1EH7A

Methylated human o6-alkylguanine-dna alkyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
161
Chain Sequence
b'CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 161
sequence length 172
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh7A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh7A01
2IJLA 5DCFA 2XAQA 4RGUA 4CXFA 3HIFA 4AIKA 3LWFA 3CLOA 3WE3A 4KIBA 3CJNA 1ZAOA 4D0PA 3EYYA 1J2XA 1ZARA 3GEZA 5TJJA 2OQGA 4Z2YA 2EA4A 4ENNA 2M30A 3P7NA 2OAZA 2LF8A 2ZBKA 3K2ZA 4IHTA 2IPQX 4CGZA 4B8XA 2QQAA 1MJBA 3V8JA 5ILVA 2FNPA 2UXXA 5L3EA 2AXLA 5CVIA 3GFMA 1P92A 1T2KA 5ERIA 3RPQA 4IRIA 2VXZA 2XKPA 4I7HA 2W57A 4RGRA 1U5TA 1T6SA 3VOEA 3G3ZA 1JGSA 2EV0A 3LA3A 2E1NA 4N9HA 2COMA 3WTXC 1H0MA 4HA8A 4KIFA 4RS8A 3BJ6A 1FSEA 2HKOA 4KICA 1KU3A 4L0ZB 4KMFA 3MQ0A 4LB6B 4KFCA 1QNTA 2FBKA 2A5YB 1VTNC 1ON2A 4HBLA 1R00A 2F5EA 3NEUA 1J0RA 2LKPA 3I59A 5J8FA 5IT3A 2D1VA 3ABTA 5LHGA 3QPHA 2PQ8A 1IUYA 1XMAA 2HGCA 2MLGA 2FEZA 2MH9A 3V8KA 3IRRA 2P5VA 4U0WA 1UHWA 1PUEE 1E2XA 2PEXA 2L4MA 4EJUA 5DUKA 2M1BA 3JTGA 4M6XA 3TO9A 4Q4ZF 2GA1A 2DPDA 3Q9VA 2K4BA 4A5NA 2HZTA 4XSXF 1MJ9A 2V1DA 4K2EA 1I1GA 3ZQ7A 1F9NA 1P2FA 4I0AA 1XMKA 4B09A 5LBQA 3H3UA 1FZPB 2L02A 4M74A 4E70A 4FT8A 1AWCA 3I71A 1W7PA 3U2RA 2NAZA 2XVCA 4UVCA 4L9TA 4F7ZA 1XSVA 1YG2A 3WTYC 4HF0A 4H0EA 4XRFA 3TDZC 4RAZA 4LMYA 2B0LA 5CVRA 2HDCA 2LF7A 1BIBA 1L3LA 5ICGA 3ZMSA 5EEHA 4LFUA 4YIFA 2P4WA 3GWZA 2F5DA 3E5QA 3J81Z 2CG4A 1X3UA 2XROA 1IW7F 3WTWC 2R7FA 4KN4X 3KP3A 5A2QZ 2EFNA 1QBJA 4A0XA 2QZ8A 3RI4A 3Q5FA 1P4XA 2PMHA 3DFGA 4A2UA 1TNSA 2DBBA 3V4GA 1G3TA 2HFHA 5L3BA 4YFNF 3CO6C 2G7HA 1FBQA 3GFIA 2K27A 3F8MA 3GVAA 2K7LA 1IRFA 2Z3YA 2CFXA 2HYFA 1EH8A 2M45A 3WGHA 3PFIA 4BAYA 4LG0B 2BV6A 3WE2A 1RUNA 5HDGA 5CVUA 5D4RA 4WF2A 2HS5A 1CGPA 3E5UA 5LGUA 3QAHA 5K5QA 4IRGA 4EJTA 2XKOA 3TO6A 5D8KB 4KT5C 4EM0B 1KYWA 1J5YA 5BOXA 5K1YA 2RGVA 2X4HA 1H9GA 3J80Z 3S2WA 1YW9A 2ZNYA 4OMYA 1SD4A 3VODA 4ESBA 1SFXA 3IC7A 4CICA 2VC1A 1USSA 4O6JA 2CYYA 3KE2A 1HSJA 3O3KA 5JHUA 4ASNA 3HSFA 3M8FA 1HKSA 4M9XA 1UCRA 5DCMA 3ROUA 4XBFA 3QP5A 3IKVA 3WTTC 1BC7C 1HSTA 3FF5A 2O0YA 2XASA 4ETSA 5JI6A 5J6XA 5AIPA 3T0YA 3MAJA 3KFWX 2E1CA 1L0OC 1EV7A 4RAYA 3CDHA 3T8TA 4HDUA 5L3GA 3KEQA 1F5TA 3WU0A 5CLSA 1YW7A 4I98B 1BM9A 1FLIA 4MQ9F 3KP6A 1R1VA 4DNCA 2NNYA 1R58A 2PJPA 2L4AA 3ZP5A 3E6BA 5BMZA 4HW0A 4G6DA 1P6RA 1XDSA 2WC2A 4HLYA 3I64A 1STZA 1ZREA 4A0ZA 5BPIA 4OIPF 3FZVA 2MA3A 5E8IA 2KRFA 3RJPA 3F3XA 4LK1F 4HQMA 1ZRFA 4QLCU 3BJAA 1O3SA 1GXPA 2OZUA 2DQRA 3T5XA 5ICEA 4GYIA 4EMSA 2W85A 2GZWA 3IWZA 2MLKA 5H20A 2QYOA 3IL2A 4UV9A 3IRQA 2QUFA 2BEOA 1XGOA 3AAFA 2M87A 2O8XA 3KEOA 2DW4A 3RDIA 1D8JA 2EWNA 3R4KA 4L9VA 3TKYA 4BQAA 2DK8A 3DPTA 5FGMA 1LNWA 2FE3A 4I09A 2ZJ2A 4OIOF 2Q8KA 2QBYB 5LHHA 2PN6A 2ZMEB 5FFZA 5HDNA 1K78B 1S29A 2D2WA 2FOKA 2NYXA 4N0BA 1GHCA 1IN8A 2EFPA 3L7WA 2ESHA 2P6SA 5K5RA 1YIOA 3CUQB 4KA4A 1JE8A 1R5HA 2KJCA 4HLXA 5H6QA 3O2PE 3L2CA 5L3CA 5H6RA 5CVJA 2V1UA 2QVOA 4WXCA 2FMYA 2FA5A 4HF2A 4YIIA 4UXNA 1SMTA 2ZFWA 4EM2A 1MZBA 2RV8A 3P9KA 5CVVA 4ESFA 1XSXA 3ELKA 5E1WA 1LEBA 3W6JB 2ZCWA 3LA2A 1TQMA 2RNJA 4P9FA 4PGGA 3CO7C 3TO7A 5E17F 1UFMA 4HX7A 1IN7A 1J59A 2EJRA 4L9NA 5DV5A 1XN7A 4FX4A 1FWZA 2JPBA 3IWFA 1R36A 2ACJA 1SD6A 1MKMA 1IF1A 1Y0UA 2L3DA 2FXAA 3DP7A 3KZYA 4LLLA 2VOPA 3I53A 5FLXZ 1BI2A 5ILUA 5JR3A 2KKOA 1R1UA 2Y0MA 3HRSA 1I5ZA 2H94A 2IRFG 3BP8A 4YG2F 2MBFA 2R7DA 3W6KB 2XHKA 4ON0A 2ISZA 2OU2A 4U88A 2UWMA 3B73A 3J81K 1B9MA 2ETHA 2RVCA 2V1XA 3FM5A 4BHBA 5A2QK 3ZN0A 3CUQC 1FY7A 2ELHA 2HR3A 3ECOA 2PG4A 2NNNA 2CO5A 2DAOA 1OYWA 2A07F 3LAPA 3O6BB 3HSEA 2PFBA 3IKTA 3ZMVA 3GXOA 1OYYA 2GQQA 1F1ZA 1KU7A 2JZYA 2JTVA 4U0YA 1S7AA 1FC3A 2P5LC 3HRTA 1OYIA 2H09A 2ZKZA 2DTRA 3TOBA 4EGYA 1MDMA 2IT0A 2IA1A 4DQ2A 4M9SA 1B4AA 5DUIA 3JSOA 1BI0A 2LSOA 2XUBA 4KIGA 3FXUA 1Z7UA 1G6NA 5HLHA 2IA2A 5D5UB 1XD7A 3J80K 1S3JA 2ADUA 3H3ZA 4ENKA 2FF4A 3WTUC 1AOYA 3LFKA 4WCGA 1IXSB 4ZH4F 3L00A 3VEPA 2GXGA 3ECHA 3KETA 1G3WA 2EV5A 1E17A 1HKTA 4AIHA 2P7CB 1B59A 4L5JA 1FP2A 4LGWA 1CF7B 5CJ9A 1BC8C 3D5LA 4LJZF 4R79A 1KU9A 2O3FA 1U2WA 3J7AO 4Y17A 3V8LA 1T98A 3GW2A 1PDNC 2VODA 5FB2A 4IJAA 4WK8F 4UHTA 2EFOA 2FBIA 5ED4A 1FBSA 1GXQA 4LD5A 4PCQA 3MEXA 3HOSA 2XIGA 2IVMA 2H6BA 1FNNA 5D5VB 4IVNA 4OIQF 2VBWA 4Q47A 2P7VB 1F4KA 1YQAA 3RTRA 4I02A 2VC0A 1S6LA 4BXUA 3F72A 2Q0OA 5E1ZB 4GCVA 1KQ0A 2EK5A 3GZ5A 2A61A 1P4AA 1QGPA 3K9TA 3FX3A 1SFEA 1LVAA 5FO5A 1YTYA 3KP7A 1ZN2A 4U7DA 4Q5SF 5HS7A 1RI7A 3K1PA 3EUHA 1IN4A 3QOPA 4EVIA 4XSZF 5ILSA 3MCZA 1J75A 2RKHA 4S05A 2V79A 1T0FA 2VT3A 2DO7A 3DQVC 5F64A 2VBZA 3MWMA 3BJOA 3RKXA 1ZRDA 3M9AA 2W84A 4MHGA 1U8RA 3C1DA 2Z33A 1ZLKA 2MH2A 2A6EF 2M8EA 3BOQA 4GYGA 1QPMA 2ZXJA 4XLNF 2TDXA 3WGGA 3LQQA 2QQBA 1IRGA 3FMRA 5DD8A 3BZ6A 2OZ6A 3OOPA 1HW1A 1SFUA 4A5MA 2L01A 5LEJA 3KZZA 1FYMA 3KP4A 3FM3A 5D4SA 5J8CA 5D5WB 4RB0A 1HW2A 3RIRA 3HUGA 1QZYA 2NS0A 5JVTA 2V6CA 4EQQA 4A12A 2HYGD 1RIOH 2G9WA 3U1DA 4MTEA 3WTSC 3GX4X 4CHUA 1XGNA 1JHFA 2PI0A 5AIQA 2ZO4A 2Q2EA 4N9IA 4PDKA 3R0JA 5L3FA 1TQIA 4JBAA 1WRJA 3Q9SA 2DFIA 3ZN1A 2K02A 1KYZA 1U5TB 2BYVE 3DPLC 2YSRA 2CW0F 3I54A 1LDJA 4A6EA 3E6CC 1FPQA 3HYIA 4CZZA 2BE5F 4OU0A 1D8KA 5L3DA 4AD9A 3GO5A 1OR7A 3NQOA 1WWXA 1R23A 1TBXA 4HX4A 3EYIA 5FLXK 2HQRA 2DQLA 2FNAA 2JPCA 1O3TA 2VBXA 3TDUC 3K1MA 3PQJA 1MD0A 4ZYDA 4UVBA 4JK1X 2VE9A 1XDUA 5BS6A 3DXJF 3H92A 3I58A 5BPDA 1LDDA 4R8HA 2P8TA 3I59B 4P55A 1BI1A 4GXOA 2W25A 1YLFA 4TV7A 5FD5A 3F21A 1PP8F 4KNYA 2A6HF 4MEXF 2RQPA 4BNCA 5F6FA 1EH6A 3DF8A 1D5VA 3BPXA 5HDKA 3C7JA 4P9UA 4IHSA 2VT2A 4KN7X 5FFXA 2XV4S 1DUXC 1U3EM 3M1EA 1XCBA 4KYWA 5KK1A 3KLNA 1ZHFA 1U78A 1ULYA 4RGSA 5JFRA 2IW5A 1DPRA 2PBIA 3U9GA 1BOAA 1KGSA 1U5TC 5AONA 1Z1DA 4WXDA 4IRHA 4L9JA 2QLZA 4U7BA 3WTZA 3P9IA 5TRDA 1Z9CA 4HOBA 3BY6A 2IA0A 2F2EA 2WV0A 4HV6A 4MQVA 5LEKA 2PLYA 5IT9Z 4G7ZF 4QWQA 2XAFA 3LA7A 4RGXA 3SXYA 3TGNA 1YYVA 3DV8A 2JRTA 1B9NA 5HLGA 3GYHX 2UXNA 2YPRA 2CSOA 3K69A 2A69F 3F6OA 3BROA 1S8NA 2L54A 1HXDA 3JTHA 1BBYA 1U6GA 3HOTA 2DPUA 1KU2A 3L9FA 5K5OA 3WG9A 4G7OF 4WWCA 1J7KA 4HDVA 4GO1A 4O5VA 3SZPA 3WTVC 2IP2A 3KP2A 4MGRA 2J5OA 6PAXA 3REOA 3LSTA 4ESJA 5ICFA 5ICCA 3HRMA 1TNTA 4RB2C 1OMIA 3T8RA 1BI3A 1A04A 4PZJA 2Y48A 3ML6A 4LG0A 5LGTA 1REPC 5HLIA 1DDNA 4LLNA 4EJOA 3V7SA 2HOEA 2K86A 1RNLA 4UV8A 3TOAA 4MTDA 3RYRA 4UUVA 3TQNA 2HEOA 3QU3A 4Y13A 4EM1A 3JAMZ 2FQ3A 3GFJA 1O7FA 2BBYA 1S7OA 2ESNA 1ZG1A 3F8CA 2ZNZA 4ENMA 5D6EA 1YW8A 3E5XA 5HOOA 3C18A 1Q1HA 2A68F 2QENA 2QQ9A 3RYPA 2VE8A 2O61A 4EJVA 4EV0A 4FX0A 5BQTA 4AVPA 3KCCA 4XLPF 3GZ6A 4Y15A 4IPAA 5DCMB 3I0TA 5E18F 3E97A 2OD5A 5KVRA 1V3FA 3FXRA 1BJAA 4P96A 5F1RA 3DEUA 1R22A 1ZH5A 2K4JA 2EFQA 1JHHA 1D3YA 1P4WA 4WX9A 4EGZA 3P9CA 2QM3A 3SFZA 3V7RA 1R7JA 1Z91A 2VOOA 4JQFA 1I6XA 3DKWA 4U0VA 2V9VA 2DI3A 1OPCA 1W5TA 4LLGF 1K6OA 4RB3C 4IF4A 2A3SA 2H6CA 3D0SA 1Z05A 5FD6A 3F6VA 3JSPA 3N4MA 3ULQB 1Z6RA 2YX7A 4RB1A 1LEAA 1GVJA 1V4RA 4OINF 2KIMA 1UHMA 4A0YA 1B1BA 3I5UA 1YFHA 4OMZA 4OIRF 5LRRA 3QP6A 2KIUA 2E7WA 3RPUA 2YR2A 4I2OA 1YO5C 3HTUA 2STWA 3SZTA 1O57A 3KP5A 1UB9A 3EETA 5D6FA 2RN7A 3K1NA 4L18B 4L0YB 4HX8A 3BWGA 3CUOA 1DPUA 3QRFF 1XGSA 2O03A 4BH9A 2KIFA 2XAHA 2PMUA 2QBYA 2XRNA 1XB4A 3QPTA 2ZMEA 4CYDA 5DD4A 3GUDA 1K78A 2GWRA 2FRHA 5LHIA 5D8LB 2FU4A 2FSWA 4ZYHA 5LLQA 1HW5A 3KLOA 4EJWA 3ERED 2DK5A 3CUQA 4G7HF 1W7PD 3VFZA 4KMUX 2FBHA 2W24A 4FHTA 2WTEA 3OV8A 1QO0D 1PP7U 4HZFA 4BYYA 1KA8A 2M5WA 2NRAC 4YFXF 4G8XA 1ZYRF 1LDKB 4P5OA 3JW4A 2LDUA 2BGCA 3LQRA 3FXQA 1G3SA 3L09A 1ZLJA 3EQLF 3M7GA 2HTSA 4BHCA 2MC3A 2OBPA 5LGNA 4I01A 3EDPA 2X0LA 3N97A 3ISPA 1IZ1A 3R61A 3PQKA 1TTYA 1HKQA 4M71A 4G94A 2F5FA 1IXCA 4ZZLA 4Q48A 4S04A 1R5GA 5IT9K 2YX4A 3MFKA 2GA2A 1USTA 2D45A 4HQEA 4YFKF 2XAJA 3RKYA 1BN5A 1FSHA 2VBYA 3I4PA 4CO8A 1FP1D 1ON1A 1SD7A 5E20A 2HQNA 1KQ8A 4UNOA 3ZMUA 3WGIA 3HSRA 3ZPLA 3WU1B 4ZYEA 2QWWA 1YS7A 3FWEA 1B6AA 4M72A 3FHZA 1XCVA 3T1BA 4NB5A 2WWYA 2H27A 4G6QA 2RC4A 3BPVA 3V7CA 2FMLA 3BDDA 3HHGA 5DYMA 3G73A 2DT5A 1QZZA 1J9IA 1O3RA 3NRVA 2G7UA 1SAXA 1RZ4A 3R6SA 2Y75A 5HVQC 2GXBA 1MGTA 1BIAA 1ZG5A 3RKWA 2VN2A 3K0LA 1ONVA 1HBXG 1YS6A 2EB7A 2MD5A 4KUMA 1LQ1A 5HS8A 1TW3A 1SMYF 1G4DA 1XGMA 1ODDA 2YU3A 1G3YA 1IXRC 1TQPA 1KQ9A 3E3VA 4AWXB 2CGPA 3HTSB 2XAGA 5DEQA 1JXSA 1IAWA 1R1TA 3GF2A 3R0AA 3SHFA 1K79A 4LB5A 1FOKA 1WKMA 2DLLA 1XSDA 4G9YA 3JAMK 1MDMB 4WXHA 2EV6A 1FYLA 1SD5A 3CTAA 1T39A 2Z5UA 4M73A 1OKRA 1FT9A 3B02A 3QU6A 4ENJA 1ZRCA 1ZG3A 2CQKA 2Z9OA 4MEYF 1ZGJA 1LJ9A 3FMSA 5CYVA 1Z6TA 1FYKA 3F8BA 1K7AA 2VONA 2R3SA 2KJBA 3F23A 1CF7A 5E8GA 1FBUA 3WODF 2E7XA 4ZYGA 3FMQA 2DU9A 3E6DA 2F5CA 1DP7P 5D5XB 3F8NA 4M9ZA 4I0BA 3ZMZA 5LRSA 2P6TA 3LAJA 5HS9A 4R1HA 4PGHA 2HWVA 2J5PA 2LNBA 2Z99A 4AIJA 2OA4A 4HV5A 4KDPA 4O3MA 3ZMTA 3M8EA 2XGXA 1C0WA 3F22A 1O3QA 1W4MA 2O6GE 4CDGA 1IN5A 1TW2A 1RUOA 1I1SA 4GGGA 2STTA 3F8FA 2JSCA 1QQIA 1TLHB 3MZHA 2GIVA 1W7PB 2JT1A 1IN6A 4HF1A 5EEGA 3E6MA 4MNUA 1WSUA 1ZGAA 4LK0F 1FX7A 4OOIA 4M6YA 1T38A 3C3WA 2HKXA 1H9TA 4HAMA 4BHPA 1MJAA 1EH7A 1W5SA 4NHJA 3GLXA 2P5KA 4HYEA 4NQWA 2RDPA 1NHAA 3IHUA 2HTJA 1WQ2A 1O7LA 3ZMDA 4UVAA 4IXAA 2D1HA 2EFWA 3VB2A 2C6YA 2AS5F 2ISYA 3HHHA 4A6DA 2OQRA 3HRUA 5DDGA 2EA2A 4L5IA 3COAC 2UZKA 3MZYA 1WI9A 4ZZDA 2CWEA 3ABUA 5E1XA 3SQNA 1I27A 3GFLA 2GAUA 1LB2A 3R60A 1HQCA
chains in the Genus database with same CATH superfamily
2IJLA 3G1OA 5DCFA 4ZJZA 2XAQA 4RGUA 4JX5A 2ZSIB 4RHBB 2LUPB 4CXFA 3PNTA 3SJMA 3HIFA 4AIKA 3LWFA 3W3CA 1BJZA 2LTSA 1YI2I 2RSMA 2VQFE 3CLOA 4C2TA 3WE3A 3IH4A 1S7EA 4KIBA 3CJNA 2BW3B 4IZZA 1ZAOA 2YTPA 4D0PA 2AXTC 4X1EA 3CMEI 1W36C 3EYYA 3H35A 3ADIA 3BG9A 1J2XA 1ZARA 3GEZA 5TJJA 1Z7LA 2OQGA 4B48A 4Z2YA 2EA4A 3EUAA 4ENNA 3G6EI 2EPCA 3F6GA 1Z67A 2K9LA 2VL8A 2MSYA 3G71I 2M30A 3P7NA 3HUGB 1X6HA 2DB2A 2DJNA 2OAZA 2LF8A 2ZBKA 3K2ZA 3S3NA 3IAS2 4IHTA 2IPQX 4CGZA 2LC2A 3E0JB 4B8XA 2B3TB 1ZTRA 2QQAA 1MJBA 3V8JA 3OYJA 3K70C 4ZYAA 5ILVA 2FNPA 2HOSA 3EPJA 2UXXA 5L3EA 2EPKX 1VQ7I 4BACA 2AXLA 5CVIA 3GFMA 2ICWG 1P92A 5EG0A 3CCEI 2DA3A 4OWRB 3OYCA 1T2KA 1WJPA 5ERIA 4FCYA 1T95A 3RPQA 4IRIA 3CDIA 5CQGA 2H36X 2VXZA 2XKPA 4I7HA 2Q2EB 2VJIA 2JK3A 2TRTA 2W57A 3IP4B 1E3PA 1GVDA 3S8PA 2CTDA 2OCEA 3W6VA 3Q0WA 4IOCF 4RGRA 1U5TA 1T6SA 5J4YA 3M4OJ 4RBOA 1OISA 3VOEA 3G3ZA 2L6MA 2W00A 2Y30A 1JGSA 2EV0A 2W1OA 3Q3SA 3LA3A 3EUHC 2E1NA 4N9HA 4ANJA 1A1LA 4WFTA 3ABLH 2COMA 4E7SA 3WTXC 2EMGA 4LF7E 4FASD 3RQIA 4BQQA 3K2AA 1JKOC 3P1XA 2O8KA 4DR7E 1H0MA 2EPLX 1W5CC 4HA8A 5M3FJ 4X0GA 4KIFA 3BTIA 4RS8A 3THOB 5EZHA 3BJ6A 1FSEA 3CJRB 2ZXHA 3I4MJ 2BVMA 2HKOA 3J7ZI 3CCLI 4GZNC 4GFBA 3OS2A 4DZJA 4KICA 5IYCJ 1KU3A 1IBME 4L0ZB 4KMFA 2CUJA 4YHHE 4TUIA 4M9VC 3MQ0A 4LB6B 4KFCA 1QNTA 3GTQJ 1TF3A 1X4PA 2FBKA 3VSKA 1QHGA 2A5YB 3LSJA 1WHQA 1ZU1A 1VTNC 5B3SH 1JTYA 5F0FA 2MDRA 1ON2A 2L2NA 4HBLA 1UHSA 1R00A 2F5EA 2VI6A 3OS0A 3S17J 5GTIC 1UN6B 3NEUA 1IQOA 1J0RA 2LKPA 4A3IJ 2YZTA 2ECCA 3TMOA 2W82A 3I59A 5J8FA 1GDTA 5IT3A 2D1VA 3ABTA 5LHGA 1DP3A 1PVEA 2AQEA 5K7FA 1XG1A 2ZSHB 2QKLB 3LMLA 3QPHA 1TWGJ 2EH3A 5IYDJ 2PQ8A 3K4KA 4O24A 1IUYA 1XMAA 2HGCA 2MLGA 2L2KB 2FEZA 2MH9A 3V8KA 4OAZA 4XK4A 3IRRA 2Z2SB 4HG2A 5IWAE 4R8OA 2P5VA 3PO3J 3OYLA 4U0WA 1LPQA 2YRHA 1UHWA 2DA4A 4AU7A 1BB8A 2L7KA 1PUEE 3UNGC 5KL5A 2DODA 1E2XA 1W1WE 1JTXA 1R6RA 5KL7A 1FIAA 2L4MA 2PEXA 1A1JA 3WG7H 4EJUA 5DUKA 2M1BA 3JTGA 1ZR4A 1FTTA 3VPRA 4M6XA 2CQXA 2HGHA 3TO9A 4DBQA 1DQUA 2WAQN 2DOFA 3GLLA 4Q4ZF 3GTMJ 3L2VA 2GA1A 5GAEJ 4A3FJ 2DPDA 1IC8A 2N8XA 2YTGA 2EIJH 4C30A 3HOWJ 2NVTJ 3Q9VA 2K4BA 2EOZA 2CS3A 5EYRA 2DA6A 1WH7A 4A5NA 2L0KA 2R7VA 2OCCH 2HZTA 4XSXF 2V83A 2ODRC 1YZ9A 4RLFA 4WSGA 1MJ9A 3A0BC 4XKWA 1H88C 2WV1A 2V1DA 2ZFUA 5DTDA 5ADZA 2IS4A 2XPUA 4K2EA 1I1GA 2EZKA 3ZQ7A 2KPMA 4DV5E 4CCJA 4BE2A 2E2JJ 2LE2A 1F9NA 1P2FA 3M07A 1UG2A 1GLNA 4I0AA 1XMKA 4B09A 1YITI 5LBQA 2MD0A 1LKXA 1V55H 3RZDJ 2E36A 3H3UA 1FZPB 2PMZN 2EOJA 1YX3A 3DPUA 2L02A 3ZQQA 2EPXA 1DGRM 1QHHD 4M74A 2HVQA 4E70A 4FT8A 3RSNA 3UR3C 1AWCA 2EOIA 4BMJA 1YUJA 3I71A 4RDUA 1W7PA 3AFHA 3BCBA 3U2RA 2NAZA 2XVCA 4UVCA 4L9TA 1I50J 2X6XA 4F7ZA 1XSVA 1YJNI 1YG2A 3WTYC 5LMNE 4HF0A 4H0EA 4XKCA 2X9DA 2FX0A 4XRFA 3TDZC 1GV5A 2ID6A 5M5XJ 3G4SI 3RZOJ 4RAZA 4LMYA 3GMEA 3GCMA 2B0LA 1YJ9I 3K70D 5CVRA 1JKRC 2HDCA 2LF7A 1BIBA 4CCKA 2CRGA 3RQ4A 1L3LA 5ICGA 1JUPA 1U9NA 2MFZA 3ZMSA 5TISC 5EEHA 4LFUA 3UKGA 4YIFA 2M9AA 2MC6A 2P4WA 4C2UA 2YRKA 2HNHA 3GWZA 4XLCA 2F5DA 1TWCJ 4NDLA 3CCMI 4IX7A 5A6KA 4X65E 3K4JA 3BR6A 3E5QA 4A3CJ 3J81Z 2CG4A 4DR5E 1X3UA 2XROA 1IW7F 3WTWC 1PUFA 1IDZA 1M1EB 2BY1A 2L7ZA 2R7FA 4KN4X 1BL0A 3S3MA 2HVSA 3LLHA 3KP3A 5A2QZ 2EFNA 2LV2A 4BEHB 1QBJA 2GLOA 1SC7A 1EF4A 1RPWA 4A0XA 2QZ8A 3RI4A 3Q5FA 1P4XA 3EPKA 3G1MA 2EZHA 2N3HA 1FOXA 2PMHA 1ETYA 3DFGA 3CJQB 4BC7A 4XOPA 4A2UA 1HDPA 5EGOB 1TNSA 3MKLA 3S16J 2DBBA 3CMYA 3V4GA 1G3TA 2HFHA 5L3BA 2RTXA 1Z1BA 4YFNF 3CO6C 4E7JA 3S15J 2G7HA 4DYQA 2M7QA 1FBQA 2OJED 2VQEE 2EIKH 2EIMH 3C2BA 4R2SA 3GFIA 5CFFE 1XTAA 2K27A 2AO9A 4DZPA 2R7TA 2Y31A 4Y33A 3JRFA 3VYUB 4YEJA 1X6EA 2CW8A 4M30A 3E7LA 3F8MA 2Z16A 3GVAA 2B7TA 2K7LA 1IRFA 2Z3YA 2CFXA 2HYFA 1EH8A 2M45A 2DA1A 3WGHA 3CF5F 2EMCA 1WXRA 2JJ7A 2BXZA 2LH9A 5BR8E 2JYAA 3DBHB 3PFIA 1D0ZA 4BAYA 1YYWA 4LG0B 2LBFA 3WU2C 1HCRA 2M9HA 2BV6A 3WE2A 4QIWN 1Z3YA 4IHWA 3JR9A 3SFIA 1MNEA 3BZKA 5A6AA 1RUNA 5HDGA 3VHTB 2M3AA 1F36A 4HPQA 5CVUA 2R1FA 4HEA2 4IHYA 2A05A 5D4RA 2BW3A 1FOYA 4WF2A 2Y2ZA 2HS5A 1CGPA 5A6BD 3E5UA 5LGUA 1AAYA 2EZLA 3QAHA 5K5QA 4IRGA 2L92A 4EJTA 2XKOA 3TO6A 2EM3A 3KYCB 2B9DA 2YU5A 1YE9A 3K4CA 2ZB9A 4D7NA 3F6HA 2EPOA 2IHR1 2DOEA 4JP0A 5D8KB 4KT5C 4EM0B 1KYWA 4XMYA 4N4NB 1J5YA 2YUSA 5BOXA 1I6HJ 3MMYB 5K1YA 2EMLA 2LVSA 2ELZA 2RGVA 2X4HA 1H9GA 1W0UA 3C2GA 1BA5A 3J80Z 5E3LA 2ADRA 2LUQA 1NK3P 4XLAA 4XN3A 1B72B 3S2WA 1YW9A 4G12A 3H0DA 3A01B 2KHMA 2ZNYA 1Z21A 2X6OA 2EPFA 4OMYA 1SD4A 3VODA 4U87A 1MW7A 4ESBA 1SFXA 2F4MB 1WJDA 3IC7A 4CICA 4JI1E 2VC1A 1USSA 1WPKA 3ABMH 4O6JA 2XAUA 2LD5A 2CYYA 3KE2A 4XLHA 2EOHA 1HSJA 2EPNA 1A1HA 3O3KA 5JHUA 4ASNA 1Q1VA 1WJBA 3HSFA 3M8FA 3C6KA 3I9V2 1HKSA 3A1YA 1UCRA 4M9XA 1U8BA 5DCMA 3ROUA 3IAM2 2JVAA 4AC0A 2BXYA 3LL7A 3MZ8A 4XBFA 3QP5A 3IKVA 3L2UA 3WTTC 3DEEA 5FRMA 1V5FA 2WB1A 3QYBA 1NCSA 1BC7C 3KYLA 3JTZA 4RAFA 4DW6A 2UU9E 1HSTA 1XC5A 3FF5A 2O0YA 2XASA 3VSLA 4ETSA 5JI6A 2RREA 2LK2A 3ZGKA 1ETXA 1MSFC 2EOEA 5J6XA 2YS9A 1OJLA 5AIPA 3HBLA 3T0YA 3FKIJ 3MAJA 3KFWX 2E1CA 1L0OC 2EL6A 1EV7A 4RAYA 4CA0A 3CDHA 3I56I 3CCRI 3QPLA 3T8TA 2DIXA 4HDUA 5L3GA 2VPLA 3NWTA 3KEQA 3RCOA 1F5TA 2LTRA 3WU0A 5CLSA 4LIUA 1YW7A 4NZVA 3OYBA 4I98B 4PSWA 4XIDA 1BM9A 1FLIA 3AG4H 4MQ9F 4M3GA 3KP6A 1R1VA 4TUGA 4IKFA 2ZJRF 4DNCA 2VKVA 2JA5J 1RC7A 4DGWB 2NNYA 4AYBA 1R58A 5KL3A 2PJPA 2L4AA 4LF5E 3E6BA 3ZP5A 1G8XA 4XLFA 1AU7A 3JRGA 5BMZA 2GIZA 4HW0A 4G6DA 2I9IA 1P6RA 1XDSA 2WC2A 4HLYA 1OLTA 2DSYA 4Q35B 3I64A 4HNVA 1STZA 2V9KA 1HNXE 1ZREA 4A0ZA 5HNFA 4FETA 5BPIA 1XNRE 4OIPF 3FZVA 5IP7J 5E3NA 4YIRX 2CH0A 2MA3A 5E8IA 3CP8A 2JY9A 3QOEA 2KRFA 4XORA 3RJPA 4L5NC 2LJUA 3F3XA 4Y52J 4LK1F 4HQMA 1ZRFA 5TGTA 2EQ1A 4JI2E 4QLCU 3BJAA 1O3SA 3ZR8X 1GXPA 4DV3E 2OZUA 2LMDA 1SFOJ 4F9AB 3DTEA 2VJ4A 2DQRA 2H1LA 3T5XA 4L5EA 2L7MP 3D5SC 3KYDB 3HPSA 1R4MB 5ICEA 3JRBA 4GYIA 5IT9C 4EMSA 2W85A 2GZWA 2LREA 3IWZA 2MLKA 3KZIC 1SANA 5H20A 4DR4E 2QYOA 2PJRA 2M4IA 3CMAI 5GP9A 2KOUA 3IL2A 2EL4A 4UV9A 1B69A 5FKNA 3IRQA 2D9HA 2QUFA 2BEOA 1XGOA 3QG5C 1PJRA 3AAFA 2M87A 1KONA 2O8XA 3OS1A 3KEOA 2UUCE 2DW4A 2HHHE 3RDIA 5KL6A 4BGDA 1D8JA 2EWNA 2WY8Q 5IP6A 3R4KA 3TP3A 2L33A 1RKTA 1ZR9A 4LF9E 1IRXA 4R2DA 4L9VA 3TKYA 5IPAA 2E2HJ 4BQAA 3ADJA 3LNQA 2ELYA 2DK8A 2B7VA 2EINH 3DPTA 3GZNB 5FGMA 1APLC 4ZTJA 4RH8A 2OUMA 1LNWA 4BCAA 2FE3A 4BDYA 1GTKA 1MNMC 4NXNE 4CYCB 4A3GJ 4I09A 2ZJ2A 1ETVA 2R0QC 4OIOF 2P0WA 4PJ0C 4NC6A 2M4KA 2OV7A 2Q8KA 2H8RA 1N75A 1VQ6I 2QBYB 2Y69H 2QEXI 5LHHA 2PN6A 3HPGA 2YRMA 3H09A 1IDYA 2ZMEB 5FFZA 2EMHA 5HDNA 4PK4A 1K78B 1S29A 2D2WA 2FOKA 2NYXA 4N0BA 1GHCA 3G1LA 4DYRA 2XF6A 1IN8A 1IQSA 2HOTA 5AE2A 2EFPA 3L7WA 2ESHA 2P6SA 5E79C 5K5RA 3CDLA 1H8AC 2JN6A 1YIOA 2XDVA 1R5ID 3CUQB 4KA4A 1JE8A 1R5HA 2KJCA 4HLXA 5H6QA 3O2PE 2FD5A 1Y8RB 3BTLA 3OIOA 4CCNA 2UXBE 3L2CA 2EN3A 2DYSH 5L3CA 2IGOA 4XRSA 2WAEA 5H6RA 3Q0UA 3SDGA 3MHSC 5CVJA 2X48A 2V1UA 2W4SA 1MBEA 2EMBA 3SZGA 1S9HA 2JA6J 3GTOJ 4DUYE 3GTKJ 2HXIA 2QVOA 4WXCA 2FMYA 3FXJA 3PM1A 2PRTA 2FA5A 1P9QC 4HF2A 4YIIA 4UXNA 2JUCA 2VKHA 2VUMJ 2DLQA 1SMTA 2ZFWA 4IJDA 4DR6E 2QGUA 4EM2A 2FUG2 1MSEC 3CD6I 2EMKA 5B66C 4X9JA 1N3GA 1MZBA 2RV8A 3P9KA 2E71A 3EPZA 5CVVA 2Y9YA 1XSXA 4ESFA 1CQTA 3ELKA 3BG5A 3JAMC 5E1WA 2R7XA 1KZHA 2ZCWA 3W6JB 1LEBA 2E72A 3LA2A 1X2MA 1TQMA 2E1MB 2RS6A 2RNJA 4P9FA 3S3OA 2GOXB 2DMYA 4DR1E 4PGGA 5LFAA 3CO7C 3TO7A 2R5ZB 5E17F 1RQ0A 2LG4A 1UFMA 1YYOA 4HX7A 1IN7A 4XL9A 1J59A 2EJRA 1ETOA 2X1EA 3ZXSA 3ZCOA 4DIQA 4L9NA 1TP4A 5DV5A 1OCOH 3TQMA 1XN7A 4AIDA 4FX4A 1FWZA 4EATA 2JPBA 3IWFA 2HDDA 1R36A 2ACJA 1VQKI 1SD6A 1MKMA 4D5FA 1Y0UA 1IF1A 5CQEA 2L3DA 2FXAA 1XMQE 3M99B 3DP7A 3KZYA 4LLLA 4F91B 2VOPA 3I53A 3D1NI 5FLXZ 1E3HA 1BI2A 3BG3A 5ILUA 5JR3A 1OCZH 4CCMA 4R2AA 5F04A 4UUSB 2EMYA 4C9YA 2KKOA 2MABA 2B7EA 1MNDA 1R1UA 1TZLA 4XOTA 2Y0MA 3HRSA 3OYIA 1I5ZA 1SAUA 5M5WJ 2H94A 2IRFG 2R92J 1YUIA 3CCSI 4IOAF 3GTLJ 3BP8A 4YG2F 2MBFA 2R7DA 1WJFA 3W6KB 2EPPA 3CLQA 2XHKA 4ON0A 2ISZA 2OU2A 4U88A 4EEFG 3A2KA 2UWMA 2RS7A 3B73A 3J81K 1YJWI 1JGGA 5AE1A 2ZMEC 1B9MA 2ETHA 2RVCA 1G2FC 4DJAA 4E7KA 2CV1A 4A3LJ 1OCPA 1RRJA 2V1XA 3FM5A 4CCOA 3CCVI 4BHBA 1QA6A 4B3ME 1YRNA 5EF6A 1ITYA 2YSPA 5A2QK 2V26A 1ZELA 3ZN0A 2K9NA 4IHXA 3FIGA 4R2PA 4JI7E 1IBLE 3C6MA 1B72A 1DU0A 3CUQC 1FJLA 4DMIA 2UXDE 1FY7A 2ELHA 4AM3A 2HR3A 1MH4A 3ECOA 3JRAA 1N34E 2PG4A 2NNNA 3MHHC 2CO5A 2MGQA 5F08A 5E3OA 2EOMA 2JP9A 2RAEA 1FKAE 2DAOA 1OYWA 3DTKA 2BHZA 2A07F 1ZBQA 2V8QB 3VYSB 4O5GA 2MDGA 1A31A 3LAPA 2Q8UA 3AL0C 3O6BB 2MC4A 3HSEA 4UY8I 3E1SA 2PFBA 1HC8A 2OF7A 4D5CA 1PKPA 2IGMA 1Y39A 3IKTA 3AKZA 3ZMVA 3FBIB 2HDWA 3GXOA 1OYYA 2GQQA 3CCQI 1I94E 2VQLA 1F1ZA 2NXNB 4CUGA 1KU7A 2JZYA 2JTVA 1NG6A 4F3QA 4U0YA 5C4JJ 3ZQHA 1S7AA 1FC3A 2LLKA 4DYCA 2VLAA 4R2RA 2P5LC 3HRTA 2NVYJ 5A69A 4PJJA 1OYIA 3DLLF 1NH3A 1MBHA 1FMWA 2H09A 2ZKZA 1AHDP 2DTRA 2VXDA 3TOBA 1MMDA 3G2BA 2E1MC 4RAGA 2B63J 2NS8A 2I13A 4EGYA 2F6CA 2IXSA 3CESA 1MDMA 2IT0A 1TN9A 3BZCA 3GTGJ 4IHVA 2IA1A 4DQ2A 1JJ6C 4M9SA 4LOCA 1B4AA 5FKLA 5DUIA 1NG7A 3JSOA 1BI0A 5J40A 2LSOA 2XUBA 4A3MJ 4KIGA 2EM9A 3FXUA 1Z7UA 3T1HE 2NUFA 2RQQA 1G6NA 2DCEA 2KRHA 3JCUC 5HLHA 2R5YA 4JYAE 2IA2A 5D5UB 1XD7A 3J80K 1S3JA 2HYJA 2LBSB 2ADUA 3H3ZA 4ENKA 2K4VA 3H1CA 3BG7A 3OTOE 1HLVA 4JI0E 2FF4A 3WTUC 1AOYA 3LFKA 5JHFA 4WCGA 1IXSB 4V19K 2CQQA 4ZH4F 3I3LA 1T33A 3L00A 3LSRA 1EKEA 1JT0A 3VEPA 3PJRA 2GXGA 3ECHA 1T4NA 3KETA 5AE3A 1G3WA 1QPIA 4BUPA 2R7ZJ 2QSHX 2EV5A 1E17A 2LJHA 4X66E 1MMGA 5IY5H 1POGA 1UAAA 3ADGA 1HKTA 4AIHA 2P7CB 5KAFC 5GTHC 1B59A 3PUBA 3BTJA 4KJZA 3JREA 1R4NB 2V89A 4L5JA 1FP2A 4LGWA 1CF7B 3D5RC 5CJ9A 1BC8C 1IJWC 3P5JA 2XF7A 3D5LA 1WI3A 4LJZF 3ZQCA 5EZGA 4R79A 2DT7B 2CPNA 1KU9A 2O3FA 2KDOA 1JKPC 4AUXA 2EM7A 4IQJA 5AC5A 1U2WA 1MBGA 3J7AO 2M1SA 3LSMA 2LKXA 4Y17A 1JT6A 3V8LA 1T98A 3GW2A 1PDNC 4N4OB 2R7SA 2VODA 1TF6A 2YU8A 1N25A 3BR1A 2MKDA 2WBSA 5FB2A 2KP6A 4IJAA 3RPUD 4WK8F 4UHTA 2EFOA 3I55I 1P47A 2FBIA 5ED4A 1FBSA 1GXQA 1W0TA 3VK6A 1LFBA 5CPRB 3K7AJ 4LD5A 4PCQA 3MEXA 3HOSA 2XIGA 4IL6C 5GAHJ 4XNFA 2IVMA 2H6BA 3OIPA 5J1UA 1FNNA 5D5VB 4QSHA 4IVNA 4OIQF 2OC6A 3S1MJ 1XS9A 3H9JA 2DTZA 3PL8A 2VBWA 1W36D 4Q47A 4FK5C 1MEYC 4FE7A 2P7VB 1F4KA 2DN0A 4X62E 2EE8A 5HODA 1LE8B 3J81C 3FK6A 1YQAA 3HXLA 4O43A 4P78A 3RTRA 1DU6A 4I02A 4F6MA 2VC0A 2KRCA 1S6LA 3K4MA 2EPMX 4JV5E 4F54A 4BXUA 3K4LA 3F72A 5AASA 4YY3E 1ZAAC 3S1NJ 5A6JA 1T4OA 3LSIA 2Q0OA 5E1ZB 4GCVA 2QA4I 2LOOA 3OSGA 4RLQA 1D1AA 1R49A 1KQ0A 2N8GA 1BR4A 1B8IB 2WAFA 1QU3A 2EK5A 3GZ5A 2A61A 1T8IA 1P4AA 1QGPA 3K9TA 2JPAA 2QF7A 3FX3A 1SFEA 1LVAA 2ECBA 5FO5A 3TW7A 1X47A 1YTYA 2YT4A 3KP7A 2V87A 4XRSG 1ZN2A 3A0HC 4U7DA 4RMNA 2IAIA 2JA2A 2QCOA 4RM3A 4Q5SF 3DBLB 5HS7A 1RI7A 3TW6A 2L9VA 3K1PA 1MBJA 3EUHA 1IN4A 4HEIA 3QOPA 4EVIA 4XSZF 4JX4A 5ILSA 2ZJPF 2FOWA 2EOYA 3MCZA 1J75A 3H3VK 2EP3A 3BBGA 2BVLA 2RKHA 4ITVA 4E7IA 4NQWB 4S05A 4JI8E 3S1QJ 2V79A 2NOJB 3LMMA 2EMAA 4WYQB 2LCEA 1T0FA 3ZQFA 1IGNA 2HOAA 2NUGA 2HVRA 2VT3A 2DO7A 3FBNB 3ZQIA 3KWRA 3DQVC 3KPHA 3HKZA 5F64A 3CCUI 2VBZA 5LD2C 4BY1J 4DUZE 1V5EA 3MWMA 2ENCA 3BJOA 3RKXA 2IGNA 3VYYA 1ZRDA 1SEUA 3M9AA 2W84A 4MHGA 1U8RA 3C1DA 1IG7A 5J47A 1F43A 4OX9E 2Z33A 2KZGA 3OR2C 4I76A 1ZLKA 2MH2A 2EN7A 4QTRA 3QPSA 1WCMJ 4ZC3A 1WJEA 2A6EF 2K9SA 2M8EA 1XMOE 2EN8A 1HOMA 4B3XA 3BOQA 4GYGA 5K7ZA 4F52A 2X51A 1A1IA 1QPMA 2R5ZA 3DLAA 4O4KA 2ZXJA 4XICA 2R7RA 2RQLA 4XLNF 3BTCA 2ZXWH 3ASOH 3BQZA 1LLMC 4HSRA 2TDXA 1X3WB 5A6BA 2HU9A 3OL4A 3WGGA 3LQQA 3O8GA 2QQBA 1X6FA 2XGEA 3ZOQB 1IRGA 1VZ0A 3FMRA 5DD8A 3BZ6A 2OZ6A 2V86A 1GUUA 3OOPA 4NXME 1HW1A 2E5LE 4UUSA 1SFUA 2CQ7A 4A5MA 2L01A 4BJTA 5LEJA 2HI3A 3KZZA 1A36A 4R2QA 1FYMA 3KP4A 3FM3A 4NNJA 4GDFA 2YTJA 5D4SA 5J8CA 1V5GA 2CQNA 3GTJJ 5D5WB 2K5CA 4RB0A 1HW2A 3RIRA 3HUGA 4A69C 1UBDC 1QZYA 3FKJA 2NS0A 5JVTA 1X1AA 4B3AA 1YX5A 5EJCA 1NEIA 2V6CA 2Q1ZB 3S14J 1VQLI 2VQCA 1WJAA 4EQQA 4A12A 2HYGD 2VF1A 1UMQA 1RIOH 2G9WA 4CH7A 1ENHA 3U1DA 4MTEA 3I4NJ 3WTSC 3B6CA 3GX4X 4DKKA 1IUFA 2E2IJ 4CHUA 1EKZA 3HGYA 2F4IA 1XGNA 1JHFA 2BOLA 2OPTA 3S93A 3ECRA 1L4SA 1YOVB 4JX6A 5AIQA 2M8GX 2XSDC 2PI0A 2ZO4A 2BB8A 1XPXA 1ZBTA 5IOYA 2Q2EA 2DDAA 4N9IA 2O5RA 4PDKA 4LFAE 1X19A 2EM2A 4GRIA 4MO7A 1UILA 1VNDA 4M3EA 3R0JA 5L3FA 1U0JA 1YPNA 1MBFA 2CUZA 3HOVJ 5E3MA 2ELJA 1D0XA 4ZDLA 1TQIA 3FXLA 4JBAA 4S0HB 3S2DJ 1WRJA 3Q9SA 4B4CA 2ODRD 2DFIA 2WA0A 3J7AY 2WBMA 3ZN1A 2K02A 1KYZA 1U5TB 2BYVE 3DPLC 2YSRA 2CW0F 2X6WA 4X6AJ 3BGHA 3I54A 1LDJA 1A6IA 4A6EA 2YTFA 3E6CC 1FPQA 4HTGA 4F6NA 3HYIA 2KONA 2I8DA 4BU2A 3WHBA 2BE5F 4OU0A 4CZZA 2LTPA 1D8KA 2X85A 1PJTA 2DA2A 5L3DA 2X6YA 4AD9A 3GO5A 1OR7A 1AH5A 3NQOA 1WWXA 1R23A 4I6ZA 1TBXA 4HX4A 5IOZA 3EYIA 2WBTA 2EQRA 5FLXK 2P81A 2HQRA 5KL4A 2JOBA 2DQLA 2FNAA 1TC3C 2JPCA 4AVZA 4XN0A 3BR5A 1O3TA 2VBXA 3TDUC 2FGGA 3K1MA 2WB1N 3PQJA 1LUJB 2Y0SA 1MD0A 4BBRJ 4J8ZA 4M3DA 1IMUA 2DT6A 2JVGA 2R7UA 2F8BA 4XONA 3FK7A 4ZYDA 4UVBA 2G0EA 2HPMA 2KLOA 4JK1X 4C3IJ 3OYMA 1JUMA 2VE9A 2YPNA 3CC2I 1XDUA 5BS6A 2YTDA 3MKWB 1JK1A 3DXJF 3H92A 1ZK8A 4UUTA 4DV7E 2L3CA 3I58A 3BIDA 1A6QA 4WSPA 5BPDA 1QU6A 1LDDA 4R8HA 2P8TA 3OYFA 2ZJQF 1J26A 3H5AA 3BR3A 3I59B 4P55A 3W2AA 1BI1A 4GXOA 2VKEA 2W25A 2YTNA 1YLFA 1FJGE 4TV7A 5B1BH 4PJNA 1D1BA 5FD5A 2NOGA 4BY7J 2EN4A 1ETWA 3F21A 2EOQA 1N77A 1PP8F 4KNYA 2MYSA 2AHQA 2A6HF 4FE4A 1RC9A 4AYBN 2RQPA 4MEXF 4BNCA 3EUKL 1BBOA 5F6FA 1EH6A 2LR8A 3BG6A 4HNUA 5HLTA 3DF8A 1D5VA 1X3ZB 3BPXA 5HDKA 2LT7A 3C7JA 2V4JC 4P9UA 4IHSA 2VT2A 3ZQGA 2H1KA 4KN7X 2FV4B 3S32A 5FFXA 2XV4S 4BL0B 4M3BA 4Y4RA 1VQPI 1DUXC 1U3EM 3M1EA 3ERMA 2EOOA 1XCBA 4KYWA 5KK1A 1Y8QB 3KLNA 1HR0E 1ZHFA 3OYEA 1KJKA 1U78A 1WH5A 1ULYA 2V6EA 4BBSJ 4DV0E 2NVXJ 4RGSA 2QKMB 2I5UA 5JFRA 4IEJA 5BNGA 2IW5A 2JA8J 2EQ3A 1DPRA 2PBIA 3U9GA 4BE1A 2RNGA 2JR1A 3CJTB 1BOAA 4F2JC 1KGSA 1VQ9I 2ELKA 4XKVA 1QVUA 3OSFA 1ETKA 2JA7J 2GBYA 2LYCA 3QQAA 1U5TC 3WHCA 4M0VA 3LSKA 5JLXA 5GADJ 2DGCA 5AONA 1Z1DA 5B5EC 2FQ4A 1A35A 4WXDA 4IRHA 4L9JA 2A25A 5HNHA 2QLZA 3DJWA 3H9GA 4U7BA 4A3DJ 2K3FA 3WTZA 3P9IA 2UUBE 4Y3OA 5TRDA 2RSIA 2F5VA 2DA7A 1Z9CA 2R7QA 4HOBA 3BY6A 1UELB 2IA0A 2F2EA 4HSTA 2WV0A 2EORA 2A6TA 5K7HA 4HV6A 1BR2A 4MQVA 2EM4A 4BC9A 3JRIA 5LEKA 2PLYA 3EPHA 4JI6E 5IT9Z 4G7ZF 4QWQA 4JI4E 2XAFA 3LA7A 4RGXA 3SXYA 3TGNA 2JWTA 5F1JA 2ZXIA 2KDZA 1HA8A 1YYVA 3DV8A 2BY3A 2JRTA 1B9NA 2L8TA 3CZ6A 1A1KA 5HLGA 1WJCA 3GYHX 2B9SA 2UXNA 2LY2A 4RM2A 3HOZJ 1VQ5I 2YPRA 1YIJI 2CSOA 1R71A 3K69A 2A69F 2ME6A 3OYAA 2K3PA 2JSPA 3F6OA 4JOMA 3BROA 1S8NA 3ZOBA 3F0CA 2E5ZA 2BZTA 2L54A 1HXDA 4HRIA 3OL3A 2CSHA 1WGXA 2BHYA 3JTHA 1BBYA 1MMAA 4LF8E 1U6GA 3AL0B 4BJ5C 1YSAC 3HOTA 5CKTA 2DPUA 1KU2A 3L9FA 2NA2A 4KITB 4E7HA 5K5OA 3K6QA 2KQRA 1E3OC 3WG9A 3HJEA 1D1CA 3ONQA 4LG3A 1QZEA 1GV2A 4G7OF 4F9CB 4WWCA 4BEHA 3DF6A 1J7KA 4HDVA 1AKHB 1PUFB 2LMZA 2DFFA 1NTCA 1ZQ3P 2JXPA 4GO1A 1X4OA 3OYDA 4BXFA 4DBRA 4O5VA 3SZPA 3WTVC 2IP2A 2YWQA 3KP2A 3QYEA 3C4BA 5EGOA 1AA7A 4MGRA 2J5OA 2NS7A 2YU9J 2NVQJ 2GLIA 4L8NA 6PAXA 5AC4A 3DTIA 2IEKA 3CCJI 1Y6IA 4IS1C 3REOA 3LSTA 5M3MJ 2L9SA 4ESJA 5ICFA 3J7YJ 2L9NA 5ICCA 1KYQA 3HRMA 1TNTA 2CU7A 2JWOA 1XX5A 2E35A 4RB2C 5FKMA 1OMIA 1HDDC 3T8RA 1Z3XA 1BI3A 1VI0A 1A04A 3HG9A 3OOUA 2J7JA 4BQNA 1WHNA 2ENAA 4PZJA 3PIPF 5FRNA 1UJ8A 2Y48A 4E4HA 4RA2A 3ML6A 4JI5E 3OIQA 2DRPA 3HM5A 4LG0A 5LGTA 3OYKA 1REPC 1ZKGA 5HLIA 2HC5A 2HQAA 1RETA 4A3JJ 1DDNA 4LLNA 3B6AA 1O4XA 2V9PA 4EJOA 1MMNA 3V7SA 4UB8C 2GM4A 2HOEA 2LBFB 4X64E 3U21A 2CUFA 2K86A 1RNLA 4UV8A 3TOAA 4MTDA 2JMWA 3LSHA 3RYRA 3FDYA 4UUVA 4LF6E 3TQNA 2L3JA 3H5RA 3KEYA 1SVOA 2L9RA 2HEOA 5C44J 1FMVA 2R93J 2R76A 5FLVA 3QU3A 1LFPA 4Y13A 3K10A 4EM1A 3JAMZ 2FQ3A 2WCC3 1JK2A 3GFJA 1D0YA 1BBGA 2DA5A 1O7FA 4R2CA 1IV6A 2EZIA 1X1DA 2YSOA 2BBYA 2E5NA 1S7OA 3ADLA 4B3RE 2LRSA 5GPAA 2ESNA 1ZG1A 3IWCA 3VYTB 3F8CA 2ZNZA 4ENMA 3H5NA 3A01A 5D6EA 1YW8A 3E5XA 5HOOA 1PJSA 1A1GA 3C18A 1TL8A 4DV4E 1Q1HA 1X1PA 3PFYA 2A68F 2VQHA 2DFEA 3KIOA 5FJ8J 2QENA 1RKWA 2QQ9A 3RYPA 2VE8A 3CC7I 2O61A 4JI3E 3MD2A 2XRLA 4EJVA 5IXMB 5J4VA 4EV0A 3HEFA 3S1RJ 4FX0A 2DMNA 5DM6F 2VPRA 3DKYA 4AVPA 5BQTA 3L1PA 4PSXA 3KCCA 3TBIA 1H89C 4XLPF 3GZ6A 3NWSA 4Y15A 3N05A 4WPYA 4IPAA 1FOWA 4BS9A 2E19A 2JUGA 4V2GA 5DCMB 2DMQA 3I0TA 4QPQA 1G59A 5LMUE 3M8JA 2MC5A 4IO9F 5E18F 1JJ8C 2OTLI 2EMFA 1X5WA 2DMIA 2R7OA 2KFDA 2O7OA 3DKXA 4ZTFA 3E97A 2OD5A 4FISA 2M4GA 5KVRA 2EN2A 1V3FA 1GT0C 4J00A 3FXRA 3O8HA 1T0FC 2DMPA 4B44A 4I8OA 1BJAA 4P96A 5F1RA 2BY2A 3DEUA 1ERDA 1R22A 1ZH5A 2K4JA 3DWLE 3ASNH 1TWAJ 2EFQA 4XQFA 3LSGA 3CCYA 3IV5A 1PJQA 1JHHA 1D3YA 1P4WA 2BBGA 1S5LC 3HOUJ 4WX9A 4EGZA 1X49A 2EMXA 3P9CA 2VRDA 2QM3A 3SFZA 3V7RA 2R4GA 2VKDA 1R7JA 5B1AH 1Z91A 1ZR2A 3AG1H 3BLYA 2LO3A 4KISA 2VOOA 4JQFA 1OCTC 5KAIC 1I6XA 1Y1WJ 2EPZA 3DKWA 4GKKE 4U0VA 2V9VA 4LU9A 1X58A 2DI3A 3LOCA 3TEDA 1OPCA 1W5TA 4LLGF 2Z1DA 2UUZA 4RB3C 1K6OA 3PIOF 5FKKA 2VJJA 4IF4A 2E60A 3DU5A 3ABKH 3W2VA 1EJ9A 1VQNI 4MLQA 3F9KA 2FJ1A 4MIMA 5FLMJ 4F93B 1I3QJ 2KT0A 4P7DA 1STUA 3L2WA 2A3SA 4QPOA 1UG0A 2H6CA 2GOMA 3D0SA 3LFUA 4R03A 1Z05A 5FD6A 3F6VA 4AQYE 1JI8A 2V88A 3BCAA 3JSPA 2WAQA 3CC4I 2DFHA 3N4MA 2IBDA 3ULQB 1Z6RA 2DYRH 2A5WA 2YX7A 4RB1A 2UXCE 2H8WA 1K6YA 2CT1A 1LEAA 2EL5A 1GVJA 1V4RA 4OINF 3HDDA 5IV8B 2KIMA 3NAUA 1UHMA 1RR7A 4A0YA 1B1BA 3I5UA 1YFHA 3FXMA 4OMZA 4X8WA 4OIRF 3HOXJ 3HPZA 5LRRA 3QP6A 4B43A 2EBIA 2LKSA 2XPWA 2KIUA 4HNTA 1WJ5A 2E7WA 1WZ2A 3HOYJ 3RPUA 2E1OA 1YHQI 2YR2A 4W1UA 2PJRB 4I2OA 3PO2J 2HPIA 1TWHJ 2VQGA 3HTUA 1YO5C 1X3CA 2EQ0A 2STWA 5F27A 3SZTA 4DOZA 1PYVA 1O57A 4CZCA 3L2RA 3KP5A 1UB9A 2VE7C 3EETA 4D9JA 2GXAA 2DMTA 5D6FA 1T4LB 4W97A 2EWLA 2MG4A 2RN7A 4XRMA 1K4TA 3VYXA 3K1NA 2L5QA 4L18B 2LY9A 2L2MA 4L0YB 2PMZA 3KX2A 3HZJA 4HX8A 5EEAA 4UB6C 5LL6R 4MFDA 3BWGA 2EILH 3CUOA 1DPUA 4CYCA 3QRFF 3GTPJ 1GZ6A 4BXXJ 1XGSA 2O03A 5KHDA 2M7AA 4BH9A 3OYGA 2LP0A 2KIFA 1IRZA 4ZDOA 4B3TE 2XAHA 1X1CA 2PMUA 4XR6A 2VIXA 2QBYA 3SEZA 2XRNA 4Q28A 1XB4A 3QPTA 5A2QC 2ZMEA 4CYDA 5DD4A 3GUDA 3V42A 1K78A 2EMIA 2GWRA 2FRHA 3PSFA 4PJLA 5LHIA 2ENHA 1OR7C 5D8LB 5J1RA 1PDAA 2FU4A 2FSWA 4ZYHA 4KWYA 5LLQA 2EOFA 1HW5A 5TSEA 2RPCA 3KLOA 1GQEA 1XNQE 4EJWA 3ERED 2KHXA 2NVUB 5H2FC 3EPLA 2DK5A 3IWBA 3CUQA 2VASA 5GPCA 4G7HF 2L7FP 3SDBA 1W7PD 2DJIA 3VFZA 4KMUX 2FBHA 3IH3A 2W24A 4FHTA 4FTHA 5T6JA 2WTEA 3OV8A 4BDZA 2KZVA 1QO0D 1PP7U 2CUEA 1I3AA 3OYHA 4HZFA 4YRVA 3MKYB 3H9QA 4BYYA 4CCLA 2XSJC 3U1KA 1KA8A 2M5WA 2NRAC 4YFXF 3AG3H 4KZSA 4G8XA 2F4VE 1ZYRF 1LDKB 4P5OA 5J1YA 3T1YE 5F0CA 1VQOI 3JW4A 1FEXA 3FXOA 2LDUA 2BGCA 3LQRA 4A93J 3FXQA 1G3SA 3L09A 2YTQA 4A3BJ 5FKOA 1AKHA 1ZLJA 1BW5A 3EQLF 1X2NA 3M7GA 2HXOA 2KMUA 1N36E 2HTSA 2V7FA 2MC3A 2OBPA 4BHCA 5LGNA 3HQ1A 2M7BA 3EDPA 2F4OB 4I01A 2X0LA 3N97A 3ISPA 2L2OA 1ZGWA 5KNLA 1IZ1A 3R61A 3PQKA 2EPRA 4D1QA 2E1MA 1TTYA 1HKQA 4LIVA 4M71A 4G94A 4B47A 2XB5A 1VFCA 2F5FA 4NC8A 1IXCA 4LF4E 2TCTA 4ZZLA 1XMXA 1SVMA 2I10A 4Q48A 3BF2A 1G2DC 3BC8A 2CFOA 4KHPE 3J80C 4S04A 3MVPA 1R5GA 3DEWA 3HKZN 3FISA 1J5EE 1WVRA 5IT9K 2YX4A 2EZ6A 4C3JJ 1A5JA 3MFKA 4J19A 5J3LA 2GA2A 1USTA 4KT6A 3OWTA 3J7Yp 3HGGA 2D45A 4HQEA 4YFKF 2XAJA 2PX9A 1OCCH 3RKYA 2KL4A 1BN5A 1FSHA 3H0GJ 1HF0A 2X1DA 4NC7A 1SFKA 1A1FA 2VBYA 3I4PA 5C4XJ 4CO8A 2Y9ZA 3IUOA 1FP1D 1ON1A 4MLVA 5F3WA 1SD7A 5E20A 1SR9A 4NHRA 2HQNA 1DI2A 1KQ8A 3HL2A 3GBGA 2EJ4A 4UNOA 2IS1A 3FHNA 2KISA 3ZMUA 9ANTA 2K9MA 3S2HJ 3VYRB 3WGIA 3HSRA 4R2EA 3ZPLA 3FXKA 3WU1B 4GKJE 4ZYEA 2BY0A 5GAGJ 2QWWA 1YS7A 4A3KJ 3FWEA 4B1RA 4BKXA 1B6AA 4M72A 4C3HJ 1XCVA 3T1BA 3FHZA 3CP2A 1Y0NA 1N33E 4NB5A 4IQ4A 2WWYA 2H27A 4G6QA 2RC4A 3BPVA 3V7CA 2EMZA 2FMLA 2M0MA 4I99C 1X1BA 3BDDA 3HHGA 4DV6E 5DYMA 4LFCE 3G73A 2DT5A 2DXIA 1QZZA 1J9IA 1O3RA 3NRVA 2G7UA 1SAXA 1RZ4A 3BT9A 3R6SA 2XF5A 1YRNB 2OTJI 3PNVA 5EG0B 2Y75A 1ETQA 1O0WA 2EPAA 1Y1VJ 2VJ5A 2LFBA 3QYFA 5HVQC 3RKQA 1MIJA 1LVKA 1OCRH 3OY9A 1Y56A 2GXBA 3M1CA 1MGTA 4M3FA 1BIAA 4XKBA 2M0CA 3Q0VA 4JYKA 1ZG5A 3RKWA 2EMWA 2VN2A 3K0LA 1ONVA 1HBXG 1RR8C 3TL4X 1YS6A 2EB7A 4II3A 2MD5A 5DS9A 4KUMA 3MKZA 4XLEA 1U9OA 2XC7A 1LQ1A 3BR2A 1J09A 3BR0A 2DOAA 4J01A 5HS8A 1JKQC 3HB9A 1TW3A 1FTZA 1SMYF 1SVLA 2K7IA 1G4DA 4D7MA 1P7IA 1XGMA 4CSWA 1MMSA 1ODDA 3SYTA 2JVHA 2M2EA 2YU3A 1G3YA 2N3GA 1IXRC 1TQPA 1KQ9A 3E3VA 4AWXB 1UZCA 5EDNA 2JRMA 4PFOA 2CGPA 3HTSB 2XAGA 2W7NA 1T08B 1BW6A 5DEQA 1JXSA 4BE0A 3CQZJ 1IAWA 1R1TA 3GF2A 3R0AA 3SHFA 1LFUP 2HJJA 2EOSA 1K79A 4LB5A 2LRDA 3C4TA 1OQYA 1FOKA 3K4BA 2EOXA 1F2IG 2WZOA 1VQ8I 1T56A 4PJMA 1NK2P 5IP9J 1WKMA 1TT0A 3JRDA 2DLLA 1XSDA 2EM6A 2W48A 4G9YA 3JAMK 3AV0A 4BBYA 1MDMB 2ID3A 2WBUA 4WXHA 4MFEA 1UHZA 2EV6A 1FYLA 1SD5A 2WADA 3CTAA 4BJ6C 1T39A 4DV2E 2Z5UA 4F92B 4M73A 2CV2A 1OKRA 1FT9A 2JOXA 3B02A 3EQ1A 4E6KG 3JU0A 3CMMA 3QU6A 4ENJA 3OMYA 3THNA 1ACIA 2R5YB 1S72I 4OOGC 1G2HA 4LITA 2Y0SN 5F0HA 2AQFA 4E7LA 1ZRCA 1ZG3A 4NBQA 1X48A 2CQKA 2Z9OA 4MEYF 1ZGJA 3ZRGA 1LJ9A 3FMSA 2XGDA 2QQ8A 4N4RB 4G6TB 5CYVA 2YTEA 1Z6TA 5C3EJ 5DNYA 1FYKA 1DGCA 2JQ7A 3A4CA 1MBKA 3F8BA 5JVGF 4NUBA 2O9LA 4DR3E 3RMPA 1K7AA 2QSFX 2VONA 2R3SA 2CW7A 1OFCX 2KJBA 3HPHA 3DCFA 3F23A 1CF7A 5E8GA 4BQOA 2UV1A 1FBUA 2VB6A 3WODF 1K4SA 3ZQLA 4C2MJ 2LY1A 3L2QA 1R9TJ 2E7XA 3M3YJ 4ZYGA 3FMQA 2DU9A 2ZC2A 4LFBE 2IS6A 1IO2A 1QRYA 3E6DA 1P7JA 2F5CA 3IH2A 1QVTA 1DP7P 2NABA 5D5XB 3OYNA 3AUZA 3C2HA 3F8NA 4V2FA 4M9ZA 4I0BA 3QODA 3ZMZA 1WFXA 5LRSA 3OR1C 3X2QH 2CMPA 1HNWE 2P6TA 2EM8A 3LAJA 3PSIA 5HS9A 4LTYA 4R1HA 5IYBJ 4PGHA 2HWVA 2D5VA 2EN6A 2J5PA 2WY7Q 2LNBA 4FQGA 3PNYA 2Z99A 4AIJA 2OA4A 2X1CA 3J7AG 1Z77A 4HV5A 4MLOA 4KDPA 3ZMTA 1RESA 4O3MA 4DR2E 1IBKE 1VF9A 3M8EA 2GPIA 2YTIA 2XGXA 4M2ZA 1C0WA 1BOBA 3HTXA 2F48A 1VQ4I 3F22A 5DM7F 1O3QA 1W4MA 1N32E 2O6GE 2YTOA 2EPUA 4CDGA 2UUAE 1IN5A 1TW2A 1VQMI 4ZDPA 2MW8A 1LE8A 1RUOA 1I1SA 2QSGX 4OAYA 4F55A 2DLKA 4GGGA 2STTA 3F8FA 2JSCA 1QQIA 3AG2H 1TLHB 3MZHA 2GIVA 1W7PB 4DV1E 5JLWA 2JT1A 2ME0A 1IN6A 3BQYA 4HF1A 5EEGA 3E6MA 4MNUA 2K85A 4Z6YA 2LVHA 1WSUA 1D5YA 2XPVA 1V54H 4PFPA 3SEQA 4PUSA 1B8IA 1ZGAA 2XGCA 4LK0F 1DQ3A 4II2A 1WHUA 1FX7A 1Z0XA 2V1NA 2HZDA 2M34A 4OOIA 4M6YA 5KL2A 3PUFA 3C3WA 1T38A 2FTXB 1DGWY 3K6GA 3K4NA 2IS2A 4E7ZA 5M5YJ 2HKXA 2K9QA 1H9TA 2CJJA 4HAMA 4K0KE 2IGKA 4Y7NJ 3MSWA 2EM5A 3QWLA 3TP0A 5FROA 4BHPA 2EN1A 3JRCA 2ZM6E 1MJAA 2XB0X 1EH7A 1JUSA 1W5SA 4B3SE 4NHJA 2KIQA 4YELA 3GLXA 3MN2A 1E0EA 2P5KA 4HYEA 4A3EJ 4H4KC 1N78A 2NUEA 1I39A 2K40A 4NQWA 2GHFA 5FLXC 4XM3A 2RDPA 1NHAA 3VWBA 4GEQB 3IHUA 2HTJA 1WQ2A 2COBA 3CF2A 2E34A 3UK3C 1K61A 4F9BB 1O7LA 3ZMDA 4UVAA 4IXAA 2D1HA 3LSPA 2EFWA 4P1WA 3VB2A 1TT5B 3H36A 4M6VA 2AS5F 2C6YA 2ISYA 3HHHA 1IV8A 4A6DA 2CV0A 2OQRA 4ABZA 2R7WA 3HRUA 1YYKA 3A03A 3JRHA 1MH3A 5DDGA 2DMUA 1ORKA 2EA2A 4L5IA 2DDBA 3COAC 2HQ5A 3IWDA 1FIPA 1TWFJ 3A02A 5KCMA 2UZKA 3DU6A 2MKNA 1BR1A 3OMLA 3W2WA 3MZYA 1WI9A 1RMDA 3ESWB 2CWEA 4ZZDA 3ABUA 1K83J 5E1XA 3HC7A 3SQNA 1I27A 3GFLA 2GAUA 3VDXA 1LB2A 3NARA 3R60A 2EM0A 2V85A 1HNZE 1EA3A 1HQCA 3DBRB 3FIWA
chains in the Genus database with same CATH topology
2IJLA 5DCFA 2XAQA 4RGUA 4CXFA 3HIFA 4AIKA 3LWFA 3CLOA 3WE3A 4KIBA 3CJNA 1ZAOA 4D0PA 3EYYA 1J2XA 1ZARA 3GEZA 5TJJA 2OQGA 4Z2YA 2EA4A 4ENNA 2M30A 3P7NA 2OAZA 2LF8A 2ZBKA 3K2ZA 4IHTA 2IPQX 4CGZA 4B8XA 2QQAA 1MJBA 3V8JA 5ILVA 2FNPA 2UXXA 5L3EA 2AXLA 5CVIA 3GFMA 1P92A 1T2KA 5ERIA 3RPQA 4IRIA 2VXZA 2XKPA 4I7HA 2W57A 4RGRA 1U5TA 1T6SA 3VOEA 3G3ZA 1JGSA 2EV0A 3LA3A 2E1NA 4N9HA 2COMA 3WTXC 1H0MA 4HA8A 4KIFA 4RS8A 3BJ6A 1FSEA 2HKOA 4KICA 1KU3A 4L0ZB 4KMFA 3MQ0A 4LB6B 4KFCA 1QNTA 2FBKA 2A5YB 1VTNC 1ON2A 4HBLA 1R00A 2F5EA 3NEUA 1J0RA 2LKPA 3I59A 5J8FA 5IT3A 2D1VA 3ABTA 5LHGA 3QPHA 2PQ8A 1IUYA 1XMAA 2HGCA 2MLGA 2FEZA 2MH9A 3V8KA 3IRRA 2P5VA 4U0WA 1UHWA 1PUEE 1E2XA 2PEXA 2L4MA 4EJUA 5DUKA 2M1BA 3JTGA 4M6XA 3TO9A 4Q4ZF 2GA1A 2DPDA 3Q9VA 2K4BA 4A5NA 2HZTA 4XSXF 1MJ9A 2V1DA 4K2EA 1I1GA 3ZQ7A 1F9NA 1P2FA 4I0AA 1XMKA 4B09A 5LBQA 3H3UA 1FZPB 2L02A 4M74A 4E70A 4FT8A 1AWCA 3I71A 1W7PA 3U2RA 2NAZA 2XVCA 4UVCA 4L9TA 4F7ZA 1XSVA 1YG2A 3WTYC 4HF0A 4H0EA 4XRFA 3TDZC 4RAZA 4LMYA 2B0LA 5CVRA 2HDCA 2LF7A 1BIBA 1L3LA 5ICGA 3ZMSA 5EEHA 4LFUA 4YIFA 2P4WA 3GWZA 2F5DA 3E5QA 3J81Z 2CG4A 1X3UA 2XROA 1IW7F 3WTWC 2R7FA 4KN4X 3KP3A 5A2QZ 2EFNA 1QBJA 4A0XA 2QZ8A 3RI4A 3Q5FA 1P4XA 2PMHA 3DFGA 4A2UA 1TNSA 2DBBA 3V4GA 1G3TA 2HFHA 5L3BA 4YFNF 3CO6C 2G7HA 1FBQA 3GFIA 2K27A 3F8MA 3GVAA 2K7LA 1IRFA 2Z3YA 2CFXA 2HYFA 1EH8A 2M45A 3WGHA 3PFIA 4BAYA 4LG0B 2BV6A 3WE2A 1RUNA 5HDGA 5CVUA 5D4RA 4WF2A 2HS5A 1CGPA 3E5UA 5LGUA 3QAHA 5K5QA 4IRGA 4EJTA 2XKOA 3TO6A 5D8KB 4KT5C 4EM0B 1KYWA 1J5YA 5BOXA 5K1YA 2RGVA 2X4HA 1H9GA 3J80Z 3S2WA 1YW9A 2ZNYA 4OMYA 1SD4A 3VODA 4ESBA 1SFXA 3IC7A 4CICA 2VC1A 1USSA 4O6JA 2CYYA 3KE2A 1HSJA 3O3KA 5JHUA 4ASNA 3HSFA 3M8FA 1HKSA 4M9XA 1UCRA 5DCMA 3ROUA 4XBFA 3QP5A 3IKVA 3WTTC 1BC7C 1HSTA 3FF5A 2O0YA 2XASA 4ETSA 5JI6A 5J6XA 5AIPA 3T0YA 3MAJA 3KFWX 2E1CA 1L0OC 1EV7A 4RAYA 3CDHA 3T8TA 4HDUA 5L3GA 3KEQA 1F5TA 3WU0A 5CLSA 1YW7A 4I98B 1BM9A 1FLIA 4MQ9F 3KP6A 1R1VA 4DNCA 2NNYA 1R58A 2PJPA 2L4AA 3ZP5A 3E6BA 5BMZA 4HW0A 4G6DA 1P6RA 1XDSA 2WC2A 4HLYA 3I64A 1STZA 1ZREA 4A0ZA 5BPIA 4OIPF 3FZVA 2MA3A 5E8IA 2KRFA 3RJPA 3F3XA 4LK1F 4HQMA 1ZRFA 4QLCU 3BJAA 1O3SA 1GXPA 2OZUA 2DQRA 3T5XA 5ICEA 4GYIA 4EMSA 2W85A 2GZWA 3IWZA 2MLKA 5H20A 2QYOA 3IL2A 4UV9A 3IRQA 2QUFA 2BEOA 1XGOA 3AAFA 2M87A 2O8XA 3KEOA 2DW4A 3RDIA 1D8JA 2EWNA 3R4KA 4L9VA 3TKYA 4BQAA 2DK8A 3DPTA 5FGMA 1LNWA 2FE3A 4I09A 2ZJ2A 4OIOF 2Q8KA 2QBYB 5LHHA 2PN6A 2ZMEB 5FFZA 5HDNA 1K78B 1S29A 2D2WA 2FOKA 2NYXA 4N0BA 1GHCA 1IN8A 2EFPA 3L7WA 2ESHA 2P6SA 5K5RA 1YIOA 3CUQB 4KA4A 1JE8A 1R5HA 2KJCA 4HLXA 5H6QA 3O2PE 3L2CA 5L3CA 5H6RA 5CVJA 2V1UA 2QVOA 4WXCA 2FMYA 2FA5A 4HF2A 4YIIA 4UXNA 1SMTA 2ZFWA 4EM2A 1MZBA 2RV8A 3P9KA 5CVVA 4ESFA 1XSXA 3ELKA 5E1WA 1LEBA 3W6JB 2ZCWA 3LA2A 1TQMA 2RNJA 4P9FA 4PGGA 3CO7C 3TO7A 5E17F 1UFMA 4HX7A 1IN7A 1J59A 2EJRA 4L9NA 5DV5A 1XN7A 4FX4A 1FWZA 2JPBA 3IWFA 1R36A 2ACJA 1SD6A 1MKMA 1IF1A 1Y0UA 2L3DA 2FXAA 3DP7A 3KZYA 4LLLA 2VOPA 3I53A 5FLXZ 1BI2A 5ILUA 5JR3A 2KKOA 1R1UA 2Y0MA 3HRSA 1I5ZA 2H94A 2IRFG 3BP8A 4YG2F 2MBFA 2R7DA 3W6KB 2XHKA 4ON0A 2ISZA 2OU2A 4U88A 2UWMA 3B73A 3J81K 1B9MA 2ETHA 2RVCA 2V1XA 3FM5A 4BHBA 5A2QK 3ZN0A 3CUQC 1FY7A 2ELHA 2HR3A 3ECOA 2PG4A 2NNNA 2CO5A 2DAOA 1OYWA 2A07F 3LAPA 3O6BB 3HSEA 2PFBA 3IKTA 3ZMVA 3GXOA 1OYYA 2GQQA 1F1ZA 1KU7A 2JZYA 2JTVA 4U0YA 1S7AA 1FC3A 2P5LC 3HRTA 1OYIA 2H09A 2ZKZA 2DTRA 3TOBA 4EGYA 1MDMA 2IT0A 2IA1A 4DQ2A 4M9SA 1B4AA 5DUIA 3JSOA 1BI0A 2LSOA 2XUBA 4KIGA 3FXUA 1Z7UA 1G6NA 5HLHA 2IA2A 5D5UB 1XD7A 3J80K 1S3JA 2ADUA 3H3ZA 4ENKA 2FF4A 3WTUC 1AOYA 3LFKA 4WCGA 1IXSB 4ZH4F 3L00A 3VEPA 2GXGA 3ECHA 3KETA 1G3WA 2EV5A 1E17A 1HKTA 4AIHA 2P7CB 1B59A 4L5JA 1FP2A 4LGWA 1CF7B 5CJ9A 1BC8C 3D5LA 4LJZF 4R79A 1KU9A 2O3FA 1U2WA 3J7AO 4Y17A 3V8LA 1T98A 3GW2A 1PDNC 2VODA 5FB2A 4IJAA 4WK8F 4UHTA 2EFOA 2FBIA 5ED4A 1FBSA 1GXQA 4LD5A 4PCQA 3MEXA 3HOSA 2XIGA 2IVMA 2H6BA 1FNNA 5D5VB 4IVNA 4OIQF 2VBWA 4Q47A 2P7VB 1F4KA 1YQAA 3RTRA 4I02A 2VC0A 1S6LA 4BXUA 3F72A 2Q0OA 5E1ZB 4GCVA 1KQ0A 2EK5A 3GZ5A 2A61A 1P4AA 1QGPA 3K9TA 3FX3A 1SFEA 1LVAA 5FO5A 1YTYA 3KP7A 1ZN2A 4U7DA 4Q5SF 5HS7A 1RI7A 3K1PA 3EUHA 1IN4A 3QOPA 4EVIA 4XSZF 5ILSA 3MCZA 1J75A 2RKHA 4S05A 2V79A 1T0FA 2VT3A 2DO7A 3DQVC 5F64A 2VBZA 3MWMA 3BJOA 3RKXA 1ZRDA 3M9AA 2W84A 4MHGA 1U8RA 3C1DA 2Z33A 1ZLKA 2MH2A 2A6EF 2M8EA 3BOQA 4GYGA 1QPMA 2ZXJA 4XLNF 2TDXA 3WGGA 3LQQA 2QQBA 1IRGA 3FMRA 5DD8A 3BZ6A 2OZ6A 3OOPA 1HW1A 1SFUA 4A5MA 2L01A 5LEJA 3KZZA 1FYMA 3KP4A 3FM3A 5D4SA 5J8CA 5D5WB 4RB0A 1HW2A 3RIRA 3HUGA 1QZYA 2NS0A 5JVTA 2V6CA 4EQQA 4A12A 2HYGD 1RIOH 2G9WA 3U1DA 4MTEA 3WTSC 3GX4X 4CHUA 1XGNA 1JHFA 2PI0A 5AIQA 2ZO4A 2Q2EA 4N9IA 4PDKA 3R0JA 5L3FA 1TQIA 4JBAA 1WRJA 3Q9SA 2DFIA 3ZN1A 2K02A 1KYZA 1U5TB 2BYVE 3DPLC 2YSRA 2CW0F 3I54A 1LDJA 4A6EA 3E6CC 1FPQA 3HYIA 4CZZA 2BE5F 4OU0A 1D8KA 5L3DA 4AD9A 3GO5A 1OR7A 3NQOA 1WWXA 1R23A 1TBXA 4HX4A 3EYIA 5FLXK 2HQRA 2DQLA 2FNAA 2JPCA 1O3TA 2VBXA 3TDUC 3K1MA 3PQJA 1MD0A 4ZYDA 4UVBA 4JK1X 2VE9A 1XDUA 5BS6A 3DXJF 3H92A 3I58A 5BPDA 1LDDA 4R8HA 2P8TA 3I59B 4P55A 1BI1A 4GXOA 2W25A 1YLFA 4TV7A 5FD5A 3F21A 1PP8F 4KNYA 2A6HF 4MEXF 2RQPA 4BNCA 5F6FA 1EH6A 3DF8A 1D5VA 3BPXA 5HDKA 3C7JA 4P9UA 4IHSA 2VT2A 4KN7X 5FFXA 2XV4S 1DUXC 1U3EM 3M1EA 1XCBA 4KYWA 5KK1A 3KLNA 1ZHFA 1U78A 1ULYA 4RGSA 5JFRA 2IW5A 1DPRA 2PBIA 3U9GA 1BOAA 1KGSA 1U5TC 5AONA 1Z1DA 4WXDA 4IRHA 4L9JA 2QLZA 4U7BA 3WTZA 3P9IA 5TRDA 1Z9CA 4HOBA 3BY6A 2IA0A 2F2EA 2WV0A 4HV6A 4MQVA 5LEKA 2PLYA 5IT9Z 4G7ZF 4QWQA 2XAFA 3LA7A 4RGXA 3SXYA 3TGNA 1YYVA 3DV8A 2JRTA 1B9NA 5HLGA 3GYHX 2UXNA 2YPRA 2CSOA 3K69A 2A69F 3F6OA 3BROA 1S8NA 2L54A 1HXDA 3JTHA 1BBYA 1U6GA 3HOTA 2DPUA 1KU2A 3L9FA 5K5OA 3WG9A 4G7OF 4WWCA 1J7KA 4HDVA 4GO1A 4O5VA 3SZPA 3WTVC 2IP2A 3KP2A 4MGRA 2J5OA 6PAXA 3REOA 3LSTA 4ESJA 5ICFA 5ICCA 3HRMA 1TNTA 4RB2C 1OMIA 3T8RA 1BI3A 1A04A 4PZJA 2Y48A 3ML6A 4LG0A 5LGTA 1REPC 5HLIA 1DDNA 4LLNA 4EJOA 3V7SA 2HOEA 2K86A 1RNLA 4UV8A 3TOAA 4MTDA 3RYRA 4UUVA 3TQNA 2HEOA 3QU3A 4Y13A 4EM1A 3JAMZ 2FQ3A 3GFJA 1O7FA 2BBYA 1S7OA 2ESNA 1ZG1A 3F8CA 2ZNZA 4ENMA 5D6EA 1YW8A 3E5XA 5HOOA 3C18A 1Q1HA 2A68F 2QENA 2QQ9A 3RYPA 2VE8A 2O61A 4EJVA 4EV0A 4FX0A 5BQTA 4AVPA 3KCCA 4XLPF 3GZ6A 4Y15A 4IPAA 5DCMB 3I0TA 5E18F 3E97A 2OD5A 5KVRA 1V3FA 3FXRA 1BJAA 4P96A 5F1RA 3DEUA 1R22A 1ZH5A 2K4JA 2EFQA 1JHHA 1D3YA 1P4WA 4WX9A 4EGZA 3P9CA 2QM3A 3SFZA 3V7RA 1R7JA 1Z91A 2VOOA 4JQFA 1I6XA 3DKWA 4U0VA 2V9VA 2DI3A 1OPCA 1W5TA 4LLGF 1K6OA 4RB3C 4IF4A 2A3SA 2H6CA 3D0SA 1Z05A 5FD6A 3F6VA 3JSPA 3N4MA 3ULQB 1Z6RA 2YX7A 4RB1A 1LEAA 1GVJA 1V4RA 4OINF 2KIMA 1UHMA 4A0YA 1B1BA 3I5UA 1YFHA 4OMZA 4OIRF 5LRRA 3QP6A 2KIUA 2E7WA 3RPUA 2YR2A 4I2OA 1YO5C 3HTUA 2STWA 3SZTA 1O57A 3KP5A 1UB9A 3EETA 5D6FA 2RN7A 3K1NA 4L18B 4L0YB 4HX8A 3BWGA 3CUOA 1DPUA 3QRFF 1XGSA 2O03A 4BH9A 2KIFA 2XAHA 2PMUA 2QBYA 2XRNA 1XB4A 3QPTA 2ZMEA 4CYDA 5DD4A 3GUDA 1K78A 2GWRA 2FRHA 5LHIA 5D8LB 2FU4A 2FSWA 4ZYHA 5LLQA 1HW5A 3KLOA 4EJWA 3ERED 2DK5A 3CUQA 4G7HF 1W7PD 3VFZA 4KMUX 2FBHA 2W24A 4FHTA 2WTEA 3OV8A 1QO0D 1PP7U 4HZFA 4BYYA 1KA8A 2M5WA 2NRAC 4YFXF 4G8XA 1ZYRF 1LDKB 4P5OA 3JW4A 2LDUA 2BGCA 3LQRA 3FXQA 1G3SA 3L09A 1ZLJA 3EQLF 3M7GA 2HTSA 4BHCA 2MC3A 2OBPA 5LGNA 4I01A 3EDPA 2X0LA 3N97A 3ISPA 1IZ1A 3R61A 3PQKA 1TTYA 1HKQA 4M71A 4G94A 2F5FA 1IXCA 4ZZLA 4Q48A 4S04A 1R5GA 5IT9K 2YX4A 3MFKA 2GA2A 1USTA 2D45A 4HQEA 4YFKF 2XAJA 3RKYA 1BN5A 1FSHA 2VBYA 3I4PA 4CO8A 1FP1D 1ON1A 1SD7A 5E20A 2HQNA 1KQ8A 4UNOA 3ZMUA 3WGIA 3HSRA 3ZPLA 3WU1B 4ZYEA 2QWWA 1YS7A 3FWEA 1B6AA 4M72A 3FHZA 1XCVA 3T1BA 4NB5A 2WWYA 2H27A 4G6QA 2RC4A 3BPVA 3V7CA 2FMLA 3BDDA 3HHGA 5DYMA 3G73A 2DT5A 1QZZA 1J9IA 1O3RA 3NRVA 2G7UA 1SAXA 1RZ4A 3R6SA 2Y75A 5HVQC 2GXBA 1MGTA 1BIAA 1ZG5A 3RKWA 2VN2A 3K0LA 1ONVA 1HBXG 1YS6A 2EB7A 2MD5A 4KUMA 1LQ1A 5HS8A 1TW3A 1SMYF 1G4DA 1XGMA 1ODDA 2YU3A 1G3YA 1IXRC 1TQPA 1KQ9A 3E3VA 4AWXB 2CGPA 3HTSB 2XAGA 5DEQA 1JXSA 1IAWA 1R1TA 3GF2A 3R0AA 3SHFA 1K79A 4LB5A 1FOKA 1WKMA 2DLLA 1XSDA 4G9YA 3JAMK 1MDMB 4WXHA 2EV6A 1FYLA 1SD5A 3CTAA 1T39A 2Z5UA 4M73A 1OKRA 1FT9A 3B02A 3QU6A 4ENJA 1ZRCA 1ZG3A 2CQKA 2Z9OA 4MEYF 1ZGJA 1LJ9A 3FMSA 5CYVA 1Z6TA 1FYKA 3F8BA 1K7AA 2VONA 2R3SA 2KJBA 3F23A 1CF7A 5E8GA 1FBUA 3WODF 2E7XA 4ZYGA 3FMQA 2DU9A 3E6DA 2F5CA 1DP7P 5D5XB 3F8NA 4M9ZA 4I0BA 3ZMZA 5LRSA 2P6TA 3LAJA 5HS9A 4R1HA 4PGHA 2HWVA 2J5PA 2LNBA 2Z99A 4AIJA 2OA4A 4HV5A 4KDPA 4O3MA 3ZMTA 3M8EA 2XGXA 1C0WA 3F22A 1O3QA 1W4MA 2O6GE 4CDGA 1IN5A 1TW2A 1RUOA 1I1SA 4GGGA 2STTA 3F8FA 2JSCA 1QQIA 1TLHB 3MZHA 2GIVA 1W7PB 2JT1A 1IN6A 4HF1A 5EEGA 3E6MA 4MNUA 1WSUA 1ZGAA 4LK0F 1FX7A 4OOIA 4M6YA 1T38A 3C3WA 2HKXA 1H9TA 4HAMA 4BHPA 1MJAA