1EHWA

Human nucleoside diphosphate kinase 4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'HMGTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The human nm23-H4 gene product is a mitochondrial nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2000-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ehwA00
4ANEA 1S5ZA 4DUTA 3EE3A 3EJMA 4KPCA 3BH6B 5IOLA 1BHNA 1NDCA 4ENOA 2HURA 2AZ1A 2CWKA 1JXVA 1NSQA 3GP9A 1XQIA 3JS9A 1NUEA 4UOFA 2HVDA 3VGVA 1NSPA 3B6BA 2BX6A 4UOHA 4W98A 2DXDA 4FKXA 3FBCA 3NGTA 1HHQA 3ENAA 1UCNA 2BEFA 3PJ9A 1HIYA 4DI6A 4EK2A 1EHWA 1VYAA 3FBBA 3FC9A 3ZTRA 3VGUA 1NDLA 1K44A 1NDKA 4WBFA 1NHKL 3ELHA 1WKKA 3EM1A 3EVWA 2DXFA 2DXEA 1BE4A 1WKJA 3EVMA 2NCKL 4C6AA 1S59A 1S57A 3EICA 3FKBA 1B99A 2HVEA 4ANDA 1NDPA 1ZS6A 3NGSA 4ANCA 4UOGA 1KDNA 5BXIA 1NPKA 1W7WA 1LWXA 3Q83A 3FBFA 3VGSA 1NB2A 3L7UA 4DZ6A 4S0MA 3VGTA 3WX8A 1PAEX 2ZUAA 2AZ3A 3NGUA 3Q8YA 3ZTQA 1HLWA 3MPDA 3VVUA 4FKYA 1NSKL 1B4SA 2DYAA 4F4AA 3BBFA 5CAAA 3Q8VA 2B8PA 3GPAA 1XIQA 3PRVA 2DY9A 3FCWA 1F3FA 1BUXA 3NGRA 1F6TA 1WKLA 3EVOA 1NLKL 3G2XA 4CP5A 4O0NA 3ZTOA 3Q8UA 3R9LA 1MN9A 1U8WA 3BBCA 5CABA 2B8QA 3DKDA 3FBEA 4F36A 1NCLA 1MN7A 3ZTSA 4HR2A 1LEOA 5C7PA 3ETMA 1PKUA 3EMTA 3ZTPA 3Q89A 2VU5A 3BH7B 3DDIA 3FCVA 3Q86A 3VVTA 3B54A 3BBBA
chains in the Genus database with same CATH superfamily
3VQSA 4F4ZA 1XN9A 3C15B 2J8AA 3H2LA 4H4MA 2BRKA 4OZ1A 2HFZA 9ATCB 4IFVB 3WZ0A 3LUYA 3ITHA 2VG7B 4F04B 4DR1J 1JJCB 2ZKUA 4WIIA 4BWJA 2W9BB 1V3RA 1OY6A 2KH9A 3KJNB 1T8EA 4LJMA 3KHGA 2ASJA 1GK8A 3KG0A 1IXKA 2QJ3A 2XQCA 1XNQJ 4J9VA 2M52A 3QSYB 4TQRA 2PDAA 5CAAA 5G0RB 2CQ0A 1N0VC 3GG1A 3S7RA 2GHPA 2V6AA 4KHPJ 1VC6A 2O3DA 2JEGA 2HIQA 3EVOA 1K47A 3PFEA 3W5ZA 4MFBB 4KR0B 4TU7A 3SDEA 2C3YA 4K2XA 5HQ8A 2JLFA 1RTDA 1HD1A 4ED3A 1WTBA 4U8YA 5A2QU 1S6QA 4CI0B 2I8EA 2N7CA 1NNDA 1RQ0A 3PX4A 1RAIB 3EXYA 1KKHA 1FEEA 1B0VA 1KN6A 3A3PB 2HHXA 4X66J 3CCES 2XYGB 2GW8A 4DFKA 1RACB 3ELHA 4DXLA 3EGNA 2CADA 1PSDA 4QWAA 2H65B 2R7UA 3R7BB 2NXJA 3ZZUA 3HF5A 4U96A 3MM6B 4C98A 2L08A 3OLBA 4ED2A 4A4JA 2VD3A 2E29A 3CW2C 1RT5B 5IV4A 2Q6CA 1XJWB 2OFHX 4IG0A 5K8NA 2IIHA 2FVCA 2LQ5A 3KLEA 1H6KX 3JQKA 4HTIA 3AJDA 1RXOB 2OEJA 3JSYA 2N3OA 1ELOA 5HROB 2ZOGA 2QFJA 3M30A 1P8GA 2HMIB 3DLHA 1I94J 2NZCA 1FE0A 2FLOA 3M6VA 4DV1J 1RI7A 3LPEA 2HNDA 2MTLA 2AQ4A 2YQ0A 4DV5J 4DR1F 1JX4A 1FJGJ 4PXEA 2AJ1A 3TZXA 1XEZA 4NYPA 4DEZA 2H1YA 4HI2A 4WBFA 2NXEA 5E33A 2COLA 4L75A 4RUAA 3RJMB 1XNQF 4QJVA 3Q8RB 2JC1A 1ZA1B 4GVLA 3VAJA 2KHCA 5KFZA 2NS1B 3ZNJ1 2RDJA 1LXJA 2BJDA 4WFYA 2HHUA 2CIMA 2W25A 1UEVA 4KHPF 1UWBA 2B4OA 3KHLA 2YKMA 1RAHB 2IYIA 3R5AA 2CPEA 1S48A 2R7TA 3MR2A 1MN9A 3FMBA 1M5HA 4Z7YA 2B9EA 1QAJA 3I5CA 4DL3A 2IA0A 2IHR1 2WB4A 5D0HA 1T9XA 5GMEA 2KRRA 1QDUB 3N0VA 1G2EA 1QD1A 3M2VB 2YQ3A 4USHA 1N0UA 2HS4A 4C0HA 1M5KC 3M8PA 1BHNA 4ENOA 3W8GA 3RUBL 2DIUA 1NXIA 1VQSA 3NCRA 3CMAS 4X66F 4JI0J 4OZ0A 4P75A 3BV8A 4DUZJ 2ZH6A 2OPRA 5KFFA 3KK2A 3T6JA 4Y28C 1B64A 1Y5NB 4M63A 1IKYB 4KIAA 2YNFB 2JSXA 1VBXA 2IYGA 3MTJA 3NRBA 3WX8A 1N5QA 1RT7B 4WCEQ 1U09A 1TU0B 4AUKA 1VS3A 4ZDNA 2L9NA 4NI2B 1HWIA 4OX9J 2DB1A 4DR5J 3SIPB 4ZOSA 2FLPA 5IM0B 4LF6F 4UTGA 2C3MA 4EZ9A 4X84A 2NPFA 3AAWB 2DCUB 3KDOA 1HWLA 3G86A 1OMSA 4I7FA 1TV6A 3C66A 1I94F 2DY1A 2HAFA 3A3OB 2A2DA 1VQ8S 3DGPB 4ILLA 4DV5F 4X64J 4DFJA 2HURA 1ZPWX 2KN4A 1FJGF 1SUQA 5GADI 4OYOA 5AE2A 1U2RA 2ZH8A 2BX6A 2M9KA 3MOZA 2FHMA 3TJAA 1WOPA 1A9NB 3MD1A 1WHVA 1XMOJ 4DFMA 3TW0A 3SQGA 2VG5A 4NPOA 1P1LA 3DRSA 2CDQA 3PRBA 2DHXA 5FLXY 1VDHA 2V8VA 3CXCR 1F5AA 1OQ6A 3P3DA 1LNQA 2QL7B 3MUMP 1AUDA 2IM3A 2DITA 1HLWA 3K58A 2HQDA 2JEIA 3NG8A 2JDJA 4DR7J 3MR7A 2UXCJ 2B9YA 2ZDPA 1LWEB 3NAHA 3NGRA 4V19J 1R8HA 5KFTA 4I2PB 2KG0A 2HWTA 2DNHA 4Q8FA 4A47A 2ZWPA 4WTYA 2ZH1A 4OHYA 2AIRB 3QRRA 4LBIA 1NZAA 3ISND 1VR6A 1ZM4A 1VIOA 2O01C 4RLEA 1FERA 2PD1A 3U1LA 3CMQA 3PHTA 2D41A 1MWQA 4DUZF 4UOHA 5SUHA 4L3NA 2R7XA 4FF2A 2DGOA 1FKOB 2VONA 3P49B 4Q8EA 2H51B 2YWGA 4E2FB 5J2NB 1KC8T 2KJWA 4I69A 4NRTA 5AE3A 1KRPA 4I0WA 3QJPA 2C3OA 4QYRA 2DPJA 2RF2B 2ZD1A 3TP2A 4M94A 4OI1A 4ED6A 5CCMA 1NK5A 2P6SA 4WP9A 3BDPA 3QJLA 3HLUA 3LPYA 4F3MA 2R7SA 2DGSA 2X3DA 2X3GA 2KFYA 4B9VA 3M1VA 5A0YA 2J6TA 2E9ZA 1HNIA 4RR5A 4O44A 1FVQA 1WSRA 2Z4PA 2HWIA 2FY1A 2JVRA 4BHQA 2KXHA 1TVRB 1OYDA 1HQEA 4MH8A 2YNHB 5IT4A 2QYGA 3DRXA 3D9BA 2CWKA 2XLJA 4K2JA 4CLKA 4IQXA 3W62A 4QPXA 1SPBP 3POTA 4FP9A 3BEGB 3OFHA 5BJRA 4NLOA 2V5HG 2MKHA 3NMRA 1UCNA 2PEBA 2MSTA 2BW2A 1HNWJ 1FFSB 3ISNC 1M5OC 1F60B 1K1SA 2P9EA 4K50A 5JXSA 1R31A 2Z2LA 2QMXA 1TL1A 4ECZA 3LQVA 2RSQA 4C8LA 3OFFA 1NH7A 2UXCF 1HQUA 2QLXA 2IRXA 1S49A 1U7LA 1IBKJ 1WJ9A 5L9NA 1DTQA 1WKLA 1T3NA 1RB0A 2HG4A 2Q66A 2HBZB 1XC9A 4LSLB 4F3OA 4B3SJ 4UZBA 3M2UA 1C0TB 3HSJA 2YWWA 2IM0A 1NEEA 3QGGA 4Q7AA 2YQ1A 4QIGA 2W4CA 5ETMA 4DMZA 2AYEA 1SQFA 3SCJE 3RBEA 4PUOB 3MAAA 4K4YA 1VBZA 4U6PA 2X7IA 1RWUA 3FUYA 2AKWB 3MEKA 4ED5A 5L1KA 2PC6A 2Z56B 3J7Z5 5DQIA 2HLTA 4C9DA 3FGVA 1LOUA 4MJKA 3CB4A 2YY3A 2QLFB 2G0CA 2R9LA 2PFFB 3NNCA 2J76E 2UV8G 2XMAA 3OL7A 4I56A 2DYAA 3LGHA 1JK9B 3QFHA 3A8KA 5FIIA 2WBMA 3UE2A 4KBIA 2I9SA 2Y1LB 4JI3J 2HYIB 1X4GA 4YQWA 5EN1A 1S6PB 1VQ6S 3SFGA 3P6YC 4KHMA 3ZTPA 3WX4A 1QSYA 2HK2A 2KRBA 1IJFB 1VFJA 1YJ7A 3PCOB 1URNA 2HHVA 5KFHA 2W4PA 2LKZA 5AXNA 1EETA 2DT9A 3F41A 3T5LA 2V69A 4R5PB 5KOXA 5CYMA 1HNWF 4IH5A 1CSJA 1BD6A 3UVJB 4EMDA 5EX3A 3GIMA 1YJWS 3OHAA 1XBWA 1GXLA 3KLGB 4ANDA 1B99A 3HULA 4O3PA 3TEGA 1KFSA 4Y2MA 2YNGB 4FN5A 1NB2A 2V34A 3CCRS 1W26A 3Q8YA 4O4GA 3BGFA 2F63A 2Y1JA 3AD7C 3N79A 3I56S 1DY3A 3N28A 4KAIA 3C16A 1U1MA 4KY3A 2W1BA 4ECQA 1DQ8A 1QTNB 2ABYA 4PG4A 4QCLA 4MYTA 2ROPA 2RKIB 4O0NA 3BBCA 2RAQA 4B3SF 3PRDA 1OY9A 2GIQA 3C19A 5KFQA 2ZOFA 5L9XA 3W3SA 2GVZB 5M2PA 1UJ6A 1R43A 3QRQA 5THWA 1L3UA 4Q2MA 1X5TA 1LQ9A 3IO1A 3E01A 3OUYA 3NS5A 1G1XA 2ATCB 4C3KA 4MT1A 2IJRA 5AT1B 5K14B 2AZ1A 4X4TA 1R3NA 2ROGA 7AT1B 4RUCA 2QA4S 1BC6A 2W01A 2A6OA 2J0SD 2HIYA 1RYSA 1KLMA 3LGNA 2VODA 2R7OA 1HD0A 3JSBA 3M05A 3CDUA 1I1GA 2JC0A 2R7VA 2GVDB 1F5CA 3THVA 3NGSA 1W7WA 3V4IB 2EFPA 5HQLA 3Q22A 4Q43A 4EZ6A 2ZHBA 1A7GE 4QR1A 1NU4A 1WHYA 4WFNQ 4CO2A 3KTQA 4HDHA 3TWZA 4D3HA 1RAGB 3K57A 1S1VA 4LF7J 1LW2B 4Q44A 1L3SA 1AUSL 4F2RA 1SQGA 4X4VA 1SIZA 2UU9J 3HD2A 2B8QA 3R5CA 3GFXA 4PQAA 4HH0A 2BUNA 2E7VA 1M0SA 4EU0A 1VRTB 2JRSA 1SJ3P 3Q86A 4ECRA 1C1BA 3QLHA 1IKXA 1WI6A 4JI5J 5ETVA 2RVJA 4RW4B 4CIOA 4KYZA 3TNVA 4X4OA 2IFXA 3BREA 2AEJA 2B4VA 4KV8B 2OPQB 1DLOB 4M1KA 2C1EB 1VJWA 1IWAA 3DOKB 2YPYA 2GGPA 5DGAA 5KOWA 1Q4RA 5D4OA 5EHHA 2GHWA 2PA3A 1UETA 2ZNZA 5IWAJ 1BQMA 2R8KA 2YTCA 3DHWC 1Q78A 4YB5A 3VZIA 4G1PA 1FFWB 4N76A 6FDRA 2Z30B 3PW0A 1F5BA 1KP6A 5F8IA 3V81B 3RW6A 4TY8B 5FLXU 1SQEA 3TQEA 2MJNA 3ONQA 4LF9F 2GO9A 3IMQJ 4RNFA 2V8GA 3IAM9 3K5PA 5D3GA 3FZBA 3T5HA 1RWKB 1N6QA 4ECUA 5M2UA 3KHRA 4N7TA 1O51A 3EJMA 1OS5A 3BR9A 3KUEA 3BKTA 4UT4A 3V6DB 1TMMA 3CD0A 3RAQA 2NXCA 2E1AA 5GAGU 2BQ3A 2MGZA 2C2ZB 1JLBB 1NSAA 3VGVA 2HHHJ 3M8SA 3HD1A 2GIRA 2H5EA 3TAMB 3VAFA 5LT5A 2DXFA 4L76A 1Q7YT 4NEYA 4C97A 2IRYA 2K1RA 3K5LA 3T6BA 3Q83A 4LSZB 2JFKA 3AOAA 2VG6B 3QAUA 4CLTA 2L41A 2YKOA 1HA1A 3KFWX 4FBUA 3MEEA 4LF7F 5DG9A 4ZPAA 1YJ9S 4A8FA 1VQ9S 2UU9F 3QWPA 5T7LA 2AJ0A 3GFYA 4M5DB 2CZVC 2ERRA 2AEMA 2FLNA 1R8AA 1SH3A 1X4FA 1Y9OA 4ZK7M 3OD2A 3CDEA 4CRJA 3W9IA 3K8WA 2GMLA 4JI5F 4GC6A 2GIFA 1TFWA 1JWWA 4RBUA 1S9EB 3X3UA 3TVYA 4ZLPA 3JQJA 1SKRA 4LREA 5HP1A 1VBKA 1WOSA 5H9EK 1L3VA 1PBAA 3KLHA 1N5YB 1VK8A 1SKWA 3QFWA 2DBBA 5C25A 4N5SA 5U47A 5F8LA 1D0EA 5IWAF 2XBPA 5GAEU 2RRBA 5DDPC 2SXLA 1RAAB 3DLGA 4CDIA 5KFEA 2ZUAA 5KFPA 4QOTA 1RE1B 4ZPTR 1Q5VA 5D8HB 3F56A 3CJKB 4DS5A 2BE9B 4DL0C 1X5SA 3C14B 4Y34A 3PR5B 4ZVSB 1FKAF 2CPHA 3ZC4A 2A2CA 2HLUA 1U0SA 4MKAA 1NLKL 4DR2F 1MSWD 1R0CB 5K5MA 5K9FA 4OHZA 4IYQA 3PDNA 3CEDA 2VC0A 2GV1A 2HNYB 2W2PP 1RTDB 1WG4A 2W9CB 3F0NA 4ZMMA 5I3UA 1GEHA 5D0RA 3M9NB 2F3JA 3SMZA 1S5ZA 4DPYA 3C3LA 2VQFJ 1FTCA 1T7PA 4ECVA 1H74A 4WP3A 4P2SA 3OSNA 4XTTA 2CDRB 2GQQA 3HFVA 4CO0A 3K89A 2BDPA 4LF8F 3DLEB 4DL6A 3W61A 1HBNB 2Z57B 1UW9A 5J1EB 2J8SA 3VAIA 1ZS6A 4E0DA 5HBMA 5BYSA 1WEXA 4JOUA 3MR5A 2QGFB 1RAOA 1XR7A 3A13A 4HACB 3QMQA 4AE5A 1ZETA 4DR6J 4WFXA 4IG0B 3UWTA 4N8OA 1HL6A 2CQCA 3KLEB 3FSYA 4YUDA 3ZTOA 1O8BA 2D69A 2ZBCA 4YS2A 2MQMA 4LSNB 5H9FK 4P74A 5F8NA 1RCOB 1BXNA 4RW6A 3OR1B 2L3MA 1Q5YA 4K5SA 4RNOA 5LMUJ 1KVIA 4M5HA 2HBQB 3ILLA 4HHUA 3DOMA 4NMLA 2VH7A 3CDBA 1Q8LA 2CPIA 4C8OA 3EGWB 4PKDB 4B3OA 5LXRA 2OKQA 4NLYA 2DR7A 2YKNA 1EQ0A 2B4PA 3SSRA 1N32J 5HATA 3Q2SC 1S59A 2VKZG 1FRIA 4QWEA 3UD3P 3FBFA 1E6YA 4DX8H 1U1NA 2RJZA 4OZ5A 1WHXA 3ZZPA 4OI0A 1YWXA 3SV3A 1U4BA 4F4KA 4JI7F 3DN9A 2EFVA 4MKYA 1FA0A 2GNKA 2YKMB 3PIPQ 4QYZK 5JUMA 2VFTA 2PEHA 1S99A 3QT7A 4NOHA 3V2UC 2PMWA 5A8WB 4F50A 2QZ8A 1LEOA 3I0RB 2BACA 1XR6A 1XMBA 2VQFF 4AT1B 3WDOA 3I0SB 3P4UB 4NA1A 1VQOS 1REVB 2QO3A 5EGYA 2QE5A 2J7WA 4R0JA 3M8PB 2EPIA 1SI9A 1NUEA 2RNEA 3AY0A 1PO6A 5J2QA 2RQMA 1NK8A 1SC1B 5CH7B 4C0OC 3M9OB 1EKSA 2DNLA 2B3TB 2POKA 4D3GA 4DV3J 3AA9A 3HX9A 4ID5B 2OHDA 1WF1A 2BQUA 4YB6A 2K3KA 4H4KC 3BQ1A 1FK9A 1AFJA 4DV2F 1ZTTA 4RO0A 1WG5A 2HZCA 4DR6F 1RT1B 4F3QA 4B9MA 4WZQA 3DU5A 3ET6A 3CIZA 3W2WA 2J5AA 4ZCIA 3OR2B 1CS4A 3J81j 2UVWA 3H5XA 2Z8QA 5LSRA 4I7FB 4YN3B 4WWSA 2OAUA 3J7AN 1MROA 2R7RA 3EUNA 3KYLA 3R3TA 5LMUF 3AB2B 1CJKA 1KLNA 4OZLA 1QE1B 3PACA 2PO4A 3JS9A 2JX2A 2GS8A 3LALA 2WRMA 2F8HA 4M95A 1N32F 3VGUA 4DSJA 1HMVA 3SQGB 1ROFA 2FC9A 4J9KA 3BGOP 2NCKL 4RL1A 3BYRA 1RWVB 1X9SA 2MZ1A 4IR9A 2LEBA 3BKFA 2LDYA 2V2ZA 2R2TA 1IJEB 4RU9A 5HLFA 3K5OA 1RDRA 1ZBTA 1LFPA 1EJ7L 1FX2A 4ZPBA 3OBIA 2J9DE 1O6XA 1CJTA 1NJWA 2V8DA 2G2ZA 3AOCA 4DHVA 2YX7A 5HK4A 1HHTP 2CJXB 2Y8YA 1FNMA 3G6XA 4ECWA 1SB6A 3CJ0A 3IS9A 2JWNA 2E1MC 2VB6A 1N5TA 1FKPA 4B9SA 1T02A 3D3BJ 1P9YA 4DV3F 1JLGA 3IGNA 4RPFA 1YX2A 3C6TB 3LWMA 3MF5A 2V2VA 4DSFA 1HBOA 1NPRA 1Y0HA 4BWMA 1I3OB 1SL2A 2HS3A 3JYTA 4CLLA 2ZC4A 2ZZMA 3L95X 3VCDA 2BJ7A 1WORA 4IOBA 4OZ2A 3UCZP 1OSCA 3HHLB 4MIBA 5EWEA 1RT3A 5D77A 1RHRB 3M1VB 1RLDA 4YR2A 4MTPA 3HCXA 4CLYA 5B08A 2MDAA 1CULA 2HGLA 2B43A 4O44B 3LW5C 2RMLA 1WEZA 1FEHA 3J7YI 7FD1A 1SXLA 2Q1LA 4IOCQ 1IBMJ 2APOA 3KK1A 3QZ8A 2DNPA 1MWYA 1MU2B 4H4OA 5DRKA 4N56A 3KLVA 4PEOA 4QQBA 2ZH4A 2VBZA 4NLSA 4ZPWR 3EGVA 2E9RX 3RBDA 2BW7A 3EM1A 2EKNA 1GXUA 3US5A 4J7CA 4GO7X 5DGBA 3K8VA 2HVEA 2JFDA 4DX7A 2ZJRQ 1Z2ZA 2I5JA 1U25A 5E7OB 1NAQA 3CJQA 4ZVRB 3ZTQA 5AXMA 3KLIB 3D6HB 4ZLLA 1DBDA 1RGVA 2IC3B 1RABB 1GQEA 1RT6B 4OZ3A 5K20B 3UW1A 4P9SA 2KHDA 1KHWA 1CC8A 3FFIB 2XSJA 3BO4A 2IA6A 2U2FA 3SYZA 4ETXA 2DGWA 2I6WA 1LK5A 3Q2TC 2ZFHA 3R2CJ 3PKMA 3EX7B 2BE2A 1VHFA 3PG9A 1NHUA 3Q8PB 3Q89A 2FJWA 4WKRA 2YH0A 3KK3A 1S1TB 4HI1A 3UDLA 4PYAA 2LQJA 2BXJA 3MAAB 3AXMA 1HFEL 2BM0A 2BKPA 2DNYA 2XO6A 3BF4A 2WW4A 5KFGA 2WVCA 1WF2A 2Y9HA 2OPSB 4RKUC 4OFZA 3NBPB 4A8YA 3TO8A 2Y1IA 1R8BA 3G71S 3CC4S 4ED7A 4X4QA 4Y2CA 2H4YB 4O3OA 1S0OA 1GMWA 1RT2A 5EWGA 1KOOA 3FMWA 1B4SA 2I1RA 3PJXA 4JI1J 1H2TZ 5L38A 4DN0A 1ZH5A 3NY0A 4U7UK 4ICLA 1Q95G 2AX1A 3H25A 3TA0A 2BV3A 5FD1A 2QLWA 4K4XA 1KBRA 4LF5J 3ILOA 1N4LA 3FBEA 3TUJC 2WOMB 2XNRA 4X4SA 2XULA 5HVGA 2EBGA 1KSPA 3G8SA 3FRYA 5HMYA 3AD8C 1UFLA 4OI2A 2HQIA 3M8WA 5DG8A 4B3MJ 4DL2A 4DPOA 4NA2A 2VOPA 3HPOA 4ZVEA 1HNVA 4J5OA 2ACMA 4PG5A 1HBMA 4L74A 2FJAB 2UUCJ 2A6MA 5A8RA 1G6BA 1N88A 3I5AA 3DOLB 4KHRA 2BOPA 4GKJJ 4NLPA 2MEWA 3H90A 1PC4A 4O3RA 4ZN3A 5HQMA 1NHKL 2QLBB 3MR3A 2MZSA 2VFSA 2MPUA 1FXDA 3G9CA 2B9WA 1OYEA 2ZZTA 1EIYB 3MM8B 1Y5LB 5KFSA 1IBCB 3UD5A 1NKCA 3MR6A 2EXUA 5EX0A 3I82A 2Q79A 1Q86T 1FVSA 2FJBB 4Y65A 1HWJA 4PWDB 3C16B 2OEMA 2B8PA 3MCSA 3GPAA 1IR1A 5KT6A 2HZAA 4I6AA 3RZAA 4ED4A 2V2QA 4ES3A 1CJUB 4DF8A 1YTYA 5F41A 3MM9A 2XC9A 4PPDA 4G1QB 3L7PA 2XWXA 3QAEA 1VQKS 2EFQA 3F44A 4IRKA 2E5LF 4JI2J 4LFAF 3PKYA 1TKTA 1FRMA 1HBUB 2DIVA 1Q8IA 5FDLA 2VA2A 2RB7A 5JMNA 1SC3B 4I6YA 3L7OA 3TZZA 1TL4A 3SZ2A 1S1XA 2CJQA 3O2IA 2QG9B 3T1YF 5DM6Q 5D4NA 3G82A 1KLMB 3IP0A 4Q45A 2C2RA 3TAQA 2HBYB 2MKYA 3FCHA 3T5JA 3ZO7A 2ROEA 3QIDA 4OZNA 2W24A 4LF4F 4UZCA 3TUPA 1XR5A 2LQ9A 1OIAA 3FNNA 2XS2A 1S76D 4JI1F 5D0GA 1LK7A 4EGLA 1QAYA 3GSDA 2BANA 4AL5A 1I51B 2DO4A 3MMJA 2C2MB 3LP2A 4EO6A 3TJ8A 1YJNS 3RB0A 4LF5F 1LWCA 1G3OA 3IRXA 3T1HJ 3X1LB 2RE1A 3CCMS 2HQCA 4YMEA 4B3MF 4P6QA 2KKHA 3BS9A 4IO1A 3SV4A 4PG8A 2FB0A 3D1HA 5KFLA 2GJIA 3IFEA 3HHLD 2UUCF 1ZOTA 3T9NA 2FY8A 2PE8A 3EZOA 3RB4A 1S97A 3MPYA 3GP9A 2LEAA 3DLJA 3RRGA 5D78A 1NSPA 5E3AA 1VHIA 2DNKA 1AZSA 2VFUA 1T9UA 4CLWA 1RTHA 2GGPB 2FZCB 3JSMB 5E0OA 5H1SV 2Z0GA 1FRJA 2MY7A 3PR4A 3VALA 1BQMB 4HVZA 2DKOB 3U1MA 4USVA 5AJ3J 3PYDA 2IRUA 4IFYA 1NO8A 2UZAA 2ZH2A 2BRLA 2W8KA 3HHNB 5IC6B 2C2EA 4CO5A 2MQLA 4GMKA 3TJ9A 3DMJA 4WP8A 2WSEC 2G13A 3CIMA 3UNGC 1JKHA 3UN2A 4ECYA 2D3OR 1RTIB 2BA9A 4LRBA 2FVRA 1S6OA 3MMCB 1TQLA 3LOUA 1U8SA 1SJQA 3BH7B 4X4UA 4LMZA 2LQBA 4CCHA 4OYXA 3WQPA 3B78A 4Z2XA 2XY5A 2KTQA 3TEHB 4XDCA 2K06A 2BKOA 1GNKA 4JB8B 2OSQA 1BMQB 2VFVA 4DG1A 4HKQA 1VRUB 1D1UA 2GHVC 3BGLA 1F2HA 4ERDA 2R2UA 3HHLC 4CO3A 4ZVQB 4PCQA 2B6AA 3HZEA 4ZJLA 2ZBQA 1DAXA 4B08A 1WELA 2K1RB 2IY5B 4JV5F 2UXBJ 2JLEA 1L3KA 4WE1A 4UUXA 3QZ7A 2ZWOA 2MXYA 3KMQA 1WI8A 2UUBJ 4TYAA 3PTWA 3CMES 4DCOB 4JI8F 1HW9A 2P5VA 3T1HF 3RW7A 3B4MA 2AJ2A 3FEYB 1YI2S 1U1PA 3A1YG 5AE1A 3QO9A 4USKA 1RSCA 4HR2A 2DEIA 4KH0B 5RUBA 4AQYJ 2E7XA 3AOBA 4DUYJ 1RADB 5I3PA 1KVKA 1UKUA 5ETTA 3PEJA 4PG7A 4OJGA 5HVHA 1KEKA 3EE3A 5JJBA 5E3RA 2ZHOA 1JLAA 3CCVS 3KJVA 4Q0BA 2ZBRA 1AB8A 4HHJA 3OV7A 2CAJA 3LGMA 2BMBA 3B6BA 4Y2KA 2DXDA 2PN6A 1BQXA 1LW0B 1IN0A 3PJ9A 5D6GA 1JNZB 4ELTA 2WSCC 2YWHA 2OP5A 3KUHA 5C25B 1WACA 2KFZA 2RH3A 1J5EF 3CCJS 2B5JA 5AXKA 2LCWA 5IV3A 3MMBA 1DURA 1YRXA 5KT3A 3BGRB 3GJQB 2JLGA 2DRDA 1U1OA 4DDFA 3CWJA 4ZJQA 2BR0A 4Y0FA 3JB9k 1V5IB 5CZVA 2OMLA 2ZJPQ 3AA8A 4NLDA 2Y8WA 3IG1B 1P1TA 2DO0A 4DL5A 1UPMB 2DY9A 1QM9A 2RUGA 3M8QA 4DJBA 3C6UB 3AQOA 2CNNB 2F4FA 5KG6A 3C2PA 1IM4A 1J2VA 3NNHA 1T05A 1NCLA 2ASDA 1T03B 3UD4P 5F8GA 2MYFA 3TANA 4RUHA 1XNRF 1PYSB 3TUIC 4F26A 3Q0AA 3RB3A 2ZOMA 2CFXA 4PWUA 1MMDA 4JV2A 4P52A 3CJ5A 4UOFA 3EDQB 2XLIA 3JTPA 5HMWA 4RNHA 3UN5A 2ACYA 3HVWA 3C15A 4ZCLA 3RGIA 2IJNA 3RYLA 2V4RA 4IG3B 2V8PA 3UR3C 2O1PA 1UZHA 2UXBF 2KL8A 4DF4A 4OIXA 4IFVA 2FVQA 2BM1A 1WD6A 2VG7A 2ZDOA 5KT2A 2W9BA 4S0MA 3Q8SB 2FJXA 2C22A 3I96A 1U1KA 2CJ9A 1TTHB 2IJFA 4A8MP 2V4JA 1TK0A 4AFFA 4C8ZA 4RU2A 1ZM3A 3G8TA 1DQ9A 4NYZA 1JXLA 1GAOA 2Y1RI 4NXNF 4A8XA 1U2CA 3CPWR 1AFIA 4CP5A 1NJIT 5IQQA 1PCAA 4AQYF 1Q7LB 2FTRA 2DRBA 4PXDA 3OHBA 1RWNB 2L9DA 4UY8T 1RTJB 4GC7A 5F9NA 3VVTA 4L6V3 1Z1ZA 4LT6A 4RW6B 4X65J 1JLEA 3OXFA 1FNXH 4P2XA 4GVBA 2XZTB 4NXMJ 4HDGA 3IM8A 4ILRA 5D4PA 2DHGA 4B3OB 1R0AA 2CPFA 3QBCA 2HRUA 3I31A 1CEZA 3LANA 5CYJA 2EWHA 3KNGA 3K59A 5EUHA 4K4SA 5GAHI 1E6YB 3R97A 5KT5A 4KB7A 2HPUA 3RTVA 3LTOA 5KFCA 1NSKL 1S7IA 3D7SB 2BOAA 4QBUA 1FHTA 4JV0A 4C4WA 2ILYA 4TY9A 2VUGA 4PR6A 1TFYA 3ILJA 2LXFA 1VGYA 4DCPB 4M8LA 3VF0B 4DQPA 4F67A 3M32B 3OTEA 3R5JB 4KSEB 4L72B 1VQ7S 1N54B 4E8UA 4LF1A 4A8OA 2ZH5A 3IA0A 4TXSA 2X1FA 2DNZA 1X4CA 4A48A 1FRLA 4B9NA 4QW8A 5HROA 1S9FA 1AYEA 1S77D 4FXDA 5KTQA 3QQCD 4X4RA 3DYAA 4CNYA 1HYSB 4DV7J 1WC6A 2HFSA 1UVJA 3MEGB 4OI4A 2R4FA 5KFOA 4DS4A 3I87A 2E1CA 4OI6A 3RBZA 3OTBA 3CO9A 3ZZTA 2OIHA 1TK8A 2LECA 2KJVA 8RUCA 2MLYA 3CE8A 2A18A 1B0TA 2MLZA 2KXFA 3K2YA 1Q81T 1SV5B 1BQNA 4USTA 2C2DA 3PX6A 2CZ4A 3W2WB 4PWWA 2QSFA 2YNIB 3D66A 3LO3A 4XK8C 3VQTA 4N77A 1S7HA 4KGVB 3UDCA 1TKXB 3ETMA 1J5OB 4X65F 3QT6A 3DFEA 3EDRB 2DH9A 3HVTB 2W2NP 2MHNA 3LAMA 3TARA 3KJQB 2OGUA 4NXMF 2VPXB 1MG7A 4O4RA 1N36J 1R8CA 5D4LA 3M2VA 1NK6A 4DZDA 3ENAA 1HIYA 2Z2MA 3DLKB 4U67Q 3CCUS 3MCNA 3M4XA 4ZP8A 1PJ6A 2BJ8A 1C0UB 1SH2A 3GYXB 4OLOA 3NAIA 4LF6J 3HDSA 5ITHA 1QAXA 3HHDA 2XO7A 1IKYA 2H9ZA 4MKBA 1YHQS 3OJSA 3Q8VA 3L9ZA 2DPIA 1MNEA 3CD6S 1K0VA 3I4HX 1LKZA 4ZVHA 5HMZA 2FGCA 3FRZA 5HN0A 3ENQA 4KFBA 1G4CA 1RT7A 3M6WA 4BS2A 2CKWA 5CABA 1Y5IB 3GJRB 4NI2A 1V6HA 1Q16B 1Q8KA 2AF6A 4UOCA 4LQ3A 1X9MA 2DNOA 4N41A 3BQ0A 5DZ6A 4NEZA 3W2VA 2QTWA 3NXZA 3CT9A 5C24A 4BLGA 4DV7F 1VQ4S 3U02A 3H4BA 2XMTA 1M1KT 3DGPA 2ZHAA 4NCAA 4YY3F 3EVMA 4CM2A 4NL5A 4QU7A 2J7KA 1TL7B 5T41A 4AL6A 3HSZA 3H20A 2QL5B 4NWBA 4RW9A 1JLFA 1OSDA 3CCWA 3HHEA 3T41A 2AV5A 2B7BB 4FYVB 2XG8A 4FZVA 2XGQA 2P2CB 2QT7A 1F3FA 3GIJA 4MKVA 1IBLJ 1NHVA 2QA1A 1RT3B 5KFDA 3NOGA 5HVFA 2ZUGA 1PGZA 3BZQA 2AGQA 4I2PA 3R7NB 3W60A 3I5BA 3QJJA 1N36F 3S8SA 1YBUA 3C8YA 2UVUA 4FNIA 4WYLA 4DQIA 3KK1B 2XM3A 1NK7A 4H4OB 3H5SA 2H4WB 2V8HA 3VV2B 3HI9A 4NYOA 3K17A 1DQAA 3QIPB 3PHEA 3GSIA 2HHWA 1ZTWA 1WC4A 4DPXA 1KDNA 2ILZA 2W7AA 3BN4A 2BBEA 4ZP9A 3OXLA 3D67A 5J2NA 3MECB 4O3QA 2ZH3A 1PYTA 3ETOA 1UVKA 2IDEA 3KKFA 3MFIA 4IR1A 4KO0A 1RZMA 4NLGA 2RF2A 1RKJA 2JEFA 3LP0B 1UPPA 2AT1B 4OYWA 2GJ2A 1WG1A 1RHJB 3VZHA 1OY8A 2WB1D 2ZBIA 3O3LA 1RLCL 4U8VA 1ACMB 2XHCA 5IOLA 2JL9A 3KK3B 4L3KA 1HNZF 4URSA 1KR4A 1AROP 1FF2A 5J1PA 1L5UA 1YQHA 4CLSA 4BC9A 1YRTA 4NZ7A 3NP5A 3HVAA 2YNHA 3DGVA 1FNOA 3OW2R 2RT3A 1EARA 3NS7B 1ZZNA 4PQUB 3KLFA 4DR3J 4DUTA 2DR9A 2FC8A 4IRCA 1RA7A 1TUVA 1SC6A 2DGVA 2EKYA 4UUWA 1RT2B 3DRRB 3MM5B 5DG7A 2B4UA 1IBLF 3N01A 5CYQB 2EC2A 2DK2A 1HI1A 1ZPVA 5GAHU 5BR8J 4YFUA 2P6TA 1T9TA 3MMAB 2KO1A 1VIXA 3IN5A 4A8KA 3DLLQ 2MKIA 4J90A 3TUZC 2GQCA 4IRDA 3GYNA 5MLCV 5IQ6A 1OPIA 2K3IA 1H98A 4DSLA 4ER8A 1MMLA 4MYUA 2FHJD 5C2CA 1WSVA 2KYXA 5DDOC 1ZM9A 2G1DA 2N4DA 3CC7S 1H7XA 3G8QA 2P9GA 1C0TA 2E66A 1FRHA 4ILMA 2OD6A 2R8HA 4DI6A 1NBEB 3RRKA 4NCGB 4X4NA 2MLXA 1WKJA 2EEYA 1NB7A 4PUOA 1VISA 4FDFA 3BQ2A 3I6PA 3NGUA 3GCWP 1D9AA 2D7SA 2GJFA 5GAGI 1GMUA 1VC5A 1S79A 1SL0A 4ZLNA 2P8IA 3W7BA 3WBZA 4C3MA 4DL7A 2VIHA 4NLWA 3G2XA 4F02A 5KG5A 5HO4A 1PG5B 3B8HA 3KG1A 1JJHA 3ADAC 4ZVOB 3EPIA 4J37A 5HJYA 1FE4A 1KTQA 4NA3A 1U0HB 2M70A 1ZAXA 4P72A 3N5FA 3GR1A 2VOOA 3IBFB 3G82B 1RP5A 4QIWD 1EHWA 2HHPA 3MAHA 2Z2ZA 4DR3F 4WU2A 4DWIA 3EVWA 1UFWA 1KHVA 3RRHA 4R5PA 2ZNYA 1I6JA 3FSXA 2H5IB 2YX4A 1NM2A 2OJ3A 3NL0A 2ZITA 3QT5A 1JLQB 4C8KA 1REGX 3UVJA 3G6ES 2XY7A 4LUBA 1X60A 4TN2A 2AD9A 5F0WA 1ULRA 3KLGA 4C2MA 2LLZA 2YBVA 5BR8F 2BANB 2YNGA 2OEKA 1DTTB 3BSCA 1LWCB 3QWUA 1NMEB 4ECXA 1D9FA 4B3TF 5B0GA 3SI8A 1Q53A 1SH0A 5GAEI 2RILA 1V9OA 3NS6A 2GQ2A 3T1AA 1K1QA 3L3CA 1T9YA 2D1CA 2RKIA 2OPPA 2HGNA 4I68A 2GCFA 4ZPDA 4ED0A 3HMJG 1C4AA 2GVZA 5AXLA 3DI6B 3GQCA 1S9GB 5A6WA 1K8AT 3Q8QB 3D0GE 3MM7B 1RTHB 3OL8A 2VFRA 4J9OA 1KOHA 2FDNA 2HHTA 2WBRA 1APSA 4ES2A 1NPKA 2XCAA 3R2DJ 3C46A 1XERA 2WVEA 3ZZ0A 2OI2A 3PEHA 3VVUA 3OFEA 5CA5A 4I2QB 2GVDA 3H4DA 2CRLA 2K2PA 4OYIA 5L46A 4FXWA 3V4IA 1TL3B 4LFBF 2KZZA 3IWXA 5C2GA 3GV5B 2I2YA 4R8UA 4LFCF 4A46A 4ZCMA 3ZTSA 2RRNA 1RT4A 3G6YA 4IDKA 1LW2A 1Y10A 2W2QP 4RWWA 4DX6A 2WTFA 1WC3A 3IWLA 4Y2IA 2LA6A 3G96A 4C7QA 2VA3A 5SZTA 4JBCA 4J9RA 1IR2A 2MQQA 4PYDA 4NLRA 5KG2A 1TKDA 1R27B 3PVXA 2X1AA 2KU7A 4H4KA 4RW7A 1KONA 1VRTA 4LRDA 2CNLB 2BEFA 1F0XA 2L48A 1VBYA 1R6YA 4RW4A 4KKOA 4JYAJ 4KV8A 3WC0A 2OPQA 1DLOA 2ZC3A 2LU1A 4ANCA 1W2BR 3M9MB 2V9WA 3GG0A 2DH7A 2FGOA 1FRKA 3DOKA 1GTEA 2PMHA 1U1RA 4WE1B 3MAQA 1BWEA 4QWDA 2VL1A 2R8JA 2I0XA 1N5SA 4LF9J 4WIQA 2BKNA 1FTRA 1TAQA 1URRA 3G87A 4QR0A 4P7VA 1KQKA 3SFUA 3HM9A 1DRZA 1GMWD 1FT8A 2AGOA 1U1QA 3CJTA 3VAGA 1K9MT 1W2IA 3MEDB 3NGDA 2KI2A 3V81A 4OHXA 3QGHA 2LEPA 2HVHA 4MK9A 3U27A 1UAWA 3IXQA 2C28A 6FD1A 5F8JA 1JLAB 3KJVB 2LU2A 2AP6A 2AGPA 2B56A 2ZH7A 3RAMA 4KE5A 4DQRA 4ES1A 4TNOA 2MZRA 3EPGA 4Y6IA 3V6DA 1TK5A 3FBBA 3W64A 2NPIA 2HK3A 2CG4A 4M5KA 1JLBA 2B5JB 2HVZA 2AYBA 1VQNS 5KFMA 4O3SA 3PIOQ 1LWFB 2EG1A 2O67A 1WUUA 3IR5B 3TAMA 2JHEA 1A6LA 3TA1A 3QYYA 4CLZA 4RNNA 5J2MA 2KVQE 1WTFA 1MMNA 2BABA 1GMVA 3MI7X 2LA4A 1F1BB 1HPZB 3CD5A 1TKZA 3CJRA 2JNJA 2F5GA 2VG6A 3M8QB 3EZ5A 4XPCA 3R5BA 3AD9C 2C3PA 2HZVA 5KAKA 2CPDA 1YITS 2FD2A 4I4BA 3GWCA 2IAJA 4CYUA 3O44A 2K8GA 4F7VA 1X4BA 4K7QA 2EBEA 3TX0A 2OH2A 4M5DA 3QRPA 1HI8A 4K4WA 1XMQF 2CQDA 3BH6B 4HHHA 2UXDJ 1RHUB 3IGVA 4P10A 1HQ2A 2GFFA 3DM2A 2CJAA 3O1LA 4X62F 2HFUA 4FS2A 2XMKA 3U1NA 4YP3A 2NXNA 1NKBA 2V67A 1GTHA 4JYAF 5MAOA 4C8MA 1S9EA 2CQGA 5LJ5Y 3SCLE 3KHHA 1YBAA 2W4DA 1JLCB 1IKVA 2IVFB 3CUNA 2Q6BA 1N5YA 3J7ZT 2AZ3A 2EI5A 1YJTA 2RHSB 4C11B 1IM6A 4DR2J 1FJCA 2V4JB 3PW4A 3UQSA 1U6FA 2WK4A 3D4JA 5KG1A 4YHHF 1S1UB 2HKEA 4GO5X 4LVNP 1QSLA 2CQ4A 3D28A 4OJ1A 4KRWA 3AQPA 2XEXA 4FXVA 4J9LA 1TL5A 3ILIA 1C1CB 3MPWA 3DLBA 3CJKA 4ELVA 1VLYA 1UVIA 1F3VA 5J2PB 2ZE2B 3NWGA 3C14A 5KFXA 2CJYB 4JI6J 2EG2A 3FQKA 1EP4B 1YLXA 3A8JA 1JLEB 2HBRB 5GVQA 4J9UE 4LF8J 4GVBB 3ZFVA 3TAPA 2XB2D 1AA1B 1X4EA 4OHWA 5LL6d 2HNYA 3BN7A 3RR8A 3B4DA 2W9CA 2CYYA 1FXLA 3GMGA 1NJXA 4AXJA 1FI4A 2QSWA 2WONA 1PJ5A 1R0AB 1YK9A 1IKWB 3FQLA 3AJ2A 3QGPA 1RWXB 3CDWA 1NDPA 3UPFA 3N4WA 1W25A 1E6VA 3OL9A 3DLEA 5KFAA 3MPDA 2WHOA 1HBNA 3HFKA 2KM8B 4JUZA 1Y00A 2HWHA 2XSFA 5J1EA 3W8PA 4WZMA 4CTAB 3L09A 2MKJA 2XMWA 1OO0B 2BJ9A 2QL9B 2ADCA 3ZZOA 1CBKA 4K4UA 2DNRA 3J7A1 3PO4A 3IC1A 3NKYA 4HACA 4YR0A 4H4MB 2MY8A 3TQ1A 5LMNF 1FESA 4CT8A 2VDIA 3IM9A 1YKWA 3ITHB 1U02A 2UXDF 3CO0P 1ZAVA 2QMUB 3GV7B 2WCXA 4Z7CA 2DGXA 3E8OA 2DCLA 4LSNA 3R27A 3NMAA 2V2KA 3D3CJ 3HHKA 2DR5A 4UW2A 4RZRA 2M4MA 3OTCA 4DPWA 3DYAB 2XMVA 3OR1A 5DETA 3BGUA 2OUGA 4O23A 3KXDA 3W1YC 2D3O1 2IBOA 2E5JA 1C2PA 1S57A 4JI7J 5E2QA 4USIA 1B7FA 2CWXA 1ICEB 1KFDA 4DZ6A 2QFIA 1PBUA 3VR1A 3A3NB 3BJYA 4OYPA 4KGZB 4YOEA 3SDEB 5BYRA 3EYZA 2XS7A 3FJ2A 2D9PA 1BQNB 1S6QB 1B0PA 1RWOB 2G1HA 2F4VJ 2MKKA 4DV0J 4JI6F 1X0PA 2HW3A 2HHSA 4CLPA 2MZQA 3MURP 2XCPA 3UCUP 3N6NA 1S12A 4DU8A 1YGYA 5DLFA 2FHOB 4NCBA 3CGIA 1SL1A 2LVWA 1KQSR 2D74B 2QLJB 5B0DA 5A8WA 4JP8A 5LM7E 3I0RA 2RU9A 5CQGA 4QZVB 4DN9A 4TLQA 5H9EJ 1X5PA 3I0SA 1IUJA 1REVA 1VYAA 4DV2J 3SCKE 2IDLA 3GIKA 3SBMA 2C2NA 4CWBA 3R7SB 3W9HA 5A8KA 4NLXA 4BC7A 3VGTA 1UVMA 1V3SA 1QY7A 1UP1A 1S1WA 3BBFA 3M30B 4OV1A 4ID5A 2AX0A 4CM0A 1RBLA 1O5JA 3P8BB 4RBTA 2XMJA 1S10A 1C4CA 1LXNA 4TQSA 4WU3A 4KFBB 3W63A 2D3UA 1TMJA 2HNDB 2HQFA 1RT1A 3I55S 5I42A 1M90T 1QLNA 4PZVA 3FSIA 2C3UA 1NK0A 1WDDA 3J80U 2XI3A 2FJDB 4OX6A 2CJKA 4R25A 3OR2A 2MSSA 1RJJA 4FS1A 2IM2A 3W2VB 1M1GA 5C24B 1EQMA 1YDLA 3I4PA 5DLGA 2YWEA 2CQ1A 3THPA 1FJEB 4DV1F 1N8RT 3JAMY 3K5MA 3UCGA 2A3JA 2HRTA 1M5SA 1QE1A 5ETQA 4FNHA 4B3RJ 3SXLA 1U24A 4B02A 4RW8A 3PXGa 4E98A 1PYOB 3CCZA 1UWBB 6AT1B 1HI0P 4IQMA 3R1HA 2W7PA 4XAKA 5L1LA 4RW9B 5KT4A 1JLFB 2YWFA 3FEZA 2ZZNA 3KOAA 1YG0A 4P73A 1NH8A 2DGTA 5KFBA 1U45A 1FWLA 3PNIA 2M8HA 4G65A 1NKEA 5DZ7A 2HEKA 3IRWP 1X0FA 2QN6B 2JEJA 2F4VF 2VPYB 4DV0F 4ED1A 1X5OA 1UA1A 4M5NA 1ZZFA 3IBCB 3JTNA 2N4CA 2Q3PA 5HAOA 3GR0A 3DDIA 4DR4J 2OPRB 2YX1A 3KK2B 5H9FJ 1MWZA 3D0HE 1TUWA 1FDAA 1Y3JA 2F1FA 3OVBA 2BE7D 4KPYA 3PYEA 2KDOA 1JMTA 2GZOA 2E5IA 2OFGX 3FBCA 2WZ1A 2D3ZA 3MCOA 5E5NA 4ZHRA 3ZTRA 1CQNA 1VI7A 2MJUA 3DU6A 4DU7A 4JI0F 3EICA 5FJ4A 1T95A 4CO4A 4J9NA 3G4SS 3CULA 1VCTA 4C8NA 4OV6A 2Q43A 4EO8A 5IT9Y 4I6WA 3Q23A 2DNQA 3C6TA 3WIVA 1V5VA 2MQ8A 3IAS9 3HFZB 1TV6B 3EXCX 2AHOB 3VAHA 4W90B 1CLFA 2R2SA 1RA6A 3CJ2A 1RU2A 2VASA 5KFNA 1RBOB 4DV4J 4KO0B 4OX9F 4KGXB 4DR5F 4QYZJ 3IWNC 3N6LA 1SUQB 2OO4A 4LBHA 3QGIA 2CXEA 4UQGA 1CJVA 3HHLA 3W9JA 3DRYA 1YZ7A 2VG5B 4FYDA 1H2VZ 1NK9A 3DRSB 4J91A 2NUUG 3OSPA 2HVDA 5F0UA 1SKUB 2M2BA 1SJ1A 4A8SA 3H98A 4B3RF 4X64F 3MFHA 1Q79A 2GMJA 3RAXA 4WFAQ 3KLFB 4AL7A 2CPXA 2I38A 3GILA 1MU2A 1XMOF 2WAQD 3TZWA 4EUVA 3ISZA 2ALZA 4I64A 2M5YA 5CXTA 3OTOJ 3WHIA 4ITSA 2DHAA 1UVNA 3KLIA 4DR7F 2QMWA 2IC3A 4IOAQ 1RT6A 4PRFA 3R5DA 4DR4F 3FFIA 5EWFA 3AXKA 2LXIA 3MTKA 1X4AA 3H5UA 3DDNA 1HKAA 1M5VC 3GIRA 4LRCA 3D1OA 2F65A 2KM8C 1JXVA 2LQ8A 4B9LA 4O0IA 4FF1A 4WXWA 5KFWA 1F9EB 1RUSA 2RS2A 2DR8A 5LOQA 2ZD1B 1S1TA 2VPWB 2G2OA 5KG4A 4WFZA 1QUPA 4AXIA 4TU8A 1YJRA 4G3IA 4LF2A 3R1LA 4J9SA 4HEA9 1U49A 3HK2A 5B0BA 3M6UA 1HR0J 4FPIA 5A0YB 4HLBA 1WNEA 2OPSA 2RRAA 3NBPA 1FFGB 1HNIB 1U26A 5B09A 4K0KJ 2FJVA 4DV4F 3GU0A 3SSSA 2CG8A 4ZA1A 1HQEB 2PA8D 2DVIA 2GA7A 2XZDB 4TKTA 2RS8A 4K4TA 2P9CA 3POTB 3GFHA 1QJHA 2XHWA 2XLKA 3H42A 4B9TA 3HXMA 2HFNA 4GKKJ 2WOMA 5CHCB 2PFDA 3DRPA 2CVIA 2ADBA 2N7YA 5HI7A 3NWRA 2IMWP 3D2WA 4U7UD 4YDDB 1TL1B 2V50A 4TU9A 4EWTA 1HQUB 2OTLS 1Q82T 5B0FA 8ATCB 1EZZB 3DOLA 2L9WA 1P9QC 2R42A 3UI3A 3AJ1A 5B0EA 5T14A 4IH7A 1DTQB 3CCLS 2MQNA 4QIVA 1VQPS 3UN3A 3OTOF 2HSEB 2N82B 3V5RA 3M2UB 3CJ8A 2X1GA 3MM8A 1JQGA 3ZZYA 3QPIA 2VV5A 4TVAB 1SIWB 3HT0A 2E5LJ 4EI2A 5DJBA 4LFAJ 5L39A 3BPDA 1ZA2B 4U9RA 1SJFA 4LIWA 4CH0S 1IBKF 4PWDA 4GRSA 3LP1A 1EKRA 1X7VA 4NLTA 3W5YA 4YDXA 2GAGC 1CJUA 1BWVA 1VC0A 2RDIA 4F0KA 3FEXB 5KFYA 2G4BA 3T1YJ 3MD3A 2XWYA 1TELA 2OPPB 3V6KA 1RHMB 2EK6A 4G1QA 1JXEA 5LXYA 1H73A 2G0IA 4G6VB 3CCSS 4A8QA 3H0PA 4DQSA 4FBTA 4M5MA 1RCXB 5J1NA 1HBUA 4LF4J 1WKKA 4Y00A 2V4QA 3PYGA 1PJ7A 4IUFA 3LWLA 1R8PA 3MWBA 3GFZA 2R2RA 1UZDA 1HR0F 4QWCA 5M2RA 1EAYC 4F8RA 1FD2A 3MDFA 5GADU 4K0KF 3D0IE 1KS2A 3J81Y 2M8DB 2VPZB 2CNOB 2VC1A 4CH7A 2IPOB 2HRYA 4USWA 5ETRA 3PW7A 4FVCA 2KT5A 3BKUA 4ZPCA 4R8UB 2LYVA 4WFBQ 1EETB 1RT4B 4G1IA 4JI3F 5CYMB 4B9UA 3JXOA 2NSBA 4IDKB 1JNRB 4ALZA 2DRAA 4GKKF 3CCQS 2KT2A 2VHGA 2QA2A 2MHEA 2F7VA 3D1QA 3AODA 1L3TA 1QSSA 4RW7B 1H0HB 2XGPA 4FYYB 3WC2A 4X2BA 2HFOA 3DNCA 4DLEA 3SCIE 4O4GB 4KKOB 5DQGA 2RQ4A 4UOGA 4ZIWA 4F25A 1LWXA 1HNXJ 1VQYA 2G0JA 5GMDA 4C0BA 3PW5A 1WF0A 4ZITA 1VQMS 5LJ3Y 1GFWB 1RHKB 3JAMU 3JSMA 4Q5VA 4F2SA 2AWZA 3N5BA 2KXNB 4OX8A 1PIEA 2DNGA 1IQTA 2R8IA 2VBYA 1N34J 3M2RA 2RIJA 2GAHC 1UTAA 3E01B 3OUYB 3CF5Q 2FLLA 4K59A 3CJ3A 3LA0A 4ZKAA 2J9EA 1FD8A 3H5YA 1DFDA 3O5TB 1YRUA 1RTIA 3IR6B 4A8WA 2JJ4D 3T3FA 3MMCA 4EBCA 4P2FA 4MK7A 1RTZA 4CT9A 2WSFC 1XTZA 3HJVA 4JV5J 5HANA 5DDQC 1R0BG 2K7KA 5D15A 3GV8B 3D6TB 3P96A 2PSZA 1S1VB 2V68A 4JI8J 4QWBA 1VRUA 4V19X 3MPVA 3H8YA 1RAFB 1HWKA 1U2FA 1Q1KA 2J9DA 5J2MB 1CC7A 3W65A 2R7QA 1TKZB 2E5HA 3THTA 2RQCA 2UUWA 1C1BB 3QLHB 1IKXB 2ATLA 1IWGA 5IT9U 4IO9Q 1SJ4P 1T11A 2RQKA 5C7PA 3CJSA 2IAJB 4CYUB 4WPAA 1O0PA 4ANEA 2F9DA 1RKIA 4NMXA 1T9VA 2VDHA 2FHKA 3DM2B 1A0OB 3P5TL 4NX9A 1J5EJ 1Y4ZB 4ID8A 4ETZA 1RAJA 4YEAA 2GO8A 2OELA 4NZ0A 3VHQA 1HNXF 4XPEA 1IKVB 1U6ZA 3FZ2A 1BY9A 2CQIA 1LW0A 2CQ2A 2NSCA 4NLUA 3QSIA 3I9ZA 4OYAA 1FX4A 1NPPA 3HVRA 2GX8A 3JQMA 5EDWA 5D3GB 1DHMA 1N34F 2IBKA 2RDDA 4AYBD 1Y7PA 5LSOA 4YB7A 1TZ0A 1N6QB 3ZNUA 3PRVA 3E51A 3BM7A 3BGRA 1NK4A 1XNRJ 2KZMA 3RBXA 3QNWB 4FYWB 1MN7A 5DDRC 2MGZB 2AJFE 3BSNA 1YIJS 3IG1A 2VBWA 4F0MA 4N47A 2KT3A 3C6UA 3R5GA 2HAIA 2DISA 1UW4A 3ZXWA 2ZM6J 2XTJP 2EFNA 1PAUB 1T03A 3BDEA 4DOZA 4FYXB 2YXLA 5IFMA 4DX5A 3GJSB 2WONB 3DDKA 2HHHF 2XNQA 1VOMA 3WIUA 2Y0SD 3MEEB 2VKRA 1K73T 1NJYA 1UFKA 1PC5A 5T7LB 4NXNJ 3SSQA 1E6VB 1WHWA 3ZZRA 4ECTA 1K0TA 4I67A 3AFGA 4ZCKA 4IG3A 3CJ4A 3HZGA 2JZ5A 2IMOA 3GYGA 4ZPVR 1N56A 2UUTA 2CQPA 2NLWA 4U7CA 2YWKA 3MZIA 2DHHA 2XI2A 5IZHA 4K8RA 1N5VA 3DKDA 5HP1B 2XZWA 1SVDA 2QYCA 2OLWA 2Y0BB 2AYGA 3KLHB 1D8ZA 4W92B 5LSLA 2DH8A 2YPZA 2OSRA 3D68A 1N48A 1KNZA 3KNAA 1FWKA 3FDSA 2BJ1A 5C42A 5A76A 1R7IA 2IVYA 2R7WA 1RTJA 4DLGA 5ETLA 3DLGB 4QR2A 1VRQC 2BYCA 3OLAA 2HNZA 3OJUA 5DS7A 2C2KB 4NLQA 2W9AA 3ULHA 5ETPA 5ETSA 2KFNA 1T3OA 1U47A 5JVGQ 3OPKA 4LVOP 4DPUA 3GLJA 4CLUA 2LP4A 5HJXA 2W8LA 2YKAA 1RBAA 5L8RC 4LIRA 1VK3A 4DFPA 2VBXA 4FKYA 4F4AA 3CD7A 2Z2YB 3N9UC 2U1AA 3W5XA 1S4FA 1I5OB 4RUBA 5I3UB 5E3PA 1P27B 2DGUA 3OQ2A 2EW9A 4ED8A 4BDPA 1FDNA 3D5MA 4KC5A 3JSRA 2NZ4A 2D9OA 2E5GA 4N8NA 1CG2A 3H40A 5KFIA 3GONA 4EYIB 2ZM6F 2LMIA 2VJUA 1CVJA 4J9MA 2CUYA 3M32A 5KG0A 3I9V9 3TI0A 4QPTA 4FF4A 3FVYA 2MB0B 2ZBPA 4WYWA 5KFRA 4DCJB 5HBMB 3RB6A 4WK3A 2QRRA 4YR3A 4J9PA 1G7CB 1JJ4A 3A8IA 4OL8A 2UUAJ 3TOQA 3HKZD 2QC3A 4EFAC 3MUVP 4ELUA 3V6HA 4C6AA 2W2MP 3HO1A 2ZKTA 4XIUA 4NLVA 5A8KB 1MW7A 4XO0A 2AJ4A 1HYSA 3S1TA 3OT9A 3EWGA 3H59A 4OYMA 4LR8A 3MEGA 3GB0A 4OYZA 1S1WB 4OZJA 5G0RA 3UR0A 2MZJA 3CSKA 1XIQA 2QEXS 5ETKA 3HSDA 1FRXA 4KT0C 4RWXA 3TVKA 4RNMA 2ZJQQ 4MFBA 1GH8A 3RU0A 1WC0A 1R89A 3GE9A 2E9TA 1RWMB 5I42B 3TRGA 1P6TA 1SV5A 3DOMB 1T0TV 3LH2S 1WC5A 4DSIA 3PYFA 3KDNA 3J81U 4ZIVA 4LRAA 4USJC 1SKSA 2YNIA 4EEYA 1H38A 1QTMA 1ZAWA 2CQBA 2YKNB 5DO2A 4ZN1A 2FHJA 1TKXA 1X31C 1J5OA 2CPJA 4QIEA 3HVTA 3UDEA 4KGMA 5K8OA 3NGTA 4ZJOA 1NZ8A 3EZUA 3D6MB 2ZH9A 1MLAA 5I4MA 4RW8B 1RU1A 2H3EB 3NOCA 1UWAA 5ETNA 2CQHA 4OYBA 3MM6A 1OWXA 5KFUA 2QX0A 4U95A 3A4TA 3DLKA 1RT5A 4OQJA 1BLUA 1S6UA 4DV6J 1GX5A 2ZVIA 5GMKa 3GIIA 2A10A 2HQGA 1C0UA 4WK1A 4IKAA 5KFKA 3TVZA 1WEYA 3BO3A 5F8MA 1FXRA 3MUTP 1UA0A 2J6SA 5J2QB 2HMIA 1S0VA 2OTJS 4OJHA 4CQ1A 1QVFR 2VU5A 3B54A 3PX0A 4WXOA 4PABA 5KT7A 4M5IA 2LFVA 4IH6A 4J9QA 5B0CA 2WVDA 1D9DA 5CCLA 1ZM2A 4YY3J 4W4MA 5KG7A 4CO1A 5E3CA 2NYHA 2UUAF 1FK9B 1B7YB 2M0GB 5B0AA 3SQOP 4V1Ak 4ZHRB 1NDLA 2DNNA 1CQMA 4M5GA 2DNMA 4LBPA 1RWWB 3ET6B 1U48A 4YB1P 5G4DA 1CS4B 1NJZA 2CNKB 2FVSA 2ALYB 2MKSA 4UQTA 3PV8A 2XYPB 2CZ9A 1TL7A 2BJEA 1MROB 2PT0A 1RISA 4C3LA 4KJIA 2VF3A 1FWPA 3O8WA 3FCWA 3MXHP 3OVSA 1KD1T 2CPYA 1Y11A 1B70B 1CJKB 4Y3CA 5B7WA 3DXBA 4LR9A 1SBRA 1D8YA 5IC4B 3HSGA 3EMTA 3JTOA 1KTVA 5K8MA 1X4DA 2V0NA 4TYBA 2B9XA 1CJVB 2X1BA 1HMVB 3B82A 2HGMA 4AD6A 3GTYX 4KH1B 5F8HA 2BVZA 4DPTA 1N52B 1SC4B 1M1HA 1KQGB 4ZVUB 1S0MA 1HHQA 4EK2A 1QAIA 2EFOA 3FC9A 4ZVPB 5HLFB 5KFVA 3VAKA 2GMHA 3KWMA 2YNFA 2MMYA 3LAKA 2MQOA 2V94A 3W66A 1GT8A 1KVJA 1CJTB 3QIPA 4MIAA 4DV6F 1RYRA 1PILA 4USMA 4L73A 2E1PA 1UL3A 1F2GA 5IM0A 3IS9B 1J27A 3N6MA 1JIHA 3UDVA 4WTOB 4ECSA 2DEJA 3NCQA 2BZ2A 5F9LA 4NE9C 1TUGB 4CZCA 3E2EA 1UMJA 3MECA 1FCAA 1FKPB 1HNZJ 2EC0A 4ZLJA 4PPZA 2AMCB 3MCMA 3T19A 8AT1B 2E44A 1IQZA 1F9FA 1FJ7A 2C42A 1JLGB 1SCJB 3LP0A 5HMXA 1RAEB 2XMMA 3E3XA 1VJQA 1VLOA 4DSEA 3OXGA 1HBOB 4KTQA 2V63A 5DM7Q 4JV1A 1ZYQA 3HP6A 2AW0A 5IXUA 1BE4A 4LRFA 2B7CB 3JYTB 2B51A 4EBEA 3VGSA 3AT1B 3BO2A 2YKQA 1Z4UA 2E7WA 2W2OP 4Y2AA 1UEUA 3QT8A 2JH3A 1R6VA 1RHQB 1KWMA 2RU3A 4PQUA 3IR7B 3IBWA 4XDDA 1LWEA 1CULB 2F40A 2AU0A 2M88A 1X8DA 5KFJA 4NZ6A 1EB0A 2FUG9 3BPSP 2J9CA 1OJ4A 1YVFA 3T9ZA 3DRRA 3MM5A 1HHSA 2FVPA 2F8MA 2V9KA 5CYQA 4NASA 2HQ3A 4ZP7A 2UVVA 2CVEA 3MMAA 1NDCA 1HARA 2KB2A 2DHSA 3DRPB 2X51A 2NREA 2FIUA 2EK1A 1YZ6A 2AJQA 3KUGA 2I5JB 2N3LA 1FKOA 1IBMF 9RUBA 2FZGB 1U1LA 3R8YA 1X4HA 3A12A 4LQ9A 3OL6A 2XSJB 1UEKA 3K5NA 4K4ZA 2F9JA 3H7HB 3RR7A 3ZZZA 2J6UA 4NCGA 2BE2B 3V4MA 2YH1A 2YKPA 3PFOA 2JVOA 3P5BP 3MPUB 4K5RA 2PGCA 1BUXA 3KJFB 2QA4G 1GX6A 4UF4A 4ATNA 4OLPA 2O66A 1HW8A 3F73A 5CD4A 2KVIA 3R6LB 4ZS6A 3PZPA 2Y3YA 3LP1B 2FJEB 2KG1A 3K0JA 3CVKA 4RJVA 2H5JB 2HS0A 3R6GB 2VICA 3Q24A 2CJBA 3BBBA 1TVRA 4FF3A 2NQPA 2HFVA 2R8GA 4MIWA 1D09B 1OQ3A 3GZ7A 2FPHX 4PAAA 4HL9A 5HSPA 1U0HA 2WVBA 4HTJA 3DXSX 1UVLA 4CNZA 1UJ4A 2MQPA 2LDIA 2DXEA 4HT7A 3FKBA 2ASLA 1WWHA 4WJBA 3HT3A 4WF9Q 1TAUA 4ICLB 4P71A 2G9OA 3G6VA 4Q2LA 5I3QA 3VAMA 3HKWA 4P2MA 2HVIA 1S0NA 3TA2A 2B0GA 4B3TJ 3KG4A 4ZVFA 4F4XA 1QUVA 1Q8BA 5A2QY 2YVSA 3H2UB 3H2VE 1JLQA 1WOOA 4H54A 2R3VA 4OMFG 1HNVB 4F0HA 4LSLA 4B17A 2KYZA 1HBMB 2OD4A 5A8RB 1UJ5A 5ETOA 3VTIA 1DTTA 3VWSA 5IT0A 2VQEJ 4DSKA 1N33J 2A1BA 1XK8A 4FPRA 3FK4A 3ENVA 2CA9A 3AHPA 3CCTA 4OHVA 2UVRA 4DQQA 3DC2A 4QIFA 4CH1A 1IR0A 3DHXA 1ITPA 2G2YA 2XS5A 2NUHA 2PMZD 5K8PA 1VMBA 3MHYA 3NGKA 4JI4J 4OJ3A 2OMOA 4KQZA 7FDRA 4GKJF 4ZP6A 3DI6A 2IM1A 2RUSA 4RX6A 5BXIA 5F3TA 1S9GA 5HL7Q 2FZKB 3MM7A 4LFBJ 3MM9B 2QV6A 4EBDA 3OFGA 4LFCJ 1B3TA 1EX8A 2ZVSA 3CC2S 1NRKA 2J0WA 3M2RB 4UY85 2EFGA 4RBVA 1TKTB 2WVFA 4QU6A 3M8RA 1S6PA 3PW2A 3M7VA 3Q8UA 1S72S 4MK8A 5FDLB 4EYHB 2DD8S 4I2QA 4F36A 5ADZA 3CNQP 1F9HA 1RWPB 4FVMA 2W7OA 3EGZA 3NLCA 1S1XB 1TL3A 2RD5C 3LF0A 3PY8A 1H2UX 1YBTA 4M5LA 4LR7A 2UP1A 5F3ZA 3P45B 4URQU 5KG3A 1AT1B 4JI2F 1VQLS 2J7UA 3DCAA 4MMOA 5IS2A 1U6BA 4K4VA 3ENWA 3TYTA 2BJ3A 2PI5A 4F4WA 1RK8A 4C8YA 4Z37A 4CLFA 2AYMA 1GXTA 1H72C 4DBQA 1FDBA 3LP2B 4OX7A 3L7UA 3IRXB 3S6EA 5C5JA 3J7YU 3V6JA 1X9WA 4X4PA 5E41A 1V3ZA 4P7TA 3ICLA 2UV8A 3TZYA 2JOQA 5JVHQ 2MZTA 2M3DA 5CD4H 4URGA 3UNYA 4HT5A 3MOJB 3R9LA 2E1RA 2AEFA 3L4BC 3A8EA 2VQEF 1AZSB 1N33F 4M5JA 4KPCA 3NCPA 2NR0A 5K14A 2NXUA 4ZVGA 3M8ZA 2F8EX 2O5DA 2Z58B 3MEDA 1XQIA 3TX8A 4PXBA 2A0FB 1H3DA 4WKYA 4JI4F 4IFYB 4DL4A 1M5PC 1YJVA 1Q0NA 3M8YA 2XY6A 2PI4A 3J80Y 3PJWA 2IVMA 1DARA 3DMJB 4BBYA 4HYKA 3GCXP 1AXQA 1JKHB 1PAEX 3GJTB 1JJ2R 2DJWA 4PXCA 3AB4B 1T94A 2HHQA 2ZEJA 4KGKA 1Y3KA 1H7WA 5AJ3F 2VJVA 3QATA 2J0QD 1LWFA 2NYIA 1LV5A 1FO1A 2QIFA 1CPZA 3BSOA 2XMUA 1XMQJ 2CQ3A 3SEOA 1BGXT 3D54A 2MKCA 4DG1B 1HPZA 3UFCX 1JB0C 4X62J 5A6PA 3AH6A 5BYQA 1QVGR 2EVZA 2K7JA 1NSQA 2B6AB 2WW8A 4TLRA 1AW0A 5E3QA 4FKXA 4C48A 1VQ5S 3M6XA 5CZXA 3U7JA 5DQHA 3PO5A 2RHQB 3NEKA 3NNAA 4O3NA 2DR6A 3O6QA 5L1IA 4YHHJ 1OPZA 2DGQA 3QO9B 4ZVTB 3D6FB 2CPZA 2H48B 4QW9A 2M7SA 2FQQB 3T5KA 1JLCA 2DTJA 4TY8A 3BB5A 1F6TA 4HH1A 1DZ5A 4PG6A 2PIIA 2UUBF 1U8WA 4Q0BB 1DJ0A 4C11A 1T9WA 4I1TA 4F4YA 4R0EA 3RG6A 1PKUA 4BCAA 1S1UA 1YJUA 3CTRA 1IVZA 3BSAA 4NRUA 1KQFB 2GC8A 1C1CA 2LXUA 2C2OB 4DUYF 2XYHB 5C42B 5J2PA 2ZE2A 3MMBB 3KMSA 4W98A 1SJRA 1EP4A 1WC1A 1TP7A 2BQRA 3OTDA 1S4EA 2HNZB 1TR0A 1K44A 1NDKA 3CDAA 2H54B 1WDTA 3K7RA 1Z2LA 2FYXA 3PM9A 1FDDA 5L1JA 3BR8A 1D3WA 2ASYA 3BYPA 3S01A 3UO0A 5D0EA 1IKWA 1T05B 3I32A 1XWLA 5LMNJ 3MGJA 4MAKA 1HWUA 3HJFA 2VZ9A 2J0XA 3TR5A 4CTAA 4USUA 1LFWA 1YSJA 4OI3A 3FCVA 3OVAA
chains in the Genus database with same CATH topology
4ANEA 1S5ZA 4DUTA 3EE3A 3EJMA 4KPCA 3BH6B 5IOLA 1BHNA 1NDCA 4ENOA 2HURA 2AZ1A 2CWKA 1JXVA 1NSQA 3GP9A 1XQIA 3JS9A 1NUEA 4UOFA 2HVDA 3VGVA 1NSPA 3B6BA 2BX6A 4UOHA 4W98A 2DXDA 4FKXA 3FBCA 3NGTA 1HHQA 3ENAA 1UCNA 2BEFA 3PJ9A 1HIYA 4DI6A 4EK2A 1EHWA 1VYAA 3FBBA 3FC9A 3ZTRA 3VGUA 1NDLA 1K44A 1NDKA 4WBFA 1NHKL 3ELHA 1WKKA 3EM1A 3EVWA 2DXFA 2DXEA 1BE4A 1WKJA 3EVMA 2NCKL 4C6AA 1S59A 1S57A 3EICA 3FKBA 1B99A 2HVEA 4ANDA 1NDPA 1ZS6A 3NGSA 4ANCA 4UOGA 1KDNA 5BXIA 1NPKA 1W7WA 1LWXA 3Q83A 3FBFA 3VGSA 1NB2A 3L7UA 4DZ6A 4S0MA 3VGTA 3WX8A 1PAEX 2ZUAA 2AZ3A 3NGUA 3Q8YA 3ZTQA 1HLWA 3MPDA 3VVUA 4FKYA 1NSKL 1B4SA 2DYAA 4F4AA 3BBFA 5CAAA 3Q8VA 2B8PA 3GPAA 1XIQA 3PRVA 2DY9A 3FCWA 1F3FA 1BUXA 3NGRA 1F6TA 1WKLA 3EVOA 1NLKL 3G2XA 4CP5A 4O0NA 3ZTOA 3Q8UA 3R9LA 1MN9A 1U8WA 3BBCA 5CABA 2B8QA 3DKDA 3FBEA 4F36A 1NCLA 1MN7A 3ZTSA 4HR2A 1LEOA 5C7PA 3ETMA 1PKUA 3EMTA 3ZTPA 3Q89A 2VU5A 3BH7B 3DDIA 3FCVA 3Q86A 3VVTA 3B54A 3BBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANE A;  1S5Z A;  4DUT A;  3EE3 A;  3EJM A;  4KPC A;  3BH6 B;  5IOL A;  1BHN A;  1NDC A;  4ENO A;  2HUR A;  2AZ1 A;  2CWK A;  1JXV A;  1NSQ A;  3GP9 A;  1XQI A;  3JS9 A;  1NUE A;  4UOF A;  2HVD A;  3VGV A;  1NSP A;  3B6B A;  2BX6 A;  4UOH A;  4W98 A;  2DXD A;  4FKX A;  3FBC A;  3NGT A;  1HHQ A;  3ENA A;  1UCN A;  2BEF A;  3PJ9 A;  1HIY A;  4DI6 A;  4EK2 A;  1EHW A;  1VYA A;  3FBB A;  3FC9 A;  3ZTR A;  3VGU A;  1NDL A;  1K44 A;  1NDK A;  4WBF A;  1NHK L;  3ELH A;  1WKK A;  3EM1 A;  3EVW A;  2DXF A;  2DXE A;  1BE4 A;  1WKJ A;  3EVM A;  2NCK L;  4C6A A;  1S59 A;  1S57 A;  3EIC A;  3FKB A;  1B99 A;  2HVE A;  4AND A;  1NDP A;  1ZS6 A;  3NGS A;  4ANC A;  4UOG A;  1KDN A;  5BXI A;  1NPK A;  1W7W A;  1LWX A;  3Q83 A;  3FBF A;  3VGS A;  1NB2 A;  3L7U A;  4DZ6 A;  4S0M A;  3VGT A;  3WX8 A;  1PAE X;  2ZUA A;  2AZ3 A;  3NGU A;  3Q8Y A;  3ZTQ A;  1HLW A;  3MPD A;  3VVU A;  4FKY A;  1NSK L;  1B4S A;  2DYA A;  4F4A A;  3BBF A;  5CAA A;  3Q8V A;  2B8P A;  3GPA A;  1XIQ A;  3PRV A;  2DY9 A;  3FCW A;  1F3F A;  1BUX A;  3NGR A;  1F6T A;  1WKL A;  3EVO A;  1NLK L;  3G2X A;  4CP5 A;  4O0N A;  3ZTO A;  3Q8U A;  3R9L A;  1MN9 A;  1U8W A;  3BBC A;  5CAB A;  2B8Q A;  3DKD A;  3FBE A;  4F36 A;  1NCL A;  1MN7 A;  3ZTS A;  4HR2 A;  1LEO A;  5C7P A;  3ETM A;  1PKU A;  3EMT A;  3ZTP A;  3Q89 A;  2VU5 A;  3BH7 B;  3DDI A;  3FCV A;  3Q86 A;  3VVT A;  3B54 A;  3BBB A; 
#chains in the Genus database with same CATH topology
 3VQS A;  4F4Z A;  1XN9 A;  3C15 B;  2J8A A;  3H2L A;  4H4M A;  2BRK A;  4OZ1 A;  2HFZ A;  9ATC B;  4IFV B;  3WZ0 A;  3LUY A;  3ITH A;  2VG7 B;  4F04 B;  4DR1 J;  1JJC B;  2ZKU A;  4WII A;  4BWJ A;  2W9B B;  1V3R A;  1OY6 A;  2KH9 A;  3KJN B;  1T8E A;  4LJM A;  3KHG A;  2ASJ A;  1GK8 A;  3KG0 A;  1IXK A;  2QJ3 A;  2XQC A;  1XNQ J;  4J9V A;  2M52 A;  3QSY B;  4TQR A;  2PDA A;  5CAA A;  5G0R B;  2CQ0 A;  1N0V C;  3GG1 A;  3S7R A;  2GHP A;  2V6A A;  4KHP J;  1VC6 A;  2O3D A;  2JEG A;  2HIQ A;  3EVO A;  1K47 A;  3PFE A;  3W5Z A;  4MFB B;  4KR0 B;  4TU7 A;  3SDE A;  2C3Y A;  4K2X A;  5HQ8 A;  2JLF A;  1RTD A;  1HD1 A;  4ED3 A;  1WTB A;  4U8Y A;  5A2Q U;  1S6Q A;  4CI0 B;  2I8E A;  2N7C A;  1NND A;  1RQ0 A;  3PX4 A;  1RAI B;  3EXY A;  1KKH A;  1FEE A;  1B0V A;  1KN6 A;  3A3P B;  2HHX A;  4X66 J;  3CCE S;  2XYG B;  2GW8 A;  4DFK A;  1RAC B;  3ELH A;  4DXL A;  3EGN A;  2CAD A;  1PSD A;  4QWA A;  2H65 B;  2R7U A;  3R7B B;  2NXJ A;  3ZZU A;  3HF5 A;  4U96 A;  3MM6 B;  4C98 A;  2L08 A;  3OLB A;  4ED2 A;  4A4J A;  2VD3 A;  2E29 A;  3CW2 C;  1RT5 B;  5IV4 A;  2Q6C A;  1XJW B;  2OFH X;  4IG0 A;  5K8N A;  2IIH A;  2FVC A;  2LQ5 A;  3KLE A;  1H6K X;  3JQK A;  4HTI A;  3AJD A;  1RXO B;  2OEJ A;  3JSY A;  2N3O A;  1ELO A;  5HRO B;  2ZOG A;  2QFJ A;  3M30 A;  1P8G A;  2HMI B;  3DLH A;  1I94 J;  2NZC A;  1FE0 A;  2FLO A;  3M6V A;  4DV1 J;  1RI7 A;  3LPE A;  2HND A;  2MTL A;  2AQ4 A;  2YQ0 A;  4DV5 J;  4DR1 F;  1JX4 A;  1FJG J;  4PXE A;  2AJ1 A;  3TZX A;  1XEZ A;  4NYP A;  4DEZ A;  2H1Y A;  4HI2 A;  4WBF A;  2NXE A;  5E33 A;  2COL A;  4L75 A;  4RUA A;  3RJM B;  1XNQ F;  4QJV A;  3Q8R B;  2JC1 A;  1ZA1 B;  4GVL A;  3VAJ A;  2KHC A;  5KFZ A;  2NS1 B;  3ZNJ 1;  2RDJ A;  1LXJ A;  2BJD A;  4WFY A;  2HHU A;  2CIM A;  2W25 A;  1UEV A;  4KHP F;  1UWB A;  2B4O A;  3KHL A;  2YKM A;  1RAH B;  2IYI A;  3R5A A;  2CPE A;  1S48 A;  2R7T A;  3MR2 A;  1MN9 A;  3FMB A;  1M5H A;  4Z7Y A;  2B9E A;  1QAJ A;  3I5C A;  4DL3 A;  2IA0 A;  2IHR 1;  2WB4 A;  5D0H A;  1T9X A;  5GME A;  2KRR A;  1QDU B;  3N0V A;  1G2E A;  1QD1 A;  3M2V B;  2YQ3 A;  4USH A;  1N0U A;  2HS4 A;  4C0H A;  1M5K C;  3M8P A;  1BHN A;  4ENO A;  3W8G A;  3RUB L;  2DIU A;  1NXI A;  1VQS A;  3NCR A;  3CMA S;  4X66 F;  4JI0 J;  4OZ0 A;  4P75 A;  3BV8 A;  4DUZ J;  2ZH6 A;  2OPR A;  5KFF A;  3KK2 A;  3T6J A;  4Y28 C;  1B64 A;  1Y5N B;  4M63 A;  1IKY B;  4KIA A;  2YNF B;  2JSX A;  1VBX A;  2IYG A;  3MTJ A;  3NRB A;  3WX8 A;  1N5Q A;  1RT7 B;  4WCE Q;  1U09 A;  1TU0 B;  4AUK A;  1VS3 A;  4ZDN A;  2L9N A;  4NI2 B;  1HWI A;  4OX9 J;  2DB1 A;  4DR5 J;  3SIP B;  4ZOS A;  2FLP A;  5IM0 B;  4LF6 F;  4UTG A;  2C3M A;  4EZ9 A;  4X84 A;  2NPF A;  3AAW B;  2DCU B;  3KDO A;  1HWL A;  3G86 A;  1OMS A;  4I7F A;  1TV6 A;  3C66 A;  1I94 F;  2DY1 A;  2HAF A;  3A3O B;  2A2D A;  1VQ8 S;  3DGP B;  4ILL A;  4DV5 F;  4X64 J;  4DFJ A;  2HUR A;  1ZPW X;  2KN4 A;  1FJG F;  1SUQ A;  5GAD I;  4OYO A;  5AE2 A;  1U2R A;  2ZH8 A;  2BX6 A;  2M9K A;  3MOZ A;  2FHM A;  3TJA A;  1WOP A;  1A9N B;  3MD1 A;  1WHV A;  1XMO J;  4DFM A;  3TW0 A;  3SQG A;  2VG5 A;  4NPO A;  1P1L A;  3DRS A;  2CDQ A;  3PRB A;  2DHX A;  5FLX Y;  1VDH A;  2V8V A;  3CXC R;  1F5A A;  1OQ6 A;  3P3D A;  1LNQ A;  2QL7 B;  3MUM P;  1AUD A;  2IM3 A;  2DIT A;  1HLW A;  3K58 A;  2HQD A;  2JEI A;  3NG8 A;  2JDJ A;  4DR7 J;  3MR7 A;  2UXC J;  2B9Y A;  2ZDP A;  1LWE B;  3NAH A;  3NGR A;  4V19 J;  1R8H A;  5KFT A;  4I2P B;  2KG0 A;  2HWT A;  2DNH A;  4Q8F A;  4A47 A;  2ZWP A;  4WTY A;  2ZH1 A;  4OHY A;  2AIR B;  3QRR A;  4LBI A;  1NZA A;  3ISN D;  1VR6 A;  1ZM4 A;  1VIO A;  2O01 C;  4RLE A;  1FER A;  2PD1 A;  3U1L A;  3CMQ A;  3PHT A;  2D41 A;  1MWQ A;  4DUZ F;  4UOH A;  5SUH A;  4L3N A;  2R7X A;  4FF2 A;  2DGO A;  1FKO B;  2VON A;  3P49 B;  4Q8E A;  2H51 B;  2YWG A;  4E2F B;  5J2N B;  1KC8 T;  2KJW A;  4I69 A;  4NRT A;  5AE3 A;  1KRP A;  4I0W A;  3QJP A;  2C3O A;  4QYR A;  2DPJ A;  2RF2 B;  2ZD1 A;  3TP2 A;  4M94 A;  4OI1 A;  4ED6 A;  5CCM A;  1NK5 A;  2P6S A;  4WP9 A;  3BDP A;  3QJL A;  3HLU A;  3LPY A;  4F3M A;  2R7S A;  2DGS A;  2X3D A;  2X3G A;  2KFY A;  4B9V A;  3M1V A;  5A0Y A;  2J6T A;  2E9Z A;  1HNI A;  4RR5 A;  4O44 A;  1FVQ A;  1WSR A;  2Z4P A;  2HWI A;  2FY1 A;  2JVR A;  4BHQ A;  2KXH A;  1TVR B;  1OYD A;  1HQE A;  4MH8 A;  2YNH B;  5IT4 A;  2QYG A;  3DRX A;  3D9B A;  2CWK A;  2XLJ A;  4K2J A;  4CLK A;  4IQX A;  3W62 A;  4QPX A;  1SPB P;  3POT A;  4FP9 A;  3BEG B;  3OFH A;  5BJR A;  4NLO A;  2V5H G;  2MKH A;  3NMR A;  1UCN A;  2PEB A;  2MST A;  2BW2 A;  1HNW J;  1FFS B;  3ISN C;  1M5O C;  1F60 B;  1K1S A;  2P9E A;  4K50 A;  5JXS A;  1R31 A;  2Z2L A;  2QMX A;  1TL1 A;  4ECZ A;  3LQV A;  2RSQ A;  4C8L A;  3OFF A;  1NH7 A;  2UXC F;  1HQU A;  2QLX A;  2IRX A;  1S49 A;  1U7L A;  1IBK J;  1WJ9 A;  5L9N A;  1DTQ A;  1WKL A;  1T3N A;  1RB0 A;  2HG4 A;  2Q66 A;  2HBZ B;  1XC9 A;  4LSL B;  4F3O A;  4B3S J;  4UZB A;  3M2U A;  1C0T B;  3HSJ A;  2YWW A;  2IM0 A;  1NEE A;  3QGG A;  4Q7A A;  2YQ1 A;  4QIG A;  2W4C A;  5ETM A;  4DMZ A;  2AYE A;  1SQF A;  3SCJ E;  3RBE A;  4PUO B;  3MAA A;  4K4Y A;  1VBZ A;  4U6P A;  2X7I A;  1RWU A;  3FUY A;  2AKW B;  3MEK A;  4ED5 A;  5L1K A;  2PC6 A;  2Z56 B;  3J7Z 5;  5DQI A;  2HLT A;  4C9D A;  3FGV A;  1LOU A;  4MJK A;  3CB4 A;  2YY3 A;  2QLF B;  2G0C A;  2R9L A;  2PFF B;  3NNC A;  2J76 E;  2UV8 G;  2XMA A;  3OL7 A;  4I56 A;  2DYA A;  3LGH A;  1JK9 B;  3QFH A;  3A8K A;  5FII A;  2WBM A;  3UE2 A;  4KBI A;  2I9S A;  2Y1L B;  4JI3 J;  2HYI B;  1X4G A;  4YQW A;  5EN1 A;  1S6P B;  1VQ6 S;  3SFG A;  3P6Y C;  4KHM A;  3ZTP A;  3WX4 A;  1QSY A;  2HK2 A;  2KRB A;  1IJF B;  1VFJ A;  1YJ7 A;  3PCO B;  1URN A;  2HHV A;  5KFH A;  2W4P A;  2LKZ A;  5AXN A;  1EET A;  2DT9 A;  3F41 A;  3T5L A;  2V69 A;  4R5P B;  5KOX A;  5CYM A;  1HNW F;  4IH5 A;  1CSJ A;  1BD6 A;  3UVJ B;  4EMD A;  5EX3 A;  3GIM A;  1YJW S;  3OHA A;  1XBW A;  1GXL A;  3KLG B;  4AND A;  1B99 A;  3HUL A;  4O3P A;  3TEG A;  1KFS A;  4Y2M A;  2YNG B;  4FN5 A;  1NB2 A;  2V34 A;  3CCR S;  1W26 A;  3Q8Y A;  4O4G A;  3BGF A;  2F63 A;  2Y1J A;  3AD7 C;  3N79 A;  3I56 S;  1DY3 A;  3N28 A;  4KAI A;  3C16 A;  1U1M A;  4KY3 A;  2W1B A;  4ECQ A;  1DQ8 A;  1QTN B;  2ABY A;  4PG4 A;  4QCL A;  4MYT A;  2ROP A;  2RKI B;  4O0N A;  3BBC A;  2RAQ A;  4B3S F;  3PRD A;  1OY9 A;  2GIQ A;  3C19 A;  5KFQ A;  2ZOF A;  5L9X A;  3W3S A;  2GVZ B;  5M2P A;  1UJ6 A;  1R43 A;  3QRQ A;  5THW A;  1L3U A;  4Q2M A;  1X5T A;  1LQ9 A;  3IO1 A;  3E01 A;  3OUY A;  3NS5 A;  1G1X A;  2ATC B;  4C3K A;  4MT1 A;  2IJR A;  5AT1 B;  5K14 B;  2AZ1 A;  4X4T A;  1R3N A;  2ROG A;  7AT1 B;  4RUC A;  2QA4 S;  1BC6 A;  2W01 A;  2A6O A;  2J0S D;  2HIY A;  1RYS A;  1KLM A;  3LGN A;  2VOD A;  2R7O A;  1HD0 A;  3JSB A;  3M05 A;  3CDU A;  1I1G A;  2JC0 A;  2R7V A;  2GVD B;  1F5C A;  3THV A;  3NGS A;  1W7W A;  3V4I B;  2EFP A;  5HQL A;  3Q22 A;  4Q43 A;  4EZ6 A;  2ZHB A;  1A7G E;  4QR1 A;  1NU4 A;  1WHY A;  4WFN Q;  4CO2 A;  3KTQ A;  4HDH A;  3TWZ A;  4D3H A;  1RAG B;  3K57 A;  1S1V A;  4LF7 J;  1LW2 B;  4Q44 A;  1L3S A;  1AUS L;  4F2R A;  1SQG A;  4X4V A;  1SIZ A;  2UU9 J;  3HD2 A;  2B8Q A;  3R5C A;  3GFX A;  4PQA A;  4HH0 A;  2BUN A;  2E7V A;  1M0S A;  4EU0 A;  1VRT B;  2JRS A;  1SJ3 P;  3Q86 A;  4ECR A;  1C1B A;  3QLH A;  1IKX A;  1WI6 A;  4JI5 J;  5ETV A;  2RVJ A;  4RW4 B;  4CIO A;  4KYZ A;  3TNV A;  4X4O A;  2IFX A;  3BRE A;  2AEJ A;  2B4V A;  4KV8 B;  2OPQ B;  1DLO B;  4M1K A;  2C1E B;  1VJW A;  1IWA A;  3DOK B;  2YPY A;  2GGP A;  5DGA A;  5KOW A;  1Q4R A;  5D4O A;  5EHH A;  2GHW A;  2PA3 A;  1UET A;  2ZNZ A;  5IWA J;  1BQM A;  2R8K A;  2YTC A;  3DHW C;  1Q78 A;  4YB5 A;  3VZI A;  4G1P A;  1FFW B;  4N76 A;  6FDR A;  2Z30 B;  3PW0 A;  1F5B A;  1KP6 A;  5F8I A;  3V81 B;  3RW6 A;  4TY8 B;  5FLX U;  1SQE A;  3TQE A;  2MJN A;  3ONQ A;  4LF9 F;  2GO9 A;  3IMQ J;  4RNF A;  2V8G A;  3IAM 9;  3K5P A;  5D3G A;  3FZB A;  3T5H A;  1RWK B;  1N6Q A;  4ECU A;  5M2U A;  3KHR A;  4N7T A;  1O51 A;  3EJM A;  1OS5 A;  3BR9 A;  3KUE A;  3BKT A;  4UT4 A;  3V6D B;  1TMM A;  3CD0 A;  3RAQ A;  2NXC A;  2E1A A;  5GAG U;  2BQ3 A;  2MGZ A;  2C2Z B;  1JLB B;  1NSA A;  3VGV A;  2HHH J;  3M8S A;  3HD1 A;  2GIR A;  2H5E A;  3TAM B;  3VAF A;  5LT5 A;  2DXF A;  4L76 A;  1Q7Y T;  4NEY A;  4C97 A;  2IRY A;  2K1R A;  3K5L A;  3T6B A;  3Q83 A;  4LSZ B;  2JFK A;  3AOA A;  2VG6 B;  3QAU A;  4CLT A;  2L41 A;  2YKO A;  1HA1 A;  3KFW X;  4FBU A;  3MEE A;  4LF7 F;  5DG9 A;  4ZPA A;  1YJ9 S;  4A8F A;  1VQ9 S;  2UU9 F;  3QWP A;  5T7L A;  2AJ0 A;  3GFY A;  4M5D B;  2CZV C;  2ERR A;  2AEM A;  2FLN A;  1R8A A;  1SH3 A;  1X4F A;  1Y9O A;  4ZK7 M;  3OD2 A;  3CDE A;  4CRJ A;  3W9I A;  3K8W A;  2GML A;  4JI5 F;  4GC6 A;  2GIF A;  1TFW A;  1JWW A;  4RBU A;  1S9E B;  3X3U A;  3TVY A;  4ZLP A;  3JQJ A;  1SKR A;  4LRE A;  5HP1 A;  1VBK A;  1WOS A;  5H9E K;  1L3V A;  1PBA A;  3KLH A;  1N5Y B;  1VK8 A;  1SKW A;  3QFW A;  2DBB A;  5C25 A;  4N5S A;  5U47 A;  5F8L A;  1D0E A;  5IWA F;  2XBP A;  5GAE U;  2RRB A;  5DDP C;  2SXL A;  1RAA B;  3DLG A;  4CDI A;  5KFE A;  2ZUA A;  5KFP A;  4QOT A;  1RE1 B;  4ZPT R;  1Q5V A;  5D8H B;  3F56 A;  3CJK B;  4DS5 A;  2BE9 B;  4DL0 C;  1X5S A;  3C14 B;  4Y34 A;  3PR5 B;  4ZVS B;  1FKA F;  2CPH A;  3ZC4 A;  2A2C A;  2HLU A;  1U0S A;  4MKA A;  1NLK L;  4DR2 F;  1MSW D;  1R0C B;  5K5M A;  5K9F A;  4OHZ A;  4IYQ A;  3PDN A;  3CED A;  2VC0 A;  2GV1 A;  2HNY B;  2W2P P;  1RTD B;  1WG4 A;  2W9C B;  3F0N A;  4ZMM A;  5I3U A;  1GEH A;  5D0R A;  3M9N B;  2F3J A;  3SMZ A;  1S5Z A;  4DPY A;  3C3L A;  2VQF J;  1FTC A;  1T7P A;  4ECV A;  1H74 A;  4WP3 A;  4P2S A;  3OSN A;  4XTT A;  2CDR B;  2GQQ A;  3HFV A;  4CO0 A;  3K89 A;  2BDP A;  4LF8 F;  3DLE B;  4DL6 A;  3W61 A;  1HBN B;  2Z57 B;  1UW9 A;  5J1E B;  2J8S A;  3VAI A;  1ZS6 A;  4E0D A;  5HBM A;  5BYS A;  1WEX A;  4JOU A;  3MR5 A;  2QGF B;  1RAO A;  1XR7 A;  3A13 A;  4HAC B;  3QMQ A;  4AE5 A;  1ZET A;  4DR6 J;  4WFX A;  4IG0 B;  3UWT A;  4N8O A;  1HL6 A;  2CQC A;  3KLE B;  3FSY A;  4YUD A;  3ZTO A;  1O8B A;  2D69 A;  2ZBC A;  4YS2 A;  2MQM A;  4LSN B;  5H9F K;  4P74 A;  5F8N A;  1RCO B;  1BXN A;  4RW6 A;  3OR1 B;  2L3M A;  1Q5Y A;  4K5S A;  4RNO A;  5LMU J;  1KVI A;  4M5H A;  2HBQ B;  3ILL A;  4HHU A;  3DOM A;  4NML A;  2VH7 A;  3CDB A;  1Q8L A;  2CPI A;  4C8O A;  3EGW B;  4PKD B;  4B3O A;  5LXR A;  2OKQ A;  4NLY A;  2DR7 A;  2YKN A;  1EQ0 A;  2B4P A;  3SSR A;  1N32 J;  5HAT A;  3Q2S C;  1S59 A;  2VKZ G;  1FRI A;  4QWE A;  3UD3 P;  3FBF A;  1E6Y A;  4DX8 H;  1U1N A;  2RJZ A;  4OZ5 A;  1WHX A;  3ZZP A;  4OI0 A;  1YWX A;  3SV3 A;  1U4B A;  4F4K A;  4JI7 F;  3DN9 A;  2EFV A;  4MKY A;  1FA0 A;  2GNK A;  2YKM B;  3PIP Q;  4QYZ K;  5JUM A;  2VFT A;  2PEH A;  1S99 A;  3QT7 A;  4NOH A;  3V2U C;  2PMW A;  5A8W B;  4F50 A;  2QZ8 A;  1LEO A;  3I0R B;  2BAC A;  1XR6 A;  1XMB A;  2VQF F;  4AT1 B;  3WDO A;  3I0S B;  3P4U B;  4NA1 A;  1VQO S;  1REV B;  2QO3 A;  5EGY A;  2QE5 A;  2J7W A;  4R0J A;  3M8P B;  2EPI A;  1SI9 A;  1NUE A;  2RNE A;  3AY0 A;  1PO6 A;  5J2Q A;  2RQM A;  1NK8 A;  1SC1 B;  5CH7 B;  4C0O C;  3M9O B;  1EKS A;  2DNL A;  2B3T B;  2POK A;  4D3G A;  4DV3 J;  3AA9 A;  3HX9 A;  4ID5 B;  2OHD A;  1WF1 A;  2BQU A;  4YB6 A;  2K3K A;  4H4K C;  3BQ1 A;  1FK9 A;  1AFJ A;  4DV2 F;  1ZTT A;  4RO0 A;  1WG5 A;  2HZC A;  4DR6 F;  1RT1 B;  4F3Q A;  4B9M A;  4WZQ A;  3DU5 A;  3ET6 A;  3CIZ A;  3W2W A;  2J5A A;  4ZCI A;  3OR2 B;  1CS4 A;  3J81 j;  2UVW A;  3H5X A;  2Z8Q A;  5LSR A;  4I7F B;  4YN3 B;  4WWS A;  2OAU A;  3J7A N;  1MRO A;  2R7R A;  3EUN A;  3KYL A;  3R3T A;  5LMU F;  3AB2 B;  1CJK A;  1KLN A;  4OZL A;  1QE1 B;  3PAC A;  2PO4 A;  3JS9 A;  2JX2 A;  2GS8 A;  3LAL A;  2WRM A;  2F8H A;  4M95 A;  1N32 F;  3VGU A;  4DSJ A;  1HMV A;  3SQG B;  1ROF A;  2FC9 A;  4J9K A;  3BGO P;  2NCK L;  4RL1 A;  3BYR A;  1RWV B;  1X9S A;  2MZ1 A;  4IR9 A;  2LEB A;  3BKF A;  2LDY A;  2V2Z A;  2R2T A;  1IJE B;  4RU9 A;  5HLF A;  3K5O A;  1RDR A;  1ZBT A;  1LFP A;  1EJ7 L;  1FX2 A;  4ZPB A;  3OBI A;  2J9D E;  1O6X A;  1CJT A;  1NJW A;  2V8D A;  2G2Z A;  3AOC A;  4DHV A;  2YX7 A;  5HK4 A;  1HHT P;  2CJX B;  2Y8Y A;  1FNM A;  3G6X A;  4ECW A;  1SB6 A;  3CJ0 A;  3IS9 A;  2JWN A;  2E1M C;  2VB6 A;  1N5T A;  1FKP A;  4B9S A;  1T02 A;  3D3B J;  1P9Y A;  4DV3 F;  1JLG A;  3IGN A;  4RPF A;  1YX2 A;  3C6T B;  3LWM A;  3MF5 A;  2V2V A;  4DSF A;  1HBO A;  1NPR A;  1Y0H A;  4BWM A;  1I3O B;  1SL2 A;  2HS3 A;  3JYT A;  4CLL A;  2ZC4 A;  2ZZM A;  3L95 X;  3VCD A;  2BJ7 A;  1WOR A;  4IOB A;  4OZ2 A;  3UCZ P;  1OSC A;  3HHL B;  4MIB A;  5EWE A;  1RT3 A;  5D77 A;  1RHR B;  3M1V B;  1RLD A;  4YR2 A;  4MTP A;  3HCX A;  4CLY A;  5B08 A;  2MDA A;  1CUL A;  2HGL A;  2B43 A;  4O44 B;  3LW5 C;  2RML A;  1WEZ A;  1FEH A;  3J7Y I;  7FD1 A;  1SXL A;  2Q1L A;  4IOC Q;  1IBM J;  2APO A;  3KK1 A;  3QZ8 A;  2DNP A;  1MWY A;  1MU2 B;  4H4O A;  5DRK A;  4N56 A;  3KLV A;  4PEO A;  4QQB A;  2ZH4 A;  2VBZ A;  4NLS A;  4ZPW R;  3EGV A;  2E9R X;  3RBD A;  2BW7 A;  3EM1 A;  2EKN A;  1GXU A;  3US5 A;  4J7C A;  4GO7 X;  5DGB A;  3K8V A;  2HVE A;  2JFD A;  4DX7 A;  2ZJR Q;  1Z2Z A;  2I5J A;  1U25 A;  5E7O B;  1NAQ A;  3CJQ A;  4ZVR B;  3ZTQ A;  5AXM A;  3KLI B;  3D6H B;  4ZLL A;  1DBD A;  1RGV A;  2IC3 B;  1RAB B;  1GQE A;  1RT6 B;  4OZ3 A;  5K20 B;  3UW1 A;  4P9S A;  2KHD A;  1KHW A;  1CC8 A;  3FFI B;  2XSJ A;  3BO4 A;  2IA6 A;  2U2F A;  3SYZ A;  4ETX A;  2DGW A;  2I6W A;  1LK5 A;  3Q2T C;  2ZFH A;  3R2C J;  3PKM A;  3EX7 B;  2BE2 A;  1VHF A;  3PG9 A;  1NHU A;  3Q8P B;  3Q89 A;  2FJW A;  4WKR A;  2YH0 A;  3KK3 A;  1S1T B;  4HI1 A;  3UDL A;  4PYA A;  2LQJ A;  2BXJ A;  3MAA B;  3AXM A;  1HFE L;  2BM0 A;  2BKP A;  2DNY A;  2XO6 A;  3BF4 A;  2WW4 A;  5KFG A;  2WVC A;  1WF2 A;  2Y9H A;  2OPS B;  4RKU C;  4OFZ A;  3NBP B;  4A8Y A;  3TO8 A;  2Y1I A;  1R8B A;  3G71 S;  3CC4 S;  4ED7 A;  4X4Q A;  4Y2C A;  2H4Y B;  4O3O A;  1S0O A;  1GMW A;  1RT2 A;  5EWG A;  1KOO A;  3FMW A;  1B4S A;  2I1R A;  3PJX A;  4JI1 J;  1H2T Z;  5L38 A;  4DN0 A;  1ZH5 A;  3NY0 A;  4U7U K;  4ICL A;  1Q95 G;  2AX1 A;  3H25 A;  3TA0 A;  2BV3 A;  5FD1 A;  2QLW A;  4K4X A;  1KBR A;  4LF5 J;  3ILO A;  1N4L A;  3FBE A;  3TUJ C;  2WOM B;  2XNR A;  4X4S A;  2XUL A;  5HVG A;  2EBG A;  1KSP A;  3G8S A;  3FRY A;  5HMY A;  3AD8 C;  1UFL A;  4OI2 A;  2HQI A;  3M8W A;  5DG8 A;  4B3M J;  4DL2 A;  4DPO A;  4NA2 A;  2VOP A;  3HPO A;  4ZVE A;  1HNV A;  4J5O A;  2ACM A;  4PG5 A;  1HBM A;  4L74 A;  2FJA B;  2UUC J;  2A6M A;  5A8R A;  1G6B A;  1N88 A;  3I5A A;  3DOL B;  4KHR A;  2BOP A;  4GKJ J;  4NLP A;  2MEW A;  3H90 A;  1PC4 A;  4O3R A;  4ZN3 A;  5HQM A;  1NHK L;  2QLB B;  3MR3 A;  2MZS A;  2VFS A;  2MPU A;  1FXD A;  3G9C A;  2B9W A;  1OYE A;  2ZZT A;  1EIY B;  3MM8 B;  1Y5L B;  5KFS A;  1IBC B;  3UD5 A;  1NKC A;  3MR6 A;  2EXU A;  5EX0 A;  3I82 A;  2Q79 A;  1Q86 T;  1FVS A;  2FJB B;  4Y65 A;  1HWJ A;  4PWD B;  3C16 B;  2OEM A;  2B8P A;  3MCS A;  3GPA A;  1IR1 A;  5KT6 A;  2HZA A;  4I6A A;  3RZA A;  4ED4 A;  2V2Q A;  4ES3 A;  1CJU B;  4DF8 A;  1YTY A;  5F41 A;  3MM9 A;  2XC9 A;  4PPD A;  4G1Q B;  3L7P A;  2XWX A;  3QAE A;  1VQK S;  2EFQ A;  3F44 A;  4IRK A;  2E5L F;  4JI2 J;  4LFA F;  3PKY A;  1TKT A;  1FRM A;  1HBU B;  2DIV A;  1Q8I A;  5FDL A;  2VA2 A;  2RB7 A;  5JMN A;  1SC3 B;  4I6Y A;  3L7O A;  3TZZ A;  1TL4 A;  3SZ2 A;  1S1X A;  2CJQ A;  3O2I A;  2QG9 B;  3T1Y F;  5DM6 Q;  5D4N A;  3G82 A;  1KLM B;  3IP0 A;  4Q45 A;  2C2R A;  3TAQ A;  2HBY B;  2MKY A;  3FCH A;  3T5J A;  3ZO7 A;  2ROE A;  3QID A;  4OZN A;  2W24 A;  4LF4 F;  4UZC A;  3TUP A;  1XR5 A;  2LQ9 A;  1OIA A;  3FNN A;  2XS2 A;  1S76 D;  4JI1 F;  5D0G A;  1LK7 A;  4EGL A;  1QAY A;  3GSD A;  2BAN A;  4AL5 A;  1I51 B;  2DO4 A;  3MMJ A;  2C2M B;  3LP2 A;  4EO6 A;  3TJ8 A;  1YJN S;  3RB0 A;  4LF5 F;  1LWC A;  1G3O A;  3IRX A;  3T1H J;  3X1L B;  2RE1 A;  3CCM S;  2HQC A;  4YME A;  4B3M F;  4P6Q A;  2KKH A;  3BS9 A;  4IO1 A;  3SV4 A;  4PG8 A;  2FB0 A;  3D1H A;  5KFL A;  2GJI A;  3IFE A;  3HHL D;  2UUC F;  1ZOT A;  3T9N A;  2FY8 A;  2PE8 A;  3EZO A;  3RB4 A;  1S97 A;  3MPY A;  3GP9 A;  2LEA A;  3DLJ A;  3RRG A;  5D78 A;  1NSP A;  5E3A A;  1VHI A;  2DNK A;  1AZS A;  2VFU A;  1T9U A;  4CLW A;  1RTH A;  2GGP B;  2FZC B;  3JSM B;  5E0O A;  5H1S V;  2Z0G A;  1FRJ A;  2MY7 A;  3PR4 A;  3VAL A;  1BQM B;  4HVZ A;  2DKO B;  3U1M A;  4USV A;  5AJ3 J;  3PYD A;  2IRU A;  4IFY A;  1NO8 A;  2UZA A;  2ZH2 A;  2BRL A;  2W8K A;  3HHN B;  5IC6 B;  2C2E A;  4CO5 A;  2MQL A;  4GMK A;  3TJ9 A;  3DMJ A;  4WP8 A;  2WSE C;  2G13 A;  3CIM A;  3UNG C;  1JKH A;  3UN2 A;  4ECY A;  2D3O R;  1RTI B;  2BA9 A;  4LRB A;  2FVR A;  1S6O A;  3MMC B;  1TQL A;  3LOU A;  1U8S A;  1SJQ A;  3BH7 B;  4X4U A;  4LMZ A;  2LQB A;  4CCH A;  4OYX A;  3WQP A;  3B78 A;  4Z2X A;  2XY5 A;  2KTQ A;  3TEH B;  4XDC A;  2K06 A;  2BKO A;  1GNK A;  4JB8 B;  2OSQ A;  1BMQ B;  2VFV A;  4DG1 A;  4HKQ A;  1VRU B;  1D1U A;  2GHV C;  3BGL A;  1F2H A;  4ERD A;  2R2U A;  3HHL C;  4CO3 A;  4ZVQ B;  4PCQ A;  2B6A A;  3HZE A;  4ZJL A;  2ZBQ A;  1DAX A;  4B08 A;  1WEL A;  2K1R B;  2IY5 B;  4JV5 F;  2UXB J;  2JLE A;  1L3K A;  4WE1 A;  4UUX A;  3QZ7 A;  2ZWO A;  2MXY A;  3KMQ A;  1WI8 A;  2UUB J;  4TYA A;  3PTW A;  3CME S;  4DCO B;  4JI8 F;  1HW9 A;  2P5V A;  3T1H F;  3RW7 A;  3B4M A;  2AJ2 A;  3FEY B;  1YI2 S;  1U1P A;  3A1Y G;  5AE1 A;  3QO9 A;  4USK A;  1RSC A;  4HR2 A;  2DEI A;  4KH0 B;  5RUB A;  4AQY J;  2E7X A;  3AOB A;  4DUY J;  1RAD B;  5I3P A;  1KVK A;  1UKU A;  5ETT A;  3PEJ A;  4PG7 A;  4OJG A;  5HVH A;  1KEK A;  3EE3 A;  5JJB A;  5E3R A;  2ZHO A;  1JLA A;  3CCV S;  3KJV A;  4Q0B A;  2ZBR A;  1AB8 A;  4HHJ A;  3OV7 A;  2CAJ A;  3LGM A;  2BMB A;  3B6B A;  4Y2K A;  2DXD A;  2PN6 A;  1BQX A;  1LW0 B;  1IN0 A;  3PJ9 A;  5D6G A;  1JNZ B;  4ELT A;  2WSC C;  2YWH A;  2OP5 A;  3KUH A;  5C25 B;  1WAC A;  2KFZ A;  2RH3 A;  1J5E F;  3CCJ S;  2B5J A;  5AXK A;  2LCW A;  5IV3 A;  3MMB A;  1DUR A;  1YRX A;  5KT3 A;  3BGR B;  3GJQ B;  2JLG A;  2DRD A;  1U1O A;  4DDF A;  3CWJ A;  4ZJQ A;  2BR0 A;  4Y0F A;  3JB9 k;  1V5I B;  5CZV A;  2OML A;  2ZJP Q;  3AA8 A;  4NLD A;  2Y8W A;  3IG1 B;  1P1T A;  2DO0 A;  4DL5 A;  1UPM B;  2DY9 A;  1QM9 A;  2RUG A;  3M8Q A;  4DJB A;  3C6U B;  3AQO A;  2CNN B;  2F4F A;  5KG6 A;  3C2P A;  1IM4 A;  1J2V A;  3NNH A;  1T05 A;  1NCL A;  2ASD A;  1T03 B;  3UD4 P;  5F8G A;  2MYF A;  3TAN A;  4RUH A;  1XNR F;  1PYS B;  3TUI C;  4F26 A;  3Q0A A;  3RB3 A;  2ZOM A;  2CFX A;  4PWU A;  1MMD A;  4JV2 A;  4P52 A;  3CJ5 A;  4UOF A;  3EDQ B;  2XLI A;  3JTP A;  5HMW A;  4RNH A;  3UN5 A;  2ACY A;  3HVW A;  3C15 A;  4ZCL A;  3RGI A;  2IJN A;  3RYL A;  2V4R A;  4IG3 B;  2V8P A;  3UR3 C;  2O1P A;  1UZH A;  2UXB F;  2KL8 A;  4DF4 A;  4OIX A;  4IFV A;  2FVQ A;  2BM1 A;  1WD6 A;  2VG7 A;  2ZDO A;  5KT2 A;  2W9B A;  4S0M A;  3Q8S B;  2FJX A;  2C22 A;  3I96 A;  1U1K A;  2CJ9 A;  1TTH B;  2IJF A;  4A8M P;  2V4J A;  1TK0 A;  4AFF A;  4C8Z A;  4RU2 A;  1ZM3 A;  3G8T A;  1DQ9 A;  4NYZ A;  1JXL A;  1GAO A;  2Y1R I;  4NXN F;  4A8X A;  1U2C A;  3CPW R;  1AFI A;  4CP5 A;  1NJI T;  5IQQ A;  1PCA A;  4AQY F;  1Q7L B;  2FTR A;  2DRB A;  4PXD A;  3OHB A;  1RWN B;  2L9D A;  4UY8 T;  1RTJ B;  4GC7 A;  5F9N A;  3VVT A;  4L6V 3;  1Z1Z A;  4LT6 A;  4RW6 B;  4X65 J;  1JLE A;  3OXF A;  1FNX H;  4P2X A;  4GVB A;  2XZT B;  4NXM J;  4HDG A;  3IM8 A;  4ILR A;  5D4P A;  2DHG A;  4B3O B;  1R0A A;  2CPF A;  3QBC A;  2HRU A;  3I31 A;  1CEZ A;  3LAN A;  5CYJ A;  2EWH A;  3KNG A;  3K59 A;  5EUH A;  4K4S A;  5GAH I;  1E6Y B;  3R97 A;  5KT5 A;  4KB7 A;  2HPU A;  3RTV A;  3LTO A;  5KFC A;  1NSK L;  1S7I A;  3D7S B;  2BOA A;  4QBU A;  1FHT A;  4JV0 A;  4C4W A;  2ILY A;  4TY9 A;  2VUG A;  4PR6 A;  1TFY A;  3ILJ A;  2LXF A;  1VGY A;  4DCP B;  4M8L A;  3VF0 B;  4DQP A;  4F67 A;  3M32 B;  3OTE A;  3R5J B;  4KSE B;  4L72 B;  1VQ7 S;  1N54 B;  4E8U A;  4LF1 A;  4A8O A;  2ZH5 A;  3IA0 A;  4TXS A;  2X1F A;  2DNZ A;  1X4C A;  4A48 A;  1FRL A;  4B9N A;  4QW8 A;  5HRO A;  1S9F A;  1AYE A;  1S77 D;  4FXD A;  5KTQ A;  3QQC D;  4X4R A;  3DYA A;  4CNY A;  1HYS B;  4DV7 J;  1WC6 A;  2HFS A;  1UVJ A;  3MEG B;  4OI4 A;  2R4F A;  5KFO A;  4DS4 A;  3I87 A;  2E1C A;  4OI6 A;  3RBZ A;  3OTB A;  3CO9 A;  3ZZT A;  2OIH A;  1TK8 A;  2LEC A;  2KJV A;  8RUC A;  2MLY A;  3CE8 A;  2A18 A;  1B0T A;  2MLZ A;  2KXF A;  3K2Y A;  1Q81 T;  1SV5 B;  1BQN A;  4UST A;  2C2D A;  3PX6 A;  2CZ4 A;  3W2W B;  4PWW A;  2QSF A;  2YNI B;  3D66 A;  3LO3 A;  4XK8 C;  3VQT A;  4N77 A;  1S7H A;  4KGV B;  3UDC A;  1TKX B;  3ETM A;  1J5O B;  4X65 F;  3QT6 A;  3DFE A;  3EDR B;  2DH9 A;  3HVT B;  2W2N P;  2MHN A;  3LAM A;  3TAR A;  3KJQ B;  2OGU A;  4NXM F;  2VPX B;  1MG7 A;  4O4R A;  1N36 J;  1R8C A;  5D4L A;  3M2V A;  1NK6 A;  4DZD A;  3ENA A;  1HIY A;  2Z2M A;  3DLK B;  4U67 Q;  3CCU S;  3MCN A;  3M4X A;  4ZP8 A;  1PJ6 A;  2BJ8 A;  1C0U B;  1SH2 A;  3GYX B;  4OLO A;  3NAI A;  4LF6 J;  3HDS A;  5ITH A;  1QAX A;  3HHD A;  2XO7 A;  1IKY A;  2H9Z A;  4MKB A;  1YHQ S;  3OJS A;  3Q8V A;  3L9Z A;  2DPI A;  1MNE A;  3CD6 S;  1K0V A;  3I4H X;  1LKZ A;  4ZVH A;  5HMZ A;  2FGC A;  3FRZ A;  5HN0 A;  3ENQ A;  4KFB A;  1G4C A;  1RT7 A;  3M6W A;  4BS2 A;  2CKW A;  5CAB A;  1Y5I B;  3GJR B;  4NI2 A;  1V6H A;  1Q16 B;  1Q8K A;  2AF6 A;  4UOC A;  4LQ3 A;  1X9M A;  2DNO A;  4N41 A;  3BQ0 A;  5DZ6 A;  4NEZ A;  3W2V A;  2QTW A;  3NXZ A;  3CT9 A;  5C24 A;  4BLG A;  4DV7 F;  1VQ4 S;  3U02 A;  3H4B A;  2XMT A;  1M1K T;  3DGP A;  2ZHA A;  4NCA A;  4YY3 F;  3EVM A;  4CM2 A;  4NL5 A;  4QU7 A;  2J7K A;  1TL7 B;  5T41 A;  4AL6 A;  3HSZ A;  3H20 A;  2QL5 B;  4NWB A;  4RW9 A;  1JLF A;  1OSD A;  3CCW A;  3HHE A;  3T41 A;  2AV5 A;  2B7B B;  4FYV B;  2XG8 A;  4FZV A;  2XGQ A;  2P2C B;  2QT7 A;  1F3F A;  3GIJ A;  4MKV A;  1IBL J;  1NHV A;  2QA1 A;  1RT3 B;  5KFD A;  3NOG A;  5HVF A;  2ZUG A;  1PGZ A;  3BZQ A;  2AGQ A;  4I2P A;  3R7N B;  3W60 A;  3I5B A;  3QJJ A;  1N36 F;  3S8S A;  1YBU A;  3C8Y A;  2UVU A;  4FNI A;  4WYL A;  4DQI A;  3KK1 B;  2XM3 A;  1NK7 A;  4H4O B;  3H5S A;  2H4W B;  2V8H A;  3VV2 B;  3HI9 A;  4NYO A;  3K17 A;  1DQA A;  3QIP B;  3PHE A;  3GSI A;  2HHW A;  1ZTW A;  1WC4 A;  4DPX A;  1KDN A;  2ILZ A;  2W7A A;  3BN4 A;  2BBE A;  4ZP9 A;  3OXL A;  3D67 A;  5J2N A;  3MEC B;  4O3Q A;  2ZH3 A;  1PYT A;  3ETO A;  1UVK A;  2IDE A;  3KKF A;  3MFI A;  4IR1 A;  4KO0 A;  1RZM A;  4NLG A;  2RF2 A;  1RKJ A;  2JEF A;  3LP0 B;  1UPP A;  2AT1 B;  4OYW A;  2GJ2 A;  1WG1 A;  1RHJ B;  3VZH A;  1OY8 A;  2WB1 D;  2ZBI A;  3O3L A;  1RLC L;  4U8V A;  1ACM B;  2XHC A;  5IOL A;  2JL9 A;  3KK3 B;  4L3K A;  1HNZ F;  4URS A;  1KR4 A;  1ARO P;  1FF2 A;  5J1P A;  1L5U A;  1YQH A;  4CLS A;  4BC9 A;  1YRT A;  4NZ7 A;  3NP5 A;  3HVA A;  2YNH A;  3DGV A;  1FNO A;  3OW2 R;  2RT3 A;  1EAR A;  3NS7 B;  1ZZN A;  4PQU B;  3KLF A;  4DR3 J;  4DUT A;  2DR9 A;  2FC8 A;  4IRC A;  1RA7 A;  1TUV A;  1SC6 A;  2DGV A;  2EKY A;  4UUW A;  1RT2 B;  3DRR B;  3MM5 B;  5DG7 A;  2B4U A;  1IBL F;  3N01 A;  5CYQ B;  2EC2 A;  2DK2 A;  1HI1 A;  1ZPV A;  5GAH U;  5BR8 J;  4YFU A;  2P6T A;  1T9T A;  3MMA B;  2KO1 A;  1VIX A;  3IN5 A;  4A8K A;  3DLL Q;  2MKI A;  4J90 A;  3TUZ C;  2GQC A;  4IRD A;  3GYN A;  5MLC V;  5IQ6 A;  1OPI A;  2K3I A;  1H98 A;  4DSL A;  4ER8 A;  1MML A;  4MYU A;  2FHJ D;  5C2C A;  1WSV A;  2KYX A;  5DDO C;  1ZM9 A;  2G1D A;  2N4D A;  3CC7 S;  1H7X A;  3G8Q A;  2P9G A;  1C0T A;  2E66 A;  1FRH A;  4ILM A;  2OD6 A;  2R8H A;  4DI6 A;  1NBE B;  3RRK A;  4NCG B;  4X4N A;  2MLX A;  1WKJ A;  2EEY A;  1NB7 A;  4PUO A;  1VIS A;  4FDF A;  3BQ2 A;  3I6P A;  3NGU A;  3GCW P;  1D9A A;  2D7S A;  2GJF A;  5GAG I;  1GMU A;  1VC5 A;  1S79 A;  1SL0 A;  4ZLN A;  2P8I A;  3W7B A;  3WBZ A;  4C3M A;  4DL7 A;  2VIH A;  4NLW A;  3G2X A;  4F02 A;  5KG5 A;  5HO4 A;  1PG5 B;  3B8H A;  3KG1 A;  1JJH A;  3ADA C;  4ZVO B;  3EPI A;  4J37 A;  5HJY A;  1FE4 A;  1KTQ A;  4NA3 A;  1U0H B;  2M70 A;  1ZAX A;  4P72 A;  3N5F A;  3GR1 A;  2VOO A;  3IBF B;  3G82 B;  1RP5 A;  4QIW D;  1EHW A;  2HHP A;  3MAH A;  2Z2Z A;  4DR3 F;  4WU2 A;  4DWI A;  3EVW A;  1UFW A;  1KHV A;  3RRH A;  4R5P A;  2ZNY A;  1I6J A;  3FSX A;  2H5I B;  2YX4 A;  1NM2 A;  2OJ3 A;  3NL0 A;  2ZIT A;  3QT5 A;  1JLQ B;  4C8K A;  1REG X;  3UVJ A;  3G6E S;  2XY7 A;  4LUB A;  1X60 A;  4TN2 A;  2AD9 A;  5F0W A;  1ULR A;  3KLG A;  4C2M A;  2LLZ A;  2YBV A;  5BR8 F;  2BAN B;  2YNG A;  2OEK A;  1DTT B;  3BSC A;  1LWC B;  3QWU A;  1NME B;  4ECX A;  1D9F A;  4B3T F;  5B0G A;  3SI8 A;  1Q53 A;  1SH0 A;  5GAE I;  2RIL A;  1V9O A;  3NS6 A;  2GQ2 A;  3T1A A;  1K1Q A;  3L3C A;  1T9Y A;  2D1C A;  2RKI A;  2OPP A;  2HGN A;  4I68 A;  2GCF A;  4ZPD A;  4ED0 A;  3HMJ G;  1C4A A;  2GVZ A;  5AXL A;  3DI6 B;  3GQC A;  1S9G B;  5A6W A;  1K8A T;  3Q8Q B;  3D0G E;  3MM7 B;  1RTH B;  3OL8 A;  2VFR A;  4J9O A;  1KOH A;  2FDN A;  2HHT A;  2WBR A;  1APS A;  4ES2 A;  1NPK A;  2XCA A;  3R2D J;  3C46 A;  1XER A;  2WVE A;  3ZZ0 A;  2OI2 A;  3PEH A;  3VVU A;  3OFE A;  5CA5 A;  4I2Q B;  2GVD A;  3H4D A;  2CRL A;  2K2P A;  4OYI A;  5L46 A;  4FXW A;  3V4I A;  1TL3 B;  4LFB F;  2KZZ A;  3IWX A;  5C2G A;  3GV5 B;  2I2Y A;  4R8U A;  4LFC F;  4A46 A;  4ZCM A;  3ZTS A;  2RRN A;  1RT4 A;  3G6Y A;  4IDK A;  1LW2 A;  1Y10 A;  2W2Q P;  4RWW A;  4DX6 A;  2WTF A;  1WC3 A;  3IWL A;  4Y2I A;  2LA6 A;  3G96 A;  4C7Q A;  2VA3 A;  5SZT A;  4JBC A;  4J9R A;  1IR2 A;  2MQQ A;  4PYD A;  4NLR A;  5KG2 A;  1TKD A;  1R27 B;  3PVX A;  2X1A A;  2KU7 A;  4H4K A;  4RW7 A;  1KON A;  1VRT A;  4LRD A;  2CNL B;  2BEF A;  1F0X A;  2L48 A;  1VBY A;  1R6Y A;  4RW4 A;  4KKO A;  4JYA J;  4KV8 A;  3WC0 A;  2OPQ A;  1DLO A;  2ZC3 A;  2LU1 A;  4ANC A;  1W2B R;  3M9M B;  2V9W A;  3GG0 A;  2DH7 A;  2FGO A;  1FRK A;  3DOK A;  1GTE A;  2PMH A;  1U1R A;  4WE1 B;  3MAQ A;  1BWE A;  4QWD A;  2VL1 A;  2R8J A;  2I0X A;  1N5S A;  4LF9 J;  4WIQ A;  2BKN A;  1FTR A;  1TAQ A;  1URR A;  3G87 A;  4QR0 A;  4P7V A;  1KQK A;  3SFU A;  3HM9 A;  1DRZ A;  1GMW D;  1FT8 A;  2AGO A;  1U1Q A;  3CJT A;  3VAG A;  1K9M T;  1W2I A;  3MED B;  3NGD A;  2KI2 A;  3V81 A;  4OHX A;  3QGH A;  2LEP A;  2HVH A;  4MK9 A;  3U27 A;  1UAW A;  3IXQ A;  2C28 A;  6FD1 A;  5F8J A;  1JLA B;  3KJV B;  2LU2 A;  2AP6 A;  2AGP A;  2B56 A;  2ZH7 A;  3RAM A;  4KE5 A;  4DQR A;  4ES1 A;  4TNO A;  2MZR A;  3EPG A;  4Y6I A;  3V6D A;  1TK5 A;  3FBB A;  3W64 A;  2NPI A;  2HK3 A;  2CG4 A;  4M5K A;  1JLB A;  2B5J B;  2HVZ A;  2AYB A;  1VQN S;  5KFM A;  4O3S A;  3PIO Q;  1LWF B;  2EG1 A;  2O67 A;  1WUU A;  3IR5 B;  3TAM A;  2JHE A;  1A6L A;  3TA1 A;  3QYY A;  4CLZ A;  4RNN A;  5J2M A;  2KVQ E;  1WTF A;  1MMN A;  2BAB A;  1GMV A;  3MI7 X;  2LA4 A;  1F1B B;  1HPZ B;  3CD5 A;  1TKZ A;  3CJR A;  2JNJ A;  2F5G A;  2VG6 A;  3M8Q B;  3EZ5 A;  4XPC A;  3R5B A;  3AD9 C;  2C3P A;  2HZV A;  5KAK A;  2CPD A;  1YIT S;  2FD2 A;  4I4B A;  3GWC A;  2IAJ A;  4CYU A;  3O44 A;  2K8G A;  4F7V A;  1X4B A;  4K7Q A;  2EBE A;  3TX0 A;  2OH2 A;  4M5D A;  3QRP A;  1HI8 A;  4K4W A;  1XMQ F;  2CQD A;  3BH6 B;  4HHH A;  2UXD J;  1RHU B;  3IGV A;  4P10 A;  1HQ2 A;  2GFF A;  3DM2 A;  2CJA A;  3O1L A;  4X62 F;  2HFU A;  4FS2 A;  2XMK A;  3U1N A;  4YP3 A;  2NXN A;  1NKB A;  2V67 A;  1GTH A;  4JYA F;  5MAO A;  4C8M A;  1S9E A;  2CQG A;  5LJ5 Y;  3SCL E;  3KHH A;  1YBA A;  2W4D A;  1JLC B;  1IKV A;  2IVF B;  3CUN A;  2Q6B A;  1N5Y A;  3J7Z T;  2AZ3 A;  2EI5 A;  1YJT A;  2RHS B;  4C11 B;  1IM6 A;  4DR2 J;  1FJC A;  2V4J B;  3PW4 A;  3UQS A;  1U6F A;  2WK4 A;  3D4J A;  5KG1 A;  4YHH F;  1S1U B;  2HKE A;  4GO5 X;  4LVN P;  1QSL A;  2CQ4 A;  3D28 A;  4OJ1 A;  4KRW A;  3AQP A;  2XEX A;  4FXV A;  4J9L A;  1TL5 A;  3ILI A;  1C1C B;  3MPW A;  3DLB A;  3CJK A;  4ELV A;  1VLY A;  1UVI A;  1F3V A;  5J2P B;  2ZE2 B;  3NWG A;  3C14 A;  5KFX A;  2CJY B;  4JI6 J;  2EG2 A;  3FQK A;  1EP4 B;  1YLX A;  3A8J A;  1JLE B;  2HBR B;  5GVQ A;  4J9U E;  4LF8 J;  4GVB B;  3ZFV A;  3TAP A;  2XB2 D;  1AA1 B;  1X4E A;  4OHW A;  5LL6 d;  2HNY A;  3BN7 A;  3RR8 A;  3B4D A;  2W9C A;  2CYY A;  1FXL A;  3GMG A;  1NJX A;  4AXJ A;  1FI4 A;  2QSW A;  2WON A;  1PJ5 A;  1R0A B;  1YK9 A;  1IKW B;  3FQL A;  3AJ2 A;  3QGP A;  1RWX B;  3CDW A;  1NDP A;  3UPF A;  3N4W A;  1W25 A;  1E6V A;  3OL9 A;  3DLE A;  5KFA A;  3MPD A;  2WHO A;  1HBN A;  3HFK A;  2KM8 B;  4JUZ A;  1Y00 A;  2HWH A;  2XSF A;  5J1E A;  3W8P A;  4WZM A;  4CTA B;  3L09 A;  2MKJ A;  2XMW A;  1OO0 B;  2BJ9 A;  2QL9 B;  2ADC A;  3ZZO A;  1CBK A;  4K4U A;  2DNR A;  3J7A 1;  3PO4 A;  3IC1 A;  3NKY A;  4HAC A;  4YR0 A;  4H4M B;  2MY8 A;  3TQ1 A;  5LMN F;  1FES A;  4CT8 A;  2VDI A;  3IM9 A;  1YKW A;  3ITH B;  1U02 A;  2UXD F;  3CO0 P;  1ZAV A;  2QMU B;  3GV7 B;  2WCX A;  4Z7C A;  2DGX A;  3E8O A;  2DCL A;  4LSN A;  3R27 A;  3NMA A;  2V2K A;  3D3C J;  3HHK A;  2DR5 A;  4UW2 A;  4RZR A;  2M4M A;  3OTC A;  4DPW A;  3DYA B;  2XMV A;  3OR1 A;  5DET A;  3BGU A;  2OUG A;  4O23 A;  3KXD A;  3W1Y C;  2D3O 1;  2IBO A;  2E5J A;  1C2P A;  1S57 A;  4JI7 J;  5E2Q A;  4USI A;  1B7F A;  2CWX A;  1ICE B;  1KFD A;  4DZ6 A;  2QFI A;  1PBU A;  3VR1 A;  3A3N B;  3BJY A;  4OYP A;  4KGZ B;  4YOE A;  3SDE B;  5BYR A;  3EYZ A;  2XS7 A;  3FJ2 A;  2D9P A;  1BQN B;  1S6Q B;  1B0P A;  1RWO B;  2G1H A;  2F4V J;  2MKK A;  4DV0 J;  4JI6 F;  1X0P A;  2HW3 A;  2HHS A;  4CLP A;  2MZQ A;  3MUR P;  2XCP A;  3UCU P;  3N6N A;  1S12 A;  4DU8 A;  1YGY A;  5DLF A;  2FHO B;  4NCB A;  3CGI A;  1SL1 A;  2LVW A;  1KQS R;  2D74 B;  2QLJ B;  5B0D A;  5A8W A;  4JP8 A;  5LM7 E;  3I0R A;  2RU9 A;  5CQG A;  4QZV B;  4DN9 A;  4TLQ A;  5H9E J;  1X5P A;  3I0S A;  1IUJ A;  1REV A;  1VYA A;  4DV2 J;  3SCK E;  2IDL A;  3GIK A;  3SBM A;  2C2N A;  4CWB A;  3R7S B;  3W9H A;  5A8K A;  4NLX A;  4BC7 A;  3VGT A;  1UVM A;  1V3S A;  1QY7 A;  1UP1 A;  1S1W A;  3BBF A;  3M30 B;  4OV1 A;  4ID5 A;  2AX0 A;  4CM0 A;  1RBL A;  1O5J A;  3P8B B;  4RBT A;  2XMJ A;  1S10 A;  1C4C A;  1LXN A;  4TQS A;  4WU3 A;  4KFB B;  3W63 A;  2D3U A;  1TMJ A;  2HND B;  2HQF A;  1RT1 A;  3I55 S;  5I42 A;  1M90 T;  1QLN A;  4PZV A;  3FSI A;  2C3U A;  1NK0 A;  1WDD A;  3J80 U;  2XI3 A;  2FJD B;  4OX6 A;  2CJK A;  4R25 A;  3OR2 A;  2MSS A;  1RJJ A;  4FS1 A;  2IM2 A;  3W2V B;  1M1G A;  5C24 B;  1EQM A;  1YDL A;  3I4P A;  5DLG A;  2YWE A;  2CQ1 A;  3THP A;  1FJE B;  4DV1 F;  1N8R T;  3JAM Y;  3K5M A;  3UCG A;  2A3J A;  2HRT A;  1M5S A;  1QE1 A;  5ETQ A;  4FNH A;  4B3R J;  3SXL A;  1U24 A;  4B02 A;  4RW8 A;  3PXG a;  4E98 A;  1PYO B;  3CCZ A;  1UWB B;  6AT1 B;  1HI0 P;  4IQM A;  3R1H A;  2W7P A;  4XAK A;  5L1L A;  4RW9 B;  5KT4 A;  1JLF B;  2YWF A;  3FEZ A;  2ZZN A;  3KOA A;  1YG0 A;  4P73 A;  1NH8 A;  2DGT A;  5KFB A;  1U45 A;  1FWL A;  3PNI A;  2M8H A;  4G65 A;  1NKE A;  5DZ7 A;  2HEK A;  3IRW P;  1X0F A;  2QN6 B;  2JEJ A;  2F4V F;  2VPY B;  4DV0 F;  4ED1 A;  1X5O A;  1UA1 A;  4M5N A;  1ZZF A;  3IBC B;  3JTN A;  2N4C A;  2Q3P A;  5HAO A;  3GR0 A;  3DDI A;  4DR4 J;  2OPR B;  2YX1 A;  3KK2 B;  5H9F J;  1MWZ A;  3D0H E;  1TUW A;  1FDA A;  1Y3J A;  2F1F A;  3OVB A;  2BE7 D;  4KPY A;  3PYE A;  2KDO A;  1JMT A;  2GZO A;  2E5I A;  2OFG X;  3FBC A;  2WZ1 A;  2D3Z A;  3MCO A;  5E5N A;  4ZHR A;  3ZTR A;  1CQN A;  1VI7 A;  2MJU A;  3DU6 A;  4DU7 A;  4JI0 F;  3EIC A;  5FJ4 A;  1T95 A;  4CO4 A;  4J9N A;  3G4S S;  3CUL A;  1VCT A;  4C8N A;  4OV6 A;  2Q43 A;  4EO8 A;  5IT9 Y;  4I6W A;  3Q23 A;  2DNQ A;  3C6T A;  3WIV A;  1V5V A;  2MQ8 A;  3IAS 9;  3HFZ B;  1TV6 B;  3EXC X;  2AHO B;  3VAH A;  4W90 B;  1CLF A;  2R2S A;  1RA6 A;  3CJ2 A;  1RU2 A;  2VAS A;  5KFN A;  1RBO B;  4DV4 J;  4KO0 B;  4OX9 F;  4KGX B;  4DR5 F;  4QYZ J;  3IWN C;  3N6L A;  1SUQ B;  2OO4 A;  4LBH A;  3QGI A;  2CXE A;  4UQG A;  1CJV A;  3HHL A;  3W9J A;  3DRY A;  1YZ7 A;  2VG5 B;  4FYD A;  1H2V Z;  1NK9 A;  3DRS B;  4J91 A;  2NUU G;  3OSP A;  2HVD A;  5F0U A;  1SKU B;  2M2B A;  1SJ1 A;  4A8S A;  3H98 A;  4B3R F;  4X64 F;  3MFH A;  1Q79 A;  2GMJ A;  3RAX A;  4WFA Q;  3KLF B;  4AL7 A;  2CPX A;  2I38 A;  3GIL A;  1MU2 A;  1XMO F;  2WAQ D;  3TZW A;  4EUV A;  3ISZ A;  2ALZ A;  4I64 A;  2M5Y A;  5CXT A;  3OTO J;  3WHI A;  4ITS A;  2DHA A;  1UVN A;  3KLI A;  4DR7 F;  2QMW A;  2IC3 A;  4IOA Q;  1RT6 A;  4PRF A;  3R5D A;  4DR4 F;  3FFI A;  5EWF A;  3AXK A;  2LXI A;  3MTK A;  1X4A A;  3H5U A;  3DDN A;  1HKA A;  1M5V C;  3GIR A;  4LRC A;  3D1O A;  2F65 A;  2KM8 C;  1JXV A;  2LQ8 A;  4B9L A;  4O0I A;  4FF1 A;  4WXW A;  5KFW A;  1F9E B;  1RUS A;  2RS2 A;  2DR8 A;  5LOQ A;  2ZD1 B;  1S1T A;  2VPW B;  2G2O A;  5KG4 A;  4WFZ A;  1QUP A;  4AXI A;  4TU8 A;  1YJR A;  4G3I A;  4LF2 A;  3R1L A;  4J9S A;  4HEA 9;  1U49 A;  3HK2 A;  5B0B A;  3M6U A;  1HR0 J;  4FPI A;  5A0Y B;  4HLB A;  1WNE A;  2OPS A;  2RRA A;  3NBP A;  1FFG B;  1HNI B;  1U26 A;  5B09 A;  4K0K J;  2FJV A;  4DV4 F;  3GU0 A;  3SSS A;  2CG8 A;  4ZA1 A;  1HQE B;  2PA8 D;  2DVI A;  2GA7 A;  2XZD B;  4TKT A;  2RS8 A;  4K4T A;  2P9C A;  3POT B;  3GFH A;  1QJH A;  2XHW A;  2XLK A;  3H42 A;  4B9T A;  3HXM A;  2HFN A;  4GKK J;  2WOM A;  5CHC B;  2PFD A;  3DRP A;  2CVI A;  2ADB A;  2N7Y A;  5HI7 A;  3NWR A;  2IMW P;  3D2W A;  4U7U D;  4YDD B;  1TL1 B;  2V50 A;  4TU9 A;  4EWT A;  1HQU B;  2OTL S;  1Q82 T;  5B0F A;  8ATC B;  1EZZ B;  3DOL A;  2L9W A;  1P9Q C;  2R42 A;  3UI3 A;  3AJ1 A;  5B0E A;  5T14 A;  4IH7 A;  1DTQ B;  3CCL S;  2MQN A;  4QIV A;  1VQP S;  3UN3 A;  3OTO F;  2HSE B;  2N82 B;  3V5R A;  3M2U B;  3CJ8 A;  2X1G A;  3MM8 A;  1JQG A;  3ZZY A;  3QPI A;  2VV5 A;  4TVA B;  1SIW B;  3HT0 A;  2E5L J;  4EI2 A;  5DJB A;  4LFA J;  5L39 A;  3BPD A;  1ZA2 B;  4U9R A;  1SJF A;  4LIW A;  4CH0 S;  1IBK F;  4PWD A;  4GRS A;  3LP1 A;  1EKR A;  1X7V A;  4NLT A;  3W5Y A;  4YDX A;  2GAG C;  1CJU A;  1BWV A;  1VC0 A;  2RDI A;  4F0K A;  3FEX B;  5KFY A;  2G4B A;  3T1Y J;  3MD3 A;  2XWY A;  1TEL A;  2OPP B;  3V6K A;  1RHM B;  2EK6 A;  4G1Q A;  1JXE A;  5LXY A;  1H73 A;  2G0I A;  4G6V B;  3CCS S;  4A8Q A;  3H0P A;  4DQS A;  4FBT A;  4M5M A;  1RCX B;  5J1N A;  1HBU A;  4LF4 J;  1WKK A;  4Y00 A;  2V4Q A;  3PYG A;  1PJ7 A;  4IUF A;  3LWL A;  1R8P A;  3MWB A;  3GFZ A;  2R2R A;  1UZD A;  1HR0 F;  4QWC A;  5M2R A;  1EAY C;  4F8R A;  1FD2 A;  3MDF A;  5GAD U;  4K0K F;  3D0I E;  1KS2 A;  3J81 Y;  2M8D B;  2VPZ B;  2CNO B;  2VC1 A;  4CH7 A;  2IPO B;  2HRY A;  4USW A;  5ETR A;  3PW7 A;  4FVC A;  2KT5 A;  3BKU A;  4ZPC A;  4R8U B;  2LYV A;  4WFB Q;  1EET B;  1RT4 B;  4G1I A;  4JI3 F;  5CYM B;  4B9U A;  3JXO A;  2NSB A;  4IDK B;  1JNR B;  4ALZ A;  2DRA A;  4GKK F;  3CCQ S;  2KT2 A;  2VHG A;  2QA2 A;  2MHE A;  2F7V A;  3D1Q A;  3AOD A;  1L3T A;  1QSS A;  4RW7 B;  1H0H B;  2XGP A;  4FYY B;  3WC2 A;  4X2B A;  2HFO A;  3DNC A;  4DLE A;  3SCI E;  4O4G B;  4KKO B;  5DQG A;  2RQ4 A;  4UOG A;  4ZIW A;  4F25 A;  1LWX A;  1HNX J;  1VQY A;  2G0J A;  5GMD A;  4C0B A;  3PW5 A;  1WF0 A;  4ZIT A;  1VQM S;  5LJ3 Y;  1GFW B;  1RHK B;  3JAM U;  3JSM A;  4Q5V A;  4F2S A;  2AWZ A;  3N5B A;  2KXN B;  4OX8 A;  1PIE A;  2DNG A;  1IQT A;  2R8I A;  2VBY A;  1N34 J;  3M2R A;  2RIJ A;  2GAH C;  1UTA A;  3E01 B;  3OUY B;  3CF5 Q;  2FLL A;  4K59 A;  3CJ3 A;  3LA0 A;  4ZKA A;  2J9E A;  1FD8 A;  3H5Y A;  1DFD A;  3O5T B;  1YRU A;  1RTI A;  3IR6 B;  4A8W A;  2JJ4 D;  3T3F A;  3MMC A;  4EBC A;  4P2F A;  4MK7 A;  1RTZ A;  4CT9 A;  2WSF C;  1XTZ A;  3HJV A;  4JV5 J;  5HAN A;  5DDQ C;  1R0B G;  2K7K A;  5D15 A;  3GV8 B;  3D6T B;  3P96 A;  2PSZ A;  1S1V B;  2V68 A;  4JI8 J;  4QWB A;  1VRU A;  4V19 X;  3MPV A;  3H8Y A;  1RAF B;  1HWK A;  1U2F A;  1Q1K A;  2J9D A;  5J2M B;  1CC7 A;  3W65 A;  2R7Q A;  1TKZ B;  2E5H A;  3THT A;  2RQC A;  2UUW A;  1C1B B;  3QLH B;  1IKX B;  2ATL A;  1IWG A;  5IT9 U;  4IO9 Q;  1SJ4 P;  1T11 A;  2RQK A;  5C7P A;  3CJS A;  2IAJ B;  4CYU B;  4WPA A;  1O0P A;  4ANE A;  2F9D A;  1RKI A;  4NMX A;  1T9V A;  2VDH A;  2FHK A;  3DM2 B;  1A0O B;  3P5T L;  4NX9 A;  1J5E J;  1Y4Z B;  4ID8 A;  4ETZ A;  1RAJ A;  4YEA A;  2GO8 A;  2OEL A;  4NZ0 A;  3VHQ A;  1HNX F;  4XPE A;  1IKV B;  1U6Z A;  3FZ2 A;  1BY9 A;  2CQI A;  1LW0 A;  2CQ2 A;  2NSC A;  4NLU A;  3QSI A;  3I9Z A;  4OYA A;  1FX4 A;  1NPP A;  3HVR A;  2GX8 A;  3JQM A;  5EDW A;  5D3G B;  1DHM A;  1N34 F;  2IBK A;  2RDD A;  4AYB D;  1Y7P A;  5LSO A;  4YB7 A;  1TZ0 A;  1N6Q B;  3ZNU A;  3PRV A;  3E51 A;  3BM7 A;  3BGR A;  1NK4 A;  1XNR J;  2KZM A;  3RBX A;  3QNW B;  4FYW B;  1MN7 A;  5DDR C;  2MGZ B;  2AJF E;  3BSN A;  1YIJ S;  3IG1 A;  2VBW A;  4F0M A;  4N47 A;  2KT3 A;  3C6U A;  3R5G A;  2HAI A;  2DIS A;  1UW4 A;  3ZXW A;  2ZM6 J;  2XTJ P;  2EFN A;  1PAU B;  1T03 A;  3BDE A;  4DOZ A;  4FYX B;  2YXL A;  5IFM A;  4DX5 A;  3GJS B;  2WON B;  3DDK A;  2HHH F;  2XNQ A;  1VOM A;  3WIU A;  2Y0S D;  3MEE B;  2VKR A;  1K73 T;  1NJY A;  1UFK A;  1PC5 A;  5T7L B;  4NXN J;  3SSQ A;  1E6V B;  1WHW A;  3ZZR A;  4ECT A;  1K0T A;  4I67 A;  3AFG A;  4ZCK A;  4IG3 A;  3CJ4 A;  3HZG A;  2JZ5 A;  2IMO A;  3GYG A;  4ZPV R;  1N56 A;  2UUT A;  2CQP A;  2NLW A;  4U7C A;  2YWK A;  3MZI A;  2DHH A;  2XI2 A;  5IZH A;  4K8R A;  1N5V A;  3DKD A;  5HP1 B;  2XZW A;  1SVD A;  2QYC A;  2OLW A;  2Y0B B;  2AYG A;  3KLH B;  1D8Z A;  4W92 B;  5LSL A;  2DH8 A;  2YPZ A;  2OSR A;  3D68 A;  1N48 A;  1KNZ A;  3KNA A;  1FWK A;  3FDS A;  2BJ1 A;  5C42 A;  5A76 A;  1R7I A;  2IVY A;  2R7W A;  1RTJ A;  4DLG A;  5ETL A;  3DLG B;  4QR2 A;  1VRQ C;  2BYC A;  3OLA A;  2HNZ A;  3OJU A;  5DS7 A;  2C2K B;  4NLQ A;  2W9A A;  3ULH A;  5ETP A;  5ETS A;  2KFN A;  1T3O A;  1U47 A;  5JVG Q;  3OPK A;  4LVO P;  4DPU A;  3GLJ A;  4CLU A;  2LP4 A;  5HJX A;  2W8L A;  2YKA A;  1RBA A;  5L8R C;  4LIR A;  1VK3 A;  4DFP A;  2VBX A;  4FKY A;  4F4A A;  3CD7 A;  2Z2Y B;  3N9U C;  2U1A A;  3W5X A;  1S4F A;  1I5O B;  4RUB A;  5I3U B;  5E3P A;  1P27 B;  2DGU A;  3OQ2 A;  2EW9 A;  4ED8 A;  4BDP A;  1FDN A;  3D5M A;  4KC5 A;  3JSR A;  2NZ4 A;  2D9O A;  2E5G A;  4N8N A;  1CG2 A;  3H40 A;  5KFI A;  3GON A;  4EYI B;  2ZM6 F;  2LMI A;  2VJU A;  1CVJ A;  4J9M A;  2CUY A;  3M32 A;  5KG0 A;  3I9V 9;  3TI0 A;  4QPT A;  4FF4 A;  3FVY A;  2MB0 B;  2ZBP A;  4WYW A;  5KFR A;  4DCJ B;  5HBM B;  3RB6 A;  4WK3 A;  2QRR A;  4YR3 A;  4J9P A;  1G7C B;  1JJ4 A;  3A8I A;  4OL8 A;  2UUA J;  3TOQ A;  3HKZ D;  2QC3 A;  4EFA C;  3MUV P;  4ELU A;  3V6H A;  4C6A A;  2W2M P;  3HO1 A;  2ZKT A;  4XIU A;  4NLV A;  5A8K B;  1MW7 A;  4XO0 A;  2AJ4 A;  1HYS A;  3S1T A;  3OT9 A;  3EWG A;  3H59 A;  4OYM A;  4LR8 A;  3MEG A;  3GB0 A;  4OYZ A;  1S1W B;  4OZJ A;  5G0R A;  3UR0 A;  2MZJ A;  3CSK A;  1XIQ A;  2QEX S;  5ETK A;  3HSD A;  1FRX A;  4KT0 C;  4RWX A;  3TVK A;  4RNM A;  2ZJQ Q;  4MFB A;  1GH8 A;  3RU0 A;  1WC0 A;  1R89 A;  3GE9 A;  2E9T A;  1RWM B;  5I42 B;  3TRG A;  1P6T A;  1SV5 A;  3DOM B;  1T0T V;  3LH2 S;  1WC5 A;  4DSI A;  3PYF A;  3KDN A;  3J81 U;  4ZIV A;  4LRA A;  4USJ C;  1SKS A;  2YNI A;  4EEY A;  1H38 A;  1QTM A;  1ZAW A;  2CQB A;  2YKN B;  5DO2 A;  4ZN1 A;  2FHJ A;  1TKX A;  1X31 C;  1J5O A;  2CPJ A;  4QIE A;  3HVT A;  3UDE A;  4KGM A;  5K8O A;  3NGT A;  4ZJO A;  1NZ8 A;  3EZU A;  3D6M B;  2ZH9 A;  1MLA A;  5I4M A;  4RW8 B;  1RU1 A;  2H3E B;  3NOC A;  1UWA A;  5ETN A;  2CQH A;  4OYB A;  3MM6 A;  1OWX A;  5KFU A;  2QX0 A;  4U95 A;  3A4T A;  3DLK A;  1RT5 A;  4OQJ A;  1BLU A;  1S6U A;  4DV6 J;  1GX5 A;  2ZVI A;  5GMK a;  3GII A;  2A10 A;  2HQG A;  1C0U A;  4WK1 A;  4IKA A;  5KFK A;  3TVZ A;  1WEY A;  3BO3 A;  5F8M A;  1FXR A;  3MUT P;  1UA0 A;  2J6S A;  5J2Q B;  2HMI A;  1S0V A;  2OTJ S;  4OJH A;  4CQ1 A;  1QVF R;  2VU5 A;  3B54 A;  3PX0 A;  4WXO A;  4PAB A;  5KT7 A;  4M5I A;  2LFV A;  4IH6 A;  4J9Q A;  5B0C A;  2WVD A;  1D9D A;  5CCL A;  1ZM2 A;  4YY3 J;  4W4M A;  5KG7 A;  4CO1 A;  5E3C A;  2NYH A;  2UUA F;  1FK9 B;  1B7Y B;  2M0G B;  5B0A A;  3SQO P;  4V1A k;  4ZHR B;  1NDL A;  2DNN A;  1CQM A;  4M5G A;  2DNM A;  4LBP A;  1RWW B;  3ET6 B;  1U48 A;  4YB1 P;  5G4D A;  1CS4 B;  1NJZ A;  2CNK B;  2FVS A;  2ALY B;  2MKS A;  4UQT A;  3PV8 A;  2XYP B;  2CZ9 A;  1TL7 A;  2BJE A;  1MRO B;  2PT0 A;  1RIS A;  4C3L A;  4KJI A;  2VF3 A;  1FWP A;  3O8W A;  3FCW A;  3MXH P;  3OVS A;  1KD1 T;  2CPY A;  1Y11 A;  1B70 B;  1CJK B;  4Y3C A;  5B7W A;  3DXB A;  4LR9 A;  1SBR A;  1D8Y A;  5IC4 B;  3HSG A;  3EMT A;  3JTO A;  1KTV A;  5K8M A;  1X4D A;  2V0N A;  4TYB A;  2B9X A;  1CJV B;  2X1B A;  1HMV B;  3B82 A;  2HGM A;  4AD6 A;  3GTY X;  4KH1 B;  5F8H A;  2BVZ A;  4DPT A;  1N52 B;  1SC4 B;  1M1H A;  1KQG B;  4ZVU B;  1S0M A;  1HHQ A;  4EK2 A;  1QAI A;  2EFO A;  3FC9 A;  4ZVP B;  5HLF B;  5KFV A;  3VAK A;  2GMH A;  3KWM A;  2YNF A;  2MMY A;  3LAK A;  2MQO A;  2V94 A;  3W66 A;  1GT8 A;  1KVJ A;  1CJT B;  3QIP A;  4MIA A;  4DV6 F;  1RYR A;  1PIL A;  4USM A;  4L73 A;  2E1P A;  1UL3 A;  1F2G A;  5IM0 A;  3IS9 B;  1J27 A;  3N6M A;  1JIH A;  3UDV A;  4WTO B;  4ECS A;  2DEJ A;  3NCQ A;  2BZ2 A;  5F9L A;  4NE9 C;  1TUG B;  4CZC A;  3E2E A;  1UMJ A;  3MEC A;  1FCA A;  1FKP B;  1HNZ J;  2EC0 A;  4ZLJ A;  4PPZ A;  2AMC B;  3MCM A;  3T19 A;  8AT1 B;  2E44 A;  1IQZ A;  1F9F A;  1FJ7 A;  2C42 A;  1JLG B;  1SCJ B;  3LP0 A;  5HMX A;  1RAE B;  2XMM A;  3E3X A;  1VJQ A;  1VLO A;  4DSE A;  3OXG A;  1HBO B;  4KTQ A;  2V63 A;  5DM7 Q;  4JV1 A;  1ZYQ A;  3HP6 A;  2AW0 A;  5IXU A;  1BE4 A;  4LRF A;  2B7C B;  3JYT B;  2B51 A;  4EBE A;  3VGS A;  3AT1 B;  3BO2 A;  2YKQ A;  1Z4U A;  2E7W A;  2W2O P;  4Y2A A;  1UEU A;  3QT8 A;  2JH3 A;  1R6V A;  1RHQ B;  1KWM A;  2RU3 A;  4PQU A;  3IR7 B;  3IBW A;  4XDD A;  1LWE A;  1CUL B;  2F40 A;  2AU0 A;  2M88 A;  1X8D A;  5KFJ A;  4NZ6 A;  1EB0 A;  2FUG 9;  3BPS P;  2J9C A;  1OJ4 A;  1YVF A;  3T9Z A;  3DRR A;  3MM5 A;  1HHS A;  2FVP A;  2F8M A;  2V9K A;  5CYQ A;  4NAS A;  2HQ3 A;  4ZP7 A;  2UVV A;  2CVE A;  3MMA A;  1NDC A;  1HAR A;  2KB2 A;  2DHS A;  3DRP B;  2X51 A;  2NRE A;  2FIU A;  2EK1 A;  1YZ6 A;  2AJQ A;  3KUG A;  2I5J B;  2N3L A;  1FKO A;  1IBM F;  9RUB A;  2FZG B;  1U1L A;  3R8Y A;  1X4H A;  3A12 A;  4LQ9 A;  3OL6 A;  2XSJ B;  1UEK A;  3K5N A;  4K4Z A;  2F9J A;  3H7H B;  3RR7 A;  3ZZZ A;  2J6U A;  4NCG A;  2BE2 B;  3V4M A;  2YH1 A;  2YKP A;  3PFO A;  2JVO A;  3P5B P;  3MPU B;  4K5R A;  2PGC A;  1BUX A;  3KJF B;  2QA4 G;  1GX6 A;  4UF4 A;  4ATN A;  4OLP A;  2O66 A;  1HW8 A;  3F73 A;  5CD4 A;  2KVI A;  3R6L B;  4ZS6 A;  3PZP A;  2Y3Y A;  3LP1 B;  2FJE B;  2KG1 A;  3K0J A;  3CVK A;  4RJV A;  2H5J B;  2HS0 A;  3R6G B;  2VIC A;  3Q24 A;  2CJB A;  3BBB A;  1TVR A;  4FF3 A;  2NQP A;  2HFV A;  2R8G A;  4MIW A;  1D09 B;  1OQ3 A;  3GZ7 A;  2FPH X;  4PAA A;  4HL9 A;  5HSP A;  1U0H A;  2WVB A;  4HTJ A;  3DXS X;  1UVL A;  4CNZ A;  1UJ4 A;  2MQP A;  2LDI A;  2DXE A;  4HT7 A;  3FKB A;  2ASL A;  1WWH A;  4WJB A;  3HT3 A;  4WF9 Q;  1TAU A;  4ICL B;  4P71 A;  2G9O A;  3G6V A;  4Q2L A;  5I3Q A;  3VAM A;  3HKW A;  4P2M A;  2HVI A;  1S0N A;  3TA2 A;  2B0G A;  4B3T J;  3KG4 A;  4ZVF A;  4F4X A;  1QUV A;  1Q8B A;  5A2Q Y;  2YVS A;  3H2U B;  3H2V E;  1JLQ A;  1WOO A;  4H54 A;  2R3V A;  4OMF G;  1HNV B;  4F0H A;  4LSL A;  4B17 A;  2KYZ A;  1HBM B;  2OD4 A;  5A8R B;  1UJ5 A;  5ETO A;  3VTI A;  1DTT A;  3VWS A;  5IT0 A;  2VQE J;  4DSK A;  1N33 J;  2A1B A;  1XK8 A;  4FPR A;  3FK4 A;  3ENV A;  2CA9 A;  3AHP A;  3CCT A;  4OHV A;  2UVR A;  4DQQ A;  3DC2 A;  4QIF A;  4CH1 A;  1IR0 A;  3DHX A;  1ITP A;  2G2Y A;  2XS5 A;  2NUH A;  2PMZ D;  5K8P A;  1VMB A;  3MHY A;  3NGK A;  4JI4 J;  4OJ3 A;  2OMO A;  4KQZ A;  7FDR A;  4GKJ F;  4ZP6 A;  3DI6 A;  2IM1 A;  2RUS A;  4RX6 A;  5BXI A;  5F3T A;  1S9G A;  5HL7 Q;  2FZK B;  3MM7 A;  4LFB J;  3MM9 B;  2QV6 A;  4EBD A;  3OFG A;  4LFC J;  1B3T A;  1EX8 A;  2ZVS A;  3CC2 S;  1NRK A;  2J0W A;  3M2R B;  4UY8 5;  2EFG A;  4RBV A;  1TKT B;  2WVF A;  4QU6 A;  3M8R A;  1S6P A;  3PW2 A;  3M7V A;  3Q8U A;  1S72 S;  4MK8 A;  5FDL B;  4EYH B;  2DD8 S;  4I2Q A;  4F36 A;  5ADZ A;  3CNQ P;  1F9H A;  1RWP B;  4FVM A;  2W7O A;  3EGZ A;  3NLC A;  1S1X B;  1TL3 A;  2RD5 C;  3LF0 A;  3PY8 A;  1H2U X;  1YBT A;  4M5L A;  4LR7 A;  2UP1 A;  5F3Z A;  3P45 B;  4URQ U;  5KG3 A;  1AT1 B;  4JI2 F;  1VQL S;  2J7U A;  3DCA A;  4MMO A;  5IS2 A;  1U6B A;  4K4V A;  3ENW A;  3TYT A;  2BJ3 A;  2PI5 A;  4F4W A;  1RK8 A;  4C8Y A;  4Z37 A;  4CLF A;  2AYM A;  1GXT A;  1H72 C;  4DBQ A;  1FDB A;  3LP2 B;  4OX7 A;  3L7U A;  3IRX B;  3S6E A;  5C5J A;  3J7Y U;  3V6J A;  1X9W A;  4X4P A;  5E41 A;  1V3Z A;  4P7T A;  3ICL A;  2UV8 A;  3TZY A;  2JOQ A;  5JVH Q;  2MZT A;  2M3D A;  5CD4 H;  4URG A;  3UNY A;  4HT5 A;  3MOJ B;  3R9L A;  2E1R A;  2AEF A;  3L4B C;  3A8E A;  2VQE F;  1AZS B;  1N33 F;  4M5J A;  4KPC A;  3NCP A;  2NR0 A;  5K14 A;  2NXU A;  4ZVG A;  3M8Z A;  2F8E X;  2O5D A;  2Z58 B;  3MED A;  1XQI A;  3TX8 A;  4PXB A;  2A0F B;  1H3D A;  4WKY A;  4JI4 F;  4IFY B;  4DL4 A;  1M5P C;  1YJV A;  1Q0N A;  3M8Y A;  2XY6 A;  2PI4 A;  3J80 Y;  3PJW A;  2IVM A;  1DAR A;  3DMJ B;  4BBY A;  4HYK A;  3GCX P;  1AXQ A;  1JKH B;  1PAE X;  3GJT B;  1JJ2 R;  2DJW A;  4PXC A;  3AB4 B;  1T94 A;  2HHQ A;  2ZEJ A;  4KGK A;  1Y3K A;  1H7W A;  5AJ3 F;  2VJV A;  3QAT A;  2J0Q D;  1LWF A;  2NYI A;  1LV5 A;  1FO1 A;  2QIF A;  1CPZ A;  3BSO A;  2XMU A;  1XMQ J;  2CQ3 A;  3SEO A;  1BGX T;  3D54 A;  2MKC A;  4DG1 B;  1HPZ A;  3UFC X;  1JB0 C;  4X62 J;  5A6P A;  3AH6 A;  5BYQ A;  1QVG R;  2EVZ A;  2K7J A;  1NSQ A;  2B6A B;  2WW8 A;  4TLR A;  1AW0 A;  5E3Q A;  4FKX A;  4C48 A;  1VQ5 S;  3M6X A;  5CZX A;  3U7J A;  5DQH A;  3PO5 A;  2RHQ B;  3NEK A;  3NNA A;  4O3N A;  2DR6 A;  3O6Q A;  5L1I A;  4YHH J;  1OPZ A;  2DGQ A;  3QO9 B;  4ZVT B;  3D6F B;  2CPZ A;  2H48 B;  4QW9 A;  2M7S A;  2FQQ B;  3T5K A;  1JLC A;  2DTJ A;  4TY8 A;  3BB5 A;  1F6T A;  4HH1 A;  1DZ5 A;  4PG6 A;  2PII A;  2UUB F;  1U8W A;  4Q0B B;  1DJ0 A;  4C11 A;  1T9W A;  4I1T A;  4F4Y A;  4R0E A;  3RG6 A;  1PKU A;  4BCA A;  1S1U A;  1YJU A;  3CTR A;  1IVZ A;  3BSA A;  4NRU A;  1KQF B;  2GC8 A;  1C1C A;  2LXU A;  2C2O B;  4DUY F;  2XYH B;  5C42 B;  5J2P A;  2ZE2 A;  3MMB B;  3KMS A;  4W98 A;  1SJR A;  1EP4 A;  1WC1 A;  1TP7 A;  2BQR A;  3OTD A;  1S4E A;  2HNZ B;  1TR0 A;  1K44 A;  1NDK A;  3CDA A;  2H54 B;  1WDT A;  3K7R A;  1Z2L A;  2FYX A;  3PM9 A;  1FDD A;  5L1J A;  3BR8 A;  1D3W A;  2ASY A;  3BYP A;  3S01 A;  3UO0 A;  5D0E A;  1IKW A;  1T05 B;  3I32 A;  1XWL A;  5LMN J;  3MGJ A;  4MAK A;  1HWU A;  3HJF A;  2VZ9 A;  2J0X A;  3TR5 A;  4CTA A;  4USU A;  1LFW A;  1YSJ A;  4OI3 A;  3FCV A;  3OVA A; 
#chains in the Genus database with same CATH homology
 4ANE A;  1S5Z A;  4DUT A;  3EE3 A;  3EJM A;  4KPC A;  3BH6 B;  5IOL A;  1BHN A;  1NDC A;  4ENO A;  2HUR A;  2AZ1 A;  2CWK A;  1JXV A;  1NSQ A;  3GP9 A;  1XQI A;  3JS9 A;  1NUE A;  4UOF A;  2HVD A;  3VGV A;  1NSP A;  3B6B A;  2BX6 A;  4UOH A;  4W98 A;  2DXD A;  4FKX A;  3FBC A;  3NGT A;  1HHQ A;  3ENA A;  1UCN A;  2BEF A;  3PJ9 A;  1HIY A;  4DI6 A;  4EK2 A;  1EHW A;  1VYA A;  3FBB A;  3FC9 A;  3ZTR A;  3VGU A;  1NDL A;  1K44 A;  1NDK A;  4WBF A;  1NHK L;  3ELH A;  1WKK A;  3EM1 A;  3EVW A;  2DXF A;  2DXE A;  1BE4 A;  1WKJ A;  3EVM A;  2NCK L;  4C6A A;  1S59 A;  1S57 A;  3EIC A;  3FKB A;  1B99 A;  2HVE A;  4AND A;  1NDP A;  1ZS6 A;  3NGS A;  4ANC A;  4UOG A;  1KDN A;  5BXI A;  1NPK A;  1W7W A;  1LWX A;  3Q83 A;  3FBF A;  3VGS A;  1NB2 A;  3L7U A;  4DZ6 A;  4S0M A;  3VGT A;  3WX8 A;  1PAE X;  2ZUA A;  2AZ3 A;  3NGU A;  3Q8Y A;  3ZTQ A;  1HLW A;  3MPD A;  3VVU A;  4FKY A;  1NSK L;  1B4S A;  2DYA A;  4F4A A;  3BBF A;  5CAA A;  3Q8V A;  2B8P A;  3GPA A;  1XIQ A;  3PRV A;  2DY9 A;  3FCW A;  1F3F A;  1BUX A;  3NGR A;  1F6T A;  1WKL A;  3EVO A;  1NLK L;  3G2X A;  4CP5 A;  4O0N A;  3ZTO A;  3Q8U A;  3R9L A;  1MN9 A;  1U8W A;  3BBC A;  5CAB A;  2B8Q A;  3DKD A;  3FBE A;  4F36 A;  1NCL A;  1MN7 A;  3ZTS A;  4HR2 A;  1LEO A;  5C7P A;  3ETM A;  1PKU A;  3EMT A;  3ZTP A;  3Q89 A;  2VU5 A;  3BH7 B;  3DDI A;  3FCV A;  3Q86 A;  3VVT A;  3B54 A;  3BBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...