1EHLL

64m-2 antibody fab complexed with d(5ht)(6-4)t
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSLVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-(D(5HT)P*(6-4)T)-3'
publication title Crystal structure of the 64M-2 antibody Fab fragment in complex with a DNA dT(6-4)T photoproduct formed by ultraviolet radiation.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2000-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ehlL01
2BVPB 1G7LA 3TESA 5GGUA 4F8QA 4I1NB 1NC2D 3LPGA 5C09B 4NQDB 3ROLB 1INDL 3MGTA 1DQTA 3ARGB 3FQRA 5DA4A 2JJWA 4EOWH 2NY6C 2IH3B 4J4PA 1GC1H 1G6RA 1JL8A 2HVJB 4P3WA 4WWKC 1NC2A 2VDQH 4FS0A 2IH1A 2OCFD 5FHBH 1C08B 1EVTC 3RPKA 4DZBB 4PR5B 1ONQA 1MHPL 4DK3A 1A0QL 4M9PA 2PYFA 4N9GB 4DN4L 1J87A 2FX9H 1S7UA 2VLLA 5IK3A 4LASH 1MF2L 3QEGH 5TGBB 5MI0B 4BQ9A 4MA8L 4FABL 4HUUA 1AD9B 2P5WD 2FZ3A 5J89A 1FGVH 4ZFGH 5EB9A 3TJHD 1SY6L 2OQJB 2VO5A 2VIRB 3QNYB 4AEIL 2E7LC 3RBGA 1U8LB 2P5WA 2WUCH 1XZ0A 1JWSA 2WAHA 4Q0XH 4H5SA 4PRHE 5E94B 4KTDH 1DUZB 2DQCH 3OGCB 1MCDA 4N5ED 4LGRB 1ZGLA 1FZMA 3MCKB 3CFDB 3MUGB 2MHAA 3GKWL 1G9NC 3GIZL 3SE8L 4ZPVB 4QXTA 2EDOA 2XWBB 4TVSa 4YDIL 4HG4K 2CKBH 4KTEL 5D7SH 3PWJB 3HS0B 2VLRE 4LOUD 3WN5A 3MOQA 4IRJC 5BXFB 3IDGA 3FT3A 1MQ8A 4KK9C 4I48A 1J0YA 3M17B 4QXUH 4NZTL 1ZT1A 2IADA 2E8YA 3UCRA 4RX4D 4N5UA 4KGLA 4XMKH 2R4RH 3MV8D 2XTJE 1HSAA 5ID1A 4U0RB 5CGYD 3RL2B 2C9AA 3HR6A 3MV7B 3OXRB 1HZHH 3CDCA 1G9MC 3KPSB 4MD4A 3MRBB 3H3KA 1LNUA 4RX4A 5JQ6L 5IMLA 3P9LB 1YC7A 3ILQC 1B3JA 4YHNB 7FABL 3PGCB 3LOWA 3MV8A 1RU9H 5C8JA 5BRZB 4LQFH 3P77A 2EYRA 4YHLL 4OZHE 3HE6B 1U92B 3VWJD 4DQOL 4LCYB 3DARA 1YJDL 5IG7A 4NKDB 3D3VE 3MUZ1 3PWVA 4KKAD 1QLFA 2DQUH 5KSAD 3UP1A 2B2XH 4XHJD 3VWKB 2H9GB 3L3JB 5A43C 3TCXA 1OSZB 2NY3C 2V17L 4NDMB 3VWJA 2DBJA 2W65A 3NIGE 3OTTA 4JPVH 2FO4B 5DJ6A 1MWAH 5KSAA 1QRNE 1AP2B 4M6NL 5C86A 1CE1L 1EEYB 4P2QB 4MVBD 4DGVL 1I8IB 2CXGA 2GTZB 3FZUC 1FAKT 3QCUH 4WNQA 3E8UL 4ELKA 3HUJF 5FECA 1PG7W 4HWEL 4LVOC 5IQ9A 4QHLA 1MPAH 3LS5H 2YS4A 4JB9H 1Z9LA 2GTWA 5KS9E 3RIAF 1BD2B 3NA9L 3L3IA 3O6LL 3ULUL 4CKVX 2YEZA 3QIUD 4GW5B 4OI9A 4RAHA 2DQFB 4HBQA 1F11B 2C1PB 4EI6B 3LZFL 4LCWE 1NGQL 2CMRH 3RZCC 1WAAE 2W59A 3FB6B 3MGOB 1G0YR 4OGXL 5I1CL 4LLMA 4S10A 4PJ9C 2IPUK 3QIUA 3HFMH 5DJ0A 2LE9A 2FLBT 1SEQL 3U7YL 5D2NE 3LQZB 5B38G 3PXHA 2V5SA 2EDWA 1LK3L 1U8QB 2R2CA 1KBGL 4OJFH 3D69B 5MERB 2V9TA 4PV9B 4PJXA 1BVZA 3V2AR 4HFUL 1HYSD 2ADFL 1VADB 3GMPB 1FG2B 3OR6A 3BGFC 1XF3B 3JV6A 1UFUA 3BIBX 1LWRA 4NNPH 3N85H 1OGAB 2AGJL 5J1SC 3ZDYE 5FUOH 2OR9L 1F3DJ 4HV8A 4ZUUA 1G6RL 5BZDB 1RUAL 4M5YL 5DHVB 3MRLB 4JFED 1A6ZB 5IVXA 2DQGH 2DWDB 4YDJA 5IQ7L 4LCIL 1QLEH 2UWEE 2W0KA 4KUCF 4WTZA 1UH2A 5HGAB 1NH6A 4JFEA 3X14A 2EICA 3CK0L 1HNFA 4D0CA 4KVNL 1F6FB 5DJXA 5I0DA 3RI5K 5ENWA 5HJ3A 5DUPL 2R9HD 1MAKA 1PLGL 1LD9B 2AJ3B 2FJGB 3JV0A 2L7JA 3VXOB 3WIIL 4PP2A 1R3KA 4YHZL 2ZCLH 2XFXB 4MLSA 4MJ2A 5KVFH 3CSYA 4B7IA 4XXDB 6FABL 4DTGL 3H9YA 3RVTD 4D94A 5E6IA 1KB9J 4QXGH 3OG6B 3QUMB 4PJDF 5C0AE 4QYOB 3T08A 3WCYA 1E4KC 3FFDB 1TVDA 1QNZH 2V7HB 1GGCL 1KJ3H 1FL6A 4JZJB 3VXTA 1D9KC 2NXYB 1MCOH 1N8ZA 3V5HA 1EAJA 1ND0A 3TN0D 4NCDA 1FO0H 3LKQA 1HDMB 4P4RA 3QWQB 4GAJH 5AZ2L 1W72A 1X5KA 3MOAH 4Z7UF 2EDFA 3V5KA 5I73B 4Y4KC 1I7TB 3GJEB 3R8BB 5F9JB 3P4MB 4PRAA 1N7MH 3L3GA 2OK0H 4OLVH 4GW1B 4N1HB 2X1PA 3RNKB 5CILH 3TN0A 4J23A 5A3IC 1RZJL 3QAZC 3O3AB 3NZ8A 2O5ZH 2UZIL 4LSSL 3O6FD 4OGYH 2ZKHH 3UJTH 3MRMB 3WLBA 5D8JH 3T0XA 43C9B 5T33H 4LSRH 3TF7C 1K6QH 1YJDC 2DLFH 3MXVH 3C87A 3T2NL 1TDQA 3QDMB 2Z8RA 2LQRA 4XPAL 3O6FA 4P57A 1HIMH 1S8DA 1KCRL 1LGVA 1CXIA 1XF2B 2PCPA 4GKSA 3CPLA 4CUCA 3N50A 3I02B 2ZUTA 4KZEL 3RWGB 1CDJA 2IALA 2NMSA 2VUOA 4JVWA 4ZOEA 1NL0H 1W0YT 5C0FB 1ED3A 5FIEA 1XF5B 4M48L 4ELME 1WWAX 2VUYA 2YD4A 5DRXA 3BD3A 4LDOB 4JAMA 3OMZA 4F58H 3FTGA 3VGEA 4Q9QL 4NYLB 4H1LG 1CQYA 3N1GC 5I1JL 1T83A 3IS0X 1NUFA 2X6MA 3X3FH 3ARFC 4JO2L 5F96H 4GRLD 4PRHD 5I1LA 3QEQB 1RJZA 4ZUSA 2IG2L 5DSCA 4MA7H 3OV6A 3ULUC 5FAAA 3JTTB 1KTRL 1QR1A 1HSBA 3AAZA 3OKMB 2YKLH 3I6KB 1K9TA 2VLRD 1DP0A 4IJ3C 4GRLA 1G7MB 4PRHA 2CIIA 4JM2B 4G6FD 2XG4A 5LAXA 1ZHBB 2OJEA 5E95B 3RGHA 5IMMA 1WC7A 2YD5A 4LSTL 3DYMA 2P7TA 1JGVL 1JTTA 3NMEA 4KROD 4LQ1A 1PSKL 4H0IA 4P2YA 5DD6B 2VLRA 2JJTC 2EE3A 2XTJD 1CGUA 2EE6A 3I84A 1E6OL 3QQ9D 5BRZE 1MCPL 4I77L 1UJ3C 2IF7A 3G6JB 3TBWB 2VXVL 2Y9RT 4R96B 5SV3A 1MJ7L 5E9DD 3TT1L 3LRSB 2FEEL 4RMWA 2OLDA 4WTWA 3H9HB 1IZJA 1SYVA 2GY5A 1GGBL 2JJVA 2QLVB 3ORJA 4J4PC 1EHLH 1HOCA 3WUWA 5CWSA 4QRQA 5E9DA 2IPTH 4OLUL 5DURD 1AD0A 4I13B 4H25B 1HH9B 4JR9L 4Z77A 2FNBA 1ZKAA 3L3HA 1DEEB 3U6RA 4L8DB 3PWUA 1BZ9B 1QFWM 1T5WA 3QDGE 4DKAA 4KKBD 3MZTA 3OL2A 1T6WA 2QQLH 1RJYB 3KR3H 3OGOE 1UKTA 1QRND 2NY2D 3QULA 1JPGB 5ACZA 3WL9A 2UYLB 3B3IA 4WI7A 4TSAL 4W4OA 1AI1L 4PGDB 4ODXB 5D5MF 2DQHL 4PTTB 1I1AD 1NEUA 3E3QC 2NYYD 4WEBL 1QRNA 3MZGB 3K2MC 4D0DB 2HWZL 4P4KB 2ATPB 1PYWB 5ETUB 1MI5E 1Z5LA 5KVDH 4P5MA 3IS1X 1ACZA 1CU4L 3VG0L 2IFFH 1I1AA 2AAVA 3PDOB 4YX2H 5T1MB 4Y4HD 1QHOA 1JZ2A 1C5CH 1DANU 5KS9A 1KUMA 4HXBL 4NT6A 1KLFA 3BKYL 4GG6E 1NMAH 5AAMA 5CP3A 5EPMA 4HX1B 4MA3A 2HFFA 2QQKH 3E6FB 1F02I 1FFNA 1UWXK 3T77A 1ZWIB 3RY5A 5I6XC 1WAAA 3ARBD 4Y4HA 4ETYA 3HA0A 3WN5C 4IIQB 4L4VB 5IEHB 3TIEB 1IEAB 4TSBL 3BRDA 4MGXA 3BPOC 2AQ2A 4K23H 1NEZG 4U6XB 5B8CB 3GMQB 3RPIA 3ARBA 2NXZD 4LOUC 4H0HB 5CMAA 4PS4L 1DN2A 3ZZ1A 5CP7B 3I3EA 1JVKA 3RKPA 1KLUB 2IMNA 3SDYH 4RZCA 2DTML 4Z7WF 5TE4L 4RGND 4CW1A 4P9HH 3FHAA 4FQLH 2E7HA 5T3XE 1V05A 1BBDH 2DBLH 3KXFD 3QJHA 1INEH 1E4XL 2A6KB 3C5ZD 2PTUA 5CGYC 5D2LF 2APWA 5JZ7D 3RTQB 1T3FA 3PXJA 3P4OA 1M7DA 3HNSL 3KXFA 1SMAA 1AXTH 5EZIH 1NCCH 4MJ6A 4GS7B 4LKCA 1BIIB 3C5ZA 5CZVL 2XNAB 2UWEA 4U1GC 3MMEB 4PP1D 2AABL 1XF4B 4WI8A 3QH3A 4KKAC 1Y18B 1YMME 4PB9L 2HFEB 3WXVL 5KSAC 4ZOAA 4XHJC 1LP9A 2ATKB 2NY5H 1T1YB 4NRXA 5MEPA 1QFOA 3ZE0F 5J06A 2VKXA 1CDBA 4M5ZH 4GRWB 2H8PB 4YGVB 2XY2A 2EDQA 5J56B 1QBML 3LSOB 4MVBC 1C5DA 1JGUL 3HZVB 2X70A 1AGFB 4UT9L 4O4YL 4R3SA 3BH9B 2VITB 1FAIL 4XP5H 1NMCB 1EJOL 2FSEA 4XVJH 3IYLW 1K2DB 2W60A 3WFCL 3QUYB 2GAZB 3QIUC 5EUOF 5GISL 4YHYB 3QIBD 4MD0B 3NN8A 1AJ7H 4D9LH 1ZTXH 1N5YH 3X11A 4JGUA 3QFDB 1CFNB 4NN5B 4R9HA 5DYOB 2N7BA 3SJVB 4R26L 1XGYH 4NQVB 3QIBA 1CLYH 4K3GA 3L5WB 2R0WL 3WFDL 4KI1A 3CMOL 4ZTPH 2DL2A 3V6FA 5FYKL 4MXQD 4ETQA 3MV9B 3QQ4A 4BSVB 1HYSC 3AU1A 1BOGB 2WLYA 1DR9A 1TJHL 1X7QB 4JRWA 4LVNB 3KPOB 1B88A 3J7HA 3TIDA 5HPMB 1BGXH 4G6JH 3BSZH 4YDKH 4OFIA 5C0IB 5KSBB 4Z7NF 4NO0D 4X7EC 2P47B 4KUZH 4I2XE 5C0JA 4OCRH 1TZGL 1LQSR 3Q6GL 1Z2KA 4KUCD 3I9GL 2HRPH 3GSNH 2H45A 3DSFL 3LEYL 1HWHB 1A1MA 3HMWL 4NO0A 3V95A 2J2ZA 4ELMA 1UVQA 1NPUA 4LK4A 4NC0B 3RKDD 2J8UA 1I1YB 4X6DB 5T1KB 5IOPB 5I18L 3MLVH 1GYAA 1KCSL 1CGSL 2R9HC 3BVNA 1BQUA 1CGYA 2SEBB 3U79A 4JLRB 3BEWA 3ZYJA 5CJQL 3HC0B 2YA2A 3ZKND 3IFPA 3SKMB 1I1FA 4LPXA 5AYQA 4WUUE 5HGBB 1ORQA 3IVKA 4MJIE 4M7KH 4RWHA 2CKBA 3RVTC 4HCRL 1CXEA 1IBGL 4WGVB 2GYSA 4U1HB 3UEZA 2H3NB 3EDEA 1GAFH 1NFKA 2NY7H 1NDGB 3LIZL 5E8OB 4L3CB 5HYQA 5DUML 1OT2A 2B4CC 1H8SA 1Q8MA 3BZEB 2VXQH 3TN0C 3QHFL 5DHYA 4ZODA 5HHNB 1PW3A 3HI6H 3LRHA 2BSRA 4NOFA 3BP6B 4M93C 1KG0A 4Z5RB 4QNPE 4YBHA 3TCLA 1Y6KR 3GM8A 4ALAH 2HFTA 3OJVC 3DI3B 5C7XL 5HVFB 4OF8A 2DD8L 5F7WC 4JVPA 3RWDA 4DEPB 4DW2L 2R23B 3MRQB 5ESAB 3IJSB 4DFHA 3LN5A 3B83A 4WRLA 3VXRE 4CMMB 4WIQA 1P7HL 4POUB 5K93A 4PJEE 4H1LH 4F15B 2Q6WA 1ITBB 4UILH 4EUPB 1MFEL 1ETZA 3WKNA 5EZLA 3TGXA 4UT7L 1ZVSA 4OZGB 1XCQA 4UIMA 1MI5D 1MWAA 3NACH 4F7MA 5F6IB 2ZPKH 1JFQL 2DWEB 4WW2B 4YO0B 4S1DD 2BNQE 3P30L 3GI9H 2AEQL 4NKOA 3ZHDA 2J3SA 3I50L 3OAUL 3RAJH 4NQTA 1MI5A 5ESQB 2I5YL 4OI7A 2NNAB 1K8DB 4JRYB 1UYWL 4OV6F 1OARL 4GRLC 3F5WB 1P5VA 2NPLX 4GG6A 2F53E 3PABB 4FTVB 1FGNH 5CINL 2Z93A 4DVBA 4ISVA 1QSEB 2B5IC 3MFGB 1ZT4A 5D1ZB 1RY7B 5L9DL 4KJQD 3ZL4L 1CE6B 3T3MF 4OM0H 1PFCA 4HIEA 4BQ8A 2X44D 4F7TB 1CFVL 1GGTA 1KENH 3RWIA 3U4EA 5I1GL 4AQ1B 4KROC 2W9DH 2PF6A 4NKMB 5EZJA 4NM8L 4KVCH 1VGEH 1LO2H 2DI7A 1Z3GL 1QFHA 2XTJC 4RBPK 4W6XB 5DTFA 3BP4B 5E8EB 4XMLH 2BVYA 3BT2H 3G9AB 3QQ9C 4YR6B 2GSGA 3L9RA 3RGVD 1S9KC 1NAMH 1MRDH 2VZOA 5TDPA 1FG9C 3O3BB 2Y07H 1A7QH 1GC1L 1WCQA 1MLCB 4OUOA 3VXMD 3KPNA 4YXKL 3V4UL 3NTCH 3B2UD 3RGVA 1A14H 5HI3C 2ED9A 1F5WA 1ZLUK 1F58H 1YMMD 4XNXH 1KB5L 1GH7A 3QYCA 3FT4B 3MA9H 3QPQD 3VXMA 5F72S 3NGBC 3TVMB 2FD6L 1OOAA 4W4OC 2HH0L 3QIWD 1JJUA 4YQXH 5FO7B 3K74B 3QZWB 1Q1JH 1YMMA 2NY2C 1A5FL 4W70A 5EUKB 1PDKA 4AK1A 3BPNB 4X4XB 2QR0B 5B21A 4G6AC 4IBLT 3C60B 3QIWA 2B0SH 1MCWM 4U1LA 4S0TD 5DVKA 4ZUTA 1NLDL 3ARQA 3OKDA 3DUSB 1I1AC 1GOFA 5AZEL 2NYYC 3UAJD 4PJCF 1BQSA 2YD8A 4IMLB 3K4ZA 3HE7D 3ME0A 3BQUD 3D0VA 2WUCL 4KTDL 2DQCL 1I1RA 1FFRA 1KEML 2VDLH 3G5ZB 3FCTB 4XPFH 4Y4HC 2FYYB 1T21A 4OZIE 2Z92A 2NTFA 4PRIE 5DDHB 3HE7A 3BQUA 2ZUVA 1KACB 1FO0A 3PHQB 4F9PA 3SKJL 5IW1B 1PKQB 4ZNEA 5D9SB 2EYTA 5D71L 2E6PA 1A4KB 3VCLB 4LF3B 2OTUB 1KPUB 4NQEE 3F65A 3IU4H 3U0PB 4LLWB 2J4WH 2R4RL 5D96B 3KYAA 5JIPA 3ECBB 1ZSDA 2NXZC 2DQJH 1QFUH 4JY6A 4IOFD 1OP9A 4RGOL 2YN5A 4RGNC 1RU9L 4P3CH 2F74B 1P9MA 1IL1A 4TPRL 3ZDZF 1A1OB 2HJLB 3EZJB 2A74A 5I75C 3C5ZC 2XKNA 1A6PA 1RIVL 1X6LA 2DQUL 3T0VA 3OBAA 5JZ7C 4G80A 3MRGA 1Z9OA 1CIDA 2CDEB 3NVQA 4G6ML 3LV3A 3O8XB 5CHNB 4AIXA 2B1AL 3F7VB 2VDPL 2VAJA 3BZFB 4BSJA 4JPVL 5FUCE 2OL3H 1Z9MA 2VZSA 5F7KC 4PP1C 5IJVA 1TQCB 1MCNA 1KLGA 3EYFB 4WUKL 2DLGA 2D7OA 5HDBE 2A77H 4NHCL 5F1IA 4P2RE 3HPJA 3BP5B 3HNTH 1F00I 4OZ4B 2YSSA 4Y4FD 3M07A 2EDRA 1EEQA 1X5YA 1N2RB 2A0LD 1TNMA 1MH5A 2Z9TA 4WUUD 1E4WH 3CVIL 2BMKA 4MJID 3RP1A 2QSVA 4K3HA 1I9RL 3WXWL 5FYJH 4M6OL 3RX7A 4J6RL 4PJBF 5GGRB 5HYJB 1YEJH 1FVEA 4HFWA 1U42A 3MNVB 1OAXL 3CC5A 4Y4FA 3LKRA 4IHOA 3G08B 4WUUA 4HPOL 4PJ5B 4NFDA 3GBNL 4MJIA 3B5HA 3L3OB 2I07A 3TFKD 3GMOB 1A9EB 1P4IL 3ARXA 4DKDC 4XNUH 2YN3A 1CDIA 1I3RB 1WISA 3RNQB 2CO6B 3EZ8A 1AGDB 3BDYH 4XBGB 2P1YA 2KZ1B 4JZNA 3QIBC 5CBEA 2F15A 3N0PB 4PJFE 4Y88A 4GG8B 2DYPD 4MQXD 5IV2B 5E99H 4LMQI 4PY8J 4Q6IB 1P4LA 1GC1C 4PJIB 1VSCA 2HG5B 3D1MC 3T04D 1TJGL 4WHTB 1CF8H 3N85L 5IHUH 5EDXA 4AEFA 3LD8C 5FUOL 3SE9H 1F4WH 3QXDA 5SWSE 4JANA 2FX7L 2DYPA 5IKCB 4RDQG 5ICZA 2Q1EA 3I6GB 4MXQC 4X6EA 3HPLB 2FJFB 3PV6A 1KJMB 5JOFB 5ISZB 3F62A 4OD3H 4NZRH 2JK5A 4NOBA 1QPPA 4HK0A 1I9JL 1TZIB 5IB3A 4RAVA 3TO2B 4JJ5A 4Y5XA 5IROA 1BECA 5LCVH 3V5DA 5AYUL 2BNQD 3DOSA 3A0OA 4KXZI 2VDRL 2KQMA 3QCTL 3PGDA 2IANB 2JB5H 3SKNA 1FZOB 5HHVL 1VB9A 2BNQA 4XP6L 2D7NA 2EIBA 4C58B 1FORH 1IT9H 2NY1D 3LQAL 4AH2B 1G7IA 3S3SA 1OAYL 1REIA 4IDLA 2ZCLL 3CDGA 2F53D 1RZGA 3RKDC 4QF1A 1E27A 4L9LA 5FB8A 1OTTC 1P69B 2Y1VA 3LMJH 4KJYB 1WBYB 3OJDA 2XZZA 3T4AB 5K9OB 4G8FB 4QXGL 25C8H 5F9WB 3IDNB 5IFAL 1JF5A 2XQYK 2DICA 3A67L 1QNZL 2F53A 4FHBD 1FDLH 1DANT 1MCOL 5IHLB 3SCMB 1Q9LB 3AS1A 1NBQA 5J12C 3ZKNC 1FO0L 2RAMA 5IHZB 3H9SB 4DUWA 3UXFA 1WK0A 3MRIA 2QSTA 4ZOCA 2OK0L 4OLVL 3MNZA 2NW3B 4UB0L 1HH6A 5IFHL 3FB8B 4FFVD 4XP1H 4MQSB 4UV4H 2O5ZL 3EDFA 3N9GL 1ES0A 1NFIA 4OZHF 2ENSA 1PZ5B 5T33L 3H3PH 1T7ZA 5CCKL 3JXAA 1BZQK 3SN6N 2PXYD 1P1ZB 4YXLL 1A7NL 1YNKH 2VDKH 2EXWD 3FOMB 3MXVL 3O6MH 5A2JH 4OIIL 1FN4A 3EO0B 1C12A 3NAAH 5BOPA 1MEXH 1DBJL 5CD3B 3TO4B 3DO7A 2E6JA 1ZLUH 3NIGF 2PXYA 1UGNA 1T20B 1X5LA 5D6CA 2BXYA 4O9HH 1OWWA 4NN6B 4ODWB 5EU3B 3VRJB 4MDJA 3UTZA 4NKIL 5TQ0H 4NSKA 2VLJB 5GGVL 1G7HA 2G9HA 1V7NH 3GRWH 4XCCH 4Z9KB 2P42B 3OJMB 4KFZC 4UQ3B 4UDTB 3B9DA 1J05B 1H0DA 3VMOA 1WGOA 1M05B 4MB5A 5F96L 5MP6L 4OQTL 3HLAB 4PYGA 4S1DC 3U30C 3U2SB 1QG3A 5TE6L 3D39B 4YGAB 4PGCA 4PRID 3FQXA 5F89A 5GGSB 2DOCA 3KJ6H 1KXTB 1INQB 5B38A 5E4IA 3S5LB 1PY4A 1DFBH 5FO9A 5GGTL 4GLRI 4M7LT 4UIKH 3TH3T 1AH1A 3CNKA 1QBLL 1RULH 4NQED 4OZIA 3GMNA 2XWTA 4PRIA 3O9WB 3M8OL 2W9LA 2VE6A 1XR8A 5J1AB 4TSCH 2VABB 4NQEA 3EOBA 1ZT7A 1FBIH 1XR9A 1QSZA 4LVHB 5EN2B 3ZDYF 1TQBB 4XNMB 5BV7H 1UACL 5HHMD 5SWZB 3KWWB 5IMOB 4URTB 4P49A 4RMQA 5I1EL 3MRPA 3PF2A 2ITDA 2D4DA 4LIQH 3BIKA 2X4PB 2JB6A 3T0ED 2ZSVA 3FFCE 3LN9A 5HHPB 3RGVC 4HT1L 5DMKB 3JV4A 4WO4B 4DGIL 1H3VA 5I30H 2EDYA 2DLHA 1KIRA 5C0EA 1NBZB 4WWID 2AK1H 4HDIA 2V2XA 3QG7H 4U1KA 1XH3A 3B2UC 3KR3L 3RUGB 1R5WB 1I3GH 1GIGH 5GS1A 3K46A 3GSNA 2P44B 1VKXB 4L8BA 4P2RD 4KRMB 2G60L 1AGCA 2P5EB 3QPQC 3WFBL 4XCNA 4U6HB 32C2B 3QIWC 2J88L 1TPXB 3LQAC 1BZ7A 4XH2A 3DROB 5F3BA 4ONGL 2PUQT 5I74B 1F90L 1DLHB 4KV5E 3TEUA 5KVDL 4P2RA 5DUBA 4J3UA 5GJTH 3CZFB 3WNLA 3MLYL 4NQXB 3AB0C 2JCCB 5FYJE 4F9LA 1GOGA 1KIUA 1AIFB 2VSCA 4HKZA 4M8QA 5I1KH 3OKYA 4M1GH 3V7AE 4ONHA 3LHPH 4NWUH 1NMAL 4M7JH 4JJHA 3F7RA 2D7TH 4PTUA 1YNLH 4QRRB 3BI9X 3WEXB 2QQKL 3HE7C 3BQUC 4F9PC 3FONB 4PJCA 1E6JL 5C9JB 5HVWA 3O11B 4XVUC 1QA9A 2P24B 1MCJA 3ES6A 5D7IE 2DB8A 3KHQA 2F8VA 5F7EH 1YEHL 2CRMA 3V0VB 4MQ7A 5D7LB 4K23L 5DMYA 5KOMC 2A9ML 2DM2A 3VH8B 3O3DA 3WHXA 1Q94B 5A40E 3MRNB 1HXMA 3EDKA 3L7FB 4PJFA 1EIBA 3MJ9H 1BJ8A 1NQBA 3IAPA 4HD9A 5EIQA 4XRCA 2CO7B 3MLTA 4KTYA 5EOCJ 1T4KB 1I7RA 5FDWB 5LJYH 2EKJA 1L6ZA 4XPGL 3H7BB 4Z0BL 1INEL 5BJTA 3NCCB 4WU7A 4KXZH 3AFLA 3TP4A 3BWAB 3S34L 3G04B 1WICA 1E0OB 1BQHB 1YPZB 4IOFC 4MCZA 3QO0A 3SGKC 2XV6B 1Q9KA 3GMMB 1AXTL 5EZIL 1NCCL 4H1LA 1AQDA 2VZ3A 5F88B 1B0GA 4OLZL 3KYOB 3PIQA 4JDZB 1QLRB 4NC2B 3C2AH 1W2KT 2Y06L 1NAKH 4KQ4L 2X1XR 3AXLB 1W0VA 1ZA3B 1FNGB 5F3HA 1F42A 2FWOA 4JDTH 2WIIA 3W81A 4KY1L 3UTTE 4S2SB 2AERT 3VGAC 2VB5A 1J1PL 2Y6SD 3QA3A 3F12B 3BUTA 1BBJB 1D5XA 3HZMA 2UUDK 3H9SE 1KN2L 5C0RH 4AMKH 3L3DB 2DKMA 5ELIA 1JGEA 4QKXB 4N9OB 4Y4FC 2V5YA 3MODH 2A0LC 1BFSA 1EEZB 4Y8DC 3ZMRA 1CICB 4XVJL 2Y4SA 4HXAH 4B5EA 3O41A 1T0NA 2F5BL 1G0XA 1GRWA 2FBJH 1UM5H 2IMMA 3JBG7 3V6OE 4PJ7E 1AJ7L 4K3JL 1ZTXL 1N4XH 2VWEE 5GRVL 3TFKC 4FQXB 5HDQL 1U36A 2KQNA 5H35A 4XI5D 4PG2A 2AEIT 4BM7A 5BS0E 4UTBL 4B41A 1KOAA 1WIOA 1CLYL 4P2OD 3MX0A 4OI8A 1NAMA 3ZTJG 1WTGT 3FL7A 1MUJB 3VI4E 4XCYB 1UWEL 2EKSA 1A7OH 1MNUL 2OTWA 3CUPA 3ZTNL 2YD7A 4L4JA 1CDUA 4QRUA 4P2OA 1ZHKB 4DOHE 5EFIA 4GFTB 1OAUH 4YNYB 4UI2A 2MTPA 3SPVA 3BSZL 4JGMA 3S9DB 4NUJA 4NUGL 2E27H 3DO3A 2AK4B 4Y5XC 5IROC 1HHJB 5A16A 4O02L 1U6AL 3L7EA 4Y19D 3GSVB 3C6LB 3V6ZA 3DXAB 2BVOA 2EO1A 2HRPL 2CUMA 4RNRA 4ZUWB 4EUPG 2J6EH 1U3ZA 2N4IA 2XIDA 4S0SD 1V3MA 5J4MA 1EMTH 4ZPTB 5F21B 3R0MA 5E2TL 4Y19A 1UWGH 1EJ6A 2CRZA 2BX5A 4ZAKB 1OQOA 4GLRH 4WI5A 5IB1B 4HUXA 3TLRA 1PX4A 4NQSA 3FOLB 5GPRA 1KTDA 1UEMA 4YFLI 5CGTA 4ZYKA 1C7SA 3FB7A 4LSPH 3ZKXC 2HLAA 4L9LC 4Y2DD 3BDXA 3VI3F 4U7MA 5ILTH 3FQNB 1J10A 3VXSB 1IGJA 2NY1C 2AXGB 2DRUA 3ZO0A 1IGTB 1NEZA 2DQTH 5L0QC 4HKJB 2CR6A 4I0PD 4Y2DA 2BNRD 1RZ8A 1T03L 5HPOA 4V2CB 2YPKA 3D9AH 5DVLA 2UZYB 2OJZH 3EYOB 4UTAH 1JUFB 4I0PA 2BNRA 1CD8A 1R5VA 1BJ1H 3NPSC 5I8OH 4Y16B 1U0QA 5MEQA 3E2HB 1IGCL 4MD5B 3U36A 3HI6L 4XAKD 3T0BA 1XGTA 3GHBH 3EOTH 4UINL 2PETA 5HBBA 3GIVB 3FFCD 2AS5M 3MRCA 1TCRB 1WZ1H 1Y0LB 4LIQE 4ZQKA 1BPVA 2R0KL 4FFVC 1DJSA 3GUTB 4O00A 4OM1L 5TF1L 3GSXA 4JO3H 5GS2H 1YN6A 1RZIA 5BZWA 3W9DA 3FFCA 3CFBA 4I3RH 3KG5A 3G5YB 2HT4D 4X9HA 3LEVH 1LO5B 5IGXH 1S7TA 3X3GH 4KJWD 4PJGA 2PXYC 1HKLH 2BY3A 3H0TA 4R0LB 3IFNH 1BFVH 3F8UB 2EXWC 3KLSA 1UB6B 3ZE1F 4XAWH 1N5AB 4N0UB 4XBEL 2NY5C 2OL3A 3QZWG 3SQOH 2EXYC 1LHZA 1I8MB 5IB2A 2Q8AH 5FYJD 3GI9L 3PGFH 1NGYB 3CFKB 1EO5A 4H20L 1RQ5A 4JO4H 5I1HL 2VNCA 3U83A 5DFTA 3OR7B 1WV7T 3CLEH 4OF5A 5SV4A 3N1FC 3VXNA 5FKAB 3EFFA 1X5IA 4UU9B 1OTUD 12E8H 3QEUA 2ZOLA 4IOIA 4PJAB 3MFFB 2DJSA 3ULSA 1OCWH 5CEXB 1FLTX 2D0HA 4Y2OA 3MRRA 4E0RB 1AO7B 4YHMH 4UMGA 4LP5A 2I9TB 5C08E 3KPLB 3VFWA 2P46B 3A6BL 3LDBC 2OZ4L 1FRGL 4Y1AD 5HGDA 4X99A 4YC2B 2RCSH 5DGQA 3OZ9H 2E5EA 1WITA 3HRZB 1RIHH 2A83A 4DKFH 5JIIA 1TFHA 4BH8B 4KRPD 4FQCL 4XMLL 4YHPA 4TNVF 2CLVA 4PLOB 2BK8A 1R5IA 3QPXL 4Y1AA 4IRSD 2EE2A 2ESVB 2PYEE 3IXAB 4GQ9L 5A2IH 4FFWC 4MAYB 1KPVA 2FATL 2AXFA 4RGMC 3NABL 4DCQB 1DN0B 2P8LB 1A14L 4GKNA 4LHQB 4UNTA 5I17B 1U91A 4IRSA 5MENB 2AJXH 2X7LB 1F58L 3GJFB 4AZ8A 3T0EC 1H3PL 3GB7B 1DLFH 2VAAB 2FHBA 4XPTH 5GS1C 5FDYA 2H1PH 2PNDA 4XVTL 1KCLA 5E2WL 1JRHI 3PWPD 3TPUA 4JM2F 4KU1A 4JPKH 1Q1JL 5FUCC 4IMKA 4U7KA 4K9EH 5KZCB 3MLSH 1F3JB 3MO1A 5CAYB 1OP3H 4ZUVB 1AXSB 2H2SD 3L95A 3PWPA 2B0SL 3WYRA 3K81A 4U49A 1QYGL 2VQ1A 5EZOL 4EDXA 4AQOA 4D9QD 3CZJA 4F9LC 3UBXB 3G6JF 4FQ1H 2KH2B 4OZFB 1BFOB 4J3SA 3DIFA 4JG0H 4X98A 2NY4D 3UDWA 4MNQB 4HKBA 2GUOB 1AE6L 1TETH 5C09D 4R4FL 5GGQL 4HWZB 1TZHB 3ARGD 2VDLL 4AEEA 4C56E 4PGEA 3UYRL 1FJ1A 4ZS7H 3ZDXF 3V4PH 5I76A 3MUHL 4RFEB 5C09A 4PJ7A 1QZ1A 3ROLA 3SY0B 3ARGA 4MMXC 5FGRA 1MJ8L 3I75B 3MLPA 4O51A 4MA1C 4IM8A 3HTLX 3IU4L 3WFHA 3HUJB 3QI9B 3C5SA 4LPCA 2HVJA 3G5XB 1UM6L 4CU6A 2XOTA 3C09C 1EH9A 3T8XA 3LEXB 3QBTB 4NJAH 4HKXA 4ODUB 2JIXB 3F7YA 4DZBA 4QTHB 3T0AA 5I1IL 1CLCA 4X4MA 4J12A 1S7SB 4PJEF 5JW4M 5ALCH 5HHOB 5IEKB 3STBA 2CK0L 1CXFA 1DQJB 4K94H 3WO4C 1JPSL 3CVHB 1NCTA 1ZVHA 4YBQD 5TGBA 3OB0K 4YWGH 2F58H 1LO4H 1WQVT 2W0FB 4JREB 1AY1H 1P6FA 4X8XA 1MIMH 2VIRA 3GRWA 3QNYA 3MLXH 3PWNB 2R2EB 1JGDA 3TBSB 5I9QC 1SBSL 1NFDB 4APQB 4EDWH 1IQWH 2YBRB 5E94A 5J11C 1CG9B 5SX5K 1QFWI 3HNTL 3VE0B 5TFSH 1NUNB 1RK1B 5LBSH 2VISA 2ICWI 3CFCL 4WJ5B 2EH8H 4XVSH 3EO1A 4ZPVA 3BW9B 1MELA 2Y6SC 3D0LB 1YEJL 3BUYB 1R24B 4OAWA 1ZS8B 4ONFH 4DKEH 5E2JA 2ENYA 3IDMA 5IB5A 1EXUB 2R1WA 4CMHB 1S9VA 1IARB 2GSIB 3KPSD 4F3FB 4NO3A 1Q0XH 1Z9SA 2PTTB 1KTLB 3TBVB 3VFRA 5DD5L 4XNUL 1M71A 3O81A 2X9XA 2ICES 5DEGA 4WDIB 1XGRB 5E5MA 1GGIH 1YMHA 3BDYL 3OXRA 2DTSA 4PG2C 4RFOH 4AENB 3KPSA 1NBVH 3MRBA 3DI2B 3HI1B 2C3HA 1UXWA 5L88H 3ILPB 4HUMB 3K3QA 1U3HB 1GJIA 3VWKD 2F54E 4X7TB 1JYNA 5E99L 4JHWL 3WFZA 1KCUH 4XI5C 2FR4B 4CVZB 4P46B 5CEZE 2BP3A 1JZ7A 4D8PA 2X4OB 4NKDA 3T0DA 4TNWF 5IHUL 1UA6H 4P2OC 3QUZB 3SE9L 3BHBA 1F4WL 4UAOC 3VWKA 1JV5B 1FZJA 4GRWF 2HFGH 4P2QD 4X5XB 1OSZA 4EUPH 4NDMA 5KJRL 1KT2B 1QHPA 1TIUA 3KAAA 4FZEH 3GSUA 1M4KA 3D2UB 2FO4A 2G2RB 1ZVYA 3JWOH 5D6DA 2IGFH 1JN6B 1BD2D 1EEYA 2F8OA 3DX6B 4P2QA 4H26B 2D03H 1EFXB 3HI5H 3QG6A 3QHZH 3RI5F 3DX8A 2GJZA 4L29A 1L9NA 2NY6B 3L3KA 2FGWH 2JB5L 1BD2A 3WNPA 4WWKB 1FYTE 1IC7L 4EI5B 1A3LH 4ZFZB 4PBWD 3UROR 2DQFA 1FORL 1KYOK 1PY9A 1QSFB 1UZ6F 4Z0XB 4X7CC 1JPTH 3BIAX 3MGOA 4J3WA 3TA3B 1JNLH 1KJ2L 4EN3D 4LAQL 3V9FA 4ZNCD 4GKOA 2AV7B 4NM4H 4Y2DC 5C08D 3QO1B 5TH2A 5IT2L 2BVUA 3BZ4A 1FDLL 3S5LG 3JWDH 4EN3A 1WEJL 1NJ9A 3MNWA 2RGSA 2C4FT 2ORBH 1OGAD 4I0PC 1DBBH 4BFIB 1FG2A 5C08A 5CJOL 3LKOB 3HMXL 5KSBF 5MEOB 2IQ9L 3SDXB 5KSUB 2EEAA 3O3UN 4ZXBD 2WUBH 1B2WL 1OGAA 3DUUB 2PYED 2YZ8A 3ARYA 4X6CE 3MJ9A 4HJJH 3CH1A 5IW6A 5EBGA 4KC3B 5DHVA 4CJ1A 1BX2A 4EXPX 1SYSB 2MWCA 3DURB 5A2FA 3MRKA 4ZXBA 3BP7A 4GMSH 1JRHH 4JKWA 2XKSA 2PYEA 1QEWB 2HN7B 4R7NA 2YD2A 4H8WL 4TUKL 4IRJB 2H41A 3LRGA 2BHZA 4X6DF 5TQ2H 4K07A 1A21A 1Q0YL 2WINB 5EO1B 3ZKMD 4QRPB 1MEXL 4JFDE 1S5HA 4C4KT 1N6VA 3R4DA 5ANME 4QCIB 5HHQB 2XZQH 4BZ1H 3FT2A 4PRNB 1VFBB 1NGZB 2R2HA 3UO1H 4KJWC 2AJ3A 4YFEA 4CVXB 4KDVA 4ODTH 5TQ0L 3F7PC 4OLXH 1V7NL 3GRWL 4MNQE 2XPGA 4U6YA 2ERJC 4XCCL 5KVGL 3UTQB 1YEEL 4JY5H 1ZLWH 2D31B 4MXVE 2X4SB 4D9RD 2XTLA 3Q6FA 2X4QB 1BQLH 3UTSE 4AIZA 4ZFFA 4M8VA 3HAEB 3MRFA 4M7LH 4C56D 4HS6B 2Q3ZA 3P73B 3W0WB 4G9DB 4DFIA 1IGMH 2NY3B 1HDMA 4G8GE 2CRYA 1BMGA 4NQCB 4F8TA 5JPNA 1IAKA 1OHQA 2J8HA 3MJ7B 1CD1B 1DFBL 1C1EL 1K85A 3KYMB 3O4LB 3KPRB 4R4BB 5TDNB 1OM3L 1PX3A 4YIQA 5HY9B 4C56A 1OTUC 5L6YH 4MAUL 2B39A 3CCHA 4YXHL 3VDBA 2H32B 3O3AA 3RWJA 5ICXA 1D6VL 2AJYH 3MRMA 1ZHNB 2YPLB 43C9A 1GPOL 4YBLC 3KS0H 5B39B 2I60H 5T5NF 1FBIL 4KMTH 4A6YB 1JYWA 3MTRA 4WEUD 3Q2CA 3IT8D 3PJSA 4OZGF 5K9KB 3NCJH 2I27N 1INDH 3HN3A 4KRPC 1XCTB 4WW2F 4PJ9B 1HNGA 3A6CL 5E8PA 1T5XA 2L4OA 4L4TE 2MKLC 1K8IB 4HZAA 4PJHB 4LHUB 3PP3H 4IRSC 1NDMA 2I9LA 4FXKA 1X5FA 2YRZA 3S8WA 1BQHG 1MFCL 2ZWLT 5E1AB 4U1IB 3OAZH 5IVZA 2AK1L 1QFWH 4POZC 4U3CA 1RJCA 1U8MA 4BKLB 3VFNB 4C4KO 1I3GL 4HH8A 4I8DA 5K59F 3W11D 2J6EA 1P2CB 1L7IL 1DBAL 1XMWA 3DSNA 1KGCD 4IMKC 1A0QH 4OV5B 1FE8L 3SGJA 1XIWB 5DC0A 4Z7WB 2ID5A 1QBBA 3WO3B 1OQXA 5ALBL 3B4NA 4OTXL 4Q2ZB 3HCVA 3OKMA 1MF2H 3ZT7A 1A6UH 2FJHA 4KMQA 4RRPA 3VFOB 4FABH 43CAA 4F7EB 5GJTL 2YD1A 3VFMB 1ZHBA 1SY6H 4HLZG 3UDWC 3ESVF 4M1GL 1I7UB 4AEIH 5I1KL 3DRTA 1JHTB 3FO1A 4NWUL 4M7JL 2BNUA 5EORH 4Q6YA 4LPYA 1YNLL 3EYQD 1MCRA 4NRYA 2NY4C 2EIZB 4R96A 3KYNB 3IJHB 3GKWH 4NJ9H 3BH8B 3SE8H 2ICCA 3ARGC 4HJGA 4P3DB 1X4YA 2LU4A 4YDIH 5EBWB 2DM4A 2VWEC 4ODBD 5FYLL 3V7MA 4ODVH 1CCZA 1JWUB 4MJ5A 1T6VN 4HWNA 5FOJA 4MNGA 2HJFA 2B20A 1MSPA 4NZTH 3WNNA 4Z78B 3NBNA 5GS2D 3T65B 2ICEB 4JFHE 2XA8L 4A2MA 1HH9A 2VDML 3BXNA 4ZFOA 3SDCD 4M6MH 3OKEB 1JF1B 1U8JB 4W68A 5JQ6H 3NFNA 1UZ8B 1JPGA 5FK9A 2Z35B 7FABH 3H3BC 4P4KD 4LKXA 3SDCA 2FGZA 1HQRB 4PGDA 4YHLH 4HH9A 4PGBB 5DXWA 1FNAA 2WBJB 4N0CC 2C3GA 4PPTA 3WS6A 3TYGL 3ZYZA 4HIIB 4D0DA 3QAZB 4P4KA 3D87B 2FEEI 1PYWA 5ETUA 4XWOD 1NAKL 2IWGA 3AS2A 4YBQC 4JG1L 5T1MA 2A9NH 3IKCB 1R0AH 3KHOA 4NWTL 1CDYA 1FYTA 1WZKA 1PD6A 1R3IL 3FN0L 4M6NH 4F80A 3SO3C 2ARJA 4S1QL 1CE1H 3QUML 3MJ8A 4MS8D 4HIHA 4E9LA 4W6YB 3E8UH 3GI8L 1ZWIA 4CDGC 4UDUA 3TV3L 1DQDH 3MODL 3NA9H 3O6LH 4OB5L 5GZND 5B4MD 1T7VA 5DJ2A 2X4NB 1B4JH 1DQLL 4QY8A 3LZFH 5HD8D 2EDEA 4U0RC 1UM5L 4D0BA 1BJMA 4HAFA 4OGXH 5I1CH 1JNHA 3ARFB 4OGAD 4ZSOA 3RWCA 1KXVC 1N4XL 3BAEL 5ID0A 4FRWA 1UB5B 2FBOJ 3U7YH 1MVUA 1ZLVH 2EDHA 3FN9A 4PY7B 3RWEA 4WY7L 3FRUB 3MLRL 4RA3A 3HE6C 5BV7C 5J13C 4X6CA 1LK3H 1KBGH 4IJ3B 4MQTB 3MLWL 1FC2D 4RSVA 4TRPL 5C07E 1J0HA 4HFUH 3VXQB 2ADFH 1P5UA 1FZKB 1MREL 4JFDD 4UUJB 5ESVB 3ARED 3VWKC 5K33A 1G6VK 2AEWA 1MJUH 2VQUA 3R8QA 4KH2A 1M7IB 4NN7C 4M3KB 2ARWA 5CIPB 1OAUL 1Y18A 1DDHA 2DLEA 1RUAH 1HILA 2E27L 4JFDA 4M5YH 5D6DC 5LGHL 5ANMA 3AREA 2F19H 1TCMA 5GGUB 1LE9A 4WI2A 3EGSA 5IQ7H 3MGTB 2EDBA 4LCIH 4U0QB 4YGVA 2YRLA 5F7FA 1W0WA 3OB8A 3E6HA 4K3EL 1BVKA 3UTSD 1E4XI 2AW2A 4CGTA 1NC2B 3TC9A 5KW9H 1AGFA 2IH1B 4X6FA 5JOPE 4KVNH 3QSKB 3BH9A 1ONQB 1UC6A 4G8GD 5DUPH 1PLGH 3UTSA 2WIMA 3R06A 4KAQH 4LU5H 5JLZB 2QQNH 4FXLA 3STZA 4FMFA 2VLLB 4G8GA 2DQTL 3ARVA 5IK3B 3AMLA 6FABH 3VGDA 1CFNA 4PJIF 5DFVC 4EN3C 5DYOA 3C9NA 4HUUB 2FZ3B 3Q5OA 4NQVA 4MLIA 1GGCH 5F7LB 3NIFE 5TPWL 2X1QA 5CEYA 1I4FA 4P99A 5H8DA 3SDAB 5LG1A 5HHXL 1RVFL 5AZ2H 5C6TL 2QJDA 3OPZH 2P5WB 2YD3A 1EO7A 1XZ0B 1JWSB 4H5SB 3IDJA 3KPOA 5LWYL 3QHTC 1FZMB 2JF1A 4L4TD 1J1OL 5LXGH 2MHAB 4ZXBC 4NKQB 1WZ1L 4DWHA 3RA7L 4QXTB 1RZJH 2Z91A 3UTPE 5FXCH 1BLNB 5T1LD 2UZIH 4LSSH 3FT3B 3K1KC 4L4TA 4FFYL 4I3RL 2IADB 3ZT6A 3WFEL 5T1KD 5CS7A 5BQ7B 3T2NH 4GUPA 5T1LA 1KCRH 1HSAB 5ID1B 3WJJC 1JPFB 3ZKMC 2UY7A 5E2UL 5T1KA 5E24E 1LNUB 4KZEH 5IMLB 4HBCL 3PHOA 5C8JB 3P77B 1N59A 4M48H 2SEBA 4F33A 2Q8AL 4ERSL 4X6BA 3OAYK 3PGFL 4UT6L 1PQZA 5IG7B 3LAFA 3PWVB 4Q9QH 1QLFB 2NXYC 5CD5D 4LSVH 3UPRA 3L5XL 1MVFA 2WBWB 2AJVL 3RFZC 2OP4L 2QEJA 4JO2H 1KN4H 3BFOA 1EGJL 3CLEL 3S96A 3UBXG 2GJ6E 4U1GB 3VWJB 3V4VL 3NFPA 5E00A 1A1NA 5EIIA 5DJ6B 1I8KB 1OCWL 2A6JA 1A47A 2DQDH 1X44A 2ITCB 1U3JA 4WNQB 4ELKB 1VGKA 5FECB 3K80A 5DI8B 3BP6A 5IQ9B 4QHLB 3OX8B 2OI9C 4LSTH 5I8EA 1JGVH 4Z5RA 3STLA 2GI7A 1HHIB 2VL5B 3WSQL 3L5HA 1KV3A 3L3IB 3PP4H 1R3HA 4MB4A 3FO9A 2YEZB 1RIHL 4DKFL 1CFBA 1MCPH 3WIHH 3T2QA 3MLUL 1P84J 5SWQB 3QCVL 1SBBA 1MCIA 3MC0A 1JTOA 4LLMB 1Y6NR 3GBML 4GJTB 5JHLH 3QIUB 2ZG2A 3GNML 4LLAA 5EOQL 1JK8A 3MREA 4GAGL 1GGBH 2JELL 4EUPA 1FNHA 5EOCL 1NCBL 1CYGA 4G7VH 4LNRA 5C2UB 2HLFC 4OLUH 3SKUD 2N1KA 1AKJD 2CD0A 2CKNA 1GHFL 4JR9H 4XPTL 2DWEA 3OR6B 4R8WH 4YO0A 4WCYL 1EBAA 3JV6B 3INUL 5IWLA 3REVA 3KNBB 3SGJC 5JXED 3ARDD 1BOYA 1OAKH 1AKJA 1M6OA 4J3VA 4YDLC 5J0BA 4HHAA 3D25B 2VH5H 3MLSL 1QSED 3GSRA 4HLZH 4HV8B 3OF6D 5D1ZD 3W11C 2F5AL 1AI1H 1LEGA 2DQHH 2EEBA 2XZAH 5KN5A 5JXEA 1P7QD 4PYHA 5IVXB 1J8HE 3ARDA 4YDJB 2BSED 2HWZH 4X80H 4X9BA 1X4ZA 1MFDL 1QSEA 3OF6A 5D1ZA 5M94B 1B0WA 1I3UA 4BFEA 2DI9A 4O5LL 1CU4H 3VG0H 1CE6A 3QNXA 4JFEB 4N8VB 3X14B 1P7QA 5EC2A 4OLYH 1FSKB 1CFTA 3ULUE 3UBXI 4D0CB 1PVHA 4G8IA 3BKYH 2IQAB 1D5ZB 3LKNA 1C16A 5ENWB 1H3WM 3V4PL 4NKMA 5LKNA 5F1SA 2EEDA 3LH2L 3EYQC 2BXZA 1F6LL 1MFBH 1R3KB 4YR6A 4BUGA 3CSYB 4TSBH 2E8ZA 3W2DH 4X0KA 2CLZA 3RUGF 5E6IB 5F9DC 1IZKA 1FVCA 3ELAT 3TVMD 4ODSL 3VXTB 1N8ZB 3O2DH 1YN7A 3V5HB 6CGTA 4GT7A 2CDGA 1ND0B 4JY4B 3LKQB 4QEGA 1W72B 3BGMA 1LEKB 1E4XH 4NO2A 1MAJA 3TVMA 4PRAB 2VN7A 1EO8L 2MQCA 4G9FB 3RIFK 2V7NA 3GMRA 1M7XA 1H8NA 3QZWA 4MZ2A 5C0CE 3B9AA 2RBLA 3WS6C 3DLQR 1YY8B 3HNSH 1WIUA 1TVBA 3NZ8B 4P4KC 1FL5A 1NUDA 1XGUA 5CZVH 3WLBB 5HXMA 4HGKC 3CFEB 3D85B 4FQJL 2AABH 4JRXE 1EK3A 5I71C 1JMXA 4PB9H 3MLXL 4FQQA 3FZUD 3IAQA 1II4E 3WXVH 3O6FB 1S8DB 1K4DA 2WWMC 1G7QA 5J6HA 2WANA 2PCPB 3E3QE 3WBDA 4LLUA 5J8OA 3O2VH 3HNVL 5GSRA 5D72L 1MFAL 1UXSA 2IALB 4JFPA 1QBMH 4HUVA 1VFOA 3PHQA 1ED3B 1PKQA 1JGUH 1XEDA 4ONFL 3BDBA 8FABA 4UT9H 3VCLA 1TITA 3IB4A 1IJ9A 1JNNL 4O2CA 1FAIH 5BMFL 1J1XL 4CN4A 3ARRA 5CLWA 5CJ5A 1YPZF 2BRRL 4R4ND 5I1LB 5GZNC 1RZFL 1JNJA 4ZUSB 1GGIL 5ADPL 4C83A 4U2ZA 2Y7QA 3O45B 4K71C 5HD8C 4EVNA 3UTPD 5L88L 4OGAC 2VRAA 4GRLB 4PRHB 2F74A 4J8RA 3X13A 2OJEB 2YMXL 5F8QC 3SE4A 1D6EA 5IMMB 1WC7B 4AIOA 2R0WH 2P7TB 3WFDH 4LSDA 3MLZL 3CMOH 1ADQL 1CFSA 2VLRB 3S37L 5FYKH 3RWHA 3PNWA 4G6FB 3MV8E 5CHNA 3AREC 3PDGA 4U33A 3BZFA 4KROB 5EWIL 2ICWA 3BO8A 2XTJB 3EYFA 5B22A 3U4BL 7CGTA 1SYVB 1NCAH 2D03L 5HYJD 3HI5L 2YD6A 5DVMA 4K9EC 4L8SB 1G9EA 2DJ4A 2LVCA 1HOCB 1SJHA 4TOYH 3Q6GH 1KSRA 3WUWB 2FGWL 2UY6A 1G7PA 3I9GH 4QRQB 2JTDA 1N2RA 2DIAA 3LEYH 1AD0B 1IKNA 3NOIA 4PV8A 2Y23A 3HMWH 1X5XA 4I3SL 1A3LL 4Z77B 5HYJA 1NMCC 4R2GD 3L3HB 4GXUM 3U6RB 1G84A 3PWUB 1T5WB 2GCYB 3G08A 4U1MA 3QUYC 1JPTL 5DURB 1SY6A 1OD7A 2IBZX 4YHYC 1JNLL 4P5KA 5ACZB 4MX7A 5I18H 2ZJSL 1A9EA 3P0YL 1KCSH 2I25N 3B3IB 3NGBB 5FA3A 1CGSH 4NM4L 4NN5C 2GT9A 1G1CA 4XBGA 5CJQH 1QRNB 3VRLF 3ZLQC 5CP3H 2ORBL 5FGBA 5AEAA 1Z5LB 4WHDA 1FNLA 4P5MB 4HCRH 1IBGH 5DJZB 1I1AB 3OHXB 4WTXA 1SM3L 4Q6IA 5C0BE 2HG5A 5D1QD 1I1CA 4AJ0A 5KS9B 3LIZH 1B9ZA 1HEZA 1S9WA 5A3ID 1FFOA 5FO8B 5DUMH 3REWB 1NC4D 4QHNA 3P40A 4PJXE 2HFFB 3I6GA 5JOFA 3VFTA 1FFNB 3T77B 4FQPA 1G7JA 4Y4HB 5D1QA 2A2QT 2R2BB 3WIFB 2V2WA 1TZIA 2IAND 2XI9A 1OB1B 3GJFH 1CL7L 4QO1A 1NC4A 3NZHH 2PO6B 5C7XH 5EO0A 2DM7A 4K94C 2AXHA 2DD8H 3ARBB 3QRGL 4DW2H 1I9EA 5CMAB 2NLJA 4JO1L 2IANA 1FZOA 4RZCB 2VKWA 3UMTA 4CW1B 1U9KA 3QQ3A 3MYZA 3HC3L 2NXZB 3EHBD 1MAML 1MFEH 2PKDA 1NKOA 1IE5A 4UQ2A 1F2QA 4M62L 3ALPA 3T4AA 1T3FB 1JFQH 3P4OB 1M7DB 4R97C 3FMGL 4HZLB 4MJ6B 4LKCB 1UM4L 1GGYA 2UWEB 4EQ3A 5C2BL 2V2TA 4M7LL 5D1XB 2ZZUT 4YK4B 2I5YH 3QH3B 4U1JA 1Z0MA 1HQ4B 2HKHL 1T1WB 5BCAA 4M7ZB 4BA8A 4UZGA 1UYWH 1NCNA 4RWYH 1OARH 5DRZA 1LP9B 5IIEA 1S7QA 4NRXB 4C59B 5MEPB 2NW3A 1VEMA 3VA2C 1XGQB 3FB8A 2ZNXA 3OKNB 3P11L 3DHJA 5L9DH 2AJYL 5JOEA 5KSVA 4KK6D 4R3SB 4YHIA 4DEPC 1KPRA 1P1ZA 2DN7A 3MCLH 4KMTL 5I1GH 5SX4I 3AGVA 4OD2B 3RRQA 5C0AB 2FSEB 1UJ3A 4O2EB 4NM8H 1Z3GH 4TUJA 2W60B 3NCJL 3V52L 3IRZA 4LPWA 2VLJD 5C0CD 1EUUA 1SMOA 5E0QA 1OVZA 3NN8B 1T20A 3S36L 1Q38A 1ZMYA 1IEBA 3QFJD 3X11B 4JHAL 2A6IA 2L0DA 3JWOC 4ODWA 5F6IC 3VRJA 1L6XA 2VLJA 1IC1A 4YXKH 3V4UH 5C0CA 5GIRA 4WW2C 4Z7VE 5IBTH 4JRXD 1QFWL 1T0PB 5IWLC 3QFJA 1U58A 4UQ3A 3PL6D 4YJZL 1KB5H 4PJAF 3V6FB 3BYYA 4N0RA 2OX5A 3QJFA 1T0MA 3QQ4B 4IDJL 1QACA 1BAFL 3HLAA 2FD6H 4HUWA 4MCYA 2OR8A 2VLME 1KFAH 4U6VL 5F1NB 4JRXA 2HH0H 1FNFA 3HG1E 1P53A 3TIDB 3IRPX 4PLKD 4JQXA 1IGIL 2C3XA 3PL6A 5JXEC 3ARDC 2N7AA 1A5FH 1TJIL 1A6UL 5INCA 1INQA 2KDGA 3S5LA 5D1ZC 2Y36H 1NLDH 4WFGE 5KBNC 4R90L 2YXFA 5AZEH 4NBXB 1MHCA 3ULVF 3IDXL 2HTKD 3O2WL 2HTLD 5FFLA 3FB5A 1IGFH 3MUJA 4J3OC 1K3ZA 2IAMD 5EORL 3JWDC 4ELMB 4ORGA 5SWZD 1BFTA 1A22B 5J1AA 3SKOB 3GO1H 2VABA 3SE3A 1KEMH 4DZ8A 4X9IA 4JKKA 4NJ9L 2QBWA 3QNZB 2IAMA 3BVNB 4WO4D 5FCUL 4XB8A 4ODVL 5IMOA 5SWZA 3SKJH 3WHE1 3EOAA 5D71H 3BEWB 4Y0GA 4J1UA 1IM3A 3IFPB 4HGWA 5IB4B 1ZANH 1ORQB 3IVKB 4MSWA 3W9EA 2CKBB 3FAXA 1SJEA 1JI1A 1Q9WA 4M6ML 2OSLA 4N8PA 5FYKE 3S3PA 3DBXB 5FA4B 4OCWL 3WD5L 5J12B 1EAPA 3TVMC 3CSGA 2RIKA 1R5WA 4RGOH 5A2LH 5IW3A 5E9DE 1EPFA 1LK2A 3V8OA 2E3VA 4G3YL 1I7ZB 2WQ8A 4PLNC 4JDVA 4N0FA 3BPNC 4TPRH 2BSSA 2BSRB 1DQQA 4JFOA 1YQ2A 3FO2B 3CU1A 3N06B 1UQSA 3C08L 4WFHD 1KG0B 1T2XA 1RIVH 3DROA 3TCLB 1QSVA 1RZKL 5H2BA 4D2NA 1G1YA 1MCLA 5L8KB 3HC4H 2CIKB 2X2YA 3S97C 2GITB 4G6MH 3RWDB 4F2MA 1JPST 2JCCA 2B1AH 2D0FA 2VDPH 3CIQA 1AIFA 2A9NL 2W38A 1R0AL 3LN5B 3OKLA 2YZ1A 2QADD 3U0TA 1KYOJ 1NGPL 4JKPH 4GRMA 4WUKH 3WEXA 4NHCH 3QDGB 2GIYA 2Q6WB 1V5JA 1ETZB 5EZLB 2EDKA 2P24A 3CVIH 4K7PL 1WUNT 4UIMB 3ARPA 4L5FL 1MCSA 1MWAB 1DQDL 4F7MB 3OG4B 1I9RH 3WXWH 4M6OH 4BQBA 4J6RH 1NBYB 5I2IA 1OAXH 4NKOB 3MROB 1B4JL 5DK2A 5C0BD 1Q94A 4HPOH 3MRNA 3GBNH 3BISA 4QHMA 1GGUA 1MI5B 4TQEH 2VR5A 1P4IH 5DS8A 1URLA 5F6HI 1CD9B 5C0BA 1K3IA 1A7PH 3PWLA 5L2KE 4R4NC 3WIHA 4YFDB 4GG6B 3G04A 1BQHA 4DVBB 2Z93B 3SE4C 5IR1A 5F1OB 1UH4A 1ZT4B 3OKOB 2P8MB 3GMMA 5F93C 4M03A 4HIEB 5E8DL 1MJUL 1VPOL 1W8OA 1DUYA 1NFDF 1TJGH 4JDZA 1QLRA 3RWIB 3U4EB 1CFQA 1FPTL 4X4YA 4RGNE 2FX7H 5DK3A 5EZJB 3PDDA 1TQCC 1FNGA 2F19L 3KXFE 1LO0H 5HYIA 1VFAB 2GSGB 4XNQA 1I9JH 1J12A 5TDPB 1UG9A 3SEPA 4OCMC 5EC1A 1JGLL 3NFSL 1CGWA 5GGVY 1IKNC 5AYUH 4OIAA 4LRIA 3RVXD 1H15A 4KHTL 2M26A 2VDRH 4NC1E 5KW9L 2EIEA 3RGVB 3QCTH 1LP9E 2XXMB 1L9MA 4EIZC 3S4SG 2EO9A 2EZ0D 5JW3H 1EEZA 2WQRA 5HHVH 4XP6H 2ZCHH 4KAQL 3DVGB 4LU5L 2QQNL 3LQAH 4R2GC 1CD0A 3P4NA 2DQEL 1OAYH 3M1BA 3RJQB 5DVNA 4ZO9A 1YMMB 2L7UA 1QQDA 5E7BA 5SX4H 1PG7H 4QGYA 5JDJA 1ZK9A 2CSPA 5FGBC 3TZVD 5IFAH 2FX8H 4UV7L 3MRHB 3QIWB 2H26B 4U1LB 3A67H 4ZUTB 3OKDB 1OTSD 4A6YH 4HWBH 4Q6IC 5M95B 3EJZD 1CGXA 4Y5YA 4XCYA 3AB0B 3TZVA 3OPZL 5GRVK 3D0VB 1P7KA 4UB0H 5D1QC 5IFHH 4WI3A 1K5NA 5LXGL 1T21B 2Z92B 3O2DA 3HE7B 3BQUB 1VENA 3N9GH 2ADIB 1RI8A 3WMSA 2EYTB 4ZAKD 2AJZA 4I0KA 5CCKH 1A7BA 4ZUWA 4YXLH 1A7NH 4OIIH 4ZPTA 3K2UH 4Z7VA 2VLMD 1DBJH 3KVQA 4ZAKA 3HG1D 4LLVA 3DHMA 2Q86B 5DR5L 5J6GB 3VXSD 4JY6B 2WSKA 1DL7L 3WE6A 1CDCA 3FQNA 4NKIH 3HG1A 2ZUYA 4WFGD 1HXYA 3EHBC 5GGVH 5F9WC 5T5FH 2A74B 2H6PA 4NNYB 2XKNB 2AQ3A 2R0LH 5INDA 2BOCA 4NQUA 2J8UE 3SDXF 2GW5A 4LSVL 4G80B 3SCMC 4I2XB 3P9MA 4Y16D 1KN4L 5MP6H 2NZ9D 4OQTH 1ZLSL 3WKMH 1RAMA 3R1GL 5TE6H 4N8VG 3EYVA 3RJDA 5IJVB 1S9XA 1KLGB 3SHSA 4Y16A 2DQDL 4KI5D 4ODHL 5F1IB 2VDOL 5GGTH 5EBMA 3VGAB 2Q87A 2FL5A 2D9QB 3HPJB 1QBLH 2YSSB 1MH5B 1Y0LA 2BMKB 3VFGL 3M8OH 3PP4L 1FVEB 4HFWB 5FYKD 4M43L 3WIHL 4WU5A 4PRPE 4Y4FB 3LKRB 4WUUB 4KK6C 4MJIB 4Z8FL 4X5WA 1DSFL 4Z7UE 1TTUA 4LLYA 1A4JA 5JHLL 1UACH 1U95B 3KLDA 2J7LA 5I1EH 4NN6C 4G7VL 5HI3D 3GSWA 3IFOA 1JCKA 2VZUA 4JZNB 5CBEB 4HT1H 4DGIH 3CXDL 4Y89A 4LPVA 3FQUA 1JHKL 4R8WL 5TDOA 1ZV5A 3WDHA 3CFKA 3RY6A 2LABA 1OAKL 2FB4L 4M61A 1YDPA 2VH5L 4JQXC 5C71A 5B3JE 3PL6C 4G6AD 4OD1H 2G60H 4MNHA 2XZAL 4UU9A 3WFBH 4LCCA 5CSBA 3VXRB 2BC4A 1L0YA 4PJAA 2JK5B 2V6HA 3GK8H 2J88H 4HK0B 3L6FA 5IB3B 4X80L 1RURH 2C5DC 4ONGH 4PLKC 4PJEB 1F90H 4Y5XB 3O9WC 3V5DB 5TE7L 3VXPB 3TJEL 3MLYH 4JN1H 5JMOC 3T1FA 3QXWA 1D5BA 1L7TL 4OLYL 2VDNL 2HYMA 4CN1A 3PGDB 3QISA 4LP4A 4XNYH 3SE3C 4PUBH 3JTSB 2YC1A 2HTKC 2HTLC 2ESVD 1JTPA 2BNQB 4LVHC 2IAMC 2BSTB 4OKVA 4MAYD 5L2KD 2K7PA 4HCRA 4PJHF 2G75B 1G7IB 1E6JH 1MFBL 1MCQA 5F9OL 3CDGB 1CLZL 3ZKXB 4QHUA 1RZGB 3CFJA 3QB7C 4QF1B 1E27B 4L9LB 1YEHH 1CWVA 2ESVA 1GSMA 3OJDB 3W2DL 1F4XL 4WHYG 4MAYA 5L2KA 1GZQA 5F7YC 1KC5H 1XAUA 4WO4C 4DCQA 1RZJC 2A9MH 1S7WA 1DN0A 2F53B 4K8RL 4K3DL 5JXAL 5L0QB 2D7PA 5I17A 4ENED 2X7LA 3O2DL 3GJFA 1ZA6A 4OT1L 3QXVA 4HPYL 4HIXL 4XPGH 4Z0BH 2O5XH 2C3VA 4RA0C 3MRIB 5D93C 2QHRL 4FP8L 4O58L 4WV1B 3S34H 3MNZB 3NPSB 3B6SA 1HH6B 4KKLD 4G6KL 3RHWF 4XGZA 3VRIB 3C5JB 3UYOD 1TPXC 2GHWB 5IBUB 4ZUVA 2P45B 1F3DH 3MRJA 4LDLB 1ES0B 1NFIB 4JQIH 2LU3A 4UOW0 3VXME 2XXCB 4OLZH 5IVOA 2P49B 3T2PA 3UBXA 4FXGA 1F4AA 2Y06H 4XC1H 1AFVL 4KQ4H 2ZUQC 1FN4B 2V5MA 1C12B 1EUTA 5JHDE 2DQIL 3MXWL 2FH6A 4MDIA 4KY1H 2RFXA 1YA5A 3LPWA 4HWZA 1T66D 5DJYA 4CVUA 3DO7B 2PXYB 3O2VL 5KTEL 1J1PH 4GBXD 5D6CB 9CGTA 2EYSB 5HYEA 2QADC 3QI9D 4LSQL 5D5ME 1F6AA 4I18A 4MDJB 1WBXA 3UTZB 1TENA 4NSKB 1KN2H 1G7HB 2G9HB 1MHEB 4GBXA 2JIXD 3E0GA 4XCEA 1C8PA 3CMGA 1UKQA 3PV7A 3HUJA 3QI9A 1H0DB 2UZXB 5K9JL 2ARJQ 5GQBA 1ODAA 2F5BH 1YYMH 3I3DA 5H94A 5HHOD 4ZNEE 2JIXA 4JCLA 3BEVA 4PGCB 3FQXB 5F89B 1AGBB 4K3JH 3DRQA 4YUEL 5BVJA 4M1DL 3RWFA 4EEEA 1D5MB 5KG9B 2ZCKL 5JR1H 5FGCE 1U8OA 5HDQH 5B38B 5ADOH 5FO9B 1S7SA 4G8EA 5T3ZL 4UTBH 5HHOA 4KK5D 4OZIB 4NFCA 4X9FA 3GMNB 4PRIB 4QHKJ 4YEFA 2HMID 4N68A 1OF2A 3EBAA 3KPPA 1EEUA 1HINL 1S7VB 3CFIC 3T4YB 1UWEH 1KELL 1IAOA 1MNUH 2VE6B 1XR8B 3IGAA 3ZTNH 5DJCA 1IKFH 4JEGB 4NQEB 3EOBB 1ZT7B 5EU6E 1FLRL 2VR4A 1QP1A 4C55A 3V0AC 4NUGH 2AXJA 1KB5A 1E28A 1DBKL 2O61A 1NCAL 5ITFB 2YBRA 2E7CA 4O02H 1U6AH 1U8PA 3ETBF 1I8LA 4TOYL 5D2LE 5DK0B 3WS3A 2CGRL 3VE0A 2ITDB 4LBEB 4LRIC 5GRZA 1RK1A 4WJ5A 3SO5A 1PGRB 3EYUL 2JB6B 2ZSVB 2NY0B 5I8KL 2BOBB 3BW9A 3JV4B 4LHJB 3IDIB 1T7WA 1R24A 1KIRB 3JZ7A 5E2TH 5JW5A 1RV6X 5C0EB 1JZ3A 4MHHG 3RVXC 4HDIB 5IM7A 1OTTD 2V2XB 4U1KB 1CVRA 1XH3B 3DV4B 1VDGA 5GS1B 2IBGA 5JUEL 5MHSD 1KTLA 3GSNB 3RX8A 2EZ0C 1FV1B 5DJDA 1Q9OA 1U3HD 4KDWA 4WDIA 5EU4A 4XCNB 4AENA 1YECL 5ICYB 3IETB 5FYJU 2Z8WC 4XH2B 5F3BB 4LFHG 1T03H 1U3HA 4P2RB 5DUBB 1N6QL 3ULVL 2GEEA 4PRPD 4Y5YC 5F7DB 3TZVC 1P6AB 2BERA 4M8QB 3G6AB 1OTSC 2EDDA 2VLKE 4PJDA 5IF0A 2W1NA 2M1KA 1JV5A 3EJZC 4X5XA 5EUOE 4PRPA 5JNYA 1T1XA 5D70L 1IGCH 1KT2A 4N0YL 2XQBL 4UINH 5I1AA 3PQYE 1QA9B 4JZOA 1HCFX 4Z7UA 4BH7A 3C6LC 3T3PE 4U31A 3NZHL 3MA7A 3DX6A 2R0KH 4H26A 1LDSA 4OM1H 5TF1H 3QP3A 2EECA 1UCBH 4G42A 3O3DB 5AUMA 2APXA 4ZMAT 3IXTB 4ZAKC 4AM0B 1HXMB 3UZQA 4PJFB 2W92A 1EBPA 1MRFH 4XRCB 5IESL 3MLTB 3C09B 2ADGB 1I7RB 1N64L 5BOZG 1NANI 5BJTB 3DWTA 4WU7B 2BCKB 2IBBA 1A9BA 4XBEH 1H5BB 3K8MA 5SWSB 5JA8B 4MCZB 3QO0B 1F8TH 3CLFL 3CAFA 4YHOL 1Q9KB 1OPGL 4H1LB 1B0GB 4H20H 3PIQB 5I1HH 5DQ9B 4BFIA 2BFVH 2JE8A 5GHWL 1W0VB 3MBEB 1EDQA 4JE4B 1U2CA 4RWYL 4Y16C 4XPBL 2NZ9C 2FWOB 5MEOA 2WIIB 5KSUA 3EAKA 3PHSA 3HKFA 2HJKA 1WWWX 3QA3B 4JFXA 4RFNC 4DVRL 3J8F7 4H0GA 2Q20A 1T1ZB 3DYOA 1D5XB 3HZMB 2W0PA 4XTRD 4KI5C 1S7XA 3A6BH 1OLLA 1QEWA 2OZ4H 1FRGH 35C8H 3MCLL 5GZOD 4JCMA 5J9PA 1PKOA 4FQCH 3SDDD 4AG4H 4FA8A 1AC6A 3QUXB 3C8HA 3QPXH 3CVHL 4PRNA 4NPYB 3Q3GA 4GQ9H 3PG2A 5HYSA 3CX5K 5BVPL 2FATH 5H35B 3IU3A 3SDDA 3NABH 2MNUA 3TNNA 3FN3A 4W6WB 4KJPD 1ZHLB 5IBTL 3QDJD 4HS8L 3UTQA 5KVEL 3V0WL 1NAMB 3RY6C 3QDAA 1H3PH 2NQCA 3W0WD 5JHDD 4NQCD 4XVTH 2EKSB 3GSQA 2OTWB 3CUPB 5D7JB 1RZ7L 2GKIA 5E2WH 1KFAL 4QRUB 3KPRD 3QDJA 4F57L 2NW2A 4LCCC 4UAOB 5EFIB 1BP3B 3P73A 3W0WA 4G9DA 1MCHA 2A38A 3QUKA 5JHDA 4Y8AA 4FOMA 4NQCA 1ORSA 2Y36L 3KYMA 3KPRA 2PN5A 5TDNA 3ZE2F 3V6ZB 1QYGH 5EZOH 2BVOB 4RNRB 2XY1A 3QR2A 1J0IA 5D5MA 1IGFL 4YC2C 5FGSA 3BMVA 2ADJB 2QV2A 4Y19B 1ZHNA 2ZUUA 1AE6H 4XVUD 5FKPA 3GO1L 4R4FH 5GGQH 4WHYH 5I16A 4HUXB 1KTDB 2VOTA 4A6YA 4HWBA 3UYRH 5DMIL 5EO9A 4YAQA 4MAYC 5DJ8A 4QT5B 1MJ8H 4GKZA 1X4XA 4RMVA 1NEZB 3U1SL 2DJUA 1ZEAL 4Y2DB 4PJHA 1ZANL 4ZS6D 1A64A 1RZ8B 3T3ME 1A6VL 1UM6H 2YPKB 2YUWA 4OFKA 4PJ8B 2VXTL 2MPAL 1FP5A 1XIWD 2VERN 2WW8A 5EU6D 5FOBA 1IM9B 3LKPA 3KJ4C 4I0PB 2BNRB 4ENEC 1R5VB 5IVXF 4QXWA 5I1IH 2EDJA 4ACPA 5MEQB 1XIWA 4LRNL 4LLDA 4Z7WA 5HHME 3U36B 5EU6A 3DVIA 3T1WA 2CK0H 2BVQB 3BRGC 1XGTB 2Q76A 3SGKA 1JPSH 3MRCB 3T0EE 5E5UB 4KKLC 4YDVB 3HC4L 4ZQKB 2IPKA 5D2LA 1BVLB 3GSXB 1NLBL 1N3NA 2I26N 1YN6B 1RZIB 3O0RL 4NC1C 3W9DB 3FFCB 2YA0A 2HRLA 5C0GA 1I7UA 1NKRA 5CJXA 4XX1G 1S7TB 1A3RH 1OAQL 4OLWL 4PJGB 3S98A 4JKPL 4BFGA 3H0TB 4IRZL 1SBSH 3BPCA 4OQTA 4KRNA 3WLWD 4I18C 2WP3T 4LSUL 5EULV 3T2OA 1CR9H 3CFCH 3KYNA 1T66C 3BH8A 1DCLA 2FHCA 2OL3B 4GBXC 2CPCA 1JWUA 3QI9C 5IB2B 2ERJB 3FQWA 5GGTA 4NCC2 4BQCA 4Z78A 2VLKD 3T65A 2ICEA 4PJCE 1BEYH 4TQEL 4JPIA 1EHNA 4YZFF 3AMKA 4JFZH 5DD5H 3VXNB 3DMMD 3EFFB 1YEIH 1A7PL 3VJ6B 3UPAA 3PQYD 2VLKA 3QEUB 2ZOLB 4IOIB 1RJLA 1KEGL 3ULSB 5GRJH 4ZDHB 4HS3A 3MRRB 5EUOA 3ZSTA 3OXSA 1HQRA 3DMMA 3LN4A 4NFBA 2X4RA 4JHWH 3PQYA 2XA3A 3VFWB 3VFSA 1NANH 5D7IB 1U8IB 2PR4L 4JREC 5ITBL 4KK5C 3O6KL 3EJYC 5HGDB 4X99B 1UKSA 5GS0H 2HMIC 5HYFA 1LEIA 1LE5B 4YBLB 1G9ML 2CRIA 5KJRH 4QOKE 5GXBB 1LO0L 4YHPB 4BSWB 4H88L 2P43B 3U46A 4Y1AB 5C1MB 1I8LC 2D0GA 1DBML 4FQ2L 4HULB 2AJSL 3TYFA 4QTIH 3VD7A 5EOTA 5I66A 1KPVB 3DNKA 4KRPB 2Z4QA 3ZDZE 2CLRA 2R8SH 1YUHB 3BJLA 3NPZB 4PY8I 4Z6AT 1GCFA 3GMLA 1U91B 3ARZA 4TVPL 4CMHC 2EE9A 1AC0A 5JW3L 1IC7H 5IMKA 2RJMA 4KMLB 2D7QA 2ZCHL 4MMZC 5DD1H 3TPUB 1FNSH 2YRPA 1KJ2H 1T2JA 2WP3O 1U8NA 4LAQH 1VACA 3MO1B 1PG7L 3LCYA 1JZ5A 1CDGA 3UTTB 4CN6A 2FX8L 5IT2H 1U3HC 4K7FA 4EDXB 1JI2A 2VQ1B 1YEFL 1WEJH 4A6YL 4HWBL 1H3GA 1WFTA 4PJBE 1CI5A 3G5VA 1GL4B 5EU5A 3DIFB 3B2VH 1WFNA 1CIUA 4UUJA 5CJOH 5ESVA 1KTKE 3HMXH 1S7RA 3IKKA 3W39A 3MACH 2IQ9H 4HKBB 4GH7B 1A2YA 5L8LB 1B2WH 2PW1B 4LEXL 1HI6A 2W91A 4PGEB 3B9EA 1MLBA 1N6UA 1T2QH 4YHKL 2AI0L 4WGWB 4PJ7B 4OQ1A 3H42L 5DQJA 1FC1A 5JW4R 2K9UA 4O51B 4H8WH 4LARH 4TUKH 1T22A 4YPGA 3WFHB 3C5SB 3FO0L 4XZUA 5DC4B 4TNVK 5BS0B 1Q0YH 5EH1A 3S35L 3K2UL 4TUOA 2J5LB 4EI5C 5I19H 4AT6A 3T8XB 4HKXB 4WI6A 3F7YB 3IDYC 2RQ8A 2EXYD 2X1OA 1JIBA 1IAIM 5ERWA 5ECJE 3TA3C 5JLZA 4I4WA 3FAWA 2OMBA 4G5ZL 4DOHB 1MCKA 3ZKQD 3MCG1 4Y19E 5T5FL 5KVGH 2R0LL 1YEEH 4XPHL 4CAGA 3SDAD 5KS9F 3WDJA 3O3EB 1FQ9C 5JDSA 1NGXA 3QWOA 2X9YA 5FV2A 3WKML 4NZDA 1YNTA 3U4AA 5D7KD 5GSVB 1WAAF 3SDAA 2VN4A 2GK0A 2XN9D 2QL1A 3MRDA 2AV1A 1JGDB 1VEPA 1JWMA 1TNNA 3LKSA 1C1EH 2HVKA 4E41E 4OUUA 2CUHA 1OM3H 2AKRB 5EU7C 2VISB 3SO3B 3DX9A 4XXCC 4ZD3L 3SBWA 5FEBA 3EO1B 4MAUH 1NGWA 4YXHH 2XN9A 4M9OA 2X4UB 2BNRE 1BLNA 1D6VH 4OAWB 2X9WA 5AWNL 5IB5B 3IDMB 1GPOH 2R1WB 4XTRC 2ZUSA 1S9VB 1A6WH 5HGHA 4NO3B 1RIUL 5BQ7A 3DECA 3BKML 4FFWD 3BOVA 3VFRB 1CT8A 1M71B 5GZOC 4V1DE 5DEGB 1WZMA 1JPFA 2IPUG 5E5MB 2VSDA 1YMHB 4XAKE 3SDDC 5LVEA 2MQ0A 3A6CH 2PW2A 1OAZL 4RIRA 4KHXL 1NCDL 1UXWB 2D4FA 2UWEF 2R56L 4PG9A 3GSOB 4PJGE 3S4SA 3WJLC 1MFCH 5BV7B 2FCBA 4HIJA 5J13B 5IBUG 1WBZB 1U41A 4JFYA 4BZ2L 4D8PB 1B0RA 2VC2H 3T0EA 3V79C 4CVWA 1LP9F 4KJPC 1TMCB 4RISL 3IAGC 1L7IH 3BHBB 3TWCL 1DBAH 1T04A 4PRDA 1FZJB 1FE8H 4OD1L 1RK0A 4P23D 4NN7B 3GSUB 5ALBH 3GK8L 1CLOL 5L7XH 1I8KA 4F7PA 4OTXH 5DO2C 1RURL 1X5JA 3BKCL 1IGYA 4OF6A 5F6HJ 5IVNA 2ITCA 3K1DA 3ET9F 4XBPA 4MB3A 3QG6B 3DX8B 5DRNA 3ZHLA 2GJZB 2KPNA 4JN1L 4L29B 4P23A 5DI8A 3IFLH 3L3KB 3OX8A 1S3KH 1OP5H 4U1NB 1HHIA 2VL5A 1HE7A 4XNYL 4PUBL 3MJ6A 3ALXA 4HLJA 3C8DA 1GZPB 1GOHA 1ZXQA 3FQTB 5SWQA 4KZDL 1F4YH 1U2HA 1DVFB 3CDYA 2GY7B 4ZO7A 3ALWA 1HHKA 4JFFE 1ZGLP 3Q48A 5FYLH 1QO3B 3OKKA 4Y5VA 1KC5L 2XRAL 5TH2B 2P48B 3VFVA 3VG9C 2ZOKA 3BZ4B 1CDHA 4EN3B 4Z76A 1NJ9B 3MNWB 3ARWA 2CJUL 2XA8H 3RIFF 3VA6A 3K0WA 1P84K 4Y1AE 4U3XA 2O26U 2VDMH 5DHVH 4P9ML 4ZS6C 5C08B 4QOKD 1KCVL 3SGDI 2O5XL 4YPJA 5E7FA 3KNBA 5IP4A 2E7BA 3IDUA 1XIWC 5T3XH 1QR4A 3D25A 2CDFA 3F6IA 1U8KB 1LVEA 2EDLA 3AS3A 3CH1B 4QOKA 4M02A 5IW6B 4GW4A 1BX2B 4K55A 5LGJB 3BMWA 4TNWK 3B9KD 4JQIL 4OCSL 3MRKB 1OW0A 5KANG 4ZXBB 3BP7B 4ELMF 3TYGH 4RAUB 1IQDB 2PYEB 5KOVC 4R7NB 4XT1C 2R4SH 3UTOA 5J7CC 4OF7A 2J8UF 1KIPA 3C6SA 4XC1L 5CJXC 3VDAA 1J9CT 1K4CA 3VXUE 3B9KA 4HF5H 4N8VA 1OP3K 4JG1H 1S5HB 2EDXA 1TVHB 1I3VA 3C2SA 2R1YB 4W4NA 3PWPE 1OGTA 1L4IA 3FT2B 4NWTH 4DK6A 1LILA 2IQAA 1D5ZA 1R3IH 1WCBA 3FN0H 4S1QH 2R2HB 1YEGL 3RVWD 3QUMH 5E6ID 1XGPA 3BPLB 3K4DA 3GI8H 1MIEL 3DVNB 3GZKA 4AL8L 5F7MC 2Q8BL 3WLWC 2XPGB 4U6YB 2FHFA 2NX5E 2C7UA 3TV3H 4D9QE 4L3AA 3I6LE 4P5TD 4OB5H 1J5OL 4L3EE 3OSKA 4GAYA 1BF2A 1I9IL 3Q6FB 1DQLH 3NCEB 4AIZB 4XP9H 4ZFFB 4OKDA 1YYML 4G9FD 4YEEA 5LGKA 2UVFA 1CK0L 5C09E 1MCFA 3MRFB 4NQDE 4PJBA 2OZ4A 4P5TA 4JY4A 2Z31D 3BAEH 5JR1L 5JPNB 5ADOL 1IAKB 1LEKA 1J18A 4G9FA 4WY7H 3MLRH 3CSPA 3DMMC 4U1SA 4YIQB 4C56B 3D85D 2WBJC 4MXWL 1O7SA 4CADA 3MLWH 4TRPH 2Z31A 3CCHB 1YY8A 3RWJB 5ICXB 1MREH 3AY4A 2OI9B 5L2JA 4X4ME 1IKFL 5HDLA 3CFEA 3D85A 5C0DA 5LGHH 3PJSB 3QEHA 3N1PC 3Q0HA 5B3JF 3SOBH 3Q1SL 4N8CL 5T5NG 4PBXA 5E8PB 1T5XB 4BK5A 5DD3L 5KANI 5FF6A 3HZYA 1NDMB 2I9LB 4FXKB 4K3EH 1S78D 4PRBA 3I85A 3KPMA 3P4LA 5IVZB 3P0GB 1U8MB 2WV3A 4BELD 5JO5A 1MFNA 1X6NA 4G43B 4XMPH 4GG6F 1A8JH 3U0WH 1C5BL 4E41D 1ACYH 4LLQB 1OD9A 4YDLB 3M45A 2ZUXA 3O45A 3P0VL 1AGEB 4R7DB 1JBJA 3HCVB 4ZOBA 3BRFA 1ULVA 4IS6A 4E41A 1FFPB 2FJHB 2A73A 1AQKL 5GJSL 4QGTA 43CAB 4IOSD 4GQPH 4LDEB 4EQ2A 4TN9A 5TPWH 2ZSWA 4NNXA 3MV7E 3DRTB 2XWJA 3FO1B 3KPSE 1DZBA 1C7TA 2MCPH 2NZIA 5HHXH 1RVFH 3JSSA 2BNUB 4FQHA 5C6TH 3BE1L 4V1DD 1AHWA 1KNOA 1A6AB 4NRYB 5DRWB 4UNUA 5LWYH 2YR3A 4NO5A 4F7CB 5KAQG 1J1OH 3HZKA 1FNEA 4KK8C 5DQDH 3RA7H 4HJGB 2X42A 3C8KA 4V1DA 4UBDD 5HVHC 1WT5A 2LTQC 2YWYA 1T7YA 4L8SA 4MJ5B 4M1CD 1QD0A 4MNGB 2HJFB 1UCBL 3D3VD 2YA1A 1IFHL 4KPHL 4FFYH 2E9IA 1DQML 3WFEH 1HHHA 3CSBA 3NH7L 3KDMB 2F54B 5DMGD 3EFDL 4OZHA 2CQVA 1MRFL 2GFBB 2KUTA 4RQQA 3BXNB 4ZFOB 3DGGA 4P2QE 3D3VA 4HEPG 2A1WH 3RY4A 2GCYA 2VXUL 5E2UH 1MHHA 1R3LA 2JJUA 3NFNB 4HBCH 3X12A 5FK9B 3KLAB 1F8TL 1VFUA 1JHLL 4LKXB 5KVMC 3SDCB 1BD2E 5J3HD 4HH9B 2D2OA 4ERSH 4JHBA 3U9UA 1DE4A 4UT6H 3RDTB 3VDCA 2WLZA 2FEDD 4LCUB 5I15L 1YEDA 3L5XH 2AJVH 2OP4H 5I1DA 1U93B 5C9KA 1EGJH 2BFVL 3WNOA 2QSCH 2QKIA 3SDAC 5DJZA 1KULA 4FZ8L 3V4VH 4DAGL 3OHXA 4LCWD 4Q9RH 1F97A 2B8OT 5I71B 3TJHC 2F9BT 1FYTB 1S9YA 4JFFD 4MWFB 1P4BL 5FO8A 4LMQE 3VI3E 1FL3A 2ARJB 3REWA 5C0ND 2DIBA 5DLMH 4JN2