1EHAA

Crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
557
structure length
557
Chain Sequence
b'TFAYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKVGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOSYLTREHALOSE TREHALOHYDROLASE
molecule tags Hydrolase
source organism Sulfolobus solfataricus
publication title Crystal structure of glycosyltrehalose trehalohydrolase from the hyperthermophilic archaeum Sulfolobus solfataricus.
pubmed doi rcsb
total genus 161
structure length 557
sequence length 557
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2000-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehaA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ehaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ehaA01
3W9EA 3QUYC 3MACL 4E0RB 4CN6A 1CK0L 3WJLA 2ZXAA 3A0OA 4BKLB 1U41A 2IBZX 4FFVC 3ALGA 1UJ3C 4QRRE 3TNMB 2VX4A 1CLVA 4DWSA 4CD7A 1GZPB 2HVJA 4PG2C 4F9LC 3IGUA 1UB6A 4KXZI 1AQHA 2AV1B 4HZ7A 4MWFB 4KUCF 3DBXA 2V7NA 1U8KA 4JZNA 2X4NA 4Z0XB 3MI6A 5F7LB 1M6OA 4UQDA 1TQWA 1AO7B 3IDYC 1H5BB 2YL6A 1M7IA 2TAAA 4QRQB 1UH2A 2PO6A 1VFBA 1XYZA 4CMMB 2JALA 2BNJA 2B2XL 3F58H 1F11A 1IL1A 5CZXC 3RIAF 3LMYA 2XNAA 1WISA 5DD1L 2XSBA 1H3PH 2NY5H 4XMLL 2H41A 3RVXC 1O7SA 3MNWA 4JFDE 1S7VA 3HLAA 4FNPA 1U8NB 3AZTA 5I15L 3WMBA 3TBYB 4YUEH 1NAMH 3EYSL 2HA1A 4U3CA 3MU7A 3ZHLA 1ADQA 2O93L 4NQXB 4Z7UA 2ICEA 4IDJL 3QIWA 3OKMB 3BQUA 3MOBL 3V52H 4OFYA 1J1OH 1LLOA 5DLMH 3VIJA 4L3EB 2EDJA 5EZLA 1AE6L 2HMIC 5HVGB 1UA7A 3V6OC 1YN6A 5DUPL 1AXSA 5A40E 4P23B 4I77L 3DIFB 1ROWA 1OSZB 3UYRL 1GQJA 5FYKD 5IW1A 4FTVD 2X0YA 1I3RB 1GGBH 3S5YA 5FA3A 3VGAC 2YC1A 3MCKB 2QPSA 1TCRB 2GTWA 4PJHF 5DD0H 2ZJSL 4TRPH 2QKIA 4RAUA 5TF1H 2HT3D 3VD3A 2VKXA 3ZDYF 4W87A 4W7VA 4KV5E 2B5IC 5BZWA 1O7DC 4HFUH 4AENA 1Q6FA 2R2EA 5DD6A 4LCYA 4H20L 3B4NA 3N1QC 3U36B 4CD5A 4QLJA 4H8WC 1FVCA 4GAYA 3BD5A 5BRZE 1IC7L 3MRNB 4M6OH 1Q9WA 1ZEAL 1KUMA 4I3SL 3O2WH 1HSAB 4Y88A 4PTWA 5I18H 4LCWD 1BJMA 3KL5A 4JFZH 5A6BA 5JMRA 3ZE1E 1WAWA 3NDYA 4ZFOB 5BS0A 3VXTB 2IXVA 1K6AA 5ESQB 3DX0A 1KFAH 5H35B 4Z2GA 1KB5B 5GGSB 5LA1A 2EH8H 4L4TE 4AEHH 2VT0A 3JZ7A 1YEKL 2GFTA 4ZG1A 2G5BB 1L4IA 4PJFF 3WSQH 1M03A 1RI8A 4FQJH 3WUGA 2PC8A 4BQCA 3SKOA 3BPNC 3HUJE 3H6JA 5DUPH 3L3IB 1HHHB 4ZO9A 2MCPH 5DQJA 1OAYL 5J56B 5BZDA 2PETA 4E9LA 3ZKXB 4DCQB 4YNYA 4PRHE 1T7VA 1FG9C 4HIJB 1NDGB 4R5EA 2RFXA 3VE0B 4WJ5A 2NTFB 3OXSB 2BC4B 3UBXB 1U91B 3V6OE 4P46C 4AQ1B 2HN7B 2J5LC 3BH4A 3QDJA 4MD5A 1US2A 4G7YH 1DANU 3MR9B 4U1MB 4X9FA 1WZMA 4I2XE 1FE8H 3GBLA 4HGWA 2GK0B 3STZA 1FJ1B 4IM8A 5EO0A 3U7BA 5E4IA 4XRCA 5I79A 3MV7B 5CZKA 5BWFA 2NY2D 4YBQC 1WDPA 5GS0C 5LBSH 2VRQA 4I0PA 3U0TA 2OMNA 3GUTA 1GQKA 4WUKH 5FUOH 3CPLB 4LGPB 4KUZL 4MNLA 4Z7WB 2IGFH 4EIGB 5B38G 4CL7A 2WANA 1S7QB 2FATH 3P2TA 3VKKA 1EJ6A 1P5UA 4IDJH 4KHTH 4LSPH 4DO6A 3IFNL 4U5KA 4JN1H 3CC5B 5I1IL 4PJEE 4PY8I 3RNKA 1UB6B 3GK8H 4L5FL 4LSTH 3BCFA 4E41A 1RK0B 1HHIA 3CLFH 3ZL4L 4NQDB 4M7JL 1V0LA 1A4JA 4QF1B 3TH3T 3SGEH 3IRZA 1KTBA 2XGIA 1V0NA 3MRPB 2WMKA 2XIIA 5ALCL 2EICA 2XV6B 5GRXG 4D72A 5FECB 2D24A 5CZVH 2YPVL 1WWAX 1ORQB 3KPSD 4Y19D 1CECA 4U6YA 3DRQB 3IKCB 1B2WL 4ORGA 4HP5A 3ZMRA 5F97E 2WWKO 4X6CB 3U1SL 3BMWA 1LO2L 3MXVH 3SQOL 1IARB 5F1IB 3SDCD 5T3ZL 1R3HB 1RUML 1XF5A 2GJ6D 2HFTA 3BGMA 3I6LD 3OAZK 3X3FH 1EHXA 2DGAA 3RIFF 1IAIM 5F7KC 1XGZA 1PZUB 1KLUB 5D1ZA 5GRVL 5CJXA 5F7HA 2VXQL 4PJIB 3MV01 4NKOA 3PWVA 4WU5B 4NHUA 3WFHB 4P5KB 1QFUL 2JELH 2EE2A 3QI9A 4AT6A 3JUGA 4KK9C 4OD2A 3P11L 3PGCB 3QAZB 4AD2A 5JR1H 4P2OA 2ESVA 3I85A 1UOKA 4ODVH 2A0LD 2DMKA 4ODWB 4GS7C 4OF3A 1GCFA 4AG4H 2WVSA 4PYHA 2DWDB 3DLQR 1OARL 2P8PA 3RVTC 4Z7VA 1OAKH 3CU7A 5DLML 3DV6B 3ECBA 1LK2B 1NFDE 4LSVL 1UWGL 3OKEA 4BELD 2G9HA 5KSBF 1MHEB 3IDJA 1JDDA 4P4KD 1C5CH 4HIHA 4JFFB 4RMQA 5D6DA 4TVDA 3EMCA 4BSWA 4JM2A 1HIMH 4X6DF 1IM9D 1ONQB 4LLDA 5GS1C 3L95B 3AISA 2WK2A 2XZZA 4PMNA 4E41B 4C56D 3ZT5A 3OLDA 2BDNL 2VDOH 3CSGA 4Y2DC 3PP3K 4Z7QE 3JWOC 5E8OB 6FABL 3HE7C 2CKBL 7FABL 2XSAA 4P2RE 1WWBX 4YPJA 3S5LB 4OGYH 4GJTB 2PTUA 4X8JB 5HYJB 4UINH 2IAND 3RJDA 1WLHA 5C8JB 5IB5B 3BD4A 1NGWB 3BVNB 2MPAH 5DJ6A 1FV1A 3VXME 1U8JB 1DANT 1VKXB 4GG6B 2DQEL 3J7HA 4WFGE 5A8MA 3AIUA 4ONFL 5TDNB 2CBIA 3TBVB 2E40A 5A94A 1S7TB 3QFJB 3WEXB 4CN4A 2NY0D 5IT2H 2L0DA 3VD9A 3LRLA 2AKRB 1U2CA 2HLAB 4G9FA 5EH1A 4FNLH 2VYRE 2XA8H 1JGVL 1CICB 3TBTA 2FIKB 3GI9H 2RGSA 3VGFA 2IALA 3MUZ1 4NZTL 4XVUC 1CIUA 3PP4H 3IETB 3O6ML 2IAMA 4GKOA 1BJ1J 4IIQB 4U1GC 5C0AB 2N56A 4YAQB 3TM6A 3MRHB 5DQJB 2BOCA 1GQLA 4CBPA 3GRWH 2YKLL 1HNFA 1TVDA 1DUZB 3UYPA 1WBYB 5GSVA 1P4BH 3C87A 4TTDD 1P4IH 3CZJA 4LLAA 4FMKA 2C3HA 1A7PL 1G6RL 4PMXA 5C0JA 1WUNT 2IFFL 1NM9A 1HOCA 2OSLB 4RSVA 3V8CA 4PRBB 1M05A 2PYEB 2DQHL 3TONA 4OIBA 2EDKA 2V5RA 2Q20A 1V3KA 1IAKA 2X4PB 5LVEA 1R3IL 3VFSA 3KPLB 1UVQB 1MAJA 3ZO0A 3LRHA 1ZEAH 3QAZC 3X14B 4E4PA 1I8MB 1DBJH 2X4UB 3HAEG 2OZ4L 3OKLB 4JO2H 4WUUD 1DWGM 4WTZA 3FB8B 4O4YH 1T0MB 4G8GE 3RGVD 4BQ2A 1V5JA 4KMLB 4WW1B 1FIEA 4PLKD 3RZCC 1LL7A 4H25B 2YD1A 1A6UL 3HR5A 3BAJA 2XFFA 1IEAB 2BSSA 2CSPA 1E6ZA 3PZVA 3FW6A 5AY7A 4HWNA 5E5RB 4JVWA 3FB7B 4HEPG 3C5JA 3TVMC 4Z7WF 2G2RB 5JHDD 1QX1A 2P46B 3DX8B 3V7AG 4E5XA 1F3JB 1OL0A 5DJ0A 1XGPB 3GSUB 3VRLF 4JCLA 1F4XL 2CXKA 4JANA 2BVUA 2OXGA 3TCLA 1A0QL 1XH3A 3R1GL 2A3CA 2DQUL 3TLRA 4KMTL 3OKYA 5C08A 2WPGA 4MSWA 1IRAY 3L9RB 2ICES 4M1CC 4Y5VB 5A1AA 2M2DA 2CLVB 2IAMC 3EYFB 4HSQA 1JZ3A 3VU2A 1JF1B 5JORA 5HGDA 1HTYA 1LNUB 4JKLA 2VLJA 2BCKA 2GJRA 2X5PA 1P7KA 1AR1C 4JRYD 3W2DH 2BNQB 4JQXC 3LVEA 4XB3A 4YQXL 1E70M 3GMNB 3I6GB 3CZKA 1MWAH 3AXXA 3D5HA 5ICZB 1D5XB 4FNUA 4QRQA 5AZ2H 3TVMD 4UIKH 1BYDA 4R96B 5JUEH 2XQYG 3VXPA 4JAMA 5T3ZD 2A6IB 4ZDHA 4HIHB 4PLKC 2ZUNA 3QNXB 4I2XB 5F8RC 3SCMC 2J8UA 5CPTA 1BM3L 2AAVA 4WNQB 5EC1A 4ZYKB 3VXNA 2P24A 4HZ6A 1MAMH 1WEJL 2GUOA 1A3RH 3ARQA 2BXYA 4ONGH 4Q9QL 3VGDA 1Z3GH 4OZHF 4YDIH 1AFVL 4WEMB 4KTEH 1V02A 2RR3A 3SE8H 2P8PB 2DWDA 5KSBB 1OARH 3CMJA 2W0PA 2W61A 1I9RH 4X9HA 4P8XA 1UACH 5CEYB 2VNCA 4E42A 1S78C 3QXAA 4LVEA 1S7SA 3W9DA 3GSXA 4JDTL 3O11B 4KRPC 3JV0A 2E7LC 1NKOA 4LGXA 3T1WA 4MX7A 5BW7A 5AYQA 2CD0A 3EYQD 4P5TA 2Y5TB 4M6NL 4Y2DA 4IOFC 5D1ZB 4LHUA 2FLRT 4XPGL 2YBUA 4LIQL 4BZ1H 4IHOB 2Z1SA 4PJ9B 1QTYT 3GI8L 1CD9B 2ZWYA 1HXJA 3HC4L 4MXQD 4V1DA 4GRLB 1YEEL 2VH5H 2W60A 4U6HB 4IHOA 5EZOL 3GH4A 5BOZG 4KKCD 5HHVL 1EV2E 4JQVA 2XQBL 4PTMA 1KYOK 5A8QA 3SOBH 4PP2A 3NCBB 1U8MA 5B21A 2VX6A 2DF3A 4ORGB 4X5WB 3D0VA 3HPLB 3IF1A 1N8ZB 3WNKA 1KJ2L 3BZ4A 3PWUB 2A38A 2VLRB 3F7YA 1A47A 5B3NA 3O0RH 1F90L 1UYWH 1L7IL 3E6FB 4QXGH 5TQ0H 3PJSA 1JHLH 4RNRA 5CBEB 1R24B 2BSRB 1L7IH 4FHBD 4QXGL 4ZSOA 2J6EA 1RK1A 5DHVH 3FFCD 3AU1B 3K8MA 5E2VH 2EEBA 4L8DB 3NA4A 3HG4A 1FCGA 3OGCA 3BP5A 3AREB 1QBBA 2HISA 1QO3B 4ZDHB 3V5KA 2WNGA 4FFZL 4F15C 5IB2A 3GUTB 2JIXD 1CL7I 5E9DD 3ULUL 5F7MC 4HOXA 3FHQA 2EYSA 1KEGH 3VFOB 3SCUA 1UWRA 2Y6SD 1TLKA 1DDHB 2IANA 3AIEA 5E1HB 5IB4B 3W82A 3HG1A 3FQWA 2VX7A 2AABL 4LVOB 1MLCA 4FQCL 3OLGA 2YD6A 4OD1L 4WUUB 2NQCA 4CU8A 5CJQL 1GC1H 4UT9L 5IESL 1C08B 5DT1L 1AD9A 4N8VA 1K9TA 4XMKL 3SUVA 2VDNL 1NOUA 3EYUL 5IJKC 5CIPB 3MRBB 2FR4A 5C07D 1VADA 5FK9B 4BK4A 5BV7B 4R8WH 1WAAA 1D2KA 1YZZA 1RHFA 3QXWA 4HLJA 3RVTD 4AQOA 1HHHA 4NYLA 1NJ9A 2HYMA 2A0LC 3NZHL 4ZE4A 3LSOA 1UM4H 4NOBA 1KJ2A 2EIEA 4QLKA 4LCIH 7A3HA 1A6WL 3KJ6L 4P3CH 3QNZA 2HJLA 1KB5A 1TZGL 2EXWD 4FFZH 1BFOB 2AI0L 4HUKB 3LQAC 3MBXL 5EU6E 4Z77A 1JPFA 3MUAA 4V1DE 3RDTA 1XF4A 3MBED 4RX4D 2YUVA 3V5HA 5HYEA 1E1FA 3P73A 1I8LC 1BFSA 3H42H 2A74A 1YDPA 3V4UL 1KELH 3N12A 3LS5L 4QDMA 2AABH 3WQVA 3AZRA 2F7PA 1LGVA 5KVDL 4OCWL 4PTUA 3ARWA 2CDEA 1MFDL 4IMKC 1SBBA 4KJPD 4GW4A 1KCVL 3TJEH 3WHXA 3MCKA 5SWSD 2J74A 2J12B 1JGEA 1U2HA 2QF8A 4ODHH 5F9DC 1I3RA 1CE1H 4P2RA 1CCZA 1A1MA 2VCBA 1KT2A 1NCWL 3HI1B 2WP3O 3QUXC 3ZIZA 4L29B 1CICC 3SBWA 4IRSD 43C9B 4U6XA 2XKNA 4V27A 2A1WL 1ISVA 5CIPA 2FIKA 1ZHBB 1W9XA 3AXLB 5BXTA 1A7BA 4G9FB 4XAKD 3BEWA 2J7DA 1D5IH 1YMHB 2AI0H 4H1LH 1BFVL 3FQXA 4PGEA 3LV3A 3QO1A 3BWUC 2UUDK 1A0QH 3U79A 1WFOA 2C1OA 3B3IA 3QSKB 5HY9A 3SKUD 1UG9A 3CNKA 4JEGB 4XC1L 4KVCH 3B8SA 1FIGH 2J8OA 1A3RL 4Q9QH 4DKAA 5IGXL 3NSXA 3RRQA 3CLEH 4KDTA 2H2PD 3GI8H 1YQVL 1M7IB 5C6TH 1HXKA 1ZS2A 4PMVA 3WV0A 4C57C 5D7IF 1FNAA 5E7BA 1FYTB 5E8OA 1A6TB 1T0PB 1NMBL 4JDVB 3SCTA 1U8HB 2YPVH 4EUPB 1F6FB 1FNHA 4W6YB 2N4IA 2VR5A 1H3XA 5E8NA 2PR4L 1CE1L 2JJSC 1U30A 2EDQA 5AZEH 2NT0A 3GSQB 1G01A 4KI1A 3ET9F 2BVYA 2EYRA 3DGCR 4LLDB 5EZJB 3KAAA 1OP5H 5LGKA 1BEYH 1KEML 4MA8L 2DJUA 4A2LA 1YEHH 1YJDH 1JYWA 3K8LA 4DN4H 3U9UB 3VOCA 4HUMB 4I3RH 4TSAL 2DLEA 5CLTA 1T1WA 3BH9B 4NQDE 1MSPA 1CZ8L 2OTUB 4M5YL 4UQ9A 3TTOA 4UNIA 2XM1A 1F45A 2ENSA 5JPNB 2D3LA 3FO0L 4R3SA 2CDFA 4YIQB 4GOSA 2CUIA 3SIMA 2ZE0A 1PX4A 3T4AA 1MCCA 4QCIA 1T5WB 4RAVB 2AXGB 1AGFB 5IHZA 1LL4A 1Q9KA 1RUAL 3VJ6B 1CFVL 4X6DA 3K74B 4LCWE 4MA7H 2CKSA 4X6CE 1S7UA 4ZUUA 4L9LA 2YR3A 3GKWL 1YA5A 3DVIA 3JUZA 4N5UA 4XNUH 2PO6D 3ZE0E 3MLTA 2D9QB 2XRAH 3O9WA 3CD4A 3MV7D 3VFVB 2EC8A 3OKKB 5HHPA 5AZEL 4LLQA 5IM7B 3OLIA 4MLSA 1J11A 1GORA 3IGAA 5EO1A 3V4VH 1ORQA 1RULL 2NX5A 5M3WA 5JBDA 5LWYH 2XZAL 3VXPB 4FQIH 4DGYL 2GDVA 1TA3B 3MREA 3V4PL 5H94A 3VIKA 1HHIB 2IADB 3BPLB 3HN3A 1T3FB 4XNMB 1NAKL 3W0KA 4OFYD 3QDGE 2BNQA 2XWBA 3B2VH 2WWCA 3O3AB 2J6EH 3K1KC 1W1VA 3QCVH 4Y8AA 2XFYA 3I2CL 3KR3H 4TSCL 1YEFH 1HQRB 4NZTH 4NFCA 2YXMA 3JWDC 5FB8A 2DTMH 2P42B 4OCRH 1Y18B 3TV3H 3PDDA 4UFKA 1QVOA 4ISVB 3B83A 3TGXA 5L2KB 4YEFA 3RJXA 1UXWB 4Y2OA 3LEXA 5EO9A 5E03A 3VFGH 2H1PH 1NAML 3EYSH 2VXUH 4F58L 2DH2A 2GAZA 2R0KH 1AGBB 1SMAA 3QDJB 4MD5B 1QSVA 1I8IA 4OBRA 4M7LT 2VRJA 1XZ0A 3CTTA 1TVHB 3ARDB 4GQPH 1CG9A 5IV2A 4MHHG 5IBLD 4G43B 4B3KA 4GIAA 3TA9A 1VCAA 3MBEB 4IRZH 3CFIC 1PKQB 1IQDA 4HKXA 4ZFFA 3IU4H 3U4EA 4DCQA 1INQA 1HNGA 4PRIE 2VXQH 2NR6D 3O3BA 4YHNB 2LAAA 1FG2A 1Q94A 4Z2IA 1OTUC 5ISZD 4RFNB 4QEGA 5I1LA 4RA0C 2M8XA 3ZE0F 3C8HA 5I1EH 1U8IB 2VWEE 5FYLH 3SO3B 4P2CG 3GSWA 1MJJB 3RO8A 4JM2C 3SCNA 5HBBA 1CL7L 3GFUA 1T7YA 3NAAL 4YPGB 3KWXA 3C6LA 5FCUH 1IAIL 2B1HH 4ZUSB 2F8VA 1B4RA 3E6HB 4GUPB 3MYZA 1IC1A 4MDOA 4NF7A 2E9WA 1X5HA 4D94A 4K23H 2QBWA 4Q9BA 4PJ7E 5FYJE 3PABA 3IJ7A 2ARWA 5I24A 1A9EA 5DTFB 5F7DB 2HWZH 3MV8E 4ZAKA 3NCJL 1F3DJ 4PY8J 4H0GA 1QG3A 1C7TA 2HVKB 2HWZL 4KKBD 4OQTH 5SWSA 3SPVB 3A24A 1ZL1A 1AQDB 3SKNA 4ZD3H 2OS7A 4RL3A 4KHTL 1MHCB 4XVJL 1EJOH 4L3AA 5KJRH 3H53A 2DQUH 4JFVA 4Z0BL 3GKZA 5TPWH 3FOLB 2WP3T 4PY7A 3HS0B 2GDUA 5HVFB 4XCCL 3HE7A 4WTZG 3WY2A 1UA3A 3NZ8B 1IZJA 5JIHA 3ARDA 1AGEB 3MS8A 1AR2A 5ISZB 1U3HC 1K8DB 4BFGA 2YK1L 2CRZA 4P23A 3SDAB 4KKBC 4NQCB 4NYLB 4Y4FD 4PJCE 1E6OL 1U8JA 1MRCL 1VKXA 1VRXA 3DVGA 1I7TA 3CC1A 1LO2H 4M8QA 1VADB 3EHBD 4RFEA 5I2UA 2YRPA 3FFCB 1BIIA 1IGJB 2GK1B 4NWUL 4UMGA 2R39A 2I26N 4U7KA 1Y0LB 1Y18A 1AGDA 1QRNE 1EPFA 1RZ7H 4RFOH 3ULUC 3IYLW 5E9DB 4EKXA 3EDEA 4WFFE 1QA9A 3D4ZA 1ZWIA 4CMHB 2D31A 5C0AD 2YSSB 1RZIA 1OTUD 4LRIC 3QXDB 4KQ3L 1CFSB 2CXGA 3H8NA 3KVQA 1MCFA 3IDIB 4LOUD 2GSGA 2NR6C 1F3DH 2FSEA 2YWZA 2WSKA 5C0RL 1PZ5A 3G5XB 4LCUB 3MUGA 5SX4H 1OSPL 5FM4A 2CUHA 3V6FA 1HH6A 3ILPA 5J8OA 4KROB 1NDMB 5D1ZD 1FVEA 1Q1JL 4NQVA 4PJHA 1XSJA 4W4OC 3WY4A 2PR4H 4HUWB 5HYIA 4O02H 1XR9B 5HHOE 1BPLB 2RCSH 1IE5A 1RK1B 4I18C 1MIEL 3KPMB 4RMSA 3VXUD 3ARVA 3WD3A 4Q2ZA 2MOVA 2PB1A 4PJBF 2G4FA 1RFDL 3MRKB 2YBTA 1W91A 4L9LB 3CFDA 3L7EA 5D1XD 4HIXH 4PJCA 5IW6B 4CJ0A 1MREH 1N8ZA 5CMAB 3C6SA 3O8XD 1K8IA 1M4KA 4UT7H 4X5WA 3OR7B 3W5NA 3MV9B 3ARDC 4WF7A 2XG5A 4PCTA 1FNGA 4XH2A 1QI0A 3BZFA 1VPOL 1F3RB 4P2YA 1T66D 1O7AA 2XTJC 5GS0H 4PJ9A 5FHAL 4ZUTB 2E8YA 1KB9K 2YOCA 1L0PA 4DW2L 4BQ5A 4P2QB 5ERWA 4UT6H 3O9WD 2PWFA 2PXYD 4N90E 3WDHA 3WDIA 1CDCA 2HT4C 4EDXA 3DRQA 1W1TA 3DNKA 3CFJA 4KZEH 4NXKA 3PG2A 4PJGF 3ZOAA 3BP4B 4KK5C 4K94C 5IT2L 1A22B 4ODSL 2OWWA 3S36L 4X4YB 4BF7A 4F57H 3GIVB 1UWEL 4P9HH 5TPWL 3T0DA 3CMOH 3AICA 5HPMA 3QO0A 1SJHA 5IFTA 2PO6C 3KPMA 3T3ME 3W27A 3TTQA 5C0CB 3MLVH 3RNKB 4PJAA 1CWYA 1XIWA 1XR9A 1NCCL 3DX1A 3VXNB 4ZYKA 1CGVA 4ZFZB 4HA1A 2BNQD 3C8KA 4JRYB 4HULB 1E4MM 4S1SH 2AMGA 3E2HB 3MX0A 4AISA 1AI1H 1QOKA 1JTOA 3A6CL 2W0FA 2B4CL 3HZYA 3ARGD 4KPHL 4OGXH 3WNPA 3DPBA 4R7NA 1NCUA 4H8HA 1NOWA 4YXKL 4L8SC 5C0FB 3U4BH 4PJBA 1ND0A 5E4EC 1JWMA 1L9NA 1W3KA 3RGVB 3QFDA 1QRNA 4U1MA 5DMKB 5E5MB 5HY9B 4N0UE 1IC4L 3IFOA 1U6AH 3Q5OA 4F7MA 4PGEB 3O9WC 4ERSH 2DKSA 5KG9B 4JO3H 5SV4A 2CBJA 1EOMA 2XKSA 3DMMB 3K0WA 5GGQH 3UAJD 5FUZL 1T66C 3WS6A 4TPRL 3WNNA 5DEFB 2ZXQA 1J8HD 3MANA 3D3VE 5TGBB 2PYED 1YEFL 1G9NL 4K7FB 1HJUA 2WINA 2PTVA 3G08A 3DXAB 1N7MH 3IRPX 3O8XC 4O2FA 3BUDA 3GM0A 3RPKA 2FWOA 1MXDA 4XT1C 4PJAE 4OFKA 1DWIM 2EPKX 1FP9A 3WO4C 3KXFB 3OGVA 1U8LB 1QSEA 4M48L 1JGDA 4MNGE 4EQ2A 3S88H 3BKJL 1ZT7A 4U7SA 4PCSA 2EZ0C 4BZYA 3TJHC 2C7UB 2YD8A 1C90A 2WCAA 2H2PC 2I07A 1FHDA 5EU4B 5EMYA 4MJ5A 1JI2A 3FO2B 1ORSB 4MDJB 1NCWH 1N26A 3F12B 3FQNA 3OKLA 5IBUB 3BAIA 2OM5A 4DK3A 3BJ91 1R46A 3BPOC 1UZ6F 3OGRA 4LGRB 1H3UA 1KCSH 2CK2A 1JYNA 4PPTA 2XUCA 3UXFA 2IH3A 1JHKL 4AMKH 2O92A 4ELMA 5A95A 4EAMA 4NGHH 4X99B 4K23L 3F5JA 2X4PA 3VXSE 2FX9L 4OT1L 4GRWE 3DETC 3WDJA 4P57A 5EG6C 2P5WD 1JGDB 4IRSC 1BZ9B 3WD0A 5I8OL 4LLWA 1A1OB 2VDML 3B43A 3JWDH 1CICD 1QFWM 4CDHA 4K7PL 3MROA 4XMPH 1E4LA 4UV7L 5I1LB 3PF2A 5GSVB 3WMSA 3JXAA 4PGDA 4MJ5B 4GT7A 5IFHH 4V2CB 2FCBA 2K3TA 2DLTA 1V0MA 4K7FA 4S1QL 5T5NF 3KDMA 4UFHA 2ZCKL 1OGAB 3O41A 5B39B 3F4VA 4LYRA 3ALPA 5IVXF 4KJPC 4WW2A 3T3PE 3UERA 2DLFL 5ISZE 4PMZA 4U3AA 2OW7A 4TNWF 3I50L 1FNLA 4HW6A 3VNYA 1IM9B 1B30A 3LS4H 1ZANH 4JLRA 4UT9H 5J9PA 1RJCA 2F5AL 4FQQA 5D5MA 2EDTA 4DVBB 5IMLB 3FZUC 3VH8B 3WYRA 4HUXA 4PJBB 5K59E 2PI6A 3MBEC 4FOMA 2FBJL 3RUGA 1CE6B 3BMVA 1PIGA 5EIQA 1QFPA 3OLEA 5T1KB 4TUFA 1OW0A 2W62A 4ZUVB 1GL4B 4OAWB 1J87A 3W25A 5I71B 3VWKB 3QFDB 2VX5A 4GAGL 3ZE2F 5I1AB 1TNMA 5D8JH 1QFHA 3NGBC 3OJDA 4NNYB 4KQ3H 4G6AD 5HGBB 3VRLE 1E6NA 3W6LA 4ZPTA 4M7KH 1UWGH 1VEOA 4KAQL 3M7SA 1HHKA 5IR1B 4JFQA 3D5OF 4HCRH 3T2QA 2O26U 5ITBH 2CR6A 5HPMB 1GZPA 1I1AC 2HVJB 3EO0B 1QNPA 1R24A 1RUAH 2HRPL 4LBEB 4FXGB 4APQC 2ZPKH 1B9ZA 1RMFL 2XIBA 3LKRB 1EO5A 4HV8A 1MJUL 4PMQA 3NTCH 3VCLB 5DS8B 5F3BA 3W29A 4FNRA 4OCSL 3X3GH 1CI5A 5EOCJ 3AROA 5B4MD 5A3IC 2UZIL 3TH2T 1A9BA 2ORBL 4QHNB 5CUSH 1FH5H 1K9FA 2F5AH 2YEZA 2P43B 5I6SA 5F7WC 4ODTL 1ZLVK 1GOKA 1W2PA 3QWOB 3AM8A 1GPOL 4EUPG 2Z92B 4X7SL 2ATPA 2EDLA 3TV8A 4WFFD 1CVRA 3OR7A 3P9LA 4N9OB 2AXGA 5FF6B 1IM3B 1F5WA 2YRZA 4NRYB 5SWZA 4P2QA 1C1EH 1YEIL 4QGTA 3C09B 4X7EC 1IC5H 5CHNA 5D7LB 2NY7H 5A2AA 1AHWC 3CZGA 5IB3A 2IPUK 4Q2ZB 3AHVA 2NY2B 2GT9A 2VAAA 2COQA 5GS1A 1VFAA 1FN4B 3U9UA 1EO8L 3KPPA 1NWTA 1FO0A 1QBLL 4HCRL 3UMTA 5KVEL 4BUGA 3VGEA 3T8XA 5KS9A 5MHSD 1UYWL 5EIVA 4TOYL 1JV5A 5DJ8A 4MD4B 5EFFA 4EVNB 1W72H 4W6XB 4D9QE 2AJUL 1N82A 4AZIA 3VWJB 5I16B 4WTXA 1ZHKA 2PW2A 3U9PH 1OTSC 2BFVL 3MYJA 4OZGF 1V08A 5GRZA 3O6KL 1KXHA 1V6XA 4XUYA 4NKMB 3QUMB 2OK0L 1VJZA 1RZIB 5D6CA 2ADGB 1QLEL 2APVA 5HGAA 1EEYB 3RY4A 1F6LL 4IOFD 2I9TA 4JFTA 2PWGA 2VXTL 1J86A 2YPKB 1AI1L 1WT5A 4BK5A 3SJVB 1MFUA 3ORJA 5C0GA 2V3DA 3PL6A 1TZHB 5DRWB 4ZUVA 2V17L 3QOKA 5LWYL 1ZBWA 1KC5H 4DUVA 3NN8A 3LKSA 1HXYB 2JEPA 4K55A 1DBJL 2R2HA 1MHPH 5TE6H 4XPHL 3WJJC 1P6WA 5HHOB 3MR9A 2JTDA 1NARA 3B3IB 1UKPA 2W0LA 4NO2B 2QSTA 5I1EL 3N06B 3D2UA 2Q76B 1R5WB 3VFTB 1HHJB 5A2CA 1JNHB 1T1ZB 5E56A 1YEKH 1BVLA 3H9SD 3KS0J 3EZ8A 1Q0YH 4G9DB 4P99A 4P7LA 2YPLB 5D7IA 3WSUA 1WB0A 5DEZA 4JDZA 5I1KL 2A1WH 2EIZB 2H2SC 1BOGB 5IVXA 3SDAD 4MNQD 3UTTA 2WBGA 1DVFA 4Y5YB 2Z8SA 2AJXH 5E99H 5F9JA 3W6MA 1VESA 1MW3A 1A2YA 2D7OA 3D69A 1IJ9A 4D9RE 2A73A 3VA6A 1K9DA 2CRIA 3RILA 1RJYA 4X6EB 3RKDC 3MV11 5LAXB 1H11A 2M26A 4QWWC 2O5ZH 3SKJL 4IS6B 3GMQA 4XVTL 3LKNB 5HVWA 1ZLUH 5KVGL 3KLAB 2DLHA 4WI6A 2EZ0D 4HJGB 4Z7QF 1I75A 4GAYB 4XPHH 5ABFB 4XAWL 1GGBL 4AM0B 2WZIA 1DVFB 2YZ1A 2NY4C 4HZLA 1ORSA 4MDJA 5EPMB 2E6PA 1Y6MR 3OKOA 4NO3A 4PB0L 2I07B 3UJIH 1BFOA 4PSRA 4GXVH 5JQ6L 1G0YR 5IQ9B 4RAUB 2QSVA 5BRZA 4JPWH 3IT8D 3QNZB 5FHBH 3RZCD 1JP5A 2ZKHL 3ARXA 4PJ9C 5D2NE 1JNHA 1T1ZA 3RGVC 5A16B 3NA9L 1Y6KR 1XR8B 1U8IA 3WJJA 1R5WA 4P5TC 3RWEA 3LQZB 4MAYD 3VXRE 1TVHA 1C5BL 4OLEA 4KKLD 3ISWA 3TT1H 3T2OA 3SO5A 2ILLA 1JF5A 4FG6D 5A69A 1BHGA 4I3RL 1AFVH 1KF9B 4J7RA 4TSAH 5CJ8A 1MWAB 4OM1L 1E4WL 2FE0A 4ONHA 2BSED 4HHAA 3LEXB 1ZLUK 4PJDE 5FM5O 4HIEA 3ALFA 4GKSB 1S9XA 3PWPD 4C4KO 5M03A 3GXTA 1RJZA 1QR4A 2I9LA 2BV9A 3WEOA 1CFVH 4ZTOH 1JGLL 1KIQB 2EACA 1RPQA 4UFJA 4LMQI 5D6CB 3ROLA 1KC5L 2APFA 1DQML 1EX0A 2X4SB 2YN5A 2ICWJ 5J13B 4WGWB 3ROOA 5FEBA 1NLDH 3TO2A 5DRWA 3MRGB 1HL9A 5FB8B 3D85D 3F65A 3TO4B 5C0GB 3LD8C 2JJWA 1A7RL 3NJ3A 1HQRA 3S3PA 5DVNA 4JGUA 4K8RH 2EH7H 3GO1L 1UCBH 2V2WB 4GG8A 2J3SA 3LY6A 5DJ8B 4C54A 1OAXL 3QFJE 1VFMA 1G7LB 5AC5A 5F9AC 3WKMH 4NSBA 1MRFL 3GSVB 2WQ8A 4PMDA 3OPZH 4PRID 5JW3L 4JPVH 2X4TA 3PP3H 5C0EA 2X0HA 5CSZB 2E7BA 3VWJA 4HK3J 1BGXL 1HNYA 1MCKA 2PF0A 5CHNB 1NFDF 3SURA 4HWBA 5JXEA 4P49A 3MA9H 3BP4A 4Y7EA 1D5ZA 3QULA 2VQTA 2YS4A 4XZUA 4JGMA 4XPTH 4XP5L 4EDXB 1Q38A 2EDYA 3WD5L 1OAKL 1S7RA 5I66A 2UVFA 4JVPA 3REVB 1BYBA 2LE9A 3TT3L 1JMXA 2CDFB 3CXHJ 4YIQA 1B0RB 4Y8DC 4E41D 3TVMB 4QLLA 4R27A 3EGSA 1R3HA 4PJ8B 2IFGA 2F54E 2VCAA 2Y5EA 1KTDA 4UOJA 3KLDA 3W0WA 2MJWA 1DL7L 3B9KD 3DSFL 1E3XA 1OLLA 2QADB 1AY1H 1G1YA 5GZNC 5DS8A 3H0TA 3CHEA 2OJEB 2Y72A 2ZOXA 4AZ8A 2Y6SC 2YL5A 3OTTA 2X1OA 3GGWB 2J7CA 5CBAB 5A2IH 3V79C 4QTHB 5D1ZC 3WFLA 1LEKB 3EJRA 1YMMB 4PGJA 1DR9A 3EO0A 5A6LA 5D72H 2A9MH 4L1DA 4X0VA 2KBGA 3T2NH 1HHKB 2QSCH 4RMVA 4GAFB 2VDPL 2Z93B 4GI9A 3LEVL 4K9EC 1WEJH 1FO0H 3MLSL 4IOIB 5H37H 4LOUC 2FB4H 3S6CA 4GW5A 4Z7WA 5FIEA 5D9SA 5FKYA 3R06A 4H26B 3FN3A 4OZFA 5JR1L 3U0WH 4WUKL 4OAWA 4LXFA 5F89A 2AQ3A 3UC0H 1DQDL 3I2CH 4I4WB 3IDIA 4YE4L 1O0VA 1ADQL 4KROC 4M24A 1CK0H 1I1WA 5ENWA 2HJFB 5K9OB 3QEUB 1CBGA 4ATDA 1AVAA 3N15A 1U8HA 1S9YA 2EYTB 2KQNA 1PGRB 2AJSL 3LPOA 3EHBC 1SYTA 2XOTA 2BVTA 4LL9A 4PS4H 2VDLL 2AP2A 1P4BL 2F5BH 2DM3A 3K81A 4MSWB 1B6DA 1CE6A 2A83A 1HP5A 3C8DA 2DL2A 4QNPE 5FOBA 1GIGL 1E0WA 2H6PB 1MCQA 1G9EA 4X6DE 1KCSL 3IJHA 2VLKE 4UNUA 1OGTB 4UT7L 3NCCB 3MXWH 2QMKA 4YHGA 3SKJH 1DQJA 4KRPD 4PUDA 3RWEB 4PJEB 5GSRB 1QPKA 3NZ8A 1MJ8H 3QHFL 4XCEA 1CLOH 3S35L 1UB5A 4FG6C 2DIJA 4U1HA 2YDSA 3KYKL 4YBQD 1FP8A 4HK3N 3T0EB 2UY5A 5F7EH 4TX8A 1KTLB 3UYOD 4PJFE 1S9VB 4MAYC 3VXSA 5GXBB 1W3LA 1ZVSA 2VZTA 1UR1A 4W6WB 2YBRA 5BROA 2ZG3A 4UV7H 4ZD3L 2OQJB 2VLLB 3HRPA 3BN3B 1AQDA 1KOAA 4GRWF 3MROB 5FGSA 3EDDA 5HDOA 4CKQA 3CU1A 2OYPA 5IHBA 1MRDL 4YR6A 2GJJA 4WJXA 4AWEA 3B5GA 2WCSA 4ALAH 1YQVH 3KPNB 4DZ8B 4QXTA 1A64A 2CO6B 5MERA 5DK2A 1FORH 1CR9H 3VH8G 4YEEA 2VUOA 3LXAA 4QXTB 4PJ7A 1INDL 5DYOB 2X2IA 5IBTH 2GSIB 4TUKH 3T0ED 4X0KA 4DN3H 4JN2B 5EUOA 3TF7C 4X6BB 3ZJKA 1WKYA 1UQSB 3I75B 4MLIA 5DVKA 4P7RA 3CPUA 3W28A 2YA1A 4EI5B 5LGJB 2NW2B 2VLLA 3C5ZA 2AXJA 5IBLC 4O02L 4Q9RH 1F2XK 3FO2A 1HINH 3VG9B 4NWUH 1E9LA 1JPFB 3NCYS 5DC9B 1JNJA 2X1QA 2JLLA 4QOKD 2XN0A 2BVEA 4H8WL 4MXVF 1I1XA 2Q7YB 3K2UL 5TQ0L 3N1PC 3DUUB 2X4RB 4XVSH 3MODL 3SEPA 4FTVB 3WY1A 2O9OA 1CF8L 3DMMA 4D2NA 4ZPVA 2WMFA 1IC5L 1S7TA 4NNPL 1T1XB 1XGTA 1YN7B 4LQ1A 1XHGA 3E1F1 3EJZC 3IU3A 2WAHA 4YUEL 2WINB 1S7VB 3FQWB 1FGNL 4A3HA 2F58L 4F33A 3KR3L 3O6AA 1OAXH 2R2HB 1KB5H 4MQSB 1CQKA 4B7IA 2QLVB 5HYJA 1JZ8A 1KPRA 3NA9H 2VIRA 3PDOA 1C8PA 4U1LB 2HT3C 3M07A 2V5TA 5I75C 5KG9A 1AP2B 1BGAA 3P30L 2XN9B 4PJ5E 5F89B 3DYPA 3Q6GH 5IB2B 2VQ1A 4LDOB 1B3ZA 2FD6H 3QDMA 3DO7A 5EBGA 1T4KA 3D25A 5L2JB 3QEUA 3PGFH 2MWCA 1UACL 2BZDA 3VFNB 4PJAB 5BQ7B 2EYSB 4HLZG 2BDNH 4ZXBD 2HMID 3VG0H 2D7NA 3IS1X 5DDHA 3CMOL 4DWSB 5DGRA 2VVNA 4ZXBC 4MMXC 4NZJA 3GGWA 3G5YA 4OZFB 1UHVA 1BAFL 2P8MA 2NXZB 1VGEL 1QO3A 4QHUA 4V2BA 3BPLC 3HZMB 3WUWA 43CAA 3OZPA 3H0TB 3VGAB 2VLJD 5IG7A 4LPCA 6A3HA 3BUYB 2HFFA 3TZVB 4JM4L 3LH2H 4M6ML 4EBQH 4X98B 4X9BA 5GS1B 4QTHA 1DE4A 2AXFA 3RA7L 4NBXB 2FYYB 4J1UB 4XWGH 4NQDD 3FKUS 2UY4A 1P7QB 4ONOA 4UDUB 4YXKH 2NY0C 3CFCH 2CIPA 3FO1A 3CFJB 2PWDA 1I1AB 2E7MA 4G3YL 4P5TB 5GJTL 3EOAB 4PJXB 3GH7A 5FOOA 1Q9KB 3UPRA 1MPAH 1WZLA 3EJZD 1OP3K 1GOGA 2AGJL 3O11A 5L6YL 3T4AB 1UCTA 1RH9A 2ZSWA 1Q9OB 1T7XA 1MF2L 5I1HH 2ZCHL 4ZUWB 1NQ6A 1GYAA 1RUKH 1WWCA 5KSBA 3AYRA 3SGEI 2E9JA 4QRUA 2DAVA 3RU8L 4XCNB 5JW4M 4F7EA 3TBWB 1SY6H 1AQKL 3LRSA 1OGAE 2OP4H 4PRIB 1WF5A 2O5YL 4M9PA 3IKCA 3VDBA 3IAPA 3RVVD 3HUJB 3QBTB 1MCSA 1R3IH 3GSXB 1HN1A 4GG8B 2J4GA 3MGAA 3L7EB 1QWNA 1BAFH 4NQVB 4PJHB 3I3DA 4Y2DD 2W9DH 3MRMA 3HE6C 2HG5B 4Z5RA 4LBEA 5D7SL 3OHXA 4YHOL 3MRGA 3EO9L 3HCVB 5A3ID 5B4MC 2EPOA 1RZKC 3H7LA 1AXTH 2E9MA 4I0CC 1G0XA 3P4MB 4Z7OF 4XNQB 4K71B 3TOPA 2AEQH 1D5BB 1OP3H 3DGGA 1INEL 3MQIA 1VGKA 3RWCA 3KPRE 3QOMA 4OLXH 3ULVE 1CZ1A 5EBAA 4KUZH 4MJ4A 1OCQA 1QNOA 3OB0K 5D2NB 4PBVC 4HC1L 1OAUL 3Q6FB 2GY5A 1YNLL 1U8PA 4N8CH 1MJ8L 4G6AC 4WO4C 1LQSR 2V2XA 3PQYD 1BD2B 3I9GH 4HKZB 5DJZA 1MCDA 5JIIA 4JRXB 4ONHB 3FFCA 5EUKA 3WLBA 3S4SA 3WD1A 1I85C 4F33B 2Y36H 3GSNL 4HUXB 4JHZA 4XNZB 4KH2A 3S88L 5D5MB 4XGZA 5BCAA 4FXKB 5ADOH 1WZAA 4R4BB 1U91A 1DLFH 1LE5B 2AJXL 3V6ZA 2HKFH 4OIAA 3GB7A 4NHCH 5TFSL 4ZNEE 3HPJA 3VE0A 1N64L 2IG2L 1IKNC 1S5IL 4HOWA 2X4RA 4XCCH 4V2XA 3C5JB 3MLUH 1MJ7H 2WHLA 4HHAB 3SDCC 3SQBA 2Q7YA 3FZUD 3GBNH 2XACC 1SJXA 4U6XB 3DC0A 5EU3A 3WFEH 5BZDB 3P9MB 4I48B 3L3IA 3QQ3B 4NQCA 3CH8A 4OCWH 4NPYA 3OR6A 2QQNL 1NWRA 1TJGH 3I75A 4NN6B 3QH3B 1JGEB 4JQXA 3LKOB 1PYWA 5MEOA 1JZ6A 2AJVH 3ARBB 5BRZB 4LYQA 1R75A 5DMYA 4KZDH 1HKIA 3IFLL 4QFUA 3ZJ8A 2FX7H 5AD0B 3M8OH 4KHXH 5I9QC 4PTTA 4R7DA 1UD3A 1KBGL 2JF6A 3K2UH 2X6MA 2Y7QA 4I5BA 5D7JB 4TVCA 3SE8L 3ARBD 1FZOA 4WU7A 3NCJH 1PSKH 3VM7A 3KLAA 2WBJA 3B8YA 4X5LA 4LIQE 4I5BB 4M1GL 3VIOA 2R4SL 5F7DA 4Y5YA 3U5UA 1S7XB 1UVQA 3NPZB 3PABB 1J05B 1Q8MA 2NY2C 2GKIA 3CVHA 3EOYG 2PTTB 3MRHA 4KMTH 4QHLB 3TWCL 1BOGA 1E4WH 4X7TA 2DQJL 5GGTL 2ZNXA 2IPUG 4LARL 3F8UB 4X7CC 5F6HJ 3BO8A 1ZT7B 1PKQA 3AY4C 2QPUA 35C8L 3NABH 5MHSE 4MJ6A 1TITA 3RFZC 5IROA 5EZOH 4X83A 4DZBB 2ZX9A 1AO7D 4PJAF 4Y16B 4NZRH 3GXDA 5SWZE 4GLRI 1AGCA 1CDIA 5I1JL 3GMPB 4BZ1L 1T89A 5DHXB 3RJYA 1T0NB 3E2HC 6CGTA 3DWTA 4IJ3C 3MGOB 2AJZB 5I8KL 1ZVYA 2CK0H 5J7CC 3MV8B 4ZS6C 4PJGA 5L0QC 2D03L 4XI5C 2J25A 4O4YL 3L5JA 4UOW1 2CETA 2BY3A 4M8UA 3RVVC 1T22A 3RWHA 4NX0A 2BOBA 3ESUF 3KPOA 4KRLB 4XGZB 2P5EB 1NEZA 4UIMB 3V0VB 5C2UB 2UVEA 1NGWA 2DYPB 3J8F7 3TT1L 4PGZA 3SCMA 1W1YA 4RE4A 4S3KA 3FO9B 3C08H 1YPZA 3JTSB 2J62A 1T3FA 2NLJB 3PNWB 1JK8A 3P4OA 4ZOCA 1WICA 5FO9A 3T0EE 4ERSL 2CHNA 3LXCA 3GHBL 5ID1A 5F7YC 1OWRM 4NZUH 3HZ3A 1F58H 3NBNA 2ORBH 4F37K 3ALXA 5T5FH 1FZKA 1A3QA 3SUTA 3ARGC 5EUOE 3BYYA 3VXMB 4I13B 3QQ9D 2ZPKL 4JFUA 3WF0A 1DEEB 2CKBH 3WFCL 3HCVA 3G6DL 1EIBA 2SEBB 1Z9OA 4ZSOE 4D9LH 4H0IA 5IBTL 4DGYH 4FQXA 1QNZH 2Y9RT 4J3VA 3X17A 1N5AA 2NX5E 2OJEA 1R34A 3AY4A 1S9KC 2VXVH 2RGLA 1T80A 2ITDB 1PG7L 1SMDA 4ELME 4NUGL 4HZ8A 1FZJA 5BS0E 3AS3A 2WMIB 4N1HB 4HU8A 1T20B 4P8VA 1QPPA 2GTZB 3GHEH 4NFDA 4BA8A 2HT4D 3PGDB 3WH8A 4LHUB 1MELA 3VX0A 3O4LB 4J6RH 4FQ1L 4OD2B 3PP4L 1DBAL 4RGNC 4Z7NE 3GHBH 4P2OD 5F3BB 1TVPA 4NKOB 2GJZA 4KKLC 3RVXD 2XTJD 3EOTL 4D6JA 5IBUG 1KLUA 2WZPD 1EZVX 2RAMA 1LHZA 2A77L 1EDGA 5FCUL 3QIUA 5ABEA 4CD8A 1MEXH 4L8SA 4XP6H 5CKGA 2AXFB 1NLBL 1E40A 3TBSA 1GAFL 5F7NC 1MQQA 4BQ6A 5KJRL 3RUGE 4G8EB 3TTSA 2XTJB 3CC5A 3KPSA 5D1XC 2L4OA 2VDQH 1L0YA 3VXRD 2XICA 1C5CL 1NCDH 4FTVE 4JZ5A 3VFPA 1MCWM 1C7SA 3MNVB 1QNZL 4HV8B 5EORL 3VFMB 1RIHL 3HG1E 1TQTA 1QEWB 2ZJSH 3G5VA 2VITB 1YYLH 4C56A 4CCDA 3THCA 1Z5LB 4XNYL 5BVPH 3AHTA 3MRDA 3OV6A 3QHMA 4QWWD 3GSQA 2Q87A 3JTSA 5KVFH 2R9HD 1ZGLM 1VF8A 4DUWA 5EO0B 3TN0C 5CSUA 1RV6X 1J88A 4UZUA 3RY6C 1OF2B 2ADFL 3TNNA 2ICCA 2JCCF 3FQUA 1FPTL 4MMZC 1L6ZA 4JHAH 3S9DB 3RWHB 3U0TB 5EC2B 3UTSD 3T0EC 5BO1H 5C0DB 4I8DA 5GRJL 5T1DL 3D0LB 2Q8AH 4EOWL 3EBAA 2YL9A 2LTQC 3KG5A 5TF0A 5GRJH 3SDAC 4DM2A 1FFOA 3FY1A 3BGAA 3RX5A 1AXIB 5DD3L 2P5ED 3ULUD 4NIKB 4RMWA 1BD2E 2DTSA 3MGTB 1RUQH 4QAWA 3JWOL 3QCVL 3Q3GB 5I0DA 1H09A 3FNDA 2JJUA 2R0ZL 4U6VH 2DH3A 4S11A 1K8DA 1KT2B 1J9YA 5ALCH 1IM9A 2HVMA 5M94B 1W1PA 5A16A 1UM5H 4ZE5A 4POYA 2B1AH 3DUUA 3TYFA 4M7JH 4WW2B 4KDTC 1VENA 5C1MB 4J3TA 1OT1A 4RIRA 4Y4FC 4H41A 4AIZA 4PG2A 4QHLA 3VFGL 2R1WA 1HH9A 1LD9A 4PTVA 3FRUA 3MMUA 5LGJA 1BZQK 1XGUA 3O81A 1OQXA 1AH1A 5HYSA 3A22A 4MAYA 1Z9SA 2GIYA 3FQNB 4E41E 4JL1A 2R1YB 4WY7H 4IUGA 3BSHA 4HBQA 3D3VB 1G7QB 3DROA 4HX1A 1DQMH 5EU6A 1J1PH 5AD0A 5K9KA 2A6KA 2B2XH 4KGJA 2EDNA 3D3VA 1AIFB 1TCMA 3VNZA 4NQCE 3S37X 3STBA 1ZS8A 2XZCL 1OTSD 1DBAH 2LQRA 5CJBA 5B8CA 3MRQB 3GSWB 5ITBL 2VDRH 2EPNA 4WFGD 4JN1L 5I1IH 5KTEH 4AG4L 4O5LL 1DN0A 3RZCB 2YBRB 4NQUA 2FX7L 5JBEA 1I9IH 3T0AA 4JHWL 3OJ2C 1XGRA 3I3BA 1PVHA 3KWWB 3PN8A 3DO3A 1RURL 2HLAA 5F6HI 3FCTA 1MF2H 3HG5A 1SM3L 3OWEA 2VDLH 3UROR 4GO8A 2VL4A 4O2FB 1DLFL 5FKAA 5GGRY 4HMCA 1X6NA 3FT3B 3UG5A 2VZOA 4TUOA 3PDGA 3BHBA 4LLUB 1W9BM 5IB4A 1MFEH 4G6KH 1NGXB 3M46A 1CPUA 3LKPA 4Z2KA 4LPXA 1UXWA 1UZ1A 4JM2F 2IC2A 4WY7L 4KWUA 2D0FA 1NCCH 2FJHA 4LK4A 3P4LA 5BXSA 3F7QA 1QHPA 5GZND 3UCQA 4F7MB 3SJVA 3OL2A 4HPHA 4OB5H 1HKFA 3A6BH 3B9KC 2VC2L 1VGKB 2UWEF 3N0PB 5D5ME 1Z2KA 1UKQA 4JRYA 4K9EH 3DGGB 5EWIH 4N8PA 4WI3A 5DK3A 2NXYC 3VTRA 2VUYA 1OGBA 1FNFA 3TIEB 4OZIB 1EFQA 1SEQH 5FCSH 2VO5A 4M03A 2DT1A 5CEZE 2IQ9L 3HZKB 5D72L 3PJSB 5DJCB 3ULVC 2FDMA 3VFMA 3MRMB 5ABHA 2NX5B 1MLBA 2CLZB 4DM1A 1RQ5A 5KSBE 4M8VA 3BUTA 4C55A 1XCQB 2IBZY 4JFDB 2G60H 4NJ9H 3UJTL 4ZSOB 5H37G 5HDBF 2HH0H 2OP4L 5CAYB 3OAYH 4TPRH 1ZA6A 2XPGB 1G7MB 3MLTB 4LFHD 1FP5A 4D1IA 5BW7C 3HFMH 5GIRA 3FONA 3R0MA 4JFEE 2H8PA 2F2HA 1JE6A 2WZEA 1RU9H 3O2LA 3PWUA 1MI5B 3S5LG 1C5DA 4HK0A 2ADIB 4PGBA 2WKGA 5E1QA 4U1NA 4XC3H 5IMOA 3LN5B 3HI6H 3MUIA 2DQCH 4U49A 2BVQA 2Z92A 3RBGA 5TE6L 3GXMA 4GAJH 1X7QB 1MFDH 4E42B 3AIRA 3VXUA 5T5NG 1T03H 1KB9J 4JG1H 4ZUTA 3TO4D 3BGMB 5J6HA 3MRKA 4HWEH 1V7MH 4U05A 1G6RA 2Y06H 4IISA 3L7FA 3QEQB 3N1AA 1P4LA 2E3VA 3F7PC 4ZNCD 4LEXH 5CEXB 1JYVA 3FMGL 4FNTA 2AEPH 2GUOB 1CFQB 2BRRL 5E00B 1Q0YL 5FUZH 4P3DB 4KRNA 5T3ZE 4IDLA 3QXAB 5FECA 3A5VA 1LK3L 4PG9B 1HJQA 4OCRL 4YHMH 5JO5B 1GQIA 1R3LA 4TQEH 3X13A 1FIGL 4JL2A 4U1GB 3D85B 2W91A 3DETD 4PRWA 4ZPTB 4OI8A 4MZ3A 4P5TD 5EOQL 2XN1A 2WC3A 1ES0B 3IDYB 5E9DA 1R5VB 3GBNL 2D23A 3L4YA 4LCUA 1I7UA 3CLWA 2WHKA 4YHZL 3WQ5A 3RDKA 3WF1A 3IXAA 3GJFA 4L8CB 2YK1H 3QWRA 1NPUA 3QXDA 1GHFH 2BSTA 4K7PY 5KVMC 2VDQL 1GOWA 5C8BB 3CDCA 2AQ2A 4MS8C 2NY4D 4I77H 3BQUD 2EXOA 2X4OA 4CVXA 3QHTC 3GJEA 4JANB 4XCFH 1KGXA 1CLOL 2P5EA 2C1OB 3BQUC 1C91A 2G3JA 2FRGP 3R8BB 3M1BA 3IU3B 3UCRA 3K3QA 2BC4A 4G8GD 1KACB 2OBGA 1VBUA 2BHUA 5JUVA 4FTVA 1QNRA 3BT2H 4PY7B 2J5LB 4BH8B 4AL8L 3GM8A 4HC1H 3ZLQC 3NCOA 4UOW0 5C92A 4DEPC 1XGRB 4KVCL 4F8TA 2PYFA 4AYFA 5A6SA 2ZP0T 5EOTA 4LSSL 1RSFA 2R0LL 3D6GA 4F7PA 1FCCA 4O2EB 5GS0L 5CEZH 5JLZB 1UM5L 4YN5A 3A23A 2DI7A 3LQZA 4ODVL 5I23A 1RHHA 4QRSB 4UUJB 5DVOA 1BGXH 1AD0A 5IIEA 4NT6A 3DX3A 3ZDZF 1NFIB 5E08L 3AMCA 4WCYL 5DD3H 5ESQA 5FYKH 1HDMA 4B15A 2X89A 2FEEL 5HDQH 3L6FA 5J1TC 2ADJA 5EU5B 3T65A 1E6RA 1LL6A 3DTXA 4UQ3A 1VACA 4NM8L 2OSLA 2R1YA 1YDPB 1X5FA 5C0JB 5BXRA 2VABB 4OBSA 4N9GA 1HQ4A 4Y4KC 1FVCB 1BP3B 1KV3A 1OAYH 4MHHI 2UZIH 3LKNA 1NC2B 2R2EB 5DD6B 4X9IA 3A67L 5JXAH 4FXLA 5BZWB 2R1WB 2HKHH 2LABA 1RZJL 5I8KH 1CT8A 4D6HA 1BD2D 2PN5A 3DI2B 5ANME 1IQDB 4HKXB 4X6FB 3LQMA 4GQ9L 2IGTA 1WDQA 2R69L 3C9NA 4DKEH 1J0KA 4L8BB 5DVMA 4BZ2L 5EBLA 3FQTA 3NMEA 3UTTB 1DQJB 1L6XA 2FL5B 3PZTA 4F7PB 1MVUA 4AMKL 1E0VA 1Y7VA 4KTEL 3NFSH 2DTML 3IJHB 2KKQA 4O2CB 3BVNA 4EBQL 4JDZB 3L4UA 1P84K 2IPKB 1I85A 4P3CL 5DUML 4RX4A 4CD6A 4A6YL 4G80A 25C8L 2ZOLB 5J4MA 5L2KD 3B6SB 1P1ZB 5BJTB 3ULVD 2DICA 1FBIH 1NGYB 2XKUA 5EIIA 5FCZA 1I3UA 2B39A 1NANI 1A7PH 1AGBA 1G6RH 5BOPA 3WELA 1WP6A 4YFLI 3EYOA 2X40A 3I84A 4WW2C 2IH1B 3PQYE 2EE9A 3BKMH 4WHTB 5B39G 5HHMD 1QACA 2FO4A 4AZCA 5JOPE 2W0FB 1YY8B 1I3GH 2DLFH 5MEPA 1WAAF 5ITFA 4HXBH 3KXFD 5D7LD 1ONQA 2W9EL 4JO1H 1C93A 2V5DA 1GZQB 3LH2L 4AEFA 5F44A 3QIBB 4J3UA 3TPUA 1OAZH 4R90L 1A3LH 1N4XL 3EFFB 2XWBB 3AGVA 3ZKMD 2VLME 3VX1A 1MI5D 3QDME 1LK2A 1U6AL 4I0PD 5JOFB 1M7XA 3MYJB 2L7UA 1YMMA 4L1HA 3N17A 4C58B 5ABGA 1MQKL 1R3LB 4CJ1A 3U0WL 3WXVH 4WSKA 2CLRB 1FSKB 3MBXH 1P7HL 2R4RL 4P3DA 3AVEA 1J1XH 4P5KA 1TZ7A 2PCPB 2R0KL 2VZ1A 5K33A 1FBIL 1KJVA 5E6ZA 4GMTH 1G7PA 1PW3A 3QJHB 3P77A 4UAOC 1I1AD 4M7KL 5INDA 2X7LB 3G9VA 5MENB 5HXMA 2RBLA 3SE4A 1GGIH 4KVNL 4U3XA 3TV3L 4X5XA 4DJMA 3MLVL 4HJJL 4R0LA 5D96B 3S7GA 4O58H 2IMNA 3HI6L 3KLSA 3MV9A 2BFVH 1DL7H 2PNDA 3DSFH 4LHJB 4D8PA 4KKCC 3VXRB 3PWVB 4WU5A 1PEWA 2DT2A 5IHZB 2NMSA 3KZSA 3KYOA 4MXQC 4U2YA 4DGVL 1QQDB 4Z9KB 3EAKA 2ATKB 3CFDB 3QA3B 3W2DL 1W32A 1G7JA 3CX5K 1XF5B 1FYHB 2B4CH 4PJ5A 4YHZH 4XNYH 2EYRB 4G42B 3AM8C 4S0TD 4KDWA 5C07E 3VRIA 1DP0A 2W65A 2E7CA 3D39B 4G5ZH 3VRJA 5EU7E 1LO3L 4YFLF 1FYTE 5C2BL 4HWUA 3EFFA 3GHEL 1I4FB 5FO7B 3SDYL 1AO7E 5EBWB 2CLZA 4U1IB 2VISB 1I1CA 5F7EL 5IDIA 3W11D 4P2QD 4UTBL 3HUJF 2Y07H 1RIVH 4R2GC 5TDOB 4F7TB 2G41A 3QHZL 5FL0A 3MUGB 1E5JA 1HEZA 4HPOL 4L5FH 4JFED 3DVNB 5KBNC 2YSSA 4H8UA 1G1CA 2APBA 2J8FA 4JM2D 5AC4A 1QR1B 2DQTH 4JHOA 2DQGL 5IMMA 2EDRA 4RDQG 5CP7B 1NGYA 3KE0A 3MLWL 2E9IA 1XF2A 4YDVB 3FQRA 1A1NB 3ZTNL 4JRYE 3AXLA 3CXHK 5I74B 3IDUA 4HIJA 6TAAA 1JNLH 3QDGA 5ADOL 5KOVC 4OV6F 2XQBH 3RX7A 1CYGA 1TMQA 2IAMD 1IAOA 1CFNA 1MVUB 3T3PF 4KU1A 3O3DB 1L9MA 5FKAB 3WNLA 4AJ0A 3ES6A 5CJXC 5CILH 4DZBA 2R9HC 1A1MB 1EGJL 2AK1L 2DI8A 1H15A 1XR8A 1OBAA 1WFTA 3WL1A 2C3GA 3POHA 5DT7A 4Z95L 3PZIA 2UYLB 2OXHA 4HAFA 1NUDA 4J6RL 1AQMA 43C9A 3RI5K 5T33H 3CVHB 5DFWH 5D9MA 3G5ZB 4PB0H 5F21B 4OLVH 5JZ7D 1P6AB 4U0RB 3B2VL 5JA9A 5TQ2L 3DSNA 2DQFB 2YUXA 3PIQB 4OSUL 3G9AB 4M4PA 1SEBB 3FN0H 3TFKC 1B31A 4Z7NF 2J79A 1NSNH 5GGSA 3DXAD 3MLRH 5JQHC 1A6UH 1NGPL 3H9SA 1WC7A 5FUCE 3MNZA 4FLRA 3RDTB 2OTWA 4Z7VE 3BLKA 4MNHA 3C08L 3O4OC 1S3KL 3L6FB 2X41A 3UZEA 1EXUA 5MERB 2A3AA 1HCVA 2EPMX 1RJYB 4BUHA 2Z0BA 5IVNA 4RGND 4MNGB 5DUMH 4MPKA 1V8HA 3T77A 1OQOA 2A74B 4C7DA 4XZBA 4M7ZB 3LQAH 3HHRB 4W4OA 3SY0B 3RAJH 5K59F 4QRSA 2X1IA 1R3JA 1VJSA 4JFWA 5GGSY 5E99L 2UY7A 1WIUA 3IDGA 4FK9A 4NWTH 1ZAGA 1SR0A 1WBYA 2V9TA 3WBEA 4TXEA 3DARA 3RWDB 1ZVSB 1LD9B 1Q94B 4G6JH 1YECL 1NGQH 4QRPD 4FQCH 4LLMB 3LEYL 1EHLH 3D18B 4KK6C 1IILE 4AIXA 1G0CA 4NCDA 2X9YA 3HPJB 1FAIL 3W81A 5ICXB 2Q76A 2CCRA 2VCCA 4K71C 2R2BB 5E5UB 3BFOA 1Q9LB 3G08B 5I30H 3HAEB 1RUPH 5AWNL 3C6LD 5HJ3A 1FFRA 3QHZH 4PJEF 3GMOB 1U42A 5FK9A 5I30L 5T1LD 2GFBB 4DK6A 5E9DE 1DDHA 4AL8H 2Y8VA 5C8JA 1IL1B 4LSPL 4NNXB 5JHDA 1NAMA 1I7ZA 5JHLH 1QVOB 4KK5D 4S2SA 5FYJD 1B0GB 3BUIA 4JB9L 4PRPD 3LXBA 5A6MA 5B38A 5E1AB 3L4VA 4N42A 4YHYB 4JZJA 1UM6L 1F00I 4OD3H 4OLUH 5E8PA 1FHLA 3MSPA 1MCJA 4WI8A 2OK0H 3H9YA 1VFBB 4P5MB 5EU7C 4GBXD 3BIAX 3HE7D 3OHXB 1OGSA 3ARDD 4F57L 5CG0A 3ZSTA 3U30B 3MNVA 3W39B 2A9NL 5EBWA 4ZFZA 2C9AA 3MTRA 4IOIA 3SGKA 4MADA 4ESKA 4OCMC 2VLJE 1OB1B 3HMCA 4GRWB 2FECI 3NCFB 1CBVL 1WV7T 5DA4A 4OJYA 3RUGF 4PB9L 3HNTL 3S35X 4FQ1H 2BJML 4BFBD 4RNRB 4UV4H 4HWBH 4G42A 5CBEA 4U31A 4WHCA 4PJ5B 1DSFH 4FFWC 3S97C 3QA3A 1BQLH 2CIIA 4V1DD 4GI8A 2R69H 4KPHH 3N9GL 3PUCA 5JW4R 1WBXB 1E15A 2VOTA 5FHBL 3D0VB 3WCYA 3SGJA 1G7HA 4JR9L 3EOAA 4PJXA 1QLFB 3RPMA 1BQUA 5IFJB 1S7SB 4K3EL 3OF6D 4IRJD 2ZUWA 1AKJD 4R3SB 1KIPA 4OUUA 4PJ8A 4N0FA 2A6DB 3UTQB 2F53D 1KIPB 4OUUB 1RIUH 2XJ7A 5D7LE 4UDTB 2WM0A 3ARBC 1W8NA 4Y2DB 2J47A 4JKPL 4OM0H 5CUSL 4KY1L 4HPGA 1F2QA 1CXEA 3UG3A 3CSPA 4TUKL 3MFGB 2WW8A 3VCLA 4W5UA 1PBGA 1D5ZB 3QULB 4ODSH 4WHDA 4AH2B 2DQHH 2WVUA 4FABH 3UR7A 4NQED 3LS5H 1JGLH 5DDHB 3L5IA 3JTTA 3WLWD 5GNZA 2XZQL 4AYGA 3VI4F 3NFPA 4CNIA 1V7ML 4AMWA 3B9KA 1MY5A 3GXNA 3O3EA 2FHBA 2IQAB 3W39A 1Q6DA 1AY1L 4GXUM 3PXJA 5GGVH 1SYSA 4J4PD 1BMGA 3C60D 5D8WA 3TO2B 4YXLL 5INCA 4V28A 2VIRB 3PDOB 4KAQH 1US3A 4BM7A 1JPSL 4HKJA 1RP8A 5F72S 4XRCB 3UTZA 5IQ7H 3T09A 1PKOA 1DUYB 5IROC 5BXFA 4JFDD 2FGZA 3NYDA 3BHBB 1CIDA 2ED9A 3FT3A 7CGTA 3LV3B 3QO1B 2VQUA 1D5IL 5HHXH 3B6SA 4OOUA 4Y16D 2AAAA 2G3NA 4OCYH 5HVHC 5I8EA 1TQBC 3AFBA 3RQ3A 1NBZB 1QKZL 4LEOB 5B39A 4PJ8C 4NKIL 3WQ8A 3U7WH 2XGBA 4MD0A 4PGDB 3H7BA 4M7LL 1FAKT 5JMOC 3ME0A 2QMJA 3T3MF 2WZHA 2NYYD 1SM3H 1QSED 3GKWH 3WEMA 3HMXL 3CSYA 5L88L 2UUDH 3QP3A 3X14A 1E72M 3MRQA 4HUNB 2RHEA 3GNRA 1R7OA 2APWA 3DX9B 4YK4C 3M6DA 1SYVB 5C07A 4X6FA 2J2ZA 1KCVH 2AQ1A 3HE6D 2X4QA 1J01A 3KPLA 1CT8B 4OZOA 4LCCA 4AZHA 2DPEA 1J5OH 2OMBA 3G6AB 2FJGA 5TDPA 4CVZB 3F58L 5E8EA 4X8XA 3W53A 4H2CA 3RWDA 1U92A 2ARJA 5EPMA 5FYJH 1QRND 5MENE 1IV8A 5KTEL 1T0MA 5JXEC 5BV7H 3H9SB 4ATLA 1EHLL 2VLRE 4AZ5A 2HFEA 3DUHA 2Q8BH 4JPVL 1KN4H 1GXEA 1UEMA 2GCYB 1UASA 4G6ML 4K68A 1FZOB 5I1KH 2Q3AA 1LF1A 5AAWA 4K3GA 1XCWA 1EK3A 1H2JA 4MNGA 5F1SA 4IS6A 3QHNA 1A5FL 3QDJD 1TJIL 1NCNA 2VKWA 4U2ZA 5DRNA 3WMCA 1OTTD 4JO3L 1HT6A 3DHUA 2PYEA 4JFZL 4KRMB 2DLGA 3BEVB 2C0HA 1BJ8A 4WWKD 5I0ZA 4JY6B 1JWUB 3UC0L 2IALB 1QSFD 3LCYA 3AQUA 1NFIA 1A2YB 3RM9A 3O2VH 1N64H 2IG2H 3EZJB 4EEEA 1RHHB 2FH6A 5E2TH 4LKCB 4LASL 1CLZH 2IBGA 2CR3A 4BSJA 3U0PA 2FJFB 4ALAL 1FG2B 1LE9B 3WDQA 4FZ8H 2HH0L 2C3VA 5DJDA 1ISXA 5DD0L 3IU4L 1LO4L 3X3GL 1KGCD 4X4ME 4LP5A 5D4QA 4L9DA 3OKMA 5CZVL 1P2CB 3LKQB 4HQQH 2QL1A 4Q74A 3RVWC 4AD0A 1EA9C 1URLA 2JKXA 4RWHA 5MEQB 1QI2A 5A2JH 1V7NL 4XC3L 4TVPL 2ICWI 2IQ9H 2ZOKA 3ZSSA 1REIA 1GOIA 2MMXA 1IGML 1UM4L 3AMLA 4AD3A 1KSRA 3QDGB 4ATWA 4NO0A 3UDWC 3VDCA 2QHLA 5F9WB 3O9NA 4WI7A 4N8CL 1JZ7A 3WY3A 3VILA 4PJ7F 2NY6B 1L7TL 1E5NA 1MCPH 4M1GH 2OLHA 2JB5H 1OM3H 5KOMC 4DTGL 3FRPG 3MPCA 1W9UA 4TX6A 4JFFA 2ED7A 4OOZA 1J1XL 1EAJA 3SUUA 1EZVY 5T5FL 1GZJA 1HJSA 2B5IB 2GQHA 2R0ZH 4BQ3A 1Q4NX 3QO0B 3PE9A 4W8LA 1I7RB 3NIDF 3OGOE 5GISH 3WJLC 3UEQA 3U46A 5EORH 2W9DL 3AAZA 5I74C 3BZDA 3HAEH 1PPIA 4BKLA 3SKMB 1U93A 3FAWA 3FOMB 4U0RC 1XYFA 2DD8H 4YHKL 1RFDH 5TF1L 1C8XA 4XP9L 3RWJB 1FH5L 4PJIA 2FGWH 3LN9A 4NCC2 5DJXB 5GGVL 5GHWH 1BFNA 4QKXB 2O61B 3EYVA 2BX5A 3L7FB 4ZXBA 4OF7A 2NW3A 3UTPE 1J0HA 1QHZA 1RJLB 2Q3ZA 2ICWA 1FNSL 1DBML 3QUYD 2J8UF 1SZNA 2V17H 3QHOA 1MFAH 3VIIA 5E2UL 2FX8H 2J4WH 2QADD 2ZUYA 5ICYB 4XX6A 1S7RB 1BLNB 5IMOB 1N0XL 4D3CL 1XRVA 3GMMB 4S1RL 3KJ6H 3HRZA 3PZUA 3C6SB 5HYQA 2BY1A 4PUBH 5F9OH 1HI6B 4GFTB 2DQIL 2LU4A 2FX9H 2C5DC 4OF8A 4Y19B 5D1QD 3RTQC 4GI6A 2RJMA 2X42A 2FO1A 2XN9D 1DSFL 4FQXB 5DFAA 5KSVA 1NMAH 3D39E 4J1UA 5F1KC 2EDDA 2D7QA 4NQDA 3P77B 4L4VD 1X9QA 2A6JA 4R97B 1GGYA 1X5ZA 1PJ9A 4ONGL 3CUJA 3UPAA 4KVNH 1G94A 1BBDL 1DBBH 3EIFA 2XVPA 3RVUC 5I19L 3IDNB 3MZTA 3BH8A 4PS4L 3UDWA 3SCQA 5KSUB 3MLWH 3DDFA 4D9LL 3U46B 3OB8A 3BDXA 4OKDA 1YPZF 1M53A 4RFNC 1WTLA 4G9FD 3C60A 4GXUN 1BQHA 2FO4B 1FJ1A 3BWAA 4AIEA 3QUXD 4K8RD 4QYOB 1P7KB 3GBML 5I3DA 1NEZB 1FYTA 1LNUA 1I1YA 3GNPA 2DKMA 5EA0H 2HN7A 5JNYA 1KYOJ 1H9VA 3EJJX 1WFNA 4TTDC 2CGRH 3POCA 2P47B 3FFDB 5J3HC 4MCYB 5T3XL 2X2YA 4JZOA 1HL8A 1FZMA 1UZ4A 1OAQH 1TJIH 3MMEB 2XI9A 1JN6B 3WIIH 3LPFA 3CV5A 2V38A 5E2VL 4YNYB 3MLZL 2CEQA 2GFBA 1LWJA 2XVLA 1FGNH 3VXMD 5DK0A 5SX5H 3DVGB 2ZOKB 2AJ3A 3ZYJA 2F1BA 3A4AA 4RDQF 3UBXA 4KROD 3CHCA 4WKAA 4G7VH 1FVDA 4LASH 3CHDA 1O7VA 1CGXA 1IAIH 2B1HL 2QQKH 4L4JA 1N7ML 1WK0A 1WT5C 1YNTA 3SE4C 1NFDA 3PQYA 2EXWC 5F6IB 1IEAA 1W8OA 3BEVA 4PREA 5C6TL 4X0NA 2CESA 5A6JA 3T0VA 2DYPD 1LE9A 1QNSA 1LP9B 4KQ4H 3BP7A 2O9TA 1JPTH 1EEZB 1TPXC 1DQLH 1EUUA 1H49A 4KQ4L 1HZHL 4LKCA 4J3SA 3O2VL 5DF0A 3P3YA 3UJJH 3PWPB 4P9HL 3T2PA 2ESCA 1RZ8A 4J2XA 1UWSA 2LV4A 4JFXB 1VACB 3CVIL 4XP1H 5J12B 1G6VK 1BGGA 1M71B 1WTGT 4NP4L 3PZGA 5EU6B 4J28A 1KFWA 3L5HA 5F3HB 3NVQA 1NC2A 3MODH 3SDYH 3C2AL 4X99A 1J7VR 3FT2B 2VZVA 5HDRA 3RY6A 4MDIA 4NQCD 1OLZA 3HNTH 2F8QA 3QWQB 3RJQB 2WBWB 3P0YH 3MRFA 4MQXC 4O9HH 5A2LH 4LCYB 1ZT4A 4N0RA 1A3LL 4P4KC 1XF4B 2Y24A 1Z0NA 4PP1C 2FATL 3WN5C 5EOTB 2EH7L 3WDRA 3G6AA 1KTLA 1FLRL 1KB5L 1R3KB 4HUUB 4QRTB 2FIRT 4LCCB 2EIZA 4WV1C 4HXAH 5C0NC 3UO1H 1TFVA 5ALBH 1P5VA 4OZFH 3N1FC 4ZAKC 1UB5B 2OYLA 2HJLB 4L3ED 1NLBH 4CW1B 3U2SB 1DVFD 4TQEL 1AD0B 4LSRH 1E4JA 1PX8A 2XIDA 2X09A 1XD0A 1W72L 4AMCA 3GB7B 1E6JH 1OW0C 3CUGA 1E6SM 4MNQB 1RY7B 1TQCC 4OKVB 4B50A 1SVZA 4O2EA 4O51A 5JLZA 3H7BB 2R4SH 1XFPA 1WAAE 3CDYA 1RIHH 5HI4D 4LYPA 1JN6A 1YMMD 4YDVA 3ARGB 3CO4A 4LNVA 3IFOB 1I9JL 1BX2B 3HA0A 4W7UA 2GYSA 3QDJE 1ZLWH 1M01A 2DD8L 3MRLB 4YHKH 3TJEL 4QYOA 3CFKA 4YWGH 3WIIL 4R7NB 3ARED 2BMKB 2EJ1A 3QISA 1ITCA 3GSNB 5D8JL 4PLNC 2WIIA 5FUOL 3T1FA 5I8CA 3EYQC 3RBSA 4JPWL 5TDOA 1HE7A 1I1FB 4PG9A 3FO0H 1IQWH 2XWEA 2NXZC 5EO1B 5FO7A 5KS9B 3RX8A 4H88L 4YDKL 4PSPA 5C0CA 3E3QE 3LAFA 1B3WA 3BE1L 5HD8D 1S5HA 4ZFMA 4WGVB 2PXYB 2BSRA 1MCPL 3N50A 3B5TA 4NBYB 3SDDB 2YZ8A 2Y36L 2A6DA 4PBXA 2HFGH 5GRVK 4I0KA 1JPTL 2YFOA 1KPVA 4P59H 4OLZH 4JY4B 2VDOL 2JF7A 4PJ9D 3SCOA 4WKHA 3KYOB 1CD0A 3HPLA 3QI9B 4OIFA 4POUB 4HWZA 1TR1A 2EKSA 1U8MB 4P46D 3QYCA 1T2QH 2B1AL 5GRUH 1FA2A 2CMRL 2V3GA 5AG8A 3O8XB 1YYML 3X3FL 4HU0A 2GTZA 2VZ3A 5I76A 2WVTA 4Q7DA 1T20A 4OGYL 4LIQH 4WO4B 1NMBH 1FZJB 5E0FA 1IGYB 5DUBB 3VW3L 3D3AA 4MA1C 2Q1EA 3HKFA 5CJQH 3DI3B 3EMZA 1WCQA 1NC4A 4ZO6A 4XWOD 1BECA 1DFBH 5E7FA 1BPVA 3IFPB 3ULSB 4U5IA 4FA8A 3WQWA 5IG7B 3H3PL 5I73C 1U58B 3CSBA 4OZ4A 3RKDD 2DIEA 3SCRA 5KANI 3GO1H 3MMDA 1I1FA 5JDSB 1OB0A 1T89C 1DWHM 4FXGA 1B6UA 1CZ8H 4X7DC 2F58H 5J11B 5IHUL 3PWLB 5C0EB 5JPMB 1R47A 2GI7A 5DI8A 3H55A 2VN7A 1G9NC 1WVZA 4M6OL 3EBVA 5FIPA 3VVGA 1K5NA 3OAZH 5CGMA 3BOVA 3TIEA 4KI5E 1CFTB 4N0CC 2F7RA 4JFFE 5E8NB 2J8UB 1S7QA 2ZCHH 4GZIA 5HYJE 4UFMA 1V02E 1BX2A 2FD6L 3ZYZA 1UR9A 4D9RD 5GGRB 5ESAA 1XCXA 3QIUD 5ID1B 2DWEA 4PRAA 2X2JA 2X4SA 1E6QM 1YPZB 1K4CB 1FC1A 2ITCB 3VXOA 3UYRH 3ROLB 1YYMH 4OZIF 2VB5A 4JZJB 4NJAH 4Z18A 2IBBA 1M7DA 2CKBB 4LLUA 3GMOA 4PRPE 3ZKXC 1G7IB 4M3JA 3T0WA 2MKLC 1D6EA 1J8KA 1EAPB 3LN4B 1EBPA 4TUJA 1RJZB 5J9PB 1CLXA 1MREL 4WFEE 5C9JA 2OWXA 3ARGA 1AJ7H 2OX5A 4NNPH 1CGTA 4E8CA 4ODTH 1MCOH 5JDJA 4HQQL 3H3PH 3WFZA 3VFUB 5C08B 3MV8A 2GK1A 4I9WE 4PMYA 5IOPA 4L4VE 3EOBA 4EI5C 1U8OB 3BAXA 3T0BA 4YFDB 4X7FC 3TP4A 2E7LA 4WK9A 4DW2H 3U0PB 5I2IB 2FL5A 5BV7L 1C5BH 5K93A 1TTGA 1M1SA 5DD5H 1BQCA 2BNRE 3E8UL 1DQQA 2XT1B 4QCFA 5CGYD 1V03A 4C7FA 1MW0A 3NIYA 1X4ZA 4LCIL 4L4OA 2VXUL 5GGTH 3LIZL 3WFBL 5DK2B 3G6JF 1PD6A 2UWEE 1IGIL 1KEGL 3CZLA 4ODUA 3OKOB 4NO3B 5HDQL 3U4AA 5JHLL 3PWPE 5DRXA 3REWB 3DECA 2ERJB 4NQSA 3TH4T 3SKNB 3ULUH 3MMWA 3UX9B 2K9UA 5CSBA 2GITB 5EFIA 1XD1A 2P5WA 1SEBA 4UZGA 1UWEH 4S1QH 3RL1B 2VL5B 1XGUB 4NJ9L 4Y5XC 5TJWK 3GMQB 4CU7A 1RUKL 2OQJA 1EHNA 1HYRC 5JIWA 4WHYH 4LAQL 4XBPB 5E2WH 1GVIA 1FAIH 4HX1B 4NC2B 3BIKA 2OI9B 1X5IA 4OLWL 2UYLA 2W07A 3EFDH 4QY8A 2A3EA 3PQYB 1DJSA 3H9HA 5BVPL 4HOZA 4A3YA 3D9AH 1RZ8B 3DX9A 4G7YL 2D7MA 1DQQB 4NT6B 5JQ6H 1H3VA 4CUCA 5F9JB 3U83A 5C6PB 2W9LA 1CXLA 3MJ7A 5I1GL 1OSZA 2LFGA 3QFJD 5D2LE 3BISA 5I2IA 5IK3B 1IAOB 5T3XH 4D0BA 3CUHA 1V6YA 4BQBA 5BXPA 3S2CA 4KJYA 3C5SA 5B3JF 5DK0B 4OB5L 4JJHA 5A2BA 2FR4B 2VRAA 1ZA3B 4HA4A 1X5KA 4UTBH 1GOOA 5C09E 1ULVA 3CXDH 1INEH 1SBSH 3VFTA 5K9QG 1FFQA 4FQJL 1CXKA 3QCUH 2GY7B 4JPKL 4ZO7A 3SE3C 2ZG2A 5TDNA 3THMH 2X05A 2QHRH 1EAPA 1BVZA 4AZ7A 2CIKB 1QR1A 5LJYH 2V9RA 1JWMB 3Q0HA 2BVPA 4BA0A 1IBGH 4LAJH 5C0FA 5CD5D 5EO9B 1KTRL 3MOQA 3BVWA 2CERA 3MUJA 2D20A 2V7HB 3CUPB 3H3KA 2D73A 4UU9A 5HPCA 4C56B 4KK9D 1CDHA 4FQ2L 2NY1C 5CP7A 2I5YL 5ETUB 5H2BB 4ELMF 1LQ0A 4JZNB 2EE6A 2ADGA 3OZ9H 2V2TA 4XNQA 1O5DT 4JFPA 3SDXA 1BF2A 1C92A 1UKSA 4DGIL 1XMWA 1B4JH 4QRRD 3JTTB 3OKNB 2XZQH 5DI8B 5B22A 2G3MA 4QOKE 1UR2A 3QUZC 4D3CH 2Z91A 2F53A 1FRGL 3EYPA 5CSGA 4PD4K 2QQLH 4BCEA 2LTQB 2ZZUT 2FX8L 3F7YB 5M5DA 3AUVA 5K9QI 3GXPA 2H32B 4RRPA 1C1EL 2DSZA 2GJZB 5ESVB 3L3JB 4KI5C 3IAQA 5DFTA 5DR5L 4YJZL 2AJVL 2B4CC 5IHSA 5IF0A 5JW4N 4UCFA 1YY9C 1GJUA 2A6JB 2XVKA 4OUOA 4WIWA 5FGCE 3QRFM 3RKPA 2E9BA 3CUFA 4EN3B 3TA3A 3DX6A 3AFLA 5FAAA 5LCVH 3X12B 1GCYA 4P2OB 1B0WA 5I66B 2ITDA 1QLFA 3WIHH 3V8OA 1AHWA 2AV7A 3QDHA 4MX7B 4PGBB 4DN3L 2J7EA 1BLNA 3WS3A 3L2MA 1GW1A 3QXUA 5GS0D 2YD4A 5CEYA 2EECA 1IT9L 4D6FA 1T7WA 3GEWB 3ILQC 4K94L 2YA0A 1ZV5A 5T3ZH 2GUYA 5GIRB 3K4DA 5DZLA 5F93C 1V3MA 3SDDA 2XPGA 3EYVB 1KCRL 2WUCL 1CVSC 2OR9H 4QRRB 5FDYA 2VXTH 4XBEH 3G04B 1HINL 4HLZH 4PJBE 3VIGA 1A4KA 3TPUB 3QG7L 1HIZA 4ETQB 2LVEA 2IWGA 4U1SB 3O4LE 5DJCA 1MUJA 4Z95H 2EEDA 3UBXG 1A6WH 4ENEC 1TMCB 3GSRB 1I7RA 4R9HA 3VIMA 3L4TA 4WFHD 5HHQB 1NMAL 3B9AA 4QO1A 2JE8A 2WUBH 5DQDL 5SV3A 4EXKA 4FQLH 5A2FA 3KLHC 2IH1A 1GHRA 3SUWA 3RWGB 1S7WA 1NAKH 2KDGA 2R2CA 3MLXH 3PV7A 1HXMA 3K8KA 3KPRB 5ETUA 2RIKA 4HKBA 1QKZH 3QPQD 5BYWA 2Q6WA 4UU9B 1ZLSL 2R8SL 1FDLH 4PYSA 3ABZA 1JK8B 3P4OB 5EN2A 5FO9B 3W4RA 1NCDL 1GONA 3PZMA 3MA9L 1D9KC 3MJ6A 2FZ3A 2NY1B 3LKPB 3PWNA 2BVPB 3MJ9A 4KJWD 4R0LC 1JVKA 1YJDC 4URIA 5IXEA 1QP1A 4TUOB 1T0NA 1OGAD 5AAMA 1XGPA 4NRSA 2K7PA 3SDAA 3I6KA 2IJ0C 4Y5VC 5ECUA 1RU9L 4JLRB 4UOZA 3GXIA 3OZ9L 1E55A 2E6QA 2H26A 1YEGL 2W67A 1YEJL 1EO7A 1CWVA 3KJ4C 3G6DH 3GMLA 4PJCF 1KG0A 2OSYA 2IPKA 3VI4E 1P69B 1FPTH 2AJZA 4Z78A 4HG4K 1JAKA 4O2CA 2J4WL 2YWYA 1P6FA 2WSPA 3VW3H 3QG6A 3HG2A 2Z8WC 1A6ZA 1QBAA 2UV3A 4MA3B 1AGCB 2EIDA 1Q6EA 3MLSH 1ZT4B 4UQ2A 3MRIB 2VDKL 2WCGA 4U1JB 3SY0A 4LCWB 5ABFA 5EULV 4HUVB 3BP6A 4MVBD 1KFAL 4P23D 1T1YB 2EDXA 3JV4B 4JO4L 1F90H 3UTPD 5KZCB 1JD7A 1TQBB 4R7DB 4GW4B 3EJSA 1A6PA 1ADQH 4X6EA 1SQ2N 2EEAA 4MNKA 4DZ8A 3ARBA 3U48A 4YPGA 5F7FA 3AXIA 5CWSB 1CGUA 1QW8A 2F54D 4UB0L 4HGMA 1SY6L 2ZG1A 2BNRB 3QQ4A 1VSCA 3CSYB 4F37F 1MCWW 2G60L 4N0YH 3WHE0 4UQ2B 1MEXL 5FFLA 2A3BA 3ZKND 2HRLA 2F7QA 3QQ3A 2F5BL 4MA3A 1A7OH 5CZXD 4AMXA 2BOCB 3PTQA