCA 1RQ0A 3DEEA 5JR3A 4LB6B 1IN8A 2IS4A 1G3YA 3WHCA 4B3XA 3WG7H 2L5QA 2M1SA 1HSTA 1YE9A 5AC4A 4YFXF 2LV2A 2M2EA 2M45A 2YWQA 1J59A 3WU0A 1P4XA 1FWZA 5JLXA 2QQAA 1XSDA 2DDBA 3SDGA 5J4VA 4KIBA 3KCCA 4E7SA 4P78A 1DPUA 1ZRCA 1X48A 4DYCA 2R7DA 4DR2E 3I53A 1KU7A 1Z1BA 2STWA 3LFKA 3ADGA 2ECBA 1T4OA 5A6BD 2I5UA 5GTIC 2EPFA 5E3OA 4P55A 3CD6I 1R7JA 2TRTA 2NVUB 4N0BA 3LNQA 3RPUD 2XDVA 3JTZA 2L7MP 3HKZA 4XN0A 3TW6A 2RS6A 3RDIA 5L3EA 6PAXA 2R5YB 2HEOA 3PO3J 1F4KA 4EJUA 2KRHA 2MSYA 5ICGA 4ZTJA 2EPXA 3R60A 1S6LA 4X62E 4O5GA 1A1FA 2O03A 2HXIA 1VQ4I 2NVQJ 3TO7A 1HDPA 1CF7A 1QU3A 1WH7A 2EN8A 2N8GA 1OISA 3CESA 1TC3C 4DZPA 2ZO4A 1NHAA 4RM2A 5HLTA 3OYHA 1UHZA 1OR7A 1YYWA 4XICA 1Y8RB 3EPZA 2DO7A 4C3IJ 1P4WA 4ZYHA 2ISYA 1TWFJ 3F8CA 4Q48A 1OQYA 1Z0XA 2EPCA 1XD7A 4JYKA 3VYYA 1Z6RA 5EGOB 2CQKA 2BGCA 2HKXA 2IXSA 3AFHA 3KP4A 4Q28A 4HPQA 1RR8C 2HDCA 1F1ZA 2VE8A 4B43A 2M7QA 2X6YA 1O3TA 3MZYA 1BC8C 3BR5A 3PSFA 1E3OC 2DCEA 3KWRA 1ITYA 1IW7F 1YHQI 2EN1A 2I9IA 3BJAA 1XGMA 5LGNA 1UG2A 2RQLA 4CHUA 2HGHA 2NAZA 3GTJJ 1MW7A 1MH4A 3QAHA 4EV0A 3J81Z 2W25A 4MFDA 4IHWA 2K7IA 2OQGA 3HM5A 1ZRDA 1I6HJ 2QSGX 2DAOA 1I1GA 1TWCJ 2HKOA 1FT9A 3HRMA 1ZK8A 3W6VA 3I0TA 2A05A 2CQXA 2L0KA 3I9V2 4MQVA 1T33A 4CCNA 1O3QA 3H1CA 2CMPA 3CLQA 5HDGA 2CRGA 4XBFA 1I1SA 2EZLA 2XAUA 4GGGA 3FHNA 2BXZA 4LG3A 2EQ1A 3AG4H 2RPCA 2OF7A 1V5EA 1FY7A 3CUQB 3EPJA 2A68F 2WV1A 2ZCWA 4OMZA 4ENKA 2WAQA 4AC0A 4KDPA 2ENCA 2F5EA 1OFCX 2ZXIA 3OIOA 1S5LC 2LMDA 3AG1H 3OR2C 1ZG5A 4IQ4A 3F8NA 3J7AO 5DD4A 2E5LE 4BDZA 1LKXA 2F5VA 2M7BA 2CU7A 3FMRA 2ZBKA 1HW5A 4BNCA 3KYLA 5A6KA 4A0ZA 2FA5A 2XAGA 3GLLA 4QPQA 3F9KA 2ZSIB 2EFWA 2L6MA 1Z7UA 5KL3A 1MDMB 3E5XA 2BVMA 2LMZA 2IGOA 2OAZA 2DIXA 5KL2A 2HR3A 4U0VA 3BTCA 2GOXB 1ZG3A 3I71A 1FPQA 2BW3A 3QOPA 5J1RA 3LAJA 2L2NA 1JKPC 4A12A 2IA1A 4M9VC 1YS7A 3HUGB 4PCQA 2BY2A 1RKWA 2QGUA 3I59A 2XVCA 2TCTA 4CZZA 3HBLA 2JSPA 1K83J 4L5IA 2IS1A 2LTRA 2CW8A 2HQNA 1YUIA 3IUOA 1YW7A 2ELJA 2GBYA 2Y48A 4E7IA 2VC1A 2ISZA 2BVLA 3OTOE 1POGA 1DQ3A 4Y17A 4F52A 2NS7A 1HA8A 2GIZA 2MLKA 2YX7A 3COAC 4DR5E 2JPCA 3LSGA 2IGNA 4MIMA 1U6GA 2L2KB 2VC0A 3E5UA 5ICFA 4N4NB 4Y3OA 1USSA 5H6QA 1VQKI 2YTIA 5BS6A 1N75A 4PZJA 2XPWA 1PJRA 4ZC3A 4KMFA 4OX9E 2EOOA 3JRHA 5E17F 3K2AA 3AL0C 4M6VA 2FBHA 4MLVA 3FX3A 2EOXA 3WTYC 2UXCE 3H0GJ 3G71I 3VHTB 4LFBE 5BR8E 2P4WA 5BQTA 4UVBA 5KAIC 1MIJA 1Z91A 2VOOA 2W57A 3HXLA 1FIAA 2ZJPF 1WJDA 1VQ7I 4QPOA 3N05A 1YIOA 4B48A 4GKKE 2IA0A 2W82A 2EMCA 3N97A 3WGGA 4PFOA 3CZ6A 5D5UB 2FXAA 3PNYA 3HOUJ 2W00A 3UK3C 4JI0E 1MMGA 3SEZA 3DEWA 3RQIA 4HF1A 5J8CA 1IC8A 3U21A 3QP5A 4DV4E 2PN6A 2CFXA 2ELYA 3DBRB 2WBSA 2XPVA 3HOSA 4O24A 1K61A 4F9CB 1VQ5I 1WJFA 3CCEI 2PJRB 3HPGA 2MA3A 3I4MJ 4UHTA 4RB0A 1PP7U 2EMHA 1DPRA 4GZNC 3FF5A 2DQRA 1SVMA 5J3LA 1FLIA 1U9OA 4UB8C 2PX9A 1R5HA 4OIRF 2RQQA 3LMLA 4HDUA 3EUKL 4A3KJ 5E8IA 2YTFA 1MGTA 2IHR1 2J5OA 2RNGA 3QPLA 4RAGA 2R92J 2DRPA 2DSYA 4XRSA 5GP9A 3SZGA 3OYGA 3FWEA 2EOSA 1WJ5A 2HGCA 1LVKA 5CVUA 2PMZN 4WPYA 3CC2I 4YHHE 1ZAOA 3RZOJ 4DR3E 2LBSB 4KFCA 1TWAJ 4B3TE 5GPAA 1DQUA 2HS5A 2JSCA 4KT6A 1MBJA 2DA4A 3DEUA 3EPKA 3RKXA 4RH8A 4LF4E 2QQ8A 5LMNE 4R2RA 4XKCA 1QZEA 3F0CA 2EM8A 3O8HA 4BBRJ 2GA1A 4A3BJ 2KL4A 2FSWA 3H36A 2EJRA 2XAQA 4NC6A 4A3FJ 2CUFA 4Y52J 1KGSA 3ZN1A 2O8KA 2BXYA 3K0LA 2UXDE 3V8KA 2K40A 5K5QA 2EPMX 3LSTA 1W36D 2Y30A 1D0YA 2IA2A 1HKTA 4DV1E 1WRJA 1SR9A 2L01A 2Y75A
chains in the Genus database with same CATH topology
3RKYA 4HX8A 2P7CB 3E6BA 2EA4A 1HW1A 1RUNA 3V4GA 2L02A 1B9NA 2DQLA 2ZNYA 1SFUA 1L3LA 1XMAA 1T2KA 1TLHB 5JHUA 1ZG1A 5DCMA 4ENMA 1KU2A 4HZFA 1BI1A 1SFXA 3HRSA 4HLYA 4CXFA 4KN4X 1LJ9A 2YPRA 1YW9A 1J75A 2P5KA 2XROA 4A0XA 2VXZA 3ISPA 3ECHA 1V4RA 4MNUA 4A6EA 3KZZA 3LQRA 4E70A 5E8GA 2H27A 2G7HA 1FNNA 3ZN0A 3H3UA 1J0RA 1R23A 2XHKA 1P4AA 2DK8A 1SD6A 3WODF 3GFLA 2NYXA 4CICA 2Q8KA 5ICEA 1O7LA 2E7WA 3HRUA 3CO6C 4RGUA 2LF8A 1G3TA 1R00A 1K78A 1LB2A 2FBIA 1DDNA 1PDNC 3F6OA 1ON2A 2FE3A 2R7FA 4RGSA 3F23A 1WKMA 4U7BA 4LG0B 3CUQA 1BI3A 3E6MA 2ZFWA 3R0AA 3RI4A 1MD0A 4EJTA 3DXJF 4F7ZA 4BH9A 4FHTA 2HYFA 4EGYA 3E6CC 2ESNA 2V1UA 5TJJA 3ROUA 1MZBA 2EV5A 3W6KB 1C0WA 3CJNA 1YLFA 2EWNA 2QQ9A 4YFNF 1T39A 1D8KA 4ESFA 4IVNA 3KETA 4M73A 3WE2A 2HTSA 4G6DA 5IT3A 1BJAA 2HYGD 3HTUA 4HX7A 4B09A 3HYIA 2VBZA 2EFPA 2L54A 4M72A 3ZMVA 1FOKA 4I0BA 2R3SA 3N4MA 1D3YA 4GXOA 3JSOA 1ZLKA 1Z1DA 2ZJ2A 3VFZA 3OV8A 5D6FA 2QWWA 3FXUA 3FMQA 4DQ2A 3LA7A 2JPBA 1XB4A 2AXLA 1X3UA 2PG4A 1BOAA 4P9FA 4ENJA 1RZ4A 1H9GA 2XUBA 4ASNA 3EQLF 2QVOA 3QU6A 3GZ5A 1FBUA 4P5OA 2XV4S 2RDPA 4WCGA 2QBYA 4RAYA 3GWZA 4MTEA 5FGMA 1LNWA 1I27A 4H0EA 2QM3A 1PP8F 4R1HA 2P5LC 1TBXA 5L3GA 2UWMA 4G8XA 1XGOA 2BBYA 4PGGA 4EM2A 2QZ8A 2K4JA 3ZMUA 2WTEA 4JQFA 2KJBA 1XGSA 2ZMEB 3DKWA 3V7RA 1HW2A 2IW5A 5D5XB 2AS5F 3RYPA 5A2QK 4I0AA 2XRNA 2IPQX 2FBKA 3WGHA 3LQQA 3HSRA 4EJOA 5FFZA 2V6CA 1ZHFA 1KA8A 4JBAA 3DP7A 1ZARA 3JTHA 3K1NA 1U2WA 2V79A 2K4BA 3K1MA 4MGRA 1QZZA 3HSFA 2UXNA 4AVPA 1S7OA 5D5WB 3H92A 4HV6A 4TV7A 4LK0F 3BP8A 2DBBA 3LA3A 3DFGA 2K27A 4S04A 2IT0A 3TGNA 1UCRA 5DYMA 3IWFA 2FF4A 1YO5C 3F8BA 3DPTA 3J80Z 1VTNC 2BYVE 2CSOA 5CVJA 3VEPA 1IRFA 3DF8A 1JXSA 3VB2A 1HBXG 2F5DA 1D8JA 2NNNA 2QYOA 2VN2A 3TKYA 1TQIA 5AIQA 1IXRC 1E17A 3ULQB 5CJ9A 3GXOA 1IN7A 5L3DA 2EK5A 4JK1X 3RTRA 5FO5A 2DI3A 3WTVC 1FBSA 5CYVA 4RAZA 4KA4A 3RJPA 4HYEA 2PMUA 4XSXF 3L7WA 4A2UA 2Y0MA 5D4SA 3IHUA 4G94A 3M9AA 4Z2YA 5LGTA 2GA2A 2Q0OA 2RN7A 4UVAA 2FMLA 5HS8A 1H9TA 3TDUC 3ZP5A 4OIOF 5JFRA 1EH6A 3CO7C 2ELHA 1ZRFA 4HOBA 3BPVA 1LQ1A 2RC4A 4Q47A 4P9UA 1JGSA 3JTGA 3EUHA 3T8TA 5FD5A 5LBQA 2PQ8A 4XRFA 1QGPA 1J2XA 4XSZF 5LEJA 3L00A 4O5VA 3IC7A 4Q4ZF 4RGXA 5KK1A 5DUIA 2IJLA 2F5FA 5E20A 3OOPA 3JW4A 2JRTA 4WXHA 3V7CA 5LRSA 1LDJA 1R1VA 1U5TA 1TQPA 4IHTA 1AWCA 3I5UA 2QBYB 5D8KB 1RNLA 1I6XA 4P96A 1DP7P 2MC3A 1B1BA 5IT9K 1KU9A 4LB5A 4RB2C 2GIVA 3CUOA 1TQMA 2O0YA 3QU3A 1IAWA 2W85A 2L3DA 4NB5A 2CWEA 4G9YA 2XASA 4KN7X 1WQ2A 3KLNA 5F1RA 2V1DA 3KFWX 3HRTA 3MEXA 4LLLA 1OYIA 1F5TA 4LMYA 3F3XA 4L9TA 1K78B 3IWZA 3WTSC 1BBYA 5K5RA 2OZUA 1XSXA 2P5VA 5H6RA 1FYMA 1UB9A 2MBFA 2FU4A 4YIIA 1FX7A 3WTTC 5JI6A 4ESBA 3T1BA 1W7PB 1T98A 3C3WA 3NQOA 3BDDA 5HS9A 1CF7B 5TRDA 5E18F 1K79A 2E7XA 1R22A 1B6AA 3WTUC 2XAHA 5LRRA 1ODDA 1B9MA 3ZQ7A 3GVAA 3GUDA 4IHSA 3EYYA 4QLCU 2CG4A 3C18A 2HTJA 3ECOA 1I5ZA 5H20A 4LLGF 1GXQA 1YYVA 3TDZC 3GO5A 2EA2A 3F6VA 4A0YA 3KEOA 4UNOA 3KP7A 2FOKA 3O2PE 1YFHA 3GF2A 1STZA 1LVAA 1MJ9A 4ENNA 3IKTA 3R61A 3I64A 5HDKA 1WI9A 1SMYF 3DPLC 4A5NA 1WSUA 4I02A 1B59A 3JSPA 4BHPA 5CVVA 1LEAA 2EFOA 3ABUA 4OINF 2STTA 4I2OA 4IRGA 3FM3A 4ZYEA 3I58A 4EM1A 1DUXC 3ERED 1QNTA 2RGVA 3GZ6A 2NS0A 1IN5A 1TNTA 2K02A 1ZLJA 1XMKA 4AIHA 3E3VA 4IPAA 1EH8A 1XN7A 3SXYA 1W7PA 2VOPA 2DU9A 4N9HA 2QUFA 5FLXK 3O3KA 4M6YA 1IF1A 1LDKB 5LHHA 4BAYA 3LWFA 4HAMA 5EEHA 2VBYA 1G3SA 2HQRA 4HF0A 1S3JA 4XLPF 4I7HA 1ZYRF 3EETA 3ZMTA 5DDGA 1XSVA 3Q5FA 2YR2A 4NHJA 2NRAC 3BPXA 5ILVA 2GAUA 4BHCA 1Y0UA 2FEZA 3BY6A 2VT3A 2FMYA 2DT5A 1BM9A 1YTYA 4LD5A 2DPUA 3REOA 3B73A 5BMZA 5ED4A 1G6NA 1G4DA 4CGZA 2VODA 2L4AA 1KQ9A 3W6JB 3U9GA 3I59B 3ZMDA 1IXCA 1EH7A 5LEKA 3F72A 3BOQA 1OYYA 4YFKF 3B02A 1GXPA 2M8EA 5BOXA 2F2EA 4HF2A 1REPC 3R0JA 5FFXA 3E97A 3L2CA 3S2WA 2PLYA 1W7PD 3BZ6A 5FB2A 2H94A 1P2FA 2PJPA 4S05A 1FC3A 5D6EA 1K6OA 5HS7A 1OPCA 4WF2A 4M9SA 2MD5A 4M74A 4L9JA 2VBWA 2GQQA 2VE9A 1QBJA 1RI7A 5DUKA 4G6QA 1J7KA 1KQ0A 3M1EA 4EJWA 4EMSA 1SD5A 1SAXA 1QQIA 3KZYA 2BEOA 2JZYA 1AOYA 2HFHA 3PQJA 1ZREA 2LSOA 2OBPA 3IRRA 4CDGA 1P6RA 2ETHA 3J81K 4MTDA 4Q5SF 2DTRA 3GW2A 1J9IA 2X0LA 1IXSB 2JTVA 3CDHA 4GO1A 3WGIA 4O3MA 3D0SA 1IZ1A 4HBLA 4NQWA 3T5XA 3HSEA 2O6GE 2J5PA 3CLOA 4HLXA 3JAMZ 2CGPA 3WTXC 5J8FA 2F5CA 4RGRA 4AWXB 4ON0A 2KIMA 2RQPA 4U88A 3GLXA 5K5OA 2ESHA 2ZKZA 4R8HA 5BPIA 1ZN2A 2C6YA 4L5JA 1R1TA 4RS8A 1R1UA 3GFIA 2RV8A 5BPDA 4OMYA 1QO0D 4LLNA 4BQAA 3WE3A 2KIFA 3CTAA 2O61A 1SD4A 3F8MA 3KP5A 1F9NA 4K2EA 3QRFF 3E5QA 2ACJA 1TTYA 1R36A 1IUYA 1FP2A 1YG2A 1U5TB 1UFMA 4KUMA 4G7ZF 1HXDA 3DQVC 2DW4A 2Z33A 5EEGA 1GVJA 3L9FA 4N9IA 3BWGA 4I98B 1W5SA 5L3CA 2X4HA 3MZHA 3F22A 4ZH4F 3L09A 3QP6A 1HKQA 2V1XA 2DPDA 4RB3C 3BJ6A 3F21A 1Z9CA 4CYDA 1O57A 1ULYA 3R4KA 4BYYA 1R5GA 1U78A 3Q9SA 3PQKA 3G3ZA 4R79A 4XLNF 4WXDA 3FM5A 3V8LA 2K7LA 1B4AA 4EQQA 1Z05A 1S29A 1USTA 1MJAA 3EDPA 5CVRA 4EGZA 2E1CA 1V3FA 2V9VA 1K7AA 2GWRA 3GFJA 3WU1B 4L9NA 1JE8A 1BIBA 2IVMA 4EVIA 3E6DA 3MQ0A 4FX4A 3KE2A 3TQNA 1MKMA 4LJZF 4OIPF 1HQCA 1IN6A 4L18B 1KU3A 4IF4A 3K1PA 2E1NA 3WG9A 3JAMK 4U0YA 2DK5A 4L0YB 1BN5A 4DNCA 5HOOA 4OIQF 4L0ZB 2D1HA 3TOBA 5FD6A 3ABTA 3MFKA 1S7AA 1S8NA 2HOEA 1O3RA 2EV6A 2XAJA 2A6EF 3WTZA 4MEYF 1YW8A 5L3FA 1FP1D 2VBXA 4M9ZA 5KVRA 5DCMB 2QENA 3KEQA 3GYHX 4LFUA 2DFIA 2KIUA 1BIAA 4BHBA 2P7VB 4KIFA 4G7HF 2FRHA 4EJVA 2UZKA 2EFNA 2RNJA 1ONVA 1IRGA 2MLGA 2EB7A 5A2QZ 4PGHA 3ZMZA 4OOIA 2W24A 3KP3A 1Q1HA 5DCFA 4A5MA 2P8TA 1A04A 1FZPB 4KICA 1Z6TA 3HOTA 2EV0A 3C7JA 3KLOA 3PFIA 3SQNA 5ILUA 1TNSA 4IRIA 4WX9A 5LHGA 2DLLA 1D5VA 3FHZA 1TW3A 1U5TC 5L3BA 5AIPA 2FNPA 1WWXA 3RKWA 4HA8A 2ZXJA 3FZVA 4CO8A 1W5TA 2CW0F 1T38A 1SD7A 3U2RA 2NNYA 3M8FA 3SZTA 3TO9A 3BJOA 5LGUA 4L9VA 3Q9VA 4WXCA 2A07F 4WWCA 4AIKA 1BI0A 4I01A 2Q2EA 2YSRA 1H0MA 1QPMA 3NRVA 3TO6A 4HDVA 2L4MA 4AD9A 2XGXA 3I54A 1UHMA 1ZGJA 3M8EA 2PI0A 4HX4A 4UV9A 5DD8A 2XIGA 2OD5A 3KP2A 3HIFA 5D4RA 1KYWA 4KT5C 4KYWA 3RPUA 1R58A 1HSJA 3H3ZA 2Z5UA 1BI2A 3MWMA 2IRFG 2B0LA 2YU3A 3ELKA 4KMUX 4O6JA 3C1DA 2Z3YA 3QPHA 4IRHA 5HLGA 4BXUA 3K2ZA 1QZYA 2H6BA 2ZNZA 4ZYGA 1PUEE 3HUGA 1RUOA 5ERIA 3F8FA 4ESJA 3K69A 2KJCA 1ZGAA 2XKPA 3V8JA 3WTWC 4AIJA 2M87A 3TOAA 4M71A 1U8RA 2XKOA 3FXQA 2PBIA 5F64A 2JT1A 2LDUA 3U1DA 2A69F 2XAFA 2QLZA 2A61A 1CGPA 1FYKA 2RVCA 3QPTA 3SFZA 2ZMEA 1XCBA 4ETSA 1ZH5A 1LDDA 2PFBA 2VT2A 3M7GA 4IXAA 3GEZA 2M1BA 2LKPA 1L0OC 4MQ9F 1YS6A 3IKVA 4D0PA 2IP2A 5DV5A 3FMSA 3K9TA 1OYWA 2M30A 1IN4A 1P92A 1YQAA 2M5WA 1J5YA 4FT8A 2VONA 2GXGA 2D2WA 4UV8A 1KYZA 2QQBA 2D1VA 4Y13A 4GYIA 3GX4X 4WK8F 2OZ6A 1O7FA 5D8LB 4HV5A 3HHGA 1KQ8A 2A6HF 3P7NA 3SHFA 2BE5F 2GXBA 3T8RA 2MH9A 2YX4A 4UUVA 2G9WA 4HQEA 4U0WA 1XDUA 4HQMA 3CUQC 3GFMA 3HTSB 5ILSA 4A6DA 2KKOA 5E1XA 4MEXF 5LLQA 3BROA 1T0FA 4MHGA 4UXNA 2RKHA 4I09A 5AONA 5JVTA 3R6SA 2A5YB 2K86A 3EYIA 1XDSA 3I4PA 4RB1A 2WV0A 4FX0A 3RYRA 3P9IA 1BC7C 5D5VB 4PDKA 3RIRA 4ZZLA 3O6BB 2WWYA 3IL2A 1FSHA 3T0YA 2OU2A 2GZWA 1G3WA 5J6XA 2P6TA 4Y15A 2W84A 1XGNA 2HZTA 3FXRA 4KIGA 3NEUA 1JHFA 2P6SA 1SFEA 5HLIA 2LNBA 3KP6A 5DEQA 1MJBA 4YG2F 2O8XA 4LGWA 2FQ3A 3G73A 1FSEA 5FLXZ 4KNYA 1RIOH 5E1ZB 2LF7A 2UXXA 1T6SA 3ZPLA 2D45A 2EFQA 2Z9OA 4YIFA 1E2XA 3ML6A 2PEXA 2A3SA 5CVIA 1OKRA 3HHHA 3VOEA 4M9XA 3ZMSA 1GHCA 1MDMA 3AAFA 1XCVA 4OU0A 3D5LA 2G7UA 5LHIA 1EV7A 4IJAA 4G7OF 1JHHA 1OMIA 3P9CA 4GCVA 3LAPA 2MH2A 2Z99A 1U3EM 5F6FA 3VODA 1UHWA 3J80K 2O3FA 2CYYA 3RPQA 3SZPA 2TDXA 5HVQC 1FYLA 3P9KA 5IT9Z 3MAJA 3MCZA 4UVCA 1FBQA 5HLHA 2ADUA 2WC2A 1ON1A 4GYGA 4HW0A 5E1WA 4LG0A 4QWQA 4EM0B 3DV8A 2PMHA 1TW2A 2OA4A 4ZZDA 5CLSA 1SMTA 3IRQA 2HWVA 2OQRA 1HKSA 2KRFA 2CO5A 4LK1F 1W4MA 4ZYDA 1LEBA 4B8XA 5ICCA 2FNAA 5HDNA 4U7DA 3V7SA 4M6XA 5K1YA 2H09A 2BV6A 1O3SA 2H6CA 3LA2A 2COMA 5JR3A 4LB6B 1IN8A 1G3YA 1HSTA 4YFXF 2M45A 1J59A 3WU0A 1P4XA 1FWZA 1XSDA 2QQAA 4KIBA 3KCCA 1DPUA 1ZRCA 2R7DA 3I53A 1KU7A 2STWA 3LFKA 4P55A 1R7JA 4N0BA 3RDIA 5L3EA 6PAXA 2HEOA 1F4KA 4EJUA 5ICGA 3R60A 1S6LA 2O03A 3TO7A 1CF7A 2ZO4A 1NHAA 1OR7A 2DO7A 4ZYHA 1P4WA 2ISYA 3F8CA 4Q48A 1XD7A 1Z6RA 2CQKA 2BGCA 2HKXA 3KP4A 2HDCA 1F1ZA 2VE8A 1O3TA 3MZYA 1BC8C 1IW7F 3BJAA 1XGMA 5LGNA 4CHUA 2NAZA 3J81Z 4EV0A 3QAHA 2W25A 2OQGA 1ZRDA 2DAOA 1I1GA 2HKOA 1FT9A 3HRMA 3I0TA 4MQVA 1O3QA 5HDGA 1I1SA 4XBFA 4GGGA 1FY7A 3CUQB 2A68F 4OMZA 2ZCWA 4ENKA 4KDPA 2F5EA 1ZG5A 3J7AO 3F8NA 5DD4A 3FMRA 4BNCA 2ZBKA 1HW5A 4A0ZA 2FA5A 2XAGA 2EFWA 1Z7UA 1MDMB 3E5XA 2OAZA 2HR3A 4U0VA 3LAJA 1ZG3A 3I71A 1FPQA 3QOPA 4A12A 2IA1A 1YS7A 4PCQA 3I59A 2XVCA 4CZZA 4L5IA 2HQNA 1YW7A 2Y48A 2VC1A 2ISZA 4Y17A 2MLKA 2YX7A 3COAC 2JPCA 1U6GA 2VC0A 3E5UA 5ICFA 1USSA 5H6QA 5BS6A 4PZJA 4KMFA 5E17F 2FBHA 3FX3A 3WTYC 2P4WA 5BQTA 4UVBA 1Z91A 2VOOA 2W57A 1YIOA 2IA0A 3N97A 3WGGA 5D5UB 2FXAA