1EHWA

Human nucleoside diphosphate kinase 4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
HMGTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The human nm23-H4 gene product is a mitochondrial nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2000-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ehwA00
3BBFA 3VGUA 4UOHA 1NLKL 1XIQA 4W98A 1LWXA 1B4SA 4F36A 4F4AA 2ZUAA 3FBEA 1ZS6A 1NHKL 1VYAA 4DI6A 3EVOA 1PAEX 1F3FA 1BUXA 1NDPA 3PJ9A 3ELHA 3B6BA 2HVDA 2CWKA 1WKJA 3DDIA 3FCWA 4DZ6A 3B54A 4O0NA 3FKBA 3R9LA 4ANCA 1S5ZA 1BE4A 4ENOA 1NSPA 2BEFA 5C7PA 3Q83A 2AZ1A 1UCNA 3FBCA 4ANDA 2DXEA 2VU5A 3VVTA 2DXDA 2NCKL 4C6AA 3PRVA 1W7WA 1WKKA 1S59A 3EICA 4FKYA 3ZTOA 3NGSA 1NPKA 3MPDA 3VGVA 3FBBA 3Q89A 4CP5A 1NSKL 3ZTSA 1PKUA 1K44A 1MN9A 3ZTQA 3Q8YA 2DXFA 2HVEA 3L7UA 3ETMA 5CAAA 3BBCA 1B99A 4HR2A 1BHNA 1NSQA 1LEOA 3DKDA 2B8QA 4FKXA 1NUEA 1WKLA 1F6TA 3ENAA 3Q86A 1HLWA 3VGSA 3Q8VA 1XQIA 3NGRA 1NDLA 3NGUA 2DY9A 3EVMA 3ZTPA 5IOLA 2DYAA 3NGTA 4UOFA 3VVUA 1NDCA 4S0MA 3EE3A 4ANEA 4KPCA 3ZTRA 2HURA 3G2XA 5CABA 3EMTA 5BXIA 3FCVA 4WBFA 1U8WA 3JS9A 1EHWA 4UOGA 1JXVA 1MN7A 3Q8UA 3EJMA 2B8PA 3FC9A 3EVWA 3BBBA 2BX6A 3BH7B 3WX8A 1HHQA 1KDNA 3EM1A 3FBFA 4DUTA 4EK2A 1HIYA 3VGTA 1NB2A 3GPAA 3GP9A 3BH6B 2AZ3A 1NCLA 1S57A 1NDKA
chains in the Genus database with same CATH superfamily
2LCWA 1UA1A 4PWUA 4UOCA 1FRXA 5KG1A 2DEIA 4CI0B 4H4KA 4OZ3A 3HPOA 2K2PA 2VFTA 3KJQB 1H7XA 3I9V9 3NXZA 2DNGA 4YEAA 5FDLA 1ZETA 3LANA 1ZTTA 4IDKA 2AP6A 2LECA 4DLEA 4GKJF 2MKSA 2BJ1A 5B08A 3HHLC 4FF3A 3UD5A 2RRAA 1HR0J 4IDKB 2AX1A 4NWBA 2N7CA 3GJSB 2F8MA 4MIWA 2HGLA 2XHWA 1PSDA 1VC5A 4N5SA 1NK8A 2GS8A 3NMRA 5HSPA 3IWNC 2YBVA 2CVIA 1Y5LB 1FTCA 1NJYA 3DFEA 4A8FA 5LSLA 1Q8LA 3OPKA 2XMMA 4LRFA 2KRBA 3FJ2A 3NMAA 1QE1B 1WOPA 4HL9A 2SXLA 5D0RA 3L09A 4DL5A 4N41A 2AHOB 2PMWA 2DHHA 3DM2B 1YBUA 3Q2SC 2IRUA 2VJUA 3O2IA 5I3UA 2CXEA 2HNDA 2Q1LA 2FTRA 2HAIA 2CQ3A 2H54B 3QT8A 4J9QA 1XN9A 1C1BA 3K8VA 2ZKTA 4LF2A 2MZSA 2HHUA 1KTQA 5DDRC 2G1DA 2LEPA 3MWBA 1HNVA 2V8HA 3R2CJ 3CT9A 1J2VA 2KI2A 4HT7A 4ZVPB 4QPXA 4DR7J 3AOAA 2DXEA 2NXNA 2O01C 1KQSR 2K3KA 5DGAA 2AGQA 2D1CA 2N7YA 3C6UB 2KG0A 1EX8A 3FEZA 4TLRA 2E5IA 1UFLA 3OQ2A 1TK0A 1RCXB 4M5DB 2ZFHA 4O44B 3SIPB 4UQGA 2LU2A 3DI6B 4G1IA 3R6LB 1NPKA 3M9NB 1RGVA 1LQ9A 4WU2A 2HBRB 1RHKB 2JC0A 4O4GA 4N7TA 4L74A 3TZWA 2H9ZA 2W1BA 4LUBA 1CJVB 1RYSA 1N88A 5AXLA 2ZE2A 2IBOA 4HTJA 4ZPDA 3I55S 1F60B 4JI4J 3J7ZT 2H4YB 4RW8A 1E6YA 1X4CA 1NU4A 3QWPA 5J2NB 2R7QA 5B0DA 3WC2A 3EPGA 3OTBA 5E7OB 2ZH6A 4G6VB 3N01A 1VQPS 5IV3A 2E5JA 5L46A 4DV1F 2FY1A 3CCZA 5B7WA 1IBCB 4QW9A 2MSSA 3L3CA 1X9SA 2XLIA 3OR2B 4EBEA 1AXQA 1U4BA 3NGUA 1CS4B 1IBLF 1IR2A 2CPDA 3IA0A 4IOCQ 4DSKA 4XTTA 2HFSA 2HBQB 3J7YI 5IOLA 2DIUA 3QO9A 4DJBA 5HN0A 2YNGA 5A8WB 1WF1A 5L1KA 1XERA 4FBTA 3N0VA 1U02A 2OH2A 1OPZA 1CEZA 5BXIA 4RW7B 4CO1A 3BQ1A 1U0SA 1WSVA 3PW5A 4ILLA 2MXYA 3M2UA 3T6JA 2XGPA 4LF7J 2H5IB 4DR5F 4NLGA 3H4DA 3PRDA 5KG0A 1YWXA 4Y28C 1A0OB 2Z4PA 4Z7CA 1AA1B 3AQOA 3EJMA 3V81B 3KLFB 5H1SV 2Z2MA 1G4CA 2OPSB 3NBPA 4ID5B 2QLFB 2ZH8A 5HROA 1VRUB 1L3UA 4LF6J 1UVMA 3HCXA 1HHQA 3V81A 3GG0A 1ICEB 4O4GB 3NCPA 1LFPA 1NM2A 3K0JA 2IM1A 2KT2A 4FF1A 4LQ9A 4NASA 1LWFB 3ILLA 4XDCA 4EBDA 1T05A 1RBAA 1S1TB 3CO0P 3GP9A 3GIKA 2D7SA 4PWDA 1SKRA 1FKPB 2KJVA 2Y9HA 2HBYB 2RKIB 3OSNA 5F8LA 2BABA 3BBFA 3CDWA 5FLXY 5DO2A 2KKHA 1YDLA 1C0TB 4UOHA 3KHGA 3WC0A 2R8HA 4WIQA 2KJWA 2V68A 3HFKA 1VQSA 4OJ3A 1S9GA 1P8GA 3AFGA 4MK8A 5ETPA 3HM9A 1NHKL 9RUBA 3CF5Q 3CJ5A 1H3DA 4C8NA 4UTGA 3NCQA 2MZRA 3W2VB 4KFBA 3W7BA 1PAEX 1WI6A 1RISA 3ILOA 1DAXA 1HQ2A 1X4FA 4A8OA 3DHWC 4XK8C 3M9OB 2JEGA 2HHXA 2VV5A 3CIMA 1YJVA 2RDIA 2R7WA 4LFAJ 1S77D 4OYMA 3TP2A 4F4KA 3SCIE 2GVDB 3M6WA 2C2EA 1A6LA 5DM7Q 2B9WA 2VFSA 3NNCA 2RQ4A 2MJUA 2MY7A 1LNQA 1TQLA 2K1RA 2RE1A 3KUEA 4PYDA 4C0BA 2GX8A 5IC6B 4ZCIA 1XMOF 1CC8A 1TK8A 2ZH5A 4H4OA 3HF5A 2ZOGA 2DITA 1O0PA 3KLIB 3PCOB 5D0EA 3U27A 1VQLS 2JOQA 2KXFA 2OP5A 3W8GA 4ELUA 3G6ES 1FJGJ 2EKNA 2YH0A 4JI3J 3KK2A 3C19A 3J7A1 4Q2LA 3THVA 1WC1A 1WORA 4RBTA 3FSIA 2WW4A 2Q6BA 2RQCA 1NJIT 3AXMA 3OTOF 4Q0BA 5KFQA 1T9WA 1IJFB 1HNIB 1HFEL 4YUDA 1X4DA 1FESA 2EG1A 3GLJA 4ED8A 2UP1A 3V6DA 1WDDA 4ZVFA 1M5KC 1NSKL 2AJ2A 3ILJA 4P6QA 3VF0B 2H5JB 1D3WA 1FFWB 3TAMA 3ZTSA 2QA4G 1XMBA 3ITHA 3M32B 4P2FA 4DL0C 1RHJB 5JVHQ 1VR6A 1KNZA 1RT4A 4NCAA 2C2NA 3SFUA 4E8UA 1SKWA 3PX0A 5E3PA 4FKXA 2HZVA 2WB1D 5A0YB 2J0WA 1VDHA 2DO4A 2JL9A 3PYEA 4DR6J 2WOMB 1S9EB 3CTRA 2WSCC 5LM7E 4AXJA 2EPIA 2VICA 4A8SA 2RS2A 3C15A 4FYWB 3LPYA 1NDLA 1OYEA 4JYAJ 4DV6J 1EKRA 2AQ4A 2FVSA 2C3UA 3PG9A 2QV6A 3IM9A 4KV8A 5M2UA 4DCJB 5AJ3J 5DG9A 2HK3A 3GB0A 1NK4A 4OHWA 4UOFA 1H6KX 4B9SA 4J9VA 4MIBA 4IRKA 4F2RA 2HNYA 2CQCA 7FD1A 3GV8B 2VC1A 3UCUP 4KHRA 3FEYB 1S49A 3PKMA 1H7WA 4FS2A 1RA6A 4I1TA 4USJC 1VRTB 3UD3P 3CCWA 4RX6A 2YKMB 4OI4A 3TQ1A 4DN9A 4ZHRA 2OHDA 4EU0A 4FBUA 1FA0A 4P75A 3FEXB 4RNHA 2ZHOA 4X4SA 2G9OA 3ISND 3U1LA 3IAS9 2AD9A 2G0IA 1ZOTA 3T41A 4DF8A 4J9PA 5I3PA 4LF4F 1RZMA 1OJ4A 3JXOA 3RW6A 3TO8A 3FSYA 4KB7A 5KFUA 1TELA 1GTEA 3AA8A 1QAXA 5HMWA 2Z57B 3UNYA 1ZTWA 4WTOB 5MLCV 3MM8B 2M52A 4J9LA 2KXHA 5DRKA 1HMVB 3N28A 1YITS 1CJTA 4ZVQB 5J2PA 2FLPA 1S0VA 2F8HA 2JC1A 1D0EA 3MAAA 2FD2A 4IKAA 4Y2IA 2P9GA 5HVHA 4YR0A 2NUUG 2WVCA 3T1YJ 2ZH2A 1QSSA 1VQ6S 2OPQA 4TU8A 4UT4A 2Y8WA 2L9DA 3B78A 5DQGA 4RW4A 3NOCA 2VL1A 3A3NB 3M1VA 3NBPB 4ID5A 2HHWA 2KT5A 4W98A 2XQCA 1L3TA 4RNOA 1VS3A 2H5EA 3MM7B 4R8UB 2UUWA 2BW2A 3CVKA 3PYGA 5HMZA 3TRGA 1SJFA 1FJ7A 2E1MC 4DI6A 2J7KA 4F7VA 2WCXA 3QLHA 4MKYA 2ILYA 2UVVA 4FS1A 4N76A 2YKQA 3OTCA 2FVQA 2FC8A 5KT4A 4X4TA 3PIPQ 3LP1A 4HACB 4DEZA 5D78A 4HI1A 1UTAA 1M1HA 5F3TA 3DNCA 3PEJA 2KVQE 2FGCA 4M5DA 4HKQA 2EK1A 1HQEB 4LIWA 4DZ6A 3NS6A 2FVCA 1BWVA 2OEJA 3GCWP 3IM8A 3E2EA 3MM9A 3TARA 2WBMA 4CH0S 2W8LA 3GIRA 1FXLA 3WQPA 4C0HA 1D9DA 2LLZA 3CJTA 1MG7A 2CQGA 2BM1A 2IRYA 2F3JA 3SMZA 3PKYA 1SQEA 3VVTA 5F8HA 2CPYA 2FUG9 1KBRA 5D4PA 1SH0A 5A0YA 1DRZA 1HBMA 2G2ZA 2WSEC 1Y9OA 1FO1A 2VB6A 1P1LA 2XMWA 4NLWA 4RLEA 4ALZA 1LFWA 5GAHU 2DCLA 1WHWA 4LBIA 1ZM3A 1WJ9A 2F40A 3IGNA 3CCES 3DM2A 4DPXA 2QO3A 2VZ9A 1K44A 1Q5YA 4TN2A 2RU9A 2W4DA 1RAIB 3K2YA 4LF9J 4PUOB 4GKKF 3SCKE 1U2RA 2AYMA 5DETA 3QGPA 1NJXA 4LBHA 4NEYA 4CQ1A 3HVWA 3ZZYA 4ZKAA 4ZP7A 1WUUA 1WTFA 4DL4A 5I42A 3DOKB 1SJ4P 3LW5C 3Q86A 3HSJA 1WDTA 5ETVA 1S12A 3GSDA 3K58A 5GADU 2CAJA 1WG4A 6AT1B 1JNRB 1F9EB 2J9CA 2ZKUA 2HIYA 4JI5J 4E98A 5KFYA 1FKAF 3D6HB 1U1MA 1S0NA 5J2QB 1RTIA 3V4IB 3MCOA 2RILA 2W25A 2YWFA 3BN4A 4IG0B 1TL7A 4LSNB 2L41A 1HHTP 2CYYA 4IQXA 4RW9B 1REGX 1NDCA 3RRGA 1R0CB 2M88A 3H59A 3CPWR 4X64J 1Q1KA 3FFIB 1LW0B 4L3NA 2XLJA 1JLQB 1RP5A 2B9XA 5M2RA 5LSOA 2ROEA 3FCVA 4OMFG 2ATLA 1NK5A 2EFGA 2BOPA 1SUQB 5LL6d 2OAUA 3JAMU 2PFFB 1OY6A 2GMHA 5D77A 3H20A 3RU0A 1F2GA 1MN7A 4KYZA 1OSDA 2R4FA 2ZDPA 1YSJA 1KHWA 3BYPA 1Q0NA 1UW4A 3LOUA 2CADA 1H0HB 1WC6A 2EKYA 4LF1A 3E8OA 3LAKA 2RMLA 5KG5A 2D3ZA 3LA0A 4Q43A 3JYTA 4QWAA 2VODA 3NWRA 1XNQF 2W24A 1OQ3A 1TP7A 3ENVA 3VAMA 2HRTA 2PI5A 3FBFA 2YNGB 1S6PA 4PG8A 1LWEB 2RF2B 4USHA 1V5VA 2PO4A 4ZCKA 3SSSA 1CBKA 4A8WA 4DR4J 2MQMA 3NAIA 2I5JA 2C3YA 2KHDA 1JNZB 1RDRA 1NRKA 1S79A 2CJ9A 2GJFA 3GMGA 4U8VA 5FIIA 5CD4H 4QYZK 1YVFA 4JUZA 2DK2A 3VV2B 4MMOA 1C0UA 2I9SA 3OR1A 4NYOA 3POTA 4O3OA 4JI0F 1S1UA 3TVKA 1PILA 1TMJA 2KN4A 1RB0A 4I6AA 3HVRA 2Q3PA 4AL5A 5HVGA 4ZPWR 4DN0A 4NLSA 4DR5J 3D9BA 1QVGR 1ZS6A 1EKSA 3H7HB 5CYMA 3PV8A 4BDPA 4WWSA 2QZ8A 5IC4B 1RE1B 4F3QA 2P2CB 3HVTB 3UR3C 5I4MA 5C24A 2FHMA 2EFNA 4DR2F 4ER8A 1BQMA 3TNVA 3O1LA 3OR2A 4RUCA 2A3JA 2RKIA 3MMBB 1P9QC 4C0OC 5DQHA 2E7VA 3HHLD 3TOQA 5BR8J 1RWUA 1IKXB 3W9IA 2I2YA 1Y3KA 4B3MF 4F02A 2LA4A 4IOAQ 2QFIA 3BGRB 5L9NA 2V8GA 3ZZPA 1JQGA 2NXCA 3H2UB 1E6VB 3MEDA 3FKBA 4DPTA 1H74A 2B4PA 3T1AA 4M5HA 1HNVB 3RB3A 2ZOFA 2MKIA 3EDRB 3MAHA 3OUYA 1RAFB 3QZ8A 2C1EB 2G2YA 1U1NA 3CDUA 4F0KA 4M8LA 1HA1A 1Z1ZA 1YBTA 2I0XA 2VU5A 2NUHA 4RBVA 1TFWA 3R2DJ 2DR9A 3PTWA 1QAYA 4F04B 4A8XA 3HVAA 2BOAA 4QZVB 4X62J 1KKHA 2DHSA 2H51B 2FB0A 1EP4B 4DS4A 3MMJA 2HVIA 4WF9Q 2ZC3A 4PQUB 1VQNS 2MQLA 3D5MA 3DU6A 1CJVA 2GMLA 3FBBA 4ZCLA 2UZAA 4MT1A 4PXCA 3U1MA 3C46A 3DRSA 1B70B 2Y3YA 3DGPB 3DMJB 4YB7A 4B3SF 1S9FA 3V4MA 4NEZA 3L7UA 1VFJA 5CAAA 1VISA 1VJQA 2YNFA 4IO9Q 3BSOA 5JJBA 4OZLA 2C2RA 4P52A 2AYBA 2ATCB 1XR7A 5CYMB 1NB7A 4DFMA 4JI8F 3OL9A 2HFZA 3KK1A 1Q16B 3RZAA 3N5FA 2VQFF 4Y6IA 4NZ0A 4U6PA 3FMWA 1UETA 4JI2J 3SSRA 4U67Q 2GHVC 8ATCB 2J6SA 3QRRA 1C1CA 3WHIA 3Q22A 3UCZP 5IQQA 4MK9A 3M8YA 2Z30B 1I5OB 1RT3A 3TAMB 1WC5A 1U24A 4WFZA 2NYHA 3RB0A 4MYTA 4OHYA 3NOGA 3EZUA 3R3TA 1LWEA 1SJRA 1LXNA 3MEKA 2MGZA 2WAQD 1UL3A 2DKOB 3O6QA 2IBKA 4EO8A 1LWCB 2KFYA 1F0XA 3UW1A 3NS7B 3TA1A 4UY8T 2ZD1A 1M90T 1BC6A 2XY6A 2BUNA 4DV0F 4P74A 1OY9A 4PPDA 2EC2A 3IR5B 4WP8A 1U1LA 3PNIA 3EWGA 2BJ7A 2AJQA 1U6FA 2M0GB 2W2QP 2ZBCA 5FDLB 4OFZA 3KDNA 2KU7A 3WX8A 4CTAA 3MECB 5F8IA 3HK2A 1S1TA 4WP3A 4FNIA 2V4QA 2ZM6F 2AJFE 3I4PA 3QIPA 1JMTA 3BDPA 3F44A 2W2PP 3DOMA 1R0BG 2XS2A 1TL1B 3T9NA 1I6JA 4I4BA 1S6OA 3FZBA 4IQMA 2ZUGA 1X5PA 2F9DA 1MNEA 2A18A 3DOMB 3A4TA 3RRKA 4WKYA 3PW7A 1HI0P 4KH0B 4ZPVR 3BREA 3PYDA 4GO5X 2R8KA 1O8BA 3VGUA 1K9MT 3M2VB 3BGOP 3E51A 4USMA 3OLAA 4G3IA 2BJ8A 5DLGA 1XJWB 3L9ZA 1E6VA 3MEDB 3CCRS 1WD6A 4F4AA 2NPFA 1KLNA 3HSGA 5ADZA 3VALA 2LEBA 1XBWA 1FRHA 2C28A 3D1OA 3UN2A 4MFBA 4U7CA 3MFIA 3J7AN 2BJDA 1GNKA 2AEMA 1Q7LB 5KFZA 1DQAA 4YFUA 5HMXA 2HK2A 1UKUA 2B5JB 1WHVA 2A1BA 1KQGB 4U7UK 3K5LA 3H5XA 2OTJS 1HD1A 5EWFA 4PYAA 5CH7B 5LXRA 2V2VA 2HNZA 2WVEA 2XZDB 5A2QY 2D3UA 3B6BA 3CCVS 2ROPA 1GH8A 1WKJA 3BO3A 4MIAA 3NGKA 1RLDA 3G82B 3THPA 4KHMA 2ADBA 4ES3A 3ET6A 2V2QA 4ZPAA 5K9FA 5IV4A 3ZZ0A 2AIRB 3UI3A 4DL3A 3MM7A 4IR1A 2BE2B 3MDFA 4C11B 4CYUB 2XWYA 2HQDA 3KUHA 1VRTA 3R5AA 1U1KA 3D1HA 4KKOA 4PEOA 1ZBTA 2C22A 2Y1LB 5K8MA 3SZ2A 2AYEA 3AJ2A 1JXEA 1AFIA 1NK0A 3DLLQ 4NRTA 1WKKA 4JI1F 2LMIA 3IBFB 5G0RB 3NLCA 3KLHB 5DDPC 1N6QB 3JQJA 4X4UA 2QLJB 1S6UA 1MROB 1N5QA 2DNKA 3KLHA 2AJ1A 2U2FA 6FD1A 2ZZMA 4K7QA 1EARA 5HATA 1HI8A 2BE9B 4YY3F 2B0GA 4LJMA 1UJ4A 4ZJLA 1VOMA 2VDIA 3C3LA 1HMVA 3BR9A 3ETMA 3RB6A 1NH8A 1HHSA 2DTJA 1QUVA 1ZPVA 4B17A 4DCOB 3QGHA 1HR0F 3RUBL 5IM0A 3QJJA 2LVWA 1JLBA 4WE1A 4G1QA 1C4AA 1YBAA 2QLXA 4I6WA 4K4SA 1RTDB 5IM0B 4GKKJ 1DJ0A 1WKLA 2V67A 5CCLA 2Y1JA 1IQZA 2QSWA 3ADAC 1DTQA 1A7GE 3N6MA 4J91A 3HT3A 4UUXA 1KLMA 2W2MP 1SQGA 3W9HA 2HNZB 4ED3A 2KYXA 4F4XA 3KG1A 4PRFA 2JX2A 1CVJA 1BD6A 2Z2YB 2FHKA 4KQZA 2MQPA 3PO4A 5CYQB 5D4NA 4DR6F 3MR5A 1YZ7A 3NRBA 3O44A 2DH8A 3FK4A 3UVJB 2ZH9A 5IQ6A 3D54A 4TKTA 3EMTA 4BS2A 4RPFA 2L9NA 1S97A 1R43A 1YZ6A 3CD0A 3F41A 3JS9A 4PAAA 4P10A 2R7RA 2EG2A 4QR2A 1RHMB 2RDDA 1N5YA 4O3RA 4TQRA 1EZZB 1ZAVA 4O3NA 1UPPA 2HNDB 2YX4A 3KLEA 3G96A 4J9SA 1OMSA 1CQNA 4USUA 4DPYA 4TU7A 3KHRA 3VHQA 2MLZA 2QC3A 4E2FB 2BX6A 2X3DA 2FZKB 4DQPA 2RS8A 5T41A 3NG8A 1HKAA 3HLUA 2C3OA 1TUVA 2HZCA 3CCTA 3GFZA 1VC6A 4BWJA 1TUGB 2JH3A 1U09A 1UFKA 3OXLA 1IWAA 5K8PA 3NKYA 3AA9A 1O5JA 3CJ4A 4B9MA 1NCLA 3IWXA 5KFBA 2B51A 3N79A 4OZ2A 3DXSX 1RAGB 2HZAA 4ZS6A 3MI7X 1REVB 3G9CA 2DRDA 5HQ8A 4K4TA 3RR7A 4KGMA 4J5OA 1DZ5A 4BHQA 1LWXA 2JEFA 2EWHA 5A8KA 3T5LA 1FRMA 3VAHA 3T1YF 2IMWP 1LOUA 2B9YA 2K7KA 2XHCA 2H65B 3X1LB 5A8RB 3EVOA 5CD4A 1BGXT 1LWFA 2LQ8A 5K20B 3R1HA 1NNDA 2CZVC 1F3FA 1BUXA 5E33A 5KG6A 2BVZA 1VQ5S 3QRQA 1F9HA 4CZCA 2ZOMA 4N77A 2FZCB 4EI2A 1HD0A 1RHQB 2PA3A 4F25A 5EHHA 5I3UB 1DQ9A 1RAHB 1HNIA 2BJEA 2HVDA 3PYFA 4L72B 4USWA 2AJ4A 3SQGB 3OLBA 3OL7A 3RR8A 4OJ1A 2BBEA 2FC9A 4RUBA 3TUPA 4FVMA 3IP0A 3RW7A 4WIIA 5C25B 3T9ZA 1M5VC 2XMVA 1G6BA 4O23A 3W2VA 4LR8A 4Y34A 5KG4A 2EEYA 3UCGA 1B7YB 3KLVA 1CULB 4WU3A 2B7CB 3PW4A 2OUGA 1GK8A 3EGWB 3G6XA 1TKDA 4ZJQA 2GGPA 2NSBA 2CJXB 5AJ3F 3THTA 2HWTA 3JSRA 1SPBP 2J6UA 1W7WA 3QGIA 4HHHA 4JI6F 4QIGA 3VCDA 1VIOA 3W64A 3KK3B 3CCSS 2CUYA 1V6HA 2Y1RI 4JI7F 1T94A 2GVDA 5HBMB 2IPOB 3M8SA 1SC6A 1VRUA 3CCUS 4O3QA 4NA2A 1PKUA 2W9AA 2P5VA 2Z8QA 3K57A 2CPJA 4CYUA 4Q8FA 3MPUB 5KFCA 3TAQA 4ZVRB 3BBCA 3D0HE 4HR2A 5K14B 5BR8F 2VQEF 2IA6A 1UVJA 1NSQA 4NOHA 5GMKa 4XIUA 1DURA 4X65F 2XMTA 1GMVA 5DLFA 2KH9A 2C2DA 1FNOA 2BW7A 3I0RA 3HULA 4NL5A 1AUSL 2D74B 5HJYA 2KTQA 4M5KA 1SB6A 4YHHJ 2DR6A 2RHQB 3I31A 3T1HF 2R8JA 2GA7A 4EYIB 3CJKB 1IJEB 3LP1B 4ZVTB 1UJ6A 2ASDA 1T03B 3RG6A 2BACA 3RBXA 5GAGU 3OL8A 5KFEA 2DNNA 2LU1A 2KYZA 2ZEJA 1VBZA 1D8ZA 1FX2A 5KT2A 2HLUA 3OHAA 4K4VA 1HQEA 4F2SA 3OXGA 3I87A 1FFSB 3R5CA 4NXMJ 1TAQA 3KJVA 3BJYA 2UUAJ 1FHTA 1YRTA 3CC4S 2ASYA 5LT5A 5ITHA 1FWKA 1X8DA 4ID8A 5F0UA 4CO5A 1B64A 2XCPA 2LDYA 4DPUA 5C5JA 3OVSA 3CJ3A 1U8WA 3G86A 4ED5A 1I51B 1SXLA 1J5OA 2OELA 2F63A 1JXVA 2GVZB 2YWKA 3TR5A 3GIJA 1C0UB 1SIWB 3OR1B 2PE8A 2VG6B 4O3PA 3KG0A 4ZIVA 4IOBA 1TKTB 1YRUA 3LAMA 4DV2F 1NK9A 3HD2A 3BBBA 2JEJA 1FX4A 3LALA 1EJ7L 3DLJA 2PMZD 3RAMA 4DV4F 4OL8A 5A8KB 1IBKF 4DL6A 3AD9C 2QL7B 1N32F 1NBEB 5HL7Q 3QGGA 2I5JB 3W2WB 5KFNA 3TA0A 1HIYA 1DQ8A 2OLWA 1X9WA 2UUBJ 1G3OA 2LQ9A 1DARA 3JSBA 5ETSA 1HQUB 2BKPA 3D6MB 4V1Ak 2Y0BB 1M5HA 2MZJA 3QAEA 1JIHA 3Q0AA 4P71A 2KG1A 2MB0B 2YVSA 4XPCA 2BANB 2MMYA 4OYZA 2F5GA 4URQU 3H98A 3TAPA 4J9MA 1YJRA 1X0FA 1UEUA 2HKEA 2N3LA 2XMJA 4ZP6A 1OO0B 3IMQJ 3POTB 4LF8J 1ZH5A 1C1BB 1HNXJ 3P5TL 2WBRA 4RW6A 3JAMY 2RUSA 2DHGA 1LW2B 1SI9A 2QA1A 4OYIA 1RWVB 2NZCA 2R7UA 4RW6B 2VG5B 2QMXA 2ZVIA 4Q5VA 2X3GA 1QTMA 3U1NA 2EFQA 1R31A 3MR3A 3VAIA 3DCAA 5JUMA 3BKTA 2HSEB 5DGBA 3DDNA 3PJWA 1TK5A 1U6BA 1JLEA 1U1PA 1IKYA 2CWKA 3L7PA 1FEHA 2AV5A 3MD1A 2W7OA 1AZSA 5AE3A 3DDIA 2YKNA 1FDBA 4ECZA 3Q2TC 3MOZA 2JNJA 4CLLA 2IAJB 2HQCA 1N33F 4QIEA 2K3IA 1N48A 1B3TA 4LSLA 1H2TZ 2F1FA 3AH6A 3W8PA 4KT0C 1JJ2R 1R8BA 1C2PA 3D66A 2HQGA 2K1RB 3AT1B 2EW9A 3IG1A 3ZXWA 4C2MA 4RZRA 3RAQA 3JSMA 2HHHF 4ANDA 5IT0A 1RK8A 1VLOA 3MEGA 1Q5VA 2OPPA 3C14A 3W9JA 4CT9A 3P96A 1NJZA 1VQ4S 1X5OA 2LQJA 2RH3A 4C3LA 1RTDA 1GAOA 4A4JA 1PJ7A 2P6SA 3EICA 4OLOA 1M0SA 3UFCX 4J9KA 4WFYA 2NYIA 2XZWA 3LWLA 5H9FK 2J6TA 1IKVB 3LGNA 1VJWA 3VWSA 5FLXU 2QN6B 3DYAA 5J2QA 5A6PA 3V4IA 4OZ0A 1UVLA 2WSFC 3N5BA 2GHWA 3TA2A 4AQYJ 4EEYA 4CTAB 4AE5A 5DDQC 5ETTA 5IWAF 4NLVA 2OJ3A 5A2QU 3HX9A 1WG1A 1OSCA 5IXUA 2IIHA 4DV3J 1RAJA 5BYSA 1U45A 1RJJA 4NLRA 4B3TF 4DQIA 4ECYA 1NPRA 4DFJA 4ZLJA 1LEOA 3BF4A 1TVRB 3SXLA 2ALYB 1WEZA 2NLWA 2D41A 2OFGX 2CPXA 1TFYA 2V4JB 3PR4A 5M2PA 3ENAA 2WVDA 3IRXB 2MZ1A 3CC7S 5B0EA 4U95A 4JV2A 1XTZA 1SKUB 2KRRA 3GFXA 1SV5B 5U47A 5HP1A 2R8GA 4B9VA 1TKTA 1MU2A 5D3GA 2DHAA 4LIRA 1U26A 2H3EB 2VG6A 3K5OA 3UR0A 4QYRA 1SC3B 2HFUA 3H2VE 4NA1A 5C42A 4F3MA 2XM3A 5HI7A 2IDLA 1C4CA 2BKOA 3EE3A 2IJRA 4NMXA 2AMCB 2JWNA 2XTJP 2B3TB 2MJNA 3HFVA 4Y2CA 2UU9F 4IUFA 2W7PA 1Y11A 2RB7A 1Q8IA 4I7FA 2VBWA 2HS0A 1WSRA 1JLFA 2MLXA 2COLA 4O0IA 1WF0A 1EAYC 2QYGA 3BM7A 4DX5A 1NHVA 1N56A 2F9JA 3KJFB 1T9TA 1FDAA 4KR0B 3T19A 5D4OA 1UP1A 2DNOA 3TX8A 5L1IA 1JKHB 1R8PA 3EM1A 4C8ZA 4MKAA 1CULA 1VK3A 3DMJA 3GONA 2XB2D 3MAAB 2ZJQQ 1GFWB 1FJCA 5EWGA 4NLXA 2ZITA 4IH6A 4C8YA 4I2PA 5LJ5Y 1AW0A 4ED7A 3A8KA 3IO1A 1FXRA 1TVRA 4CLUA 1KC8T 4ECRA 2LEAA 5B0CA 5AE2A 2ACYA 2HG4A 2M8HA 3C6TA 3LUYA 3CO9A 3N4WA 2V9WA 1MW7A 4MAKA 3CD6S 3GV7B 3KMSA 3VZHA 1U1OA 2UXDF 3EGZA 5DZ6A 2HFNA 5L1LA 4GC7A 1RWXB 1S1WB 2VASA 4FXDA 4F36A 1NH7A 4J90A 3FBEA 1FERA 1X0PA 3ENQA 1RT2B 3QFWA 4HLBA 2FHOB 3PXGa 2XBPA 4TQSA 4P72A 2VQEJ 5A76A 4F4ZA 3T3FA 1UW9A 1N36F 4GRSA 1VLYA 4PG5A 4A48A 4DSFA 4F4WA 3V6JA 3R7SB 4DR7F 1WEXA 3O3LA 2GV1A 2CPZA 2YNHB 4EYHB 4B3SJ 4C8MA 5CXTA 5KFLA 1Y5NB 1LWCA 1QJHA 4M5LA 3QSYB 1T03A 2QL5B 2DT9A 1REVA 2YPYA 5E3CA 1FT8A 3HXMA 4IFYA 3AD8C 3L7OA 3SCLE 3FCWA 4XDDA 2VFUA 4QPTA 1S1XB 4USTA 2VHGA 1S5ZA 3HFZB 4O3SA 2LXIA 3H4BA 4ECTA 3G8SA 2HMIB 3SV4A 2YNIB 4QCLA 3AAWB 2VH7A 5HK4A 2GJIA 2FLLA 2YKAA 1S4EA 2XLKA 2YNIA 3CMES 3KNAA 1FJGF 2VPYB 4P2SA 2H1YA 1N5VA 2JVRA 1VGYA 5DJBA 4EBCA 2VPXB 1S59A 2Z0GA 1GMWA 3HSZA 3KLEB 1H98A 4RKUC 2HGMA 2G1HA 3IRXA 4K2XA 4DHVA 3CUNA 1NKBA 1FKOB 1TU0B 3CJSA 4CP5A 2LKZA 2I6WA 2DH7A 5BYRA 3R1LA 1MMNA 1X5TA 2GZOA 2RQMA 3PHEA 1ZM9A 4HTIA 1YTYA 1Q86T 4LF7F 1JJHA 3A3PB 3NS5A 4EWTA 2D9OA 5A6WA 2J76E 4OI1A 4B9TA 4FXWA 3CSKA 3GR1A 1F5BA 2UU9J 1HQUA 1PBAA 2ZWOA 4LRDA 2EK6A 2BA9A 1KVIA 1SL1A 1RTHA 4YB1P 2YKPA 2OI2A 2K8GA 2ZBIA 3SDEA 2M70A 4DMZA 2ZNYA 3E01A 4Z37A 2J9DA 5HANA 2C3PA 5KFOA 1UEVA 2APOA 4GO7X 5E5NA 2G4BA 1FRIA 3WDOA 1X4GA 3NEKA 3ISNC 2EFOA 3T5JA 5KOWA 2AU0A 1B0VA 4QJVA 5GADI 1FNXH 4FYDA 2RD5C 3TEGA 3HZGA 2GO9A 3LP0A 3MM5A 4ICLB 3VVUA 3EX7B 3ZTRA 4EFAC 3MCNA 4LSNA 3H90A 3QRPA 3K7RA 1U0HB 2CJAA 2JFDA 2Y8YA 2YXLA 2MQOA 3OJUA 5D8HB 2BJ9A 1D1UA 1NZAA 2HFOA 3RRHA 3M8QA 3MM6B 5DG8A 1QAJA 5IT9Y 4WBFA 1VBKA 1AYEA 2MHEA 3M30B 4L75A 3D7SB 3J81U 1FNMA 4H4MB 2JZ5A 2O66A 1DY3A 2QT7A 3PJXA 4I69A 3GYXB 4G65A 4RWWA 3ZZRA 3H42A 4YQWA 4ED2A 2PMHA 1C0TA 4AL6A 1Q81T 4C8OA 3CD7A 3TUIC 2LA6A 2F4FA 2QYCA 4NLDA 3TZYA 4WFNQ 3MR2A 4LFCF 2YPZA 4ED1A 1VIXA 4DUTA 4EK2A 2UUCJ 4PUOA 2R7SA 3KFWX 3MPYA 1MMLA 4K5SA 4DG1B 5IT9U 4I7FB 1HBUB 3GIIA 2FZGB 1DTTB 3LO3A 4IYQA 3GFHA 4J9RA 2A0FB 5ETQA 3CW2C 4WE1B 3HHEA 1VQ8S 3LGMA 1QSLA 3PVXA 4CO3A 1GMUA 2HBZB 3M1VB 2XYHB 1S6QB 1Q8BA 4TLQA 2IY5B 5GVQA 5B09A 5EX3A 3KLFA 2B4VA 2RHSB 5B0FA 1UAWA 1CJUA 4CRJA 3EZ5A 1H72C 3P4UB 2CZ4A 4NCGA 5ETOA 2V9KA 3AODA 2MQNA 1JLAA 4B3OA 4MKVA 4C8KA 4PCQA 1RHRB 3HP6A 1UVKA 3OD2A 2CFXA 4RU9A 4DBQA 1DBDA 2XY7A 1QLNA 1HBOA 3GR0A 2VIHA 4TYBA 4FZVA 3UWTA 3ZZZA 4KKOB 2ZHBA 3TJAA 1Y7PA 3ZNJ1 3S01A 1VMBA 3H2LA 3ELHA 3HKZD 4KBIA 4NLUA 2DB1A 3SQGA 3HVTA 4B9LA 3FSXA 4TXSA 2O3DA 4EGLA 5KG2A 4R5PA 1M1KT 1WG5A 3D28A 4RNFA 2B7BB 3BPSP 4M95A 2CQHA 2ZH3A 4B9UA 2DNLA 2GQ2A 2ZH4A 4R5PB 2Z2LA 4KGZB 2DEJA 1PYSB 3F73A 1BE4A 2FGOA 1FXDA 2CQIA 3MPWA 5T7LA 1YJNS 3GSIA 2QLWA 2UXBJ 2KZMA 3JTOA 2HAFA 4JBCA 4ES1A 2G0CA 1TMMA 3P3DA 5CYJA 3VTIA 1TL3A 1RBLA 1NZ8A 2L08A 3MZIA 4YN3B 3M4XA 3DXBA 3KK3A 3BQ0A 2OFHX 2GMJA 3IG1B 5J2MA 3KYLA 2UUBF 1K0VA 2AYGA 3I5CA 2GJ2A 1P27B 3GJQB 5KT7A 4Y65A 3W65A 2XNRA 3D6TB 4ITSA 2ZZTA 1NO8A 2OGUA 3HT0A 3TZZA 1VBYA 3C15B 1HARA 2OSQA 3NY0A 8RUCA 1WC0A 4DLGA 1MN9A 1YRXA 1D9AA 4G1PA 1IKVA 1RWWB 5CA5A 4X62F 3DLEA 4C9DA 1TAUA 3FRZA 4PG6A 1RWNB 4ZCMA 2C42A 1NSAA 2ZWPA 2VDHA 3BN7A 4P73A 2BJ3A 2W8KA 1VC0A 1S7IA 3OFGA 3D0IE 3DRPB 1SQFA 4M5NA 3DGVA 2OMOA 1AUDA 2V2ZA 1HBMB 3VZIA 4C97A 7AT1B 2FIUA 4PQAA 2LXUA 1HLWA 1ZA1B 1UPMB 3GZ7A 4WPAA 2VC0A 1YQHA 4QR1A 4IG0A 1BWEA 1R27B 8AT1B 2N4DA 1T9UA 3V6HA 3HHLB 4YR3A 4B3MJ 1VQYA 3EVMA 3MTJA 1WHYA 2W01A 4CH7A 4Z2XA 2EI5A 1S1VA 1U25A 5ETLA 3NGTA 5F8NA 1Y00A 4ZVUB 2HQIA 5H9EK 1U48A 1I1GA 2YWEA 3OVAA 1X4AA 4ELTA 3P45B 1JLCB 1MWYA 1HYSB 5EGYA 2YNFB 1K73T 1TL4A 4QQBA 3AD7C 4IH5A 3MUTP 1N5TA 4I56A 2ALZA 1JLGB 1HPZB 1VQKS 2RAQA 4DX7A 3WX4A 3TJ8A 1N33J 5KAKA 1S10A 3DLBA 1Q53A 1RAEB 4DL7A 4IRDA 1UZHA 2EFVA 1S9EA 4DPWA 1EHWA 3MHYA 4I67A 4Y2KA 5GAEI 2YQ1A 5KFIA 4XO0A 1NEEA 1X60A 2XULA 3D68A 4HEA9 4ZMMA 1PYOB 4DWIA 3D67A 1Z2LA 5IZHA 5KFGA 2OO4A 3DRYA 3W62A 9ATCB 4RW9A 2UXCJ 2ERRA 1WC3A 3GE9A 4OHXA 4DSEA 2HMIA 2IHR1 1KDNA 3JTPA 1I94J 3NNHA 4DSLA 3BDEA 4JB8B 4M5IA 5C2CA 5KT5A 2W9CA 2QGFB 2KO1A 4RR5A 3GPAA 3K8WA 3TVZA 1QSYA 4LT6A 3DRPA 2Z58B 2DGSA 1HNXF 4ECXA 2JHEA 1NDKA 1RBOB 4OJHA 2E7XA 3SYZA 4JP8A 2DRAA 2VD3A 5H9FJ 2XCAA 4DSJA 5IFMA 1QAIA 2AF6A 2Q6CA 3IWLA 1HWJA 2YKNB 3JTNA 1BQNB 4TYAA 1NLKL 3CJ2A 2F4VF 3U02A 4LF6F 3R6GB 4RJVA 1JKHA 3LPEA 2J0SD 1R3NA 5BJRA 1SIZA 2EVZA 4IFVB 2YX7A 4HYKA 1NDPA 2FJVA 4CLPA 4D3GA 4AYBD 1XR5A 1PIEA 5KFSA 5HAOA 2H48B 4F0HA 1L5UA 3OTEA 4QOTA 1DTQB 1T9VA 1Z4UA 3WIVA 4RNNA 4DV4J 1IKWB 3HJVA 4KAIA 2VBZA 3H8YA 3K89A 2RUGA 2M4MA 5AXMA 4DZDA 5KFDA 1FWLA 5E3RA 3PIOQ 2CPIA 2Q66A 1VK8A 2L48A 2BQRA 2BXJA 2O67A 4CO2A 2MKHA 3GCXP 3HSDA 5CZXA 2JJ4D 2ZE2B 2HQFA 2NSCA 1T3OA 3S7RA 2HHPA 3W66A 1ACMB 3AJDA 1U8SA 4OLPA 2WRMA 4WXOA 4URGA 4QWCA 2XY5A 4NLQA 1S6PB 1UCNA 3C66A 1ZM4A 3QT7A 3D0GE 5G0RA 3MCMA 3W2WA 2B5JA 1S4FA 2DJWA 2R42A 2NCKL 3VQSA 4C6AA 2RNEA 3PRVA 5E41A 2GIQA 2RDJA 2PI4A 1QY7A 4KPYA 1KN6A 3UPFA 2OIHA 1YJUA 2RIJA 1K1QA 4GVBA 1UEKA 3MPDA 5C25A 1EQMA 3M6VA 3ETOA 1RT4B 2N4CA 3ZO7A 4JI1J 3O8WA 3ET6B 3TW0A 5EWEA 2W9BB 3BR8A 4YDXA 5G4DA 1PAUB 3P5BP 1R6VA 4YHHF 2BM0A 4ETZA 2GIRA 3B4DA 3H5SA 2IC3B 5FJ4A 4ZN1A 4CH1A 3W63A 1DTTA 4TVAB 4X65J 2KVIA 2AT1B 4ZLNA 4ERDA 1H2VZ 2GQQA 2J7UA 5KFWA 3QJPA 2IVYA 2OEKA 5KFVA 1TTHB 3SCJE 3BO4A 3NP5A 2QJ3A 1Q82T 3PFOA 2R2UA 2VOPA 2RJZA 5CHCB 2ZD1B 4BLGA 1Y3JA 3K5MA 2HS3A 1Q95G 1YLXA 4OZ5A 2OKQA 1JK9B 1VHFA 1TZ0A 3HKWA 3MMBA 5AT1B 2DY9A 4F26A 1JLEB 3V5RA 4K4WA 4DQSA 4OYOA 3TI0A 2YQ3A 2KXNB 2AWZA 1JJCB 4NCBA 1KHVA 1FD2A 2R7TA 2R9LA 3G8TA 4A47A 2PIIA 1OIAA 2OD6A 2QRRA 2HHVA 1KOOA 3LP0B 3C16A 3MM5B 4ICLA 4MYUA 5LOQA 3DLGA 3OT9A 4LVOP 1YIJS 3P8BB 1JX4A 2EBGA 2CQBA 3R97A 4AQYF 1RA7A 3BB5A 1QE1A 4GVLA 4UOGA 4LREA 4WYWA 4N56A 2OSRA 2HLTA 5ETNA 3E01B 2QFJA 1T95A 2CNNB 3FQLA 4F3OA 4B02A 1P6TA 1Q78A 2BANA 4LSZB 1G2EA 2XWXA 4RUAA 2GHPA 4I0WA 3MMAB 3ENWA 3I5BA 2OMLA 1S9GB 2CPEA 4IG3A 4ZVHA 1RKIA 4I6YA 2ASJA 3M05A 2BR0A 3FDSA 5BYQA 2QMWA 3I56S 2B43A 2JVOA 3MR6A 2VONA 3IXQA 1A9NB 2GGPB 3H5YA 5D15A 3OV7A 2DGUA 1YKWA 4FVCA 1RU2A 3W1YC 2M2BA 1F9FA 5THWA 5F8MA 1B0PA 2WONB 5KT3A 2EXUA 2AGPA 4CCHA 1R8CA 1UMJA 1QD1A 1Y10A 4OI0A 3BSNA 2WONA 5KOXA 1IKYB 1TUWA 4KC5A 4KGKA 4ZK7M 1RT2A 1IBMJ 2IJFA 2VA2A 4RO0A 1B4SA 2CG4A 4TNOA 3RTVA 3AOCA 4L6V3 3MECA 5D4LA 2OEMA 4HVZA 2Z2ZA 2E66A 1RT3B 3KWMA 2UV8A 2C3MA 4ZP8A 1XNRF 2HEKA 2VUGA 4X4RA 4K4ZA 3CJ8A 5EX0A 2LXFA 4LBPA 3CXCR 4X4VA 3LF0A 1RKJA 4EZ9A 4ECWA 3GTYX 3KK2B 1W25A 4WYLA 3LQVA 3TUZC 2MKCA 3G6VA 3GG1A 2V5HG 4YS2A 5IT4A 2V63A 5GAEU 4F67A 1O6XA 1S1VB 2NXUA 5EUHA 1U2FA 3B54A 4ZPBA 2U1AA 4NCGB 3R9LA 1ZYQA 2DO0A 1KQFB 1KVKA 3KJVB 3VR1A 5HQLA 2D3O1 2MSTA 2FY8A 2HRYA 4I2QB 3AXKA 2BEFA 2IC3A 3IS9B 4IG3B 3CGIA 3I5AA 2XI2A 5DZ7A 2E44A 3MM8A 2ABYA 2ZDOA 1DLOA 2L9WA 3CB4A 3D4JA 1BQMB 4USIA 5HJXA 4CLKA 3OW2R 2CPHA 3G6YA 1TL3B 4FNHA 1KVJA 2HIQA 2J7WA 5F0WA 1F1BB 4OI2A 3QIDA 2W4PA 2ACMA 4DR3J 4WKRA 1RWOB 4PKDB 1VRQC 3RJMB 1YI2S 1WHXA 1UFWA 2C2KB 2M3DA 2E1RA 3VGVA 3L95X 1B0TA 1AT1B 2JDJA 3CJQA 1NAQA 3J7Z5 2RVJA 1RI7A 2FYXA 1G7CB 4ECQA 4WTYA 2DR5A 1S7HA 5C42B 2RF2A 2AW0A 4QWBA 1MMDA 3Q8PB 1W2IA 2L3MA 3CDBA 1B99A 3FQKA 2CWXA 2IMOA 3D1QA 2HNYB 3TX0A 3I4HX 2V94A 3JB9k 2B8QA 1AFJA 4H54A 1FWPA 4OX7A 3M8QB 3MM6A 3BGFA 2XSJA 2FDNA 3UD4P 4NLYA 4WFXA 1N6QA 4ZVOB 3IC1A 1AROP 5KG7A 2Y1IA 1JLFB 1EP4A 2DHXA 3C8YA 3M2RB 2Y0SD 1PC4A 4K5RA 5ETRA 1N5SA 5KFRA 3T5KA 3GYGA 1XQIA 1RT1B 1SBRA 4LVNP 1K47A 2B4OA 4U8YA 2KM8B 1RT7B 4QIFA 3BV8A 4ED4A 2RU3A 5HROB 3RAXA 3AJ1A 2DNMA 4IFVA 5L39A 5GAGI 1SL0A 3A8EA 1HNZJ 4NX9A 2HURA 3DRXA 5CABA 5SZTA 1M5OC 1S72S 2E5LJ 5CZVA 1F5AA 4A46A 3NNAA 4DUYJ 2P6TA 2JLEA 3SI8A 2FLNA 4WZQA 3OJSA 3QYYA 5B0GA 2X51A 4HT5A 1Q4RA 4HHJA 1M5PC 4ZITA 2IVMA 2OPQB 4RBUA 1K8AT 3W5YA 4XPEA 1SJQA 1GXUA 1T9XA 2AEFA 3A1YG 3SEOA 3RBEA 1IR0A 3UDCA 3RBDA 1YG0A 2EFPA 2DNZA 5GMEA 4KE5A 4NZ6A 2X1BA 4L3KA 3H5UA 5KFKA 4B3RJ 3J80U 1R8HA 2BQUA 3Q8SB 1EETB 2D69A 2J9DE 2O5DA 1WC4A 2UVRA 4ZJOA 5K14A 2FVPA 1NK6A 1W26A 1N0UA 1I94F 4DFPA 1BLUA 2W9CB 3Q8RB 1SCJB 2PFDA 3TYTA 2HQ3A 3IAM9 3ONQA 2UUAF 4DXLA 3V6DB 2UVWA 2FJEB 3TJ9A 1Q79A 2RSQA 2BKNA 1R89A 3NAHA 3VAJA 1RAAB 1QUPA 2VPZB 3FUYA 2QA2A 2NXJA 4ZP9A 4F0MA 4AD6A 1LXJA 3OFHA 1VHIA 4BC7A 2QIFA 1RTIB 3BKUA 4KH1B 2IRXA 4X4QA 2LQ5A 1XEZA 1VBXA 1U1QA 1MWQA 2MZQA 3W3SA 1R0AB 3A8JA 4X64F 3KK1B 4MKBA 4H4OB 1WF2A 1N52B 2BRLA 1KEKA 2VFRA 4DR2J 2Q43A 4LQ3A 2XC9A 2GO8A 3MXHP 1HBNA 2VFVA 4ZA1A 5MAOA 4W92B 3KOAA 5F8JA 1OQ6A 2HS4A 2WZ1A 2UVUA 3M30A 4LF5J 2DBBA 4LSLB 3X3UA 1PJ6A 3A3OB 3B4MA 1S1WA 3M2VA 5JXSA 2XMAA 1HYSA 4UZCA 4DS5A 5JVGQ 1ZAWA 2MLYA 2NPIA 1NSPA 3I82A 1OY8A 2B9EA 3HHNB 4KFBB 4QR0A 2QA4S 3TQEA 3QZ7A 2BMBA 1SKSA 2R3VA 1VQ7S 1P1TA 4FF4A 1H38A 3MOJB 2HGNA 2DXDA 2POKA 1ZZFA 3QFHA 4GC6A 1ZA2B 3P49B 3PRBA 3BO2A 4B3RF 2GQCA 2XG8A 1FDNA 1APSA 1EIYB 1X4BA 4JI2F 4DV7J 1T0TV 4DSIA 2W2NP 3DLEB 4EMDA 5KFFA 2J0QD 4U7UD 4OYWA 3BKFA 2YH1A 4IR9A 4ZVSB 1H2UX 3ZTQA 2ILZA 3FMBA 4L76A 3UDVA 4KHPF 1FCAA 4ILRA 4ATNA 3UDLA 4Q7AA 2R2SA 1N36J 2Q79A 4AL7A 4JOUA 5F3ZA 4V19J 1D09B 4K4UA 4A8MP 1J27A 2CA9A 2K06A 3BYRA 4A8KA 1YK9A 5L9XA 2HW3A 2F4VJ 5J1EB 3EXYA 4QIVA 2B6AA 5LJ3Y 2BE7D 2RT3A 1F6TA 3IBCB 1IR1A 1V3RA 3KNGA 2V8VA 3VGSA 3HMJG 1FK9B 2IM3A 2F8EX 3J7YU 2DISA 2V69A 4Y00A 4P7TA 3CMQA 1RSCA 4FDFA 2CJKA 4NXNF 3A13A 4FPIA 3M8WA 4NI2A 2N3OA 2DNRA 4WFAQ 2ZC4A 2VF3A 1MLAA 4FYXB 1PJ5A 3TEHB 1FFGB 2OPRA 2QLBB 2E9TA 3G2XA 2R7VA 2P9EA 3M2UB 1EETA 1HWKA 2E5GA 5AXKA 3RGIA 1Q8KA 4DL2A 2V0NA 3I32A 4KO0A 1TKZA 1WI8A 4C48A 5KFPA 1UZDA 2G13A 2JFKA 2MKJA 1IXKA 3M2RA 1UWBA 1R8AA 3CJKA 1PC5A 2X7IA 2C2ZB 1S6QA 4NMLA 2DNQA 3J80Y 3BPDA 2NS1B 4ECVA 1I3OB 4Q0BB 2JSXA 3PR5B 2EC0A 1X31C 4YOEA 4PQUA 1GQEA 2CQPA 4KV8B 4MJKA 3CCMS 3VQTA 5IS2A 1L3KA 2ADCA 3PX6A 1HNWJ 3VAKA 2MDAA 1ULRA 3S8SA 3GJTB 1TL1A 2CNKB 2IM2A 2QTWA 1KSPA 1F2HA 2KDOA 3VAGA 2HWHA 3HD1A 1YJTA 2R2RA 4PG4A 2R7OA 3HDSA 4URSA 2GNKA 1TV6B 1UVNA 1S57A 5J1EA 4OYBA 3R7NB 3K5NA 4H4MA 5DM6Q 2DY1A 4P7VA 3DRRB 5F9NA 1RXOB 4ZVGA 3OBIA 4ZDNA 3KMQA 5KFMA 1FDDA 3PACA 2IAJA 1XIQA 3DOLB 5D3GB 2QL9B 4DX6A 3KHHA 4PXBA 2ZUAA 4OX8A 1RT5B 4ZIWA 3OSPA 2DIVA 1BQNA 1RTZA 2FLOA 2G0JA 4C7QA 4M94A 1RT6B 3M7VA 3O5TB 3FCHA 4B3TJ 2OPRB 4DV2J 3NGDA 3H0PA 3R5JB 2HHQA 4LRAA 1LK7A 4QBUA 1NXIA 3JSYA 1X4EA 1BMQB 3SV3A 1X4HA 2BZ2A 1D9FA 4ZLPA 3VAFA 1Y0HA 3G82A 1XNRJ 1GTHA 2QE5A 4NA3A 5HO4A 2A6MA 3SQOP 1TL7B 3CCQS 3DYAB 4K0KJ 2AEJA 1EQ0A 4ZOSA 2MYFA 1SH2A 2WVBA 1IBMF 4DV5J 4JV5J 1RWMB 1U49A 1KWMA 3JSMB 4J37A 3DLGB 1HNZF 2J0XA 3HJFA 3EYZA 3Q83A 4ILMA 1HWIA 1X7VA 1U7LA 1P9YA 2YY3A 4I2QA 3FBCA 5LXYA 2UXDJ 1TKXA 4U96A 4ZLLA 2QMUB 3KG4A 2ZZNA 2CQ4A 2IYGA 4OZNA 5AXNA 5GAHI 1N34J 5I42B 5C2GA 5B0BA 1FJEB 4OZJA 2DR8A 3IR6B 2VG7B 3NGSA 3QWUA 1QDUB 4KGXB 2CNLB 3SBMA 3QT5A 3HHKA 5J1PA 1L3VA 1U6ZA 3BS9A 2PSZA 1OPIA 4QU6A 4ECUA 2KFNA 3HHLA 2LYVA 2A2DA 2PEHA 1GXLA 3QMQA 3M8PB 2DXFA 4DV1J 2V34A 5HMYA 1WOOA 3MPVA 2HFVA 1N8RT 4UZBA 2NQPA 4JI7J 2CZ9A 1ROFA 3ULHA 4DR4F 4FN5A 4USKA 3MEGB 2CJQA 3BEGB 1LW0A 2PD1A 3MGJA 4LRBA 2KL8A 3H25A 2JLFA 1RAOA 2MZTA 2P9CA 2KM8C 1SC1B 4CWBA 4IH7A 1RTJA 3C2PA 2EBEA 1ZZNA 1BY9A 1RTHB 3Q8VA 2GVZA 2HVHA 2CNOB 4DV6F 3NGRA 4IO1A 3J81j 1RABB 4CLYA 1F5CA 2OPSA 2P8IA 3FNNA 3ZTPA 2VQFJ 1AZSB 2KHCA 2A10A 3CC2S 1T8EA 2DVIA 2H4WB 4S0MA 4X84A 4CNYA 3BGUA 4DQRA 2QEXS 1Y4ZB 1S1XA 4DPOA 7FDRA 4C3KA 2PGCA 2GCFA 3CDAA 2UUCF 2XO7A 3MEEB 1Q7YT 3R27A 5CYQA 5I3QA 4DQQA 1G1XA 4R25A 3CDEA 3CMAS 1YGYA 5D0HA 1HBNB 5FD1A 4DX8H 5J2PB 2IDEA 3UN3A 3UVJA 2FHJD 4HACA 2XSJB 2GAHC 4OV6A 4DV5F 2HRUA 4PWDB 1EB0A 4TY9A 5H9EJ 1IBKJ 3LP2A 3DRRA 1QTNB 3AB4B 3M9MB 4DV7F 1RACB 3W5XA 4TY8A 2YWGA 3MUMP 2B8PA 3FC9A 2PA8D 2F65A 4Q8EA 3GWCA 5T7LB 1HNWF 4LFBJ 3GJRB 1RT7A 3BH7B 1HWUA 1AB8A 2GAGC 3K17A 1N0VC 2WK4A 4Y2MA 4DU8A 4DUZJ 2HHTA 4DV0J 4X4NA 2W9BA 5D6GA 1WACA 2PT0A 3CIZA 3QPIA 4F50A 4JV1A 3JQMA 3RYLA 4PG7A 1OS5A 4KJIA 1BXNA 4PWWA 5DS7A 5LMNF 1SH3A 2ZBRA 4FPRA 3IFEA 2XNQA 4G1QB 3JQKA 4WCEQ 2AZ3A 2QG9B 5HBMA 2CIMA 1MSWD 4CM2A 4GKJJ 2M9KA 3EGNA 3PZPA 2YWWA 3E3XA 2IFXA 2ASLA 2E1PA 2DRBA 4B9NA 1FVQA 2I38A 3UO0A 2HHHJ 5L1JA 2ZHAA 1KOHA 4NYZA 4UQTA 3I6PA 2V8DA 1PCAA 2R8IA 3KXDA 1N34F 1LKZA 1CJUB 1R7IA 2DGXA 3UE2A 4CIOA 2E7WA 5KG3A 2GIFA 1XWLA 2BE2A 4C11A 1F3VA 3CCLS 3UDEA 4DR1F 3MMCB 2X1AA 4RL1A 5EN1A 2VBYA 2MY8A 1HBUA 2E1AA 1U0HA 3R7BB 3Q8UA 4YB6A 5JMNA 1NHUA 3FGVA 3QLHB 2E5HA 2DGWA 2DNHA 3MTKA 4PABA 4CLSA 5L38A 3R5BA 3C6TB 2OD4A 1SC4B 3W5ZA 4C8LA 4ZN3A 1HW8A 1T7PA 5CCMA 3AY0A 4I68A 3UQSA 2HYIB 1KFSA 4BWMA 1KS2A 4FXVA 4GVBB 4NI2B 2NR0A 5AE1A 3KJNB 4LR7A 3LP2B 3ZZUA 4OQJA 3ZZOA 4AUKA 2ZH1A 3M8RA 3EGVA 3A12A 4NLPA 1L3SA 3L4BC 3GV5B 2N82B 3S6EA 3T6BA 1NMEB 2JLGA 1HL6A 1JLGA 1HPZA 2MPUA 3CCJS 5C7PA 3BGLA 4K50A 1TKZB 2AZ1A 3QJLA 4KIAA 2CQDA 4U9RA 5CQGA 4CLZA 1UA0A 3ZNUA 4R0JA 2FQQB 3KLGB 1HI1A 2CQ1A 2PN6A 2V4JA 4P9SA 4FKYA 4HH0A 3ZTOA 5EDWA 4QWDA 2V8PA 3LTOA 3CE8A 1FRLA 3D2WA 3Q89A 3OXFA 5KFXA 4WZMA 4WFBQ 2BQ3A 2NZ4A 1FI4A 4WK1A 2J5AA 4RW8B 1X5SA 2DGVA 5KTQA 1V3SA 5LSRA 4YY3J 1N32J 2R7XA 3DU5A 5K5MA 2FHJA 2CVEA 4DR1J 3GIMA 2J8SA 2CDRB 1ZAXA 2IA0A 4OJGA 5A8RA 1FTRA 3BSCA 3EDQB 2I1RA 4FP9A 3SDEB 3SSQA 2CPFA 3CULA 1FE0A 1ZPWX 3N6NA 5KT6A 4KTQA 3U7JA 3KTQA 2O1PA 2VG7A 4PXDA 1URRA 3NL0A 3TWZA 3OTOJ 3PFEA 1N5YB 2XYGB 4UW2A 4GMKA 4JI5F 2LFVA 1IBLJ 3B8HA 5DG7A 4OZ1A 1Z2ZA 2G2OA 3B82A 3V6KA 3IRWP 1JLCA 5J1NA 3DRSB 1RT6A 1CSJA 4EO6A 2HVZA 2MKYA 5LMUF 1UVIA 1LW2A 4WP9A 1IWGA 4ES2A 4EUVA 3MM9B 1HW9A 1T11A 2XEXA 4ECSA 4V19X 2VG5A 1NKCA 1NPPA 2BRKA 4FYYB 4N8NA 4OX9F 2FJXA 5LMNJ 2JEIA 1Y5IB 4CO4A 1GX5A 3QT6A 1UJ5A 5GMDA 2XMKA 2X1GA 2BDPA 5ETMA 2MGZB 2LP4A 4LFBF 1WEYA 2GFFA 3BZQA 1TV6A 4RU2A 2XGQA 1JXLA 3LWMA 1IM6A 1GT8A 3KKFA 4RW4B 5F8GA 2E1CA 4ED0A 2FJBB 4Y2AA 1N54B 3W60A 3G4SS 4C4WA 1KRPA 1KFDA 1VCTA 5ETKA 2PDAA 1NJWA 1VQOS 4HI2A 4R8UA 4CLFA 3LGHA 4USVA 2B4UA 2LDIA 4L73A 2XO6A 3IR7B 4HH1A 3Q24A 1FKPA 2ZVSA 4BBYA 5D0GA 1URNA 4OI3A 4RW7A 2W4CA 2DNPA 2XMUA 3V2UC 1K0TA 3PY8A 1KR4A 3PX4A 2XZTB 3IGVA 1FVSA 3BH6B 2YNHA 4J9OA 1RUSA 4K4XA 1UWBB 4JI6J 2AJ0A 1U2CA 1O51A 1V3ZA 2ROGA 3ZC4A 1LV5A 1KP6A 4J9NA 2B56A 3ISZA 2ZM6J 3TANA 2IYIA 2XSFA 1GEHA 2ZBQA 3KDOA 1S76D 3P6YC 1YX2A 4J7CA 1IM4A 4OV1A 4E0DA 3WIUA 2C2MB 3MMAA 1GXTA 4NRUA 5K8NA 1HWLA 2DGTA 4EZ6A 3GYNA 1K1SA 3M6UA 4CM0A 3QBCA 4CNZA 5DDOC 2KB2A 3RB4A 2X1FA 1VYAA 1V9OA 4AT1B 4X66F 4Y3CA 4OHVA 1PGZA 2YTCA 2C2OB 3PEHA 2QX0A 1CPZA 1FD8A 4Z7YA 1XC9A 3GU0A 3TZXA 1IKWA 4WJBA 4I2PB 4KY3A 1GMWD 6FDRA 1CQMA 1DLOB 2VOOA 3CNQP 3UNGC 1FK9A 3M8ZA 5LMUJ 1RLCL 5C24B 2JRSA 4C3MA 2VJVA 5HLFA 2BYCA 2WHOA 3ZZTA 3DN9A 2D3OR 4M63A 3ZFVA 1PG5B 1WELA 1KQKA 4ETXA 3K59A 1WTBA 2FJWA 4LF5F 4B3OB 3SFGA 4M5MA 4LMZA 2E9RX 1UWAA 1DHMA 2VKZG 4O0NA 3DGPA 2DGOA 2DPJA 2RRNA 1WOSA 2RRBA 3BGRA 1RT5A 1J5EJ 4LFAF 1YJ7A 1HBOB 2YQ0A 3QSIA 4OIXA 2RQKA 4DR3F 4ZVEA 4N47A 2R2TA 1RADB 3DC2A 2MQQA 2GW8A 3K5PA 4H4KC 5F41A 4JV0A 3H40A 4JV5F 4X4PA 2VKRA 1FF2A 1N4LA 3I0RB 2WTFA 4KGVB 4LFCJ 4TU9A 1R6YA 4CT8A 5E3QA 4LF4J 4D3HA 2VPWB 3CD5A 2ZJPQ 1QM9A 3MR7A 5HLFB 2W7AA 1RT1A 4M5JA 4YP3A 3T5HA 3F0NA 2XYPB 4DOZA 1XR6A 3Q8YA 1MROA 3CJRA 2YKOA 4P2XA 1FE4A 3I0SA 4DCPB 4Y0FA 5J2NA 2HVEA 3QIPB 4DUZF 4X2BA 4X66J 3KHLA 1CJTB 1TL5A 3KUGA 3MUVP 1BHNA 4P2MA 5E0OA 3CJ0A 1DFDA 3KLIA 4WXWA 3DKDA 2CDQA 5F9LA 1PBUA 3C6UA 1D8YA 4Q2MA 3R8YA 4BCAA 4ZPTR 4IRCA 2HHSA 1SUQA 4NLTA 4O44A 4CLWA 4DDFA 4LR9A 3IBWA 4CLTA 3HZEA 3I96A 1IUJA 3JYTB 1NKEA 2WOMA 4I64A 4MK7A 4ED6A 1WWHA 3EUNA 4NE9C 4Q44A 3Q8QB 1JJ4A 1B7FA 1CC7A 2M8DB 1OWXA 4XAKA 1RWPB 1C1CB 2DYAA 3CWJA 4M5GA 4JI3F 4KPCA 2YKMA 3HHDA 3FRYA 1TR0A 3ILIA 2V6AA 2YX1A 1VQ9S 2CJBA 5E2QA 5KFHA 2HPUA 1FRJA 3W61A 1PO6A 1CLFA 2PEBA 3C16B 4RWXA 3DOKA 3A8IA 3WBZA 4DU7A 1SJ3P 2IM0A 4RUHA 3IN5A 1J5EF 2LQBA 1XMQJ 3MAQA 2CJYB 2A6OA 3OL6A 4UF4A 4W90B 3PM9A 3DLHA 3DI6A 1MWZA 4DF4A 3F56A 3OFEA 4PPZA 4QW8A 4MFBB 3EXCX 1T05B 3I0SB 3BSAA 4N8OA 1TKXB 3OFFA 1R0AA 1SL2A 3NCRA 1U1RA 4JI0J 4M1KA 5B0AA 3VGTA 3DLKA 4B08A 1M1GA 3MD3A 4RNMA 1RHUB 2QSFA 4OYXA 3NWGA 2XS5A 3R5GA 1FKOA 1RQ0A 2FJAB 4HDHA 2HWIA 4C98A 1S99A 2CKWA 2IJNA 2MKKA 3PHTA 4YB5A 5K8OA 4NXNJ 4QIWD 1ITPA 1CJKB 3AHPA 3M8PA 2AGOA 3HI9A 5HVFA 2ZJRQ 2YWHA 1RWKB 2NXEA 4QYZJ 3AQPA 3US5A 2XS7A 3HO1A 4OYPA 4K59A 2V50A 3WZ0A 3AOBA 3OUYB 1T9YA 3OTDA 3PJ9A 1H73A 4F8RA 4JI8J 4K0KF 4K4YA 2CQ2A 2A2CA 1VQMS 2DR7A 2WW8A 5HQMA 3EPIA 3PO5A 4IFYB 1KLMB 4KO0B 4KHPJ 4QU7A 4NPOA 2ZNZA 2Z56B 1YJWS 4JI4F 2UXBF 2CG8A 3DDKA 1CG2A 3BQ2A 4R0EA 1JLAB 2MQ8A 4K2JA 4PR6A 4OYAA 4ANCA 3QATA 3M6XA 4LRCA 2FJDB 4A8QA 3G87A 1QVFR 4CO0A 4FYVB 4ENOA 4UY85 4OX6A 2DNYA 4DFKA 3MFHA 1JLBB 3MMCA 3RBZA 4KRWA 2V4RA 4ELVA 1BQXA 1FRKA 2F7VA 3TVYA 1J5OB 4OX9J 5KFJA 1GX6A 4NYPA 5IWAJ 1JB0C 3MCSA 1S0OA 2NREA 2VA3A 2UXCF 2B6AB 3TUJC 4CDIA 4ZPCA 4NXMF 1X9MA 2KZZA 5T14A 1XMOJ 3GQCA 1MU2B 1IKXA 2DGQA 4MTPA 2E9ZA 1SV5A 5HP1B 2ZBPA 3KLGA 3QNWB 2DD8S 1WNEA 3PW2A 1LK5A 1KTVA 3CEDA 4LF9F 2BV3A 4MH8A 1FEEA 2XI3A 5SUHA 3DOLA 4PZVA 1PYTA 4J9UE 3UN5A 4HDGA 2DCUB 3QO9B 5E3AA 4Q45A 3OHBA 3T1HJ 2M5YA 3AB2B 3MEEA 3N6LA 4W4MA 1XMQF 5A8WA 1SVDA 2CQ0A 2AX0A 2FPHX 2KFZA 3G71S 2E29A 5RUBA 1T02A 2V2KA 5J2MB 4LF8F 4A8YA 1KONA 1NUEA 4NZ7A 4WK3A 3D3BJ 4X4OA 4QWEA 3PW0A 2PC6A 2IVFB 5DQIA 1RU1A 3MF5A 3N9UC 2DPIA 2OTLS 3ICLA 4TY8B 3S1TA 4K8RA 1VI7A 2M7SA 2WB4A 1RTJB 2KT3A 1YHQS 1T3NA 2VBXA 1YJ9S 2MTLA 3ITHB 3FVYA 3M32A 4AFFA 3LH2S 1JWWA 2J8AA 3G8QA 4F4YA 5KFAA 4ANEA 5KFTA 2WVFA 1E6YB 2DH9A 4ZHRB 1ELOA 2MHNA 3R5DA 2ZH7A 3IS9A 3DLKB 4KSEB 4HHUA 4PXEA 3GFYA 3Q23A 1XNQJ 1OYDA 4NLOA 4BC9A 2W2OP 3QAUA 2D9PA 3QQCD 1IVZA 3D6FB 4O4RA 1U47A 2FVRA 1RYRA 4DV3F 2UUTA 1KD1T 1CS4A 1W2BR 1XK8A 4JYAF 1V5IB 3DHXA 4FF2A 1IQTA 2MEWA 3EVWA 3OVBA 1CJKA 2I8EA 3I9ZA 3PDNA 5L8RC 3GILA 1S0MA 4DG1A 3FZ2A 3J81Y 3MURP 4YR2A 1ZM2A 2AKWB 1S48A 2E5LF 3FFIA 4UUWA 4OI6A 2GC8A 4AXIA 2OPPB 3C14B 4DUYF 1JLQA 1NB2A 4OHZA 2K7JA 2UV8G 1M5SA 1RCOB 3EZOA 4YDDB 4YMEA 1NK7A 2J9EA 3D3CJ 1SJ1A 1IN0A 1S1UB 2CRLA
chains in the Genus database with same CATH topology
3BBFA 3VGUA 4UOHA 1NLKL 1XIQA 4W98A 1LWXA 1B4SA 4F36A 4F4AA 2ZUAA 3FBEA 1ZS6A 1NHKL 1VYAA 4DI6A 3EVOA 1PAEX 1F3FA 1BUXA 1NDPA 3PJ9A 3ELHA 3B6BA 2HVDA 2CWKA 1WKJA 3DDIA 3FCWA 4DZ6A 3B54A 4O0NA 3FKBA 3R9LA 4ANCA 1S5ZA 1BE4A 4ENOA 1NSPA 2BEFA 5C7PA 3Q83A 2AZ1A 1UCNA 3FBCA 4ANDA 2DXEA 2VU5A 3VVTA 2DXDA 2NCKL 4C6AA 3PRVA 1W7WA 1WKKA 1S59A 3EICA 4FKYA 3ZTOA 3NGSA 1NPKA 3MPDA 3VGVA 3FBBA 3Q89A 4CP5A 1NSKL 3ZTSA 1PKUA 1K44A 1MN9A 3ZTQA 3Q8YA 2DXFA 2HVEA 3L7UA 3ETMA 5CAAA 3BBCA 1B99A 4HR2A 1BHNA 1NSQA 1LEOA 3DKDA 2B8QA 4FKXA 1NUEA 1WKLA 1F6TA 3ENAA 3Q86A 1HLWA 3VGSA 3Q8VA 1XQIA 3NGRA 1NDLA 3NGUA 2DY9A 3EVMA 3ZTPA 5IOLA 2DYAA 3NGTA 4UOFA 3VVUA 1NDCA 4S0MA 3EE3A 4ANEA 4KPCA 3ZTRA 2HURA 3G2XA 5CABA 3EMTA 5BXIA 3FCVA 4WBFA 1U8WA 3JS9A 1EHWA 4UOGA 1JXVA 1MN7A 3Q8UA 3EJMA 2B8PA 3FC9A 3EVWA 3BBBA 2BX6A 3BH7B 3WX8A 1HHQA 1KDNA 3EM1A 3FBFA 4DUTA 4EK2A 1HIYA 3VGTA 1NB2A 3GPAA 3GP9A 3BH6B 2AZ3A 1NCLA 1S57A 1NDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBF A;  3VGU A;  4UOH A;  1NLK L;  1XIQ A;  4W98 A;  1LWX A;  1B4S A;  4F36 A;  4F4A A;  2ZUA A;  3FBE A;  1ZS6 A;  1NHK L;  1VYA A;  4DI6 A;  3EVO A;  1PAE X;  1F3F A;  1BUX A;  1NDP A;  3PJ9 A;  3ELH A;  3B6B A;  2HVD A;  2CWK A;  1WKJ A;  3DDI A;  3FCW A;  4DZ6 A;  3B54 A;  4O0N A;  3FKB A;  3R9L A;  4ANC A;  1S5Z A;  1BE4 A;  4ENO A;  1NSP A;  2BEF A;  5C7P A;  3Q83 A;  2AZ1 A;  1UCN A;  3FBC A;  4AND A;  2DXE A;  2VU5 A;  3VVT A;  2DXD A;  2NCK L;  4C6A A;  3PRV A;  1W7W A;  1WKK A;  1S59 A;  3EIC A;  4FKY A;  3ZTO A;  3NGS A;  1NPK A;  3MPD A;  3VGV A;  3FBB A;  3Q89 A;  4CP5 A;  1NSK L;  3ZTS A;  1PKU A;  1K44 A;  1MN9 A;  3ZTQ A;  3Q8Y A;  2DXF A;  2HVE A;  3L7U A;  3ETM A;  5CAA A;  3BBC A;  1B99 A;  4HR2 A;  1BHN A;  1NSQ A;  1LEO A;  3DKD A;  2B8Q A;  4FKX A;  1NUE A;  1WKL A;  1F6T A;  3ENA A;  3Q86 A;  1HLW A;  3VGS A;  3Q8V A;  1XQI A;  3NGR A;  1NDL A;  3NGU A;  2DY9 A;  3EVM A;  3ZTP A;  5IOL A;  2DYA A;  3NGT A;  4UOF A;  3VVU A;  1NDC A;  4S0M A;  3EE3 A;  4ANE A;  4KPC A;  3ZTR A;  2HUR A;  3G2X A;  5CAB A;  3EMT A;  5BXI A;  3FCV A;  4WBF A;  1U8W A;  3JS9 A;  1EHW A;  4UOG A;  1JXV A;  1MN7 A;  3Q8U A;  3EJM A;  2B8P A;  3FC9 A;  3EVW A;  3BBB A;  2BX6 A;  3BH7 B;  3WX8 A;  1HHQ A;  1KDN A;  3EM1 A;  3FBF A;  4DUT A;  4EK2 A;  1HIY A;  3VGT A;  1NB2 A;  3GPA A;  3GP9 A;  3BH6 B;  2AZ3 A;  1NCL A;  1S57 A;  1NDK A; 
#chains in the Genus database with same CATH topology
 2LCW A;  1UA1 A;  4PWU A;  4UOC A;  1FRX A;  5KG1 A;  2DEI A;  4CI0 B;  4H4K A;  4OZ3 A;  3HPO A;  2K2P A;  2VFT A;  3KJQ B;  1H7X A;  3I9V 9;  3NXZ A;  2DNG A;  4YEA A;  5FDL A;  1ZET A;  3LAN A;  1ZTT A;  4IDK A;  2AP6 A;  2LEC A;  4DLE A;  4GKJ F;  2MKS A;  2BJ1 A;  5B08 A;  3HHL C;  4FF3 A;  3UD5 A;  2RRA A;  1HR0 J;  4IDK B;  2AX1 A;  4NWB A;  2N7C A;  3GJS B;  2F8M A;  4MIW A;  2HGL A;  2XHW A;  1PSD A;  1VC5 A;  4N5S A;  1NK8 A;  2GS8 A;  3NMR A;  5HSP A;  3IWN C;  2YBV A;  2CVI A;  1Y5L B;  1FTC A;  1NJY A;  3DFE A;  4A8F A;  5LSL A;  1Q8L A;  3OPK A;  2XMM A;  4LRF A;  2KRB A;  3FJ2 A;  3NMA A;  1QE1 B;  1WOP A;  4HL9 A;  2SXL A;  5D0R A;  3L09 A;  4DL5 A;  4N41 A;  2AHO B;  2PMW A;  2DHH A;  3DM2 B;  1YBU A;  3Q2S C;  2IRU A;  2VJU A;  3O2I A;  5I3U A;  2CXE A;  2HND A;  2Q1L A;  2FTR A;  2HAI A;  2CQ3 A;  2H54 B;  3QT8 A;  4J9Q A;  1XN9 A;  1C1B A;  3K8V A;  2ZKT A;  4LF2 A;  2MZS A;  2HHU A;  1KTQ A;  5DDR C;  2G1D A;  2LEP A;  3MWB A;  1HNV A;  2V8H A;  3R2C J;  3CT9 A;  1J2V A;  2KI2 A;  4HT7 A;  4ZVP B;  4QPX A;  4DR7 J;  3AOA A;  2DXE A;  2NXN A;  2O01 C;  1KQS R;  2K3K A;  5DGA A;  2AGQ A;  2D1C A;  2N7Y A;  3C6U B;  2KG0 A;  1EX8 A;  3FEZ A;  4TLR A;  2E5I A;  1UFL A;  3OQ2 A;  1TK0 A;  1RCX B;  4M5D B;  2ZFH A;  4O44 B;  3SIP B;  4UQG A;  2LU2 A;  3DI6 B;  4G1I A;  3R6L B;  1NPK A;  3M9N B;  1RGV A;  1LQ9 A;  4WU2 A;  2HBR B;  1RHK B;  2JC0 A;  4O4G A;  4N7T A;  4L74 A;  3TZW A;  2H9Z A;  2W1B A;  4LUB A;  1CJV B;  1RYS A;  1N88 A;  5AXL A;  2ZE2 A;  2IBO A;  4HTJ A;  4ZPD A;  3I55 S;  1F60 B;  4JI4 J;  3J7Z T;  2H4Y B;  4RW8 A;  1E6Y A;  1X4C A;  1NU4 A;  3QWP A;  5J2N B;  2R7Q A;  5B0D A;  3WC2 A;  3EPG A;  3OTB A;  5E7O B;  2ZH6 A;  4G6V B;  3N01 A;  1VQP S;  5IV3 A;  2E5J A;  5L46 A;  4DV1 F;  2FY1 A;  3CCZ A;  5B7W A;  1IBC B;  4QW9 A;  2MSS A;  3L3C A;  1X9S A;  2XLI A;  3OR2 B;  4EBE A;  1AXQ A;  1U4B A;  3NGU A;  1CS4 B;  1IBL F;  1IR2 A;  2CPD A;  3IA0 A;  4IOC Q;  4DSK A;  4XTT A;  2HFS A;  2HBQ B;  3J7Y I;  5IOL A;  2DIU A;  3QO9 A;  4DJB A;  5HN0 A;  2YNG A;  5A8W B;  1WF1 A;  5L1K A;  1XER A;  4FBT A;  3N0V A;  1U02 A;  2OH2 A;  1OPZ A;  1CEZ A;  5BXI A;  4RW7 B;  4CO1 A;  3BQ1 A;  1U0S A;  1WSV A;  3PW5 A;  4ILL A;  2MXY A;  3M2U A;  3T6J A;  2XGP A;  4LF7 J;  2H5I B;  4DR5 F;  4NLG A;  3H4D A;  3PRD A;  5KG0 A;  1YWX A;  4Y28 C;  1A0O B;  2Z4P A;  4Z7C A;  1AA1 B;  3AQO A;  3EJM A;  3V81 B;  3KLF B;  5H1S V;  2Z2M A;  1G4C A;  2OPS B;  3NBP A;  4ID5 B;  2QLF B;  2ZH8 A;  5HRO A;  1VRU B;  1L3U A;  4LF6 J;  1UVM A;  3HCX A;  1HHQ A;  3V81 A;  3GG0 A;  1ICE B;  4O4G B;  3NCP A;  1LFP A;  1NM2 A;  3K0J A;  2IM1 A;  2KT2 A;  4FF1 A;  4LQ9 A;  4NAS A;  1LWF B;  3ILL A;  4XDC A;  4EBD A;  1T05 A;  1RBA A;  1S1T B;  3CO0 P;  3GP9 A;  3GIK A;  2D7S A;  4PWD A;  1SKR A;  1FKP B;  2KJV A;  2Y9H A;  2HBY B;  2RKI B;  3OSN A;  5F8L A;  2BAB A;  3BBF A;  3CDW A;  5FLX Y;  5DO2 A;  2KKH A;  1YDL A;  1C0T B;  4UOH A;  3KHG A;  3WC0 A;  2R8H A;  4WIQ A;  2KJW A;  2V68 A;  3HFK A;  1VQS A;  4OJ3 A;  1S9G A;  1P8G A;  3AFG A;  4MK8 A;  5ETP A;  3HM9 A;  1NHK L;  9RUB A;  3CF5 Q;  3CJ5 A;  1H3D A;  4C8N A;  4UTG A;  3NCQ A;  2MZR A;  3W2V B;  4KFB A;  3W7B A;  1PAE X;  1WI6 A;  1RIS A;  3ILO A;  1DAX A;  1HQ2 A;  1X4F A;  4A8O A;  3DHW C;  4XK8 C;  3M9O B;  2JEG A;  2HHX A;  2VV5 A;  3CIM A;  1YJV A;  2RDI A;  2R7W A;  4LFA J;  1S77 D;  4OYM A;  3TP2 A;  4F4K A;  3SCI E;  2GVD B;  3M6W A;  2C2E A;  1A6L A;  5DM7 Q;  2B9W A;  2VFS A;  3NNC A;  2RQ4 A;  2MJU A;  2MY7 A;  1LNQ A;  1TQL A;  2K1R A;  2RE1 A;  3KUE A;  4PYD A;  4C0B A;  2GX8 A;  5IC6 B;  4ZCI A;  1XMO F;  1CC8 A;  1TK8 A;  2ZH5 A;  4H4O A;  3HF5 A;  2ZOG A;  2DIT A;  1O0P A;  3KLI B;  3PCO B;  5D0E A;  3U27 A;  1VQL S;  2JOQ A;  2KXF A;  2OP5 A;  3W8G A;  4ELU A;  3G6E S;  1FJG J;  2EKN A;  2YH0 A;  4JI3 J;  3KK2 A;  3C19 A;  3J7A 1;  4Q2L A;  3THV A;  1WC1 A;  1WOR A;  4RBT A;  3FSI A;  2WW4 A;  2Q6B A;  2RQC A;  1NJI T;  3AXM A;  3OTO F;  4Q0B A;  5KFQ A;  1T9W A;  1IJF B;  1HNI B;  1HFE L;  4YUD A;  1X4D A;  1FES A;  2EG1 A;  3GLJ A;  4ED8 A;  2UP1 A;  3V6D A;  1WDD A;  4ZVF A;  1M5K C;  1NSK L;  2AJ2 A;  3ILJ A;  4P6Q A;  3VF0 B;  2H5J B;  1D3W A;  1FFW B;  3TAM A;  3ZTS A;  2QA4 G;  1XMB A;  3ITH A;  3M32 B;  4P2F A;  4DL0 C;  1RHJ B;  5JVH Q;  1VR6 A;  1KNZ A;  1RT4 A;  4NCA A;  2C2N A;  3SFU A;  4E8U A;  1SKW A;  3PX0 A;  5E3P A;  4FKX A;  2HZV A;  2WB1 D;  5A0Y B;  2J0W A;  1VDH A;  2DO4 A;  2JL9 A;  3PYE A;  4DR6 J;  2WOM B;  1S9E B;  3CTR A;  2WSC C;  5LM7 E;  4AXJ A;  2EPI A;  2VIC A;  4A8S A;  2RS2 A;  3C15 A;  4FYW B;  3LPY A;  1NDL A;  1OYE A;  4JYA J;  4DV6 J;  1EKR A;  2AQ4 A;  2FVS A;  2C3U A;  3PG9 A;  2QV6 A;  3IM9 A;  4KV8 A;  5M2U A;  4DCJ B;  5AJ3 J;  5DG9 A;  2HK3 A;  3GB0 A;  1NK4 A;  4OHW A;  4UOF A;  1H6K X;  4B9S A;  4J9V A;  4MIB A;  4IRK A;  4F2R A;  2HNY A;  2CQC A;  7FD1 A;  3GV8 B;  2VC1 A;  3UCU P;  4KHR A;  3FEY B;  1S49 A;  3PKM A;  1H7W A;  4FS2 A;  1RA6 A;  4I1T A;  4USJ C;  1VRT B;  3UD3 P;  3CCW A;  4RX6 A;  2YKM B;  4OI4 A;  3TQ1 A;  4DN9 A;  4ZHR A;  2OHD A;  4EU0 A;  4FBU A;  1FA0 A;  4P75 A;  3FEX B;  4RNH A;  2ZHO A;  4X4S A;  2G9O A;  3ISN D;  3U1L A;  3IAS 9;  2AD9 A;  2G0I A;  1ZOT A;  3T41 A;  4DF8 A;  4J9P A;  5I3P A;  4LF4 F;  1RZM A;  1OJ4 A;  3JXO A;  3RW6 A;  3TO8 A;  3FSY A;  4KB7 A;  5KFU A;  1TEL A;  1GTE A;  3AA8 A;  1QAX A;  5HMW A;  2Z57 B;  3UNY A;  1ZTW A;  4WTO B;  5MLC V;  3MM8 B;  2M52 A;  4J9L A;  2KXH A;  5DRK A;  1HMV B;  3N28 A;  1YIT S;  1CJT A;  4ZVQ B;  5J2P A;  2FLP A;  1S0V A;  2F8H A;  2JC1 A;  1D0E A;  3MAA A;  2FD2 A;  4IKA A;  4Y2I A;  2P9G A;  5HVH A;  4YR0 A;  2NUU G;  2WVC A;  3T1Y J;  2ZH2 A;  1QSS A;  1VQ6 S;  2OPQ A;  4TU8 A;  4UT4 A;  2Y8W A;  2L9D A;  3B78 A;  5DQG A;  4RW4 A;  3NOC A;  2VL1 A;  3A3N B;  3M1V A;  3NBP B;  4ID5 A;  2HHW A;  2KT5 A;  4W98 A;  2XQC A;  1L3T A;  4RNO A;  1VS3 A;  2H5E A;  3MM7 B;  4R8U B;  2UUW A;  2BW2 A;  3CVK A;  3PYG A;  5HMZ A;  3TRG A;  1SJF A;  1FJ7 A;  2E1M C;  4DI6 A;  2J7K A;  4F7V A;  2WCX A;  3QLH A;  4MKY A;  2ILY A;  2UVV A;  4FS1 A;  4N76 A;  2YKQ A;  3OTC A;  2FVQ A;  2FC8 A;  5KT4 A;  4X4T A;  3PIP Q;  3LP1 A;  4HAC B;  4DEZ A;  5D78 A;  4HI1 A;  1UTA A;  1M1H A;  5F3T A;  3DNC A;  3PEJ A;  2KVQ E;  2FGC A;  4M5D A;  4HKQ A;  2EK1 A;  1HQE B;  4LIW A;  4DZ6 A;  3NS6 A;  2FVC A;  1BWV A;  2OEJ A;  3GCW P;  3IM8 A;  3E2E A;  3MM9 A;  3TAR A;  2WBM A;  4CH0 S;  2W8L A;  3GIR A;  1FXL A;  3WQP A;  4C0H A;  1D9D A;  2LLZ A;  3CJT A;  1MG7 A;  2CQG A;  2BM1 A;  2IRY A;  2F3J A;  3SMZ A;  3PKY A;  1SQE A;  3VVT A;  5F8H A;  2CPY A;  2FUG 9;  1KBR A;  5D4P A;  1SH0 A;  5A0Y A;  1DRZ A;  1HBM A;  2G2Z A;  2WSE C;  1Y9O A;  1FO1 A;  2VB6 A;  1P1L A;  2XMW A;  4NLW A;  4RLE A;  4ALZ A;  1LFW A;  5GAH U;  2DCL A;  1WHW A;  4LBI A;  1ZM3 A;  1WJ9 A;  2F40 A;  3IGN A;  3CCE S;  3DM2 A;  4DPX A;  2QO3 A;  2VZ9 A;  1K44 A;  1Q5Y A;  4TN2 A;  2RU9 A;  2W4D A;  1RAI B;  3K2Y A;  4LF9 J;  4PUO B;  4GKK F;  3SCK E;  1U2R A;  2AYM A;  5DET A;  3QGP A;  1NJX A;  4LBH A;  4NEY A;  4CQ1 A;  3HVW A;  3ZZY A;  4ZKA A;  4ZP7 A;  1WUU A;  1WTF A;  4DL4 A;  5I42 A;  3DOK B;  1SJ4 P;  3LW5 C;  3Q86 A;  3HSJ A;  1WDT A;  5ETV A;  1S12 A;  3GSD A;  3K58 A;  5GAD U;  2CAJ A;  1WG4 A;  6AT1 B;  1JNR B;  1F9E B;  2J9C A;  2ZKU A;  2HIY A;  4JI5 J;  4E98 A;  5KFY A;  1FKA F;  3D6H B;  1U1M A;  1S0N A;  5J2Q B;  1RTI A;  3V4I B;  3MCO A;  2RIL A;  2W25 A;  2YWF A;  3BN4 A;  4IG0 B;  1TL7 A;  4LSN B;  2L41 A;  1HHT P;  2CYY A;  4IQX A;  4RW9 B;  1REG X;  1NDC A;  3RRG A;  1R0C B;  2M88 A;  3H59 A;  3CPW R;  4X64 J;  1Q1K A;  3FFI B;  1LW0 B;  4L3N A;  2XLJ A;  1JLQ B;  1RP5 A;  2B9X A;  5M2R A;  5LSO A;  2ROE A;  3FCV A;  4OMF G;  2ATL A;  1NK5 A;  2EFG A;  2BOP A;  1SUQ B;  5LL6 d;  2OAU A;  3JAM U;  2PFF B;  1OY6 A;  2GMH A;  5D77 A;  3H20 A;  3RU0 A;  1F2G A;  1MN7 A;  4KYZ A;  1OSD A;  2R4F A;  2ZDP A;  1YSJ A;  1KHW A;  3BYP A;  1Q0N A;  1UW4 A;  3LOU A;  2CAD A;  1H0H B;  1WC6 A;  2EKY A;  4LF1 A;  3E8O A;  3LAK A;  2RML A;  5KG5 A;  2D3Z A;  3LA0 A;  4Q43 A;  3JYT A;  4QWA A;  2VOD A;  3NWR A;  1XNQ F;  2W24 A;  1OQ3 A;  1TP7 A;  3ENV A;  3VAM A;  2HRT A;  2PI5 A;  3FBF A;  2YNG B;  1S6P A;  4PG8 A;  1LWE B;  2RF2 B;  4USH A;  1V5V A;  2PO4 A;  4ZCK A;  3SSS A;  1CBK A;  4A8W A;  4DR4 J;  2MQM A;  3NAI A;  2I5J A;  2C3Y A;  2KHD A;  1JNZ B;  1RDR A;  1NRK A;  1S79 A;  2CJ9 A;  2GJF A;  3GMG A;  4U8V A;  5FII A;  5CD4 H;  4QYZ K;  1YVF A;  4JUZ A;  2DK2 A;  3VV2 B;  4MMO A;  1C0U A;  2I9S A;  3OR1 A;  4NYO A;  3POT A;  4O3O A;  4JI0 F;  1S1U A;  3TVK A;  1PIL A;  1TMJ A;  2KN4 A;  1RB0 A;  4I6A A;  3HVR A;  2Q3P A;  4AL5 A;  5HVG A;  4ZPW R;  4DN0 A;  4NLS A;  4DR5 J;  3D9B A;  1QVG R;  1ZS6 A;  1EKS A;  3H7H B;  5CYM A;  3PV8 A;  4BDP A;  4WWS A;  2QZ8 A;  5IC4 B;  1RE1 B;  4F3Q A;  2P2C B;  3HVT B;  3UR3 C;  5I4M A;  5C24 A;  2FHM A;  2EFN A;  4DR2 F;  4ER8 A;  1BQM A;  3TNV A;  3O1L A;  3OR2 A;  4RUC A;  2A3J A;  2RKI A;  3MMB B;  1P9Q C;  4C0O C;  5DQH A;  2E7V A;  3HHL D;  3TOQ A;  5BR8 J;  1RWU A;  1IKX B;  3W9I A;  2I2Y A;  1Y3K A;  4B3M F;  4F02 A;  2LA4 A;  4IOA Q;  2QFI A;  3BGR B;  5L9N A;  2V8G A;  3ZZP A;  1JQG A;  2NXC A;  3H2U B;  1E6V B;  3MED A;  3FKB A;  4DPT A;  1H74 A;  2B4P A;  3T1A A;  4M5H A;  1HNV B;  3RB3 A;  2ZOF A;  2MKI A;  3EDR B;  3MAH A;  3OUY A;  1RAF B;  3QZ8 A;  2C1E B;  2G2Y A;  1U1N A;  3CDU A;  4F0K A;  4M8L A;  1HA1 A;  1Z1Z A;  1YBT A;  2I0X A;  2VU5 A;  2NUH A;  4RBV A;  1TFW A;  3R2D J;  2DR9 A;  3PTW A;  1QAY A;  4F04 B;  4A8X A;  3HVA A;  2BOA A;  4QZV B;  4X62 J;  1KKH A;  2DHS A;  2H51 B;  2FB0 A;  1EP4 B;  4DS4 A;  3MMJ A;  2HVI A;  4WF9 Q;  2ZC3 A;  4PQU B;  1VQN S;  2MQL A;  3D5M A;  3DU6 A;  1CJV A;  2GML A;  3FBB A;  4ZCL A;  2UZA A;  4MT1 A;  4PXC A;  3U1M A;  3C46 A;  3DRS A;  1B70 B;  2Y3Y A;  3DGP B;  3DMJ B;  4YB7 A;  4B3S F;  1S9F A;  3V4M A;  4NEZ A;  3L7U A;  1VFJ A;  5CAA A;  1VIS A;  1VJQ A;  2YNF A;  4IO9 Q;  3BSO A;  5JJB A;  4OZL A;  2C2R A;  4P52 A;  2AYB A;  2ATC B;  1XR7 A;  5CYM B;  1NB7 A;  4DFM A;  4JI8 F;  3OL9 A;  2HFZ A;  3KK1 A;  1Q16 B;  3RZA A;  3N5F A;  2VQF F;  4Y6I A;  4NZ0 A;  4U6P A;  3FMW A;  1UET A;  4JI2 J;  3SSR A;  4U67 Q;  2GHV C;  8ATC B;  2J6S A;  3QRR A;  1C1C A;  3WHI A;  3Q22 A;  3UCZ P;  5IQQ A;  4MK9 A;  3M8Y A;  2Z30 B;  1I5O B;  1RT3 A;  3TAM B;  1WC5 A;  1U24 A;  4WFZ A;  2NYH A;  3RB0 A;  4MYT A;  4OHY A;  3NOG A;  3EZU A;  3R3T A;  1LWE A;  1SJR A;  1LXN A;  3MEK A;  2MGZ A;  2WAQ D;  1UL3 A;  2DKO B;  3O6Q A;  2IBK A;  4EO8 A;  1LWC B;  2KFY A;  1F0X A;  3UW1 A;  3NS7 B;  3TA1 A;  4UY8 T;  2ZD1 A;  1M90 T;  1BC6 A;  2XY6 A;  2BUN A;  4DV0 F;  4P74 A;  1OY9 A;  4PPD A;  2EC2 A;  3IR5 B;  4WP8 A;  1U1L A;  3PNI A;  3EWG A;  2BJ7 A;  2AJQ A;  1U6F A;  2M0G B;  2W2Q P;  2ZBC A;  5FDL B;  4OFZ A;  3KDN A;  2KU7 A;  3WX8 A;  4CTA A;  3MEC B;  5F8I A;  3HK2 A;  1S1T A;  4WP3 A;  4FNI A;  2V4Q A;  2ZM6 F;  2AJF E;  3I4P A;  3QIP A;  1JMT A;  3BDP A;  3F44 A;  2W2P P;  3DOM A;  1R0B G;  2XS2 A;  1TL1 B;  3T9N A;  1I6J A;  4I4B A;  1S6O A;  3FZB A;  4IQM A;  2ZUG A;  1X5P A;  2F9D A;  1MNE A;  2A18 A;  3DOM B;  3A4T A;  3RRK A;  4WKY A;  3PW7 A;  1HI0 P;  4KH0 B;  4ZPV R;  3BRE A;  3PYD A;  4GO5 X;  2R8K A;  1O8B A;  3VGU A;  1K9M T;  3M2V B;  3BGO P;  3E51 A;  4USM A;  3OLA A;  4G3I A;  2BJ8 A;  5DLG A;  1XJW B;  3L9Z A;  1E6V A;  3MED B;  3CCR S;  1WD6 A;  4F4A A;  2NPF A;  1KLN A;  3HSG A;  5ADZ A;  3VAL A;  2LEB A;  1XBW A;  1FRH A;  2C28 A;  3D1O A;  3UN2 A;  4MFB A;  4U7C A;  3MFI A;  3J7A N;  2BJD A;  1GNK A;  2AEM A;  1Q7L B;  5KFZ A;  1DQA A;  4YFU A;  5HMX A;  2HK2 A;  1UKU A;  2B5J B;  1WHV A;  2A1B A;  1KQG B;  4U7U K;  3K5L A;  3H5X A;  2OTJ S;  1HD1 A;  5EWF A;  4PYA A;  5CH7 B;  5LXR A;  2V2V A;  2HNZ A;  2WVE A;  2XZD B;  5A2Q Y;  2D3U A;  3B6B A;  3CCV S;  2ROP A;  1GH8 A;  1WKJ A;  3BO3 A;  4MIA A;  3NGK A;  1RLD A;  3G82 B;  3THP A;  4KHM A;  2ADB A;  4ES3 A;  3ET6 A;  2V2Q A;  4ZPA A;  5K9F A;  5IV4 A;  3ZZ0 A;  2AIR B;  3UI3 A;  4DL3 A;  3MM7 A;  4IR1 A;  2BE2 B;  3MDF A;  4C11 B;  4CYU B;  2XWY A;  2HQD A;  3KUH A;  1VRT A;  3R5A A;  1U1K A;  3D1H A;  4KKO A;  4PEO A;  1ZBT A;  2C22 A;  2Y1L B;  5K8M A;  3SZ2 A;  2AYE A;  3AJ2 A;  1JXE A;  1AFI A;  1NK0 A;  3DLL Q;  4NRT A;  1WKK A;  4JI1 F;  2LMI A;  3IBF B;  5G0R B;  3NLC A;  3KLH B;  5DDP C;  1N6Q B;  3JQJ A;  4X4U A;  2QLJ B;  1S6U A;  1MRO B;  1N5Q A;  2DNK A;  3KLH A;  2AJ1 A;  2U2F A;  6FD1 A;  2ZZM A;  4K7Q A;  1EAR A;  5HAT A;  1HI8 A;  2BE9 B;  4YY3 F;  2B0G A;  4LJM A;  1UJ4 A;  4ZJL A;  1VOM A;  2VDI A;  3C3L A;  1HMV A;  3BR9 A;  3ETM A;  3RB6 A;  1NH8 A;  1HHS A;  2DTJ A;  1QUV A;  1ZPV A;  4B17 A;  4DCO B;  3QGH A;  1HR0 F;  3RUB L;  5IM0 A;  3QJJ A;  2LVW A;  1JLB A;  4WE1 A;  4G1Q A;  1C4A A;  1YBA A;  2QLX A;  4I6W A;  4K4S A;  1RTD B;  5IM0 B;  4GKK J;  1DJ0 A;  1WKL A;  2V67 A;  5CCL A;  2Y1J A;  1IQZ A;  2QSW A;  3ADA C;  1DTQ A;  1A7G E;  3N6M A;  4J91 A;  3HT3 A;  4UUX A;  1KLM A;  2W2M P;  1SQG A;  3W9H A;  2HNZ B;  4ED3 A;  2KYX A;  4F4X A;  3KG1 A;  4PRF A;  2JX2 A;  1CVJ A;  1BD6 A;  2Z2Y B;  2FHK A;  4KQZ A;  2MQP A;  3PO4 A;  5CYQ B;  5D4N A;  4DR6 F;  3MR5 A;  1YZ7 A;  3NRB A;  3O44 A;  2DH8 A;  3FK4 A;  3UVJ B;  2ZH9 A;  5IQ6 A;  3D54 A;  4TKT A;  3EMT A;  4BS2 A;  4RPF A;  2L9N A;  1S97 A;  1R43 A;  1YZ6 A;  3CD0 A;  3F41 A;  3JS9 A;  4PAA A;  4P10 A;  2R7R A;  2EG2 A;  4QR2 A;  1RHM B;  2RDD A;  1N5Y A;  4O3R A;  4TQR A;  1EZZ B;  1ZAV A;  4O3N A;  1UPP A;  2HND B;  2YX4 A;  3KLE A;  3G96 A;  4J9S A;  1OMS A;  1CQN A;  4USU A;  4DPY A;  4TU7 A;  3KHR A;  3VHQ A;  2MLZ A;  2QC3 A;  4E2F B;  2BX6 A;  2X3D A;  2FZK B;  4DQP A;  2RS8 A;  5T41 A;  3NG8 A;  1HKA A;  3HLU A;  2C3O A;  1TUV A;  2HZC A;  3CCT A;  3GFZ A;  1VC6 A;  4BWJ A;  1TUG B;  2JH3 A;  1U09 A;  1UFK A;  3OXL A;  1IWA A;  5K8P A;  3NKY A;  3AA9 A;  1O5J A;  3CJ4 A;  4B9M A;  1NCL A;  3IWX A;  5KFB A;  2B51 A;  3N79 A;  4OZ2 A;  3DXS X;  1RAG B;  2HZA A;  4ZS6 A;  3MI7 X;  1REV B;  3G9C A;  2DRD A;  5HQ8 A;  4K4T A;  3RR7 A;  4KGM A;  4J5O A;  1DZ5 A;  4BHQ A;  1LWX A;  2JEF A;  2EWH A;  5A8K A;  3T5L A;  1FRM A;  3VAH A;  3T1Y F;  2IMW P;  1LOU A;  2B9Y A;  2K7K A;  2XHC A;  2H65 B;  3X1L B;  5A8R B;  3EVO A;  5CD4 A;  1BGX T;  1LWF A;  2LQ8 A;  5K20 B;  3R1H A;  1NND A;  2CZV C;  1F3F A;  1BUX A;  5E33 A;  5KG6 A;  2BVZ A;  1VQ5 S;  3QRQ A;  1F9H A;  4CZC A;  2ZOM A;  4N77 A;  2FZC B;  4EI2 A;  1HD0 A;  1RHQ B;  2PA3 A;  4F25 A;  5EHH A;  5I3U B;  1DQ9 A;  1RAH B;  1HNI A;  2BJE A;  2HVD A;  3PYF A;  4L72 B;  4USW A;  2AJ4 A;  3SQG B;  3OLB A;  3OL7 A;  3RR8 A;  4OJ1 A;  2BBE A;  2FC9 A;  4RUB A;  3TUP A;  4FVM A;  3IP0 A;  3RW7 A;  4WII A;  5C25 B;  3T9Z A;  1M5V C;  2XMV A;  1G6B A;  4O23 A;  3W2V A;  4LR8 A;  4Y34 A;  5KG4 A;  2EEY A;  3UCG A;  1B7Y B;  3KLV A;  1CUL B;  4WU3 A;  2B7C B;  3PW4 A;  2OUG A;  1GK8 A;  3EGW B;  3G6X A;  1TKD A;  4ZJQ A;  2GGP A;  2NSB A;  2CJX B;  5AJ3 F;  3THT A;  2HWT A;  3JSR A;  1SPB P;  2J6U A;  1W7W A;  3QGI A;  4HHH A;  4JI6 F;  4QIG A;  3VCD A;  1VIO A;  3W64 A;  3KK3 B;  3CCS S;  2CUY A;  1V6H A;  2Y1R I;  4JI7 F;  1T94 A;  2GVD A;  5HBM B;  2IPO B;  3M8S A;  1SC6 A;  1VRU A;  3CCU S;  4O3Q A;  4NA2 A;  1PKU A;  2W9A A;  2P5V A;  2Z8Q A;  3K57 A;  2CPJ A;  4CYU A;  4Q8F A;  3MPU B;  5KFC A;  3TAQ A;  4ZVR B;  3BBC A;  3D0H E;  4HR2 A;  5K14 B;  5BR8 F;  2VQE F;  2IA6 A;  1UVJ A;  1NSQ A;  4NOH A;  5GMK a;  4XIU A;  1DUR A;  4X65 F;  2XMT A;  1GMV A;  5DLF A;  2KH9 A;  2C2D A;  1FNO A;  2BW7 A;  3I0R A;  3HUL A;  4NL5 A;  1AUS L;  2D74 B;  5HJY A;  2KTQ A;  4M5K A;  1SB6 A;  4YHH J;  2DR6 A;  2RHQ B;  3I31 A;  3T1H F;  2R8J A;  2GA7 A;  4EYI B;  3CJK B;  1IJE B;  3LP1 B;  4ZVT B;  1UJ6 A;  2ASD A;  1T03 B;  3RG6 A;  2BAC A;  3RBX A;  5GAG U;  3OL8 A;  5KFE A;  2DNN A;  2LU1 A;  2KYZ A;  2ZEJ A;  1VBZ A;  1D8Z A;  1FX2 A;  5KT2 A;  2HLU A;  3OHA A;  4K4V A;  1HQE A;  4F2S A;  3OXG A;  3I87 A;  1FFS B;  3R5C A;  4NXM J;  1TAQ A;  3KJV A;  3BJY A;  2UUA J;  1FHT A;  1YRT A;  3CC4 S;  2ASY A;  5LT5 A;  5ITH A;  1FWK A;  1X8D A;  4ID8 A;  5F0U A;  4CO5 A;  1B64 A;  2XCP A;  2LDY A;  4DPU A;  5C5J A;  3OVS A;  3CJ3 A;  1U8W A;  3G86 A;  4ED5 A;  1I51 B;  1SXL A;  1J5O A;  2OEL A;  2F63 A;  1JXV A;  2GVZ B;  2YWK A;  3TR5 A;  3GIJ A;  1C0U B;  1SIW B;  3OR1 B;  2PE8 A;  2VG6 B;  4O3P A;  3KG0 A;  4ZIV A;  4IOB A;  1TKT B;  1YRU A;  3LAM A;  4DV2 F;  1NK9 A;  3HD2 A;  3BBB A;  2JEJ A;  1FX4 A;  3LAL A;  1EJ7 L;  3DLJ A;  2PMZ D;  3RAM A;  4DV4 F;  4OL8 A;  5A8K B;  1IBK F;  4DL6 A;  3AD9 C;  2QL7 B;  1N32 F;  1NBE B;  5HL7 Q;  3QGG A;  2I5J B;  3W2W B;  5KFN A;  3TA0 A;  1HIY A;  1DQ8 A;  2OLW A;  1X9W A;  2UUB J;  1G3O A;  2LQ9 A;  1DAR A;  3JSB A;  5ETS A;  1HQU B;  2BKP A;  3D6M B;  4V1A k;  2Y0B B;  1M5H A;  2MZJ A;  3QAE A;  1JIH A;  3Q0A A;  4P71 A;  2KG1 A;  2MB0 B;  2YVS A;  4XPC A;  2BAN B;  2MMY A;  4OYZ A;  2F5G A;  4URQ U;  3H98 A;  3TAP A;  4J9M A;  1YJR A;  1X0F A;  1UEU A;  2HKE A;  2N3L A;  2XMJ A;  4ZP6 A;  1OO0 B;  3IMQ J;  3POT B;  4LF8 J;  1ZH5 A;  1C1B B;  1HNX J;  3P5T L;  2WBR A;  4RW6 A;  3JAM Y;  2RUS A;  2DHG A;  1LW2 B;  1SI9 A;  2QA1 A;  4OYI A;  1RWV B;  2NZC A;  2R7U A;  4RW6 B;  2VG5 B;  2QMX A;  2ZVI A;  4Q5V A;  2X3G A;  1QTM A;  3U1N A;  2EFQ A;  1R31 A;  3MR3 A;  3VAI A;  3DCA A;  5JUM A;  3BKT A;  2HSE B;  5DGB A;  3DDN A;  3PJW A;  1TK5 A;  1U6B A;  1JLE A;  1U1P A;  1IKY A;  2CWK A;  3L7P A;  1FEH A;  2AV5 A;  3MD1 A;  2W7O A;  1AZS A;  5AE3 A;  3DDI A;  2YKN A;  1FDB A;  4ECZ A;  3Q2T C;  3MOZ A;  2JNJ A;  4CLL A;  2IAJ B;  2HQC A;  1N33 F;  4QIE A;  2K3I A;  1N48 A;  1B3T A;  4LSL A;  1H2T Z;  2F1F A;  3AH6 A;  3W8P A;  4KT0 C;  1JJ2 R;  1R8B A;  1C2P A;  3D66 A;  2HQG A;  2K1R B;  3AT1 B;  2EW9 A;  3IG1 A;  3ZXW A;  4C2M A;  4RZR A;  3RAQ A;  3JSM A;  2HHH F;  4AND A;  5IT0 A;  1RK8 A;  1VLO A;  3MEG A;  1Q5V A;  2OPP A;  3C14 A;  3W9J A;  4CT9 A;  3P96 A;  1NJZ A;  1VQ4 S;  1X5O A;  2LQJ A;  2RH3 A;  4C3L A;  1RTD A;  1GAO A;  4A4J A;  1PJ7 A;  2P6S A;  3EIC A;  4OLO A;  1M0S A;  3UFC X;  4J9K A;  4WFY A;  2NYI A;  2XZW A;  3LWL A;  5H9F K;  2J6T A;  1IKV B;  3LGN A;  1VJW A;  3VWS A;  5FLX U;  2QN6 B;  3DYA A;  5J2Q A;  5A6P A;  3V4I A;  4OZ0 A;  1UVL A;  2WSF C;  3N5B A;  2GHW A;  3TA2 A;  4AQY J;  4EEY A;  4CTA B;  4AE5 A;  5DDQ C;  5ETT A;  5IWA F;  4NLV A;  2OJ3 A;  5A2Q U;  3HX9 A;  1WG1 A;  1OSC A;  5IXU A;  2IIH A;  4DV3 J;  1RAJ A;  5BYS A;  1U45 A;  1RJJ A;  4NLR A;  4B3T F;  4DQI A;  4ECY A;  1NPR A;  4DFJ A;  4ZLJ A;  1LEO A;  3BF4 A;  1TVR B;  3SXL A;  2ALY B;  1WEZ A;  2NLW A;  2D41 A;  2OFG X;  2CPX A;  1TFY A;  2V4J B;  3PR4 A;  5M2P A;  3ENA A;  2WVD A;  3IRX B;  2MZ1 A;  3CC7 S;  5B0E A;  4U95 A;  4JV2 A;  1XTZ A;  1SKU B;  2KRR A;  3GFX A;  1SV5 B;  5U47 A;  5HP1 A;  2R8G A;  4B9V A;  1TKT A;  1MU2 A;  5D3G A;  2DHA A;  4LIR A;  1U26 A;  2H3E B;  2VG6 A;  3K5O A;  3UR0 A;  4QYR A;  1SC3 B;  2HFU A;  3H2V E;  4NA1 A;  5C42 A;  4F3M A;  2XM3 A;  5HI7 A;  2IDL A;  1C4C A;  2BKO A;  3EE3 A;  2IJR A;  4NMX A;  2AMC B;  2JWN A;  2XTJ P;  2B3T B;  2MJN A;  3HFV A;  4Y2C A;  2UU9 F;  4IUF A;  2W7P A;  1Y11 A;  2RB7 A;  1Q8I A;  4I7F A;  2VBW A;  2HS0 A;  1WSR A;  1JLF A;  2MLX A;  2COL A;  4O0I A;  1WF0 A;  1EAY C;  2QYG A;  3BM7 A;  4DX5 A;  1NHV A;  1N56 A;  2F9J A;  3KJF B;  1T9T A;  1FDA A;  4KR0 B;  3T19 A;  5D4O A;  1UP1 A;  2DNO A;  3TX8 A;  5L1I A;  1JKH B;  1R8P A;  3EM1 A;  4C8Z A;  4MKA A;  1CUL A;  1VK3 A;  3DMJ A;  3GON A;  2XB2 D;  3MAA B;  2ZJQ Q;  1GFW B;  1FJC A;  5EWG A;  4NLX A;  2ZIT A;  4IH6 A;  4C8Y A;  4I2P A;  5LJ5 Y;  1AW0 A;  4ED7 A;  3A8K A;  3IO1 A;  1FXR A;  1TVR A;  4CLU A;  1KC8 T;  4ECR A;  2LEA A;  5B0C A;  5AE2 A;  2ACY A;  2HG4 A;  2M8H A;  3C6T A;  3LUY A;  3CO9 A;  3N4W A;  2V9W A;  1MW7 A;  4MAK A;  3CD6 S;  3GV7 B;  3KMS A;  3VZH A;  1U1O A;  2UXD F;  3EGZ A;  5DZ6 A;  2HFN A;  5L1L A;  4GC7 A;  1RWX B;  1S1W B;  2VAS A;  4FXD A;  4F36 A;  1NH7 A;  4J90 A;  3FBE A;  1FER A;  1X0P A;  3ENQ A;  1RT2 B;  3QFW A;  4HLB A;  2FHO B;  3PXG a;  2XBP A;  4TQS A;  4P72 A;  2VQE J;  5A76 A;  4F4Z A;  3T3F A;  1UW9 A;  1N36 F;  4GRS A;  1VLY A;  4PG5 A;  4A48 A;  4DSF A;  4F4W A;  3V6J A;  3R7S B;  4DR7 F;  1WEX A;  3O3L A;  2GV1 A;  2CPZ A;  2YNH B;  4EYH B;  4B3S J;  4C8M A;  5CXT A;  5KFL A;  1Y5N B;  1LWC A;  1QJH A;  4M5L A;  3QSY B;  1T03 A;  2QL5 B;  2DT9 A;  1REV A;  2YPY A;  5E3C A;  1FT8 A;  3HXM A;  4IFY A;  3AD8 C;  3L7O A;  3SCL E;  3FCW A;  4XDD A;  2VFU A;  4QPT A;  1S1X B;  4UST A;  2VHG A;  1S5Z A;  3HFZ B;  4O3S A;  2LXI A;  3H4B A;  4ECT A;  3G8S A;  2HMI B;  3SV4 A;  2YNI B;  4QCL A;  3AAW B;  2VH7 A;  5HK4 A;  2GJI A;  2FLL A;  2YKA A;  1S4E A;  2XLK A;  2YNI A;  3CME S;  3KNA A;  1FJG F;  2VPY B;  4P2S A;  2H1Y A;  1N5V A;  2JVR A;  1VGY A;  5DJB A;  4EBC A;  2VPX B;  1S59 A;  2Z0G A;  1GMW A;  3HSZ A;  3KLE B;  1H98 A;  4RKU C;  2HGM A;  2G1H A;  3IRX A;  4K2X A;  4DHV A;  3CUN A;  1NKB A;  1FKO B;  1TU0 B;  3CJS A;  4CP5 A;  2LKZ A;  2I6W A;  2DH7 A;  5BYR A;  3R1L A;  1MMN A;  1X5T A;  2GZO A;  2RQM A;  3PHE A;  1ZM9 A;  4HTI A;  1YTY A;  1Q86 T;  4LF7 F;  1JJH A;  3A3P B;  3NS5 A;  4EWT A;  2D9O A;  5A6W A;  2J76 E;  4OI1 A;  4B9T A;  4FXW A;  3CSK A;  3GR1 A;  1F5B A;  2UU9 J;  1HQU A;  1PBA A;  2ZWO A;  4LRD A;  2EK6 A;  2BA9 A;  1KVI A;  1SL1 A;  1RTH A;  4YB1 P;  2YKP A;  2OI2 A;  2K8G A;  2ZBI A;  3SDE A;  2M70 A;  4DMZ A;  2ZNY A;  3E01 A;  4Z37 A;  2J9D A;  5HAN A;  2C3P A;  5KFO A;  1UEV A;  2APO A;  4GO7 X;  5E5N A;  2G4B A;  1FRI A;  3WDO A;  1X4G A;  3NEK A;  3ISN C;  2EFO A;  3T5J A;  5KOW A;  2AU0 A;  1B0V A;  4QJV A;  5GAD I;  1FNX H;  4FYD A;  2RD5 C;  3TEG A;  3HZG A;  2GO9 A;  3LP0 A;  3MM5 A;  4ICL B;  3VVU A;  3EX7 B;  3ZTR A;  4EFA C;  3MCN A;  4LSN A;  3H90 A;  3QRP A;  3K7R A;  1U0H B;  2CJA A;  2JFD A;  2Y8Y A;  2YXL A;  2MQO A;  3OJU A;  5D8H B;  2BJ9 A;  1D1U A;  1NZA A;  2HFO A;  3RRH A;  3M8Q A;  3MM6 B;  5DG8 A;  1QAJ A;  5IT9 Y;  4WBF A;  1VBK A;  1AYE A;  2MHE A;  3M30 B;  4L75 A;  3D7S B;  3J81 U;  1FNM A;  4H4M B;  2JZ5 A;  2O66 A;  1DY3 A;  2QT7 A;  3PJX A;  4I69 A;  3GYX B;  4G65 A;  4RWW A;  3ZZR A;  3H42 A;  4YQW A;  4ED2 A;  2PMH A;  1C0T A;  4AL6 A;  1Q81 T;  4C8O A;  3CD7 A;  3TUI C;  2LA6 A;  2F4F A;  2QYC A;  4NLD A;  3TZY A;  4WFN Q;  3MR2 A;  4LFC F;  2YPZ A;  4ED1 A;  1VIX A;  4DUT A;  4EK2 A;  2UUC J;  4PUO A;  2R7S A;  3KFW X;  3MPY A;  1MML A;  4K5S A;  4DG1 B;  5IT9 U;  4I7F B;  1HBU B;  3GII A;  2FZG B;  1DTT B;  3LO3 A;  4IYQ A;  3GFH A;  4J9R A;  2A0F B;  5ETQ A;  3CW2 C;  4WE1 B;  3HHE A;  1VQ8 S;  3LGM A;  1QSL A;  3PVX A;  4CO3 A;  1GMU A;  2HBZ B;  3M1V B;  2XYH B;  1S6Q B;  1Q8B A;  4TLQ A;  2IY5 B;  5GVQ A;  5B09 A;  5EX3 A;  3KLF A;  2B4V A;  2RHS B;  5B0F A;  1UAW A;  1CJU A;  4CRJ A;  3EZ5 A;  1H72 C;  3P4U B;  2CZ4 A;  4NCG A;  5ETO A;  2V9K A;  3AOD A;  2MQN A;  1JLA A;  4B3O A;  4MKV A;  4C8K A;  4PCQ A;  1RHR B;  3HP6 A;  1UVK A;  3OD2 A;  2CFX A;  4RU9 A;  4DBQ A;  1DBD A;  2XY7 A;  1QLN A;  1HBO A;  3GR0 A;  2VIH A;  4TYB A;  4FZV A;  3UWT A;  3ZZZ A;  4KKO B;  2ZHB A;  3TJA A;  1Y7P A;  3ZNJ 1;  3S01 A;  1VMB A;  3H2L A;  3ELH A;  3HKZ D;  4KBI A;  4NLU A;  2DB1 A;  3SQG A;  3HVT A;  4B9L A;  3FSX A;  4TXS A;  2O3D A;  4EGL A;  5KG2 A;  4R5P A;  1M1K T;  1WG5 A;  3D28 A;  4RNF A;  2B7B B;  3BPS P;  4M95 A;  2CQH A;  2ZH3 A;  4B9U A;  2DNL A;  2GQ2 A;  2ZH4 A;  4R5P B;  2Z2L A;  4KGZ B;  2DEJ A;  1PYS B;  3F73 A;  1BE4 A;  2FGO A;  1FXD A;  2CQI A;  3MPW A;  5T7L A;  1YJN S;  3GSI A;  2QLW A;  2UXB J;  2KZM A;  3JTO A;  2HAF A;  4JBC A;  4ES1 A;  2G0C A;  1TMM A;  3P3D A;  5CYJ A;  3VTI A;  1TL3 A;  1RBL A;  1NZ8 A;  2L08 A;  3MZI A;  4YN3 B;  3M4X A;  3DXB A;  3KK3 A;  3BQ0 A;  2OFH X;  2GMJ A;  3IG1 B;  5J2M A;  3KYL A;  2UUB F;  1K0V A;  2AYG A;  3I5C A;  2GJ2 A;  1P27 B;  3GJQ B;  5KT7 A;  4Y65 A;  3W65 A;  2XNR A;  3D6T B;  4ITS A;  2ZZT A;  1NO8 A;  2OGU A;  3HT0 A;  3TZZ A;  1VBY A;  3C15 B;  1HAR A;  2OSQ A;  3NY0 A;  8RUC A;  1WC0 A;  4DLG A;  1MN9 A;  1YRX A;  1D9A A;  4G1P A;  1IKV A;  1RWW B;  5CA5 A;  4X62 F;  3DLE A;  4C9D A;  1TAU A;  3FRZ A;  4PG6 A;  1RWN B;  4ZCM A;  2C42 A;  1NSA A;  2ZWP A;  2VDH A;  3BN7 A;  4P73 A;  2BJ3 A;  2W8K A;  1VC0 A;  1S7I A;  3OFG A;  3D0I E;  3DRP B;  1SQF A;  4M5N A;  3DGV A;  2OMO A;  1AUD A;  2V2Z A;  1HBM B;  3VZI A;  4C97 A;  7AT1 B;  2FIU A;  4PQA A;  2LXU A;  1HLW A;  1ZA1 B;  1UPM B;  3GZ7 A;  4WPA A;  2VC0 A;  1YQH A;  4QR1 A;  4IG0 A;  1BWE A;  1R27 B;  8AT1 B;  2N4D A;  1T9U A;  3V6H A;  3HHL B;  4YR3 A;  4B3M J;  1VQY A;  3EVM A;  3MTJ A;  1WHY A;  2W01 A;  4CH7 A;  4Z2X A;  2EI5 A;  1S1V A;  1U25 A;  5ETL A;  3NGT A;  5F8N A;  1Y00 A;  4ZVU B;  2HQI A;  5H9E K;  1U48 A;  1I1G A;  2YWE A;  3OVA A;  1X4A A;  4ELT A;  3P45 B;  1JLC B;  1MWY A;  1HYS B;  5EGY A;  2YNF B;  1K73 T;  1TL4 A;  4QQB A;  3AD7 C;  4IH5 A;  3MUT P;  1N5T A;  4I56 A;  2ALZ A;  1JLG B;  1HPZ B;  1VQK S;  2RAQ A;  4DX7 A;  3WX4 A;  3TJ8 A;  1N33 J;  5KAK A;  1S10 A;  3DLB A;  1Q53 A;  1RAE B;  4DL7 A;  4IRD A;  1UZH A;  2EFV A;  1S9E A;  4DPW A;  1EHW A;  3MHY A;  4I67 A;  4Y2K A;  5GAE I;  2YQ1 A;  5KFI A;  4XO0 A;  1NEE A;  1X60 A;  2XUL A;  3D68 A;  4HEA 9;  4ZMM A;  1PYO B;  4DWI A;  3D67 A;  1Z2L A;  5IZH A;  5KFG A;  2OO4 A;  3DRY A;  3W62 A;  9ATC B;  4RW9 A;  2UXC J;  2ERR A;  1WC3 A;  3GE9 A;  4OHX A;  4DSE A;  2HMI A;  2IHR 1;  1KDN A;  3JTP A;  1I94 J;  3NNH A;  4DSL A;  3BDE A;  4JB8 B;  4M5I A;  5C2C A;  5KT5 A;  2W9C A;  2QGF B;  2KO1 A;  4RR5 A;  3GPA A;  3K8W A;  3TVZ A;  1QSY A;  4LT6 A;  3DRP A;  2Z58 B;  2DGS A;  1HNX F;  4ECX A;  2JHE A;  1NDK A;  1RBO B;  4OJH A;  2E7X A;  3SYZ A;  4JP8 A;  2DRA A;  2VD3 A;  5H9F J;  2XCA A;  4DSJ A;  5IFM A;  1QAI A;  2AF6 A;  2Q6C A;  3IWL A;  1HWJ A;  2YKN B;  3JTN A;  1BQN B;  4TYA A;  1NLK L;  3CJ2 A;  2F4V F;  3U02 A;  4LF6 F;  3R6G B;  4RJV A;  1JKH A;  3LPE A;  2J0S D;  1R3N A;  5BJR A;  1SIZ A;  2EVZ A;  4IFV B;  2YX7 A;  4HYK A;  1NDP A;  2FJV A;  4CLP A;  4D3G A;  4AYB D;  1XR5 A;  1PIE A;  5KFS A;  5HAO A;  2H48 B;  4F0H A;  1L5U A;  3OTE A;  4QOT A;  1DTQ B;  1T9V A;  1Z4U A;  3WIV A;  4RNN A;  4DV4 J;  1IKW B;  3HJV A;  4KAI A;  2VBZ A;  3H8Y A;  3K89 A;  2RUG A;  2M4M A;  5AXM A;  4DZD A;  5KFD A;  1FWL A;  5E3R A;  3PIO Q;  2CPI A;  2Q66 A;  1VK8 A;  2L48 A;  2BQR A;  2BXJ A;  2O67 A;  4CO2 A;  2MKH A;  3GCX P;  3HSD A;  5CZX A;  2JJ4 D;  2ZE2 B;  2HQF A;  2NSC A;  1T3O A;  3S7R A;  2HHP A;  3W66 A;  1ACM B;  3AJD A;  1U8S A;  4OLP A;  2WRM A;  4WXO A;  4URG A;  4QWC A;  2XY5 A;  4NLQ A;  1S6P B;  1UCN A;  3C66 A;  1ZM4 A;  3QT7 A;  3D0G E;  5G0R A;  3MCM A;  3W2W A;  2B5J A;  1S4F A;  2DJW A;  2R42 A;  2NCK L;  3VQS A;  4C6A A;  2RNE A;  3PRV A;  5E41 A;  2GIQ A;  2RDJ A;  2PI4 A;  1QY7 A;  4KPY A;  1KN6 A;  3UPF A;  2OIH A;  1YJU A;  2RIJ A;  1K1Q A;  4GVB A;  1UEK A;  3MPD A;  5C25 A;  1EQM A;  3M6V A;  3ETO A;  1RT4 B;  2N4C A;  3ZO7 A;  4JI1 J;  3O8W A;  3ET6 B;  3TW0 A;  5EWE A;  2W9B B;  3BR8 A;  4YDX A;  5G4D A;  1PAU B;  3P5B P;  1R6V A;  4YHH F;  2BM0 A;  4ETZ A;  2GIR A;  3B4D A;  3H5S A;  2IC3 B;  5FJ4 A;  4ZN1 A;  4CH1 A;  3W63 A;  1DTT A;  4TVA B;  4X65 J;  2KVI A;  2AT1 B;  4ZLN A;  4ERD A;  1H2V Z;  2GQQ A;  2J7U A;  5KFW A;  3QJP A;  2IVY A;  2OEK A;  5KFV A;  1TTH B;  3SCJ E;  3BO4 A;  3NP5 A;  2QJ3 A;  1Q82 T;  3PFO A;  2R2U A;  2VOP A;  2RJZ A;  5CHC B;  2ZD1 B;  4BLG A;  1Y3J A;  3K5M A;  2HS3 A;  1Q95 G;  1YLX A;  4OZ5 A;  2OKQ A;  1JK9 B;  1VHF A;  1TZ0 A;  3HKW A;  3MMB A;  5AT1 B;  2DY9 A;  4F26 A;  1JLE B;  3V5R A;  4K4W A;  4DQS A;  4OYO A;  3TI0 A;  2YQ3 A;  2KXN B;  2AWZ A;  1JJC B;  4NCB A;  1KHV A;  1FD2 A;  2R7T A;  2R9L A;  3G8T A;  4A47 A;  2PII A;  1OIA A;  2OD6 A;  2QRR A;  2HHV A;  1KOO A;  3LP0 B;  3C16 A;  3MM5 B;  4ICL A;  4MYU A;  5LOQ A;  3DLG A;  3OT9 A;  4LVO P;  1YIJ S;  3P8B B;  1JX4 A;  2EBG A;  2CQB A;  3R97 A;  4AQY F;  1RA7 A;  3BB5 A;  1QE1 A;  4GVL A;  4UOG A;  4LRE A;  4WYW A;  4N56 A;  2OSR A;  2HLT A;  5ETN A;  3E01 B;  2QFJ A;  1T95 A;  2CNN B;  3FQL A;  4F3O A;  4B02 A;  1P6T A;  1Q78 A;  2BAN A;  4LSZ B;  1G2E A;  2XWX A;  4RUA A;  2GHP A;  4I0W A;  3MMA B;  3ENW A;  3I5B A;  2OML A;  1S9G B;  2CPE A;  4IG3 A;  4ZVH A;  1RKI A;  4I6Y A;  2ASJ A;  3M05 A;  2BR0 A;  3FDS A;  5BYQ A;  2QMW A;  3I56 S;  2B43 A;  2JVO A;  3MR6 A;  2VON A;  3IXQ A;  1A9N B;  2GGP B;  3H5Y A;  5D15 A;  3OV7 A;  2DGU A;  1YKW A;  4FVC A;  1RU2 A;  3W1Y C;  2M2B A;  1F9F A;  5THW A;  5F8M A;  1B0P A;  2WON B;  5KT3 A;  2EXU A;  2AGP A;  4CCH A;  1R8C A;  1UMJ A;  1QD1 A;  1Y10 A;  4OI0 A;  3BSN A;  2WON A;  5KOX A;  1IKY B;  1TUW A;  4KC5 A;  4KGK A;  4ZK7 M;  1RT2 A;  1IBM J;  2IJF A;  2VA2 A;  4RO0 A;  1B4S A;  2CG4 A;  4TNO A;  3RTV A;  3AOC A;  4L6V 3;  3MEC A;  5D4L A;  2OEM A;  4HVZ A;  2Z2Z A;  2E66 A;  1RT3 B;  3KWM A;  2UV8 A;  2C3M A;  4ZP8 A;  1XNR F;  2HEK A;  2VUG A;  4X4R A;  4K4Z A;  3CJ8 A;  5EX0 A;  2LXF A;  4LBP A;  3CXC R;  4X4V A;  3LF0 A;  1RKJ A;  4EZ9 A;  4ECW A;  3GTY X;  3KK2 B;  1W25 A;  4WYL A;  3LQV A;  3TUZ C;  2MKC A;  3G6V A;  3GG1 A;  2V5H G;  4YS2 A;  5IT4 A;  2V63 A;  5GAE U;  4F67 A;  1O6X A;  1S1V B;  2NXU A;  5EUH A;  1U2F A;  3B54 A;  4ZPB A;  2U1A A;  4NCG B;  3R9L A;  1ZYQ A;  2DO0 A;  1KQF B;  1KVK A;  3KJV B;  3VR1 A;  5HQL A;  2D3O 1;  2MST A;  2FY8 A;  2HRY A;  4I2Q B;  3AXK A;  2BEF A;  2IC3 A;  3IS9 B;  4IG3 B;  3CGI A;  3I5A A;  2XI2 A;  5DZ7 A;  2E44 A;  3MM8 A;  2ABY A;  2ZDO A;  1DLO A;  2L9W A;  3CB4 A;  3D4J A;  1BQM B;  4USI A;  5HJX A;  4CLK A;  3OW2 R;  2CPH A;  3G6Y A;  1TL3 B;  4FNH A;  1KVJ A;  2HIQ A;  2J7W A;  5F0W A;  1F1B B;  4OI2 A;  3QID A;  2W4P A;  2ACM A;  4DR3 J;  4WKR A;  1RWO B;  4PKD B;  1VRQ C;  3RJM B;  1YI2 S;  1WHX A;  1UFW A;  2C2K B;  2M3D A;  2E1R A;  3VGV A;  3L95 X;  1B0T A;  1AT1 B;  2JDJ A;  3CJQ A;  1NAQ A;  3J7Z 5;  2RVJ A;  1RI7 A;  2FYX A;  1G7C B;  4ECQ A;  4WTY A;  2DR5 A;  1S7H A;  5C42 B;  2RF2 A;  2AW0 A;  4QWB A;  1MMD A;  3Q8P B;  1W2I A;  2L3M A;  3CDB A;  1B99 A;  3FQK A;  2CWX A;  2IMO A;  3D1Q A;  2HNY B;  3TX0 A;  3I4H X;  2V94 A;  3JB9 k;  2B8Q A;  1AFJ A;  4H54 A;  1FWP A;  4OX7 A;  3M8Q B;  3MM6 A;  3BGF A;  2XSJ A;  2FDN A;  3UD4 P;  4NLY A;  4WFX A;  1N6Q A;  4ZVO B;  3IC1 A;  1ARO P;  5KG7 A;  2Y1I A;  1JLF B;  1EP4 A;  2DHX A;  3C8Y A;  3M2R B;  2Y0S D;  1PC4 A;  4K5R A;  5ETR A;  1N5S A;  5KFR A;  3T5K A;  3GYG A;  1XQI A;  1RT1 B;  1SBR A;  4LVN P;  1K47 A;  2B4O A;  4U8Y A;  2KM8 B;  1RT7 B;  4QIF A;  3BV8 A;  4ED4 A;  2RU3 A;  5HRO B;  3RAX A;  3AJ1 A;  2DNM A;  4IFV A;  5L39 A;  5GAG I;  1SL0 A;  3A8E A;  1HNZ J;  4NX9 A;  2HUR A;  3DRX A;  5CAB A;  5SZT A;  1M5O C;  1S72 S;  2E5L J;  5CZV A;  1F5A A;  4A46 A;  3NNA A;  4DUY J;  2P6T A;  2JLE A;  3SI8 A;  2FLN A;  4WZQ A;  3OJS A;  3QYY A;  5B0G A;  2X51 A;  4HT5 A;  1Q4R A;  4HHJ A;  1M5P C;  4ZIT A;  2IVM A;  2OPQ B;  4RBU A;  1K8A T;  3W5Y A;  4XPE A;  1SJQ A;  1GXU A;  1T9X A;  2AEF A;  3A1Y G;  3SEO A;  3RBE A;  1IR0 A;  3UDC A;  3RBD A;  1YG0 A;  2EFP A;  2DNZ A;  5GME A;  4KE5 A;  4NZ6 A;  2X1B A;  4L3K A;  3H5U A;  5KFK A;  4B3R J;  3J80 U;  1R8H A;  2BQU A;  3Q8S B;  1EET B;  2D69 A;  2J9D E;  2O5D A;  1WC4 A;  2UVR A;  4ZJO A;  5K14 A;  2FVP A;  1NK6 A;  1W26 A;  1N0U A;  1I94 F;  4DFP A;  1BLU A;  2W9C B;  3Q8R B;  1SCJ B;  2PFD A;  3TYT A;  2HQ3 A;  3IAM 9;  3ONQ A;  2UUA F;  4DXL A;  3V6D B;  2UVW A;  2FJE B;  3TJ9 A;  1Q79 A;  2RSQ A;  2BKN A;  1R89 A;  3NAH A;  3VAJ A;  1RAA B;  1QUP A;  2VPZ B;  3FUY A;  2QA2 A;  2NXJ A;  4ZP9 A;  4F0M A;  4AD6 A;  1LXJ A;  3OFH A;  1VHI A;  4BC7 A;  2QIF A;  1RTI B;  3BKU A;  4KH1 B;  2IRX A;  4X4Q A;  2LQ5 A;  1XEZ A;  1VBX A;  1U1Q A;  1MWQ A;  2MZQ A;  3W3S A;  1R0A B;  3A8J A;  4X64 F;  3KK1 B;  4MKB A;  4H4O B;  1WF2 A;  1N52 B;  2BRL A;  1KEK A;  2VFR A;  4DR2 J;  2Q43 A;  4LQ3 A;  2XC9 A;  2GO8 A;  3MXH P;  1HBN A;  2VFV A;  4ZA1 A;  5MAO A;  4W92 B;  3KOA A;  5F8J A;  1OQ6 A;  2HS4 A;  2WZ1 A;  2UVU A;  3M30 A;  4LF5 J;  2DBB A;  4LSL B;  3X3U A;  1PJ6 A;  3A3O B;  3B4M A;  1S1W A;  3M2V A;  5JXS A;  2XMA A;  1HYS A;  4UZC A;  4DS5 A;  5JVG Q;  1ZAW A;  2MLY A;  2NPI A;  1NSP A;  3I82 A;  1OY8 A;  2B9E A;  3HHN B;  4KFB B;  4QR0 A;  2QA4 S;  3TQE A;  3QZ7 A;  2BMB A;  1SKS A;  2R3V A;  1VQ7 S;  1P1T A;  4FF4 A;  1H38 A;  3MOJ B;  2HGN A;  2DXD A;  2POK A;  1ZZF A;  3QFH A;  4GC6 A;  1ZA2 B;  3P49 B;  3PRB A;  3BO2 A;  4B3R F;  2GQC A;  2XG8 A;  1FDN A;  1APS A;  1EIY B;  1X4B A;  4JI2 F;  4DV7 J;  1T0T V;  4DSI A;  2W2N P;  3DLE B;  4EMD A;  5KFF A;  2J0Q D;  4U7U D;  4OYW A;  3BKF A;  2YH1 A;  4IR9 A;  4ZVS B;  1H2U X;  3ZTQ A;  2ILZ A;  3FMB A;  4L76 A;  3UDV A;  4KHP F;  1FCA A;  4ILR A;  4ATN A;  3UDL A;  4Q7A A;  2R2S A;  1N36 J;  2Q79 A;  4AL7 A;  4JOU A;  5F3Z A;  4V19 J;  1D09 B;  4K4U A;  4A8M P;  1J27 A;  2CA9 A;  2K06 A;  3BYR A;  4A8K A;  1YK9 A;  5L9X A;  2HW3 A;  2F4V J;  5J1E B;  3EXY A;  4QIV A;  2B6A A;  5LJ3 Y;  2BE7 D;  2RT3 A;  1F6T A;  3IBC B;  1IR1 A;  1V3R A;  3KNG A;  2V8V A;  3VGS A;  3HMJ G;  1FK9 B;  2IM3 A;  2F8E X;  3J7Y U;  2DIS A;  2V69 A;  4Y00 A;  4P7T A;  3CMQ A;  1RSC A;  4FDF A;  2CJK A;  4NXN F;  3A13 A;  4FPI A;  3M8W A;  4NI2 A;  2N3O A;  2DNR A;  4WFA Q;  2ZC4 A;  2VF3 A;  1MLA A;  4FYX B;  1PJ5 A;  3TEH B;  1FFG B;  2OPR A;  2QLB B;  2E9T A;  3G2X A;  2R7V A;  2P9E A;  3M2U B;  1EET A;  1HWK A;  2E5G A;  5AXK A;  3RGI A;  1Q8K A;  4DL2 A;  2V0N A;  3I32 A;  4KO0 A;  1TKZ A;  1WI8 A;  4C48 A;  5KFP A;  1UZD A;  2G13 A;  2JFK A;  2MKJ A;  1IXK A;  3M2R A;  1UWB A;  1R8A A;  3CJK A;  1PC5 A;  2X7I A;  2C2Z B;  1S6Q A;  4NML A;  2DNQ A;  3J80 Y;  3BPD A;  2NS1 B;  4ECV A;  1I3O B;  4Q0B B;  2JSX A;  3PR5 B;  2EC0 A;  1X31 C;  4YOE A;  4PQU A;  1GQE A;  2CQP A;  4KV8 B;  4MJK A;  3CCM S;  3VQT A;  5IS2 A;  1L3K A;  2ADC A;  3PX6 A;  1HNW J;  3VAK A;  2MDA A;  1ULR A;  3S8S A;  3GJT B;  1TL1 A;  2CNK B;  2IM2 A;  2QTW A;  1KSP A;  1F2H A;  2KDO A;  3VAG A;  2HWH A;  3HD1 A;  1YJT A;  2R2R A;  4PG4 A;  2R7O A;  3HDS A;  4URS A;  2GNK A;  1TV6 B;  1UVN A;  1S57 A;  5J1E A;  4OYB A;  3R7N B;  3K5N A;  4H4M A;  5DM6 Q;  2DY1 A;  4P7V A;  3DRR B;  5F9N A;  1RXO B;  4ZVG A;  3OBI A;  4ZDN A;  3KMQ A;  5KFM A;  1FDD A;  3PAC A;  2IAJ A;  1XIQ A;  3DOL B;  5D3G B;  2QL9 B;  4DX6 A;  3KHH A;  4PXB A;  2ZUA A;  4OX8 A;  1RT5 B;  4ZIW A;  3OSP A;  2DIV A;  1BQN A;  1RTZ A;  2FLO A;  2G0J A;  4C7Q A;  4M94 A;  1RT6 B;  3M7V A;  3O5T B;  3FCH A;  4B3T J;  2OPR B;  4DV2 J;  3NGD A;  3H0P A;  3R5J B;  2HHQ A;  4LRA A;  1LK7 A;  4QBU A;  1NXI A;  3JSY A;  1X4E A;  1BMQ B;  3SV3 A;  1X4H A;  2BZ2 A;  1D9F A;  4ZLP A;  3VAF A;  1Y0H A;  3G82 A;  1XNR J;  1GTH A;  2QE5 A;  4NA3 A;  5HO4 A;  2A6M A;  3SQO P;  1TL7 B;  3CCQ S;  3DYA B;  4K0K J;  2AEJ A;  1EQ0 A;  4ZOS A;  2MYF A;  1SH2 A;  2WVB A;  1IBM F;  4DV5 J;  4JV5 J;  1RWM B;  1U49 A;  1KWM A;  3JSM B;  4J37 A;  3DLG B;  1HNZ F;  2J0X A;  3HJF A;  3EYZ A;  3Q83 A;  4ILM A;  1HWI A;  1X7V A;  1U7L A;  1P9Y A;  2YY3 A;  4I2Q A;  3FBC A;  5LXY A;  2UXD J;  1TKX A;  4U96 A;  4ZLL A;  2QMU B;  3KG4 A;  2ZZN A;  2CQ4 A;  2IYG A;  4OZN A;  5AXN A;  5GAH I;  1N34 J;  5I42 B;  5C2G A;  5B0B A;  1FJE B;  4OZJ A;  2DR8 A;  3IR6 B;  2VG7 B;  3NGS A;  3QWU A;  1QDU B;  4KGX B;  2CNL B;  3SBM A;  3QT5 A;  3HHK A;  5J1P A;  1L3V A;  1U6Z A;  3BS9 A;  2PSZ A;  1OPI A;  4QU6 A;  4ECU A;  2KFN A;  3HHL A;  2LYV A;  2A2D A;  2PEH A;  1GXL A;  3QMQ A;  3M8P B;  2DXF A;  4DV1 J;  2V34 A;  5HMY A;  1WOO A;  3MPV A;  2HFV A;  1N8R T;  4UZB A;  2NQP A;  4JI7 J;  2CZ9 A;  1ROF A;  3ULH A;  4DR4 F;  4FN5 A;  4USK A;  3MEG B;  2CJQ A;  3BEG B;  1LW0 A;  2PD1 A;  3MGJ A;  4LRB A;  2KL8 A;  3H25 A;  2JLF A;  1RAO A;  2MZT A;  2P9C A;  2KM8 C;  1SC1 B;  4CWB A;  4IH7 A;  1RTJ A;  3C2P A;  2EBE A;  1ZZN A;  1BY9 A;  1RTH B;  3Q8V A;  2GVZ A;  2HVH A;  2CNO B;  4DV6 F;  3NGR A;  4IO1 A;  3J81 j;  1RAB B;  4CLY A;  1F5C A;  2OPS A;  2P8I A;  3FNN A;  3ZTP A;  2VQF J;  1AZS B;  2KHC A;  2A10 A;  3CC2 S;  1T8E A;  2DVI A;  2H4W B;  4S0M A;  4X84 A;  4CNY A;  3BGU A;  4DQR A;  2QEX S;  1Y4Z B;  1S1X A;  4DPO A;  7FDR A;  4C3K A;  2PGC A;  2GCF A;  3CDA A;  2UUC F;  2XO7 A;  3MEE B;  1Q7Y T;  3R27 A;  5CYQ A;  5I3Q A;  4DQQ A;  1G1X A;  4R25 A;  3CDE A;  3CMA S;  1YGY A;  5D0H A;  1HBN B;  5FD1 A;  4DX8 H;  5J2P B;  2IDE A;  3UN3 A;  3UVJ A;  2FHJ D;  4HAC A;  2XSJ B;  2GAH C;  4OV6 A;  4DV5 F;  2HRU A;  4PWD B;  1EB0 A;  4TY9 A;  5H9E J;  1IBK J;  3LP2 A;  3DRR A;  1QTN B;  3AB4 B;  3M9M B;  4DV7 F;  1RAC B;  3W5X A;  4TY8 A;  2YWG A;  3MUM P;  2B8P A;  3FC9 A;  2PA8 D;  2F65 A;  4Q8E A;  3GWC A;  5T7L B;  1HNW F;  4LFB J;  3GJR B;  1RT7 A;  3BH7 B;  1HWU A;  1AB8 A;  2GAG C;  3K17 A;  1N0V C;  2WK4 A;  4Y2M A;  4DU8 A;  4DUZ J;  2HHT A;  4DV0 J;  4X4N A;  2W9B A;  5D6G A;  1WAC A;  2PT0 A;  3CIZ A;  3QPI A;  4F50 A;  4JV1 A;  3JQM A;  3RYL A;  4PG7 A;  1OS5 A;  4KJI A;  1BXN A;  4PWW A;  5DS7 A;  5LMN F;  1SH3 A;  2ZBR A;  4FPR A;  3IFE A;  2XNQ A;  4G1Q B;  3JQK A;  4WCE Q;  2AZ3 A;  2QG9 B;  5HBM A;  2CIM A;  1MSW D;  4CM2 A;  4GKJ J;  2M9K A;  3EGN A;  3PZP A;  2YWW A;  3E3X A;  2IFX A;  2ASL A;  2E1P A;  2DRB A;  4B9N A;  1FVQ A;  2I38 A;  3UO0 A;  2HHH J;  5L1J A;  2ZHA A;  1KOH A;  4NYZ A;  4UQT A;  3I6P A;  2V8D A;  1PCA A;  2R8I A;  3KXD A;  1N34 F;  1LKZ A;  1CJU B;  1R7I A;  2DGX A;  3UE2 A;  4CIO A;  2E7W A;  5KG3 A;  2GIF A;  1XWL A;  2BE2 A;  4C11 A;  1F3V A;  3CCL S;  3UDE A;  4DR1 F;  3MMC B;  2X1A A;  4RL1 A;  5EN1 A;  2VBY A;  2MY8 A;  1HBU A;  2E1A A;  1U0H A;  3R7B B;  3Q8U A;  4YB6 A;  5JMN A;  1NHU A;  3FGV A;  3QLH B;  2E5H A;  2DGW A;  2DNH A;  3MTK A;  4PAB A;  4CLS A;  5L38 A;  3R5B A;  3C6T B;  2OD4 A;  1SC4 B;  3W5Z A;  4C8L A;  4ZN3 A;  1HW8 A;  1T7P A;  5CCM A;  3AY0 A;  4I68 A;  3UQS A;  2HYI B;  1KFS A;  4BWM A;  1KS2 A;  4FXV A;  4GVB B;  4NI2 B;  2NR0 A;  5AE1 A;  3KJN B;  4LR7 A;  3LP2 B;  3ZZU A;  4OQJ A;  3ZZO A;  4AUK A;  2ZH1 A;  3M8R A;  3EGV A;  3A12 A;  4NLP A;  1L3S A;  3L4B C;  3GV5 B;  2N82 B;  3S6E A;  3T6B A;  1NME B;  2JLG A;  1HL6 A;  1JLG A;  1HPZ A;  2MPU A;  3CCJ S;  5C7P A;  3BGL A;  4K50 A;  1TKZ B;  2AZ1 A;  3QJL A;  4KIA A;  2CQD A;  4U9R A;  5CQG A;  4CLZ A;  1UA0 A;  3ZNU A;  4R0J A;  2FQQ B;  3KLG B;  1HI1 A;  2CQ1 A;  2PN6 A;  2V4J A;  4P9S A;  4FKY A;  4HH0 A;  3ZTO A;  5EDW A;  4QWD A;  2V8P A;  3LTO A;  3CE8 A;  1FRL A;  3D2W A;  3Q89 A;  3OXF A;  5KFX A;  4WZM A;  4WFB Q;  2BQ3 A;  2NZ4 A;  1FI4 A;  4WK1 A;  2J5A A;  4RW8 B;  1X5S A;  2DGV A;  5KTQ A;  1V3S A;  5LSR A;  4YY3 J;  1N32 J;  2R7X A;  3DU5 A;  5K5M A;  2FHJ A;  2CVE A;  4DR1 J;  3GIM A;  2J8S A;  2CDR B;  1ZAX A;  2IA0 A;  4OJG A;  5A8R A;  1FTR A;  3BSC A;  3EDQ B;  2I1R A;  4FP9 A;  3SDE B;  3SSQ A;  2CPF A;  3CUL A;  1FE0 A;  1ZPW X;  3N6N A;  5KT6 A;  4KTQ A;  3U7J A;  3KTQ A;  2O1P A;  2VG7 A;  4PXD A;  1URR A;  3NL0 A;  3TWZ A;  3OTO J;  3PFE A;  1N5Y B;  2XYG B;  4UW2 A;  4GMK A;  4JI5 F;  2LFV A;  1IBL J;  3B8H A;  5DG7 A;  4OZ1 A;  1Z2Z A;  2G2O A;  3B82 A;  3V6K A;  3IRW P;  1JLC A;  5J1N A;  3DRS B;  1RT6 A;  1CSJ A;  4EO6 A;  2HVZ A;  2MKY A;  5LMU F;  1UVI A;  1LW2 A;  4WP9 A;  1IWG A;  4ES2 A;  4EUV A;  3MM9 B;  1HW9 A;  1T11 A;  2XEX A;  4ECS A;  4V19 X;  2VG5 A;  1NKC A;  1NPP A;  2BRK A;  4FYY B;  4N8N A;  4OX9 F;  2FJX A;  5LMN J;  2JEI A;  1Y5I B;  4CO4 A;  1GX5 A;  3QT6 A;  1UJ5 A;  5GMD A;  2XMK A;  2X1G A;  2BDP A;  5ETM A;  2MGZ B;  2LP4 A;  4LFB F;  1WEY A;  2GFF A;  3BZQ A;  1TV6 A;  4RU2 A;  2XGQ A;  1JXL A;  3LWM A;  1IM6 A;  1GT8 A;  3KKF A;  4RW4 B;  5F8G A;  2E1C A;  4ED0 A;  2FJB B;  4Y2A A;  1N54 B;  3W60 A;  3G4S S;  4C4W A;  1KRP A;  1KFD A;  1VCT A;  5ETK A;  2PDA A;  1NJW A;  1VQO S;  4HI2 A;  4R8U A;  4CLF A;  3LGH A;  4USV A;  2B4U A;  2LDI A;  4L73 A;  2XO6 A;  3IR7 B;  4HH1 A;  3Q24 A;  1FKP A;  2ZVS A;  4BBY A;  5D0G A;  1URN A;  4OI3 A;  4RW7 A;  2W4C A;  2DNP A;  2XMU A;  3V2U C;  1K0T A;  3PY8 A;  1KR4 A;  3PX4 A;  2XZT B;  3IGV A;  1FVS A;  3BH6 B;  2YNH A;  4J9O A;  1RUS A;  4K4X A;  1UWB B;  4JI6 J;  2AJ0 A;  1U2C A;  1O51 A;  1V3Z A;  2ROG A;  3ZC4 A;  1LV5 A;  1KP6 A;  4J9N A;  2B56 A;  3ISZ A;  2ZM6 J;  3TAN A;  2IYI A;  2XSF A;  1GEH A;  2ZBQ A;  3KDO A;  1S76 D;  3P6Y C;  1YX2 A;  4J7C A;  1IM4 A;  4OV1 A;  4E0D A;  3WIU A;  2C2M B;  3MMA A;  1GXT A;  4NRU A;  5K8N A;  1HWL A;  2DGT A;  4EZ6 A;  3GYN A;  1K1S A;  3M6U A;  4CM0 A;  3QBC A;  4CNZ A;  5DDO C;  2KB2 A;  3RB4 A;  2X1F A;  1VYA A;  1V9O A;  4AT1 B;  4X66 F;  4Y3C A;  4OHV A;  1PGZ A;  2YTC A;  2C2O B;  3PEH A;  2QX0 A;  1CPZ A;  1FD8 A;  4Z7Y A;  1XC9 A;  3GU0 A;  3TZX A;  1IKW A;  4WJB A;  4I2P B;  4KY3 A;  1GMW D;  6FDR A;  1CQM A;  1DLO B;  2VOO A;  3CNQ P;  3UNG C;  1FK9 A;  3M8Z A;  5LMU J;  1RLC L;  5C24 B;  2JRS A;  4C3M A;  2VJV A;  5HLF A;  2BYC A;  2WHO A;  3ZZT A;  3DN9 A;  2D3O R;  4M63 A;  3ZFV A;  1PG5 B;  1WEL A;  1KQK A;  4ETX A;  3K59 A;  1WTB A;  2FJW A;  4LF5 F;  4B3O B;  3SFG A;  4M5M A;  4LMZ A;  2E9R X;  1UWA A;  1DHM A;  2VKZ G;  4O0N A;  3DGP A;  2DGO A;  2DPJ A;  2RRN A;  1WOS A;  2RRB A;  3BGR A;  1RT5 A;  1J5E J;  4LFA F;  1YJ7 A;  1HBO B;  2YQ0 A;  3QSI A;  4OIX A;  2RQK A;  4DR3 F;  4ZVE A;  4N47 A;  2R2T A;  1RAD B;  3DC2 A;  2MQQ A;  2GW8 A;  3K5P A;  4H4K C;  5F41 A;  4JV0 A;  3H40 A;  4JV5 F;  4X4P A;  2VKR A;  1FF2 A;  1N4L A;  3I0R B;  2WTF A;  4KGV B;  4LFC J;  4TU9 A;  1R6Y A;  4CT8 A;  5E3Q A;  4LF4 J;  4D3H A;  2VPW B;  3CD5 A;  2ZJP Q;  1QM9 A;  3MR7 A;  5HLF B;  2W7A A;  1RT1 A;  4M5J A;  4YP3 A;  3T5H A;  3F0N A;  2XYP B;  4DOZ A;  1XR6 A;  3Q8Y A;  1MRO A;  3CJR A;  2YKO A;  4P2X A;  1FE4 A;  3I0S A;  4DCP B;  4Y0F A;  5J2N A;  2HVE A;  3QIP B;  4DUZ F;  4X2B A;  4X66 J;  3KHL A;  1CJT B;  1TL5 A;  3KUG A;  3MUV P;  1BHN A;  4P2M A;  5E0O A;  3CJ0 A;  1DFD A;  3KLI A;  4WXW A;  3DKD A;  2CDQ A;  5F9L A;  1PBU A;  3C6U A;  1D8Y A;  4Q2M A;  3R8Y A;  4BCA A;  4ZPT R;  4IRC A;  2HHS A;  1SUQ A;  4NLT A;  4O44 A;  4CLW A;  4DDF A;  4LR9 A;  3IBW A;  4CLT A;  3HZE A;  3I96 A;  1IUJ A;  3JYT B;  1NKE A;  2WOM A;  4I64 A;  4MK7 A;  4ED6 A;  1WWH A;  3EUN A;  4NE9 C;  4Q44 A;  3Q8Q B;  1JJ4 A;  1B7F A;  1CC7 A;  2M8D B;  1OWX A;  4XAK A;  1RWP B;  1C1C B;  2DYA A;  3CWJ A;  4M5G A;  4JI3 F;  4KPC A;  2YKM A;  3HHD A;  3FRY A;  1TR0 A;  3ILI A;  2V6A A;  2YX1 A;  1VQ9 S;  2CJB A;  5E2Q A;  5KFH A;  2HPU A;  1FRJ A;  3W61 A;  1PO6 A;  1CLF A;  2PEB A;  3C16 B;  4RWX A;  3DOK A;  3A8I A;  3WBZ A;  4DU7 A;  1SJ3 P;  2IM0 A;  4RUH A;  3IN5 A;  1J5E F;  2LQB A;  1XMQ J;  3MAQ A;  2CJY B;  2A6O A;  3OL6 A;  4UF4 A;  4W90 B;  3PM9 A;  3DLH A;  3DI6 A;  1MWZ A;  4DF4 A;  3F56 A;  3OFE A;  4PPZ A;  4QW8 A;  4MFB B;  3EXC X;  1T05 B;  3I0S B;  3BSA A;  4N8O A;  1TKX B;  3OFF A;  1R0A A;  1SL2 A;  3NCR A;  1U1R A;  4JI0 J;  4M1K A;  5B0A A;  3VGT A;  3DLK A;  4B08 A;  1M1G A;  3MD3 A;  4RNM A;  1RHU B;  2QSF A;  4OYX A;  3NWG A;  2XS5 A;  3R5G A;  1FKO A;  1RQ0 A;  2FJA B;  4HDH A;  2HWI A;  4C98 A;  1S99 A;  2CKW A;  2IJN A;  2MKK A;  3PHT A;  4YB5 A;  5K8O A;  4NXN J;  4QIW D;  1ITP A;  1CJK B;  3AHP A;  3M8P A;  2AGO A;  3HI9 A;  5HVF A;  2ZJR Q;  2YWH A;  1RWK B;  2NXE A;  4QYZ J;  3AQP A;  3US5 A;  2XS7 A;  3HO1 A;  4OYP A;  4K59 A;  2V50 A;  3WZ0 A;  3AOB A;  3OUY B;  1T9Y A;  3OTD A;  3PJ9 A;  1H73 A;  4F8R A;  4JI8 J;  4K0K F;  4K4Y A;  2CQ2 A;  2A2C A;  1VQM S;  2DR7 A;  2WW8 A;  5HQM A;  3EPI A;  3PO5 A;  4IFY B;  1KLM B;  4KO0 B;  4KHP J;  4QU7 A;  4NPO A;  2ZNZ A;  2Z56 B;  1YJW S;  4JI4 F;  2UXB F;  2CG8 A;  3DDK A;  1CG2 A;  3BQ2 A;  4R0E A;  1JLA B;  2MQ8 A;  4K2J A;  4PR6 A;  4OYA A;  4ANC A;  3QAT A;  3M6X A;  4LRC A;  2FJD B;  4A8Q A;  3G87 A;  1QVF R;  4CO0 A;  4FYV B;  4ENO A;  4UY8 5;  4OX6 A;  2DNY A;  4DFK A;  3MFH A;  1JLB B;  3MMC A;  3RBZ A;  4KRW A;  2V4R A;  4ELV A;  1BQX A;  1FRK A;  2F7V A;  3TVY A;  1J5O B;  4OX9 J;  5KFJ A;  1GX6 A;  4NYP A;  5IWA J;  1JB0 C;  3MCS A;  1S0O A;  2NRE A;  2VA3 A;  2UXC F;  2B6A B;  3TUJ C;  4CDI A;  4ZPC A;  4NXM F;  1X9M A;  2KZZ A;  5T14 A;  1XMO J;  3GQC A;  1MU2 B;  1IKX A;  2DGQ A;  4MTP A;  2E9Z A;  1SV5 A;  5HP1 B;  2ZBP A;  3KLG A;  3QNW B;  2DD8 S;  1WNE A;  3PW2 A;  1LK5 A;  1KTV A;  3CED A;  4LF9 F;  2BV3 A;  4MH8 A;  1FEE A;  2XI3 A;  5SUH A;  3DOL A;  4PZV A;  1PYT A;  4J9U E;  3UN5 A;  4HDG A;  2DCU B;  3QO9 B;  5E3A A;  4Q45 A;  3OHB A;  3T1H J;  2M5Y A;  3AB2 B;  3MEE A;  3N6L A;  4W4M A;  1XMQ F;  5A8W A;  1SVD A;  2CQ0 A;  2AX0 A;  2FPH X;  2KFZ A;  3G71 S;  2E29 A;  5RUB A;  1T02 A;  2V2K A;  5J2M B;  4LF8 F;  4A8Y A;  1KON A;  1NUE A;  4NZ7 A;  4WK3 A;  3D3B J;  4X4O A;  4QWE A;  3PW0 A;  2PC6 A;  2IVF B;  5DQI A;  1RU1 A;  3MF5 A;  3N9U C;  2DPI A;  2OTL S;  3ICL A;  4TY8 B;  3S1T A;  4K8R A;  1VI7 A;  2M7S A;  2WB4 A;  1RTJ B;  2KT3 A;  1YHQ S;  1T3N A;  2VBX A;  1YJ9 S;  2MTL A;  3ITH B;  3FVY A;  3M32 A;  4AFF A;  3LH2 S;  1JWW A;  2J8A A;  3G8Q A;  4F4Y A;  5KFA A;  4ANE A;  5KFT A;  2WVF A;  1E6Y B;  2DH9 A;  4ZHR B;  1ELO A;  2MHN A;  3R5D A;  2ZH7 A;  3IS9 A;  3DLK B;  4KSE B;  4HHU A;  4PXE A;  3GFY A;  3Q23 A;  1XNQ J;  1OYD A;  4NLO A;  4BC9 A;  2W2O P;  3QAU A;  2D9P A;  3QQC D;  1IVZ A;  3D6F B;  4O4R A;  1U47 A;  2FVR A;  1RYR A;  4DV3 F;  2UUT A;  1KD1 T;  1CS4 A;  1W2B R;  1XK8 A;  4JYA F;  1V5I B;  3DHX A;  4FF2 A;  1IQT A;  2MEW A;  3EVW A;  3OVB A;  1CJK A;  2I8E A;  3I9Z A;  3PDN A;  5L8R C;  3GIL A;  1S0M A;  4DG1 A;  3FZ2 A;  3J81 Y;  3MUR P;  4YR2 A;  1ZM2 A;  2AKW B;  1S48 A;  2E5L F;  3FFI A;  4UUW A;  4OI6 A;  2GC8 A;  4AXI A;  2OPP B;  3C14 B;  4DUY F;  1JLQ A;  1NB2 A;  4OHZ A;  2K7J A;  2UV8 G;  1M5S A;  1RCO B;  3EZO A;  4YDD B;  4YME A;  1NK7 A;  2J9E A;  3D3C J;  1SJ1 A;  1IN0 A;  1S1U B;  2CRL A; 
#chains in the Genus database with same CATH homology
 3BBF A;  3VGU A;  4UOH A;  1NLK L;  1XIQ A;  4W98 A;  1LWX A;  1B4S A;  4F36 A;  4F4A A;  2ZUA A;  3FBE A;  1ZS6 A;  1NHK L;  1VYA A;  4DI6 A;  3EVO A;  1PAE X;  1F3F A;  1BUX A;  1NDP A;  3PJ9 A;  3ELH A;  3B6B A;  2HVD A;  2CWK A;  1WKJ A;  3DDI A;  3FCW A;  4DZ6 A;  3B54 A;  4O0N A;  3FKB A;  3R9L A;  4ANC A;  1S5Z A;  1BE4 A;  4ENO A;  1NSP A;  2BEF A;  5C7P A;  3Q83 A;  2AZ1 A;  1UCN A;  3FBC A;  4AND A;  2DXE A;  2VU5 A;  3VVT A;  2DXD A;  2NCK L;  4C6A A;  3PRV A;  1W7W A;  1WKK A;  1S59 A;  3EIC A;  4FKY A;  3ZTO A;  3NGS A;  1NPK A;  3MPD A;  3VGV A;  3FBB A;  3Q89 A;  4CP5 A;  1NSK L;  3ZTS A;  1PKU A;  1K44 A;  1MN9 A;  3ZTQ A;  3Q8Y A;  2DXF A;  2HVE A;  3L7U A;  3ETM A;  5CAA A;  3BBC A;  1B99 A;  4HR2 A;  1BHN A;  1NSQ A;  1LEO A;  3DKD A;  2B8Q A;  4FKX A;  1NUE A;  1WKL A;  1F6T A;  3ENA A;  3Q86 A;  1HLW A;  3VGS A;  3Q8V A;  1XQI A;  3NGR A;  1NDL A;  3NGU A;  2DY9 A;  3EVM A;  3ZTP A;  5IOL A;  2DYA A;  3NGT A;  4UOF A;  3VVU A;  1NDC A;  4S0M A;  3EE3 A;  4ANE A;  4KPC A;  3ZTR A;  2HUR A;  3G2X A;  5CAB A;  3EMT A;  5BXI A;  3FCV A;  4WBF A;  1U8W A;  3JS9 A;  1EHW A;  4UOG A;  1JXV A;  1MN7 A;  3Q8U A;  3EJM A;  2B8P A;  3FC9 A;  3EVW A;  3BBB A;  2BX6 A;  3BH7 B;  3WX8 A;  1HHQ A;  1KDN A;  3EM1 A;  3FBF A;  4DUT A;  4EK2 A;  1HIY A;  3VGT A;  1NB2 A;  3GPA A;  3GP9 A;  3BH6 B;  2AZ3 A;  1NCL A;  1S57 A;  1NDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...