1EHAA

Crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
557
structure length
557
Chain Sequence
TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKVGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 161
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehaA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ehaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ehaA01
4Q9BA 3VFGL 5C0IA 2FO4B 3UZEA 2EKJA 3KVQA 5GRJL 1SM3H 1LDPL 1L0QA 2BK8A 3SE4C 1FGVH 4R2GC 5HBBA 1FZMB 4KMLB 5DHYA 2Z0BA 4DAGL 5M94B 5HJ3B 1T7VA 1KN4H 2HWZH 5C0ND 1IFHL 5IMKB 1T1YA 5EOCL 1PZ2A 1RUMH 1JNDA 1IGJB 1MREH 4NBXB 3WSQL 4UNUA 3WQ6A 4D6IA 4GXPA 3DX3A 3L4UA 1BVZA 2PR4H 2AJ3A 3W0WE 4ML4A 5E2TL 1A7PH 3MV11 1G7HA 3RL1B 1AJ7H 4EVNB 1ES0B 3Q1SH 3VXSA 3R06B 2DL2A 3D25B 3RUGA 1L9NA 3G08A 2LE9A 3ROOB 1U3YA 4M1RA 2Q76A 4XPHL 3DVFA 1E28B 2F18A 2DIEA 4G7YH 3IJHA 3SQOH 4LCCB 3THMH 3UTTD 2UWFA 5HI3C 3CIVA 1BYDA 4PGEB 4WHDA 3CLEL 5SWQB 1HSAB 1T1XA 4F7EB 1QO3A 1I75A 2VAAA 5TQ2L 3WFCL 5A2BA 3OL2A 1AQ0A 3CZSA 5SWSD 5BS0E 1ETZA 3LXBA 3UC0L 1IM9D 2JIXD 1FNLA 3GI9L 4MWFB 2F74A 4OZFH 4OFKA 4ZSOB 2ID5A 4OOZA 2OYKA 5GS0D 1NDGB 4CAGA 1MFDH 5JOEA 2ARWA 4UZGA 4J8RA 2CESA 1OIMA 4EOWL 2J8FA 4U1NB 4PLNC 2QADC 4J2XA 1KBBA 3PHQB 5IHZA 4DKAA 1AGBA 3M45A 1QR4A 1F58L 1S7XA 1M01A 2P8PA 1NCBL 2F9BT 2WWMD 1RP9A 1E1EA 5JA8B 3EOBA 1EBAA 2Z93A 3LRMA 2I60L 1UWSA 3JV4A 1WDPA 3MRRA 4ORGB 1N3NB 2J12B 3DVGA 3VINA 2FLBT 2DLFL 5AG8A 1MFNA 2GSIA 1QYGL 4FQHB 5DJDA 4JDVA 5CP3A 1CLZL 1V0LA 1KN2H 1MQKH 3CD4A 5GQBA 1J1XL 3MJGX 3QIBA 4ZUUB 4Q2ZA 2C3VB 4HJGB 5ETUB 1V8HA 5H37G 2YWYA 4P3DA 2GJ6A 3QEUB 3MV7D 4XTRD 2W65B 4XB7A 5GRYA 4NCDA 2E6QA 4RRPA 4J6RH 1FHGA 5CSZB 2WNGA 1IGCH 5FIEA 4NZTH 3BQUB 2XRAL 4PY7B 4K71B 4GG8B 2ITDB 4IMLA 1T6WA 5EU4B 3T8XB 4MA1C 4NQSA 1MLBB 1NCNA 4X6FA 4GO6B 3L3KA 1CFBA 3SGJC 3UDWC 4KZDH 1JMXA 2FB4H 2JB5L 2MPAL 1E56A 3W2DH 1UWGH 4NRYB 1QX1A 2QR0B 3SCRA 4FFYL 3VGHA 3T0EA 5L7XH 3GB7B 3HG1E 4Y89A 2DQEL 1MCRA 2E3ZA 1NCWH 3B9VA 1XGYL 5F3HB 2B5IB 5LAXA 4YBLC 3X12B 4OZHE 1MCBA 5EOQH 4UFIA 4LASL 3AFLA 5J7CC 1G1CA 2VZUA 1NWSA 3MV01 4PJ9D 1R3LB 3FB6A 1FOBA 4JE4B 3L5JA 5TDPA 3S98A 1S7VA 5CCKH 3VVGA 1KF9B 5SV4A 3MROB 3CXDL 4N8PA 3ARGA 1ORSB 2G75B 4YBHA 1ZVYA 1NSNL 4Z7UA 4JQVA 1QSEB 5CP7B 4EDWH 3M8OL 1B9ZA 4TSCL 1OWWA 2G5RA 3GSQA 5H37H 3OB8A 4D9QD 5KAQF 2P5EA 1NCUA 3CDCA 4TOQA 5E8OA 1DWIM 4Y1AD 3NZ8A 4JFQB 3PZTA 4LLDA 1LP9F 1RHHA 4PJ7F 3HE7B 3MV8E 3VIJA 2OBGA 4Y5XC 1BF2A 1X9QA 1BX2B 3NBNA 1QR1A 3VXNB 4DN4H 1TQVA 2ITCA 1TJIH 1TZ7A 5E8PA 5GS3A 1V08A 3TIEB 5HGBB 3KL3A 2DIJA 1P7QA 5GGRA 2C5DC 2NXZB 1BAFH 5KSAD 2ZCKH 3C2AH 1M4KA 4ODXB 4MXVE 3ZT7A 2BX5A 3RGVD 4OD2B 1MAML 4OLUL 4IS6A 2RCSH 4JZOA 4KPHH 2WAGA 3WIFA 4Y2DB 3K0WA 2VLKE 1TVBB 1IAII 2IH1B 4WDIA 3UTZA 1LEGB 1ZVSA 1ZLWK 4K3JL 4CW1A 2YPKB 3DVNB 4WGVB 1RQ5A 5E5MA 3PWJA 3V6OC 4L4TD 5F7EL 4GIAA 4QTHB 2PXYA 4KI5C 2CKBH 4NO3B 4OLXL 1QI4A 5T3ZH 3MJ9H 4WW1A 2GAZB 4K3EH 4LYRA 1FDLH 5ADOH 5J0BA 5LQBH 1CGVA 1QA9B 1V3LA 3DX2A 4AMWA 3WY3A 4NFBA 2SEBB 1ORQA 2WCAA 2AJZA 2YZ1A 5HDBE 3VFUB 3HZYA 2HT3D 4DZ8B 1IQDB 4TVPL 2QJDA 4Z76B 5IEKB 1JBJA 1KR0A 2CK2A 1EQPA 2BOBB 1QNRA 1WQVT 1IGTB 1M6OB 3NFSH 5E7FA 5A3ID 1KJVB 4G6FD 3QNYB 3O4LB 4TSBH 2CBIA 4XCEB 4AT6B 1OTUD 4GG6F 3OR6A 2X4TA 4GKNB 3V95A 2AKRB 1JE6A 2J7BA 1GGIH 1KGCD 3BVNB 3BP7A 3WNMA 4YFEA 3NOIA 1KGUA 2WC7A 4DOHB 2BNRE 2PKDA 5J56B 5I1LB 3MRFA 3TNMB 3ZYOA 5JORB 1OM3L 3QQNA 3WBEA 3LOWA 5D2LB 3CBWA 1A6TB 5GPRA 3VJ6A 4GUPB 4WW2B 2R69L 5AZ2L 1J87A 3DHMA 4QRRE 3O6FA 5IMLA 3CFDA 2WMJA 1P7KB 4U6XA 3UBXI 5CD3A 3MFFA 3WELA 1E73M 1HCFX 3M6DA 2ESVB 2B39A 1F45A 5I19H 3PDOA 4QEGA 4PMDA 1BEYH 1MCEA 3HC4H 3F58H 3MNZA 3P4OA 4MD4A 4NSKA 4O9HH 5C0IB 3W0WA 1QSVA 1ZT4B 3U30C 4AC1X 2V3EA 3FRUA 3VXQA 4JREB 5DHYB 4OD3L 4Z2IA 4OAWA 5DUPH 1JTPA 1DL7L 1MCSA 3V5HA 2E9IA 5FA3A 4PN2A 2VQUA 1T1YB 4PLKD 2I9TA 2A77L 3HRZA 4NKIH 5JTWA 1CICC 1CBVL 1KEMH 5M7QA 4AYSA 5DO8A 1C5BL 2F54B 2H8PA 2GK1B 3V0AC 2AJ3B 2EIDA 2VDQL 2CKRA 5J13B 4IRSB 3BN3B 1GXEA 3NZHH 1U8KA 3ZKMD 3FN0H 2QSQA 3BZDA 3LHPH 3QUZD 1WITA 3RUGB 5LGKA 3GJFA 5C0GA 3BLBA 3G08B 3ARFD 4G8FA 5E03A 3C5ZB 4J3XA 2AEQL 3UO1H 3RCNA 4LLMA 4N1CA 2DKMA 1FV1A 2GDUA 3IJHB 3TA3D 2E27L 3MGOA 4LLQA 5C0NC 4X6BA 5IGXH 3QCVH 2VSCA 4HULB 1T1XB 4LGXA 2VQTA 1T80A 3BLPX 1PLGL 1ZVHA 1QBLL 4LQFL 2VAAB 2Y1VA 5HYJB 2BCKA 2E9JA 1ETZB 3EDEA 4ZAKD 3U0TB 2D9QB 3B8YA 2F74B 1PIGA 1OTTC 3C09C 4NWUL 1GHFH 5D7KD 1YECH 3NIYA 2LTQC 4OFPA 1KXVC 3T4YA 4J8RB 5JW4R 2X2HA 1H5BC 3ILQC 3NA9L 1OW0A 5T1DL 2OZ4H 5IHZB 3VU2A 2I5YL 4P3CL 1S7XB 5K9JL 2P8PB 5I2IA 5I71C 1Z0NA 1CD9B 3K3QA 3MRRB 4OCYH 4K3GA 2FL5A 1U8JA 3V4PH 4XPBH 4X4ZA 2EBNA 4M93B 4S10A 4XP1H 3FQTB 3DVGB 2VCBA 1FNGA 1JHTB 4M4PA 2GSIB 2IPKA 2R0KL 4PYHA 4XNQA 1SBSL 4JDVB 3L3OB 1UWEH 3NH7L 1ZLWH 4PMRA 2AXFB 3GI8H 4ODWA 2ADGA 5GS0C 3GBDA 4NCC2 4NN5C 4TUKH 3QIBB 1Q6FA 4Q2ZB 3KJ6H 1XGRA 2XVNA 4HIJB 2GJ6B 3LQAH 2X41A 3TO4B 4PMZA 5FM4A 4UB0H 3SUVA 4HX1A 4ISVB 1UCBH 4TNVK 1L7IL 3BGFC 5CLWA 2PN5A 3R8QA 4M9PA 1IBGH 2PNDA 5I1HL 2UY4A 2F58H 4JANA 2DQCH 4AZHA 1F13A 4IMLB 2F7QA 4G5ZL 2HKHL 4XVTL 4NQSB 5ESAA 5FGBA 3L3KB 4KGLA 1U33A 4RIRA 4R90H 1FHDA 3QUMH 4OCWL 3MLUL 5IHUL 3QXUA 5C08A 2O5YH 1UD8A 2DQTL 3PZIA 1Q9OA 3CFBB 5I15H 1D9KD 2EIZA 5H8DA 3WDJA 2ZG1A 2O9RA 1BVLA 4XTRC 4HK3N 3CMOH 3QP3A 4DUXA 3WD4A 6CGTA 5F1SA 4EEEA 4XC3L 1WT5A 1TLKA 2VXTH 3IFNL 1AH1A 4UOJA 4N8VA 3AJ7A 3GIZL 5F1OB 2DYPD 2ERJC 2PW2A 2E7LA 5F1IA 2CBJA 5TDPB 1BQHA 1S7VB 4WI7A 5DJCA 4Q9RL 3BVWA 3NIFF 3FQNA 3ARGB 1X7QA 1L9MA 1OAXH 3D18A 3MV8A 3SCWA 5TF0A 5FDYA 4Z7UB 4YHZH 4YXKH 4AXNA 5I1AA 1G7JB 3ZJ7A 2CRIA 3KYOB 4BSWA 3OGRA 4J3VA 3GSQB 5D7SL 3MBEB 3EFDH 2P5EB 3ARRA 5EZOL 1QSFD 3IK2A 3DYOA 2DT3A 4U1GC 4LIQH 1W1TA 3QXVA 5C07D 5E8OB 4GAGL 4ZEPA 3BP4A 3NZ8B 4XAKE 4LCWD 4GRLD 3EO1A 4LLDB 4AM0A 2EE6A 5IBTL 1RHHB 4WTXA 4JFDA 5C0AD 2VR9A 3K8KA 4PJ9C 4PB9H 3RTQD 2D7QA 4XAWL 2NY3B 1BGAA 1R3KB 3WKMH 5JO5A 4JLRA 2GFBB 5CLTA 5E5RB 1QR1B 2AK4D 1MFAH 2ITCB 4L29A 4G8GB 5F88A 4JZNA 5E8PB 4NC2B 2VC2L 4FQQB 4P5MA 5GRXG 2PF6A 1P7QB 2ATPA 4X9BA 2VKWA 5IFHH 3K46A 4K8RC 1MNUL 2OSWA 1JYXA 2HVKA 4IS6B 2XN9E 2JJTC 5BW7C 4EXKA 3WIFB 3GSUA 1WF5A 4OCRH 4I48A 4UDTA 3UG5A 1ZS8B 3HMWL 1QHOA 5EU6D 4AQ1B 3SDAD 4WDIB 3UTZB 2VUYA 1ZVSB 4CW1B 3KYMA 5BZWA 4FNTA 3B9EA 1C7TA 5E5MB 4ONFH 4YE4L 3ZDZF 2PXYB 1R6VA 3RX7A 3QI9A 4NJAH 3WUWA 4WW1B 3MJ6A 1EDGA 5BXFB 4JHAL 1IT9H 1U95A 3MPCA 4RISH 4YJZL 1I9EA 3VGDA 1EFXA 4DQOL 3TONA 1NBVH 2AQ1A 1ORQB 5CUSL 4BQ4A 3OKOA 3QDGD 2AJZB 5LXGL 4H04A 5KSAC 3HZYB 2HT4D 1NPUA 5L6YL 4HS6A 5C0FA 5EU5A 3U48A 2YL6A 2QHLA 2IANB 4FZ8L 4UTBH 3RGVC 4J28A 5D7IF 4HMDA 1TQUA 3UXFA 2XPGA 1RHFA 3JZ7A 5DURB 1KCSL 4RGOH 3S97C 5JW4N 4PJAE 3N1QC 2EYRA 4FN0A 1Y6NR 5BRPA 3T2OA 2JFEX 2WHMA 4YHEA 4WUUD 3W27A 3MJ7B 2HG5A 1K6QH 4LSPH 3BP7B 2YPLE 1N7ML 2ZCLL 3I50L 5FCUL 3LS4H 1UZ6F 1A4JA 1OARH 3P30H 3V8OA 1FC2D 3A67L 4JO1L 3Q5TA 3W9DA 3MRFB 5FK9A 1ZANL 1BQUA 2DD8H 4Y19A 4Y4FC 1Q72L 3VJ6B 5C0RL 4OUUA 2HT3C 1RZKL 4GW5A 4Z5RA 1WO2A 4UQ9A 5T3ZE 5IMLB 5I16B 2CEQA 3NIDE 4MCYA 1DDHA 4RNRA 1WFNA 3IETA 4U6XB 5CD3B 3MFFB 5A3IC 1Q9WA 5MI0B 3P0VH 4UFJA 4KKAD 2NW2A 3BEWA 2NXYD 2BC4B 3SO5A 4ZDHA 5MHSE 3WMSA 1FL3A 4K3DL 4D8PA 4XC1H 3P4OB 1INDH 3MNZB 1A14H 4I9WE 4MD4B 3W0WB 1MCPL 2XKSA 4JGMA 1JGDA 4PTTA 4PP1C 3FRUB 3DX0A 4G6ML 3VXQB 2JB6B 1OGAA 2WINA 2J62A 3F65A 3EO0B 1F3JA 4OAWB 1F90H 4LSUL 5FA3B 4W5ZA 2ILLA 2CUHA 4UOW0 2GK0A 2IPTH 2I9TB 3HRZB 1XR8A 3FOLA 5KVEL 4ZXBD 4U1LA 2OTUA 2H8PB 3PHAA 3SN6N 4XBEL 5IKCB 4P4KD 1A6ZB 3ARBD 1T2XA 2VXVL 5E6YA 1JF5A 4J23A 1RZJL 1U8KB 1XT5A 3MFGB 5DUBA 1VKXA 1IGML 3MRDA 1RSFA 3SDDC 2FX8H 2JELH 4Y0GA 4P57A 4DW2H 4M24A 3GJFB 1MI5D 4G8FB 1JRHL 5BS0B 4P46D 3DUUA 2BXYA 4M8VA 2DQUH 1K85A 4NKOA 4LLMB 3L1OL 3VFOB 1EH9A 4LCYA 1DVFC 1FV1B 1U3HC 4Q74A 3RNKA 2W9DH 3UTPD 3NAAL 3PZVA 4YZFE 4LLQB 5CILL 1MIMH 3EJZD 4X6BB 2CETA 4PLKC 4CMHC 3HRPA 1VFFA 3WIIL 4ZO9A 5T1KD 3AHZA 1UKOA 4M5YL 2BCKB 3ES6A 3PZ9A 1W1YA 3ZKMC 3FFCE 3QUZC 1BG9A 2JE8A 1E4KA 3ARFC 3U7BA 2IPUK 3TO2A 2GDVA 4ODHH 5HPOA 4X7SH 3U79A 3W5NA 4BFBD 5DRZA 3TA3C 1C1EH 3SGJA 5B39A 5I2IB 4LMQE 1N6QL 2FH6A 2F8XC 5F7HA 4P23C 4X6DE 4WWID 2FL5B 1CFTA 1U8HA 2P8LA 2NT1A 4DGYL 4OZFA 3UTSA 1FNGB 4ZAKC 1ZT7B 3FO9A 4C56D 1ACYH 3WFDL 2IPKB 4P2RA 1FHLA 3SDYH 1BWWA 2J7LA 3QG7H 4WFHE 4ODWB 1NAKL 4C7FA 3WN5A 4R26L 2ZE0A 3TM6A 3WUGA 5F70A 2OSXA 1XGRB 1HINH 3CFJB 2E7MA 4BYHA 4LMQI 2AEPL 3EDJA 4JHWH 2J7HA 4ZUSA 2VCCA 4HX1B 1HDMA 4HKZB 5FYKD 4F8TA 4WO4D 4Y8AA 1L4IA 2J2ZA 2QPSA 1ZLVH 3KPPA 3CK0L 4JANB 4U1HA 3HCVA 3AZSA 1UZ1A 2HFGH 4NKMA 3LAFA 5D2NE 3LEVL 3OKNB 4MA8L 4OZHB 1GQJA 3OV6A 5ESAB 3SUWA 2HJKA 3H3PL 3W82A 4JDZA 4RIRB 2BFVH 3KLLA 1KB9K 2A9NH 1KV3A 3ARYA 5D2LF 5DLML 4UINL 4WW2F 5C08B 1RUPH 2X2YA 2YUZA 1Q9OB 3D85D 1XZ0A 4JHOA 4LKXA 4U6TA 2DI9A 2NY2B 1UH2A 3RU8H 3BCDA 1HXYB 5ICXA 5DJ6B 3RWJA 4XNXL 3HKFA 3EUUA 1XGQA 5DEFA 4PRHD 4X0KA 3ARED 3QEHB 4N8VB 4DKDC 4K9EH 3MLTA 4UOZA 1YMHA 2PW2B 2XN0A 5JBDA 4JKWA 1BQHB 3D39A 5DJCB 2IPUG 4HPOH 3TYGL 4G42A 2R29L 2IG2H 5F3BA 3FQNB 1HKLH 5BXTA 1X7QB 3D50A 1X6LA 3NABL 3D18B 3MV8B 4AY1A 3T65B 5I1AB 1D9KC 4AD5A 3DI3B 3CC5A 4BSWB 4HUVA 1DBJL 3F5JA 3CMGA 1LK3H 2VLRE 4QXTA 4U6VL 3GDBA 4DKEH 4HHAA 1MCWM 1X5FA 1TZHA 1HEZB 2MSPA 2GJXA 3BP4B 3RMEA 3EO1B 4AM0B 3OG6B 2J1KA 3UJTL 2KL6A 2XN9A 4RGNE 4Y1AE 1TUXA 1UEMA 5BOPA 3DYMA 3ULSA 1MCOL 2VLKB 1ZEAH 4JLRB 5JO5B 1JPFB 2WBJD 4QT5A 4MNJA 3I6LE 4TVSa 5MENE 4L29B 3GHBH 5F88B 1DR9A 4JZNB 2DQXA 3O6KH 4K23L 4LEXL 5E6IC 3CU7A 2EABA 3TT1L 1H3PL 5DDHA 2EYSA 1J18A 2ATPB 4JO2L 4FFZH 1AKJA 4Y4HB 5AWNH 3OLIA 2G60H 2XTLA 4OGZA 3D0LA 2HVKB 3UJIH 4PBXA 2QHRL 4NZDA 4URTB 2R2HA 3U9UA 3GMLA 4UDTB 5C70A 4OLVL 1HJWA 1RI8A 3KYMB 5BZWB 2J88L 2VDMH 2XTJD 3RTQC 3GTNA 1J1PH 3QI9B 3WUWB 2PO6A 1ZK9A 4F15C 4LIQE 1U8LA 4PJAA 5GJTH 5F44A 2IBGA 1JNHA 1QLRB 1EFXB 5EORH 1JAKA 2XWBA 3OKOB 2YPLA 1P84K 1KCRH 5F7WC 1NFDE 2DICA 3KPMA 3QJHB 2BNRB 4HS6B 5EU5B 5IVOA 5C0FB 5GRZA 4TXEA 4NRXA 4QHMA 2IXUA 4M7ZB 3EZJB 3GMOA 3C60D 2R0LH 3PHSA 4HC1H 4JQXA 1N5YL 2B0SL 3SDAC 3BUPA 2EYRB 1OPGH 4YNYA 2CPUA 2CKBA 1CL7I 1TA3A 3IF1B 1JZ2A 2WSKA 2FNBA 2ORBH 4PD4J 1GVYA 3JXAA 3PXJA 1UA3A 1MQPA 4RSVA 3W9DB 5BMFH 5FK9B 4HLZG 2XFXB 4Y19B 3GEWB 4C57C 3RIFK 4OSUL 5I73B 1QNZL 4GW5B 4Z5RB 2B1AL 4F80A 1DDHB 4RNRB 3CFEB 4JN1L 2XZZA 1Q9WB 2GY7B 5HYIA 2NW2B 3BEWB 3DI2B 4LHUB 4ZDHB 4XCFH 1CF8H 1FL3B 4D8PB 4U31A 1JGDB 4PTTB 1DSFH 4ZO8A 2WINB 5HDOA 1YEGL 3RPKA 2LU7A 3Q6GL 3APGA 3DWTA 1TJGH 1YQ2A 1DUYB 3W37A 4GXUN 3VXPA 2GK0B 3GHEL 1XR8B 3CX5K 1UH4A 3FOLB 5AZEL 4U1LB 4PMXA 1H5BA 2OTUB 4MNGE 1LWJA 3KYKL 2CLRA 5AYBA 2ICWI 5AAMA 1CR9L 2E40A 4X6EA 3VH8G 4BUGA 1M03A 4TNWK 4AYFA 4KKAC 5DUBB 3UTTA 3VFNB 2NXYC 3MRDB 4P57B 4MD5A 4MJ5A 3HPJA 4WWKD 5IK3A 1QUNA 3DUUB 4MXWH 4Z6AT 3OKLA 5KOVC 4NKOB 2OK0H 4L1HA 3FFCA 5SWSA 2WWKO 3PWUA 1IM9A 3I3BA 4I3GA 4R4FH 3A6OA 2IC2A 2P4AB 3CXHK 2XHYA 4YH6A 5KW9L 4OD1H 5D96B 2XM2A 1MFVA 3BPOB 1I1CA 4YXLL 4YC2C 2F8QA 5E2UH 3RKDC 4E9LA 3DV4A 2EDYA 4FQLL 4P4KC 3ARBC 3ES6B 3EMZA 1KWGA 4P49A 3G6JE 4K2UH 3CAFA 5I2UA 4D6JA 4R6UA 1E0VA 1JNNL 1FORH 4Y4KD 1TQCC 4W4OA 5A94A 1Q0YL 2PTTA 3DTXA 4OCXH 1CDGA 2WUCL 4P46C 3TO2B 4M3JA 3RVUC 4H5SA 3RA7L 5DRZB 4MA1B 1AGEA 4OI9A 3O81A 4KK8D 3LKNA 1AMYA 4MJID 5B39B 1H0GA 5J6GA 3ZJKA 1UB5A 2BHZA 3MYZA 4BSJA 5I6SA 2CD0A 1CFTB 1U41A 1U8HB 2P8LB 4LNVA 4K68A 1DE4A 4OZFB 4DEPC 1JNLH 1WK0A 3UTSB 4OI7A 1NGQH 3ARDB 3FO9B 2RBLA 1IAIM 4ZTPH 5EU7E 4ZS7L 2FEEI 4KK9D 5LWYL 4YXHL 4YHYB 2WQ8A 3EYUH 4ELMF 1BFNA 5ICYA 5IHBA 1LO0L 3WN5B 4QXGL 2ZX6A 4TULH 4D9LL 4I5BA 1JGUH 4ZUSB 1C8PA 5JBFA 3DMMB 1HDMB 1YEFL 5EIIB 3KPPB 5GS1C 4U1HB 3HCVB 1WV7T 5LGHL 2F7OA 4NKMB 3JBG7 1UA6H 2A6JA 4JFED 1KEGL 4RE2A 1S7UA 2HJKB 3WO3B 1WPCA 4JDZB 4UDUA 4FHBD 4EDXA 2FX9H 4HW6A 3VG0L 5CQ1A 1EUTA 1V7MH 5C0EB 5C92A 1GOIA 1T89A 4DUWA 5CKGA 5GZNC 43CAA 3OKEA 3BCFA 4AL8L 4LKXB 5KVFL 2F5AL 3AM8C 1QPPA 1U58A 4PJ9A 1YEHL 1Q8MA 5FXCH 3IGAB 3KR3H 1ZA3A 4WO4C 2QSCH 1FSKC 3FB5A 3G5ZA 3VIPA 3VTRA 5ICXB 2OL3A 4NWTL 3RWJB 2ZWLT 4AH2A 2K9UA 1AFVL 4U0RC 3ARUA 4LEOA 3STLB 1XGQB 5DEFB 4X0KB 2OTWB 4XPGL 5TF1L 2VLRA 3MLTB 2CO7B 1J9YA 1YMHB 3QUMA 5MERB 2Z91B 1GHRA 2XVPA 2LAAA 1NLBL 1F8TL 1T2QH 1R3IL 2WMPA 5DC4B 2E8ZA 4G42B 5BW7A 4Q58C 5F3BB 3JVGA 1GC1C 3P0GB 4Y1AA 2Y36H 4BS0A 4TVPD 1B0RA 4Z0XA 3BXWA 3CC5B 4KRPD 3T04D 5MENA 4D6DA 5D6CA 4XPFH 4NJ9H 3N18A 1KIUA 4QXTB 1G84A 1F3DJ 4UT7L 1TZHB 1QSFE 4PRNA 4U5KA 5D6DC 5E00A 2GJXB 5CHNB 5A6LA 4AD0A 4XUYA 3JSSA 3AREC 3WH6A 2XN9B 2Y06L 3ZM8A 1DWJM 5KSAA 3ULSB 2IUZA 4QT5B 1CGUA 3JWDL 4XP9L 2D31A 2R39A 1I1WA 3AIEA 5DJAA 5DDHB 2EYSB 4KV5F 1AKJB 1RUQL 1A7RL 3D0LB 8FABA 1CNVA 3U9UB 1XR9A 3GMLB 3P11L 3CUJA 4NZFA 1UQYA 3PZOA 1NFDA 2Y7QA 2EH8L 3LXCA 3KPSD 4HGWA 3GJEB 3RY6C 1A5FH 1TTFA 2E9LA 5CKAA 2J5LB 1OAKH 3B3IA 2DJSA 4HDIA 1H15B 3GYCA 2OMNA 2Z8WC 2PO6B 2WBJC 1U8LB 4PJAB 1KIQA 2FHFA 4LLVA 3EYVA 5I1GL 1JNHB 2A6KB 4EUPG 2EH7H 1H41A 2XWBB 1XH3A 2YPLB 4G9FE 4HUWA 4UCFA 3KPMB 1V6YA 2KH2B 3MCLL 1YPZA 1OP5K 3CCHA 1FYTE 4NRXB 1NBYB 4YHMH 4BZ1H 3U30B 4JZJC 4QHMB 3KHOA 2YD1A 3GMOB 3SKMB 5E08H 1P9MC 1HJUA 1MPAL 2NTSP 1C93A 4YNYB 2CKBB 5IQ7L 2XTJC 1TA3B 4GINA 3LPFA 4Z7NF 4YDIH 4XNYH 2BS9A 1J86A 2X1WL 5IT2L 1PGRB 2ICWA 1GGUA 6TAAA 5DMGD 1UR9A 4OLWL 5E99L 1QHZA 3GMQA 4FG6C 2AJXL 1J1XH 1ZLSL 4IJ3B 1ZGLM 3WIHL 3X17A 2EE3A 1I8LA 1WDRA 2X05A 3LKQA 4L8DA 4PB0H 2WM0A 3C60C 4RFEB 4ZG1A 2Y8KA 4HWUA 3LCYA 4B5EA 2A6DB 3ZKND 4PS4H 4Y88A 1S8DA 3UROR 4MQXD 1QNQA 1G9MH 2ZNWA 4TQEL 4QXUL 2B2XH 5DJ2B 5F1NA 1KPUB 4B16A 4TSAL 2AQ2A 3WQ5A 1JDCA 2DM2A 5L88L 4J27A 5BJTA 1UYWH 5D93C 3LDBC 5ID1A 2W62A 1ZSDA 2P1YA 3VI4E 5FCZA 3QUZA 4HWNA 3VXPB 2LTQB 3RDTD 1PG7X 4LAQL 4EUPH 4PUDA 3TH4T 3WMCA 4FFYH 3K4DA 2D3VA 4M6NL 5FDWA 3FAWA 1KQYA 1TVNA 4KFZC 4PRIE 4P7LA 1TJHL 1MQ8A 1BJMA 2C4FT 4JKLA 4X6EB 3HPLA 2FEDD 4KHXL 3TA3A 1XGYH 3OJMB 3UTTB 3SCMD 5CZKA 3U7WL 5ACZA 2A3AA 1UHVA 2Y9RT 4MD5B 2OLDA 4MJ5B 3HPJB 5D1ZA 3BZEA 5IK3B 1XD0A 3P4MA 4I3SH 3OKLB 4PPTA 5A95A 4LLAA 4HIHA 3SKNA 1IAOA 5FYJL 2C3XA 4GMTH 3PNWB 3FFCB 1OT1A 3RWDB 4ZAKA 3GMPA 5DVLA 4M1GL 1HQ4A 5JW5A 4N9GA 4WEMB 3N1MC 3MMEA 4MQ7A 4UFHA 3QUYD 1KC5H 2OP4H 5LBSL 3DSFL 3Q5YA 2VCAA 5IVXE 3UTPE 4P5TA 4NKQB 3TTSA 1UC6A 3DV4B 1NDMA 1Y6KR 4X6DB 4X7CC 2NY5H 4JM4H 3ARVA 3UESA 2F1AA 2VIRA 3RL2B 2P7TA 3IDJB 3EYPA 1RIVH 4WWKC 3DTXB 5DC9B 4L4OA 4HT1L 5B3JF 3VSUA 3DO7A 4OZ4A 3G6DL 2ZUMA 3KPRE 3BD3A 5HY9A 4RWHA 4X5XB 2ZOKA 3LKNB 1DLFL 2YD7A 3H0TA 1EGJH 4KROC 5J6GB 1UB5B 3TJEH 1TFHA 4Z7VA 4X9YA 1BBJA 4KY1H 4NP4L 3WBDA 4J3UA 3IRPX 1DE4B 2VLMD 1M05A 3KXFD 3UX9B 1MFBH 5IFAH 1INEL 1R5WA 2NX5E 5E8DL 3D87B 4OLUH 2JK5A 4FP8H 5ICYB 5D2NB 3ULUF 1FH5L 4Y4KC 4LPUA 1ZS2A 5GGSY 2Y07H 4EQ3A 1HKJA 3SCUA 3SIMA 4L8SC 2X9XA 3GSNL 4I5BB 4K3JH 1PQZA 1HTYA 4V2XA 3BW9A 3CPUA 2XI9A 4KK8C 4OF0A 5C8JA 4OLXH 4R4ND 3CNKA 2QQNL 4I3RH 4MNHA 1LO4H 4XVSL 5L9DL 1PZ5A 3MSDA 1TZGL 4MMZC 3BJ91 5DD3H 2D7OA 2YSSA 1HYRC 1OP5H 4LPXA 2EDXA 1F4YL 1R3JA 4QO1A 4K7FA 2A6JB 4FNLL 2VYRE 1NH6A 3L95A 3QR2A 1S7UB 1EIBA 4OM1L 1DQMH 4KK9C 4UDUB 2ZSVA 4EDXB 4Y5VC 4KQ4H 4HU0A 2GSGA 1DQQA 4B3LA 43CAB 1H11A 2X9WA 5DGRA 4JFFD 3TN0D 3OKEB 4CMMA 5C0CD 1FQ9C 3IAQA 4C55A 1HZHL 2R1WA 5TGBA 1B2WL 3NGBB 4GS7B 2DYPA 4XNMA 1ZA3B 4JO3H 1R7AA 3QUXB 1QLEL 3GNRA 3EHBD 4O02L 3G5ZB 4GW4A 2YOCA 3MUGA 3DURA 4Z7QF 1II4E 5C0BD 4AH2B 4LEOB 2NY6C 4YX2L 3IFLL 2VLRB 1KG0A 3QUMB 4RMTA 5GJSL 2R69H 3FL7A 4H0IA 1AXTH 1QSFA 2NY1D 1ZLUK 3BD4A 4OGYH 5FO8B 5AYUL 3T4AA 4RGNB 4XVJL 4Y1AB 5E5UB 3SJVE 5JNYA 5HVFB 1B0RB 2VLJD 4I0PB 4GRLA 4LCWA 4Z0XB 1HIMH 1FFRA 4XWOC 5C0AA 5AYQA 5CJXC 1WFTA 3RTQA 5MENB 2FSEA 5D6CB 2WLYA 1V7NL 12E8L 4UFMA 2C4XA 5DI8A 1UD2A 4L4JA 1IKFH 4AWEA 4L1DA 5E00B 3AYSA 1NFIA 4P0DA 1T1WB 3A47A 1HWHB 1UACL 3DIFA 4LVHC 3ZE2E 4GO9A 3W29A 1C7SA 2CPCA 2G41A 1JZ5A 4W85A 5DMKA 3KE0A 5JMRA 1K8DB 1MCIA 2D31B 5EU6A 4Y8DC 5FV2A 1KELL 5DJAB 5I17A 1T7ZA 1FCGA 1KB5L 1YNKL 4KRPC 4PJFE 4M82A 5LA2A 5ALBH 1T03H 4HKXA 8FABB 3SKOA 2AEQH 2MJWA 2YUVA 4G7VH 1CGTA 1NWTA 3CZJA 1XR9B 1G1YA 2ZUXA 4G9FA 3TIDA 1MFEL 5LA0A 1NFDB 2Y7QB 4FMVA 1A9EA 4HGWB 4KUZH 4TUOA 3GXFA 3QEGL 3WXWL 1FYTA 3VW3H 3QR3A 4PY8I 4OBRA 3BKMH 3QBTB 1S7TA 3BAXA 3G5XA 3B3IB 4HDIB 5L8JB 3GRWH 2H2SD 3QIWD 2FYVA 4D6HA 1MQRA 2HN7A 4LLVB 3EYVB 3HTLX 1HT6A 4HOZA 1ISWA 1RVFL 2BRRL 4NWUH 4WI6A 4ZO6A 1BBDL 1XH3B 5DUMH 4WUUA 5EUOF 4PP2A 3DLQR 3CCHB 3T09A 1ZT1A 3NA9H 3KL0A 3OAUL 3KS0H 4Z0BH 2WZPD 3QSKB 3S34H 3V7MA 2YBTA 3WNOA 1F42A 4LVEA 1T0PB 3VIGA 2CLVA 6FABL 3SEPA 3SGKA 4OCSH 2PW1B 3RY5A 1FBIH 2JF6A 1MJ8L 3MRIB 5IMOA 3ARXA 1J0ZA 2E9WA 4POYA 4JM2D 5ADPL 1CTNA 3I75A 2ICWB 3A5VA 3E0GA 5EZJA 1VFMA 3ZTNL 2CDGB 1UADC 3HNTL 1U8OA 2ZNXA 4TOYH 3NIGE 3GMQB 1NMBL 2XKNA 4TPRH 3MR9A 4Z7OE 4ZQKA 5MP6H 4JCLA 2DDQH 3FAXA 4XZUA 4HC1A 4KVNH 1RZ7H 3BMWA 4L8DB 5SX4H 3LRGA 1BQLH 5KAQG 1I3VA 5FOJA 1E4NA 2FATH 4YHIA 2OCFD 1EEQA 4LP5A 5E9DE 3VFVA 1S8DB 1U36A 2V9RA 3T0AA 4HUMB 4XWGL 5BCAA 4ZXBA 4K7PL 3MOBL 4XVTH 4IDLA 5I18H 5BJTB 4P4KA 2J4WL 4OV6F 5ID1B 4OJFL 1UKPA 3AB0C 5KTEL 3MC0A 1FH7A 5DT5A 4N8CL 5HI5D 1NCDL 3HE6D 1NUGA 1WUNT 3TVMD 3RY4A 2VZ1A 2PBGA 2X10A 3T1WA 1YJDH 3LKOA 1GOFA 2I27N 3HPLB 2V7HA 5IVXA 3ZKNC 5H35B 4WFGD 5ACZB 4FQJL 4RFOH 1FNEA 2R2EA 2XA8L 4MQXC 2H26A 5D1ZB 3BZEB 4OIIH 3P4MB 2R4RH 4KI5F 4S3JA 4LOUD 5T1KA 1ZLUH 3SKNB 5FHAH 5I1CH 1B0WA 1RIHH 3WFBH 1HQ4B 8CGTA 4N9GB 4QHUB 4GAFB 3TBYA 1MY5A 3MMEB 4MQ7B 4XI5D 1MHPH 2R15A 3KWXA 1YMMD 3RDTC 4P5TB 1DWGM 1E70M 2DSUA 3KPRA 4XRCA 2X4SA 2NW0A 4WFFD 1JGVL 3TEUA 1RZFL 3PQYE 3QQ3A 1SYSA 2L4OA 5BO1L 1JTOA 4UFKA 2DBLL 1RUKL 1R75A 2FEDC 1FH8A 3NYDA 1F4XL 4U3CA 3SCMC 4M6MH 2VIRB 5J6HB 3S6TA 3LZFL 2D0GA 4IRJA 3NSMA 4GAGH 3IXTA 5FGCB 3VGGA 3POHA 5C6TH 3DO7B 1YYML 3G6MA 2H3NA 2XVKA 2NX5A 5IBTH 4PJHE 4JFOB 1F4AA 1GIGL 3LQAC 5BOZG 5HY9B 4C56A 4AZCB 4B53A 2ZOKB 4QRPE 4ZS6D 3H0TB 4TUFA 4YHLH 3RKPA 2JF7A 2YLLA 3QUYC 4AW7A 4GBXD 1BBJB 4R0LA 1O6IA 1MWAL 2W60A 3B4NA 4MJIE 1B0GA 4HWBH 3SPVA 1AO7D 4PTVA 1SYVB 1TMCB 1GOMA 1M05B 1IC1A 4RMUA 4GOSA 2LVCA 3HR6A 2IJ0C 4W4NA 3QHZL 7CGTA 4NQDE 2J8UE 5F8QC 2IGFH 1W3HA 3HMWH 1MJUL 4N0FA 1T21A 2C0HA 5F6IB 4PJEF 1DBKH 3ZYJA 1NC2D 3BW9B 3QDHA 3VWKA 2D1ZA 4MB5A 3INUL 4PJXF 1ZJBA 1W3LA 5C8JB 5J1AA 1E0OB 1H3XA 2A3BA 1I4FB 4LSSH 4MNHB 3UR8A 1PZ5B 3DRQA 5F1KC 2QMKA 2YSSB 4QTIH 2BMKA 4G6AD 1R3JB 3WV0A 4DK6A 3D85A 4DQOH 4K7FB 1HCVA 1JXJA 1EUUA 2EEXA 1U6AL 2CGRL 3L95B 2RFXA 2ICWJ 1X3DA 2ZSVB 5BVPH 2V2TA 2APVA 1H5VA 5JOFA 3VWJD 3CDGA 4JCMA 2GSGB 3K2UL 1DQQB 1KCSH 3MUJA 1R5IA 4X4MA 1UXWA 2VURA 3AMLA 2ZUSA 1FNSL 4CMMB 1BFOA 2Z31C 4PRHA 4URIA 5T33L 3AREA 5EIQA 5TGBB 3HNVL 5DFVD 5GGTA 3NACL 2DYPB 3TZVD 3WXVL 2O5ZL 5FECB 2VRKA 4R4NC 4MLSA 1GNXA 3SDCD 3I50H 5FCUH 3SJVA 2AI0L 3MUGB 2EDTA 3OAZK 1WSST 3DURB 1T4KA 3F7PC 5JXEA 4F8QA 1WEJL 4UI2A 1CFQA 4NZCA 4DO5A 4LCUA 4GSDH 3S35X 1Q72H 2PWEA 3ZDXF 1KG0B 4ACZA 1T22A 1K3IA 3L5IA 1QSFB 4NQCE 1KR1A 4RGMB 5EB9A 2PWFA 2GT9A 3T4AB 2DL9A 3UTQA 5B38G 3BE1H 4WCYL 4M48H 1NWUA 3TN0C 4LCWB 4M5ZL 4GRLB 5TE4L 4M9OA 4P2QE 2E8YA 4X8JA 3RY6A 2HLAA 5C0AB 3MXVH 3TC9A 1X4ZA 2FSEB 1B30A 4JEGB 4JHZA 3QPXL 2X4NA 2X09A 3EHBC 5DI8B 2R1YA 5A8OA 3RWHA 1NGZA 1NFIB 4N0UE 4PJFA 2V7NA 4L9LC 5HHXL 1J1OL 3F62A 3ZKSD 5IEHB 1M7IA 1EOKA 5DVKA 1A7OH 5J11C 3DIFB 1RZIA 1LO2L 4P2OD 5IOPA 4NRZB 1URLA 1ZJAA 5KVEH 3CTTA 1MEXH 4MS8C 2DS4A 1SMDA 1KXQE 3MRBA 5DMKB 3F7QA 2WC4A 4JZJA 4Z2GA 1P9MA 1GPOH 3GXIA 3B5HA 5D5ME 5I17B 4HF5L 3IDXL 1E0XA 5SWZE 2YJQA 4HKXB 3SOBL 2AK1H 3SKOB 5LKNA 3LRHA 4ZTOH 1V0KA 5J1SC 2DI7A 5F7FA 4FQ1H 4G9FB 1CK0L 1FJ1A 3EIFA 3TIDB 3VOCA 1A9EB 4TUOB 4JPKL 4F58H 1FYTB 4FTVE 3BEVA 3G5XB 3LRSA 3U7VA 2UY7A 2ZXAA 1AIFA 1K2DA 4M5YH 4AY0A 1UFUA 1CYGA 3TBWA 4WU5A 4WUKL 4KTDL 4NCC1 1ISYA 2VX5A 5DD0H 4QCFA 5EB8A 2HN7B 4H0GA 3HG2A 2WVSA 2MCPL 3MRMB 1Z32X 4E42A 4J4PC 3BWUC 3AIWA 4PP2B 4IPNB 3HC3H 3U9PH 1NL0H 1ZT1B 2CRYA 2R4SL 4YDKH 1CLCA 4KTEH 4LCIH 4G3YH 1PG7H 4MX7B 5HHQB 4DFIA 3EJQA 3S7GA 1MOEA 2CLVB 3KGRA 2VO5A 2VDRH 2V5MA 5BV7H 1N6QH 1SJVA 4G8IA 4KQ3L 4M4RA 5IMOB 1IC5L 3S5LG 3UYPA 3NFNA 3VFPA 1OD7A 2IFFL 4QNPF 1W9PA 1X5KA 1OT2A 3QIWC 1UR8A 5E9DA 3MRNA 3I75B 1W0VA 3WFDH 5EZJB 4W5UA 3O0RH 3D9AH 4PCTA 1FZJA 1U8OB 4JY5L 15C8L 2COQA 4R7DA 4EIZC 2XKNB 1PFCA 5C3TA 3LEYH 2EDBA 3MR9B 3THDA 4ZQKB 2BJMH 4XZUB 3FT4A 3CH1B 1RZJC 1A1MB 1G5AA 3BH8B 4J1UB 4YHIB 1RZ8B 2OI9B 5GGQH 3VFVB 1W72H 4R4BA 2D4FA 1IC7H 4APQB 4ZXBB 1QBAA 3WNNA 1H0IA 1HL9A 3T08A 3HMXL 4MA8H 1PYWB 4P5KA 4JM2C 4XBPA 5D8JH 1EJOH 4MDIA 2Q6WA 4HEME 4U1SB 1HWWA 2DGAA 4JDTL 5EU7C 1QZ1A 5IB2A 2VTFA 2W59A 5KSVA 4XMLL 1TTGA 1BFVL 4YHOL 1WP6A 2M2DA 2WIIA 3GBNH 3LKOB 5DQJA 5KS9F 1OM0A 3GXTA 5IVXB 3JTTA 2W07A 4QLRA 1FNEB 2R2EB 4H88H 1MJ7L 3E8UH 2H26B 3MLPA 3PQYA 3CUPA 2HVMA 5T1KB 3MA9H 3OHXB 1NLDL 3T0XA 5IM7A 43C9A 1IGFH 5LCVH 5DRXA 2N56A 3TBYB 1NAML 3CHFA 2XG9A 3KLKA 3HE6C 4Y4KA 2VDLL 3NABH 2OW6A 4BCEA 3JTSA 4PJHA 3KPRB 1RULL 5HDLA 1J10A 5F9JA 2X4SB 4L8SA 5I76A 2ESCA 3NMEA 3OLEA 2ADJA 4QRPA 1QBML 1SYSB 1W9UA 3GBLA 2PB1A 2FBJL 2CO6B 5DWUL 4IM4A 4MJIA 3NCFB 5SX4I 3QEQD 4IRJB 5F89A 5JW3L 3IXTB 4MAUL 3VRLF 4LOUC 1YYLH 1MIEH 1HH6A 3I2CL 1I1YA 2H3NB 2HRLA 2J74A 2NX5B 2YMXL 3PTKA 5E4EC 1S5IL 1I3GL 4C56B 5LGJB 3BGMA 2J8UA 3IDNA 4NC1C 1PX4A 4LDEB 4XI5C 2P49B 4Y5VA 2YFNA 4R0LB 2W60B 3LD8B 3OIHA 1B0GB 4EQ2A 3UPRA 1ODAA 4BK4A 5CXPA 2FR4A 2FGWH 3SPVB 1S3KL 4JN2A 4DVRL 1K4DA 1K3ZA 3E6HA 2PWDA 2Q1EA 2J77A 3QHMA 2UY6A 1I1AD 3HI1B 3MRPA 4W81A 5CPSA 1YPZF 1Z3GH 1KT2A 4PGJA 2VKXA 3L3IB 4OGAD 4X9IA 4N0FB 1T21B 3VNZA 3SO3C 2YN3A 4GT7A 4HCRL 2UY3A 4DN3L 2YK1H 4JFEA 1TQBB 3VWKB 1A3RL 3JV0A 1XF3A 5I6XB 2V5CA 3O4OC 1DANT 4YPJA 2BVDA 3ZHKA 4GBXC 3LN5A 3DRQB 1XIWA 4R97B 1O7AA 1NGPH 1IJ9A 2APWA 2BMKB 4RQQA 3D85B 5IUSA 3MMDA 3RM4A 5GZOD 3UEQA 2J7FA 4LVOB 3B5TA 2YBUA 3UPAA 2DJUA 4P99A 1LP9E 2RFXB 4PLOB 4PJ7E 2V2TB 3MXWL 2C9AA 4U1MA 5JOFB 4NN7C 3CX2A 2M1KA 2EC9U 4PSRA 4ZFMA 3ELAT 3ULVL 1R5IB 1UXWB 3PZQA 1JWUA 2VH5L 3IDYB 4JGUA 3IU4H 4D6FA 1JZ8A 4MNMA 1W1PA 4XPTH 2NY0D 3SJVB 1BYBA 4NNXA 4N0RA 2WAHA 3LH2H 1AD0A 1T4KB 1UJ3C 2VWEC 5CZXD 4W87A 2IQAA 2XZAH 4G6AC 3V9FA 1K5NB 3MX0A 5JPNA 2XKUA 4W86A 5HNNA 2OR9H 3RBSA 1HIZA 1GZJA 4ACZB 3SCVA 3D3VD 2R2CA 1Q94A 4UV4L 5FYJU 2GT9B 1GH7A 3UTQB 1ZU8A 1NMCB 1QI0A 1E4XL 3N1GC 2Y8VA 1IEHA 3VNYA 2B4CH 1QFUH 3O6LH 1MHHA 4X8JB 5C2BL 3RZWA 2HLAB 4QOKE 3CFKA 3LN4A 4M61B 3VXRE 1KXQA 4UOQA 5DFVC 4PMOA 2IMNA 4UQBA 4PSPA 2VLJE 3T2NL 2X4NB 3SDCC 2R1YB 4XXCC 1YEGH 4I0KA 1NGZB 4NN6B 4PJFB 1LE5A 2V7NB 1MXDA 1FVCB 1C91A 1M7IB 1N64L 3CSPA 3BGAA 1RZIB 3U5YA 2X6MA 3S36X 2NY7L 4TUJB 2WK2A 2MHAA 2CMRL 4GG6E 2KUTA 1J01A 3MRBB 5FCSH 4BFGA 1J8HD 1TIUA 4NOFA 1OD9A 4FTVA 1VFBA 1MWOA 5D1XD 1JVKA 2DQHH 4Q6YA 2NYYC 2V5YA 3MTRA 4CN6A 1D5MA 4OZIF 4UNIA 4ONHB 1OP3H 3VILA 1FJ1B 5LG1A 2BRQA 4AIEA 2IQ9H 3SCOA 4PREB 5SX5K 3O41A 3BEVB 2YKKA 5GGRY 5D8WA 4P2OC 3WNKA 3LRSB 1KGXA 1K2DB 5ESQA 3VXMD 4Z7VF 4JFYA 4U5IA 1F11A 2G3NA 3MLZL 4QRQA 1G7PA 2NTFA 3SCSA 5DMJB 5GIRB 3N9KA 3RNQA 1AXSA 3AC0A 3FKUS 4PR5A 4E42B 4BQ6A 1FIGL 3BT2H 5IW3A 3EYSL 4H8WH 5IV2A 2WUCH 2EQDA 4D2NA 4M7KL 4OGXH 2FD6H 1H0DA 1LO3L 4M00A 1I7TB 4I13B 4KJYB 1NJ9A 5DQ9A 2BVPA 1T1ZA 3HZVA 4G8IB 5FYJD 3TESA 1OGSA 1E6XM 4FQ2H 2WKGA 2R1XB 5F7YC 3V2AR 2DQGH 4MMXC 3C6LD 4JG0L 3VFPB 1IGIL 2F53D 2CJUH 2ZOLA 4YWGL 2MCG1 5E9DB 3MRNB 1BWMA 1W0VB 5KSBF 3T0DA 3ALFA 5KZCB 2NLJA 4YXHH 1WZAA 1FZJB 5EO0A 4R7DB 3P40A 1ZHBA 2M8XA 4NZRL 4WNQA 1EBPA 4XPAL 5J3HD 2DQIH 3FT4B 2PYFA 2P46B 4IUGA 4N0YL 1P6FA 2XZQH 5CZVL 1HHHB 3ZE0F 2CIPA 4OLZL 3LEXA 5HHMD 3BAKA 1KENH 1B6UA 3SHSA 4R4BB 4XMKL 3VFWA 1R24A 3RDTA 4HKJA 5IB3A 4F9PC 4JKKA 4JFSA 5DR5H 4P5KB 3O9WD 3L9RA 1BD2E 3LXAA 5D4YA 4LBEA 4MDIB 1OTSD 5EUKA 3D48R 2Q6WB 4CVWA 5CJOL 4LSDA 4M43L 4RFNB 5IB2B 3QHFL 5HHNA 5KSVB 5LA1A 2IALB 2HTKD 3QXTA 5IG7A 4K8RL 4XX1G 3RHWK 2G3IA 3GZAA 4F9JA 4B15A 2WIIB 5DQJB 1T0NA 3BMVA 1WGOA 2B8OT 5TDNA 3SE9H 3VIMA 4JB9L 3ZO9A 3I6KA 2CDFA 5L0QB 1T2JA 2UZYB 3QUYA 2A1WH 3PQYB 3F7RA 3CUPB 4NWTH 3TCLA 2EPOA 5JHLH 4PY8J 4O2EA 3C9NA 2OM5A 5DRXB 2X2IA 1YY8A 3MLWH 3G9AB 3GK8L 2R9HC 1FFQA 5A6BD 4WTWA 5ABEA 3WDHA 1FVDB 1GQLA 1NLBH 4EUPB 1X6NA 3MZTA 5ISZE 1O7DC 2FJGA 4U33A 4CU7A 5DTFA 3JTSB 4PJHB 5F9JB 2P45B 5I76B 4PTXA 5EG6C 2ADJB 1ZHNB 4QRPB 2YA2A 5T3XH 3PIQA 4CUCA 4MJIB 4DWSD 1AVAA 1FG2A 4UAOC 4UT7H 5F89B 5C0JA 1C5DA 1OAQH 1HH6B 1I1YB 2NCMA 3JUYA 3P0YL 3AS3A 1A6UH 3RI5K 3MRQA 5HVWA 5EO9A 2Y06H 5JR1L 2X4OA 3KXFA 4JFZH 3BGMB 2J8UB 2UVEA 3IDNB 4LFHD 4OF7A 3VGFA 1H3VA 4JKPH 3ZO0A 4Y5VB 4BQ9A 1DN0A 3QO1A 4BM7A 4JFXA 2XUCA 4G6KH 2WKLA 3UPRB 4ODTL 5DJYA 2FR4B 1OAYL 4JN2B 4FZEL 2YFOA 2FGZA 1W91A 3A3HA 1K4DB 1DQJA 2ZG2A 3E6HB 1A7RH 5HVGB 1JD9A 1CGWA 1DBBH 2ZUNA 3I9GL 4JRYD 5SX5H 5F9AC 3MRPB 3S35H 1KT2B 1BM3L 3NIFE 5IFPA 4KJQC 1G7LA 5FV1L 5GISH 4DUVA 4PFEA 1MF2H 3CVIL 2WBGA 4JFEB 4RWYL 2VB5A 4O2CA 5FUCC 4HG4J 2ZX7A 1XF3B 2VN7A 1JPGA 5T5FH 3GUTA 2IAMA 4HWEH 1I85A 5IIEB 4XP6L 3LN5B 4F57L 4XNUH 2EE9A 1XIWB 4HWBA 5JHDD 1NOWA 1MW3A 4AZ6A 4AIOA 3OKDA 4NNYA 3W9EA 2BNQE 3THCA 5FUOL 5HHPA 4S1QH 5C7XH 4P7NA 1EO5A 1EO7A 2D7NA 4U1MB 1E5NA 3ZKXC 1I1AC 1A21A 3RPMA 3QXWA 4OLEA 4OGAC 3FCTA 1QRNE 3ZLQC 1JHLL 5HDQH 3WF3A 3BAWA 4NQCB 4POUB 1GCFA 2BV9A 4J7RA 2WHLA 3MUZ1 3PE9A 3QRGH 5GSRA 5ERWA 4FQCH 4I0CC 2J6EL 5D9SB 2XA3A 5EBGA 4NNXB 4OF6A 1WZ1H 4ZSOE 1VPOL 4P2QB 3PP3K 2O93L 3N06B 1AD0B 3VXRA 3EJPA 2IQAB 1BIHA 1WKYA 5I1JL 5L8KB 5I30H 5E0CA 5JPNB 5GZOC 2VLJA 2AJXH 1PSKL 2DTMH 4L5FL 3JWDC 3D2UD 1BVKB 4YEEA 1A2YA 5IVNA 2VDKH 1R33A 1FO0L 1C16A 1Q94B 3ZDZE 2JJSA 2LABA 4JVUA 5A8QA 5B4MD 1ZTXH 2ZKHL 1SEQH 1MHHB 1MJJA 2WCGA 4GG6A 2W9EL 1NCAH 3CFKB 3LN4B 4HZ8A 4WV1C 5I75C 2PCPA 2NY0C 3IRZA 1FNHA 4PYGA 4S0SD 3MJ8A 4WTZA 1A6WL 1JF1A 3QCTL 5D7IE 5CZXC 5AYIA 1LE5B 3CHDA 5GGVL 1XRVA 1E4WL 3UYRL 3Q48A 2X4QA 3H9SE 1HXMA 4LAQH 1RUAL 2MHAB 4ZFZA 3GJFK 4LPCA 1A3LL 1TJHH 4FTVB 1J0HA 1VFBB 2HMID 4LAJH 4KHXH 1UZ6E 3VA2C 1T7YA 2F7RA 4LSQL 3H42H 1QFWL 3AAZB 3QDJD 3OPZL 1DLHA 5A6KA 3GKWH 5HVHB 1CFNA 1FFNA 3E2HC 4WEBL 1GHSA 5FYJH 2FX7L 2YD2A 2CK0H 2P5WD 3ZSTA 4Z78A 2C8NA 3OJDA 1CXKA 2VZSA 5I8KL 5CIPH 2GFTA 3O41B 4QCIA 3TNNA 3AQUA 3W25A 3NPSC 1MYRA 5CINH 1JPSH 4OV5A 3VIHA 3R0NA 5ESQB 3WL9A 3MUY1 3MLRL 4M7JH 2I9LB 4GQ9H 4JFYB 1XGZA 1F11B 4QRQB 1WJ3A 1YY9D 3WMBA 2O9PA 3H3BC 2NTFB 3H2WA 5CBAA 3RNQB 5CEZL 1AXSB 5D9NA 4PR5B 5D1XC 3KDMA 3ECBA 5HD8D 1UKSA 4UILH 5IV2B 1J0KA 4JKMA 1M7DA 3WY1A 2R0ZL 1MVUA 1E6OH 1SJEA 3QA3A 2AP2A 1RAMA 3G6DH 3L4ZA 1H0DB 1UWXH 4HMEA 1JWSB 5DQ9B 3FOMB 2BVPB 1T1ZB 3HZVB 3TBVA 2Q20A 2W92A 1IM3A 4BELD 1VACB 1U9KA 3VXUD 3S4SG 1P6WA 2ZCHL 25C8L 2ZOLB 2X1QA 3R1GH 3R4DA 2OJEA 4EBQH 1ISVA 4NZUL 5A40E 4H20H 2XGIA 1IILE 2EEBA 2NLJB 4NHUA 1WDQA 1OB0A 5EO0B 3PZMA 4PD4K 1WBYB 1KXHA 1ED3A 1SY6L 4WNQB 1N5AA 1YEKL 3TYFA 2XWTA 2ZXDA 3VIFA 3H9HA 2PYFB 1MRDL 4LX4A 1T20A 4UZUA 5B8CC 4HPGA 4XHJC 1BYAA 2UWEF 3IS1X 4MA3A 3LEXB 1UWQA 4XVSH 1GOWA 1ZGLP 3HE6A 3VFWB 2XIBA 5IB3B 3TVMA 1S9YA 4IIQC 3T3PF 2D20A 2IBZX 1MFCH 5FYLH 1H1NA 5HPCA 1U92A 4LBEB 4I1NB 2CHOA 5EUKB 4YQXL 2FDMA 5FM5M 4A2MA 3BKCH 3HUJA 3DSNA 3TV3H 5HTSA 1DBAH 3PV7A 2VX6A 3L4YA 1TPXC 5HHNB 4YK4B 5HPMB 1NQBA 5EZIH 1QHPA 5F6HJ 3TT3L 2CRMA 4YFDB 4JQIL 1HZHH 1PEWA 1UWIA 3PP3H 3C87A 1W72A 2VXQH 4JR9L 5TDNB 5I1DA 5TPWL 4L8CA 4BFIA 3CPLB 4UV7L 3GBMH 3QUYB 3HMCA 3GXDA 5D7LD 5FO9A 3TCLB 2B31A 4O2EB 4W8BA 4WKFA 3VD9A 3C9NB 2QKIA 2DLHA 4R2GD 3CFIC 5C09D 1JFQL 3T77A 4ENEC 1YY8B 5CS7A 3S9DB 3F5WA 1CWYA 2AAVA 3V6FA 1NUNB 3DX8A 1OTSC 4TTGA 5C1MB 2ZSWA 4N90D 3MSGA 3BHBA 2E4TA 4NGHL 4W8AA 4LRIC 1Y0LA 2HTKC 3B5GA 3CUIA 4GMSH 3LY6A 1T04B 2E9BA 3QHNA 3O11A 1TENA 3PIQB 5D72H 5E1HB 3NCBB 2HTLC 4D9RD 4M80A 4MXQD 1Q1JL 5FF6A 1R8LA 4ETYA 1C5DB 5D2LE 5ANME 3VFSA 1S46A 3CO4A 4IHOB 4M1CD 2Z92B 5D1QC 1EHLL 4AEIL 2X0YA 2O61B 2A2QT 1FRGL 5EO9B 3A6BL 5HI3D 2X4OB 3A24A 1FFOB 3WCYA 3BKJL 4NQEE 1ODZA 3DHPA 3V79C 1LVEA 1LO5A 3N50A 3W0KA 3QO1B 1M53A 2EXYD 1GGCH 4JFXB 3VXTA 5A6JA 1U8PA 1N0XL 1OY3B 1TQWA 2IWGA 4PJ5D 4DJMA 2Q86A 1JDAA 1NC2A 1DQJB 4YFLF 1NUDA 3O3DA 3CLFL 1B3XA 1IEAA 4A6YL 4OOUA 1C5CL 2XQYG 5LVEA 2BNQA 2VDPL 2F19H 3B9AA 4JY4A 2FE0A 1G7LB 4NM4H 3I85A 4O2CB 1I9IL 4V2BA 3WEMA 4F37F 2D4DA 1SZNA 5T3XE 4XP5H 1JPGB 4Y7MA 4TX8A 3GUTB 3OSKA 2IAMB 1UKTA 3VWJA 3M17A 3L2MA 3VXSE 3BAYA 3OKDB 1RVFH 3L3DA 4NNYB 3W9EB 2KPNA 1BBDH 4ZUVA 4YN5A 1X5XA 5FKAA 1X5ZA 4UR9A 3TZVA 3S2CA 2P42B 5JIWA 3WLBA 5AD0A 3MMUA 3SDCA 4XXCA 2NY4C 3CFCH 1AGDA 3S36H 3KS0J 3FCTB 3V4VH 3A6CH 3QDMD 1XF5A 1QRKA 1YEJL 6FABH 4D1JA 1DQLL 5BXRA 3PN8A 5GSRB 5ERWB 2JJWA 1AY1L 4GQQA 1BYCA 1MJ8H 4XX1E 2NY1B 2EJ1A 1I9RH 7FABL 1F6LL 3WYRA 3WFEL 1QI5A 5ADPH 5K59F 1MRFH 5KVDL 2YD6A 4EN3D 4QOKB 1GAFL 3SKJL 3VXRB 3OWEA 2FJFA 1A0QH 3PGFL 2OS7A 1BFSA 5B22A 2VLJB 2X4RA 2OWWA 1G0XA 1V0NA 3QIUC 1A2YB 4CBPA 5D7IA 1C16B 3B9KA 3VGBA 3DGGB 3TTYA 3BFOA 2D03H 3D3VE 3H9SA 3ETBF 4I4WA 3WY4A 3TWCH 3WD5H 2OYMA 2IH3A 1MJJB 4M1DH 3W11C 4GG6B 1X1NA 4GAJL 4O5LH 3GO1L 4W89A 4LSRH 1UR4A 3WN6A 2PCPB 3FMGH 5D9MA 3MOBH 3MJ8B 5FUZH 4MNKA 1JF1B 4UT6H 4OQTL 1OAZL 4I8DA 4NSBA 1U0QA 2X4QB 2R56H 4OM0L 1B3ZA 4LARL 4NM8L 1ZAGA 1HXMB 3MV9D 2X70A 5FO7A 2QLYA 3WUWG 1MCFA 4ZFZB 4CL7A 4JPIA 2QV2A 1GGBL 4XVUC 2WB5A 2CSPA 1EXPA 4JO4H 4MAVA 2Y72A 5DFAA 1KTKE 2DQJL 1W0YT 1Q6DA 2MKLC 5DJ8B 1RURL 4PTWA 1HHGB 2JIWA 1E9LA 1V6UA 3FW6A 1B2YA 5BRZE 3JWOL 1KPRB 4Q0XH 2VLLA 3OJDB 4UT9H 5HHOD 3C5JB 4H41A 2IBZY 4QCIB 3T0EE 3TNNB 1XMWA 3SE8L 4OUOA 4ZPTA 2OW7A 3N0PB 1WIUA 5BRQA 1TVHA 4L3AA 4WENB 1CDJA 4OV5B 1FZKA 3WL9B 5CFHA 3BKYH 3G6LA 3U7YL 3WH7A 1XH2A 3L5XH 4NKDA 3AXHA 2IMMA 2HMIC 1OOAA 1F4XH 1NC4D 1CLVA 3GZKA 2Q7NA 1KNOA 3KDMB 3ECBB 3QWOA 3MLSL 3U7AA 3O3AB 4PRPE 2OR7A 3QYCA 4IRZL 5EBWA 5DVNA 4NRRA 3V52H 3WJJC 3STZA 4Z8FL 1MVUB 1YEIL 3QA3B 1KFWA 5BYWA 3S37L 4LSTL 2J7GA 1PD6A 1AQKH 2FJHA 3ZTJG 2Q7YB 2A74A 3BN9D 3TBVB 4HU8A 1VAHA 3BP5A 1IM3B 3N9GH 4V1DD 1BVNP 5E8NA 4XT1C 3AFBA 3HG4A 3MLVL 1KFAH 3MCKA 5FYJE 4HMCA 4PBGA 2OJEB 5B38B 5I1KH 3ZDYF 3SURA 1YY9C 3ALXA 5J06A 4NHUB 5IQ9A 5CEXB 4NQUA 4YDLC 2N1KA 3LPPA 5JUEL 2CXGA 1DEEA 3BPNC 4NO0A 4DKFH 4Q9QL 1N5AB 1JZ4A 3TYFB 1BD2B 4FQXD 1KCVL 1MW2A 3ULUH 3H9HB 1CLOH 5DT1L 4IDJL 4CD6A 3PWPD 1T20B 1CU4H 5IROA 1LEKA 1OHQA 3QRFM 1M7XA 5BV7B 1JZ6A 3RJYA 2GJZB 2A9ML 5I74B 1GOHA 3VO0A 3ZJ8A 5TD4A 5FM8A 5EBLA 3TVMB 3HZKA 3O45B 1S9YB 1MCCA 1U6AH 1U92B 5KOMC 4CGTA 5FA4A 4ZFOB 4B9YA 4HK3J 3FN3A 4H1LA 1TQTA 4KHTH 3HI6H 1HI6A 1FNSH 1YUHB 4WI3A 4Z2JA 1W72B 5I1DB 2O5ZH 3BDXA 4L8CB 1A9BA 3A0OA 3ZTJH 3TTOA 4YR6A 4BFIB 4AD4A 4PUBL 2O5XH 2WQRA 1DBML 4XNZB 1GSMA 3KLHD 5FO9B 4ELME 3HG3A 1B3VA 2QKIB 1NGXA 3T77B 5I8OL 3V6FB 3DX8B 4ZE4A 1D7FA 2WWKT 4N5UA 3RZCC 4PTUA 5ANMA 3EYFA 3BHBB 3U4BH 5A43C 1Y0LB 3NCJH 4WCYH 2CHNA 1R5VA 4OZFG 4CVZA 1VGEL 4QLJA 1E71M 1J11A 5FYLE 4LF3A 3O11B 3GSOA 3D3AA 3ULVD 2YPVH 4OBSA 3GMMA 1D5XB 1F3DH 2Y2WA 2X1IA 3VFSB 3S5LB 5KANG 4JFTA 4TX6A 3RJXA 2AABL 1LO2H 4OFYA 5EOTB 4QRSA 1V5JA 1SM3L 2ZX8A 2ALWA 1FGVL 2GI7A 2H32H 1LO5B 4E41E 1RY7B 1KN4L 1U8PB 2HWZL 1I7ZA 1CQKA 4FK9A 1RUML 1T66D 2Q86B 2ED9A 3BQUD 1XF2A 1MREL 1YZZA 5DJXA 1OTTD 5HYSG 3O3DB 3PABA 2Z1SA 1IEAB 3AMCA 2PR4L 2VVSA 5BVJA 4UFLA 3WQVA 1A7PL 2BNQB 3AU1A 4MXQC 3ILQD 3MLYH 1AJ7L 2B1HH 4JY4B 3Q1SL 4NPYA 3EO9H 5HYQA 4M1CC 5E56A 4D0BA 1MY7A 5DEZA 4YLQT 5I1IH 4YDVA 2DSWA 5IHRA 3AVEA 1QRNB 2H6PA 3VWJB 2VDOH 4ALAH 2VXSL 4G7YL 3SQOL 2EXYC 2FECI 4UU9A 3THML 3VGAB 2MCPH 3CUGA 2EDQA 4NUGH 3UG4A 3MRGA 1MW1A 4JIEA 1OIFA 5I23A 2GUOA 3NCCB 4OFDA 5FKAB 1AR1C 4HV8A 3TZVB 1I9JH 5F9WB 4U49A 2FRGP 3WLBB 5AD0B 1LG1A 3WNPA 3U57A 3WDRA 2XGBA 3MODH 2X40A 3BIBX 1AGDB 4QP0A 3WQ4A 2BSRB 2D7TL 1RJYA 4HIXH 3PGCA 5A8MA 1T83A 1XF5B 1MFDL 5D9OA 1CXIA 5GRUH 1UVQA 4KQ3H 1DQDH 4JVWA 3D3VA 5ABFA 1IC5H 4KV5E 1QSED 5FL0A 5EPMA 1NGYA 2IFFH 3FFDA 1P1ZA 3D69B 4G80A 2ICCA 3PTQA 1IL1A 2ED7A 3BAEH 4RE4A 2X4RB 2GJPA 3ZKQD 3UJJH 3QULA 1FIEA 4KDTA 1H4PA 2QSTA 3ZT6A 4E8DA 3HE7D 1FNAA 2W0FA 5D7IB 3WUBA 1B4JH 3B9KB 3CV5A 5CJ8A 5HHVH 1VENA 5CWSB 1HNFA 5IR1A 1K8IA 2XYCA 5GXBB 1WIPA 3H9SB 1UKQA 3TFKC 3E3QE 1KN2L 1MQKL 2YN5A 1D5ZA 2XXCB 5HGAA 1FAIH 5JXAH 2CUIA 1EEZA 4W6WB 3H9ZA 4X8XA 2YL8A 3DHUA 1J8HA 3CH8A 1YQVH 4EN3C 3MNWA 4X0NA 1RPKA 3WIHA 5JW4M 1IGCL 4NZTL 5D1XA 5FO7B 2X70B 3HB3D 5CJQH 5BRZA 4EI5C 4BH8A 3BVUA 4F66A 4JPIB 5E2WH 3RAJH 4LVNB 1YNLH 1RIUH 3PUCA 5AC5A 4Z7NE 1T5WB 4Z95H 5JA9A 4KZDL 3W39B 4N1EA 2FB4L 3PHOB 4N68A 3W2DL 1UWGL 4CKVX 2VZ3A 2ZXQA 1J5OH 3MBXH 5I9QB 1P7HL 4WHTA 1F4WL 5HGGS 5L7XL 4D72A 1ERNA 3FHQA 1TMQA 3EOTH 5HYEA 4ZYKA 2J8OA 1NCWL 4W84A 3OF6D 4X99A 4PRPA 1IZKA 5C08E 5EOQL 3V0WH 1W9BM 1DEDA 1G6VK 1TVHB 1LWRA 4YUEH 1RULH 1SVCP 1FZKB 3C5SB 2FYYA 5FM5O 2XV6B 4U6HA 1S9KC 3U5UA 5FGRA 4NKDB 5I0DA 2DLIA 3OB0H 3ZIZA 4C7DA 3T2QA 1A8JH 5CCKL 5DZLA 4WIQA 4MHHI 4K8RD 1KNOB 3QWOB 3AS2A 3VMNA 3TH2T 2V6HA 5B3NA 4CCEA 3C6LA 1D6EA 4EDWL 1JYWA 5D70H 2F53A 5DD5L 2FJHB 1E1FA 1LGVA 5CIPA 4LLUA 1I3GH 2A74B 1EO8H 3F6IA 4HA3A 4KU1A 4DK3A 4MZ2A 3BP5B 4I18C 4UUJB 1UZ8A 1GCYA 2X42A 2ESVD 4KK5D 5EULV 3OZ9H 2BSTA 3MCKB 4FS0A 3GIVA 2J7CA 3OGCA 4L4PA 4L3EE 3RM9A 4DN4L 3VD7A 2H1PH 1U2CA 1TJIL 1F02I 3O8XB 1DHKA 3IT8D 1DEEB 4NO0B 4JFDE 3VCLA 4AIUA 1F6AB 4TRPH 3OXRA 1BAFL 1XGPA 1KGWA 2ZCKL 2EXOA 3O9WA 1LEKB 5IW1B 2XM1A 2F54D 3BN9C 4P9HH 4HPHA 4KPHL 1UWTA 4CKQA 1WVZA 1AHWC 4IRSD 3CZEA 4Y5YC 3KLAA 5EBLB 3A21A 3HZKB 3CDFA 3AIQA 3C5ZD 5B3JE 4W7VA 4AMCA 3P77A 1PPIA 5T3ZL 3MJ9L 1S5HA 5FA4B 3MZGB 4ELMA 4Y4FD 3LRLA 3W6LA 1FDLL 3GSNA 5ADOL 4U05A 2A3EA 1HKIA 3PF2A 4H1LB 1OINA 4UAOB 4WJ5A 1FZOA 2EE2A 4FQXC 2Y4SA 3LVEA 1LD9A 2OXHA 5JDJA 3PBGA 1OAUH 1ZE3C 4CU8A 2BVUA 5HYJD 3EMCA 5GNYA 1CECA 5J89A 2C26A 3NFSL 3S96A 3CZFA 4DCQA 4I77H 1OB1B 1P5UA 5F21B 3WDIA 4TSBL 4PP1D 3ULUE 2J75A 4BJLA 1VRXA 3T1FA 3BH9B 5BROA 1M71A 1V03A 5FKPB 1GGIL 4PJCF 4QRUA 5I1EH 4LLWA 2HH0H 5IB1A 5ANMB 4DWSA 2FIKB 3EYFB 5L2KE 3VG9B 3LQZA 4K94H 4LCCC 1WWBX 2XZCH 1R5VB 4CVZB 5ICZA 3AY4C 4NQEB 3WO4B 4EI6B 2C1PB 3GM8A 5T1LD 3MRLA 2CKNA 3WBAA 5F97E 4E41A 1E6RA 2ATKA 3GSOB 5KVGH 4C4KO 3SDDD 3T2NH 2VQ1A 5FHBH 3QOMA 4HK0A 3RX5A 4ZE5A 3KG5A 5EN2A 5F9OH 1BSIA 3GMMB 3KLHC 3MRJA 3S4SA 4Y19E 5I19L 1DVFD 1U3HD 3EBVA 4ZNEA 1BEYL 3HC4L 3F58L 2HRPH 4O9HL 2NY7H 3D52A 4QRSB 2GJ6D 3WFHA 3TO4D 4JRYA 1GL4B 1MRCH 1JIBA 1RU9H 2DM3A 5DUPL 5GS0H 2QMJA 1KOAA 1I7ZB 1RK0A 2XQBH 3KPQA 1A6AA 4NKIL 2EIEA 4Z7QE 1XF2B 5TE6H 1G7HB 2PWGA 4E5XA 1GOQA 1KEML 2Q8BH 3PABB 1OGAE 3VXSB 1UYQA 4MAYA 3WHE1 3ULVC 3VD4A 1UD6A 1FE8H 4MNQD 4PGZA 3GH5A 3AU1B 5DVOA 1EZVX 3NZHL 5JHDA 1BREA 2Q76B 2PYED 2VL4A 3L5HA 3LHPL 4NPYB 5HYQB 4ACPA 4LPTA 3UCRA 1WCQA 3LKPA 3VRIA 4JM2F 5JOPE 1W9VA 2EPNA 5DMIH 4YDVB 4QAWA 1CDYA 1DP0A 1AD9A 2H6PB 4P23D 1W0WA 4F33A 1QO3B 3AUVA 3NTCL 1KB5A 1MH5A 5IGXL 3GSWA 3MRGB 1T66C 3EJRA 3BQUC 2R8SH 4K71C 2GUOB 1OSPH 4KWUA 4NXKA 1J7VR 5EBMA 3BZ4A 1XSIA 1RZGA 4JFVA 3TOPA 2WUBH 3LQMA 1RJYB 3PGCB 3OR7A 1GHFL 1YECL 3ARGD 3C2SA 1AGBB 1UVQB 3D5HA 2G2RA 3IJ7A 3D2UA 3X3GH 5C6PB 2G3JA 2W0PA 2ENSA 3VFMA 3D3VB 5ABFB 5EPMB 3LMJL 3EOBB 2Z93B 2OZ4L 3FFDB 5ABDE 1P1ZB 2WHJA 3JV4B 3MBED 4HWZA 4G80B 1Y6MR 2P5ED 4P9MH 4Z77A 1IL1B 5TJWK 4JY6A 2W66A 3Q2CA 2C3GA 3VUPA 3QULB 4DTGH 4OCYL 1Z6JT 5DJDB 4CDHA 2ARJQ 3V4PL 4XPBL 3HUJF 2F1BA 1HJVA 3WJLC 1RJZA 2W0FB 1CDCA 4XP1L 2DT0A 3SUSA 2YWZA 3WS3A 2NY3D 5CEZD 1K8IB 3MRHA 1UWEL 1WB0A 1MCNA 4P3DB 3GI8L 5CZVH 4G8GD 5E1QA 4TUKL 5IJKC 2OSYA 5KBNC 1KLUA 2CKSA 1D5ZB 4HLJA 2YUWA 3UTSE 1OF2A 1EEZB 3LQAL 1X4XA 5EUOE 4P2RE 4WFEE 4GH7B 1KUMA 3FQRA 1J8HB 4UB0L 1AQHA 5ID0A 3W28A 2OL3H 3S37X 2JIEA 1GONA 2IF7A 2F58L 4X6FB 2DQCL 3GSRA 1BJ8A 2A6IA 3QHFH 4FQIH 5BRZB 1Z0MA 3C8KA 5ITBH 2J8HA 1KQZA 1XGUA 1H3WM 3HE7C 2X44D 4K8RH 3RPIA 1KJ2L 2WCSA 1TNNA 2PXYD 3T0EB 3BUTA 3B2VH 4LK4A 4R90L 2NZIA 3QUML 4W6XB 1HYSD 4ODVL 4CDGC 2O5YL 4X7TA 5TQ0H 4OB5L 4OLYH 3QZWA 2AGJH 3BVVA 1QP1A 4XCCH 5LAXB 2JALA 5I15L 3BXNA 4H8WC 2NXZC 2JLLA 4ZYKB 3OG2A 1RFDL 3U36A 2OXGA 1SEBA 2IAND 3CMOL 3SGEH 5KANI 1KTCA 1R7OA 4X99B 4PRPB 3U0WH 4NFDA 3BIKA 4Y2DC 2UUDK 3FB6B 1QI2A 5CAYB 3HB3C 1RMFL 4KMQA 1A6VH 1KTRL 2FYYB 4CD5A 1HL8A 2E7HA 3CZGA 1VBRA 1S7SA 4FABH 5F7DA 5E6ID 4UQDA 1A22B 4JFHD 2DDXA 4PJDF 5ALCL 3WHXA 4UIMA 4U2ZA 1OAXL 1JK8A 2YUXA 1KJ3H 4GXUM 4FNPA 3KL5A 3VXUA 4YHZL 4YXKL 3ZSSA 2HFFA 2ZJSH 3C6LB 3P0YH 1D6EB 4L3EA 2FH8A 3EFDL 3D39E 5CIPB 4LLUB 3QQ4A 2XY2A 4NYLA 2Q8AH 4WSJA 3X11A 1D5IH 4BZ2H 4LIQL 1CL7L 1S9VA 4OZGA 4ZO7A 4HS8L 5IESH 1UZ8B 1ONQA 3LRKA 2F2HA 3V6OE 3QCUH 4KMTH 1JF6A 2BSTB 4PB9L 4FZEH 5DK0A 4KI5E 4U1IA 3GIVB 3OGCB 4ODSL 1G9EA 3WKML 4B50A 4D3CH 5AC4A 1JWMA 3DETD 5E0QA 1MFAL 1G6RH 5GGRB 4X80H 5LJYH 4X98A 4ETQA 3SUTA 5K93A 2EO1A 3RRQA 4PRAA 3VCLB 4Q6IC 2AMGA 3WH5A 4JZOB 4TTUA 5IFHL 1XGPB 1JFHA 1FPTH 3PL6A 3O9WB 2XSAA 5TE7H 3SCQA 4M3KB 1E6SM 1MWAA 3PWJB 3QFDA 4CJ1A 4HGKC 1L7TH 2DQFA 3KLAB 5KJRH 3KYAA 3BUYA 4HZLA 4KK5C 1BIIA 4RZCA 3BUBA 5BS0D 4ONFL 4GI8A 1HP5A 2QEJA 3P77B 5E6ZA 1S5HB 1P69B 5TH2A 1ZLVK 4ELMB 1IT9L 4JREC 5M03A 1RK1A 2W63A 2OWCA 4GJTB 1V3KA 3RIAK 4WJ5B 2WMHA 1FZOB 4AMXA 1NBVL 3V0VA 4GKOA 1UUQA 4AMKH 5IBLD 3SE4A 1FLTX 1I8IA 3W6MA 2IADA 2AJSH 3HNSH 4B41A 4HBCH 5L2KA 4UTBL 4HJ0C 4AEHH 4CCDA 3OR6B 2X4TB 3S96B 5J13C 4IRSC 3CZFB 1GVIA 4DCQB 3CC1A 2F5BL 4RGOL 5A1AA 2KDGA 2IBBA 3PDDA 5ENWA 2N7AA 1JPTH 3KJ4C 3T1FB 1PSKH 1CGSH 3C5ZC 1M71B 1K6QL 4LSPL 4GZEA 4QRUB 2VN4A 4PJEE 4LYQA 3LS4L 1FO0H 2W61A 2YA1A 4ZFGH 1OARL 3P30L 3W26A 4DWSB 4PJXE 5DYOA 3O6FB 1QSZA 1CG9A 2QBWA 3WL1A 2DD8L 3CFDB 5ICZB 2ZKHH 5M5DA 2DF3A 3MRLB 1QTYT 3T0VA 4E41B 1UWUA 3PDOB 3P9LA 3RILA 5ABHA 4HK0B 5GRVK 3IJYA 1HN1A 5EN2B 4NSKB 1A6WH 2WVUA 3MRJB 3P0VL 3EJYD 2X89A 3S4SB 4WIWA 2GIYA 4NBZB 5J8OA 5CSYA 4O51A 4PJ5A 3S3PA 4XC1L 4KKLD 1INDL 1MELA 1A14L 3V5HB 3IFPA 1C8QA 3WFHB 1GOGA 4CD7A 3F8UB 1K4CA 2DLEA 5FYKU 4XCNA 1F90L 2XYLA 1RK0B 3RKDD 2IPTL 3HG1D 3KPQB 4RDQF 1A6AB 4KRMB 4WI8A 1OSZA 2FEEL 4E5XB 2V5TA 4PJBF 4M93C 2C3WA 4MAYB 3BO8A 2NW3A 3O3EA 3ZDXE 3L3JA 4JPWH 3TCXA 5C0GB 2UUDH 2WZEA 1CQYA 5GSVA 4NNPH 3RVUD 5JHDB 3MCG1 3V5DA 2FX8L 2JELL 4KAQH 4DW2L 5I8KH 3QIBC 3LKPB 1BAGA 3SQBA 1G0CA 1BP3B 2H32A 3IGUA 2DQUL 3MGOB 1IV8A 3V6BR 5IFJA 3ROLA 1A7BA 1KCUH 4M7LH 1AE6H 3TO4C 4XMPH 3UTTE 2NY2D 1LQ0A 4F33B 5F71A 1MCKA 2W9DL 1JZ7A 1KB5B 2GQHA 3P9WB 4P7OA 1MIML 4WY7H 1MH5B 3GSWB 5DD6A 4BUHA 4HS3A 4YHKH 4O58H 4UZSA 2J79A 5SWSE 1BJ1H 4HPYH 5EBMB 3T4YB 1GUVA 4JFUA 1WIOA 4LGPB 1B90A 1RZGB 4M03A 3DX1A 3OR7B 2X4PA 2BXZA 4AJ0A 4LU5H 2EDWA 3MV8D 2G9HA 4W93A 5GS2D 4S2SA 4OKDA 3D2UB 4ODHL 1QOXA 1CLYL 3VFMB 3UDWA 1GZQA 3U0PA 1JGIA 1QFWM 4HWZB 4N42A 2D7MA 1U8JB 4Z77B 4GXVH 4NZUH 1F6FB 4LGRB 4MLIA 1C1EL 1P4IH 2YD4A 1BQSA 5JQ6L 4S1RL 1R3HA 3WFZA 2I25N 4XNQB 5EUOA 3MSPA 3WLWD 1A7NH 2EPKX 1V3HA 2OJZH 1RJZB 2ADGB 1GGTA 1SMAA 5GZND 3WS3B 1ACYL 1W32A 3MRHB 2VLKD 2ZUVA 3B43A 1JN6A 3SDYL 4ZOAA 2QHAA 3ARGC 1EHAA 4J3SA 4OT1H 1KLUB 4ZD3H 3ABZA 5I77A 3MV9A 1HINL 3WH8A 4Y4HD 3MV7E 3PDGA 4JHWL 3MBEC 1WZKA 3S3SA 3AS1A 4S1DD 4YQXH 2EDKA 2DEPA 3IDGA 4Z2KA 1U8MA 2GUYA 3VSVA 4YHPA 3GSRB 2A6IB 5HYSA 3C8KB 2HFGL 1P4BH 5GHWH 1IEBA 1XGUB 5GGUA 2CIKA 2WVVA 3RPIB 4BSVA 2NY3C 2V17H 3QI9D 3WS6C 2V3FA 1XD1A 4QNPE 2VRQA 2EIZB 2A9NL 2APBA 4HXAH 2P44B 1BVLB 1RUPL 4X7TB 4I18A 4OCLC 3QZWB 4B0MM 1HHIA 1EFXD 1X5HA 4Y5XA 1A1NA 3BXNB 4EKJA 5M95B 5DJZA 1TXKA 1JFQH 3U36B 2BNRD 1SEBB 5I66A 2C7UA 3RIFF 1NKOA 5BXPA 4FA8A 4H7VA 3L4TA 2AJUL 4NGHH 1UH3A 3X3FH 5F1IB 1WBXA 4QRRD 5EWIL 4B9ZA 3UERA 1UM5H 2C7FA 4K9EL 2G5BA 1XFPA 1S7SB 2PXYC 5F7DB 1DTUA 1EV2E 2MNUA 4JG1H 4KRNA 3V4UH 4HPOL 2IG2L 3WHXB 1HYSC 1HKLL 4UIMB 3V6OA 1JK8B 2EACA 1A7QH 1QFHA 5BQ7A 4V1DA 3VXUB 4V28A 3ARQA 3EFFA 4L3EB 4D9QE 2VXUH 1NAMA 3QQ4B 4NYLB 3U82B 3X11B 2DAVA 1LK3L 1J88A 4JFDB 1G7QA 1S9VB 5KS9E 4DKEL 4OZGB 3C08H 4LHUD 1BGXH 4KK6D 4FQXA 1HE7A 4PIRF 5DK0B 4U1IB 3JV5A 3PWPA 3D1MC 2F8VA 4P5MB 2QPUA 1ZEAL 3EYQC 2V5SA 1I3RA 3GHBL 1C5CH 4X98B 1Z2KA 1B31A 4ETQB 3O6KL 3DVIA 3RL1A 2VR5A 4PRAB 2P8MA 1ES0A 3LIZH 3ECQA 2L7JA 2Y5TA 3GSUB 1NBQA 2EDHA 4FFZL 4I48B 5AWNL 3PL6B 2G60L 4MVBD 2VZOA 5JW4Q 3UJIL 1WE5A 5DC0A 2Q3ZA 1ZMYA 2EDDA 4W6YB 5DFWH 3QFDB 5HOSA 5MI0C 3BISA 3SGEI 3BUYB 1BIIB 1CDUA 4L4TE 4RZCB 2VDML 1VESA 1U95B 2OQJA 3AY4A 5SWQA 2XWEA 3VRLE 3VIKA 3DETC 4MDJA 5TH2B 5DQDH 4FG6D 1PG7W 1WAAA 3SDXF 2WBKA 1RK1B 3HI5H 4L3CA 3MGTA 3OGOE 1N26A 1CVSC 5EORL 3V0VB 4QHLA 4KKBD 4AEEA 3KPTA 4PJEA 1ZBWA 4AISA 1KCRL 2XPGB 1DQLH 4UQ2A 1I8IB 4R2GB 5DFTA 2IADB 2E3VA 1AY1H 3OXSA 5L2KB 4PJXA 4EXPX 1QKZH 4Y7EA 4GQRA 2PI6A 1L6ZA 1U91A 4H8UA 4HC1L 5A8PA 1CICA 2HG5B 4CJ0A 4MA7H 4Q9CA 3UZVB 2R0WH 5ENWB 1OPGL 3K4AA 5DA4A 1A4JB 1YPZE 4AZ5A 4F3FA 3P4NA 4GKLA 4QWWC 3CH9A 1KGCE 35C8H 3IDIA 4MTVA 1D2KA 5IW6A 4HH9A 3F4VA 2D22A 3KLSA 4OUUB 5DYOB 3VSTA 5BMFL 1PBYA 3H9YA 2ADFH 2DQDL 1Q0XH 1CG9B <