1EH7A

Methylated human o6-alkylguanine-dna alkyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
161
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
total genus 41
structure length 161
sequence length 172
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh7A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh7A01
4FX4A 2X4HA 5JVTA 2DW4A 5CYVA 2E1NA 1IUYA 3HOTA 5L3FA 3WGIA 4YIFA 4IRHA 1IXCA 2TDXA 3F6OA 4HW0A 1PDNC 3O6BB 1G3TA 1R5HA 1U78A 5JFRA 4CO8A 2Z33A 2K7LA 1L0OC 1ZREA 4G8XA 1HKQA 1XGSA 4EMSA 1RUNA 3LQRA 1ZYRF 5ED4A 1BIAA 3K1PA 2ADUA 5CVRA 3ELKA 3VOEA 1U5TB 2A69F 3LA2A 5TJJA 2HKXA 1YW8A 2F5DA 4EV0A 2XRNA 5FD5A 1O3TA 4WK8F 1XSVA 3O2PE 4A6DA 2XAGA 4Q5SF 4L9TA 1O7LA 4A5NA 4M72A 3I59B 2FQ3A 4G94A 4MTEA 2W24A 2O03A 3LA7A 1G6NA 1HW1A 1ZG1A 1K79A 1LB2A 4EJVA 2E1CA 4R8HA 1L3LA 5FLXK 2PMUA 5LHHA 4HYEA 2YU3A 3F21A 5HLIA 3MCZA 2M87A 4L9JA 3WGHA 5IT9K 3HYIA 2OD5A 3CTAA 4IHSA 1I27A 2B0LA 4IJAA 1P2FA 3DV8A 1ZGJA 4EM2A 3K1MA 2CQKA 2HZTA 1IRGA 1U8RA 3RDIA 3FZVA 4BHPA 3V8KA 2COMA 3F6VA 2KIFA 1B59A 3F72A 4HQMA 2L01A 2L3DA 1U2WA 1KGSA 1J75A 3ZN0A 5J8CA 3GYHX 4EJUA 3BWGA 4U7BA 1MD0A 1ONVA 4IF4A 5E1ZB 1V4RA 4U7DA 4ESBA 1U5TA 5TRDA 3QPHA 2RGVA 1FSHA 3L09A 4OIOF 2Z3YA 2XVCA 2RQPA 2QM3A 3FWEA 3ULQB 1IN8A 2E7XA 4LLGF 2DO7A 2F2EA 2G7UA 3MZHA 2RNJA 1PP7U 2QQ9A 1B9NA 2Q0OA 2V1DA 1SAXA 2O8XA 1STZA 2JPBA 4U0WA 2WTEA 2FRHA 1J59A 4JQFA 3E3VA 4Q48A 2D1VA 3WTSC 3BP8A 5KVRA 2AS5F 5DD8A 3HRUA 2XAHA 4A6EA 2VT3A 2V1XA 1R00A 5AONA 2J5PA 3CO6C 1BC7C 1EH8A 1LDKB 2VXZA 3EQLF 2ACJA 3TO6A 4IVNA 2JRTA 1G3YA 2M45A 2EA2A 2EFNA 4B8XA 3DPLC 5DUKA 3E6MA 1AOYA 2XAFA 2Z5UA 1SFUA 1UHWA 4OIPF 5HLGA 1S29A 1T0FA 2E7WA 1YLFA 2EFWA 1B4AA 5DYMA 3K2ZA 2BYVE 2YPRA 2XUBA 2EB7A 4MEYF 1TTYA 2A3SA 4MQ9F 2GQQA 2XROA 1HKSA 1HBXG 4PDKA 4Q4ZF 3F23A 3IKVA 1FYMA 1DPRA 2JZYA 4RB3C 2LF8A 3VODA 3PQJA 1D8JA 1R58A 3T0YA 3F8CA 4LG0A 4KNYA 3U2RA 2EK5A 1FZPB 3ZP5A 1Z6TA 1HSJA 3E6CC 1BI0A 1XSXA 2ZBKA 5LEJA 4H0EA 1R1TA 3SQNA 3M9AA 1VTNC 5FFXA 1XGOA 1K78A 4P55A 3OOPA 4AIJA 2XGXA 4HA8A 2X0LA 2QENA 2UXXA 2PLYA 2FBHA 4UVCA 3ABTA 3BY6A 1ZRDA 2GAUA 2FBKA 4PCQA 3TQNA 4HX8A 4ZYGA 2JTVA 5DEQA 5LRSA 2L4MA 2FA5A 2P6TA 3HSEA 5A2QK 1HW2A 4P5OA 3MFKA 2DI3A 3P7NA 1NHAA 2MBFA 2PQ8A 1W4MA 4XLPF 3ISPA 2VBZA 1R1VA 3KP6A 3SZPA 2DK5A 1MDMA 1K78B 2Y75A 2ESNA 1H0MA 5LGTA 2XKOA 3QRFF 2VONA 1G3WA 3RKWA 3ZMTA 1SMYF 2VBXA 3C1DA 3HUGA 1V3FA 2BV6A 2OZUA 1D3YA 2IP2A 3Q5FA 3BROA 1BI2A 3GO5A 5HDKA 1GXPA 1ZG3A 3WG9A 4ZYDA 1GXQA 2OAZA 1O3SA 4A0YA 2C6YA 4HV5A 1LEAA 1W5TA 4G9YA 1P4XA 3LSTA 5E8IA 3ECOA 5K5QA 1K6OA 2MLGA 4LLNA 2KIMA 4Q47A 4PGHA 2RDPA 3HSFA 2EV6A 2F5FA 2VOOA 1R7JA 1R36A 1TW2A 4MTDA 3GFLA 2P5KA 1S8NA 2CW0F 1F1ZA 1TQIA 4MGRA 3KLNA 1R23A 2RVCA 3QP5A 5FD6A 3T8TA 2HFHA 4MEXF 4UVAA 1BJAA 2GXBA 3F8MA 5DCMA 5KK1A 1YTYA 4EQQA 4RGXA 3ABUA 5LHGA 4KDPA 1OPCA 2OQRA 5BMZA 2MH2A 2DK8A 1REPC 5D4RA 3GFIA 2IVMA 3KLOA 4EJTA 4XLNF 3HRMA 1ZN2A 4HX4A 4LK0F 2NNYA 2ZNZA 4LGWA 5HVQC 4RB1A 2DAOA 4MQVA 2UZKA 3ECHA 4P9FA 2PFBA 1AWCA 5ICCA 1X3UA 5HDGA 2HQNA 3DPTA 2HKOA 1TQMA 2LF7A 1P92A 3FM3A 2QLZA 3TKYA 5D5VB 2PI0A 3B73A 3DP7A 2L02A 5CLSA 4Z2YA 4HDVA 1YG2A 3MAJA 1S3JA 4GYGA 2ZJ2A 3TDUC 1Z9CA 3FXUA 1QGPA 5E1XA 4DNCA 3IRRA 1F4KA 1KYWA 3J80K 3LAJA 3BJ6A 4G7OF 2PG4A 5HLHA 4HQEA 3CLOA 3I5UA 5AIQA 1YIOA 4HV6A 5JHUA 4M9ZA 2J5OA 2FNPA 4KIGA 3I58A 2OQGA 4AWXB 5CVUA 1P6RA 1RUOA 5LRRA 3FM5A 3KFWX 2D2WA 1EH6A 1ZH5A 2FXAA 1ZG5A 4O5VA 5CVIA 5LGNA 2HQRA 3RIRA 4EGZA 3ZMDA 3NEUA 1U3EM 4WXCA 3AAFA 3GLXA 3R61A 1CF7A 3ZMSA 3R0JA 2O6GE 3DKWA 4LLLA 4E70A 2K4JA 1XCBA 2IA2A 4PGGA 1O57A 3SHFA 4PZJA 1XB4A 5D6EA 2PEXA 1KQ0A 3HRTA 3EYIA 3SZTA 1IRFA 3GFMA 2DTRA 2V9VA 3OV8A 1RI7A 4RAZA 1HXDA 1I5ZA 1P4WA 1R1UA 1T6SA 1PP8F 1T2KA 2ZCWA 4A5MA 4WF2A 3GVAA 3MQ0A 2XAQA 3E6DA 1BBYA 4JBAA 4KIFA 4S05A 1FPQA 3WE3A 3DQVC 3BDDA 3KZYA 2Y48A 3B02A 2M5WA 4HLYA 2QYOA 1ZARA 4KN7X 4CDGA 4M6YA 5D8KB 4LMYA 2PMHA 4HF2A 2W85A 3KETA 2P8TA 2RKHA 4HLXA 5H20A 2A5YB 1MGTA 3WTZA 5LHIA 3WTVC 2BE5F 2P7CB 1MJAA 1T38A 3F8NA 1FBUA 5K5RA 1IN6A 1G3SA 2W57A 3RPUA 1EV7A 3G73A 1C0WA 1Z1DA 3RI4A 3HTSB 4O6JA 1OYYA 3QP6A 1H9GA 3H3ZA 4GYIA 2R7DA 4MNUA 3VEPA 3CO7C 4M6XA 2DU9A 2FMLA 5IT3A 3BJOA 1D5VA 4BHCA 4FT8A 3H3UA 5JI6A 3M8EA 1P4AA 3JW4A 3NQOA 4I01A 2CSOA 2JT1A 4WWCA 2IA0A 3IWZA 3Q9VA 2ZKZA 4G7ZF 2CYYA 2BBYA 3IC7A 3JAMK 3M7GA 3BZ6A 1O3RA 1UB9A 3QU3A 4KN4X 1JHHA 5FFZA 3I0TA 1OMIA 3U1DA 3REOA 4R79A 1I6XA 2UXNA 2R7FA 3WTYC 2EFOA 3L7WA 4KMFA 1IXRC 2DLLA 4GO1A 4A2UA 1FY7A 4Y15A 3U9GA 3I4PA 5ICFA 2PBIA 2UWMA 1UCRA 2VE9A 1USSA 2ETHA 3FF5A 2STTA 3KZZA 5L3EA 4OMZA 5FGMA 3JSOA 2QVOA 2A6HF 2QUFA 2OZ6A 1U6GA 3LAPA 3GWZA 2QWWA 1Z05A 1CGPA 2GIVA 4IPAA 1ZRCA 1ON2A 1XGMA 1Q1HA 5HOOA 5J6XA 5IT9Z 1Z91A 1ZLJA 5LEKA 2P5LC 2LSOA 1ZAOA 1SFXA 4KUMA 1RZ4A 1DPUA 3CUQB 4M9SA 3SFZA 1J2XA 1OYIA 1UHMA 4ETSA 4FHTA 3JAMZ 2OBPA 4Y13A 3RPQA 4I7HA 1A04A 2M8EA 2H09A 1OYWA 3V4GA 5D8LB 1SFEA 2Q2EA 2NRAC 4ENMA 4CZZA 2K4BA 5L3GA 4ZH4F 4L9NA 2ZXJA 1BIBA 3RKXA 2ISZA 2G7HA 1J0RA 4G6DA 3L9FA 2HYFA 2CWEA 3R60A 2ESHA 3N4MA 5D6FA 3P9IA 1F5TA 4WX9A 1D8KA 4KA4A 3TDZC 1FSEA 3HRSA 3EYYA 4O3MA 4AD9A 1B9MA 1G4DA 2KRFA 3T8RA 3R0AA 2WV0A 2W84A 4ASNA 5HS7A 4YIIA 1ULYA 4L0ZB 2IJLA 4U0YA 3KP2A 1OR7A 2QQBA 1LQ1A 4KMUX 1XD7A 2D45A 4L0YB 5D4SA 3M1EA 4UNOA 3V8JA 4L5IA 3RJPA 2QBYA 1ON1A 5CJ9A 5DD4A 5HS8A 2GA1A 4B09A 1WI9A 3P9KA 5JR3A 5L3BA 1IN5A 1JE8A 2Z99A 2VBYA 4A0XA 1MDMB 3Q9SA 4XSXF 1ZLKA 5K1YA 2V6CA 1IAWA 5FO5A 4M9XA 1MJ9A 4LG0B 4UHTA 1O3QA 1IF1A 4RGRA 2VN2A 1IN4A 3COAC 2ELHA 2XHKA 1ZGAA 3WODF 2DQLA 3PFIA 3HOSA 4L9VA 2VC0A 4R1HA 2Z9OA 5ILSA 5EEHA 3P9CA 4LB6B 2HYGD 3CUQC 3LA3A 2IRFG 1FWZA 3PQKA 1TLHB 1IZ1A 4ZZDA 5ILUA 1DUXC 3HTUA 1WRJA 4D0PA 1FNNA 3FHZA 1IW7F 2CFXA 3C3WA 2ZMEA 4ENKA 1IXSB 4RB2C 5D5XB 2BEOA 1H9TA 1FX7A 1HKTA 1LVAA 4WCGA 2ISYA 4HX7A 5ERIA 3TO9A 2KIUA 4MHGA 2DT5A 3WTUC 4K2EA 2M30A 3SXYA 4ENNA 2KKOA 4ZYEA 4IRIA 3KE2A 3WTWC 1SD6A 3RYPA 3D0SA 1XMAA 1FC3A 3TOBA 2L4AA 3IRQA 3V8LA 1KU2A 2DPUA 3NRVA 2KJCA 2VOPA 2IW5A 2YR2A 3ZMUA 4GXOA 1EH7A 4AVPA 1KQ9A 4LJZF 4BH9A 3JTHA 4BYYA 2XKPA 3TOAA 4AIKA 4YG2F 5FB2A 2K02A 1KU3A 5E18F 1YQAA 1BM9A 3FMSA 3E6BA 1BI3A 3J80Z 3DFGA 4KIBA 3MWMA 2H6CA 3IWFA 3N97A 2A61A 2JPCA 3LFKA 2HR3A 1TNTA 3HHHA 1KU9A 5BPIA 4BXUA 5E20A 1B1BA 2VE8A 4P96A 6PAXA 3KCCA 1SMTA 2W25A 3BOQA 3ML6A 1XDSA 3E5UA 4RGSA 4BAYA 5F64A 2FU4A 3EETA 2P6SA 4N9HA 2NYXA 4TV7A 2GA2A 3FX3A 1UFMA 2KJBA 4XSZF 4CICA 1ZRFA 2DPDA 3DF8A 2FF4A 3F3XA 2A6EF 4HF0A 4UV9A 5FLXZ 4EVIA 4ZYHA 3EDPA 2RV8A 2Y0MA 1U5TC 4M71A 5CVJA 4LK1F 1W5SA 2IPQX 2FNAA 5EEGA 2QQAA 2IT0A 1FOKA 2R3SA 4UXNA 3IHUA 5ICEA 4L5JA 2VODA 2CG4A 2O61A 1MKMA 2ZFWA 1J9IA 1XSDA 4QWQA 2DBBA 1J5YA 3F8BA 2MLKA 4A12A 4LD5A 2Q8KA 2A68F 2EWNA 1FBQA 2FBIA 5HDNA 3RYRA 3KP3A 2VC1A 1Z6RA 1R22A 2ZO4A 3ZMZA 5LBQA 1R5GA 1FP2A 3ROUA 4HAMA 1XN7A 2YX7A 4UV8A 3CUOA 2OA4A 3W6JB 4EM1A 1QQIA 4HOBA 2GZWA 4LFUA 2MC3A 2D1HA 2O0YA 1HSTA 3TGNA 1JXSA 2MH9A 2HGCA 4AIHA 1SD4A 2HOEA 2QZ8A 5LLQA 2YSRA 1YYVA 2PN6A 1DDNA 2K27A 1LDJA 3ZQ7A 4CYDA 3J7AO 2DQRA 1KYZA 5E1WA 4N0BA 2VBWA 1K7AA 2XIGA 3T5XA 1QO0D 5AIPA 2LDUA 1TNSA 2A07F 1KA8A 2FOKA 1LJ9A 3S2WA 3CDHA 2ZMEB 2HWVA 3QOPA 2FE3A 1BI1A 3F22A 3ZPLA 3WU1B 1S7AA 3KP7A 1YW7A 4N9IA 5ILVA 3DXJF 3HHGA 5F6FA 3D5LA 3T1BA 4OIRF 1OKRA 4I02A 2MA3A 3KP5A 4OOIA 4XBFA 2H94A 4BQAA 1TBXA 2HTSA 1SD5A 1SD7A 4G7HF 2HTJA 4G6QA 1YS7A 5D5WB 4LB5A 5H6RA 3GW2A 1GVJA 4EJWA 1WQ2A 4WXDA 3RKYA 3C7JA 4OINF 1RIOH 1YO5C 4I2OA 2OU2A 4IRGA 4HZFA 4F7ZA 1W7PD 3V7CA 3J81Z 5A2QZ 3L2CA 4NQWA 5DV5A 1BC8C 1XDUA 4EGYA 2YX4A 1J7KA 1I1GA 4HF1A 2P4WA 1FYLA 3L00A 1BN5A 2HDCA 1BOAA 3QU6A 2HEOA 3W6KB 4RS8A 5DCMB 3M8FA 3MZYA 3EUHA 5DCFA 4XRFA 1QZZA 2EV0A 4NB5A 1MJBA 2F5EA 3WU0A 2GXGA 2AXLA 2HS5A 1I1SA 4EM0B 3FXRA 1XCVA 2IA1A 2H6BA 3GFJA 4QLCU 3KEQA 4WXHA 4I09A 2P7VB 2EJRA 3BPVA 5E8GA 4L18B 5DUIA 2PJPA 2FEZA 1CF7B 2EFPA 3WGGA 2CO5A 4M73A 2CGPA 4CXFA 2MD5A 2RC4A 3VB2A 3E5XA 3GF2A 4RAYA 1O7FA 1GHCA 3IL2A 5D5UB 1T98A 3K1NA 3GX4X 4YFNF 4KT5C 2XAJA 1ZHFA 2K86A 5K5OA 4JK1X 4OIQF 5L3DA 2VT2A 3C18A 3RTRA 5BS6A 3V7RA 4U0VA 4S04A 1FP1D 1WWXA 5L3CA 4ENJA 1LEBA 2WWYA 3GUDA 4EJOA 4GGGA 1W7PA 3IKTA 3FXQA 5E17F 3J81K 3QPTA 4HDUA 3CJNA 1PUEE 1QPMA 4RB0A 2XV4S 1RNLA 3HSRA 3ZMVA 4FX0A 4YFKF 2F5CA 1LNWA 5LGUA 2JSCA 4KYWA 2GWRA 3H92A 3G3ZA 1S6LA 1KQ8A 4OMYA 4UUVA 4ESJA 2V79A 2O3FA 4P9UA 2BGCA 4BHBA 3JTGA 3FMRA 3K9TA 2ZNYA 2NNNA 4I0BA 1Z7UA 2FSWA 5BQTA 1JHFA 3BJAA 1MZBA 1FBSA 1E2XA 3F8FA 1QBJA 3HIFA 3GZ5A 4ON0A 3I64A 3WTTC 2WC2A 4GCVA 3I54A 1QZYA 2NS0A 4M74A 2V1UA 4ESFA 4RGUA 1B6AA 1FT9A 5HS9A 1Y0UA 2P5VA 3GEZA 5CVVA 3I71A 2XASA 3LWFA 2M1BA 4HBLA 3TO7A 2NAZA 3K69A 4I98B 4ZZLA 3BPXA 4UVBA 3LQQA 1S7OA 2FMYA 3FMQA 3ZN1A 2H27A 3VFZA 5ICGA 4IHTA 5BPDA 3I53A 1WKMA 3WE2A 2EV5A 1TQPA 4NHJA 4U88A 1LDDA 2G9WA 1WSUA 4Y17A 1XGNA 3DEUA 3CUQA 1FLIA 5DDGA 3ERED 3KP4A 4DQ2A 3R6SA 4KICA 5F1RA 2EA4A 3QAHA 2LKPA 4IXAA 1YW9A 4A0ZA 4I0AA 1YFHA 1JGSA 1W7PB 1YS6A 4KFCA 1QNTA 4YFXF 1DP7P 4CHUA 3E97A 3GXOA 1USTA 1IN7A 1F9NA 3WTXC 5J8FA 1HW5A 1E17A 1XMKA 1FYKA 3MEXA 2RN7A 4OU0A 4BNCA 2DFIA 3KEOA 3JSPA 3I59A 4CGZA 1KU7A 2L54A 5BOXA 3R4KA 1TW3A 2QBYB 1T39A 3GZ6A 1HQCA 2STWA 2LNBA 3V7SA 3E5QA 3K0LA 2EFQA 1ODDA 5H6QA 3O3KA
chains in the Genus database with same CATH superfamily
1XMQE 2JA5J 3FXOA 1OCCH 4FX4A 1FOXA 2DA1A 3OIQA 4LITA 3H09A 2X4HA 5JVTA 2DW4A 5CYVA 2EQRA 2I10A 2HGHA 2E1NA 2QEXI 2X51A 3HOTA 1MSFC 1IUYA 1G2HA 2XRLA 1YE9A 2BY2A 1HNXE 2WAFA 4LF7E 3PM1A 5L3FA 3WGIA 4YIFA 2L8TA 2L0KA 4D7MA 4IRHA 1IXCA 2TDXA 3F6OA 3G1LA 4HW0A 1PDNC 4AYBA 1V5EA 3O6BB 4GKJE 1G3TA 1R5HA 1U78A 4B3RE 2CV0A 3S3NA 1G59A 5JFRA 4CO8A 3BR3A 3K10A 2EMXA 3KX2A 4RDUA 2Z33A 2RQQA 2K7LA 2R5YB 1POGA 1L0OC 2YPNA 1D0ZA 1ZREA 4A3LJ 4G8XA 1HKQA 4DV1E 1XGSA 1WPKA 4EMSA 4DV2E 1RUNA 3LQRA 1X1PA 1ZYRF 2DT6A 2LREA 5C4XJ 1WJDA 4YHHE 4BC7A 2YRHA 1MMDA 5ED4A 1ZR2A 1BIAA 3K1PA 5KL6A 1YJNI 2ADUA 5CVRA 3ELKA 3VOEA 2LP0A 4F9BB 1U5TB 2A69F 3LA2A 1LLMC 4FK5C 1Y6IA 5TJJA 1MBFA 2HKXA 3AG1H 2UUCE 3BLYA 3LNQA 3FXLA 3ERMA 1YW8A 3LFUA 3JTZA 2DA6A 2F5DA 4EV0A 2XRNA 5FD5A 1O3TA 1K4SA 4WK8F 2A25A 1XSVA 3A0HC 3O2PE 3BQYA 4A6DA 2XAGA 4Q5SF 1IDZA 1DGRM 3KEYA 4E7LA 4L9TA 1O7LA 1N36E 4A5NA 2EQ1A 2DMQA 3OS0A 4M72A 4XLFA 1QA6A 3I59B 3CC7I 2FQ3A 2LTRA 4G94A 4MTEA 2W24A 2O03A 1HDDC 3LA7A 2V4JC 1JK2A 1G6NA 1HW1A 1ZG1A 4X0GA 1K79A 1OCRH 4M3FA 1LB2A 4EJVA 2DT7B 3IH3A 4I76A 2E1CA 4R8HA 1L3LA 5FLXK 4JI7E 2ELZA 2PMUA 2XAUA 4HYEA 5LHHA 2YU3A 4V19K 1IRZA 3F21A 2EMGA 5HLIA 4BKXA 1Q1VA 3DTEA 3J7Yp 3MCZA 3LSJA 2EN2A 2M4IA 2M87A 3QQAA 4L9JA 1JKOC 3WGHA 4F6NA 3RKQA 1V5FA 5IT9K 2OUMA 5BNGA 2XB5A 4XQFA 3HYIA 2OD5A 3OL4A 5EG0A 3ZXSA 3S32A 4DR3E 3CTAA 4IHSA 1I27A 2B0LA 4IJAA 4MLOA 2UU9E 2VF1A 1P2FA 3DV8A 1ZGJA 3C6MA 4EM2A 1FTZA 3K1MA 2CQKA 4F2JC 1X2MA 2Q8UA 2HZTA 1IRGA 4D5CA 1U8RA 4A3FJ 3RDIA 4X6AJ 3UK3C 3Q0WA 5JHFA 3FZVA 4BHPA 3BGHA 2K3FA 3V8KA 2COMA 3F6VA 3EPLA 3CDLA 2KIFA 4V2GA 1B59A 5IV8B 3F72A 4HQMA 2EOQA 3O8GA 2L01A 2MW8A 4P1WA 2L3DA 2H1KA 1PYVA 1U2WA 3FXKA 3CCJI 1TWCJ 1KGSA 1IO2A 4XN3A 1Z21A 1J75A 3OTOE 3ZN0A 5J8CA 2KDZA 2M7BA 3GYHX 3PNTA 5A6JA 4EJUA 3BWGA 3N05A 4U7BA 1MD0A 1ONVA 4IF4A 5E1ZB 4CUGA 1V4RA 4U7DA 4I6ZA 4ESBA 1XS9A 1RQ0A 1U5TA 4E7JA 2ELJA 5TRDA 5A6AA 1B8IB 3QPHA 3H1CA 2RGVA 4DV3E 1KJKA 2BXZA 5E3LA 3L09A 1FSHA 2UUZA 3LSPA 4OIOF 1SFKA 2GBYA 2LK2A 3LL7A 1NTCA 1YJWI 2Z3YA 2XVCA 2XF6A 2FJ1A 2RQPA 2QM3A 4MFEA 2R76A 3FWEA 5FROA 3ULQB 2CRGA 1IN8A 4IKFA 3RQ4A 2E7XA 4LLGF 3BF2A 1LFUP 2EIMH 1ETXA 2K40A 2DO7A 1Z77A 4A69C 2F2EA 1HC8A 2RS7A 2L7KA 2G7UA 4X8WA 3MZHA 2RNJA 1PP7U 1GV5A 1VI0A 3HXLA 1IG7A 1NG7A 2QQ9A 1B9NA 3BG9A 2Q0OA 2V1DA 3PUFA 1SAXA 2O8XA 4XIDA 4M0VA 1STZA 2JPBA 3EUKL 4U0WA 2WTEA 2NVTJ 3F0CA 4Y7NJ 2FRHA 1J59A 4JQFA 3E3VA 3H9JA 1W0TA 4Q48A 2D1VA 2M4KA 3WTSC 1YUIA 1SC7A 2DOFA 3BP8A 1AKHB 5KVRA 2AS5F 1XTAA 1VQ6I 1ORKA 1X5WA 5DD8A 4BU2A 3S3MA 2DOEA 3HRUA 2NS8A 2XAHA 4A6EA 2VT3A 3BR2A 2V1XA 1R00A 5AONA 2J5PA 3DBRB 3CO6C 5EGOB 3CF5F 3DLLF 3GTLJ 1BC7C 4HSTA 1EH8A 2LY1A 4DBQA 2CV1A 3OWTA 1LDKB 2VXZA 4BXXJ 3EQLF 1V5GA 2ACJA 2E1OA 1TZLA 2HVSA 3ADIA 3SFIA 1GVDA 1AHDP 2R7ZJ 3TO6A 3OYEA 1RC7A 4IQJA 4IVNA 2JRTA 1Z7LA 1ZELA 1G3YA 2M45A 3WHBA 2EA2A 2EFNA 4B8XA 3DPLC 5DUKA 2DMTA 3E6MA 1OJLA 1AOYA 2XAFA 2Z5UA 1X6EA 1SFUA 1X47A 1UHWA 2LBSB 2F6CA 2CQ7A 4OIPF 5HLGA 1DQ3A 4K0KE 1SVOA 2EPNA 1RPWA 1S29A 1T0FA 2E7WA 1YLFA 2EFWA 1B4AA 5DYMA 3K2ZA 3HL2A 3G1OA 3ZGKA 2ZXIA 2HOTA 2LG4A 2BYVE 3Q0UA 5IOYA 2YPRA 2DA5A 2XUBA 4DR2E 4DR6E 4E7ZA 2EB7A 4MEYF 2W4SA 1TTYA 2A3SA 4MQ9F 2GQQA 3VYSB 2MDGA 2XROA 3F9KA 4DV0E 4IHXA 1HKSA 2DCEA 1HBXG 2D5VA 2H8RA 2EBIA 4PDKA 1Z1BA 4L8NA 4N4OB 4Q4ZF 3F23A 3IKVA 1FYMA 1DPRA 2JZYA 4RB3C 4BS9A 2LF8A 3RSNA 3VODA 4AVZA 4DZPA 3PQJA 3CCVI 3DTKA 3KYCB 2CFOA 4CCNA 4BE2A 1D8JA 1R58A 3T0YA 1HOMA 3EQ1A 3F8CA 3KZIC 4LG0A 3T1HE 4KNYA 3U2RA 3A03A 5J1UA 2EK5A 1FZPB 3M3YJ 3OMLA 3ZP5A 1F2IG 2P0WA 1Z6TA 1VQNI 2Y0SA 4ITVA 1HSJA 3MHHC 3E6CC 1BI0A 2VQCA 1XSXA 2ZBKA 5LEJA 1ZBTA 4FASD 1YYOA 4H0EA 3THNA 5B3SH 1R1TA 2DA2A 4JI4E 2QQ8A 3SQNA 1R5ID 2V26A 3CCYA 1SEUA 4TUIA 3M9AA 5EEAA 1VTNC 4YEJA 5FFXA 1XGOA 4HEA2 1K78A 4P78A 4P55A 1VQMI 3OOPA 5IP9J 4AIJA 4R03A 2W82A 1JJ8C 2XGXA 1I3QJ 1OCOH 2DSYA 1WI3A 3SDBA 2JVHA 2PX9A 4X64E 2XF7A 3U21A 2XSDC 2ZFUA 5HLTA 4HA8A 2X0LA 2QENA 2UXXA 2PLYA 2FBHA 4UVCA 1AKHA 2HJJA 3ABTA 2YTQA 3HB9A 4R2QA 2CU7A 3ZQCA 4BC9A 3BY6A 4B3TE 1ETQA 1ZRDA 1GZ6A 2EOOA 2GAUA 2FBKA 3LSIA 4PCQA 3UNGC 4TUGA 3TQNA 4HX8A 4ZYGA 2EPPA 2JTVA 5DEQA 3JRHA 5LRSA 1JKPC 4B3ME 2L4MA 5ADZA 3A4CA 2FA5A 2P6TA 2VIXA 2DFEA 3HSEA 2PMZA 4RAFA 2AO9A 1A1JA 2M9HA 5A2QK 4P5OA 2LKXA 1HW2A 3LMLA 2MG4A 2DI3A 3P7NA 3MFKA 3M4OJ 1FIAA 3MKWB 4Q35B 1NHAA 2DA3A 2MBFA 2PQ8A 4BDZA 1VQ5I 1W4MA 3H5RA 4XLPF 3ISPA 4JI2E 2MD0A 2VBZA 3G4SI 3S93A 2RREA 4WSGA 1R1VA 3KP6A 3SZPA 2DK5A 3TBIA 1MDMA 1K78B 2Y75A 2EM3A 2EN4A 2ESNA 1QZEA 1H0MA 5LGTA 4PJ0C 2XKOA 3QRFF 2VONA 4R2AA 2BVMA 1G3WA 4E6KG 3RKWA 4LF6E 5E3NA 4WFTA 2CH0A 3ZMTA 1SMYF 2WBSA 2VBXA 3C1DA 3HUGA 2E34A 3DEWA 2KLOA 2EMFA 1V3FA 2BV6A 2E5NA 4ZDLA 1OCTC 1WJ5A 2DA4A 3LSHA 4JOMA 2OZUA 3DLAA 2ME6A 4A3EJ 1D3YA 3AG4H 2LVHA 4MFDA 2IP2A 3Q5FA 3BROA 1BI2A 3GO5A 5E79C 5HDKA 5K7HA 1GXPA 4XKCA 1ZG3A 1OCZH 4WPYA 2EMWA 3WG9A 4ZYDA 3I4MJ 1GXQA 2OAZA 2LYCA 1O3SA 1RRJA 4A3GJ 4A0YA 5C3EJ 4FCYA 2VJJA 3CJTB 2NXNB 1ETVA 2C6YA 1MIJA 4OX9E 4BJ6C 4HV5A 1LEAA 3FK7A 3IP4B 4ZJZA 3S1NJ 4LF4E 3GLLA 1W5TA 4G9YA 4NC7A 1FTTA 3C4TA 2CJJA 4EATA 1P4XA 3LSTA 4GDFA 3CCLI 5E8IA 1N78A 1E0EA 2MSYA 4F54A 2L9NA 1I94E 3ECOA 5K5QA 5A6KA 4Y3OA 1K6OA 2MLGA 1HLVA 1XMOE 4RHBB 1FMWA 4LLNA 4XRSA 2R7OA 2KIMA 4Q47A 4BACA 4BY7J 4PGHA 2RDPA 3HSFA 3HUGB 2EV6A 2F5FA 5JLWA 2JMWA 3K4NA 4BE1A 2EILH 2YU8A 5J4VA 2VOOA 1WHQA 1R7JA 1R36A 4ZDPA 1OFCX 2DJIA 1TW2A 4MTDA 3GFLA 4IQ4A 2P5KA 1VQ7I 1S9HA 5J47A 1S8NA 3IAS2 3W2WA 2CW0F 1F1ZA 1TQIA 2CMPA 4MGRA 3BR5A 1R23A 3KLNA 2B3TB 2RVCA 3QP5A 5FD6A 2YU5A 2XPWA 4WYQB 3T8TA 2HFHA 1B72B 4MEXF 4UVAA 1P9QC 4OWRB 1BJAA 5F27A 2GXBA 1UZCA 3F8MA 2B9DA 1X1BA 2ZXWH 2EOYA 5DCMA 5KK1A 1YTYA 2KT0A 2L5QA 1PDAA 4E7IA 1APLC 2JYAA 2NVQJ 4EQQA 4RGXA 2WCC3 3CJQB 4FQGA 2Z2SB 5EJCA 3ABUA 3BTIA 1YRNB 4UY8I 5LHGA 4KDPA 1ZAAC 3SDGA 1AU7A 1OPCA 3GTKJ 2VQFE 4BXFA 2OQRA 4M30A 4QSHA 2R7WA 3Q3SA 3VSKA 5BMZA 2MH2A 1WJFA 2BW3B 3S3OA 4G12A 2DK8A 1REPC 2JVGA 4G6TB 3CC4I 5D4RA 5F0HA 4KHPE 3PIOF 2IVMA 3KLOA 3GFIA 4XLNF 3HRMA 3TP0A 4EJTA 2R93J 2YTNA 1ZN2A 3THOB 3PO3J 4HX4A 4LK0F 2NNYA 1FMVA 2ZNZA 4LGWA 2BY3A 5HVQC 3LSGA 3HPGA 4X62E 1JKQC 2YWQA 4RB1A 2EQ0A 2E35A 2DAOA 4MQVA 4PK4A 3SZGA 2UZKA 4E7KA 3E1SA 5KAIC 4DUZE 3ECHA 4P9FA 1X4OA 3ADLA 1T56A 2PFBA 1AWCA 5ICCA 2MYSA 1X3UA 2ECCA 5HDGA 1MEYC 2HQNA 2JN6A 2M34A 3DPTA 3PL8A 2Y2ZA 2HI3A 1IBLE 2HKOA 1R4NB 5AE2A 1TQMA 2LF7A 4XK4A 1P92A 1PUFB 3TQMA 3FM3A 2QLZA 3TKYA 5D5VB 3H5AA 1MNEA 3FIWA 2PI0A 2IS4A 4AQYE 3B73A 3DP7A 2L02A 5B1AH 5K7ZA 5CLSA 3IH2A 4FETA 4Z2YA 3W2VA 5J1RA 4HDVA 1YG2A 3FBNB 2LOOA 2R7UA 3MAJA 4A3KJ 4L5EA 2JWTA 1S3JA 3J7AY 4GYGA 2ZJ2A 4XOTA 3TDUC 1Z9CA 3FXUA 2WBUA 1QGPA 5E1XA 4DNCA 3IRRA 1F4KA 4B43A 1KYWA 2H1LA 4W1UA 3J80K 2M8GX 1MMNA 2OTLI 3LAJA 3GCMA 2BHYA 3BJ6A 2E2IJ 3DF6A 4G7OF 2PG4A 3PNYA 1A35A 5HLHA 1NH3A 5FLVA 4HQEA 3CLOA 1Y8QB 5CPRB 4NNJA 3I5UA 5AIQA 1YIOA 4HV6A 5JHUA 1N32E 4M9ZA 5M3FJ 1MBJA 2J5OA 2FNPA 2VUMJ 2KRHA 4RLFA 1X58A 4KIGA 3I58A 3ASOH 4RM3A 2OQGA 4AWXB 3ASNH 2ZJQF 5CVUA 1JUSA 1UAAA 3GTQJ 1P6RA 2I13A 1HNWE 1RUOA 2L2MA 4XORA 3BBGA 5LRRA 2RS6A 1PJSA 2XB0X 2K9QA 5B66C 3FM5A 1IV6A 5M5WJ 2K9SA 1WFXA 3KFWX 3BR6A 2HU9A 1I3AA 5C4JJ 4F3QA 2D2WA 5KCMA 1EH6A 4XLCA 1Y8RB 2HVQA 2FXAA 3RQIA 2QSGX 1ZH5A 1ZG5A 1A1GA 2DJNA 4O5VA 5CVIA 1T4NA 1HDPA 5F04A 5LGNA 2HQRA 4LG3A 1ZKGA 4J00A 1W0UA 1V55H 5HODA 3RIRA 3CMMA 3OYLA 4EGZA 4E7HA 1IQSA 2OF7A 5K7FA 4A3IJ 3OY9A 1Y0NA 1IV8A 4B3XA 4PJMA 4DJAA 4C9YA 1LKXA 1Y1VJ 3HBLA 3ZMDA 2XPVA 3OR1C 3NEUA 3CP2A 1HA8A 1U3EM 4WXCA 4B1RA 2QKLB 3AAFA 3GLXA 4NDLA 3JRIA 3L1PA 2EMCA 1AA7A 3R61A 2BB8A 2GOMA 1CF7A 1W1WE 1H89C 2EOXA 4XLAA 3MKZA 3ZMSA 4CCJA 3R0JA 2O6GE 4XRMA 4BE0A 3RMPA 1VF9A 1UILA 1JI8A 3DKWA 2ID6A 1T4LB 2ZC2A 4LLLA 2GIZA 4RAGA 3VYXA 4E70A 2M7QA 2JA2A 4A3BJ 3GMEA 1SVLA 4BJTA 1DGWY 2K7IA 2K4JA 1ZQ3P 4ANJA 1XCBA 2IA2A 4PGGA 2A6TA 2IGNA 3K6QA 3OYMA 1O57A 4NUBA 3S1RJ 3SHFA 4PZJA 3I9V2 2V6EA 5M5YJ 4CSWA 1STUA 5HNHA 2AQFA 2Z1DA 3TL4X 1XB4A 5D6EA 1MNDA 2NOJB 1KQ0A 2PEXA 2EL5A 3HRTA 3EYIA 4ZTJA 3SZTA 5FLMJ 3D5RC 4LOCA 2YTGA 1IRFA 3GFMA 4IHVA 2KISA 2DTRA 2LD5A 2V9VA 3OSGA 2EL6A 4RH8A 3OV8A 1RI7A 2I8DA 2OV7A 4RAZA 1HXDA 2EP3A 3JU0A 4F52A 1I5ZA 1LVKA 3E0JB 1P4WA 1R1UA 1T6SA 1PP8F 1P47A 1T2KA 2ZCWA 4A5MA 4WF2A 3GVAA 2L92A 1QVUA 1X1CA 2Q1ZB 2X6YA 1X1DA 3MQ0A 5EDNA 3GTMJ 2XAQA 3E6DA 4C30A 1BBYA 3MKLA 5CQEA 3DKXA 1P7JA 4IL6C 4JBAA 4KIFA 4YY3E 4S05A 3JRGA 3BG6A 1FPQA 3WE3A 3DQVC 1KONA 3BDDA 5GPAA 2DDAA 1MNMC 2WBTA 2LKSA 3KZYA 4O5GA 2Y48A 4IS1C 3B02A 2M5WA 1J26A 2EMKA 4HLYA 3PNVA 2QYOA 1ZARA 3ZQQA 4AC0A 4KN7X 4HTGA 1B8IA 4CDGA 4M6YA 3T1YE 4C2MJ 5D8KB 4CA0A 2CTDA 4LMYA 2PMHA 3OYCA 3MVPA 2EPUA 3EPHA 2EQ3A 5AC5A 3ECRA 4HF2A 1S72I 4C3JJ 4JV5E 2W85A 3KETA 1DGCA 2P8TA 2RKHA 1R4MB 4HLXA 5H20A 2A5YB 1MGTA 3WTZA 5LHIA 2HOSA 2DLQA 1MW7A 3HGGA 1X2NA 4NQWB 3WTVC 4CCLA 4LFCE 3IUOA 2X6XA 2BE5F 2P7CB 1MJAA 1T38A 3F8NA 1FBUA 5K5RA 2N3HA 4KITB 3TP3A 1IN6A 2R7VA 1G3SA 4QPOA 4KWYA 2W57A 2PJRA 3CD6I 3MSWA 3RPUA 1T8IA 4R2DA 5EZGA 1EV7A 3G73A 2KZVA 1C0WA 1QPIA 1Z1DA 3RI4A 4DBRA 3HTSB 2VJ4A 2EH3A 4O6JA 1OYYA 2LCEA 2IHR1 1N75A 3QP6A 1H9GA 4DZJA 3H3ZA 4YRVA 5KL4A 2AQEA 1W5CC 2G0EA 1ETOA 2R7DA 4GYIA 4PFPA 1RC9A 5JVGF 4MNUA 2LY9A 3EUAA 4NC8A 2Y9ZA 1YITI 2WA0A 3VEPA 3S2HJ 2EM0A 3UKGA 3CO7C 4M6XA 3JRDA 4R2RA 4M6VA 2DU9A 4OOGC 2FMLA 5IT3A 4F9CB 1A1LA 3BJOA 1D5VA 4BHCA 4BEHA 1TF3A 4CCMA 4FT8A 1TWFJ 1JGGA 3H3UA 5JI6A 3M8EA 1TL8A 2X85A 3CP8A 1JKRC 1VZ0A 1P4AA 3JW4A 3NQOA 4M2ZA 4M3EA 3WU2C 4I01A 5FRMA 2DYRH 2EN8A 2HC5A 2CSOA 2JT1A 3HTXA 4D9JA 4WWCA 2IA0A 1YIJI 4A3DJ 2GLIA 2KIQA 3IWZA 3Q9VA 3H9QA 1YJ9I 2VASA 2ZKZA 1QVTA 3BG7A 3BIDA 3FXJA 4AYBN 4PJNA 4G7ZF 2DFHA 2LJHA 2CYYA 2BBYA 2L2NA 4Y4RA 3S1MJ 2M0MA 2YRMA 2BW3A 3IC7A 3DU5A 3QYEA 1J09A 1LFBA 2DMPA 3JAMK 3M7GA 3BZ6A 3K4JA 1O3RA 5GTIC 3VWBA 4QPQA 1UB9A 3CCUI 2ELYA 1IRXA 3QU3A 3OS1A 4F55A 1ZGWA 2EM5A 5J4YA 4LFBE 2LVSA 1WJCA 1BJZA 4KN4X 1JHHA 3M07A 3MD2A 5FFZA 3I0TA 3I56I 2X6OA 3O8HA 1A31A 2JA6J 3M99B 1OMIA 3U1DA 3REOA 1JT0A 4R79A 4DYCA 2BOLA 1I6XA 5DM7F 2UXNA 2YUSA 1X1AA 3ZOBA 2ODRC 2XSJC 3FKJA 3U1KA 4UUTA 2R7FA 2FD5A 3HEFA 2I5UA 1NK2P 3WTYC 2EFOA 4DGWB 1FOYA 1UG0A 3L7WA 3SEQA 4X1EA 4KMFA 2GPIA 1IXRC 1QU6A 2DLLA 4GO1A 4I8OA 5KHDA 3S14J 4A2UA 2BXYA 2VL8A 2KHMA 3ZQIA 2E72A 2JP9A 1FY7A 1RR7A 4Y15A 3U9GA 2E1MC 3I4PA 4F9AB 2DTZA 1IBKE 2V86A 5ICFA 2PBIA 2UWMA 1UCRA 1ETWA 1QHGA 2VE9A 1USSA 2ETHA 3FF5A 1YZ9A 3KZZA 2STTA 2IXSA 3QODA 5L3EA 2HXIA 3OOUA 3HQ1A 2RAEA 4OMZA 5FGMA 3VYRB 3JSOA 2QVOA 3PJRA 4WSPA 2JQ7A 3D1NI 3MHSC 1X6HA 2O7OA 2A6HF 2EINH 1KZHA 2E5LE 3SYTA 4NXNE 2FQ4A 2QUFA 2OZ6A 1U6GA 2CW7A 2MC4A 3LAPA 2Z16A 3GWZA 3OL3A 4DV4E 4JYAE 2QWWA 2E36A 1Z05A 2HYJA 2WBMA 1CGPA 2YZTA 2EWLA 2GIVA 4IPAA 5C44J 1ZRCA 3OYIA 1DP3A 1ON2A 1XGMA 1Q1HA 1SAUA 1DU0A 3K70D 2WAQA 5HOOA 2COBA 2MFZA 2HXOA 1WJEA 4MIMA 5J6XA 3VSLA 5IT9Z 4C2TA 1Z91A 3D5SC 2FOWA 3OYBA 3S2DJ 3PSIA 3K2AA 2LLKA 3HPSA 1MBHA 2CUZA 4J01A 4XKWA 1ZLJA 4LIUA 1GDTA 1JJ6C 2ZB9A 1VFCA 5LEKA 2P5LC 3HOVJ 2DMYA 2LH9A 2LSOA 2JVAA 1IDYA 3P1XA 4HNVA 4KZSA 1ZAOA 1SFXA 3IWCA 4KUMA 1RZ4A 5LD2C 1DPUA 3CUQB 2DMIA 2EOZA 4M9SA 1RKTA 2V88A 2XF5A 3SFZA 5FRNA 1V54H 1AAYA 1R49A 1J2XA 1OYIA 1UHMA 4ETSA 4HEIA 2ZSIB 1UN6B 4FHTA 2RTXA 4BUPA 2H8WA 3JAMZ 3IWBA 2LJUA 3H5NA 2OBPA 2KPMA 3RPQA 4Y13A 5IP6A 1FOWA 4I7HA 1A04A 2M8EA 4IJDA 2B63J 4FE7A 2Y69H 2H09A 3DEEA 2KMUA 2EPAA 1BR1A 2F8BA 2NUGA 3CMEI 1OYWA 3W6VA 2DB2A 2P81A 1FKAE 3V4GA 2LTPA 5D8LB 3TMOA 2MC6A 1JK1A 1SFEA 3RZDJ 3HM5A 2WB1A 3NAUA 2Q2EA 3H9GA 1OLTA 2NRAC 2HHHE 3K4KA 2L6MA 4X66E 4ENMA 4B3AA 4CZZA 2K4BA 5L3GA 1DU6A 2XGDA 5DM6F 2CQQA 4ZH4F 3DJWA 1IQOA 4L9NA 2ZXJA 1BIBA 3RKXA 1H88C 3M8JA 2ISZA 2ADRA 4DYRA 2G7HA 1J0RA 1Z67A 4KT6A 2EPMX 4M3DA 3FISA 4G6DA 2AHQA 3OYFA 2KP6A 3L9FA 2HYFA 2W48A 4XL9A 2CWEA 3FXMA 3R60A 2ESHA 2Y9YA 3N4MA 2PJRB 3IWDA 1D1CA 3CMYA 3NARA 5D6FA 1BOBA 5A2QC 3HGYA 3P9IA 1N33E 4XMYA 1F5TA 2QF7A 4WX9A 2FUG2 2CUEA 2WV1A 1D8KA 4AIDA 4J8ZA 3J81C 5F0CA 1YYWA 3K7AJ 1S5LC 2EIKH 4KA4A 2F5VA 2L9VA 3TDZC 5TISC 1FSEA 3KIOA 3ONQA 3HRSA 3EYYA 3HOZJ 2ICWG 4O3MA 5A69A 4AD9A 1B9MA 1G4DA 2KRFA 3T8RA 3R0AA 4O43A 2WV0A 1LPQA 2W84A 2EMYA 4ASNA 4FISA 4JI6E 2Y31A 5HS7A 2E60A 4YIIA 4Z6YA 2VQLA 5GTHC 1ULYA 4L0ZB 2IJLA 4HSRA 3GBGA 4U0YA 3KP2A 1A36A 1OR7A 1VQ9I 2QQBA 3HPZA 2B7TA 1LQ1A 4KMUX 2EN7A 4KJZA 1WHUA 5TGTA 2E19A 1XD7A 2D45A 2ELKA 1YX5A 2VXDA 5GP9A 2DLKA 1ITYA 2NA2A 4L0YB 3KWRA 5D4SA 1PUFA 3M1EA 4UNOA 1X3ZB 3V8JA 4RMNA 3H0GJ 2JOXA 4L5IA 1LFPA 3RJPA 2QBYA 2EIJH 2L7ZA 2BY0A 2O8KA 1ON1A 5CJ9A 5DD4A 5HS8A 3GTPJ 3HJEA 2F4IA 2GA1A 2JR1A 3FIGA 4B09A 1QU3A 2EE8A 1WI9A 3FHNA 3P9KA 5JR3A 5L3BA 2N8GA 5IT9C 4B48A 3HOUJ 1IN5A 1JE8A 2IS2A 3EPJA 2QA4I 2IGMA 2Z99A 5FJ8J 1R71A 2VBYA 2GM4A 4A0XA 1MDMB 4QTRA 3Q9SA 4XSXF 1YSAC 1ZLKA 4U87A 2R7TA 2LV2A 2L3JA 2LE2A 5K1YA 5CQGA 2V6CA 5DTDA 1IAWA 5FO5A 2XPUA 4M9XA 2M0CA 5GAGJ 3OIOA 4DMIA 4JI1E 3DBHB 3QWLA 2EZIA 2V7FA 2IS1A 4GZNC 1MJ9A 1MH3A 4II3A 5AE1A 4NXME 3OYKA 2EZHA 4LG0B 1GTKA 4UHTA 4X65E 1O3QA 2FGGA 4AU7A 1IF1A 4RGRA 2VN2A 1IN4A 3COAC 4Y52J 1F36A 2ELHA 2XHKA 4H4KC 3Q0VA 4R2CA 1ZGAA 2IS6A 2MKNA 3WODF 2DQLA 1WGXA 2HPIA 3PFIA 1VQ4I 1YPNA 2EPXA 3HOSA 4L9VA 3CC2I 2VC0A 4JX5A 4R1HA 1UHZA 2Z9OA 2EN3A 4JI5E 3ZCOA 2Y0SN 5ILSA 1U9NA 2KFDA 5EEHA 3P9CA 1H8AC 5IWAE 2GOXB 4LB6B 2EPRA 2HYGD 3LSMA 1AH5A 2M4GA 2MABA 3CUQC 3LA3A 3TW6A 2LMZA 2VKHA 4AUXA 2X1DA 4P7DA 2IRFG 1FWZA 1D0XA 1FJLA 3PQKA 1Y56A 2A05A 1PKPA 2LTSA 2V87A 1A1KA 1TLHB 1IZ1A 4ZZDA 4IOCF 5ILUA 5M5XJ 1WJPA 1DUXC 3HTUA 3ADJA 3PSFA 1WRJA 3C4BA 2DRPA 4D0PA 2J7JA 2UXDE 4DUYE 4B44A 2R92J 1FNNA 3OYDA 3GTGJ 3FKIJ 3FHZA 1ZR4A 4CZCA 1IW7F 4PSWA 2JSPA 4XR6A 4I99C 2CFXA 3C3WA 2HOAA 2ZMEA 2ZMEC 1ZBQA 1UJ8A 4ENKA 9ANTA 1IXSB 4RB2C 1U0JA 4GFBA 5D5XB 2R5ZB 2BEOA 4CH7A 1H9TA 1OCPA 1VQPI 1FX7A 1HKTA 1LVAA 2DMUA 4WCGA 2ISYA 4HX7A 5ERIA 2V89A 3J80C 3DBLB 1XC5A 3QPSA 2JUCA 3TO9A 3VK6A 2KIUA 3ESWB 3GZNB 1JUPA 4E4HA 4MHGA 2ZJRF 2DT5A 2WADA 1K83J 3WTUC 2NUEA 2E1MA 4K2EA 3LSRA 1XNQE 2ME0A 3VPRA 2M30A 3SXYA 4ENNA 3TW7A 2KKOA 4ZYEA 2H36X 3CLQA 4IRIA 4A93J 4JI8E 3KE2A 4ZC3A 3WTWC 1T95A 2EMZA 4A3JJ 2MDRA 2N8XA 1SD6A 5IXMB 3RYPA 2JA8J 3MKYB 2HZDA 3D0SA 1I50J 1OISA 1XMAA 1FC3A 3TOBA 2OCCH 1T0FC 1EKEA 3L2QA 2L4AA 4C2UA 3BG5A 1ETYA 3K4CA 3IRQA 3V8LA 1UBDC 3L2RA 1KU2A 4R2SA 4QIWN 3SJMA 2DPUA 1LE8A 3NRVA 2KJCA 2XGCA 1BR2A 2VOPA 4BBSJ 2IW5A 1DQUA 2X9DA 2YR2A 3ZMUA 4GXOA 1EH7A 4AVPA 1KQ9A 4LJZF 2K85A 4BH9A 5IP7J 2YSPA 3JTHA 4BYYA 1PJQA 2VJ5A 2XKPA 3TOAA 1ZR9A 2VKEA 4AIKA 4YG2F 5FB2A 2K02A 1KU3A 5E18F 5J40A 1IMUA 1YQAA 3BTCA 1BM9A 3FMSA 2E71A 4BQOA 5KL2A 3E6BA 1E3OC 3CESA 1BI3A 4BL0B 3J80Z 1D1AA 3DFGA 3MWMA 2WY8Q 2H6CA 3IWFA 4KIBA 2VLAA 3N97A 2A61A 2JPCA 3LFKA 2HR3A 1TNTA 3HHHA 4EEFG 4JX4A 2R5YA 2EOMA 1TWAJ 3ABKH 3BTJA 4JYKA 2QSHX 2K9LA 2D9HA 3DKYA 2JXPA 1KU9A 2WB1N 4LIVA 5BPIA 4BXUA 5E20A 1B1BA 2OTJI 2VE8A 2ZXHA 4P96A 1UG2A 6PAXA 3KCCA 2LUQA 1SMTA 2W25A 3V42A 3DCFA 3BOQA 3ML6A 1XDSA 3E5UA 5EF6A 2CW8A 3J7ZI 4RGSA 5H2FC 4BAYA 2MGQA 3RPUD 1SANA 5F64A 2FU4A 3HOYJ 3EETA 2P6SA 4N9HA 1LE8B 2GLOA 2JA7J 2IAIA 2NYXA 4TV7A 2GA2A 2ENHA 3FX3A 1UFMA 2KJBA 4XSZF 2QGUA 2LT7A 4CICA 1ZRFA 4W97A 1B72A 2VKDA 2NVXJ 2JJ7A 2DPDA 3B6CA 3VHTB 2L7MP 3DF8A 1OR7C 1T33A 2FF4A 3F3XA 2A6EF 2XDVA 3OS2A 1I39A 4HF0A 2DMNA 5IYCJ 3ABLH 4UV9A 2JUGA 2HDDA 5FLXZ 4EVIA 1BW6A 4ZYHA 2HNHA 3EDPA 2RV8A 3AUZA 1VQ8I 2Y0MA 2RQLA 1U5TC 4IZZA 2PMZN 1N77A 3ZOQB 4M71A 5CVJA 3ADGA 3NWSA 4LK1F 3S1QJ 1W5SA 2DXIA 4NZVA 5CFFE 3EPKA 2IPQX 3BCBA 2LBFB 3QYFA 4XLHA 2FNAA 5EEGA 3KPHA 2QKMB 2QQAA 2L3CA 5KAFC 2IT0A 2GXAA 1FOKA 4FTHA 2R3SA 1RR8C 4LF5E 3OR2C 2JOBA 5EYRA 4UXNA 3IHUA 4DR1E 5JLXA 5ICEA 4L5JA 4DW6A 4B47A 1N25A 2HQAA 2IEKA 2VODA 1BR4A 2CG4A 2O61A 2BY1A 2F48A 1MKMA 2ZFWA 3BR1A 1J9IA 1XSDA 4O24A 4QWQA 2EPOA 1A6QA 2DBBA 1J5YA 2O9LA 2EM9A 1TC3C 1ACIA 3F8BA 1K6YA 2MLKA 4A12A 4PJJA 4LD5A 2Q8KA 5A6BD 2ENAA 2A68F 2EWNA 1Y1WJ 2AXTC 1FBQA 2FBIA 4LTYA 5HDNA 1WXRA 2K9NA 3RYRA 4DV6E 3AV0A 2QSFX 1D1BA 3KP3A 2ZJPF 2EM8A 2K5CA 4RBOA 2VC1A 3S15J 4HNTA 1Z6RA 3BZCA 3C2HA 4D1QA 1R22A 2ZO4A 1BB8A 2KOUA 3ZMZA 5LBQA 2KHXA 1R5GA 4IHWA 1FP2A 3K70C 3JRFA 1IGNA 3AFHA 2M3AA 2ZM6E 3VDXA 2JK3A 1NEIA 3ROUA 4HAMA 1XN7A 3BQZA 2YTPA 3HKZN 2YX7A 4UV8A 3QPLA 3CUOA 2KQRA 2OA4A 2YTIA 3W6JB 4EM1A 1QQIA 2EN6A 4HOBA 3X2QH 4GRIA 4DKKA 1X6FA 2GZWA 4NC6A 3A01A 4D7NA 4LFUA 5GPCA 1PJTA 1BL0A 1SR9A 2MC3A 2D1HA 3BCAA 3CDIA 1Y39A 1MBKA 2O0YA 1HSTA 3TGNA 2CV2A 1JXSA 4Y33A 2MH9A 5IPAA 2HGCA 1TT0A 3CF2A 4AIHA 1WZ2A 2EMIA 1SD4A 2FV4B 5KL5A 2HOEA 3A02A 2QZ8A 5LLQA 2EMLA 2EPKX 1RKWA 2YSRA 1YYVA 1X4PA 2PN6A 1VQOI 1DDNA 2K27A 5AE3A 1LDJA 3ZQ7A 3LMMA 1MH4A 4CYDA 1UHSA 4DOZA 3J7AO 1GLNA 1DI2A 4LF8E 2DQRA 1KYZA 5E1WA 4N0BA 5IOZA 2B9SA 2R7XA 2VBWA 4PJLA 4DIQA 1K7AA 2BVLA 4F6MA 2XIGA 4IEJA 3T5XA 4DV5E 1QO0D 4AM3A 3OYGA 5AIPA 1WJBA 4B4CA 4ZDOA 1QRYA 1EJ9A 2LUPB 5EGOA 2LDUA 1W36D 1TNSA 1M1EB 3C2GA 2A07F 1KA8A 4UUSA 2NS7A 2UUAE 2UV1A 2FOKA 5FKMA 2ZSHB 1LJ9A 3S2WA 2EOSA 3QG5C 3CDHA 3MN2A 1XG1A 4GEQB 3W3CA 2ZMEB 2HWVA 3QOPA 4BQNA 2IGOA 4GKKE 2FE3A 3JREA 1BI1A 2E2HJ 3F22A 3ZPLA 3WU1B 1S7AA 2R5ZA 3K4MA 5IYBJ 3KP7A 3VYTB 1N3GA 5GAEJ 5TSEA 1YW7A 2WY7Q 3F6HA 1J5EE 4N9IA 5ILVA 3DXJF 1IJWC 3H3VK 1YHQI 3HHGA 5F6FA 2VPLA 2DOAA 5B5EC 3D5LA 4ZYAA 1JT6A 1MBEA 3T1BA 1QHHD 5FKOA 2F4MB 4HPQA 4OIRF 1OKRA 4I02A 5LMUE 2MA3A 2EJ4A 3KP5A 4OOIA 1R9TJ 2ID3A 4L5NC 1R6RA 2EOJA 1P7IA 2M1SA 4XBFA 1SFOJ 1MMSA 2H94A 1A5JA 3A0BC 4BQAA 1TBXA 2XC7A 1PJRA 2TRTA 2R0QC 2W1OA 2HTSA 2M2EA 1U8BA 2KZGA 1SD5A 3CZ6A 1SD7A 4G7HF 1YOVB 2HTJA 4G6QA 1YS7A 2L2OA 3FK6A 4OAZA 2JRMA 5H6RA 5D5WB 3K4BA 3OIPA 3OYJA 4LB5A 2EPZA 5FLXC 3ZQHA 2RPCA 3GW2A 2Y30A 1WCMJ 4N4RB 3ZR8X 2VI6A 2E1MB 3CMAI 2EZ6A 1GVJA 4EJWA 5F0FA 2KONA 1B69A 1WQ2A 4WXDA 4UB6C 4OAYA 4XKBA 2X48A 3RKYA 3HOXJ 2A5WA 2UXBE 3C7JA 5LL6R 3CQZJ 5E3OA 1K61A 4XKVA 4OINF 2OJED 1RIOH 2YT4A 1G2FC 1YO5C 2L9SA 4I2OA 2EMAA 2OU2A 3RCOA 4IRGA 1FEXA 2OCEA 5EG0B 1WVRA 4HZFA 3L2VA 3QOEA 1YYKA 4F7ZA 4XN0A 1RESA 1W7PD 3V7CA 3WG7H 3J81Z 3S16J 4ZTFA 3A2KA 1BA5A 2L33A 2EZKA 3NWTA 5A2QZ 2F4VE 4IOAF 2KRCA 3L2CA 1Z3XA 3TEDA 4NQWA 5DV5A 5FKKA 2NABA 4C3HJ 1BC8C 1XDUA 3HZJA 4EGYA 2EPCA 5CKTA 3OYAA 1I6HJ 2YTDA 2YX4A 1J7KA 1I1GA 2E2JJ 4HF1A 2P4WA 3LSKA 1MMAA 1FYLA 3L00A 1BN5A 2K9MA 2WZOA 3A1YA 2EPFA 3B6AA 3I55I 1D0YA 3C2BA 3DWLE 4V2FA 3ZQFA 1FIPA 1YRNA 2HDCA 1KYQA 4MLVA 1BOAA 3CCMI 2YTFA 3VYYA 3QU6A 2HEOA 2DDBA 4PSXA 3W6KB 5GADJ 3WHCA 4IHYA 4RS8A 3HG9A 5DCMB 3M8FA 3MZYA 4ABZA 3EUHA 5DCFA 4XRFA 1QZZA 4N4NB 2EV0A 2X1EA 4NB5A 1MJBA 2N3GA 2F5EA 3WU0A 1TN9A 2HQ5A 4JI3E 1GUUA 3P5JA 3IV5A 2GXGA 3M1CA 4UB8C 2AXLA 3J7AG 2UUBE 3CCRI 2HS5A 1LUJB 1I1SA 1E3HA 4EM0B 3H35A 4LF9E 4UUSB 3MZ8A 2NVYJ 3FXRA 1XCVA 2IA1A 2H6BA 3CJRB 3GFJA 1E3PA 3HPHA 4JX6A 5EZHA 5J1YA 4QLCU 1OQYA 1UELB 3CCSI 3CCEI 1HR0E 3KEQA 3JRBA 3I4NJ 2RSIA 3SEZA 4WXHA 5AC4A 4I09A 2EN1A 3DTIA 2P7VB 2EJRA 2IBDA 2VE7C 4R2PA 4DR5E 2CSHA 3BPVA 5E8GA 2JPAA 4D5FA 2B7EA 4L18B 3PO2J 5DS9A 5DUIA 2PJPA 4Q28A 2FEZA 2F4OB 1CF7B 2EFPA 4XNFA 4F92B 1IBME 3WGGA 5J3LA 2CPNA 3VYUB 2CUJA 2CO5A 4M73A 1JTXA 2CGPA 3JAMC 4XOPA 4CXFA 1ERDA 2MD5A 2RC4A 4XLEA 2DODA 1WJAA 2WAQN 3E5XA 3VB2A 3H0DA 1TWHJ 3S8PA 2NUFA 3GF2A 2L7FP 2DYSH 1YI2I 3IH4A 3S17J 1EF4A 1IUFA 2R1FA 4RAYA 1O7FA 4IO9F 1GHCA 3IL2A 2LRSA 5BR8E 1VNDA 2EOFA 1F43A 5D5UB 1T98A 3K1NA 1CQTA 4M9VC 3GX4X 4YFNF 2OC6A 4KT5C 2XAJA 4NBQA 1ZHFA 2K86A 5K5OA 4JK1X 4OIQF 4YELA 4II2A 5L3DA 2VT2A 3C18A 5B1BH 3RTRA 1GV2A 1ENHA 3FDYA 3FBIB 2DN0A 4HRIA 1WH5A 3I3LA 5BS6A 1IC8A 2EOEA 3GTOJ 1TT5B 3V7RA 4U0VA 4S04A 3JCUC 1FP1D 1U9OA 4BBYA 3HOWJ 1WWXA 2K3PA 5L3CA 1A1IA 4ENJA 4RM2A 1EA3A 3HDDA 1LEBA 4KISA 4CCOA 2WWYA 1WHNA 3GUDA 4EJOA 3PIPF 4GGGA 1W7PA 2E5ZA 4IX7A 2EORA 3IKTA 1ETKA 1XNRE 2IGKA 3FXQA 2EOHA 2VJIA 3J81K 1T08B 3QPTA 4HDUA 3CJNA 5E17F 2B7VA 2EM2A 5KL7A 1PUEE 1BBOA 2CQNA 3ZQGA 1GT0C 2EOIA 3W2AA 1QPMA 1ZU1A 4RB0A 5KL3A 5GAHJ 4JP0A 2XV4S 4M3BA 4A3MJ 4PFOA 1RNLA 1RMDA 3HSRA 3ZMVA 4XRSG 2KDOA 4FX0A 2M9AA 4YFKF 2JY9A 2F5CA 1VQKI 1LNWA 1EKZA 5LGUA 2JSCA 3DPUA 3L2UA 1W36C 2VRDA 2W7NA 3G1MA 4XICA 1NK3P 4KYWA 1L4SA 2GWRA 3H92A 3HC7A 4FE4A 2FX0A 3BG3A 5F1JA 2RSMA 3MMYB 1WH7A 4R8OA 3G3ZA 5IY5H 1S6LA 3OYHA 1KQ8A 2VKVA 2CUFA 4OMYA 4UUVA 2UXCE 4ESJA 2V79A 2K4VA 2V1NA 4XONA 1A1FA 3BTLA 3CCQI 2O3FA 4P9UA 5FKLA 2BGCA 4BHBA 3JTGA 1MSEC 3A01B 5F3WA 4NHRA 3FMRA 3QYBA 3BR0A 3K9TA 2V85A 5HNFA 1NG6A 2ZNYA 2NNNA 2LO3A 4I0BA 1Z7UA 1HF0A 2FSWA 5BQTA 2I9IA 1JHFA 3BJAA 2R7QA 1HCRA 1MZBA 1FBSA 1E2XA 2VPRA 4C3IJ 3G71I 1G8XA 3F8FA 1X49A 4RA2A 1QBJA 3HIFA 3GZ5A 3EPZA 4CCKA 4ON0A 1BBGA 3I64A 5M3MJ 4BJ5C 1TWGJ 1XX5A 3AKZA 1A1HA 4RLQA 2YU9J 2EL4A 1TF6A 3WTTC 2WC2A 4GCVA 3I54A 4CYCB 1QZYA 2NS0A 4M74A 2YS9A 2NVUB 2V1UA 4ESFA 4RGUA 1B6AA 4BGDA 3AG2H 2ODRD 4BCAA 1FT9A 5HS9A 4MO7A 2NOGA 3GEZA 1A6IA 1Y0UA 1ZTRA 2P5VA 5CVVA 3I71A 4BDYA 3F6GA 4B3SE 2CS3A 2XASA 3UR3C 4MLQA 2ECBA 3LWFA 1NCSA 4JI0E 2X6WA 2M1BA 2RNGA 4HBLA 3TO7A 2NAZA 2M7AA 1X19A 2YSOA 3K69A 4I98B 5E3MA 4ZZLA 2HPMA 1X48A 3K6GA 1BW5A 3BPXA 2O5RA 4UVBA 1T4OA 3LQQA 1S7OA 1XMXA 2FMYA 3FMQA 2JWOA 3ZN1A 2H27A 4BQQA 3VFZA 1S7EA 3G6EI 2YTOA 5ICGA 2ENCA 4IHTA 3HKZA 1X3WB 5BPDA 3AG3H 3I53A 1WKMA 2V9KA 3WE2A 2EV5A 4X9JA 2DGCA 2V9PA 2TCTA 1TQPA 4NHJA 2YTJA 4U88A 4HG2A 1LDDA 5LFAA 2G9WA 1WSUA 2EMBA 2R4GA 4Y17A 2VQHA 1XGNA 5DNYA 5LMNE 3DEUA 4HNUA 3CUQA 1D5YA 1FLIA 3AL0C 3PFYA 5DDGA 3JRAA 2XGEA 2EM4A 4O4KA 3ERED 3KP4A 4DQ2A 1Z3YA 2HDWA 2V83A 1VQLI 3R6SA 3LOCA 1MBGA 3BT9A 4KICA 4S0HB 5F1RA 2EA4A 3QAHA 4BY1J 2YRKA 2GHFA 1JTYA 1UMQA 2LKPA 4IXAA 2MKDA 3BC8A 2R7SA 2FTXB 1YW9A 1YX3A 1ZK8A 2EZLA 2OPTA 4A0ZA 4I0AA 4DYQA 2LRDA 3L2WA 3ABMH 1JGSA 1W7PB 4XM3A 1YFHA 4LFAE 1YS6A 1XPXA 4KFCA 3EUHC 1TP4A 1RETA 4M3GA 5KNLA 3PUBA 4BMJA 3H36A 5F08A 3OSFA 2BBGA 1QNTA 3J7YJ 4YFXF 2LY2A 3OYNA 3BZKA 3DU6A 1DP7P 4YIRX 3ZQLA 4CHUA 2VQEE 2BZTA 3E97A 1GQEA 2QCOA 3GXOA 3G2BA 2V8QB 1USTA 3RZOJ 1IN7A 2R7RA 1F9NA 1MMGA 1YUJA 3WTXC 5AASA 2DIXA 4F91B 4BBRJ 1HW5A 5J8FA 5IYDJ 1E17A 3JRCA 2EM7A 5FKNA 3IAM2 3ZRGA 2EMHA 3GTJJ 4J19A 1XMKA 3K4LA 2Q2EB 1FYKA 3MEXA 4LU9A 2RN7A 2EPLX 2LC2A 2MC5A 5T6JA 3KYDB 4BEHB 4R2EA 4OU0A 5A6BA 2LR8A 3E7LA 1K4TA 4PUSA 4A3CJ 2L9RA 4BNCA 2CT1A 2DFIA 1JUMA 3KEOA 3JSPA 3I59A 4CGZA 1KU7A 2L54A 4DR7E 1X3CA 5BOXA 4DR4E 3R4KA 2DFFA 3LLHA 1TW3A 2QBYB 1G2DC 2BHZA 2CQXA 4DV7E 2W00A 2X1CA 1PVEA 1T39A 2LBFA 3GZ6A 1HQCA 1N34E 4CYCA 1SVMA 2STWA 2LNBA 3V7SA 2HVRA 3E5QA 4F93B 3K0LA 1HNZE 3JR9A 2EFQA 2PRTA 1FJGE 2LFBA 2VQGA 2EM6A 4E7SA 2L2KB 1O0WA 3C6KA 1ODDA 3OMYA 1Z0XA 2VB6A 3AL0B 2YTEA 5H6QA 2LMDA 2WAEA 1O4XA 2DA7A 3KYLA 2KL4A 3O3KA
chains in the Genus database with same CATH topology
4FX4A 2X4HA 5JVTA 2DW4A 5CYVA 2E1NA 1IUYA 3HOTA 5L3FA 3WGIA 4YIFA 4IRHA 1IXCA 2TDXA 3F6OA 4HW0A 1PDNC 3O6BB 1G3TA 1R5HA 1U78A 5JFRA 4CO8A 2Z33A 2K7LA 1L0OC 1ZREA 4G8XA 1HKQA 1XGSA 4EMSA 1RUNA 3LQRA 1ZYRF 5ED4A 1BIAA 3K1PA 2ADUA 5CVRA 3ELKA 3VOEA 1U5TB 2A69F 3LA2A 5TJJA 2HKXA 1YW8A 2F5DA 4EV0A 2XRNA 5FD5A 1O3TA 4WK8F 1XSVA 3O2PE 4A6DA 2XAGA 4Q5SF 4L9TA 1O7LA 4A5NA 4M72A 3I59B 2FQ3A 4G94A 4MTEA 2W24A 2O03A 3LA7A 1G6NA 1HW1A 1ZG1A 1K79A 1LB2A 4EJVA 2E1CA 4R8HA 1L3LA 5FLXK 2PMUA 5LHHA 4HYEA 2YU3A 3F21A 5HLIA 3MCZA 2M87A 4L9JA 3WGHA 5IT9K 3HYIA 2OD5A 3CTAA 4IHSA 1I27A 2B0LA 4IJAA 1P2FA 3DV8A 1ZGJA 4EM2A 3K1MA 2CQKA 2HZTA 1IRGA 1U8RA 3RDIA 3FZVA 4BHPA 3V8KA 2COMA 3F6VA 2KIFA 1B59A 3F72A 4HQMA 2L01A 2L3DA 1U2WA 1KGSA 1J75A 3ZN0A 5J8CA 3GYHX 4EJUA 3BWGA 4U7BA 1MD0A 1ONVA 4IF4A 5E1ZB 1V4RA 4U7DA 4ESBA 1U5TA 5TRDA 3QPHA 2RGVA 1FSHA 3L09A 4OIOF 2Z3YA 2XVCA 2RQPA 2QM3A 3FWEA 3ULQB 1IN8A 2E7XA 4LLGF 2DO7A 2F2EA 2G7UA 3MZHA 2RNJA 1PP7U 2QQ9A 1B9NA 2Q0OA 2V1DA 1SAXA 2O8XA 1STZA 2JPBA 4U0WA 2WTEA 2FRHA 1J59A 4JQFA 3E3VA 4Q48A 2D1VA 3WTSC 3BP8A 5KVRA 2AS5F 5DD8A 3HRUA 2XAHA 4A6EA 2VT3A 2V1XA 1R00A 5AONA 2J5PA 3CO6C 1BC7C 1EH8A 1LDKB 2VXZA 3EQLF 2ACJA 3TO6A 4IVNA 2JRTA 1G3YA 2M45A 2EA2A 2EFNA 4B8XA 3DPLC 5DUKA 3E6MA 1AOYA 2XAFA 2Z5UA 1SFUA 1UHWA 4OIPF 5HLGA 1S29A 1T0FA 2E7WA 1YLFA 2EFWA 1B4AA 5DYMA 3K2ZA 2BYVE 2YPRA 2XUBA 2EB7A 4MEYF 1TTYA 2A3SA 4MQ9F 2GQQA 2XROA 1HKSA 1HBXG 4PDKA 4Q4ZF 3F23A 3IKVA 1FYMA 1DPRA 2JZYA 4RB3C 2LF8A 3VODA 3PQJA 1D8JA 1R58A 3T0YA 3F8CA 4LG0A 4KNYA 3U2RA 2EK5A 1FZPB 3ZP5A 1Z6TA 1HSJA 3E6CC 1BI0A 1XSXA 2ZBKA 5LEJA 4H0EA 1R1TA 3SQNA 3M9AA 1VTNC 5FFXA 1XGOA 1K78A 4P55A 3OOPA 4AIJA 2XGXA 4HA8A 2X0LA 2QENA 2UXXA 2PLYA 2FBHA 4UVCA 3ABTA 3BY6A 1ZRDA 2GAUA 2FBKA 4PCQA 3TQNA 4HX8A 4ZYGA 2JTVA 5DEQA 5LRSA 2L4MA 2FA5A 2P6TA 3HSEA 5A2QK 1HW2A 4P5OA 3MFKA 2DI3A 3P7NA 1NHAA 2MBFA 2PQ8A 1W4MA 4XLPF 3ISPA 2VBZA 1R1VA 3KP6A 3SZPA 2DK5A 1MDMA 1K78B 2Y75A 2ESNA 1H0MA 5LGTA 2XKOA 3QRFF 2VONA 1G3WA 3RKWA 3ZMTA 1SMYF 2VBXA 3C1DA 3HUGA 1V3FA 2BV6A 2OZUA 1D3YA 2IP2A 3Q5FA 3BROA 1BI2A 3GO5A 5HDKA 1GXPA 1ZG3A 3WG9A 4ZYDA 1GXQA 2OAZA 1O3SA 4A0YA 2C6YA 4HV5A 1LEAA 1W5TA 4G9YA 1P4XA 3LSTA 5E8IA 3ECOA 5K5QA 1K6OA 2MLGA 4LLNA 2KIMA 4Q47A 4PGHA 2RDPA 3HSFA 2EV6A 2F5FA 2VOOA 1R7JA 1R36A 1TW2A 4MTDA 3GFLA 2P5KA 1S8NA 2CW0F 1F1ZA 1TQIA 4MGRA 3KLNA 1R23A 2RVCA 3QP5A 5FD6A 3T8TA 2HFHA 4MEXF 4UVAA 1BJAA 2GXBA 3F8MA 5DCMA 5KK1A 1YTYA 4EQQA 4RGXA 3ABUA 5LHGA 4KDPA 1OPCA 2OQRA 5BMZA 2MH2A 2DK8A 1REPC 5D4RA 3GFIA 2IVMA 3KLOA 4EJTA 4XLNF 3HRMA 1ZN2A 4HX4A 4LK0F 2NNYA 2ZNZA 4LGWA 5HVQC 4RB1A 2DAOA 4MQVA 2UZKA 3ECHA 4P9FA 2PFBA 1AWCA 5ICCA 1X3UA 5HDGA 2HQNA 3DPTA 2HKOA 1TQMA 2LF7A 1P92A 3FM3A 2QLZA 3TKYA 5D5VB 2PI0A 3B73A 3DP7A 2L02A 5CLSA 4Z2YA 4HDVA 1YG2A 3MAJA 1S3JA 4GYGA 2ZJ2A 3TDUC 1Z9CA 3FXUA 1QGPA 5E1XA 4DNCA 3IRRA 1F4KA 1KYWA 3J80K 3LAJA 3BJ6A 4G7OF 2PG4A 5HLHA 4HQEA 3CLOA 3I5UA 5AIQA 1YIOA 4HV6A 5JHUA 4M9ZA 2J5OA 2FNPA 4KIGA 3I58A 2OQGA 4AWXB 5CVUA 1P6RA 1RUOA 5LRRA 3FM5A 3KFWX 2D2WA 1EH6A 1ZH5A 2FXAA 1ZG5A 4O5VA 5CVIA 5LGNA 2HQRA 3RIRA 4EGZA 3ZMDA 3NEUA 1U3EM 4WXCA 3AAFA 3GLXA 3R61A 1CF7A 3ZMSA 3R0JA 2O6GE 3DKWA 4LLLA 4E70A 2K4JA 1XCBA 2IA2A 4PGGA 1O57A 3SHFA 4PZJA 1XB4A 5D6EA 2PEXA 1KQ0A 3HRTA 3EYIA 3SZTA 1IRFA 3GFMA 2DTRA 2V9VA 3OV8A 1RI7A 4RAZA 1HXDA 1I5ZA 1P4WA 1R1UA 1T6SA 1PP8F 1T2KA 2ZCWA 4A5MA 4WF2A 3GVAA 3MQ0A 2XAQA 3E6DA 1BBYA 4JBAA 4KIFA 4S05A 1FPQA 3WE3A 3DQVC 3BDDA 3KZYA 2Y48A 3B02A 2M5WA 4HLYA 2QYOA 1ZARA 4KN7X 4CDGA 4M6YA 5D8KB 4LMYA 2PMHA 4HF2A 2W85A 3KETA 2P8TA 2RKHA 4HLXA 5H20A 2A5YB 1MGTA 3WTZA 5LHIA 3WTVC 2BE5F 2P7CB 1MJAA 1T38A 3F8NA 1FBUA 5K5RA 1IN6A 1G3SA 2W57A 3RPUA 1EV7A 3G73A 1C0WA 1Z1DA 3RI4A 3HTSB 4O6JA 1OYYA 3QP6A 1H9GA 3H3ZA 4GYIA 2R7DA 4MNUA 3VEPA 3CO7C 4M6XA 2DU9A 2FMLA 5IT3A 3BJOA 1D5VA 4BHCA 4FT8A 3H3UA 5JI6A 3M8EA 1P4AA 3JW4A 3NQOA 4I01A 2CSOA 2JT1A 4WWCA 2IA0A 3IWZA 3Q9VA 2ZKZA 4G7ZF 2CYYA 2BBYA 3IC7A 3JAMK 3M7GA 3BZ6A 1O3RA 1UB9A 3QU3A 4KN4X 1JHHA 5FFZA 3I0TA 1OMIA 3U1DA 3REOA 4R79A 1I6XA 2UXNA 2R7FA 3WTYC 2EFOA 3L7WA 4KMFA 1IXRC 2DLLA 4GO1A 4A2UA 1FY7A 4Y15A 3U9GA 3I4PA 5ICFA 2PBIA 2UWMA 1UCRA 2VE9A 1USSA 2ETHA 3FF5A 2STTA 3KZZA 5L3EA 4OMZA 5FGMA 3JSOA 2QVOA 2A6HF 2QUFA 2OZ6A 1U6GA 3LAPA 3GWZA 2QWWA 1Z05A 1CGPA 2GIVA 4IPAA 1ZRCA 1ON2A 1XGMA 1Q1HA 5HOOA 5J6XA 5IT9Z 1Z91A 1ZLJA 5LEKA 2P5LC 2LSOA 1ZAOA 1SFXA 4KUMA 1RZ4A 1DPUA 3CUQB 4M9SA 3SFZA 1J2XA 1OYIA 1UHMA 4ETSA 4FHTA 3JAMZ 2OBPA 4Y13A 3RPQA 4I7HA 1A04A 2M8EA 2H09A 1OYWA 3V4GA 5D8LB 1SFEA 2Q2EA 2NRAC 4ENMA 4CZZA 2K4BA 5L3GA 4ZH4F 4L9NA 2ZXJA 1BIBA 3RKXA 2ISZA 2G7HA 1J0RA 4G6DA 3L9FA 2HYFA 2CWEA 3R60A 2ESHA 3N4MA 5D6FA 3P9IA 1F5TA 4WX9A 1D8KA 4KA4A 3TDZC 1FSEA 3HRSA 3EYYA 4O3MA 4AD9A 1B9MA 1G4DA 2KRFA 3T8RA 3R0AA 2WV0A 2W84A 4ASNA 5HS7A 4YIIA 1ULYA 4L0ZB 2IJLA 4U0YA 3KP2A 1OR7A 2QQBA 1LQ1A 4KMUX 1XD7A 2D45A 4L0YB 5D4SA 3M1EA 4UNOA 3V8JA 4L5IA 3RJPA 2QBYA 1ON1A 5CJ9A 5DD4A 5HS8A 2GA1A 4B09A 1WI9A 3P9KA 5JR3A 5L3BA 1IN5A 1JE8A 2Z99A 2VBYA 4A0XA 1MDMB 3Q9SA 4XSXF 1ZLKA 5K1YA 2V6CA 1IAWA 5FO5A 4M9XA 1MJ9A 4LG0B 4UHTA 1O3QA 1IF1A 4RGRA 2VN2A 1IN4A 3COAC 2ELHA 2XHKA 1ZGAA 3WODF 2DQLA 3PFIA 3HOSA 4L9VA 2VC0A 4R1HA 2Z9OA 5ILSA 5EEHA 3P9CA 4LB6B 2HYGD 3CUQC 3LA3A 2IRFG 1FWZA 3PQKA 1TLHB 1IZ1A 4ZZDA 5ILUA 1DUXC 3HTUA 1WRJA 4D0PA 1FNNA 3FHZA 1IW7F 2CFXA 3C3WA 2ZMEA 4ENKA 1IXSB 4RB2C 5D5XB 2BEOA 1H9TA 1FX7A 1HKTA 1LVAA 4WCGA 2ISYA 4HX7A 5ERIA 3TO9A 2KIUA 4MHGA 2DT5A 3WTUC 4K2EA 2M30A 3SXYA 4ENNA 2KKOA 4ZYEA 4IRIA 3KE2A 3WTWC 1SD6A 3RYPA 3D0SA 1XMAA 1FC3A 3TOBA 2L4AA 3IRQA 3V8LA 1KU2A 2DPUA 3NRVA 2KJCA 2VOPA 2IW5A 2YR2A 3ZMUA 4GXOA 1EH7A 4AVPA 1KQ9A 4LJZF 4BH9A 3JTHA 4BYYA 2XKPA 3TOAA 4AIKA 4YG2F 5FB2A 2K02A 1KU3A 5E18F 1YQAA 1BM9A 3FMSA 3E6BA 1BI3A 3J80Z 3DFGA 4KIBA 3MWMA 2H6CA 3IWFA 3N97A 2A61A 2JPCA 3LFKA 2HR3A 1TNTA 3HHHA 1KU9A 5BPIA 4BXUA 5E20A 1B1BA 2VE8A 4P96A 6PAXA 3KCCA 1SMTA 2W25A 3BOQA 3ML6A 1XDSA 3E5UA 4RGSA 4BAYA 5F64A 2FU4A 3EETA 2P6SA 4N9HA 2NYXA 4TV7A 2GA2A 3FX3A 1UFMA 2KJBA 4XSZF 4CICA 1ZRFA 2DPDA 3DF8A 2FF4A 3F3XA 2A6EF 4HF0A 4UV9A 5FLXZ 4EVIA 4ZYHA 3EDPA 2RV8A 2Y0MA 1U5TC 4M71A 5CVJA 4LK1F 1W5SA 2IPQX 2FNAA 5EEGA 2QQAA 2IT0A 1FOKA 2R3SA 4UXNA 3IHUA 5ICEA 4L5JA 2VODA 2CG4A 2O61A 1MKMA 2ZFWA 1J9IA 1XSDA 4QWQA 2DBBA 1J5YA 3F8BA 2MLKA 4A12A 4LD5A 2Q8KA 2A68F 2EWNA 1FBQA 2FBIA 5HDNA 3RYRA 3KP3A 2VC1A 1Z6RA 1R22A 2ZO4A 3ZMZA 5LBQA 1R5GA 1FP2A 3ROUA 4HAMA 1XN7A 2YX7A 4UV8A 3CUOA 2OA4A 3W6JB 4EM1A 1QQIA 4HOBA 2GZWA 4LFUA 2MC3A 2D1HA 2O0YA 1HSTA 3TGNA 1JXSA 2MH9A 2HGCA 4AIHA 1SD4A 2HOEA 2QZ8A 5LLQA 2YSRA 1YYVA 2PN6A 1DDNA 2K27A 1LDJA 3ZQ7A 4CYDA 3J7AO 2DQRA 1KYZA 5E1WA 4N0BA 2VBWA 1K7AA 2XIGA 3T5XA 1QO0D 5AIPA 2LDUA 1TNSA 2A07F 1KA8A 2FOKA 1LJ9A 3S2WA 3CDHA 2ZMEB 2HWVA 3QOPA 2FE3A 1BI1A 3F22A 3ZPLA 3WU1B 1S7AA 3KP7A 1YW7A 4N9IA 5ILVA 3DXJF 3HHGA 5F6FA 3D5LA 3T1BA 4OIRF 1OKRA 4I02A 2MA3A 3KP5A 4OOIA 4XBFA 2H94A 4BQAA 1TBXA 2HTSA 1SD5A 1SD7A 4G7HF 2HTJA 4G6QA 1YS7A 5D5WB 4LB5A 5H6RA 3GW2A 1GVJA 4EJWA 1WQ2A 4WXDA 3RKYA 3C7JA 4OINF 1RIOH 1YO5C 4I2OA 2OU2A 4IRGA 4HZFA 4F7ZA 1W7PD 3V7CA 3J81Z 5A2QZ 3L2CA 4NQWA 5DV5A 1BC8C 1XDUA 4EGYA 2YX4A 1J7KA 1I1GA 4HF1A 2P4WA 1FYLA 3L00A 1BN5A 2HDCA 1BOAA 3QU6A 2HEOA 3W6KB 4RS8A 5DCMB 3M8FA 3MZYA 3EUHA 5DCFA 4XRFA 1QZZA 2EV0A 4NB5A 1MJBA 2F5EA 3WU0A 2GXGA 2AXLA 2HS5A 1I1SA 4EM0B 3FXRA 1XCVA 2IA1A 2H6BA 3GFJA 4QLCU 3KEQA 4WXHA 4I09A 2P7VB 2EJRA 3BPVA 5E8GA 4L18B 5DUIA 2PJPA 2FEZA 1CF7B 2EFPA 3WGGA 2CO5A 4M73A 2CGPA 4CXFA 2MD5A 2RC4A 3VB2A 3E5XA 3GF2A 4RAYA 1O7FA 1GHCA 3IL2A 5D5UB 1T98A 3K1NA 3GX4X 4YFNF 4KT5C 2XAJA 1ZHFA 2K86A 5K5OA 4JK1X 4OIQF 5L3DA 2VT2A 3C18A 3RTRA 5BS6A 3V7RA 4U0VA 4S04A 1FP1D 1WWXA 5L3CA 4ENJA 1LEBA 2WWYA 3GUDA 4EJOA 4GGGA 1W7PA 3IKTA 3FXQA 5E17F 3J81K 3QPTA 4HDUA 3CJNA 1PUEE 1QPMA 4RB0A 2XV4S 1RNLA 3HSRA 3ZMVA 4FX0A 4YFKF 2F5CA 1LNWA 5LGUA 2JSCA 4KYWA 2GWRA 3H92A 3G3ZA 1S6LA 1KQ8A 4OMYA 4UUVA 4ESJA 2V79A 2O3FA 4P9UA 2BGCA 4BHBA 3JTGA 3FMRA 3K9TA 2ZNYA 2NNNA 4I0BA 1Z7UA 2FSWA 5BQTA 1JHFA 3BJAA 1MZBA 1FBSA 1E2XA 3F8FA 1QBJA 3HIFA 3GZ5A 4ON0A 3I64A 3WTTC 2WC2A 4GCVA 3I54A 1QZYA 2NS0A 4M74A 2V1UA 4ESFA 4RGUA 1B6AA 1FT9A 5HS9A 1Y0UA 2P5VA 3GEZA 5CVVA 3I71A 2XASA 3LWFA 2M1BA 4HBLA 3TO7A 2NAZA 3K69A 4I98B 4ZZLA 3BPXA 4UVBA 3LQQA 1S7OA 2FMYA 3FMQA 3ZN1A 2H27A 3VFZA 5ICGA 4IHTA 5BPDA 3I53A 1WKMA 3WE2A 2EV5A 1TQPA 4NHJA 4U88A 1LDDA 2G9WA 1WSUA 4Y17A 1XGNA 3DEUA 3CUQA 1FLIA 5DDGA 3ERED 3KP4A 4DQ2A 3R6SA 4KICA 5F1RA 2EA4A 3QAHA 2LKPA 4IXAA 1YW9A 4A0ZA 4I0AA 1YFHA 1JGSA 1W7PB