1EH7A

Methylated human o6-alkylguanine-dna alkyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
161
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 161
sequence length 172
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh7A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh7A01
3ZPLA 5A2QK 3K1MA 4HQEA 1KU7A 1ZREA 3M8EA 1O3SA 3IKVA 4KN7X 1R5HA 3OOPA 5JR3A 3R0AA 1ON2A 2PG4A 4KMUX 4R1HA 1FX7A 4HX8A 3WTTC 3C1DA 3HSRA 1U2WA 3HTSB 2DLLA 5KVRA 3U9GA 2CG4A 5K5RA 4G7HF 1STZA 1J2XA 4XRFA 3FHZA 5FLXK 4FT8A 2D45A 1F9NA 3PFIA 3BOQA 1UB9A 2FE3A 2HDCA 2YSRA 1IUYA 5DEQA 1WI9A 1ON1A 3V7CA 5ILVA 1BI2A 5L3CA 3ZMDA 2V1UA 2H6CA 1BI3A 2LDUA 1R7JA 4IHSA 3EQLF 1BN5A 3ABUA 5LEKA 2XAGA 1ZRDA 1SD5A 2CSOA 4A6EA 2J5OA 3MQ0A 2VOOA 2HQRA 2A68F 1YLFA 2DTRA 1MGTA 3TO6A 3T1BA 2XKPA 3K1PA 2H94A 1REPC 4ZYEA 2EA2A 2QQAA 4RGXA 3V4GA 2O6GE 2H27A 3R60A 3V8KA 3TDUC 5FFZA 2QM3A 1FNNA 4ZYHA 2QENA 2VC0A 4HA8A 4EJWA 4ENKA 1XCVA 2IW5A 2Z33A 4YIIA 1SD4A 5BMZA 5IT9K 4KNYA 1KQ8A 4OIRF 3ZQ7A 3E6CC 2AXLA 1BM9A 3HIFA 2WC2A 3HRSA 3K69A 4HQMA 3FXQA 3JAMK 2KIFA 1YQAA 3FZVA 1XCBA 1KYZA 4KDPA 3NQOA 1LDKB 4G8XA 4KIGA 6PAXA 1P4XA 1R22A 2O61A 1W7PD 4AIKA 3L2CA 1ZN2A 3C3WA 3GFIA 3CDHA 5HLHA 4KFCA 3FMRA 4P5OA 4BH9A 1CGPA 3RKXA 1IRGA 1USSA 3QRFF 5EEHA 3O2PE 1TNSA 4N9HA 1XSDA 4YFNF 4G94A 3GFMA 1I5ZA 3BJOA 1IN6A 1HSTA 1S7OA 4P9UA 5CVRA 2LF7A 2XAJA 4OIPF 2XGXA 5CJ9A 3F8CA 1RUNA 4Y15A 1LVAA 1FOKA 3GWZA 5LHGA 3I71A 2MC3A 1K7AA 4DQ2A 5ICGA 3DF8A 2GWRA 4M6YA 1I6XA 1GXQA 3BDDA 2TDXA 3L7WA 4OU0A 2WWYA 3P9IA 4CDGA 2ZCWA 2HZTA 5DCMA 2AS5F 2OAZA 4RGRA 1ODDA 5DD4A 2GA1A 4UVCA 4RB3C 5LHHA 2L3DA 1R1UA 3R0JA 4M72A 2F5FA 5E18F 3R6SA 1AOYA 3DPTA 1XDUA 1G6NA 4CXFA 1USTA 2IVMA 4P96A 2HR3A 3GW2A 4CYDA 4PDKA 4LB6B 1H9GA 5D5VB 3F8NA 2VT3A 4WF2A 4KA4A 1HBXG 1OR7A 2OZ6A 1ULYA 3GXOA 1ZHFA 5FD6A 4HF2A 5D8LB 4K2EA 2VODA 4NQWA 3T8RA 2Q2EA 1SD6A 2IA1A 3H3UA 3HUGA 5LEJA 4MTEA 4HDUA 1R5GA 2XAHA 2P6SA 1SFXA 4HX4A 2JTVA 2HYGD 4HOBA 1RI7A 2L02A 3TO9A 4IPAA 3QU3A 1G3WA 4U0WA 4FX0A 2KIUA 1FBQA 4MNUA 1KU3A 2EV0A 1MJ9A 3HRUA 2VXZA 2W85A 4F7ZA 4GYIA 2YU3A 4EGYA 1DPRA 2PJPA 1PDNC 2FMLA 4KT5C 1L0OC 5H6RA 2NNYA 2NYXA 2V9VA 4BYYA 4RGSA 5D5WB 3ECHA 3FXRA 2RN7A 2PMHA 1W7PA 2QZ8A 4OIQF 4I0AA 3GEZA 2UXXA 1IN7A 5F6FA 3MAJA 2QUFA 4NB5A 4CHUA 3V7RA 5BS6A 4GXOA 2YX7A 1BC7C 4OMZA 1ZYRF 1VTNC 3O3KA 4CO8A 4RB2C 1Z91A 3F6VA 3NEUA 1YTYA 4UVAA 2F2EA 4LMYA 1TNTA 1B4AA 4M73A 1D5VA 2WTEA 1LDDA 3FXUA 1O3TA 2P8TA 3QAHA 3GX4X 4N0BA 3F21A 3S2WA 1FBSA 3JW4A 2D2WA 3DQVC 4UHTA 5LGTA 1MD0A 5DCMB 2QQ9A 1QO0D 3ZP5A 1MJAA 1IW7F 3E6BA 4A6DA 4EJTA 4WXCA 4EMSA 4NHJA 2FBKA 3ZMZA 2OZUA 5L3BA 1IXCA 3G73A 3J81Z 2DO7A 5D5XB 4ENNA 2GXGA 1ZGAA 3ZMVA 3WGGA 2QWWA 3TQNA 2ZFWA 3QP5A 1BBYA 4EQQA 4YFXF 5DV5A 4L18B 2A69F 2HTJA 1J7KA 4ENMA 4ASNA 4ZZLA 4I7HA 2ESNA 2GQQA 4BHBA 4A0XA 1FT9A 5E1ZB 3TKYA 1SMTA 2P7VB 1EH8A 2LNBA 1Z1DA 3TO7A 4RAZA 1FYLA 2CFXA 4I2OA 1ZRFA 2FBHA 3HRMA 2ACJA 2X4HA 2R3SA 5L3GA 3GLXA 4DNCA 1TQPA 5FFXA 1J0RA 1XMKA 4UXNA 1FBUA 1G3SA 1U8RA 4A5NA 2LKPA 2M8EA 5HDKA 1W4MA 3FMQA 2FOKA 3Q5FA 4HV6A 2F5CA 1TW3A 2XROA 2PBIA 1T2KA 2HYFA 4TV7A 3JTGA 1P6RA 1BI0A 2KJCA 1H0MA 4JQFA 4HLYA 2EB7A 5ERIA 1W7PB 2P4WA 1NHAA 1Z05A 2VC1A 3VFZA 1XSXA 2K7LA 2FRHA 1V4RA 2BE5F 4KUMA 4B8XA 2ISYA 3RI4A 1AWCA 4UV9A 2GXBA 3I64A 3CLOA 2VBWA 1S3JA 3MCZA 1W5TA 4WWCA 1IF1A 3T8TA 3GYHX 2EJRA 1HW2A 5AIQA 3OV8A 4U0YA 3RYRA 2A07F 3J7AO 4I0BA 2YR2A 5ILSA 4O5VA 1DPUA 5HDNA 3EETA 2H09A 2YPRA 2C6YA 1ZARA 2ADUA 1S6LA 3I58A 4LK1F 5D4SA 2P7CB 3F72A 2HKXA 4LG0A 5FD5A 2CQKA 5JFRA 2VN2A 5J8CA 1KU9A 3LWFA 2COMA 1MDMA 2ZO4A 5CLSA 3N4MA 3RIRA 1QZYA 5IT3A 5JHUA 1T38A 4M71A 3MZYA 1ZG5A 5BPDA 2O03A 2FNPA 2IP2A 1SAXA 2FMYA 4ON0A 5ILUA 2EWNA 3RTRA 1B59A 4BHCA 2MA3A 4XLNF 1V3FA 1QQIA 2M5WA 4HW0A 1FP2A 2IRFG 1KGSA 4E70A 3WGHA 2Z99A 4HF0A 2MH2A 3L09A 5HVQC 3H3ZA 1S7AA 2EFWA 2LF8A 2EV5A 2B0LA 4L9VA 2ZJ2A 3JSOA 1GHCA 1IZ1A 3ULQB 1I1SA 3M7GA 4L5IA 4OOIA 3I4PA 2DU9A 4Q5SF 2G7UA 3BPVA 3RKWA 3I54A 5E1XA 2Y48A 1SFEA 1OMIA 3KP3A 2M30A 3REOA 3GFJA 1ZG1A 3PQKA 3U1DA 2OA4A 3DEUA 1EH6A 5CYVA 1XD7A 3LFKA 4R8HA 2MLKA 4IRGA 1YS7A 4L0ZB 2IPQX 3V8LA 3KP6A 4Q47A 4ESJA 3CUQA 1UHMA 4I09A 2K4BA 2CYYA 4CICA 4U0VA 1HW5A 4EGZA 4OINF 2D1VA 2BV6A 3R4KA 5ED4A 1T39A 1P4WA 4ZYDA 4PGGA 1R1VA 5TJJA 2PMUA 3SXYA 2R7DA 5F1RA 5J6XA 3FM3A 5LGUA 1Z7UA 1H9TA 3BJ6A 2R7FA 1ZG3A 3QP6A 3KP5A 2L54A 3F3XA 1T98A 4MEYF 1XGOA 1G3YA 2ZMEA 2P5KA 1DP7P 3Q9SA 3CTAA 3CUQC 4KIFA 4KYWA 4LG0B 5CVVA 3FMSA 4M9ZA 2A6EF 2E1NA 5DUKA 2NS0A 1MDMB 3J81K 4WCGA 3SFZA 2P6TA 2ZNZA 4LB5A 1ZLKA 3FF5A 1QZZA 3ZMTA 4H0EA 4PCQA 1LJ9A 2IA0A 3GF2A 4HDVA 3VOEA 3TOBA 4IRIA 3L00A 2E7XA 4AD9A 1TLHB 1PP7U 1E17A 4G7OF 3KE2A 2DK5A 3CO6C 1FYMA 2A3SA 2VONA 2ISZA 1SD7A 3ML6A 3DPLC 1S29A 4LD5A 3SZPA 4QLCU 5D6EA 1OYWA 4EV0A 3C18A 1IN5A 4AWXB 3TDZC 2GIVA 1W5SA 4ZYGA 4IHTA 3ROUA 3GZ6A 1X3UA 1K78A 2OD5A 4IVNA 1SMYF 3BP8A 3KP7A 2BEOA 1IN8A 3SQNA 3GVAA 4OIOF 3KCCA 1U78A 3WTWC 5ICFA 4BHPA 3WTVC 5D8KB 1R36A 3WU1B 2UZKA 1R1TA 1D8JA 3FWEA 5DDGA 2HFHA 4JK1X 3HSEA 4S05A 3KEOA 4G6DA 3ECOA 4G9YA 1MKMA 2NAZA 1G4DA 5AONA 1IAWA 1Q1HA 1ZLJA 2Y75A 3IHUA 5LGNA 3QPTA 3LQQA 4LJZF 4HV5A 4BNCA 3LA7A 2CWEA 4L9JA 2Z9OA 3K9TA 5L3DA 2HEOA 2HOEA 2ZXJA 2JT1A 3DXJF 2PFBA 4QWQA 1IN4A 1J59A 3G3ZA 2O8XA 3KEQA 4UNOA 1P4AA 4HX7A 3GUDA 2HKOA 4UV8A 2DK8A 1QNTA 1XMAA 3BROA 3CUQB 1XSVA 3HTUA 2EFQA 3C7JA 5LRSA 5HLGA 1UFMA 3EUHA 3ISPA 2MD5A 5FGMA 3M9AA 1CF7A 2O0YA 1YW9A 2XVCA 2XUBA 2M87A 2W84A 3W6KB 2RDPA 2KKOA 1R23A 3R61A 3F8MA 3FM5A 2DI3A 4KN4X 2BGCA 2VBXA 5LRRA 2LSOA 1JHFA 4IXAA 5BPIA 3NRVA 1ZGJA 4HAMA 4EM2A 4Q4ZF 2M1BA 5HS7A 2RV8A 3DFGA 2ZMEB 4G7ZF 2VBZA 1ZRCA 3IRQA 1ONVA 1BIBA 1YG2A 3MFKA 2P5LC 1TW2A 1U6GA 2FSWA 4CZZA 1XB4A 1YW7A 3HOTA 2FF4A 3KFWX 3U2RA 2KRFA 4BXUA 1B1BA 1YO5C 5CVUA 1RIOH 2L4MA 3E3VA 4KMFA 1B6AA 1DUXC 4Y17A 3ELKA 5D4RA 1K6OA 4O3MA 4ZH4F 3MWMA 3M8FA 1Z9CA 1UHWA 2ETHA 4Z2YA 4P9FA 2BYVE 3P7NA 1LEAA 3CO7C 1Z6RA 2HQNA 5E8GA 1XGSA 2VE9A 2DQRA 3QOPA 4EJUA 1HW1A 4XLPF 2IT0A 3RPUA 2HGCA 3O6BB 3KP2A 2DAOA 3CJNA 1WKMA 2KIMA 3P9KA 2F5DA 3DP7A 3MEXA 2JPCA 4EM0B 2XV4S 3ZN0A 1Y0UA 4EM1A 2J5PA 3RPQA 4ZZDA 2Q8KA 2DPDA 4HYEA 4EVIA 1S8NA 3ERED 1UCRA 2XRNA 4UVBA 4RGUA 1KYWA 2FU4A 1JGSA 1YS6A 4M74A 2DBBA 2XAQA 3KETA 4HZFA 2PN6A 1GXPA 2O3FA 3RYPA 3RDIA 1FLIA 3LA2A 5CVJA 3EYYA 2NRAC 3KZZA 3IKTA 1CF7B 5TRDA 4FX4A 3WTSC 1I27A 3WE2A 5LHIA 2EFOA 3Q9VA 3WE3A 1PP8F 1D3YA 3F6OA 3M1EA 1ZH5A 2DPUA 4GO1A 4IF4A 3K0LA 1HSJA 2XIGA 2ELHA 2OQGA 4AIHA 1KQ9A 1HQCA 3E5UA 2Y0MA 3E5XA 2DT5A 3LSTA 1HXDA 2QQBA 5FB2A 2W24A 1RNLA 1U5TA 1P2FA 3HSFA 1P92A 1QBJA 3J80Z 2PQ8A 4I01A 3I5UA 5H20A 2GAUA 1XGMA 3BWGA 1IXSB 2EFPA 3BJAA 2IJLA 4LGWA 2Q0OA 3WTXC 1WWXA 3K2ZA 4I98B 1O7FA 2P5VA 2EK5A 3HHHA 3VODA 1EH7A 2V6CA 3WTYC 2A6HF 3TOAA 1MZBA 4B09A 4L0YB 2STWA 2Z5UA 3F22A 2K27A 3ZN1A 1LQ1A 1LNWA 4BAYA 3CUOA 4PGHA 4XBFA 3EDPA 1HKSA 1KU2A 1U5TC 2QYOA 2HTSA 5ICCA 2CW0F 2FBIA 1EV7A 2XASA 3BZ6A 2A61A 2RC4A 5BQTA 1FYKA 3KLOA 4Q48A 5HOOA 4CGZA 3K1NA 2E1CA 1O7LA 2EFNA 5DD8A 1G3TA 5DCFA 1YIOA 3F23A 1FC3A 2PEXA 5HS9A 2ZBKA 4WK8F 2FA5A 1QPMA 3SHFA 2QBYA 4S04A 1WQ2A 3LAJA 1J5YA 4L9TA 5HS8A 1BJAA 2VE8A 5A2QZ 2HS5A 2W25A 5F64A 2JPBA 3HRTA 2E7WA 2XKOA 2DW4A 3IWZA 5J8FA 4Y13A 1Z6TA 2HWVA 2H6BA 3FX3A 1J9IA 3KP4A 1FY7A 1O57A 2XHKA 3DV8A 1SFUA 1IRFA 4MTDA 3I59A 5H6QA 1LB2A 1R58A 4LLGF 4M9SA 3L9FA 5FLXZ 2KJBA 1BOAA 3IC7A 2UWMA 2A5YB 1DDNA 3P9CA 2EV6A 1D8KA 1TQIA 5K1YA 4WXDA 2GZWA 1T6SA 5DYMA 4MEXF 3D5LA 1KA8A 1MJBA 1J75A 2BBYA 2JSCA 2WV0A 2VT2A 3V8JA 5D5UB 4MQ9F 4L5JA 3HYIA 4WXHA 3QPHA 4HBLA 3LA3A 1U5TB 1BC8C 3RKYA 3PQJA 4RB0A 5E20A 4LLLA 4U88A 2EA4A 2L01A 4M6XA 2OQRA 1JE8A 2Z3YA 4OMYA 1B9NA 1LDJA 2K02A 4MQVA 5EEGA 4LLNA 1FZPB 3KZYA 1HKTA 2GA2A 4IRHA 4UUVA 3LAPA 2STTA 1BIAA 4ESFA 5BOXA 4A5MA 5D6FA 2CGPA 1IXRC 3B02A 1O3RA 5IT9Z 3ABTA 4GCVA 1TBXA 1TQMA 4A12A 4YG2F 2DFIA 1YYVA 4JBAA 5CVIA 4YIFA 1RUOA 5L3EA 1R00A 4G6QA 1U3EM 2QLZA 4XSZF 4U7BA 1OYYA 3JAMZ 5E1WA 4FHTA 5HDGA 3T5XA 1HKQA 1F4KA 2UXNA 4RS8A 3GFLA 2VOPA 3WTUC 1PUEE 4AIJA 1I1GA 3EYIA 1B9MA 5LBQA 1RZ4A 1XGNA 2FXAA 4GYGA 4GGGA 3QU6A 1FP1D 3V7SA 5HLIA 3F8BA 3MZHA 2K86A 2OU2A 2QBYB 1XDSA 2ESHA 3W6JB 2VBYA 2G7HA 2X0LA 2OBPA 2NNNA 3JSPA 2M45A 4EJVA 1QGPA 2MBFA 3E5QA 4KICA 4RAYA 3RJPA 1BI1A 3WGIA 1OPCA 1YFHA 1WSUA 1FWZA 4D0PA 1XN7A 4YFKF 4KIBA 2FNAA 3BPXA 1GVJA 4HF1A 4M9XA 2L4AA 1K79A 2JRTA 1F1ZA 4I02A 3GO5A 3I59B 2FEZA 2V1DA 2W57A 2D1HA 1L3LA 3I53A 1LEBA 3I0TA 3D0SA 2PLYA 4O6JA 3ZMUA 4XSXF 1C0WA 2G9WA 3LQRA 4A0ZA 3IRRA 3WG9A 3GZ5A 3E97A 3DKWA 2CO5A 4N9IA 3BY6A 3JTHA 4EJOA 3E6MA 3SZTA 2YX4A 4PZJA 3COAC 1KQ0A 1FSEA 3HHGA 3IL2A 5E8IA 4U7DA 2IA2A 1T0FA 3VEPA 2RKHA 4ETSA 2ZNYA 3J80K 1FSHA 2PI0A 2RQPA 2RNJA 4P55A 5K5OA 3T0YA 2QVOA 5ICEA 2K4JA 4A2UA 4A0YA 1WRJA 2F5EA 5E17F 3B73A 1ZAOA 5JI6A 1E2XA 4MHGA 5DUIA 2JZYA 5L3FA 1OKRA 1F5TA 2V1XA 4AVPA 2DQLA 1JHHA 4LK0F 5LLQA 5K5QA 3IWFA 1OYIA 1K78B 2RGVA 1A04A 4MGRA 3TGNA 2ZKZA 5AIPA 3H92A 3VB2A 3N97A 1YW8A 3WU0A 1O3QA 4ENJA 4WX9A 2FQ3A 4IJAA 3WTZA 5JVTA 4L9NA 3HOSA 4ESBA 5FO5A 4HLXA 2RVCA 1FPQA 4RB1A 1JXSA 3KLNA 3WODF 4LFUA 2MLGA 4R79A 3F8FA 3E6DA 5KK1A 2MH9A 1TTYA 3AAFA 2V79A 3ZMSA 4BQAA 2XAFA
chains in the Genus database with same CATH superfamily
3ZPLA 5A2QK 2DOFA 3K1MA 4HQEA 1KU7A 1ZREA 1WH7A 3EPHA 3M8EA 2KQRA 3IKVA 1O3SA 4KN7X 2M4KA 3K4NA 4PSWA 3VWBA 2R93J 1BR4A 4BMJA 3CP8A 1R5HA 3OOPA 5JR3A 3K6QA 3QG5C 3R0AA 3JR9A 1ON2A 3J7AG 1NG6A 2PG4A 4KMUX 4R1HA 4CCNA 1FX7A 3NAUA 4BC7A 3H0DA 4HX8A 3WTTC 2V89A 2ZM6E 3C1DA 4FE4A 2L6MA 3HSRA 3OYNA 4CYCA 4DW6A 1U2WA 3HTSB 2DLLA 3JREA 5KVRA 3U9GA 2FGGA 2CG4A 3MHHC 5K5RA 2L3CA 3Q0UA 4G7HF 1STZA 1ORKA 5EDNA 2EN7A 2M9AA 2VL8A 5IPAA 1J2XA 3DPUA 4XRFA 3OYJA 3FHZA 3S2DJ 4P7DA 1YRNA 5FLXK 3THOB 1LFBA 4FT8A 2MDRA 2D45A 1F9NA 2X51A 2CT1A 4Y4RA 3PFIA 3BOQA 4NC7A 2EN2A 1UB9A 2JP9A 2FE3A 2EOOA 4XKBA 5M5WJ 1XC5A 2HDCA 4ZTJA 2YSRA 1IUYA 3VYXA 5DEQA 1WHNA 2WA0A 2LTPA 2LOOA 2RQQA 3MD2A 3ZQGA 1WI9A 1ON1A 1XS9A 3S32A 3V7CA 5ILVA 5M5XJ 4E7JA 1HDDC 1BI2A 5L3CA 3ZMDA 2V1UA 2EMFA 2H6CA 1BI3A 1N78A 1RETA 2EMYA 2LDUA 1R7JA 5M5YJ 2DXIA 5J1RA 4IHSA 3EQLF 1KJKA 2VQFE 3FISA 5EF6A 1EF4A 2DMYA 3CC7I 2R7OA 1BN5A 2IGKA 4JI5E 4OOGC 5J4VA 2VKEA 3ABUA 5F27A 1RRJA 2RSMA 5FROA 5LEKA 4M30A 2XAGA 2JRMA 2EMHA 3CESA 1ZRDA 2LBFB 4R2CA 2W82A 5IYDJ 2HOTA 2DFHA 1SD5A 2CSOA 2R0QC 2XB5A 3MKZA 4A6EA 2J5OA 1N25A 2E2JJ 3MQ0A 2VOOA 2HQRA 2NABA 2DYRH 3DEEA 2A68F 2YTQA 2DMQA 1NK2P 1YLFA 2LO3A 2NOJB 2EL5A 5F3WA 3V42A 3MHSC 4DV2E 2EILH 2DTRA 1JUSA 1MGTA 2M34A 3TO6A 3T1BA 2XKPA 2XGEA 3K1PA 3S3MA 2V85A 2OC6A 2H94A 1REPC 4ZYEA 3U1KA 5EGOB 4KISA 3ZQCA 2EA2A 2QQAA 4RGXA 4H4KC 3V4GA 2UXDE 1H89C 2L7MP 2O6GE 2H27A 3R60A 3V8KA 2M3AA 3LMMA 3TDUC 1X3ZB 5AE2A 1W36D 2EPNA 5FFZA 2QM3A 2EE8A 3PSFA 1FNNA 1J09A 2EZIA 2QENA 2VC0A 2VQCA 3M8JA 4HA8A 4EJWA 4ZYHA 5IY5H 1P7IA 4ENKA 1XCVA 2IW5A 2Z33A 2LR8A 4AUXA 4YIIA 1SD4A 5BMZA 4A3CJ 5IT9K 2NVUB 4KNYA 1KQ8A 3J80C 1MMDA 3S1MJ 2MYSA 5E3MA 4OIRF 2E72A 3ZQ7A 3E6CC 2M2EA 1XMXA 3AG1H 1N33E 3K10A 1Y56A 3M99B 2V9KA 1A6QA 2AXLA 4D9JA 3VHTB 1BM9A 2CFOA 3HIFA 1NH3A 2WC2A 2EOIA 1TWHJ 3HRSA 1VQKI 3K69A 1BBGA 2W1OA 2R7RA 3D1NI 5IWAE 3CJRB 4HQMA 3FXQA 3J7YJ 2QKLB 4MFDA 3VK6A 4R2AA 3JAMK 2KIFA 4AIDA 1YQAA 2VIXA 3FZVA 5C44J 1XCBA 4A3MJ 5A69A 1UN6B 3RSNA 1KYZA 1TP4A 1OJLA 5IXMB 2I13A 2WBMA 4KDPA 4UUSA 3NQOA 2JXPA 1N32E 3OS0A 1TN9A 1LDKB 3KYCB 4G8XA 5IP9J 2LH9A 2FUG2 2FX0A 4DR1E 4KIGA 4B43A 3OL3A 2GOXB 6PAXA 4DV0E 1WJFA 4D7MA 1P4XA 1R22A 2JA6J 4DV1E 1E3HA 4IHYA 2O61A 3IUOA 1LFPA 1W7PD 4JP0A 4AIKA 1FOXA 3ZCOA 3L2CA 2K3PA 3OYBA 1M1EB 1ZN2A 3C3WA 2DFEA 1SR9A 3OYDA 1WHUA 3BIDA 3GFIA 2QGUA 1EKZA 2BVLA 3CDHA 4FQGA 2ECBA 5HLHA 1W0TA 2NVYJ 4QIWN 5IYCJ 4XRMA 4JI2E 1JTXA 4CCKA 4KFCA 3FMRA 3CQZJ 3KEYA 4P5OA 3RKXA 4BH9A 1CGPA 1USSA 1IRGA 3QRFF 5EEHA 1X5WA 3O2PE 3OS2A 4RH8A 1TNSA 2DA2A 4N9HA 3ABMH 1XSDA 4YFNF 3VSLA 1JKOC 4G94A 3GFMA 1I5ZA 2R7WA 3BJOA 4ZTFA 1IN6A 2BVMA 1HSTA 1S7OA 4BJTA 1G2DC 4P9UA 4DZJA 2DT6A 5CKTA 5F04A 5HLTA 4E7HA 5CVRA 2LF7A 2XAJA 2EOXA 2NS7A 4OIPF 4OX9E 3BZKA 4C2TA 2XGXA 3EPKA 2RREA 5CJ9A 4CYCB 4MIMA 3F8CA 1RUNA 2UXCE 4Y15A 3HDDA 1LVAA 3AG3H 2X9DA 3K4CA 4A3JJ 1Y39A 1VQ5I 1FOKA 1WJ5A 3W2VA 4ZJZA 3H3VK 3GWZA 2TCTA 5LHGA 2NUFA 3I71A 2MC3A 2TRTA 1Y0NA 4C2UA 1RESA 1K7AA 2YU5A 2KZVA 1QVUA 4M3BA 4DQ2A 5ICGA 4B3SE 5FKNA 3DF8A 3OIOA 2GWRA 1Z7LA 4IHXA 5J3LA 2H1LA 1MMSA 4M6YA 1I6XA 1YRNB 1WJEA 1G2HA 1GXQA 1S9HA 4EATA 4F55A 1ZK8A 5DM6F 4IHWA 1ZKGA 2KFDA 3BDDA 2TDXA 4ITVA 3OYMA 3ADJA 1IRXA 4HEA2 3L7WA 3S1RJ 4I8OA 4L5EA 5LD2C 1IQOA 4OU0A 3LFUA 4ZDLA 2WWYA 3P9IA 2L9RA 3FXMA 1JI8A 1EA3A 4CDGA 3JCUC 4F9CB 2ZCWA 2HZTA 5DCMA 2AS5F 1A1KA 2EIKH 3SJMA 2OAZA 1QU6A 2BZTA 2UUZA 4RGRA 3PIOF 1ODDA 3HGGA 5DD4A 2GA1A 4FASD 1VQ6I 4UVCA 4RB3C 2KDOA 1R1UA 2L3DA 5LHHA 2LMZA 3R0JA 3OYGA 4M72A 2F5FA 5E18F 3R6SA 1AOYA 3DPTA 2VE7C 1XDUA 4E6KG 2CV0A 3BT9A 4CH7A 1E3PA 4C3JJ 1NTCA 3EQ1A 5FLXC 1I3AA 1WCMJ 5F0CA 1MNEA 3HOUJ 2M4IA 2MABA 3U21A 3HOYJ 1G6NA 2XPUA 1ETXA 4CXFA 5TSEA 1N36E 3I55I 2JVGA 1USTA 1ZR2A 2LV2A 5E3LA 2IVMA 2JOXA 3PNYA 2L7FP 4P96A 4EEFG 2HR3A 4A3EJ 5K7FA 1SEUA 3K4JA 3GW2A 4CYDA 4F93B 1YPNA 4PDKA 4LU9A 3JRCA 4LB6B 1H9GA 1LKXA 2PX9A 2L9VA 2LJHA 5D5VB 1MBKA 3F8NA 2VT3A 4WF2A 4IL6C 4UUTA 5M3FJ 4KA4A 1HBXG 1OR7A 2GLOA 2OZ6A 1ULYA 3GXOA 4QPQA 1ZHFA 1D1CA 4BBRJ 4A3KJ 5FD6A 4XN3A 3ZQIA 3F9KA 4DUZE 4HF2A 5FLVA 1JKRC 4D5FA 3VDXA 2UXBE 2EM2A 3S15J 4FISA 5D8LB 3RPUD 2YTFA 4K2EA 2VODA 4NQWA 3T8RA 5J1UA 2Q2EA 1SD6A 1UELB 2ME6A 5F0HA 4IOAF 2IA1A 1UMQA 3MSWA 3G6EI 3H3UA 1R5ID 2JJ7A 2WADA 3OYIA 4NUBA 2CU7A 3ERMA 3HUGA 2YTNA 5LEJA 4B47A 5FKKA 4MTEA 4LFCE 4HDUA 2EM9A 4BBSJ 4XR6A 3ZXSA 1R5GA 2XAHA 1PJTA 3OYKA 5BR8E 2P6SA 1SFXA 5EEAA 4HX4A 4ZYAA 2JTVA 2HYGD 4HOBA 2YSPA 4GRIA 4JI0E 5KAFC 3OY9A 4O5GA 3DLAA 1QRYA 2BY3A 3OYEA 3QPLA 1GQEA 4LF8E 1RI7A 2L02A 3TO9A 3JU0A 4WFTA 2Z16A 4IPAA 3ZOQB 2E19A 2EPRA 4DV7E 3QU3A 2HJJA 5FJ8J 2HZDA 4UUSB 4R03A 1G3WA 4U0WA 4FX0A 2KIUA 1H8AC 2COBA 1DGRM 1FBQA 1SVLA 4MNUA 4D7NA 1UJ8A 4HNTA 1KU3A 2EV0A 1MJ9A 3HRUA 1U8BA 1FJLA 4RAGA 2VXZA 2WAEA 4XONA 2W85A 1TWGJ 4F7ZA 3K4KA 4GYIA 3IAS2 4ZC3A 2YU3A 2L9NA 2ME0A 1FIAA 5C4JJ 4EGYA 2HDDA 3HJEA 5IOYA 1A1JA 1DPRA 2PJPA 2MC4A 1PDNC 2FMLA 2R5ZA 4KT5C 2GHFA 1QVTA 3JAMC 2EMGA 1L0OC 5H6RA 2NNYA 5T6JA 1JGGA 2NYXA 4B3XA 1TT0A 4O24A 3TW6A 2V9VA 4BYYA 4RGSA 4B3ME 3G1LA 5D5WB 1N3GA 3ECHA 2DSYA 2LKXA 3FXRA 1W36C 2RN7A 3CCEI 1T4OA 2PMHA 1AKHA 1W7PA 2E36A 2QZ8A 4OIQF 4IHVA 3ZR8X 1Q1VA 3NARA 1BA5A 3CJTB 4I0AA 3GEZA 3CCUI 2UXXA 1XMQE 1BR2A 1IN7A 5F6FA 3MAJA 2UU9E 2QUFA 1WH5A 3FIGA 5IYBJ 1KZHA 3BGHA 4NB5A 1Y1WJ 4CHUA 1DU6A 3V7RA 5BS6A 4R2PA 4GXOA 2YX7A 1BC7C 4CCMA 4IJDA 4NNJA 3DLLF 4OMZA 1ZYRF 3B6AA 1BB8A 1VTNC 1TL8A 1AA7A 2X85A 3O3KA 4CO8A 2KOUA 3TEDA 4RB2C 1ETVA 1FTTA 1Z91A 5GPAA 3JTZA 2DA5A 3F6VA 3NEUA 3G71I 3PUFA 1YJWI 5AE1A 1VNDA 1YTYA 4W1UA 2HPIA 4UVAA 2F2EA 4LMYA 1XPXA 1SFOJ 1TNTA 5BNGA 1Y8RB 5KL7A 1B4AA 3H5RA 1OCZH 4M73A 2LD5A 2WTEA 3IH4A 3X2QH 1LDDA 3FXUA 5IOZA 3KZIC 1O3TA 2P8TA 2L2MA 3DKXA 3QAHA 1R4NB 3GX4X 4N0BA 2ZJQF 3PFYA 3F21A 2M4GA 1MW7A 3S2WA 3LSGA 4BE2A 1YI2I 1FBSA 3JW4A 2D2WA 3DQVC 1J5EE 2JQ7A 4UHTA 2W7NA 4R2EA 4BU2A 3VPRA 2WY7Q 4BQOA 5LGTA 1MD0A 1WJCA 5DCMB 2QQ9A 1QO0D 3ZP5A 2EMBA 3MZ8A 1MJAA 3IH3A 3GTMJ 1Z67A 1R4MB 1IW7F 2XGDA 3E6BA 4A6DA 2ENHA 4V19K 4EJTA 4WXCA 2O7OA 4EMSA 3O8GA 4NHJA 3NWTA 2FBKA 4KJZA 3VYSB 3ZMZA 3H9JA 2OZUA 3TBIA 5L3BA 1IXCA 3G73A 3J81Z 2XGCA 2DO7A 5D5XB 3SDGA 3OL4A 4ENNA 2GXGA 3VYRB 2LRDA 1ZGAA 3ZMVA 2XPVA 3WGGA 2QWWA 1S72I 3TQNA 2HQ5A 2ZFWA 4UB6C 3QP5A 1X6HA 3EUHC 4BDZA 3S8PA 1BBYA 4EQQA 3C4TA 2L2OA 3UKGA 4QPOA 2EMAA 4M3EA 1WJDA 2B7EA 4YFXF 3T1HE 4BC9A 1T56A 5DV5A 4BXXJ 4HPQA 1FMVA 1Y8QB 4DV6E 4L18B 4NC8A 2A69F 2HTJA 1J7KA 2R5YA 4ENMA 4JI8E 2XF6A 4ASNA 2L2KB 4AQYE 3CCRI 4ZZLA 5C3EJ 4I7HA 2ESNA 2GQQA 4BHBA 2B9SA 1OFCX 2JUCA 4A0XA 3JRHA 1FT9A 5E1ZB 3TKYA 2NXNB 1SMTA 2Y30A 2M8GX 3HPSA 2P7VB 1EH8A 1U9OA 3C2HA 2LNBA 2DMNA 3N05A 3LSHA 4BEHB 1UZCA 1Z1DA 2GOMA 3TO7A 2Z1DA 2R76A 2VJJA 4RAZA 3L2UA 4NQWB 1FYLA 5KL5A 2Q2EB 2CFXA 3G4SI 5A6BD 1YYWA 4I2OA 3LSIA 1ZRFA 3BCAA 2FBHA 2EZLA 3HRMA 3FIWA 3BQZA 4IO9F 2ACJA 1X48A 2X4HA 3CF2A 3RZDJ 4A93J 2R3SA 5FKMA 1IQSA 5L3GA 4E4HA 2KT0A 3GLXA 2VQHA 4DNCA 3ZQLA 1TQPA 4ZDPA 2HVSA 5CQGA 5FFXA 3C6KA 2X6XA 4WSGA 1J0RA 1XMKA 4UXNA 1GDTA 2F4MB 2NA2A 4GKKE 2P81A 4X6AJ 1FBUA 1G3SA 1U8RA 4A5NA 1I50J 2LKPA 2M8EA 2IHR1 2N3GA 2F6CA 2LMDA 4A3IJ 5HDKA 1W4MA 3FMQA 2FOKA 2EOSA 4E7ZA 3Q5FA 2ADRA 1P47A 2K9QA 3IP4B 1A36A 2HXIA 4HV6A 2WAFA 3I3LA 2VF1A 2F5CA 3MN2A 2GPIA 1HNWE 1TW3A 4NDLA 2EORA 4BS9A 2XROA 5AC4A 2LT7A 1XX5A 2NS8A 2PBIA 1T2KA 4NZVA 2HYFA 4TV7A 1MEYC 3TQMA 3JTGA 2MKNA 2R5ZB 1P6RA 1BI0A 2KJCA 1IUFA 3LSJA 1H0MA 1SANA 4JQFA 4PSXA 4HLYA 4A69C 1F2IG 1HR0E 4F52A 5J40A 2LP0A 2EB7A 2QQ8A 1FOYA 5LL6R 2EL6A 3CMEI 2EOEA 2JA8J 5ERIA 5K7ZA 2DA3A 4PUSA 1AKHB 4RA2A 1W7PB 2P4WA 2E5ZA 1NHAA 1Z05A 1MNMC 2EN3A 4DJAA 4TUGA 2L7KA 2VC1A 4II3A 3VFZA 1VQPI 5A6JA 1XSXA 2K7LA 2UUCE 3BG9A 2FRHA 1V4RA 1YX5A 2BE5F 4KUMA 4DYQA 3C4BA 3H9GA 2ISYA 4B8XA 3CP2A 3RI4A 1AWCA 4UV9A 4CCJA 2GXBA 3I64A 2VI6A 3CLOA 2VBWA 1S3JA 4YIRX 1D0XA 3MCZA 1W5TA 4WWCA 1IF1A 2YS9A 2L33A 3T8TA 3GYHX 2EJRA 3D5SC 1HW2A 5M3MJ 5AIQA 2QSFX 4D5CA 1AU7A 4P1WA 1D1AA 3I56I 3OV8A 4U0YA 2HVRA 3TP0A 3HPHA 3G2BA 3L1PA 3RYRA 2A07F 3J7AO 3AV0A 2M9HA 4I0BA 2YRKA 3OMYA 2UUAE 2Q1ZB 2YR2A 2MD0A 1P7JA 2RS7A 5ILSA 3ZOBA 2DGCA 4O5VA 2IS1A 2WV1A 3DTEA 3EETA 5HDNA 1DPUA 2H09A 2V1NA 2YPRA 2C6YA 4A3BJ 1GV5A 3BR6A 1ZARA 2ADUA 2E1OA 2R7QA 5KAIC 1PJQA 4MLOA 3GTOJ 1S6LA 3I58A 4LK1F 1HF0A 5D4SA 2P7CB 2DJIA 2HKXA 3F72A 4LG0A 3OIPA 1VQ7I 4DR3E 2DLKA 5FD5A 5GTHC 4F6NA 1XMOE 2CQKA 5JFRA 2VN2A 3G1OA 5IP7J 5J8CA 1KU9A 3A03A 1BOBA 2Y9YA 3LWFA 2COMA 1MDMA 5JLWA 3C6MA 1NCSA 2GBYA 2ZO4A 4BUPA 4A3FJ 2LLKA 5CLSA 2CQQA 3OSGA 2E1MA 3N4MA 2WAQN 2R7VA 2XPWA 3RIRA 1QZYA 2QA4I 5E3NA 5IT3A 5JHUA 2FD5A 1T38A 4M71A 2L5QA 4BBYA 3MZYA 3DKYA 1ZG5A 2WAQA 5BPDA 2O03A 4Y3OA 4LFBE 3OYCA 2FNPA 2IP2A 1SAXA 1ETWA 2V9PA 1VF9A 5AC5A 1MBEA 4R2QA 4XKVA 2FMYA 2EOMA 2CQXA 4ON0A 1MBHA 2AXTC 2EWNA 5ILUA 3CCVI 2MFZA 2VUMJ 1TT5B 4DKKA 3RTRA 1B59A 1MNDA 4XLEA 4BHCA 5GTIC 2MA3A 3CCLI 3C2BA 4FCYA 3ABKH 4HSRA 1V3FA 1X4OA 5CQEA 4XLNF 2R5YB 1VQLI 1QQIA 2M1SA 3KPHA 2M5WA 4HW0A 4UY8I 1FP2A 2IRFG 1NK3P 1KGSA 2R1FA 4E70A 4IZZA 3WGHA 2Z99A 3W3CA 1L4SA 2L0KA 2KPMA 4HF0A 4BL0B 2WBSA 1DI2A 2MH2A 3CDLA 3L09A 1X58A 5HVQC 2EM4A 1Z3YA 3H3ZA 1S7AA 2EFWA 2LF8A 2EV5A 2B0LA 2I5UA 4N4RB 2Q8UA 4L9VA 2ZJ2A 1E0EA 1MMNA 3JSOA 1GHCA 2KRHA 1BBOA 4HNUA 3AL0C 1IZ1A 1WFXA 3ULQB 5FKOA 1I1SA 2BXZA 3M7GA 4F92B 3PJRA 2MC6A 4CCLA 4L5IA 2JVAA 3RZOJ 2E1MC 2HPMA 4E7IA 4OOIA 3I4PA 5GAHJ 2DU9A 4Q5SF 2G7UA 3BPVA 3IWCA 3RKWA 2F8BA 4LF5E 1MH4A 3I54A 1XNQE 3CC4I 1X1DA 2WB1N 2CJJA 2K40A 5E1XA 2Y48A 1B8IA 2EOZA 1SFEA 4C2MJ 5FRNA 1OMIA 3KP3A 2EH3A 2K4VA 2CQ7A 1UG2A 3GTLJ 4LF9E 2WB1A 2RS6A 2M30A 1UHSA 1VFCA 4AYBN 3OYAA 2KL4A 1K83J 1I39A 3REOA 3GFJA 1D1BA 5A6BA 4JI4E 1FKAE 4AYBA 1D0YA 1ZG1A 4UB8C 3PQKA 3VSKA 3U1DA 4L5NC 1Z1BA 4YHHE 3HOWJ 2OA4A 3DEUA 2DA4A 2CTDA 2EPUA 2Y2ZA 1EH6A 2M0CA 3A0HC 3HTXA 2GLIA 3ASNH 5K7HA 1TWAJ 5CYVA 2A25A 1XD7A 2EP3A 2VQGA 4U87A 3LSKA 3K4MA 3LFKA 4BY1J 1IDYA 4R8HA 2MLKA 2EOQA 2K7IA 2EIMH 3BTIA 1TF6A 2VKHA 4IRGA 2EM3A 3BLYA 1GUUA 3W2WA 1YS7A 4L0ZB 2QEXI 2DN0A 4DR7E 2IPQX 3V8LA 1X19A 4XLCA 3KP6A 2E34A 4Q47A 1BJZA 4ESJA 1ERDA 2CV2A 3BTJA 4WPYA 3CUQA 1UHMA 4I09A 3LSRA 2EOHA 1B72A 1D5VA 2F4VE 2K4BA 2CYYA 1V5FA 2EMZA 4CICA 5KNLA 4U0VA 1GLNA 5EJCA 1HW5A 1U9NA 1ETKA 4N4NB 4EGZA 5JHFA 2EOJA 4IS1C 2HNHA 4OINF 2D1VA 2BV6A 2CH0A 3R4KA 5ED4A 1T39A 2LUQA 2N8GA 1P4WA 4ZYDA 2EPAA 1MBJA 4PGGA 1R1VA 5TJJA 1HLVA 1IO2A 4B3AA 2YTIA 5A2QC 2PMUA 3M1CA 3SXYA 2R7DA 5F1RA 5J6XA 1IGNA 2V26A 4BQNA 3HEFA 3FM3A 2M7QA 3KIOA 5LGUA 2JA7J 2BB8A 3AUZA 1Z7UA 1NEIA 1H9TA 3BJ6A 4XN0A 2VLAA 3ZQHA 4XK4A 5DNYA 2R7FA 1ZG3A 2ECCA 1ZELA 3QP6A 4AC0A 2KISA 3KP5A 2QSHX 4XORA 2R7XA 2L54A 3HKZN 3F3XA 5DM7F 1K61A 2VASA 4DV4E 3HC7A 1PJRA 1T98A 4MEYF 1DGCA 2V7FA 1XGOA 1IJWC 1G3YA 3HKZA 2ZMEA 2P5KA 3MKLA 3ZQFA 1DP7P 3Q9SA 3CTAA 1ZQ3P 3CUQC 4KIFA 3QYFA 2QSGX 4KYWA 1JJ8C 4LG0B 2L8TA 5GADJ 5CVVA 2GIZA 3FMSA 5CFFE 4M9ZA 2A6EF 2E1NA 5DUKA 2NS0A 1MDMB 2WBUA 3AL0B 3J81K 1JK1A 1TWCJ 1E3OC 2E1MB 4CA0A 4WCGA 5KL3A 4RHBB 1ZBQA 4E7LA 4NC6A 3PIPF 3SFZA 3KYLA 2P6TA 2ZNZA 3Q0WA 4LB5A 1DP3A 1ZLKA 1JT6A 2VJ5A 2EMLA 3A01A 2KP6A 3FF5A 1QZZA 3OYLA 1A1GA 1YSAC 3ZMTA 4H0EA 4PCQA 1ZU1A 2YPNA 4DV3E 1LJ9A 2IA0A 4R8OA 3GF2A 2DMTA 4HDVA 3K70C 3VOEA 3TOBA 1JT0A 4IRIA 3JRAA 2A05A 3O8HA 3CCSI 3A02A 2XRLA 3L00A 2YTPA 1A1HA 3JRFA 3WHCA 2JPAA 2E7XA 1IBKE 4KHPE 4AD9A 3K4LA 4F3QA 2LYCA 4W97A 3UK3C 1TLHB 1PP7U 3AKZA 2N8XA 1E17A 4G7OF 1ETQA 1WHQA 3KE2A 2EPMX 2DK5A 1RPWA 2CUJA 1A1FA 3CO6C 1FYMA 1KYQA 1YZ9A 2A3SA 4A3LJ 2VONA 2LBSB 2ISZA 1SD7A 3ML6A 3DPLC 3CLQA 2OCCH 1S29A 2ZMEC 4LD5A 1GZ6A 3SZPA 4QLCU 5D6EA 4DMIA 5HNFA 2L9SA 1OYWA 5JVGF 2DOAA 4EV0A 2PJRA 2EM7A 3C18A 1IN5A 2JMWA 4AWXB 1OCTC 4BE0A 1T4NA 3TDZC 2EM6A 3S2HJ 1BW5A 2GIVA 1W5SA 3BG7A 3Q3SA 4ZYGA 2VPRA 4IHTA 3ROUA 2VPLA 4JV5E 3GZ6A 3H35A 1UBDC 2OJED 1X3UA 3CCYA 1YE9A 3DBHB 1K78A 4KWYA 3M3YJ 2OD5A 4IVNA 1SMYF 2KDZA 2I10A 5LMUE 3BP8A 3S17J 2YU8A 3KP7A 5GPCA 2BEOA 1IN8A 2H36X 3SQNA 3GVAA 4OIOF 3KCCA 2IGNA 1U78A 2LE2A 3WTWC 5ICFA 4BHPA 1B8IB 5IT9C 3WTVC 3VYTB 5D8KB 1R36A 3WU1B 2G0EA 3W2AA 2UZKA 1R1TA 4J19A 3FWEA 5DDGA 1D8JA 1K4SA 2K5CA 2HFHA 4JK1X 3HSEA 4HNVA 4S05A 3KEOA 4G6DA 3ECOA 4G9YA 1MKMA 2NAZA 2E35A 1G4DA 5AONA 1IAWA 1Q1HA 1ZLJA 2Y75A 3TW7A 3CF5F 3IHUA 3FK7A 5LGNA 3QPTA 3LQQA 1D5YA 4LTYA 4A3DJ 2DRPA 4LJZF 4DOZA 3T1YE 2DA7A 4HV5A 2MW8A 4BNCA 3LA7A 2CWEA 2YRMA 2K3FA 4L9JA 4RDUA 2Z9OA 1HC8A 3K9TA 1APLC 5L3DA 1DQUA 1POGA 1MSEC 2HOEA 2HEOA 3MVPA 2JY9A 2VKVA 2ZXJA 2JT1A 1U0JA 3DXJF 2PFBA 3FBNB 3I4NJ 2EQ3A 1IG7A 4CUGA 5A6AA 4QWQA 1IN4A 2DYSH 4DBRA 1SVOA 2XAUA 3G3ZA 1J59A 2O8XA 4C30A 2MKDA 3KEQA 4UNOA 4HTGA 5KCMA 1P4AA 1R6RA 3W6VA 4HX7A 2YU9J 3UNGC 3GUDA 3KWRA 2HKOA 4UV8A 2DK8A 3K7AJ 3PO3J 3UR3C 4ANJA 2GXAA 1QNTA 1XMAA 3BROA 3CUQB 1B72B 3I4MJ 1X49A 3ADGA 1XSVA 3HTUA 4X62E 2BW3A 3GMEA 2FTXB 2EJ4A 1HDPA 2EFQA 2WY8Q 3C7JA 1LPQA 1QA6A 5LRSA 3ZRGA 5HLGA 1UFMA 2H8RA 1V55H 2BOLA 2WZOA 3EUHA 3JRGA 3ISPA 3IAM2 4D1QA 2MD5A 5FGMA 1VQ9I 3M9AA 1UHZA 3IV5A 1CF7A 2O0YA 4BY7J 2ID6A 2JR1A 9ANTA 4CZCA 5FRMA 2M7BA 2UV1A 3I9V2 3J7ZI 3S93A 1YW9A 3SFIA 2XVCA 2XUBA 2M87A 4XKWA 3LLHA 2W84A 4X9JA 1GTKA 3W6KB 3LL7A 2RDPA 3F0CA 2KKOA 3ESWB 3ZQQA 1YJNI 3CCJI 1R23A 2EMIA 1UG0A 2LY9A 2DCEA 3F8MA 3R61A 1WPKA 1S7EA 2JA5J 3FM5A 2V86A 5GAEJ 4LF6E 1NG7A 2ZJPF 2DI3A 1DU0A 4KN4X 4X66E 2BGCA 2VBXA 4F9BB 4F9AB 5LRRA 2LSOA 3K2AA 1JHFA 1HCRA 4IXAA 5BPIA 3F6GA 3NRVA 1FJGE 2EPKX 4NHRA 1ZGJA 4LFAE 3EPJA 1Z3XA 2EPCA 1I6HJ 1R49A 4HAMA 4EM2A 1VQOI 4Q4ZF 1PJSA 1B69A 2M1BA 5HS7A 3FDYA 2RV8A 3DFGA 2ZMEB 4G7ZF 4GDFA 2VBZA 1ZRCA 3IRQA 4XL9A 1ONVA 1BIBA 1YG2A 3MFKA 4XLFA 2P5LC 3AG4H 2HVQA 1TW2A 4CSWA 1U6GA 2FSWA 1MBFA 4CZZA 3HM5A 4LIVA 2KLOA 1XB4A 4DR5E 1YW7A 2EMWA 4AVZA 2B7TA 1X3CA 4BCAA 1IDZA 4LF7E 3HOTA 1W0UA 2FF4A 4BQQA 2ZXHA 3KFWX 1STUA 2YUSA 1YIJI 2L92A 3HZJA 3U2RA 2KRFA 4BXUA 2B7VA 5EG0A 1B1BA 1YO5C 1HA8A 1RC7A 1D0ZA 4BDYA 5CVUA 1CQTA 2IGOA 3OS1A 4YEJA 3A01B 1RIOH 3GTKJ 2L4MA 2NVTJ 2H8WA 5EZHA 3E3VA 4KMFA 1X2NA 4GKJE 2R7ZJ 1B6AA 1DUXC 4Y17A 2EIJH 3ELKA 5D4RA 1SAUA 1W1WE 4J01A 3BQYA 1K6OA 4K0KE 2NUEA 4O3MA 2CSHA 4ZH4F 3E1SA 3MWMA 3M8FA 2OF7A 1Z9CA 1UHWA 2ETHA 4Z2YA 4JX4A 1YYOA 4P9FA 2BYVE 4R2SA 1SC7A 4TUIA 3J81C 3P7NA 1LEAA 4B1RA 3CO7C 2Y9ZA 4MO7A 1Z6RA 2HQNA 5E8GA 4JX5A 1XGSA 2DTZA 3HUGB 1SVMA 2VE9A 1MMGA 2PJRB 2XSDC 2HHHE 4XQFA 2DQRA 1AAYA 2DA1A 3QOPA 3BC8A 2OTJI 3BG6A 2YSOA 1WJAA 4M0VA 4EJUA 1HW1A 4XLPF 2DA6A 2IT0A 2LCEA 1IV6A 3RPUA 3E0JB 3RKQA 2HGCA 4ABZA 2B63J 3O6BB 3KP2A 3GLLA 2DAOA 1G8XA 1OLTA 2E71A 3CJNA 1ETYA 3FXKA 3ABLH 1WKMA 2KIMA 3PM1A 2A6TA 4PFOA 3L2WA 2XB0X 1AHDP 3GZNB 3P9KA 2F5DA 2GM4A 3CCQI 3OYFA 4F6MA 3C2GA 3DP7A 3MEXA 2JPCA 2KMUA 1IV8A 4I6ZA 4EM0B 2XV4S 4BXFA 4IKFA 2KRCA 2Y69H 3ZN0A 4BJ6C 2BY1A 2DB2A 1Y0UA 2ZJRF 2JOBA 4XRSG 1FOWA 4EM1A 2J5PA 5EYRA 2NVQJ 3RPQA 4ZZDA 2HI3A 1VQ8I 2Q8KA 1AH5A 2DPDA 4HYEA 4EVIA 1S8NA 3ERED 4Y33A 1UCRA 2XRNA 4MFEA 4RGUA 4UVBA 3S16J 1KYWA 2FU4A 1PUFA 3HBLA 1JGSA 2D5VA 2HGHA 3QYEA 4I99C 3PUBA 3A4CA 3K70D 1YS6A 3DTKA 4M74A 1OCPA 4DYCA 4M6VA 2DBBA 2XAQA 3KETA 4HZFA 2PN6A 3LOCA 3BG3A 2HYJA 1GXPA 3LSMA 2O3FA 2JK3A 3RYPA 2ELKA 5GAGJ 5A6KA 3RDIA 3KX2A 5HODA 2EM8A 2BW3B 2KIQA 2W00A 4F2JC 4ZDOA 5EZGA 1FLIA 3LA2A 2X48A 5CVJA 3DTIA 2IS4A 3EYYA 2NRAC 4J00A 5IV8B 2K9LA 4O4KA 3KZZA 2HQAA 2M7AA 3CMMA 3IKTA 2IS6A 1CF7B 4RAFA 2M0MA 5TRDA 2I8DA 4OAZA 4FX4A 1LE8A 2AQFA 1RQ0A 1PVEA 4FTHA 3WTSC 1I27A 4XMYA 3WE2A 4F91B 4MLVA 3RQ4A 5LHIA 4F54A 2K9MA 1LLMC 3P5JA 4JI7E 2OCEA 2EFOA 3Q9VA 3WE3A 1PP8F 2JUGA 1D3YA 3F6OA 4RM3A 2R7SA 2D9HA 2LREA 3M1EA 4RMNA 2JVHA 1YOVB 1ZH5A 2DPUA 1F43A 1EJ9A 3DEWA 4GO1A 4IF4A 1P9QC 1FIPA 2LK2A 5F0FA 2JWTA 3K0LA 3H5AA 2BY2A 1HSJA 4XM3A 2XIGA 2ELHA 2YT4A 3F6HA 2OQGA 3QOEA 3SYTA 4AIHA 2R7TA 2FQ4A 2CPNA 1KQ9A 1VQ4I 4JOMA 5JLXA 1HQCA 3E5UA 1BL0A 2FJ1A 2Y0MA 2EN8A 3E5XA 4N4OB 1ZGWA 1JUPA 2DT5A 2X1CA 3LSTA 1HXDA 1UILA 1MH3A 3J7Yp 1X1BA 2QQBA 4M9VC 5FB2A 2W24A 1RNLA 3WHBA 1U5TA 3CZ6A 1P2FA 3VYUB 1WJPA 1R9TJ 4XICA 2QKMB 3HSFA 3HQ1A 4FK5C 1P92A 1QBJA 3BF2A 3J80Z 2PQ8A 2AQEA 3DCFA 3GBGA 4PK4A 2DMIA 1YUJA 1T95A 1I3QJ 4I01A 3I5UA 2LTRA 5H20A 1N75A 2GAUA 5KL2A 1XGMA 3BWGA 1IXSB 2EFPA 3FKIJ 1IBLE 5EG0B 2RPCA 3BJAA 2Z2SB 3AFHA 2LFBA 2IJLA 1UAAA 4YRVA 4LGWA 3NWSA 2Q0OA 3WTXC 2LY2A 3BR2A 4PJMA 2ODRD 1WWXA 3K2ZA 3JRBA 4I98B 1O7FA 2P5VA 2DT7B 2EK5A 3HHHA 3RCOA 4WSPA 2DODA 3VODA 1EH7A 1Z21A 2V6CA 2MDGA 4JYAE 3WTYC 3H36A 4V2FA 2ZXIA 2A6HF 2DOEA 3TOAA 1MZBA 3L2VA 4B09A 4L0YB 2V8QB 1DGWY 1X47A 4B48A 3PNTA 2Z5UA 2STWA 3F22A 2K27A 2O8KA 3BR5A 4O43A 1T4LB 1A1LA 4JI3E 2JSPA 1YITI 5CPRB 3IWBA 3ZN1A 1LQ1A 1LNWA 3RMPA 3OWTA 4BAYA 2EQ0A 3CUOA 4PGHA 3CMYA 4XBFA 3EDPA 2YTOA 1HKSA 1KU2A 1U5TC 2QYOA 2HTSA 5ICCA 2CW0F 2FBIA 1O0WA 1MSFC 2XF7A 1EV7A 4JX6A 3ASOH 5E79C 2XASA 3BZ6A 2A61A 2RC4A 3ONQA 3PNVA 5BQTA 2EINH 1X1AA 1FYKA 3KLOA 1FTZA 4Q48A 4R2DA 5HOOA 4CGZA 3K1NA 1G59A 2E1CA 1I94E 1O7LA 4X64E 1A1IA 2CW7A 2I9IA 2EFNA 2V4JC 5DD8A 4E7KA 4LIUA 2NUGA 1KONA 1G3TA 5DCFA 2DDBA 1YIOA 3F23A 1FC3A 4DGWB 4MLQA 2PEXA 1W5CC 5HS9A 3TMOA 2ZBKA 4X8WA 5AASA 2EPOA 4WK8F 2CUFA 2VJ4A 2CV1A 2FA5A 3DWLE 1QPMA 1Z77A 3SHFA 3HOXJ 1OCOH 2O9LA 2QBYA 4S04A 1WQ2A 2F4IA 3LAJA 3THNA 3BTLA 2RNGA 3M07A 5DTDA 1RR7A 1J5YA 4L9TA 3SEQA 5HS8A 4XRSA 5B1AH 1BJAA 1N77A 2E2IJ 2VE8A 4DYRA 3BR1A 2HOSA 5A2QZ 2HS5A 2W25A 5F64A 3D5RC 2JPBA 2YTJA 1PUFB 2EL4A 3HRTA 2KHXA 2OUMA 2IGMA 1ACIA 1YUIA 2K9NA 3FXOA 4B3RE 3SZGA 2L7ZA 2E7WA 2XKOA 2LKSA 2ELZA 3A2KA 2EPPA 2XF5A 3HGYA 5IP6A 2DW4A 5FLMJ 3IWZA 2KHMA 2ELJA 2MSYA 5J8FA 4Y13A 1Z6TA 1MBGA 2HWVA 4I76A 2R92J 4DR4E 5B1BH 2OV7A 2H6BA 3FX3A 1J9IA 2QCOA 3KP4A 1OCRH 2E5NA 2QF7A 3P1XA 1FY7A 1O57A 2XHKA 4YY3E 1WGXA 3DV8A 1SFUA 1GV2A 1IRFA 4MTDA 4L8NA 1LFUP 3I59A 3OOUA 5H6QA 2EN1A 1LB2A 1R58A 2BY0A 4LLGF 3ZGKA 4M9SA 3L9FA 3OR1C 4LG3A 5FLXZ 2KJBA 1LE8B 1BOAA 3PL8A 2OTLI 3IC7A 2UWMA 2EPXA 3H09A 4G6TB 2A5YB 1DDNA 3P9CA 1IC8A 2PMZN 1H88C 2WBTA 1MMAA 3LMLA 2EOFA 2EV6A 3EPZA 3OTOE 2ICWG 1D8KA 1TQIA 5K1YA 2PMZA 2EPFA 4WXDA 5F08A 1X6EA 2LVSA 2GZWA 4E7SA 1T6SA 5DYMA 1JKQC 1Y6IA 4MEXF 3D5LA 2N3HA 1KA8A 2Y0SN 1MJBA 2XDVA 4HEIA 1J75A 3SEZA 2BBYA 2JSCA 4AM3A 2WV0A 2MG4A 4R2RA 3JRDA 2VT2A 2KZGA 2DDAA 2HDWA 2Y0SA 4Z6YA 3L2QA 3S3NA 3V8JA 5D5UB 4MQ9F 2L3JA 4L5JA 3S3OA 3HYIA 4WXHA 4GEQB 1TWFJ 3QPHA 3FKJA 1A6IA 1ETOA 1OCCH 4RBOA 1F36A 2CUZA 4HBLA 3LA3A 1U5TB 2DMUA 4AU7A 3S1NJ 3ECRA 3LSPA 1T33A 1BC8C 2CUEA 2RAEA 3RKYA 3PQJA 2W4SA 4RB0A 5E20A 4LLLA 1TF3A 2K85A 4U88A 2IEKA 2EMCA 1YJ9I 3CD6I 2EA4A 2L01A 4M6XA 2OQRA 2JN6A 4RLFA 3A1YA 1JE8A 3S14J 2Z3YA 5C4XJ 4OMYA 4XOTA 1B9NA 1LDJA 2K02A 1OQYA 3HPGA 4X0GA 4MQVA 1MIJA 5EEGA 3ADLA 3MKYB 4IX7A 1FZPB 3KZYA 4LLNA 1HKTA 2GA2A 4IRHA 2LVHA 3TL4X 3E7LA 2BHYA 2OPTA 3LAPA 4UUVA 2EM0A 2STTA 1BIAA 1A35A 3HB9A 4ESFA 5BOXA 2EWLA 2MGQA 4A5MA 5D6FA 1T8IA 5KL6A 1K6YA 2EPLX 2CGPA 2L2NA 5AE3A 2PRTA 3BR0A 1IXRC 3B02A 2K9SA 1O3RA 2CW8A 4C3HJ 2YTEA 1X2MA 3DBRB 5IT9Z 3K6GA 1K4TA 4YELA 1V5EA 3QQAA 3ABTA 4G12A 4IOCF 1YHQI 5TGTA 4GCVA 1TBXA 4BEHA 1G2FC 1TQMA 2R7UA 3OIQA 4A12A 4YG2F 4GZNC 2DFIA 1YYVA 4JBAA 4XIDA 5CVIA 3FXLA 2EBIA 2F5VA 1WJBA 5ADZA 4YIFA 1Y1VJ 3CJQB 4OAYA 3L2RA 1RUOA 5J4YA 1Z0XA 2A5WA 5L3EA 1VQMI 1J26A 1R00A 4G6QA 4LF4E 4HG2A 1U3EM 2QLZA 4XSZF 4Q28A 1JTYA 1WI3A 4U7BA 1OYYA 4PJLA 3JAMZ 3QWLA 1EKEA 4BACA 2E5LE 5E1WA 2X6WA 2X1EA 3EUKL 2AO9A 4FHTA 4S0HB 1TC3C 5HDGA 3T5XA 3PO2J 1XG1A 1HKQA 1F4KA 4BE1A 2ZC2A 2CMPA 4XLHA 2UXNA 4BGDA 3HPZA 1IMUA 2FV4B 1HNZE 4RS8A 2YZTA 3GFLA 2VOPA 3PSIA 3WTUC 1PUEE 1IBME 4NXNE 4AIJA 1I1GA 3EYIA 4IQ4A 2EQ1A 1B9MA 1A31A 3LNQA 5LBQA 2ZXWH 1RZ4A 1XGNA 4KZSA 1QZEA 2EZKA 1OR7C 2FXAA 3GTPJ 3FHNA 5F1JA 4GYGA 3WG7H 1RMDA 1ZR9A 2O5RA 4GGGA 3MKWB 3QU6A 3EPLA 1HOMA 2EN6A 1FP1D 1DQ3A 3V7SA 5HLIA 3F8BA 2BHZA 3MZHA 2K86A 4PJJA 5FKLA 2OU2A 2BXYA 2IS2A 2QBYB 1XDSA 3FBIB 2EQRA 2CQNA 2ESHA 3DJWA 3W6JB 2X6YA 5B5EC 4KITB 1ZTRA 3FXJA 1YYKA 3KYDB 2VBYA 2G7HA 2V6EA 3BR3A 2X0LA 2OBPA 4PFPA 4DBQA 2ODRC 1N34E 2NNNA 3JSPA 2EMXA 3AG2H 2M45A 2XC7A 4M3FA 3DU6A 1ITYA 4EJVA 1T08B 1QGPA 2ZSHB 2MBFA 3OR2C 3E5QA 4KICA 4RAYA 1LUJB 4RM2A 3RJPA 2H1KA 4FETA 4M3GA 4X65E 3K4BA 4NXME 1BI1A 1BW6A 3WGIA 1OPCA 3FK6A 2DJNA 2XSJC 2Y31A 3G1MA 4PJNA 3SDBA 4BKXA 1YFHA 2E60A 1WSUA 1FWZA 1WVRA 1XN7A 2ID3A 4D0PA 4YFKF 2V87A 4KIBA 2CS3A 2FNAA 3BPXA 4FE7A 3S1QJ 4Q35B 2F48A 1VI0A 1GVJA 4A3GJ 4HF1A 4M9XA 2L4AA 3IWDA 1K79A 5H2FC 2JRTA 3BTCA 5KHDA 2MC5A 1XNRE 2YWQA 4XKCA 2B9DA 2CRGA 5HNHA 2ZFUA 2X6OA 1F1ZA 4I02A 3GO5A 3I59B 2FEZA 2V1DA 2W57A 2D1HA 2DMPA 1L3LA 3I53A 1X1CA 1LEBA 1X4PA 1X3WB 2DLQA 4DIQA 3QYBA 3I0TA 4DR2E 1QHHD 3IH2A 4B44A 3CC2I 3HOZJ 4P78A 3D0SA 2PLYA 4O6JA 3ZMUA 4XSXF 5LFAA 5B66C 2G9WA 3LQRA 1C0WA 2V83A 4DUYE 2DFFA 4A0ZA 3IRRA 2B3TB 2EOYA 2UUBE 3WG9A 1JKPC 3GZ5A 3HOVJ 1RKTA 1QU3A 4Y52J 4M2ZA 3E97A 3CMAI 3DKWA 2CO5A 4XOPA 4N9IA 1QPIA 3BY6A 1ENHA 3JTHA 1JUMA 4EJOA 3E6MA 3BG5A 4OWRB 3SZTA 4GFBA 2YX4A 1LVKA 4II2A 3H5NA 5DS9A 4PZJA 1YX3A 3CDIA 2P0WA 2LBFA 3DBLB 3COAC 1GT0C 1KQ0A 1FSEA 2VXDA 3HHGA 3Q0VA 4RLQA 3IL2A 4JYKA 4PJ0C 4HSTA 3DU5A 4IEJA 4NBQA 1SFKA 3H1CA 4B4CA 5E8IA 4U7DA 2IA2A 3GTQJ 2IXSA 1T0FA 4KT6A 3VEPA 2RKHA 4ETSA 2VRDA 1OISA 2WCC3 2ZNYA 2NVXJ 4DR6E 1QHGA 3A0BC 3J80K 3BZCA 1FSHA 1TZLA 3HG9A 3J7AY 3MMYB 2PI0A 2RQPA 2ELYA 2LRSA 2RTXA 5J47A 2RNJA 5KL4A 4P55A 5K5OA 3T0YA 2QVOA 5EGOA 4JI6E 3HXLA 2YTGA 1X1PA 2EN4A 2LY1A 5ICEA 1VZ0A 3CCMI 4V2GA 2AHQA 2ZSIB 1PDAA 2K4JA 1IRZA 2EZHA 2NOGA 4A0YA 4A2UA 1WRJA 4DZPA 2F5EA 2IBDA 3VYYA 5E17F 1A5JA 2VQEE 4J8ZA 3B73A 3BBGA 3OYHA 3QODA 4C9YA 4WYQB 1ZAOA 3GTJJ 2X1DA 5JI6A 1O4XA 2JA2A 1WZ2A 5TISC 3ADIA 1E2XA 2JWOA 4CCOA 4MHGA 5DUIA 2DIXA 4LITA 2JYAA 1BR1A 2EM5A 1ZR4A 2JZYA 5L3FA 1OKRA 1V5GA 1F5TA 2EZ6A 2V1XA 2HOAA 5B3SH 2RSIA 1RC9A 2IAIA 4AVPA 3B6CA 2RQLA 1JJ6C 2DQLA 2EPZA 2LJUA 1ZBTA 4IQJA 1ZAAC 1FEXA 1JHHA 1V54H 2VB6A 2VJIA 3HL2A 4LK0F 5LLQA 4Y7NJ 2YRHA 5K5QA 3IWFA 1OYIA 1K78B 2RGVA 1A04A 4MGRA 3TGNA 4JI1E 2ZKZA 5AIPA 1T0FC 3H92A 2LC2A 3VB2A 3BCBA 4C3IJ 3GCMA 2W48A 3N97A 1PKPA 4DV5E 2KONA 2V88A 2HC5A 1R71A 3JRIA 1YW8A 3WU0A 2VKDA 1O3QA 5LMNE 4ENJA 4WX9A 2FQ3A 3TP3A 3EUAA 4IJAA 3RQIA 1FMWA 2LG4A 2ENCA 3WTZA 5JVTA 1HNXE 4L9NA 4HRIA 1X6FA 4XNFA 1VQNI 3GTGJ 1S5LC 4QSHA 3H0GJ 4X1EA 4BJ5C 4ESBA 3HOSA 2EMKA 3OMLA 5FO5A 3QPSA 4HLXA 2RVCA 2R4GA 2HXOA 3H9QA 2LTSA 1FPQA 4RB1A 4XLAA 4QTRA 5GP9A 1JXSA 1PYVA 1GVDA 2HU9A 3KLNA 3WU2C 3WODF 1JK2A 4M3DA 4LFUA 2MLGA 4R79A 2FOWA 5J1YA 2LUPB 3F8FA 2BBGA 2YTDA 3E6DA 5KK1A 5E3OA 1WXRA 1XTAA 4LOCA 2J7JA 2MH9A 2ZB9A 2E2HJ 3M4OJ 1RKWA 1TTYA 2ENAA 3DF6A 3OSFA 4B3TE 2F4OB 2VQLA 2V79A 3ZMSA 3AAFA 1RR8C 2XAFA 4BQAA
chains in the Genus database with same CATH topology
3ZPLA 5A2QK 3K1MA 4HQEA 1KU7A 1ZREA 3M8EA 1O3SA 3IKVA 4KN7X 1R5HA 3OOPA 5JR3A 3R0AA 1ON2A 2PG4A 4KMUX 4R1HA 1FX7A 4HX8A 3WTTC 3C1DA 3HSRA 1U2WA 3HTSB 2DLLA 5KVRA 3U9GA 2CG4A 5K5RA 4G7HF 1STZA 1J2XA 4XRFA 3FHZA 5FLXK 4FT8A 2D45A 1F9NA 3PFIA 3BOQA 1UB9A 2FE3A 2HDCA 2YSRA 1IUYA 5DEQA 1WI9A 1ON1A 3V7CA 5ILVA 1BI2A 5L3CA 3ZMDA 2V1UA 2H6CA 1BI3A 2LDUA 1R7JA 4IHSA 3EQLF 1BN5A 3ABUA 5LEKA 2XAGA 1ZRDA 1SD5A 2CSOA 4A6EA 2J5OA 3MQ0A 2VOOA 2HQRA 2A68F 1YLFA 2DTRA 1MGTA 3TO6A 3T1BA 2XKPA 3K1PA 2H94A 1REPC 4ZYEA 2EA2A 2QQAA 4RGXA 3V4GA 2O6GE 2H27A 3R60A 3V8KA 3TDUC 5FFZA 2QM3A 1FNNA 4ZYHA 2QENA 2VC0A 4HA8A 4EJWA 4ENKA 1XCVA 2IW5A 2Z33A 4YIIA 1SD4A 5BMZA 5IT9K 4KNYA 1KQ8A 4OIRF 3ZQ7A 3E6CC 2AXLA 1BM9A 3HIFA 2WC2A 3HRSA 3K69A 4HQMA 3FXQA 3JAMK 2KIFA 1YQAA 3FZVA 1XCBA 1KYZA 4KDPA 3NQOA 1LDKB 4G8XA 4KIGA 6PAXA 1P4XA 1R22A 2O61A 1W7PD 4AIKA 3L2CA 1ZN2A 3C3WA 3GFIA 3CDHA 5HLHA 4KFCA 3FMRA 4P5OA 4BH9A 1CGPA 3RKXA 1IRGA 1USSA 3QRFF 5EEHA 3O2PE 1TNSA 4N9HA 1XSDA 4YFNF 4G94A 3GFMA 1I5ZA 3BJOA 1IN6A 1HSTA 1S7OA 4P9UA 5CVRA 2LF7A 2XAJA 4OIPF 2XGXA 5CJ9A 3F8CA 1RUNA 4Y15A 1LVAA 1FOKA 3GWZA 5LHGA 3I71A 2MC3A 1K7AA 4DQ2A 5ICGA 3DF8A 2GWRA 4M6YA 1I6XA 1GXQA 3BDDA 2TDXA 3L7WA 4OU0A 2WWYA 3P9IA 4CDGA 2ZCWA 2HZTA 5DCMA 2AS5F 2OAZA 4RGRA 1ODDA 5DD4A 2GA1A 4UVCA 4RB3C 5LHHA 2L3DA 1R1UA 3R0JA 4M72A 2F5FA 5E18F 3R6SA 1AOYA 3DPTA 1XDUA 1G6NA 4CXFA 1USTA 2IVMA 4P96A 2HR3A 3GW2A 4CYDA 4PDKA 4LB6B 1H9GA 5D5VB 3F8NA 2VT3A 4WF2A 4KA4A 1HBXG 1OR7A 2OZ6A 1ULYA 3GXOA 1ZHFA 5FD6A 4HF2A 5D8LB 4K2EA 2VODA 4NQWA 3T8RA 2Q2EA 1SD6A 2IA1A 3H3UA 3HUGA 5LEJA 4MTEA 4HDUA 1R5GA 2XAHA 2P6SA 1SFXA 4HX4A 2JTVA 2HYGD 4HOBA 1RI7A 2L02A 3TO9A 4IPAA 3QU3A 1G3WA 4U0WA 4FX0A 2KIUA 1FBQA 4MNUA 1KU3A 2EV0A 1MJ9A 3HRUA 2VXZA 2W85A 4F7ZA 4GYIA 2YU3A 4EGYA 1DPRA 2PJPA 1PDNC 2FMLA 4KT5C 1L0OC 5H6RA 2NNYA 2NYXA 2V9VA 4BYYA 4RGSA 5D5WB 3ECHA 3FXRA 2RN7A 2PMHA 1W7PA 2QZ8A 4OIQF 4I0AA 3GEZA 2UXXA 1IN7A 5F6FA 3MAJA 2QUFA 4NB5A 4CHUA 3V7RA 5BS6A 4GXOA 2YX7A 1BC7C 4OMZA 1ZYRF 1VTNC 3O3KA 4CO8A 4RB2C 1Z91A 3F6VA 3NEUA 1YTYA 4UVAA 2F2EA 4LMYA 1TNTA 1B4AA 4M73A 1D5VA 2WTEA 1LDDA 3FXUA 1O3TA 2P8TA 3QAHA 3GX4X 4N0BA 3F21A 3S2WA 1FBSA 3JW4A 2D2WA 3DQVC 4UHTA 5LGTA 1MD0A 5DCMB 2QQ9A 1QO0D 3ZP5A 1MJAA 1IW7F 3E6BA 4A6DA 4EJTA 4WXCA 4EMSA 4NHJA 2FBKA 3ZMZA 2OZUA 5L3BA 1IXCA 3G73A 3J81Z 2DO7A 5D5XB 4ENNA 2GXGA 1ZGAA 3ZMVA 3WGGA 2QWWA 3TQNA 2ZFWA 3QP5A 1BBYA 4EQQA 4YFXF 5DV5A 4L18B 2A69F 2HTJA 1J7KA 4ENMA 4ASNA 4ZZLA 4I7HA 2ESNA 2GQQA 4BHBA 4A0XA 1FT9A 5E1ZB 3TKYA 1SMTA 2P7VB 1EH8A 2LNBA 1Z1DA 3TO7A 4RAZA 1FYLA 2CFXA 4I2OA 1ZRFA 2FBHA 3HRMA 2ACJA 2X4HA 2R3SA 5L3GA 3GLXA 4DNCA 1TQPA 5FFXA 1J0RA 1XMKA 4UXNA 1FBUA 1G3SA 1U8RA 4A5NA 2LKPA 2M8EA 5HDKA 1W4MA 3FMQA 2FOKA 3Q5FA 4HV6A 2F5CA 1TW3A 2XROA 2PBIA 1T2KA 2HYFA 4TV7A 3JTGA 1P6RA 1BI0A 2KJCA 1H0MA 4JQFA 4HLYA 2EB7A 5ERIA 1W7PB 2P4WA 1NHAA 1Z05A 2VC1A 3VFZA 1XSXA 2K7LA 2FRHA 1V4RA 2BE5F 4KUMA 4B8XA 2ISYA 3RI4A 1AWCA 4UV9A 2GXBA 3I64A 3CLOA 2VBWA 1S3JA 3MCZA 1W5TA 4WWCA 1IF1A 3T8TA 3GYHX 2EJRA 1HW2A 5AIQA 3OV8A 4U0YA 3RYRA 2A07F 3J7AO 4I0BA 2YR2A 5ILSA 4O5VA 1DPUA 5HDNA 3EETA 2H09A 2YPRA 2C6YA 1ZARA 2ADUA 1S6LA 3I58A 4LK1F 5D4SA 2P7CB 3F72A 2HKXA 4LG0A 5FD5A 2CQKA 5JFRA 2VN2A 5J8CA 1KU9A 3LWFA 2COMA 1MDMA 2ZO4A 5CLSA 3N4MA 3RIRA 1QZYA 5IT3A 5JHUA 1T38A 4M71A 3MZYA 1ZG5A 5BPDA 2O03A 2FNPA 2IP2A 1SAXA 2FMYA 4ON0A 5ILUA 2EWNA 3RTRA 1B59A 4BHCA 2MA3A 4XLNF 1V3FA 1QQIA 2M5WA 4HW0A 1FP2A 2IRFG 1KGSA 4E70A 3WGHA 2Z99A 4HF0A 2MH2A 3L09A 5HVQC 3H3ZA 1S7AA 2EFWA 2LF8A 2EV5A 2B0LA 4L9VA 2ZJ2A 3JSOA 1GHCA 1IZ1A 3ULQB 1I1SA 3M7GA 4L5IA 4OOIA 3I4PA 2DU9A 4Q5SF 2G7UA 3BPVA 3RKWA 3I54A 5E1XA 2Y48A 1SFEA 1OMIA 3KP3A 2M30A 3REOA 3GFJA 1ZG1A 3PQKA 3U1DA 2OA4A 3DEUA 1EH6A 5CYVA 1XD7A 3LFKA 4R8HA 2MLKA 4IRGA 1YS7A 4L0ZB 2IPQX 3V8LA 3KP6A 4Q47A 4ESJA 3CUQA 1UHMA 4I09A 2K4BA 2CYYA 4CICA 4U0VA 1HW5A 4EGZA 4OINF 2D1VA 2BV6A 3R4KA 5ED4A 1T39A 1P4WA 4ZYDA 4PGGA 1R1VA 5TJJA 2PMUA 3SXYA 2R7DA 5F1RA 5J6XA 3FM3A 5LGUA 1Z7UA 1H9TA 3BJ6A 2R7FA 1ZG3A 3QP6A 3KP5A 2L54A 3F3XA 1T98A 4MEYF 1XGOA 1G3YA 2ZMEA 2P5KA 1DP7P 3Q9SA 3CTAA 3CUQC 4KIFA 4KYWA 4LG0B 5CVVA 3FMSA 4M9ZA 2A6EF 2E1NA 5DUKA 2NS0A 1MDMB 3J81K 4WCGA 3SFZA 2P6TA 2ZNZA 4LB5A 1ZLKA 3FF5A 1QZZA 3ZMTA 4H0EA 4PCQA 1LJ9A 2IA0A 3GF2A 4HDVA 3VOEA 3TOBA 4IRIA 3L00A 2E7XA 4AD9A 1TLHB 1PP7U 1E17A 4G7OF 3KE2A 2DK5A 3CO6C 1FYMA 2A3SA 2VONA 2ISZA 1SD7A 3ML6A 3DPLC 1S29A 4LD5A 3SZPA 4QLCU 5D6EA 1OYWA 4EV0A 3C18A 1IN5A 4AWXB 3TDZC 2GIVA 1W5SA 4ZYGA 4IHTA 3ROUA 3GZ6A 1X3UA 1K78A 2OD5A 4IVNA 1SMYF 3BP8A 3KP7A 2BEOA 1IN8A 3SQNA 3GVAA 4OIOF 3KCCA 1U78A 3WTWC 5ICFA 4BHPA 3WTVC 5D8KB 1R36A 3WU1B 2UZKA 1R1TA 1D8JA 3FWEA 5DDGA 2HFHA 4JK1X 3HSEA 4S05A 3KEOA 4G6DA 3ECOA 4G9YA 1MKMA 2NAZA 1G4DA 5AONA 1IAWA 1Q1HA 1ZLJA 2Y75A 3IHUA 5LGNA 3QPTA 3LQQA 4LJZF 4HV5A 4BNCA 3LA7A 2CWEA 4L9JA 2Z9OA 3K9TA 5L3DA 2HEOA 2HOEA 2ZXJA 2JT1A 3DXJF 2PFBA 4QWQA 1IN4A 1J59A 3G3ZA 2O8XA 3KEQA 4UNOA 1P4AA 4HX7A 3GUDA 2HKOA 4UV8A 2DK8A 1QNTA 1XMAA 3BROA 3CUQB 1XSVA 3HTUA 2EFQA 3C7JA 5LRSA 5HLGA 1UFMA 3EUHA 3ISPA 2MD5A 5FGMA 3M9AA 1CF7A 2O0YA 1YW9A 2XVCA 2XUBA 2M87A 2W84A 3W6KB 2RDPA 2KKOA 1R23A 3R61A 3F8MA 3FM5A 2DI3A 4KN4X 2BGCA 2VBXA 5LRRA 2LSOA 1JHFA 4IXAA 5BPIA 3NRVA 1ZGJA 4HAMA 4EM2A 4Q4ZF 2M1BA 5HS7A 2RV8A 3DFGA 2ZMEB 4G7ZF 2VBZA 1ZRCA 3IRQA 1ONVA 1BIBA 1YG2A 3MFKA 2P5LC 1TW2A 1U6GA 2FSWA 4CZZA 1XB4A 1YW7A 3HOTA 2FF4A 3KFWX 3U2RA 2KRFA 4BXUA 1B1BA 1YO5C 5CVUA 1RIOH 2L4MA 3E3VA 4KMFA 1B6AA 1DUXC 4Y17A 3ELKA 5D4RA 1K6OA 4O3MA 4ZH4F 3MWMA 3M8FA 1Z9CA 1UHWA 2ETHA 4Z2YA 4P9FA 2BYVE 3P7NA 1LEAA 3CO7C 1Z6RA 2HQNA 5E8GA 1XGSA 2VE9A 2DQRA 3QOPA 4EJUA 1HW1A 4XLPF 2IT0A 3RPUA 2HGCA 3O6BB 3KP2A 2DAOA 3CJNA 1WKMA 2KIMA 3P9KA 2F5DA 3DP7A 3MEXA 2JPCA 4EM0B 2XV4S 3ZN0A 1Y0UA 4EM1A 2J5PA 3RPQA 4ZZDA 2Q8KA 2DPDA 4HYEA 4EVIA 1S8NA 3ERED 1UCRA 2XRNA 4UVBA 4RGUA 1KYWA 2FU4A 1JGSA 1YS6A 4M74A 2DBBA 2XAQA 3KETA 4HZFA 2PN6A 1GXPA 2O3FA 3RYPA 3RDIA 1FLIA 3LA2A 5CVJA 3EYYA 2NRAC 3KZZA 3IKTA 1CF7B 5TRDA 4FX4A 3WTSC 1I27A 3WE2A 5LHIA 2EFOA 3Q9VA 3WE3A 1PP8F 1D3YA 3F6OA 3M1EA 1ZH5A 2DPUA 4GO1A 4IF4A 3K0LA 1HSJA 2XIGA 2ELHA 2OQGA 4AIHA 1KQ9A 1HQCA 3E5UA 2Y0MA 3E5XA 2DT5A 3LSTA 1HXDA 2QQBA 5FB2A 2W24A 1RNLA 1U5TA 1P2FA 3HSFA 1P92A 1QBJA 3J80Z 2PQ8A 4I01A 3I5UA 5H20A 2GAUA 1XGMA 3BWGA 1IXSB 2EFPA 3BJAA 2IJLA 4LGWA 2Q0OA 3WTXC 1WWXA 3K2ZA 4I98B 1O7FA 2P5VA 2EK5A 3HHHA 3VODA 1EH7A 2V6CA 3WTYC 2A6HF 3TOAA 1MZBA 4B09A 4L0YB 2STWA 2Z5UA 3F22A 2K27A 3ZN1A 1LQ1A 1LNWA 4BAYA 3CUOA 4PGHA 4XBFA 3EDPA 1HKSA 1KU2A 1U5TC 2QYOA 2HTSA 5ICCA 2CW0F 2FBIA 1EV7A 2XASA 3BZ6A 2A61A 2RC4A 5BQTA 1FYKA 3KLOA 4Q48A 5HOOA 4CGZA 3K1NA 2E1CA 1O7LA 2EFNA 5DD8A 1G3TA 5DCFA 1YIOA 3F23A 1FC3A 2PEXA 5HS9A 2ZBKA 4WK8F 2FA5A 1QPMA 3SHFA 2QBYA 4S04A 1WQ2A 3LAJA 1J5YA 4L9TA 5HS8A 1BJAA 2VE8A 5A2QZ 2HS5A 2W25A 5F64A 2JPBA 3HRTA 2E7WA 2XKOA 2DW4A 3IWZA 5J8FA 4Y13A 1Z6TA 2HWVA 2H6BA 3FX3A 1J9IA 3KP4A 1FY7A 1O57A 2XHKA 3DV8A 1SFUA 1IRFA 4MTDA 3I59A 5H6QA 1LB2A 1R58A 4LLGF 4M9SA 3L9FA 5FLXZ 2KJBA 1BOAA 3IC7A 2UWMA 2A5YB 1DDNA 3P9CA 2EV6A 1D8KA 1TQIA 5K1YA 4WXDA 2GZWA 1T6SA 5DYMA 4MEXF 3D5LA 1KA8A 1MJBA 1J75A 2BBYA 2JSCA 2WV0A 2VT2A 3V8JA 5D5UB 4MQ9F 4L5JA 3HYIA 4WXHA 3QPHA 4HBLA 3LA3A 1U5TB 1BC8C 3RKYA 3PQJA 4RB0A 5E20A 4LLLA 4U88A 2EA4A 2L01A 4M6XA 2OQRA 1JE8A 2Z3YA 4OMYA 1B9NA 1LDJA 2K02A 4MQVA 5EEGA 4LLNA 1FZPB 3KZYA 1HKTA 2GA2A 4IRHA 4UUVA 3LAPA 2STTA 1BIAA 4ESFA 5BOXA 4A5MA 5D6FA 2CGPA 1IXRC 3B02A 1O3RA 5IT9Z 3ABTA 4GCVA 1TBXA 1TQMA 4A12A 4YG2F 2DFIA 1YYVA 4JBAA 5CVIA 4YIFA 1RUOA 5L3EA 1R00A 4G6QA 1U3EM 2QLZA 4XSZF 4U7BA 1OYYA 3JAMZ 5E1WA 4FHTA 5HDGA 3T5XA 1HKQA 1F4KA 2UXNA 4RS8A 3GFLA 2VOPA 3WTUC 1PUEE 4AIJA 1I1GA 3EYIA 1B9MA 5LBQA 1RZ4A 1XGNA 2FXAA 4GYGA 4GGGA 3QU6A 1FP1D 3V7SA 5HLIA 3F8BA 3MZHA 2K86A 2OU2A 2QBYB 1XDSA 2ESHA 3W6JB 2VBYA 2G7HA 2X0LA 2OBPA 2NNNA 3JSPA 2M45A 4EJVA 1QGPA 2MBFA 3E5QA 4KICA 4RAYA 3RJPA 1BI1A 3WGIA 1OPCA 1YFHA 1WSUA 1FWZA 4D0PA 1XN7A 4YFKF 4KIBA 2FNAA 3BPXA 1GVJA 4HF1A 4M9XA 2L4AA 1K79A 2JRTA 1F1ZA 4I02A 3GO5A 3I59B 2FEZA 2V1DA 2W57A 2D1HA 1L3LA 3I53A 1LEBA 3I0TA 3D0SA 2PLYA 4O6JA 3ZMUA 4XSXF 1C0WA 2G9WA 3LQRA 4A0ZA 3IRRA 3WG9A 3GZ5A 3E97A 3DKWA 2CO5A 4N9IA 3BY6A 3JTHA 4EJOA 3E6MA 3SZTA 2YX4A 4PZJA 3COAC 1KQ0A 1FSEA 3HHGA 3IL2A 5E8IA 4U7DA 2IA2A 1T0FA 3VEPA 2RKHA 4ETSA 2ZNYA 3J80K 1FSHA 2PI0A 2RQPA 2RNJA 4P55A 5K5OA 3T0YA 2QVOA 5ICEA 2K4JA 4A2UA 4A0YA 1WRJA 2F5EA 5E17F 3B73A 1ZAOA 5JI6A 1E2XA 4MHGA 5DUIA 2JZYA 5L3FA 1OKRA 1F5TA 2V1XA 4AVPA 2DQLA 1JHHA 4LK0F 5LLQA 5K5QA 3IWFA