1EHWA

Human nucleoside diphosphate kinase 4
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
HMGTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The human nm23-H4 gene product is a mitochondrial nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2000-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ehwA00
3BH6B 2HVEA 2DY9A 3FKBA 1MN7A 4HR2A 1MN9A 3EE3A 5C7PA 3FBBA 1F3FA 1K44A 3BBCA 1S5ZA 1F6TA 1NCLA 1HIYA 1NDKA 1NDLA 1NLKL 3VVTA 4ANDA 3NGRA 3B54A 1U8WA 3ZTPA 4W98A 1S59A 4WBFA 3PJ9A 3FBCA 3EVMA 1PKUA 4KPCA 2BX6A 3VGTA 1JXVA 1LWXA 1S57A 2VU5A 4DI6A 4FKYA 4UOGA 1NHKL 3BH7B 1BHNA 1BUXA 1NDCA 4F36A 3WX8A 1B4SA 1HLWA 1VYAA 3ELHA 3Q8UA 5IOLA 4O0NA 3EJMA 5CAAA 3Q89A 1HHQA 3EVOA 4DUTA 1WKLA 1PAEX 2DXEA 3FBFA 3BBFA 1ZS6A 2BEFA 3GPAA 3L7UA 1NB2A 3ZTOA 4C6AA 2AZ3A 2ZUAA 3R9LA 3EICA 4CP5A 3VVUA 3Q86A 3FBEA 4ANCA 5BXIA 3DDIA 3VGVA 1B99A 4ENOA 1XIQA 1UCNA 1NUEA 3Q8VA 4DZ6A 1LEOA 3JS9A 1NPKA 3MPDA 3Q83A 3FCVA 3ENAA 4S0MA 3ZTRA 3NGSA 1XQIA 3EVWA 3VGSA 3FC9A 2CWKA 4FKXA 3BBBA 1W7WA 3EM1A 1NDPA 3NGUA 4UOHA 2DXFA 3VGUA 2NCKL 1WKKA 3ZTSA 3NGTA 3PRVA 5CABA 4F4AA 1EHWA 2DXDA 4EK2A 1NSKL 2DYAA 3EMTA 1NSQA 1KDNA 3G2XA 3ZTQA 4ANEA 2AZ1A 3GP9A 2B8QA 3ETMA 3FCWA 4UOFA 3Q8YA 3DKDA 2HURA 1WKJA 2HVDA 1BE4A 2B8PA 1NSPA 3B6BA
chains in the Genus database with same CATH superfamily
1V3SA 2LFVA 2DKOB 3EE3A 3I56S 5K8OA 3TX0A 4UQGA 1AW0A 3BREA 3D6MB 1RWWB 4IOCQ 2C2MB 2UUTA 3MURP 3M4XA 1SJRA 2AMCB 2LDYA 6FDRA 3PIOQ 2B4OA 4LF4J 1K0TA 2YWFA 4JV5J 2KM8C 2JFKA 4N8OA 5L46A 4P74A 3DHWC 4USMA 4HHUA 1E6VA 5KFCA 4ELVA 2LDIA 2ZOFA 2ZKTA 5GAEU 2VQEJ 2LEAA 2AWZA 2AJ2A 2ASDA 4B9MA 3A8JA 3OFEA 1CC8A 4TY9A 5ETQA 4KPCA 1WG1A 2JWNA 2YKMB 1DZ5A 4FBUA 3DMJB 2B7BB 2SXLA 1XERA 2CQIA 4RNNA 1TP7A 4DI6A 3CEDA 5DGBA 4ALZA 2Z8QA 1T94A 2OIHA 2MSTA 5M2RA 2NR0A 3E01A 2H65B 1JNZB 5BYRA 1VJWA 2NXUA 2XGQA 5T41A 1Q0NA 1FI4A 1RGVA 4X65F 3QAUA 4ZVHA 4UZBA 2D9OA 3CCZA 4DX5A 2E9TA 4CZCA 4DDFA 3J7YI 2UVUA 1JNRB 4WFNQ 3HPOA 4NYPA 1BWEA 3R2DJ 1JQGA 4CO4A 5FLXU 4DUTA 5A76A 2JH3A 5F8GA 2B6AA 2DRDA 4HDHA 4TVAB 2MKKA 3MR5A 2ZH8A 2QLFB 3CCTA 3KTQA 4ZP6A 5HL7Q 3NXZA 5AXMA 2RDIA 2YNFA 4QR2A 4PPDA 1YIJS 1QE1A 2RHQB 4ZVOB 5GAHU 5SUHA 2O01C 4GRSA 3RRKA 2V4JA 1WWHA 1Y5IB 2ZNZA 1Q7LB 2VBYA 2H1YA 3BPDA 2Q6BA 4UF4A 3KG1A 3ENVA 3C2PA 2G1DA 2QA1A 3MPWA 2AD9A 2VG5B 1ZAVA 2AEMA 3L3CA 4DL7A 3VTIA 5LSRA 3C6TB 5CYQA 4NWBA 2ASLA 1NZ8A 3LTOA 1FRIA 2HBZB 4CLFA 2WB4A 1NU4A 1C1CB 3H90A 5G4DA 4BWMA 1AFJA 3NAHA 3TP2A 2DD8S 3H42A 1LW0B 2VJUA 4DV7F 4C2MA 3Q83A 2EK6A 2HHHJ 3HHLB 4YN3B 1FCAA 2K1RA 1RT3A 2PI4A 4YQWA 2G0IA 2GA7A 4S0MA 1PYTA 4KKOA 3M8QA 1JLFB 4BBYA 3HVRA 3VAMA 1FXRA 1YJUA 1IVZA 4G6VB 2YWEA 2IYIA 4WTOB 2DHHA 3NY0A 4ILRA 3TZZA 3TJ8A 1UVJA 2XS2A 1H3DA 1F3VA 3S1TA 1RTIA 5EHHA 2DXDA 3UQSA 3EZUA 1FNMA 1UAWA 1IQTA 1KHWA 1Q8LA 5D4LA 2DGSA 4MKYA 3DNCA 2HQ3A 3M30B 3AJ1A 1HNXJ 4HT7A 5KG0A 3MM7B 5DG8A 2C3OA 3X1LB 4YB1P 1N52B 5CZXA 3L95X 1UKUA 3PEJA 3T9NA 2WHOA 1QVFR 2CQ1A 2WTFA 5IC6B 2B43A 5IM0A 3LWMA 2AP6A 3HHDA 3KUEA 4N5SA 3CCRS 2HWHA 1M5KC 2UXDJ 1BE4A 1WHWA 4RR5A 1WC4A 2ZHBA 1NSPA 2N4CA 5ETSA 2UV8A 3DFEA 3A8KA 3QFHA 4HI2A 2JVOA 3H4BA 2LU2A 1CSJA 1BC6A 3G6VA 1N5SA 2XEXA 4TN2A 4LREA 5D78A 3OL8A 2JOQA 1SKSA 4LFCJ 3R6LB 4CO5A 1XBWA 4HKQA 1VR6A 2C42A 4KQZA 3MMBA 4Y6IA 2C2RA 2UUCJ 4X2BA 1X7VA 3TA0A 3QIDA 1UFWA 2JL9A 5BR8J 4DX8H 4CLYA 3O8WA 4EU0A 3KUHA 2H3EB 3MR6A 1XMOJ 3GZ7A 3C14B 3FEZA 3K57A 1JIHA 1TTHB 1S59A 1TMJA 1V6HA 2HRUA 3MM5B 2JX2A 4GKKJ 1UFLA 2J9EA 3IS9A 2VG7B 4GVBA 4LUBA 4F0HA 4QWCA 3Q0AA 2XO6A 4J9RA 4DR7J 4KKOB 4DSIA 3QLHA 3FSXA 2C2ZB 4P9SA 1JXVA 3AXMA 2C2EA 1OYEA 1RCXB 2A6MA 2E1CA 2G0JA 3DLKB 1NM2A 4WFAQ 3EZOA 1DY3A 1RAAB 2WONA 2YNFB 4ZPWR 3WIVA 1N8RT 2E9RX 3NOCA 4EI2A 1K1SA 3JYTB 2IA0A 3MM5A 2JSXA 3RB4A 4HL9A 2BQRA 2XSFA 4NRTA 3W2WB 4B02A 3BF4A 1GX5A 1T03B 4F67A 3WX8A 3PW2A 2XSJA 3ET6B 3C46A 4GC6A 1Z2LA 2EI5A 1CULA 4QCLA 4DQIA 3MR2A 4I2QA 1ZTTA 4O0NA 1LWEB 3DYAB 1HHQA 2UZAA 1FT8A 1GK8A 1C0UB 2MEWA 2MSSA 3ISND 4KR0B 2ZDOA 4NPOA 2DXEA 4K8RA 5HMZA 1SUQB 4YR3A 5L1JA 1UWBA 1R6YA 1A0OB 4ZDNA 3OTOF 3CCUS 1R0AA 2DNKA 2V9WA 2A3JA 1WG4A 2WAQD 3ULHA 2ROEA 1CJTA 5SZTA 1U4BA 2ZUAA 2OLWA 2E5LF 3AQPA 2ZC4A 2OD4A 3CD5A 2DR7A 2BJ1A 1SJ1A 1X4EA 2CFXA 5HN0A 2UXBF 5ETTA 2MY7A 1UMJA 1YZ7A 1PAUB 3CDEA 3EGWB 3P45B 4NLGA 1CLFA 1HHTP 3IRWP 4DG1A 2L9NA 2PSZA 1Y4ZB 2XMKA 4DZDA 5K8NA 2P2CB 3CT9A 2JHEA 3HSDA 3UN3A 4ICLA 3Q22A 3TJ9A 2FGCA 4X4OA 2IM0A 1KQFB 3R27A 1VOMA 3Q8VA 4K2JA 1RBAA 3Q8SB 4ECTA 2K8GA 1VBYA 4DL6A 3TZWA 4DV7J 1LEOA 3GIIA 3G8SA 2Y1IA 1KFDA 1HI1A 2IJFA 2E29A 3KK1A 1S6UA 3IWNC 2H4WB 3LGMA 5FIIA 3LP0A 1U1OA 2XB2D 2OO4A 1N36F 1ICEB 5ETVA 5HBMB 2OH2A 4WZMA 2F8MA 1S4FA 3MDFA 5LT5A 5C5JA 3PEHA 1KRPA 2BJEA 2OTJS 1X9SA 2JDJA 2RRNA 4MKAA 5ETPA 4M5MA 2RQ4A 4KGMA 1J5OA 1JLQA 2JFDA 3N6NA 1G4CA 4O3PA 5CABA 4K5RA 4B3RJ 4P2MA 4YDDB 4OYAA 3CULA 3PR4A 1EIYB 4I6AA 3TYTA 3AHPA 5KG7A 4FF2A 2JNJA 4R8UA 1KD1T 3CCES 1FERA 3M2UB 3RZAA 1PG5B 4M5LA 1RAFB 4NL5A 2BJDA 4NOHA 1N0UA 2CJAA 2KDOA 3I6PA 3UN2A 4AYBD 2A18A 3PFEA 4N7TA 4OIXA 3UNYA 3WBZA 3W5ZA 4AD6A 2ZM6J 1URNA 2VPXB 4WF9Q 2OSRA 3GSIA 4XDDA 2V34A 4CRJA 4WKYA 4LF5J 1FDNA 2FUG9 2UUAF 2HVDA 4KFBA 1FRLA 4Q5VA 4FF1A 2ZH3A 2IM3A 3NAIA 5F3TA 2QRRA 3TEHB 2IRYA 2XQCA 4LFCF 3LP1A 4KH0B 3W65A 3ZTSA 3I9V9 3LAMA 1S6QA 1EARA 1DTTB 3PHTA 1HD0A 1RT2B 4P2SA 1T3NA 1VC5A 4Q8FA 1U8WA 4B08A 3LF0A 1U1LA 4IFYB 4LFAF 3MZIA 2HS4A 1K0VA 4DV4F 2HEKA 2KL8A 2X3GA 3CD0A 1RAEB 3A13A 4HEA9 4EMDA 4DV5J 2AYGA 5L9XA 1UW4A 2YQ0A 1U45A 1XNQF 2RSQA 5DG9A 3KMSA 2VODA 3P49B 1UVIA 1QTMA 4ATNA 1XMBA 3KLGA 5KFSA 2BX6A 3EYZA 1IBMJ 1B64A 3AJ2A 5L9NA 2YKOA 3A3PB 5HP1A 2HAFA 4B9UA 2CQ0A 2W9CB 1QTNB 4WTYA 4KB7A 4ED6A 3UDEA 1T9WA 4JV2A 2VC0A 1JJHA 4OYWA 2CPXA 1YVFA 2YX7A 4UY8T 2Y8WA 2H5IB 1ZA1B 2WSCC 2KFYA 1A7GE 5DLGA 4LF5F 3SCIE 1H7XA 4PG6A 3I55S 1YK9A 3DRRB 3H0PA 2M8DB 3D66A 4ZK7M 3G82B 5GMEA 1FK9B 1S1TB 2DNRA 5J2QB 2R7XA 1RHRB 2XG8A 3H20A 3HHEA 4PEOA 4DV0F 3M2RB 1KQKA 2D3ZA 4MIAA 2PA8D 1FDAA 1N48A 1FDBA 2QYCA 4CLWA 3OTEA 5DGAA 4JYAJ 3GPAA 3D54A 1FX4A 1AT1B 5J2MB 1ZZNA 3HHKA 4DJBA 1IKWA 2AZ3A 3MF5A 3MEEA 1RADB 5I42B 1RYRA 3RYLA 3PY8A 2AX1A 2Y1LB 3KJVB 4ES3A 5J2QA 1JLAB 5HQMA 2G13A 2XCPA 2DGVA 4YR2A 1HKAA 1BQNA 1QUVA 3FK4A 3MOJB 2ZITA 3DDIA 3HULA 5HVGA 2DTJA 2R7UA 4Y65A 1G1XA 2EFPA 2I5JA 1RT7B 4QIFA 2MKIA 1IKWB 4I56A 5H9FK 1X4BA 1PO6A 4LR9A 3CCVS 3P3DA 1G3OA 5A6PA 4AL7A 3FGVA 2E44A 2MGZA 4F4WA 4DR7F 1GXUA 3JS9A 2CDRB 2JVRA 4PABA 2EFGA 5DS7A 2XY6A 1WI6A 4RLEA 5KFQA 4CO2A 3DDNA 1QM9A 2XTJP 2V4RA 2VFVA 4FXDA 4NA1A 4K50A 1QSSA 2J7UA 4I69A 3W5XA 2R7WA 2AJFE 7FD1A 2I0XA 2ROGA 4O44A 1SC3B 1E6VB 2FLOA 2VFRA 5J2NA 1YJWS 2M4MA 3JTNA 2DRAA 2KZMA 2GC8A 4OV6A 2PN6A 4J9VA 1YX2A 2VD3A 5B0EA 3W2VB 3CMAS 4F7VA 3ILJA 4MJKA 3NGTA 3BKFA 4UUWA 4AFFA 1J5EJ 2XZDB 1RE1B 1X4HA 4LRAA 4AT1B 4JI3J 3AJDA 2VOOA 1RHJB 3NG8A 3AD9C 1CQNA 5I3UB 2LECA 1NH8A 3R5GA 4BDPA 5HMXA 1HNWJ 5ITHA 4H4OB 4QIEA 3VF0B 5HK4A 4F2SA 2E5HA 3O3LA 4WXWA 5IQQA 1W25A 4C0HA 3V6HA 1S1XA 4IH6A 3VR1A 5LXYA 2HHXA 3IP0A 3ILOA 1G2EA 3QJLA 3F56A 1XMQJ 5B0CA 2W4CA 1X9MA 2BDPA 3UDVA 1NJIT 1AFIA 2XWYA 4K4VA 2HFNA 1SC4B 2ZH4A 4DR6J 4B3OB 3KLIB 4E8UA 3N0VA 2HQCA 4P52A 3LPYA 1UP1A 3DGPA 5K5MA 1YJRA 3MD1A 1FWLA 1TL3B 3JSMA 3G4SS 3TR5A 3M8RA 5JJBA 2NXNA 3W8GA 2CNLB 2H4YB 4JI6J 5D77A 2LXIA 2ZVSA 3DLEA 2YPYA 1U1PA 1VQYA 4K5SA 2PMHA 4PPZA 3TRGA 4C48A 3RU0A 3POTB 1U6ZA 2R3VA 3GIKA 2GHPA 5DQGA 3H5YA 4EBDA 2PFDA 1WHYA 3ZZTA 4IUFA 4YOEA 4RUCA 3MFIA 3CCWA 3D0GE 4M5JA 2EWHA 4WWSA 3N5FA 5KG1A 5LJ3Y 2VICA 2R7TA 2LP4A 2YWGA 2K3KA 1RTDB 7AT1B 2EFNA 1PILA 5G0RB 2KM8B 1XTZA 5HLFA 1JLGB 2R9LA 4H4MA 5DM6Q 4O44B 2XI3A 2VU5A 4FKYA 4L76A 4UOGA 2O5DA 5AE2A 4OJHA 4P7VA 4LF9J 5JVHQ 1CVJA 3ZZOA 2B51A 2EG2A 3K2YA 3MECA 4TLRA 1Q53A 4ELUA 4Y0FA 4J9QA 2ZBQA 5I3UA 4F25A 2ZEJA 1OY6A 4V19J 3BYRA 4XDCA 2GGPA 3KLEB 1U6BA 2A10A 4WKRA 1YSJA 1YBUA 1GH8A 1SPBP 4HDGA 5IOLA 1EB0A 4NCAA 4NLVA 4ID5A 3O6QA 2CPFA 1VQNS 5T7LB 3BO4A 3TANA 5C42A 1WTFA 1M5HA 1N5YB 1WKLA 3GG1A 1TZ0A 2IA6A 1LFPA 2FJVA 2DCLA 2W7OA 3KYLA 3HM9A 2AJ4A 2HWTA 1SC6A 1NB2A 3UWTA 1NZAA 1VMBA 4JV1A 5CCLA 1C4AA 2XMTA 3H7HB 3R9LA 3RUBL 4Z37A 4KO0A 2R42A 4IO9Q 4IDKB 2GW8A 3EZ5A 1TL7B 3TJAA 1FA0A 4GO5X 1RBLA 3OTOJ 2U1AA 5DG7A 2WVCA 1B0VA 3FZ2A 5LSLA 4PR6A 5D0HA 5CD4A 3GV5B 2DNZA 3CGIA 3G86A 3VGVA 2Y8YA 3PYFA 2W2QP 1Y3JA 3OQ2A 1OS5A 2B4VA 3R5DA 3UD5A 1B7YB 1PC5A 3HZEA 1FRMA 2BRLA 1NXIA 2DO0A 4DR5F 3NL0A 1RA6A 1WTBA 4FNIA 4TY8A 2MKCA 3ILIA 3J7YU 3DLHA 2YKNA 5EX0A 4DPXA 4PUOB 2PDAA 4CI0B 3HD1A 3GCWP 3TQEA 2ZD1B 3ZO7A 1FESA 4E98A 2QA2A 4M5KA 4DF4A 1HBMA 2V0NA 3DRPB 5H9EK 2D3OR 1RWKB 1MW7A 3DHXA 3KDOA 2IDEA 5E41A 2GVZB 4NMLA 2C28A 1V3ZA 2M3DA 3C3LA 4FVMA 5M2UA 4I6YA 4ZKAA 4RL1A 3NNAA 2DNHA 4LR7A 1HNZF 2KH9A 2LQBA 4DX7A 2QL7B 2FYXA 4JI5J 1FK9A 1OO0B 1S1TA 2C3PA 3VGUA 2J0SD 3GU0A 3JQMA 4ZOSA 3MCSA 2IHR1 4EO8A 4RWWA 4LRCA 2ALZA 4DSEA 3EGZA 1U09A 2YPZA 4RNHA 2V6AA 2MXYA 3BSOA 4TQSA 2F7VA 4IFYA 2FJWA 2KXFA 3QPIA 4QU7A 1PCAA 4CLPA 3QIPA 3C8YA 5HAOA 4CM0A 5JUMA 2HQIA 3UCUP 2CAJA 2ZVIA 5B0DA 1KVIA 5KFTA 4ZLJA 2G9OA 4ANEA 3SBMA 2W8LA 4NE9C 4R0EA 2R2RA 1N6QA 5E3CA 1YRTA 4K4YA 4DPUA 3KHHA 1BQMA 3I5AA 4U9RA 1KBRA 1NMEB 1VGYA 3V2UC 3D5MA 5HJYA 3QT8A 5IWAF 4I2QB 4ECVA 2CQ2A 3N01A 2HURA 1M5VC 2E1RA 2OPRA 3UR3C 4CLZA 5DZ7A 5AE1A 5GADU 3VALA 4KHMA 2RMLA 5LJ5Y 4WIQA 5D15A 3T1HJ 2YNGB 2OP5A 2KU7A 3MM9A 4P2FA 3HMJG 2QYGA 3MMAA 4EYIB 3BV8A 1D9DA 2MGZB 3DM2B 4DPOA 3QSYB 1T11A 1RTIB 2IM2A 3BBCA 1Q82T 1DTTA 1NCLA 1RI7A 4WFYA 2F65A 4QZVB 3V6JA 1XWLA 5HATA 4RBUA 1R0AB 4ANDA 2IJNA 2E66A 3J80U 3PFOA 2CPYA 1S6PA 2OPRB 2OPPA 4YB6A 5LOQA 4F2RA 4A8FA 4MIWA 3AFGA 3H2VE 5HO4A 1X0FA 2AU0A 4ZLLA 4IQMA 3UVJA 2QIFA 2M0GB 4L72B 5DDQC 4ECUA 5D4PA 1RLDA 3BGUA 2OMLA 2J0XA 1UTAA 4Y28C 4O3QA 4CLSA 3VCDA 2VV5A 1H2VZ 4CNZA 4K4WA 2KTQA 2DO4A 2DY1A 5GVQA 1Y5NB 4OJGA 4DN0A 3SCKE 1Q95G 2JLEA 3I5CA 1S77D 4G1QA 3WC2A 3W9JA 4B3SF 4QOTA 2OJ3A 3OHAA 4LR8A 5LM7E 1KVKA 1R43A 4YB7A 4JI3F 4JB8B 3OLAA 2ZJQQ 1PC4A 3ISNC 3R5JB 4R5PB 3D28A 1BHNA 3CJQA 5BYSA 3F0NA 1R6VA 3AAWB 4ZN3A 3HSGA 2WVEA 2C2OB 1HLWA 3KLIA 3ZFVA 1X0PA 3LGHA 1X4DA 3EJMA 3WZ0A 3EVOA 4C11B 2NUHA 4J9PA 2MQOA 3IC1A 3W60A 4BLGA 1NHVA 2WBRA 3TVZA 4U8VA 3MM7A 3QJJA 1U1MA 3PKMA 3DC2A 3CC7S 3S8SA 1HWUA 1TKXB 3I0RA 1ZS6A 1U1KA 3BYPA 3L7UA 1UFKA 2RKIB 4NZ7A 3NKYA 1QD1A 1O5JA 5KFZA 2KN4A 4OX6A 1ZPVA 4PG4A 3KFWX 2CQPA 1I51B 5CYQB 1DQ9A 4OHYA 5C42B 5KFKA 4YR0A 1RUSA 3IFEA 2VDIA 1Y7PA 1D3WA 3HI9A 3OTBA 4CQ1A 4B3TF 1WHXA 3KJFB 2PT0A 3PRDA 1YITS 2FLLA 4X4UA 1OIAA 1TL5A 5FDLA 5KT5A 4O3RA 4PWDA 4Q2MA 1JX4A 2AF6A 4JI7J 4A47A 3B8HA 1QVGR 2HFZA 2B9EA 5FLXY 3O5TB 5E33A 3VZHA 1Z2ZA 1IM6A 4ES2A 4XPCA 3TW0A 3FFIB 4FYWB 4I7FB 4WFZA 2HFSA 4KT0C 4HLBA 2KVQE 4OI4A 2B4PA 4DZ6A 4LMZA 3LP1B 2KVIA 2YWWA 3EWGA 1RKJA 1WOSA 1LWCA 2CADA 3AH6A 2ZKUA 2FGOA 4NYOA 4LFAJ 1U25A 4HHHA 2BV3A 4I0WA 5J2PA 1ZH5A 2GQQA 1HWJA 1NPRA 3CO9A 3ENAA 1WC0A 3BPSP 3QMQA 3DOKB 1QJHA 3MM8A 4ID8A 1S9GB 2F9JA 4N77A 5D4NA 4JI2F 3VAGA 2DJWA 3DOMB 3TI0A 4FKXA 2FTRA 3MAAA 3DLBA 3SFUA 4HACB 2QMUB 1W7WA 4RW6B 1NDPA 3G71S 3JTPA 5KT4A 1H2TZ 4MH8A 2DXFA 1X4FA 1LW0A 3HFVA 3J81Y 3V4IB 1YHQS 4I67A 4NLDA 2XZTB 2KO1A 3IBCB 4F4AA 4C3MA 3OJSA 5D0RA 1I5OB 1MROB 2DIVA 1AA1B 1IKVA 1EHWA 3HHNB 1S9FA 6AT1B 1WF1A 2BW7A 3GYGA 4IG3A 4IYQA 2HHUA 3MHYA 3AOBA 4C11A 3AA9A 1KOHA 2CNNB 2IAJB 3IR7B 4FYVB 3SCJE 2FPHX 4JBCA 2WOMB 5A6WA 5G0RA 4DQQA 1FJGJ 2GAGC 5C25A 2MQNA 3FCWA 1NK4A 1J2VA 1S0VA 2OPSB 2W1BA 3J81j 1MROA 1CJKA 1YTYA 3KDNA 3LWLA 2EKYA 3DRRA 2MQQA 1EKRA 4KHRA 4DQRA 3R1LA 2UXCJ 2VOPA 5IT9Y 3CC4S 5KFJA 4LF8J 4MFBB 3B6BA 5KFNA 1YJNS 2DNNA 2H54B 4PXCA 1KQSR 3OPKA 3WQPA 4FBTA 4PQUA 1MN7A 3OD2A 3G96A 4LBHA 5C7PA 2LYVA 2D1CA 5A8KA 4DCJB 5DDRC 4JYAF 3CDAA 1OSCA 1U24A 4OZLA 2Q6CA 3UD4P 2MQLA 2CJQA 1R8CA 2ZOMA 3I0SB 2HK3A 5AJ3J 3HK2A 4J5OA 1LXNA 4YEAA 4RW7A 2Y1JA 2L3MA 2DHSA 2BE7D 2E5IA 3N79A 4ZVFA 1PBAA 4ZJOA 5J1NA 1JLBB 3RTVA 4LF7J 2ALYB 4OLOA 5D0GA 2VBXA 3D3CJ 2V68A 5B0GA 2W8KA 3KLVA 1ZTWA 1T7PA 2ZJRQ 4JI5F 2ZOGA 3T1YJ 5C24B 1GMUA 2QX0A 1C1BB 1SC1B 3MGJA 5ETKA 1VQKS 2XHCA 3CO0P 4WP3A 1RCOB 5ETNA 3W64A 1J5OB 1FJGF 2AT1B 1J27A 1H7WA 4DL0C 3OL6A 2QE5A 3DGVA 4TY8B 5J2NB 3MEKA 3ELHA 2I38A 3ZZZA 2HVZA 2VG5A 2QLJB 4RJVA 3BQ2A 4UY85 1B70B 3ILLA 3W9IA 2OHDA 4H4KA 1LKZA 4ECWA 5KFVA 4N76A 1V5VA 2OELA 1X8DA 3WX4A 3ZC4A 1RT4B 2GAHC 2ZC3A 3MTJA 1IBCB 1VQ8S 4ECZA 2WCXA 1U0HB 2ZFHA 3AB4B 2K1RB 2VKZG 1U48A 3MR7A 4A8XA 4TXSA 2R8GA 2Y0BB 3D6TB 3QWPA 1Y0HA 4NCBA 2HNZB 3BGFA 5J1EB 1KLMB 2MLYA 4A8SA 1ZZFA 2CNOB 5CYMB 4YP3A 2HLUA 1TFWA 2GMHA 4HH0A 2MLZA 4ZVTB 4FVCA 4OI3A 1FNXH 4RO0A 3QRRA 4B3OA 2BA9A 2J9DA 2QZ8A 4QR1A 3CCLS 1U02A 2C2NA 1TUWA 4Q0BA 2G2ZA 3VZIA 2HS3A 2ZE2B 3K89A 4X64F 3HLUA 3P5TL 4KGKA 1DJ0A 3BN7A 2PE8A 2CDQA 4NLTA 3OR1A 4MKBA 3TAPA 2FC8A 2DNPA 2E7WA 2LXFA 3HVAA 1S7HA 4KGVB 2DH9A 5F8IA 2JEJA 3HO1A 1YRUA 2FHJD 3LAKA 2AQ4A 2KRRA 4K4TA 5E5NA 3ITHA 4M94A 3KLHA 2VFTA 2CRLA 2IYGA 3MAHA 3BGRB 3NP5A 1P8GA 3O44A 2VG6B 3PYDA 4OI2A 1CJUB 1REVB 1X5TA 1YLXA 4PAAA 2KI2A 2X1AA 1RTDA 3DLJA 4DV0J 2AGPA 2IBOA 1VBZA 3BDPA 2N3OA 2COLA 2RF2A 4A8OA 2IC3B 1F5CA 1HI8A 1IR2A 1R8BA 4F8RA 4QU6A 4DV3J 1XR7A 1IKXA 3AY0A 4TQRA 1OPZA 2V4QA 2FLNA 5DJBA 4IKAA 1RSCA 3I9ZA 1X4CA 3MTKA 1Z1ZA 4MKVA 5F0WA 2JJ4D 5KOXA 3MFHA 1RWOB 2QLBB 1NO8A 3DRXA 3MUVP 1WOPA 4LF8F 5K20B 4TNOA 3I0SA 4F4KA 5GMKa 5AXLA 1S1UB 2GO9A 2ZUGA 3M05A 1SL1A 3EDQB 4Y2AA 1N6QB 5ETOA 1O0PA 4O3OA 1LK5A 1RHUB 1UPPA 4Z2XA 5A8RB 1OQ6A 4U95A 3R97A 3V81B 2ZZMA 1VFJA 1RKIA 2CJBA 3FMBA 1UA0A 1R89A 4OI6A 1FEHA 3PIPQ 4PQAA 3TX8A 2R7VA 4DCPB 2E5LJ 1SQEA 1YJ7A 1S5ZA 3QNWB 4QWDA 4DS5A 4J9OA 4ZIVA 5AJ3F 3OVSA 3CNQP 5KT7A 3OL9A 3QWUA 3B54A 5CH7B 1ZPWX 3DCAA 3MCOA 4Q0BB 2BZ2A 1L3TA 1FEEA 4QBUA 3J80Y 4F50A 3N9UC 2RDDA 2X3DA 1NSAA 3KLFA 3KK2A 4IOBA 2W2PP 3PJ9A 4C97A 1LQ9A 2LVWA 3QAEA 3PTWA 4U67Q 1HI0P 1CJVA 4CT8A 1M90T 1PKUA 1VQ5S 2HYIB 3GILA 2DNQA 1L3SA 1NH7A 4RWXA 3VGTA 4ED5A 2MQPA 4A8KA 4OZ2A 4LQ3A 1IQZA 3CIZA 3FSYA 3KLGB 1YBAA 1RLCL 3FSIA 1TV6A 4X84A 4GKJF 2ZHOA 3W2VA 3RBXA 2AW0A 1N5TA 4OYBA 3NGDA 1WEXA 2XS5A 2FJDB 2V9KA 3RAXA 1D8ZA 1NDCA 1WOOA 1F9FA 2EPIA 1FWKA 3S01A 2MQ8A 3F44A 3RGIA 3UPFA 1HBUA 4B3SJ 5IM0B 3OXGA 1HBOB 4A48A 2X1FA 4DUYF 1N54B 2B4UA 3SIPB 3PYGA 4FYYB 4URQU 3ZZRA 4CNYA 1TKDA 1UVNA 4K4ZA 3K5LA 3HP6A 1OWXA 3L7OA 1F2HA 5F9LA 3TAQA 3DN9A 1JK9B 4DFMA 2J6SA 2UXCF 1QUPA 1UEKA 1YWXA 1XEZA 3OV7A 3QIPB 2OAUA 3QT5A 2I5JB 2B3TB 3TEGA 4C6AA 1EAYC 4NLXA 4ZVQB 5JXSA 4P71A 4NXMJ 2C3MA 2PEBA 3KKFA 4J90A 2QMXA 4DOZA 1APSA 2JC1A 1UJ5A 5DETA 1KN6A 1N5QA 2F8HA 2BE9B 3ZZ0A 3N4WA 4RW7B 1S76D 2H9ZA 3TVKA 4LBIA 1CJUA 1S6QB 4DV2J 4YS2A 4ENOA 2BQ3A 4WK3A 3RR8A 4IR9A 2MMYA 2NUUG 2OEJA 3SFGA 4ELTA 3RW7A 4WYWA 1ZM3A 3EX7B 1RWPB 1RTHB 2WONB 4OX8A 3M2UA 3VAHA 3TAMB 2DVIA 1HBNB 3PX4A 5KFIA 2VA3A 4JI7F 1FJCA 4ZVRB 1RACB 2HPUA 3GYXB 1LK7A 3N6MA 1VK3A 2HS0A 4X4TA 3V6DA 2BOAA 4WPAA 1S0MA 1RHMB 2G4BA 5CCMA 5FD1A 5ETRA 5KFEA 1T9XA 1CULB 3M8ZA 3CCQS 1P1LA 2UU9J 2VFUA 3OR2A 4R0JA 4XPEA 2AYBA 2ZHAA 2HZAA 1TL4A 2PMZD 1R27B 4LSLA 4DLEA 4DSLA 2Q79A 5AXNA 4P2XA 4ETXA 1N36J 1WKKA 1RWNB 1LOUA 2RNEA 3E8OA 1JXEA 3U27A 1J5EF 2R8KA 5HBMA 4JI2J 3T41A 1XMQF 1EP4A 4ZJQA 2B56A 2BE2B 4IG3B 1BMQB 4EK2A 1S7IA 5HMYA 5IT4A 5KFBA 2DYAA 4FNHA 1KS2A 2WRMA 3U1MA 1I3OB 1YZ6A 1RA7A 5CYMA 1HNXF 1N5YA 5J1EA 3M1VB 4KC5A 1VQ9S 1U1QA 1NK9A 4QYZJ 3W1YC 4DG1B 1WC6A 2MHNA 2XI2A 4PRFA 2PI5A 2RD5C 3SDEB 2W7AA 1UJ6A 3CJTA 1S1XB 3MM8B 4RUHA 4LBPA 1DFDA 2EFQA 4ZHRA 1PJ6A 2J8AA 4ED8A 2GMJA 5KG3A 4LFBF 4OHZA 3BB5A 2RKIA 4CLUA 2NQPA 2WZ1A 1NLKL 2XCAA 2A2CA 3WC0A 2A1BA 3NGRA 4H4MB 4WXOA 3Q2SC 3JB9k 4ECXA 3NOGA 5DLFA 2VHGA 3BO2A 5K8MA 4KPYA 2L9DA 4ED2A 2HNDA 5FDLB 3LANA 1FXLA 2WVBA 3I4HX 1HMVA 1VQ6S 1WEZA 1E6YB 1FNOA 2HZCA 1F60B 4M1KA 4J9MA 4DR2F 2XGPA 2GX8A 2XY5A 4CYUB 3TQ1A 4R8UB 4FXVA 4FS2A 1U49A 4GO7X 4OYIA 1ULRA 1TK5A 2F63A 2YVSA 3AD7C 3C66A 3K5OA 4K4XA 3OT9A 4C4WA 3SQGB 3JXOA 2YWHA 4IG0B 4MMOA 2KT5A 2I8EA 3J7ZT 3RAQA 4JI1F 1T03A 1VBKA 1HW9A 3PO4A 3W2WA 2DHGA 5H9EJ 3N28A 4OYXA 2Q43A 4QW9A 3D7SB 2LQ5A 2PO4A 4B9LA 2BANA 4YUDA 4CO1A 2FC9A 1R7IA 3UVJB 2HW3A 2KFZA 3IMQJ 3T1HF 3OSNA 3CD7A 1FVSA 5H1SV 1AZSA 3P5BP 1PBUA 1FKPA 3M32B 4C8KA 3R5CA 5IT9U 1RU1A 1SJFA 1SJ4P 3GR0A 1BWVA 2W01A 4ZPTR 3EUNA 4F26A 1OPIA 4U6PA 2DR9A 1VS3A 1FTCA 1VLYA 2B9WA 1IN0A 1KONA 1D9AA 2CG8A 3EICA 5C25B 4ZIWA 3M6XA 4PCQA 1IBLJ 3JSYA 4FXWA 3QATA 2DPJA 3FRZA 2CVIA 4U8YA 1SKWA 3RB6A 4JI6F 4DR2J 4O3NA 3IA0A 3M2VB 3W63A 1HQEA 3UI3A 3IGNA 2R4FA 1D09B 2OPPB 3A3OB 5A8WA 1S9GA 3ET6A 1M1HA 2XLIA 2EW9A 5HP1B 3PX6A 1SB6A 3KHRA 1SKRA 1U1RA 2YXLA 3CB4A 2K7JA 4IRKA 3D6FB 2A0FB 3VHQA 3QZ8A 4ECYA 1RB0A 3LALA 4UW2A 1T0TV 5DZ6A 4KFBB 4A46A 2MJUA 5HROB 3G8QA 3GMGA 4RW9A 3D68A 3P4UB 3TZYA 1XQIA 2Z2ZA 3CWJA 5A8WB 3R1HA 2HGLA 3H2LA 3BQ1A 3SZ2A 3PO5A 3BGOP 4MK9A 2IRUA 4J9NA 4UOHA 2BMBA 2CQBA 1VC0A 4L3KA 1ROFA 1HFEL 1KVJA 2L48A 3PRVA 4CTAB 3GG0A 5JVGQ 1S99A 3AA8A 1FF2A 3GJTB 4RBTA 5LMUJ 4W90B 3GLJA 5A2QY 3NEKA 2OPSA 3K5PA 1MG7A 3OTDA 4X65J 3M8SA 5LSOA 3TUIC 3DI6A 2CPIA 3JYTA 1RHQB 3BSAA 5E3PA 4DFJA 4FPIA 5KFWA 2XMUA 2CZ9A 3TUJC 3UW1A 4P10A 5KFYA 3GP9A 2B8QA 3M8QB 1FJEB 1VRUA 3GJQB 4ZPVR 3FVYA 3T6BA 4LRFA 3BR9A 3NBPB 1HMVB 1GNKA 1EX8A 1YDLA 1SI9A 3V4IA 1FO1A 1C0TB 3K8WA 4IDKA 2WVDA 2HHSA 4D3GA 1UW9A 2O1PA 2QN6B 3QGPA 4EUVA 4YDXA 3M6WA 3VAFA 4LFBJ 4Q8EA 1IKVB 2NREA 3TAMA 1K44A 3UD3P 4NLYA 2I2YA 1NDKA 5KAKA 4DL5A 2KYZA 2BKOA 3R3TA 3SSQA 2RU9A 2WK4A 2EBGA 2RDJA 3D1HA 1VLOA 4M63A 5KFFA 2AHOB 2W4PA 2J7KA 4ZMMA 4XIUA 2WB1D 1HNIB 4J37A 5LMNF 2EG1A 3CF5Q 2UU9F 3CDWA 1XK8A 3NCPA 4QWEA 1S0OA 2JEIA 4OZ0A 4F3MA 3RJMB 4H4OA 3FEYB 1KP6A 2MKSA 4Q43A 2L41A 1LW2A 3TWZA 2XS7A 3FQKA 2Z56B 1G7CB 4QPXA 2YH1A 1QDUB 2OFGX 4OV1A 2OTLS 3LPEA 4ECRA 2M8HA 1BUXA 1CS4A 1JLGA 2RH3A 3DXBA 1PGZA 4ILLA 4LF9F 4DL2A 4ZCLA 3RBZA 1S10A 3OUYA 2KJVA 3SDEA 4OQJA 3KLHB 2UUAJ 1R0BG 1Q4RA 4JUZA 2ZH1A 3M2VA 4IO1A 3CCJS 2VUGA 3QGGA 7FDRA 3GIJA 2VBZA 2WW8A 2XULA 3U02A 4RUBA 5CD4H 2QEXS 2V67A 2WW4A 1BLUA 2XBPA 4ZPCA 2EBEA 3HFZB 1X9WA 2CA9A 1MU2A 2RAQA 2ZWOA 1HNVA 3AD8C 4ZHRB 5B08A 4DUZJ 4OX7A 3QSIA 4YHHJ 1GMWA 4CCHA 3KOAA 3HKWA 4M5NA 5IV4A 2MQMA 1RXOB 4ZVUB 4LSLB 5F9NA 1F1BB 3PYEA 2X51A 3HSZA 1M5PC 4X62J 1NB7A 4IH7A 2PFFB 3H5SA 1UWAA 2ASYA 1U6FA 4O23A 4UOCA 2QA4G 5KFAA 2FJXA 3PW4A 5EWFA 2P6TA 4I2PA 1W2IA 4OLPA 4QJVA 5GAGU 4TU9A 4FS1A 5JMNA 5HQ8A 1D1UA 1S6PB 3B82A 1QE1B 2DNOA 2RUGA 3VV2B 2J6UA 2DRBA 3MM6B 1JLEB 1PJ7A 3GJRB 2BW2A 3H8YA 3B4DA 3NRBA 4URGA 3BSCA 1VRTA 1VQ4S 2D41A 2BYCA 3I32A 4ERDA 2J76E 4DR5J 1NK7A 1JXLA 2DCUB 2OD6A 3HVTA 4L75A 1SBRA 4Q44A 3JSMB 3IWLA 1R3NA 3CJ4A 1W2BR 2L9WA 2XYGB 5L38A 4B17A 1WF2A 1L3UA 2HIQA 3P96A 4O3SA 3KLFB 3TA2A 1JMTA 3EM1A 2J8SA 1QAXA 3IR6B 3G6XA 1U47A 2ZD1A 1GMVA 1QLNA 1CPZA 1FE0A 4RX6A 3CJ2A 3DM2A 1H74A 1LFWA 4HVZA 4JI1J 3D0IE 2UUBF 5DDPC 3AXKA 2IVMA 4IR1A 2Y0SD 1N33J 5F0UA 2RILA 4CLKA 4M5DB 1WI8A 5K8PA 1TL7A 3ETMA 3K7RA 1FHTA 1RWUA 4DU7A 1LNQA 3CJSA 4OJ3A 2A6OA 4CLTA 2J7WA 1AB8A 1JLCA 1HBOA 1N56A 4E2FB 4TYBA 1WKJA 2E1AA 4Q45A 3CPWR 3AOAA 4PKDB 4DF8A 3G8TA 3KHGA 3FC9A 2BJ8A 1HQUA 2DGWA 1SH2A 4J7CA 4WK1A 5D8HB 2EEYA 2YKAA 3BM7A 2DY9A 3D2WA 1FFGB 4K0KF 3NWGA 2JC0A 1IKXB 1F3FA 1TKZA 3ISZA 3UR0A 1NDLA 2QGFB 2VQFJ 4B3TJ 2E9ZA 2VL1A 1F2GA 2NPIA 1M5OC 2P9EA 3C6TA 3MPUB 1NK6A 3MM6A 1JJ2R 3KXDA 1EKSA 1IKYA 2DR5A 2CKWA 3D67A 1N34F 2HHVA 3AODA 2V8GA 2B5JB 3ONQA 4OZJA 4AE5A 1R0CB 2UVWA 3M9MB 1BQNB 5L1IA 2CPHA 2OPQA 4MYTA 2CIMA 2HBRB 3T1AA 4GC7A 3CTRA 3IBFB 1SH3A 5HQLA 4WU3A 1HR0F 4X4NA 4HYKA 3TZXA 3JQJA 2DGTA 1DQ8A 3IXQA 3UO0A 2HLTA 2RQKA 5IQ6A 4JI8F 1T9YA 3CMES 2UVVA 4DPTA 5ADZA 4MK8A 4TLQA 1H38A 2B0GA 4O4RA 3UN5A 3CIMA 5I3QA 3BR8A 1YJVA 2KZZA 3P6YC 4WU2A 1NKEA 1HWIA 2AEFA 2DITA 2J5AA 2RJZA 2CPDA 2VKRA 3BN4A 3HDSA 1DTQA 1SQGA 3Q8UA 2FDNA 3IRXA 3PXGa 4NX9A 1Y5LB 5K14A 3PW5A 1JKHA 2IPOB 1BY9A 4OZNA 1ZAWA 4C98A 1D9FA 4KGXB 3UFCX 2MB0B 3FEXB 2X7IA 4ECSA 2HHWA 1PAEX 2D69A 2FJEB 3O2IA 3WDOA 2F5GA 1H0HB 3K0JA 3E2EA 1Q78A 5I3PA 4FF3A 4P6QA 2C2DA 3M9NB 1T9TA 3KG0A 2W7PA 1VJQA 2ZM6F 1GXLA 2ZBIA 3LO3A 2KRBA 4P73A 4DV6F 4NXNJ 1MMNA 1R31A 1XR6A 1T05A 1CEZA 1JKHB 1FWPA 1TR0A 3NCQA 2ZE2A 3OFHA 4CP5A 2XLKA 2YNHB 2HAIA 1I6JA 1Q1KA 1IR0A 2B7CB 3FBEA 4ED0A 1HNIA 2DGXA 2FVPA 1IJFB 2QLXA 2WVFA 1OY9A 5E3QA 4JV0A 2QFJA 4NZ0A 2KXNB 1XIQA 2B9XA 1X5SA 2MZSA 3OXFA 8AT1B 3BJYA 1NHUA 1DBDA 2P9CA 1GEHA 3HKZD 1EETA 4ZJLA 4GKKF 2APOA 2R2SA 4NA2A 4P7TA 3K58A 3HSJA 5KG2A 4HI1A 2HSEB 2LCWA 2HQFA 3POTA 4MYUA 1RISA 2CJ9A 1CJVB 3HVWA 4KV8A 5KFOA 3KK3B 4U96A 4DV5F 3HJVA 4PG7A 4DR3J 1YJ9S 3ENWA 4I4BA 1JLAA 2CQGA 3W7BA 3P8BB 1IXKA 4L74A 4JV5F 1VQSA 2QSFA 4I68A 4ZVEA 3N5BA 1S1VA 4C8NA 2UUBJ 1GXTA 3NGUA 4CH7A 1G6BA 1SQFA 2JEFA 2GQCA 4OFZA 2NCKL 5KG6A 4WCEQ 1RK8A 3SMZA 4CIOA 1KSPA 4KV8B 5KFLA 2ACMA 2VONA 3US5A 3KNAA 3OJUA 2HQDA 2X1GA 5DM7Q 3D0HE 3BDEA 1NRKA 3L7PA 4DXLA 1RTHA 2VASA 4ETZA 5EGYA 1NSKL 1UVKA 1TMMA 2CJXB 3HHLC 3I96A 4KSEB 3K59A 5L1KA 1TVRB 4DUZF 1P1TA 3DLGA 4NMXA 4N47A 3DRSB 2XMMA 3ZTQA 4Z7CA 4X4PA 3OHBA 5HJXA 1S1WB 1C2PA 4FP9A 2ABYA 3QZ7A 1VISA 1TAUA 3GYNA 1VIXA 2BABA 2I6WA 4X62F 2K2PA 1MWQA 4G1IA 1WUUA 1YJTA 2NSCA 3GFHA 1NNDA 1Q8KA 1OYDA 2BM0A 1FTRA 2WOMA 4RW9B 3UCGA 4QWAA 3IAM9 4Y00A 3TO8A 3MXHP 2XY7A 1CS4B 4RW4A 4K0KJ 1LWCB 3MMAB 5IT0A 2A2DA 4CH0S 3FBBA 1WDTA 3TUZC 5KFMA 4XO0A 1F6TA 2XC9A 4ZCIA 4DR3F 3HVTB 4NYZA 4G3IA 3DOLB 5IV3A 2FHMA 1FKOA 3A12A 4ES1A 2V2VA 1AYEA 1KKHA 3ZZPA 4ED7A 2P6SA 1XC9A 2O3DA 1KTVA 5A0YA 1SXLA 2AJ0A 1UEUA 2XYHB 3BKTA 1P9QC 4NA3A 4PWWA 2ERRA 2DBBA 3IN5A 3NNHA 1GAOA 2VQEF 4AL5A 4AL6A 2NZCA 1FRKA 2LLZA 2R8HA 2AEJA 4K2XA 3R7BB 2ATCB 3A1YG 4USIA 5EX3A 5A8KB 2UP1A 3MPYA 3LQVA 5KG5A 4X4QA 3NLCA 2W2NP 2XMWA 3UNGC 3CJRA 2L08A 1WACA 4WP9A 3W9HA 2IAJA 1LW2B 1UPMB 3OFGA 5KT3A 4PZVA 3M2RA 3W8PA 3AQOA 1N0VC 1RTZA 3GSDA 3SXLA 2YBVA 4ZCMA 4QPTA 4RBVA 1N33F 3I5BA 2DISA 3RRHA 3RR7A 4DS4A 4YY3J 2F4FA 4R25A 2Q3PA 4OX9F 1KEKA 4FYDA 4QIVA 1M1GA 4EWTA 1REGX 2FZCB 3QT7A 2GIFA 2VPYB 5B0AA 2YQ1A 3H25A 4NXMF 3W62A 2G2YA 4DEZA 2DPIA 3IG1A 4C8OA 4J9KA 3C19A 3BBFA 1GTHA 2BBEA 1TKXA 2BEFA 2F40A 2PIIA 3I0RB 1T3OA 4GVLA 4UZCA 1VI7A 2BUNA 3H98A 4ZP8A 5DDOC 3KK1B 4DV2F 3PVXA 5MAOA 3IGVA 1HW8A 2MY8A 2QG9B 1AXQA 2YKPA 3M7VA 4X66J 4ED3A 4NASA 3S7RA 2XNRA 1GQEA 4USHA 3QQCD 1RT4A 1RBOB 3EGVA 3NNCA 3I31A 2W24A 4NEZA 2VG6A 2CQCA 3Q8PB 1VQMS 3NBPA 1NPPA 2VH7A 3CUNA 3K5NA 3T5HA 2R2TA 3L09A 1RHKB 2QMWA 2VFSA 2VQFF 4F0MA 3FJ2A 4HTIA 3PG9A 3MR3A 1NUEA 1TFYA 1C0TA 1C1BA 1Y00A 3FFIA 1SV5A 4I7FA 1KQGB 5U47A 3ADAC 3C6UA 4FF4A 2CZ4A 2LEBA 3GONA 2JZ5A 1IBMF 3VQSA 4BWJA 1V3RA 5DO2A 4DHVA 2VPWB 4MAKA 3PCOB 2HVHA 1DLOA 2VDHA 4WE1A 1RT7A 3BGLA 4X64J 2EC2A 1RWVB 2RRBA 4ZPAA 2UUCF 5BR8F 3RRGA 1F5AA 2M70A 3BKUA 3IM8A 3M8PB 5E2QA 1NAQA 2WSFC 3D3BJ 3DI6B 5CYJA 4LQ9A 3GQCA 1LWEA 3DYAA 4RUAA 2FVQA 2QLWA 2WBMA 3T3FA 3MPVA 2DNGA 4H4KC 4KRWA 5F41A 4FDFA 1RQ0A 3QBCA 4RU2A 3PRBA 1WEYA 1FJ7A 5BJRA 2HVIA 1CJTB 1U0SA 2M88A 3MI7X 1SJ3P 1U8SA 2V8VA 2LQ9A 4G1QB 5KOWA 2LXUA 3RAMA 1JLEA 1TUVA 4TU8A 1A6LA 3GV7B 4NLUA 2GVDB 2HIYA 2XMVA 2IFXA 1TKTA 4IFVB 1ZM4A 1FRXA 5GAEI 2KG1A 3H5UA 5HROA 3Q8YA 3CC2S 3CDUA 4QQBA 1MMDA 3MEGB 1VQOS 5KFPA 1RTJA 2OEMA 3DKDA 1RAJA 1UETA 1JLFA 3KJVA 3DLGB 4QWBA 2ZH5A 1RDRA 4EBEA 2RIJA 2DR8A 3MAAB 2W2MP 4B9SA 2CUYA 3FKBA 3OL7A 3FUYA 1URRA 2G0CA 3L9ZA 4C8YA 1OJ4A 2C2KB 1HIYA 2AV5A 3SQOP 4ZVGA 2IBKA 1Z4UA 1JB0C 1RAGB 3PR5B 1RT6B 2HNYB 4NLWA 2KFNA 3DRYA 2N7CA 3DGPB 2MLXA 3HF5A 4KIAA 3C14A 2IVFB 4W98A 2ZWPA 2GHVC 8RUCA 2IMWP 5F3ZA 3G82A 4DPWA 1NKCA 2LEPA 3IS9B 2VJVA 1H6KX 1I1GA 1R8PA 1RP5A 2FHKA 2ZNYA 4KBIA 4OZ1A 1ZYQA 1L5UA 3EVMA 2LMIA 1QSLA 1MNEA 4G65A 2KJWA 5AXKA 1LWXA 1IJEB 2M9KA 3DLKA 1V9OA 3FCHA 3B4MA 4HT5A 2CPEA 4CO0A 2YNGA 3CE8A 1F5BA 3ZXWA 2F4VF 2D3UA 3HHLD 5J2PB 3D6HB 1VHIA 1OSDA 1EQ0A 4PQUB 4CDIA 4NCGB 1E6YA 2GS8A 1RJJA 4F36A 4RNFA 5J1PA 2J9DE 2H5JB 3DOMA 4C9DA 1B4SA 3ICLA 3M6VA 1ELOA 5A2QU 1IBKJ 4OX9J 3R7NB 1S97A 5CAAA 4KTQA 4ZA1A 1FRJA 4P72A 1SJQA 3CD6S 3W61A 3EDRB 4EZ6A 3DMJA 3VWSA 1ZM2A 2NYIA 4ER8A 2OI2A 4WFBQ 3CSKA 2N82B 1VHFA 4XK8C 2CVEA 4NI2B 4OYOA 2HMIB 1RT1A 4RW8B 4LF6J 2OFHX 1SL2A 1WORA 4ZVPB 1XN9A 2YKNB 5T7LA 2NXCA 1JLQB 3H59A 1C1CA 3U1NA 5A0YB 1IBLF 4DR4F 3IG1B 4ANCA 3IBWA 1YG0A 1TAQA 1FKPB 4RPFA 3MUTP 1NJXA 3DLLQ 1CJKB 2K7KA 3LH2S 4L6V3 3UDCA 4DMZA 4USVA 2W9BB 3S6EA 4CT9A 2CXEA 2FJAB 2J0WA 2BJ7A 3FQLA 4LSZB 2MKJA 3BQ0A 3DOKA 2FHOB 1KFSA 2RT3A 4EO6A 2HRYA 4Y2MA 2K06A 3IM9A 2RU3A 2LQ8A 1L3VA 3QT6A 4K59A 2NZ4A 1WD6A 3KJNB 3MMBB 2MZ1A 2HHQA 1Y11A 2AIRB 2CYYA 3ZTRA 3M1VA 2MJNA 1SVDA 2EXUA 4BHQA 1IBKF 2VA2A 4C0OC 1JJ4A 5KFGA 3T5JA 1BGXT 4RNMA 4DX6A 3GIRA 2B5JA 1GT8A 4F04B 1XJWB 1JJCB 3L4BC 3QGHA 2GO8A 4B3MF 1H2UX 1TL1B 3JQKA 2BR0A 3MCNA 4DU8A 2IJRA 3EXCX 1BQMB 5E0OA 3Q8RB 2DHAA 1HR0J 1OY8A 2ROPA 4IH5A 5C2CA 3G87A 3GV8B 3M9OB 1UVLA 3PACA 1W26A 1VRQC 2HG4A 2EC0A 4OI1A 3EMTA 2LU1A 4TYAA 2HFOA 5D6GA 2DH8A 2E5GA 2RQMA 1JWWA 1K1QA 4IRCA 4OL8A 2B6AB 2QJ3A 3MMCB 3SV3A 3HCXA 3IWXA 3GFZA 4Y2IA 1UZDA 4EGLA 2JLFA 6FD1A 2NLWA 3Q24A 2B9YA 4EBCA 1FD2A 4NEYA 4USJC 5GADI 1OMSA 4RZRA 4DR1F 4ZITA 4N56A 3KHLA 1SKUB 1IR1A 3ZZYA 1S9EB 2HVEA 2Y3YA 4YB5A 1FD8A 4DCOB 4UQTA 4JI4J 4W92B 4RW4B 1MN9A 2GIQA 4PXBA 1HA1A 3SSSA 3T5LA 4HH1A 4ED4A 1Y9OA 1UL3A 3I4PA 5B0FA 2VBWA 3AOCA 3V6DB 1P27B 2YWKA 1ZETA 4DSJA 1QSYA 1ZM9A 4I64A 2MDAA 4I6WA 4OI0A 5EWEA 3GIMA 3OR2B 2H48B 3JTOA 4WBFA 1NBEB 3K5MA 3X3UA 2NSBA 1RAIB 1SIZA 2QA4S 4USTA 5EWGA 1RT3B 3MUMP 2AGOA 2FZKB 1M1KT 1N32J 1NK5A 1S57A 1NKBA 3VAIA 3J7Z5 3G9CA 1WDDA 2EFOA 4BC7A 1WELA 1FXDA 3F73A 3IRXB 3KG4A 1NJWA 2GHWA 4ZLNA 4J91A 1TL1A 3A4TA 3BH7B 3O1LA 4FPRA 2Y1RI 4CM2A 2IM1A 1F9HA 2MPUA 2YX1A 2AGQA 4WZQA 3GE9A 4IOAQ 4QYRA 1YRXA 2LQJA 2W9BA 1IWAA 1RTJB 2BVZA 3NS5A 3N6LA 2ASJA 4KY3A 1LWFB 3C16B 3ENQA 3CJKA 4MK7A 5FJ4A 4IG0A 5H9FJ 3QO9A 4NLPA 5IWAJ 4NLOA 3PX0A 4C8ZA 2QO3A 1X4AA 3FBFA 5EUHA 2P5VA 3KLEA 2IMOA 5F8HA 2QL9B 3EPIA 1U26A 2CPZA 3OSPA 2BKNA 2HGMA 4F4ZA 3R2CJ 2MZJA 2QV6A 1JLCB 5AT1B 3QRPA 4KJIA 1S9EA 2CJYB 5L1LA 3EXYA 4LSNA 1HQUB 4A8MP 3PV8A 3CDBA 1KWMA 3JAMU 4PWUA 3IO1A 1T02A 4DSKA 1D0EA 3OVBA 3W3SA 1MSWD 1S49A 1KOOA 2FIUA 2OMOA 1VIOA 1TKZB 1S1UA 4X4SA 2FVCA 4K4UA 3PJWA 2DK2A 2F1FA 5HI7A 1DARA 5DQHA 2QFIA 4L73A 2BXJA 2E1PA 2IIHA 9RUBA 3PHEA 1HD1A 5B09A 1S0NA 2PA3A 3HT3A 1UWBB 3MPDA 3QRQA 3C6UB 3OLBA 4HHJA 3I82A 5KTQA 3MEDA 1AUSL 2Q1LA 2YKMA 5CZVA 2CQHA 4EYHB 3H5XA 1JLBA 1FX2A 5HVHA 2MKHA 3LA0A 5D0EA 1PSDA 2PGCA 1U7LA 5LMNJ 1R8HA 3J7A1 2GGPB 2YNHA 4FZVA 2R7QA 1PYOB 1VQ7S 1WSVA 4M95A 2AJ1A 3MEEB 5I42A 1K47A 4WYLA 3GR1A 3T9ZA 4ED1A 1FRHA 4O4GB 3LOUA 4DFPA 1FKAF 2UVRA 1T8EA 2O67A 1FE4A 2KT2A 1HNWF 3PNIA 3OVAA 3W5YA 9ATCB 3R5AA 4DV6J 2Z2YB 4LF2A 3U7JA 2FD2A 4D3HA 5K14B 1U2CA 1DAXA 4MFBA 2VF3A 1NSQA 5IS2A 2RHSB 2AYEA 3R8YA 3SV4A 4DR1J 1Q81T 1MU2B 2PD1A 4ZVSB 8ATCB 1GX6A 3HX9A 2F3JA 2D3O1 1PJ5A 1S72S 3M8WA 3E51A 3VAJA 2AYMA 3CCSS 2MHEA 4F02A 3BO3A 1REVA 2VIHA 5THWA 1S4EA 1UZHA 2HNZA 4LF6F 1NJZA 1B7FA 3MMCA 2ILYA 2Z57B 3OBIA 2R8JA 4WIIA 4I2PB 4V1Ak 4LJMA 4OYZA 1PIEA 1HPZB 3K8VA 3CJ0A 3DU5A 2V8PA 2ZH6A 1Q5VA 1RABB 2ACYA 2HWIA 1GTEA 2LA6A 4P75A 4Q7AA 4TKTA 5K9FA 1RYSA 2GZOA 3GFXA 3FBCA 3ZNJ1 2XZWA 3KMQA 4YMEA 3LP0B 2QC3A 1RZMA 3ITHB 4M5HA 1N4LA 4URSA 3IAS9 5L8RC 5D3GA 3EPGA 1SV5B 4GKJJ 1NK8A 3THVA 4NRUA 4B3RF 4BS2A 2XMAA 2VB6A 3QYYA 3T6JA 1S12A 2G2OA 5AE3A 4GMKA 3TOQA 2HZVA 4QYZK 4NCGA 1FVQA 4DL4A 1CQMA 2V8HA 4LRDA 4EFAC 4B3MJ 1TK8A 4PWDB 2GFFA 3M8PA 4F4YA 2R7OA 1VYAA 3RB3A 4NLRA 4KHPJ 2QT7A 2GIRA 3R6GB 2YKQA 3TVYA 2LKZA 1HNZJ 2CNKB 3Q89A 4M5GA 4OHVA 4USWA 3RBDA 1RAHB 1SCJB 1WHVA 1Q16B 2CQ3A 3DRSA 4R5PA 2IDLA 4WJBA 2CJKA 4JI0J 3PZPA 1KNZA 3KJQB 4C7QA 1I94F 1NK0A 2HHTA 3JSBA 3THPA 4LF4F 2MZQA 1ZA2B 1NEEA 2HMIA 4LIWA 3DXSX 3PM9A 4ITSA 3CJKB 1VQPS 4DPYA 3V81A 3RG6A 1HNVB 2GMLA 3LW5C 2OGUA 3Q86A 5ETLA 4OHXA 2QSWA 5BXIA 4EEYA 1Y3KA 1YGYA 5IZHA 4RNOA 1B99A 3MEGA 4JI4F 2ZH9A 2CQ4A 1X5PA 2JRSA 4B9TA 1T95A 1FFSB 2V63A 4DR4J 3I87A 3GWCA 1U2FA 4F3QA 5HANA 3GJSB 1K8AT 1O8BA 2D9PA 3T19A 1MLAA 2FQQB 2PMWA 3OTCA 4DN9A 5HMWA 1NPKA 1N32F 1N34J 1VC6A 2M5YA 1RT5B 3ZNUA 4F4XA 3FCVA 4A8QA 2RS2A 2XNQA 2VZ9A 3NS6A 2GQ2A 2IC3A 1MMLA 2AKWB 5E3AA 2KXHA 3GTYX 4C3LA 2W25A 5M2PA 3T1YF 4KHPF 1U1NA 1P6TA 1H73A 1AUDA 4ICLB 3OW2R 1TUGB 2PC6A 4USUA 4AUKA 1HYSA 2RB7A 4OHWA 1RT1B 4RW8A 3SI8A 1WC3A 2D74B 2DNYA 3FDSA 4OZ3A 4XTTA 3MD3A 4PG5A 2GVDA 4JI8J 2IVYA 3TA1A 4ILMA 3CVKA 4NZ6A 2DNLA 2KKHA 3V4MA 4KGZB 3UE2A 2ATLA 2GJ2A 1ACMB 2DGQA 1Q7YT 2E7VA 2EFVA 4DBQA 1T9VA 2ADCA 3FZBA 2ZBCA 5E3RA 3QFWA 1KDNA 3GCXP 3R7SB 5T14A 3CMQA 1KLNA 2MYFA 4AXIA 4DUYJ 4MIBA 1DLOB 4WE1B 1QAYA 4JP8A 3RW6A 3C15A 3VQTA 3VAKA 2KYXA 3GFYA 2BANB 1N88A 1Q5YA 2YY3A 2V2QA 1X4GA 2ZZTA 3M30A 2B8PA 2MTLA 1TVRA 4LF1A 2AJQA 4DLGA 1EJ7L 1KR4A 1XR5A 2NXEA 3M32A 3ZZUA 1X31C 3H40A 2YH0A 4DQPA 2HBQB 5E7OB 2FVSA 3BS9A 4NLSA 2BE2A 1UVMA 3WIUA 2GCFA 4N8NA 4DV1J 4OJ1A 3QGIA 1C4CA 3VVTA 4UTGA 1YKWA 5F8MA 2V50A 2KG0A 1RWMB 1GMWD 2NYHA 2HQGA 3E3XA 3H2UB 4JOUA 4FN5A 3ZTPA 4CYUA 2XLJA 4UT4A 4HACA 1EZZB 1DQAA 1HQ2A 1S6OA 1WSRA 2YNIB 2NPFA 4O0IA 4B9VA 4DQSA 2UXBJ 5MLCV 1Q8BA 3IR5B 3PW0A 3TNVA 2QTWA 3AT1B 3AB2B 5LMUF 5F8JA 3KK3A 2J0QD 2CWXA 1VCTA 3LP2B 1DHMA 2POKA 1IKYB 2RE1A 1U2RA 1VRUB 2V4JB 3V5RA 4C8LA 5IXUA 3RB0A 2Y9HA 4Z7YA 1P9YA 1U0HA 2NS1B 1DURA 5LL6d 4ZPBA 3A8IA 1XNQJ 3J7AN 3A3NB 4GVBB 4KAIA 1Q8IA 2BRKA 4A8YA 4DFKA 4N41A 1XNRF 2DB1A 2YX4A 3B78A 3K17A 3ETOA 3MM9B 2RQCA 1Q79A 4KE5A 1N5VA 5KFXA 3OUYB 4HTJA 3KWMA 4W4MA 4DWIA 3PKYA 3MMJA 1ZBTA 2HNDB 2M52A 3MCMA 2P8IA 2CG4A 2UUWA 1CG2A 1D8YA 1HWKA 2O66A 3J81U 3MEDB 1CC7A 4IRDA 2KT3A 5CA5A 4X66F 2HKEA 3JSRA 4G1PA 3D1OA 4CO3A 1HWLA 1WJ9A 2ILZA 4K7QA 4QIWD 4LVNP 1IM4A 4C3KA 3W66A 2E7XA 3ZTOA 5BYQA 2IRXA 3Q8QB 5B7WA 2R8IA 2FLPA 1KHVA 4BC9A 1IUJA 2OSQA 5GAGI 3D1QA 3KUGA 3TUPA 2XMJA 2LA4A 3NS7B 5I4MA 3A8EA 4A4JA 3VVUA 1SUQA 2M2BA 1SH0A 3LGNA 2MKYA 2KB2A 1UJ4A 4LVOP 4Y34A 4Y2CA 5HSPA 3CJ3A 3QLHB 2HGNA 4AXJA 5GMDA 2BQUA 3HJFA 5GAHI 2XWXA 4KYZA 1RT6A 2HNYA 4Q2LA 4C0BA 3H4DA 1HL6A 2U2FA 2V2ZA 2WSEC 4V19X 4USKA 1VK8A 2CZVC 4ZN1A 2YNIA 4UUXA 1Q86T 2MZRA 1RWXB 4CH1A 2DT9A 3MAQA 2FJBB 2YQ3A 1AROP 2R7RA 3NMAA 3SSRA 1VRTB 2DEJA 2HFVA 2HHPA 1MWZA 4LRBA 5KT6A 2RUSA 4DL3A 2J6TA 2VC1A 1EP4B 2YTCA 4CTAA 1YI2S 3FRYA 2DIUA 4RU9A 5L39A 3NGSA 1KC8T 3M6UA 5KFRA 2J9CA 2XSJB 1SIWB 4IQXA 2CWKA 1B3TA 2UV8G 3Q23A 4RW6A 3UCZP 1VQLS 1V5IB 2ZBPA 5KT2A 1VBXA 5DRKA 4DV4J 4M5IA 5CHCB 1RT5A 4B9NA 1ITPA 2ADBA 1HBNA 2H5EA 4IFVA 1B0PA 5KFDA 2Z0GA 5KG4A 4OYMA 2ZDPA 3MWBA 4O4GA 2FY8A 1QAJA 4PYAA 1K9MT 2V8DA 2E5JA 1R8AA 1UEVA 4H54A 1ZAXA 4YFUA 3PW7A 1B0TA 2QL5B 1S1VB 4LT6A 1FKOB 4PUOA 4L3NA 4X4VA 2DH7A 1BQXA 2VG7A 3CJ5A 4PYDA 2G1HA 3WHIA 3G2XA 4YY3F 4AQYJ 1M5SA 2AZ1A 2BKPA 3CXCR 2GVZA 3OXLA 1O51A 2V94A 3PJXA 3KK2B 2C22A 1A9NB 1XMOF 2HFUA 1RAOA 3MOZA 4WP8A 2BACA 3EGNA 2XM3A 1FDDA 5LXRA 3CW2C 1WF0A 2XYPB 3DU6A 4LIRA 4M8LA 2XO7A 1X5OA 5F8LA 1I94J 1S48A 4MT1A 4UOFA 1TK0A 2AX0A 5EN1A 1EETB 3BEGB 3BH6B 3NMRA 1SL0A 3HD2A 2I1RA 1S1WA 4HR2A 4X4RA 4DR6F 4DV1F 2DNMA 2GJFA 1WC5A 2Z2LA 4CWBA 1WG5A 4OYPA 2OUGA 1S79A 1LV5A 5DQIA 1C0UA 5D4OA 2FY1A 1O6XA 4LSNB 1BD6A 2DGUA 2R2UA 1HYSB 1CBKA 3BGRA 2HHHF 1QAIA 4PXEA 4OZ5A 2GV1A 1IWGA 2FVRA 2C1EB 4LF7F 2ZBRA 4U7CA 1HBMB 3DRPA 1YQHA 4ZS6A 2JLGA 3RBEA 2R7SA 2RVJA 3TARA 1T05B 2Z58B 4ZP9A 4XAKA 3NGKA 2VPZB 4PG8A 3BZQA 3OFFA 3FNNA 5CQGA 1RU2A 4ID5B 3CCMS 1LXJA 2JEGA 3BSNA 4DSFA 1XNRJ 1NHKL 3HHLA 4OMFG 1AZSB 1KTQA 2BJ9A 4Y3CA 3LP2A 2Q66A 4U7UD 4PXDA 2C3UA 5CXTA 3HT0A 5HLFB 2BM1A 4J9SA 2OKQA 5IC4B 2GNKA 1TELA 1DTQB 2Z4PA 5A8RA 3C15B 2XHWA 4RKUC 2ZH2A 1EQMA 3SCLE 4KO0B 5ETMA 3HXMA 2ZH7A 2E1MC 2DEIA 2RS8A 1WC1A 1TKTB 3SQGA 1F9EB 2V69A 3LUYA 5HVFA 4U7UK 3G6ES 5KFHA 2CQDA 2GJIA 2UXDF 4C8MA 4QW8A 2HRTA 2I9SA 2NXJA 2DGOA 2N7YA 4KH1B 4E0DA 3DDKA 3U1LA 4NXNF 1OQ3A 3R5BA 4JI0F 1FFWB 2N3LA 3T5KA 1F0XA 3HFKA 5D3GB 3Q2TC 3UDLA 2P9GA 2K3IA 4EZ9A 2MZTA 1UA1A 1HHSA 2ZJPQ 1H72C 1MWYA 4WFXA 2D7SA 1NJYA 1UCNA 1Y10A 5B0BA 5F8NA 4A8WA 2FHJA 4NI2A 2X1BA 1K73T 2FB0A 2DR6A 4MTPA 1WNEA 2CPJA 2F8EX 2W9CA 4F3OA 2PEHA 3CJ8A 3OR1B 3D4JA 5KFUA 3G6YA 2IY5B 4FYXB 2V2KA 1HPZA 4NLQA 3SEOA 5C2GA 2BOPA 2H51B 3QJPA 2C3YA 1HARA 2EVZA 4J9LA 1YBTA 1HQEB 1HBUB 3NWRA 4CLLA 4ECQA 3V6KA 3EVWA 3VGSA 3F41A 3BBBA 1T9UA 4I1TA 1BXNA 2Z2MA 2F9DA 2EK1A 1M0SA 3NCRA 1TL3A 2M7SA 1ZOTA 2OPQB 3MECB 4QIGA 3E01B 3D9BA 4ZPDA 4BCAA 4ZLPA 3DOLA 2F4VJ 4M5DA 1RT2A 1KLMA 3KNGA 1DRZA 2RF2B 4DV3F 3DLEB 3GB0A 4Y2KA 1L3KA 2KHDA 2EKNA 2OEKA 2HBYB 2W2OP 1TQLA 2Z30B 1H98A 3PDNA 5C24A 2RRAA 2KHCA 5J2MA 3JAMY 1LWFA 3C16A 4QR0A 2BJ3A 5RUBA 1QY7A 4J9UE 4TU7A 3THTA 3FMWA 4AQYF 1VDHA 1X60A 5EDWA 1GFWB 4F0KA 3QO9B 2FZGB 3HZGA 1PYSB 2N4DA 3M8YA 4ZP7A 4K4SA 2V5HG 2ZZNA 4YHHF 5IFMA 1TU0B 1TV6B 2DHXA 2W9AA 3SYZA 2W4DA 4ZCKA 2HK2A
chains in the Genus database with same CATH topology
3BH6B 2HVEA 2DY9A 3FKBA 1MN7A 4HR2A 1MN9A 3EE3A 5C7PA 3FBBA 1F3FA 1K44A 3BBCA 1S5ZA 1F6TA 1NCLA 1HIYA 1NDKA 1NDLA 1NLKL 3VVTA 4ANDA 3NGRA 3B54A 1U8WA 3ZTPA 4W98A 1S59A 4WBFA 3PJ9A 3FBCA 3EVMA 1PKUA 4KPCA 2BX6A 3VGTA 1JXVA 1LWXA 1S57A 2VU5A 4DI6A 4FKYA 4UOGA 1NHKL 3BH7B 1BHNA 1BUXA 1NDCA 4F36A 3WX8A 1B4SA 1HLWA 1VYAA 3ELHA 3Q8UA 5IOLA 4O0NA 3EJMA 5CAAA 3Q89A 1HHQA 3EVOA 4DUTA 1WKLA 1PAEX 2DXEA 3FBFA 3BBFA 1ZS6A 2BEFA 3GPAA 3L7UA 1NB2A 3ZTOA 4C6AA 2AZ3A 2ZUAA 3R9LA 3EICA 4CP5A 3VVUA 3Q86A 3FBEA 4ANCA 5BXIA 3DDIA 3VGVA 1B99A 4ENOA 1XIQA 1UCNA 1NUEA 3Q8VA 4DZ6A 1LEOA 3JS9A 1NPKA 3MPDA 3Q83A 3FCVA 3ENAA 4S0MA 3ZTRA 3NGSA 1XQIA 3EVWA 3VGSA 3FC9A 2CWKA 4FKXA 3BBBA 1W7WA 3EM1A 1NDPA 3NGUA 4UOHA 2DXFA 3VGUA 2NCKL 1WKKA 3ZTSA 3NGTA 3PRVA 5CABA 4F4AA 1EHWA 2DXDA 4EK2A 1NSKL 2DYAA 3EMTA 1NSQA 1KDNA 3G2XA 3ZTQA 4ANEA 2AZ1A 3GP9A 2B8QA 3ETMA 3FCWA 4UOFA 3Q8YA 3DKDA 2HURA 1WKJA 2HVDA 1BE4A 2B8PA 1NSPA 3B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  2HVE A;  2DY9 A;  3FKB A;  1MN7 A;  4HR2 A;  1MN9 A;  3EE3 A;  5C7P A;  3FBB A;  1F3F A;  1K44 A;  3BBC A;  1S5Z A;  1F6T A;  1NCL A;  1HIY A;  1NDK A;  1NDL A;  1NLK L;  3VVT A;  4AND A;  3NGR A;  3B54 A;  1U8W A;  3ZTP A;  4W98 A;  1S59 A;  4WBF A;  3PJ9 A;  3FBC A;  3EVM A;  1PKU A;  4KPC A;  2BX6 A;  3VGT A;  1JXV A;  1LWX A;  1S57 A;  2VU5 A;  4DI6 A;  4FKY A;  4UOG A;  1NHK L;  3BH7 B;  1BHN A;  1BUX A;  1NDC A;  4F36 A;  3WX8 A;  1B4S A;  1HLW A;  1VYA A;  3ELH A;  3Q8U A;  5IOL A;  4O0N A;  3EJM A;  5CAA A;  3Q89 A;  1HHQ A;  3EVO A;  4DUT A;  1WKL A;  1PAE X;  2DXE A;  3FBF A;  3BBF A;  1ZS6 A;  2BEF A;  3GPA A;  3L7U A;  1NB2 A;  3ZTO A;  4C6A A;  2AZ3 A;  2ZUA A;  3R9L A;  3EIC A;  4CP5 A;  3VVU A;  3Q86 A;  3FBE A;  4ANC A;  5BXI A;  3DDI A;  3VGV A;  1B99 A;  4ENO A;  1XIQ A;  1UCN A;  1NUE A;  3Q8V A;  4DZ6 A;  1LEO A;  3JS9 A;  1NPK A;  3MPD A;  3Q83 A;  3FCV A;  3ENA A;  4S0M A;  3ZTR A;  3NGS A;  1XQI A;  3EVW A;  3VGS A;  3FC9 A;  2CWK A;  4FKX A;  3BBB A;  1W7W A;  3EM1 A;  1NDP A;  3NGU A;  4UOH A;  2DXF A;  3VGU A;  2NCK L;  1WKK A;  3ZTS A;  3NGT A;  3PRV A;  5CAB A;  4F4A A;  1EHW A;  2DXD A;  4EK2 A;  1NSK L;  2DYA A;  3EMT A;  1NSQ A;  1KDN A;  3G2X A;  3ZTQ A;  4ANE A;  2AZ1 A;  3GP9 A;  2B8Q A;  3ETM A;  3FCW A;  4UOF A;  3Q8Y A;  3DKD A;  2HUR A;  1WKJ A;  2HVD A;  1BE4 A;  2B8P A;  1NSP A;  3B6B A; 
#chains in the Genus database with same CATH topology
 1V3S A;  2LFV A;  2DKO B;  3EE3 A;  3I56 S;  5K8O A;  3TX0 A;  4UQG A;  1AW0 A;  3BRE A;  3D6M B;  1RWW B;  4IOC Q;  2C2M B;  2UUT A;  3MUR P;  3M4X A;  1SJR A;  2AMC B;  2LDY A;  6FDR A;  3PIO Q;  2B4O A;  4LF4 J;  1K0T A;  2YWF A;  4JV5 J;  2KM8 C;  2JFK A;  4N8O A;  5L46 A;  4P74 A;  3DHW C;  4USM A;  4HHU A;  1E6V A;  5KFC A;  4ELV A;  2LDI A;  2ZOF A;  2ZKT A;  5GAE U;  2VQE J;  2LEA A;  2AWZ A;  2AJ2 A;  2ASD A;  4B9M A;  3A8J A;  3OFE A;  1CC8 A;  4TY9 A;  5ETQ A;  4KPC A;  1WG1 A;  2JWN A;  2YKM B;  1DZ5 A;  4FBU A;  3DMJ B;  2B7B B;  2SXL A;  1XER A;  2CQI A;  4RNN A;  1TP7 A;  4DI6 A;  3CED A;  5DGB A;  4ALZ A;  2Z8Q A;  1T94 A;  2OIH A;  2MST A;  5M2R A;  2NR0 A;  3E01 A;  2H65 B;  1JNZ B;  5BYR A;  1VJW A;  2NXU A;  2XGQ A;  5T41 A;  1Q0N A;  1FI4 A;  1RGV A;  4X65 F;  3QAU A;  4ZVH A;  4UZB A;  2D9O A;  3CCZ A;  4DX5 A;  2E9T A;  4CZC A;  4DDF A;  3J7Y I;  2UVU A;  1JNR B;  4WFN Q;  3HPO A;  4NYP A;  1BWE A;  3R2D J;  1JQG A;  4CO4 A;  5FLX U;  4DUT A;  5A76 A;  2JH3 A;  5F8G A;  2B6A A;  2DRD A;  4HDH A;  4TVA B;  2MKK A;  3MR5 A;  2ZH8 A;  2QLF B;  3CCT A;  3KTQ A;  4ZP6 A;  5HL7 Q;  3NXZ A;  5AXM A;  2RDI A;  2YNF A;  4QR2 A;  4PPD A;  1YIJ S;  1QE1 A;  2RHQ B;  4ZVO B;  5GAH U;  5SUH A;  2O01 C;  4GRS A;  3RRK A;  2V4J A;  1WWH A;  1Y5I B;  2ZNZ A;  1Q7L B;  2VBY A;  2H1Y A;  3BPD A;  2Q6B A;  4UF4 A;  3KG1 A;  3ENV A;  3C2P A;  2G1D A;  2QA1 A;  3MPW A;  2AD9 A;  2VG5 B;  1ZAV A;  2AEM A;  3L3C A;  4DL7 A;  3VTI A;  5LSR A;  3C6T B;  5CYQ A;  4NWB A;  2ASL A;  1NZ8 A;  3LTO A;  1FRI A;  2HBZ B;  4CLF A;  2WB4 A;  1NU4 A;  1C1C B;  3H90 A;  5G4D A;  4BWM A;  1AFJ A;  3NAH A;  3TP2 A;  2DD8 S;  3H42 A;  1LW0 B;  2VJU A;  4DV7 F;  4C2M A;  3Q83 A;  2EK6 A;  2HHH J;  3HHL B;  4YN3 B;  1FCA A;  2K1R A;  1RT3 A;  2PI4 A;  4YQW A;  2G0I A;  2GA7 A;  4S0M A;  1PYT A;  4KKO A;  3M8Q A;  1JLF B;  4BBY A;  3HVR A;  3VAM A;  1FXR A;  1YJU A;  1IVZ A;  4G6V B;  2YWE A;  2IYI A;  4WTO B;  2DHH A;  3NY0 A;  4ILR A;  3TZZ A;  3TJ8 A;  1UVJ A;  2XS2 A;  1H3D A;  1F3V A;  3S1T A;  1RTI A;  5EHH A;  2DXD A;  3UQS A;  3EZU A;  1FNM A;  1UAW A;  1IQT A;  1KHW A;  1Q8L A;  5D4L A;  2DGS A;  4MKY A;  3DNC A;  2HQ3 A;  3M30 B;  3AJ1 A;  1HNX J;  4HT7 A;  5KG0 A;  3MM7 B;  5DG8 A;  2C3O A;  3X1L B;  4YB1 P;  1N52 B;  5CZX A;  3L95 X;  1UKU A;  3PEJ A;  3T9N A;  2WHO A;  1QVF R;  2CQ1 A;  2WTF A;  5IC6 B;  2B43 A;  5IM0 A;  3LWM A;  2AP6 A;  3HHD A;  3KUE A;  4N5S A;  3CCR S;  2HWH A;  1M5K C;  2UXD J;  1BE4 A;  1WHW A;  4RR5 A;  1WC4 A;  2ZHB A;  1NSP A;  2N4C A;  5ETS A;  2UV8 A;  3DFE A;  3A8K A;  3QFH A;  4HI2 A;  2JVO A;  3H4B A;  2LU2 A;  1CSJ A;  1BC6 A;  3G6V A;  1N5S A;  2XEX A;  4TN2 A;  4LRE A;  5D78 A;  3OL8 A;  2JOQ A;  1SKS A;  4LFC J;  3R6L B;  4CO5 A;  1XBW A;  4HKQ A;  1VR6 A;  2C42 A;  4KQZ A;  3MMB A;  4Y6I A;  2C2R A;  2UUC J;  4X2B A;  1X7V A;  3TA0 A;  3QID A;  1UFW A;  2JL9 A;  5BR8 J;  4DX8 H;  4CLY A;  3O8W A;  4EU0 A;  3KUH A;  2H3E B;  3MR6 A;  1XMO J;  3GZ7 A;  3C14 B;  3FEZ A;  3K57 A;  1JIH A;  1TTH B;  1S59 A;  1TMJ A;  1V6H A;  2HRU A;  3MM5 B;  2JX2 A;  4GKK J;  1UFL A;  2J9E A;  3IS9 A;  2VG7 B;  4GVB A;  4LUB A;  4F0H A;  4QWC A;  3Q0A A;  2XO6 A;  4J9R A;  4DR7 J;  4KKO B;  4DSI A;  3QLH A;  3FSX A;  2C2Z B;  4P9S A;  1JXV A;  3AXM A;  2C2E A;  1OYE A;  1RCX B;  2A6M A;  2E1C A;  2G0J A;  3DLK B;  1NM2 A;  4WFA Q;  3EZO A;  1DY3 A;  1RAA B;  2WON A;  2YNF B;  4ZPW R;  3WIV A;  1N8R T;  2E9R X;  3NOC A;  4EI2 A;  1K1S A;  3JYT B;  2IA0 A;  3MM5 A;  2JSX A;  3RB4 A;  4HL9 A;  2BQR A;  2XSF A;  4NRT A;  3W2W B;  4B02 A;  3BF4 A;  1GX5 A;  1T03 B;  4F67 A;  3WX8 A;  3PW2 A;  2XSJ A;  3ET6 B;  3C46 A;  4GC6 A;  1Z2L A;  2EI5 A;  1CUL A;  4QCL A;  4DQI A;  3MR2 A;  4I2Q A;  1ZTT A;  4O0N A;  1LWE B;  3DYA B;  1HHQ A;  2UZA A;  1FT8 A;  1GK8 A;  1C0U B;  2MEW A;  2MSS A;  3ISN D;  4KR0 B;  2ZDO A;  4NPO A;  2DXE A;  4K8R A;  5HMZ A;  1SUQ B;  4YR3 A;  5L1J A;  1UWB A;  1R6Y A;  1A0O B;  4ZDN A;  3OTO F;  3CCU S;  1R0A A;  2DNK A;  2V9W A;  2A3J A;  1WG4 A;  2WAQ D;  3ULH A;  2ROE A;  1CJT A;  5SZT A;  1U4B A;  2ZUA A;  2OLW A;  2E5L F;  3AQP A;  2ZC4 A;  2OD4 A;  3CD5 A;  2DR7 A;  2BJ1 A;  1SJ1 A;  1X4E A;  2CFX A;  5HN0 A;  2UXB F;  5ETT A;  2MY7 A;  1UMJ A;  1YZ7 A;  1PAU B;  3CDE A;  3EGW B;  3P45 B;  4NLG A;  1CLF A;  1HHT P;  3IRW P;  4DG1 A;  2L9N A;  2PSZ A;  1Y4Z B;  2XMK A;  4DZD A;  5K8N A;  2P2C B;  3CT9 A;  2JHE A;  3HSD A;  3UN3 A;  4ICL A;  3Q22 A;  3TJ9 A;  2FGC A;  4X4O A;  2IM0 A;  1KQF B;  3R27 A;  1VOM A;  3Q8V A;  4K2J A;  1RBA A;  3Q8S B;  4ECT A;  2K8G A;  1VBY A;  4DL6 A;  3TZW A;  4DV7 J;  1LEO A;  3GII A;  3G8S A;  2Y1I A;  1KFD A;  1HI1 A;  2IJF A;  2E29 A;  3KK1 A;  1S6U A;  3IWN C;  2H4W B;  3LGM A;  5FII A;  3LP0 A;  1U1O A;  2XB2 D;  2OO4 A;  1N36 F;  1ICE B;  5ETV A;  5HBM B;  2OH2 A;  4WZM A;  2F8M A;  1S4F A;  3MDF A;  5LT5 A;  5C5J A;  3PEH A;  1KRP A;  2BJE A;  2OTJ S;  1X9S A;  2JDJ A;  2RRN A;  4MKA A;  5ETP A;  4M5M A;  2RQ4 A;  4KGM A;  1J5O A;  1JLQ A;  2JFD A;  3N6N A;  1G4C A;  4O3P A;  5CAB A;  4K5R A;  4B3R J;  4P2M A;  4YDD B;  4OYA A;  3CUL A;  3PR4 A;  1EIY B;  4I6A A;  3TYT A;  3AHP A;  5KG7 A;  4FF2 A;  2JNJ A;  4R8U A;  1KD1 T;  3CCE S;  1FER A;  3M2U B;  3RZA A;  1PG5 B;  4M5L A;  1RAF B;  4NL5 A;  2BJD A;  4NOH A;  1N0U A;  2CJA A;  2KDO A;  3I6P A;  3UN2 A;  4AYB D;  2A18 A;  3PFE A;  4N7T A;  4OIX A;  3UNY A;  3WBZ A;  3W5Z A;  4AD6 A;  2ZM6 J;  1URN A;  2VPX B;  4WF9 Q;  2OSR A;  3GSI A;  4XDD A;  2V34 A;  4CRJ A;  4WKY A;  4LF5 J;  1FDN A;  2FUG 9;  2UUA F;  2HVD A;  4KFB A;  1FRL A;  4Q5V A;  4FF1 A;  2ZH3 A;  2IM3 A;  3NAI A;  5F3T A;  2QRR A;  3TEH B;  2IRY A;  2XQC A;  4LFC F;  3LP1 A;  4KH0 B;  3W65 A;  3ZTS A;  3I9V 9;  3LAM A;  1S6Q A;  1EAR A;  1DTT B;  3PHT A;  1HD0 A;  1RT2 B;  4P2S A;  1T3N A;  1VC5 A;  4Q8F A;  1U8W A;  4B08 A;  3LF0 A;  1U1L A;  4IFY B;  4LFA F;  3MZI A;  2HS4 A;  1K0V A;  4DV4 F;  2HEK A;  2KL8 A;  2X3G A;  3CD0 A;  1RAE B;  3A13 A;  4HEA 9;  4EMD A;  4DV5 J;  2AYG A;  5L9X A;  1UW4 A;  2YQ0 A;  1U45 A;  1XNQ F;  2RSQ A;  5DG9 A;  3KMS A;  2VOD A;  3P49 B;  1UVI A;  1QTM A;  4ATN A;  1XMB A;  3KLG A;  5KFS A;  2BX6 A;  3EYZ A;  1IBM J;  1B64 A;  3AJ2 A;  5L9N A;  2YKO A;  3A3P B;  5HP1 A;  2HAF A;  4B9U A;  2CQ0 A;  2W9C B;  1QTN B;  4WTY A;  4KB7 A;  4ED6 A;  3UDE A;  1T9W A;  4JV2 A;  2VC0 A;  1JJH A;  4OYW A;  2CPX A;  1YVF A;  2YX7 A;  4UY8 T;  2Y8W A;  2H5I B;  1ZA1 B;  2WSC C;  2KFY A;  1A7G E;  5DLG A;  4LF5 F;  3SCI E;  1H7X A;  4PG6 A;  3I55 S;  1YK9 A;  3DRR B;  3H0P A;  2M8D B;  3D66 A;  4ZK7 M;  3G82 B;  5GME A;  1FK9 B;  1S1T B;  2DNR A;  5J2Q B;  2R7X A;  1RHR B;  2XG8 A;  3H20 A;  3HHE A;  4PEO A;  4DV0 F;  3M2R B;  1KQK A;  2D3Z A;  4MIA A;  2PA8 D;  1FDA A;  1N48 A;  1FDB A;  2QYC A;  4CLW A;  3OTE A;  5DGA A;  4JYA J;  3GPA A;  3D54 A;  1FX4 A;  1AT1 B;  5J2M B;  1ZZN A;  3HHK A;  4DJB A;  1IKW A;  2AZ3 A;  3MF5 A;  3MEE A;  1RAD B;  5I42 B;  1RYR A;  3RYL A;  3PY8 A;  2AX1 A;  2Y1L B;  3KJV B;  4ES3 A;  5J2Q A;  1JLA B;  5HQM A;  2G13 A;  2XCP A;  2DGV A;  4YR2 A;  1HKA A;  1BQN A;  1QUV A;  3FK4 A;  3MOJ B;  2ZIT A;  3DDI A;  3HUL A;  5HVG A;  2DTJ A;  2R7U A;  4Y65 A;  1G1X A;  2EFP A;  2I5J A;  1RT7 B;  4QIF A;  2MKI A;  1IKW B;  4I56 A;  5H9F K;  1X4B A;  1PO6 A;  4LR9 A;  3CCV S;  3P3D A;  1G3O A;  5A6P A;  4AL7 A;  3FGV A;  2E44 A;  2MGZ A;  4F4W A;  4DR7 F;  1GXU A;  3JS9 A;  2CDR B;  2JVR A;  4PAB A;  2EFG A;  5DS7 A;  2XY6 A;  1WI6 A;  4RLE A;  5KFQ A;  4CO2 A;  3DDN A;  1QM9 A;  2XTJ P;  2V4R A;  2VFV A;  4FXD A;  4NA1 A;  4K50 A;  1QSS A;  2J7U A;  4I69 A;  3W5X A;  2R7W A;  2AJF E;  7FD1 A;  2I0X A;  2ROG A;  4O44 A;  1SC3 B;  1E6V B;  2FLO A;  2VFR A;  5J2N A;  1YJW S;  2M4M A;  3JTN A;  2DRA A;  2KZM A;  2GC8 A;  4OV6 A;  2PN6 A;  4J9V A;  1YX2 A;  2VD3 A;  5B0E A;  3W2V B;  3CMA S;  4F7V A;  3ILJ A;  4MJK A;  3NGT A;  3BKF A;  4UUW A;  4AFF A;  1J5E J;  2XZD B;  1RE1 B;  1X4H A;  4LRA A;  4AT1 B;  4JI3 J;  3AJD A;  2VOO A;  1RHJ B;  3NG8 A;  3AD9 C;  1CQN A;  5I3U B;  2LEC A;  1NH8 A;  3R5G A;  4BDP A;  5HMX A;  1HNW J;  5ITH A;  4H4O B;  4QIE A;  3VF0 B;  5HK4 A;  4F2S A;  2E5H A;  3O3L A;  4WXW A;  5IQQ A;  1W25 A;  4C0H A;  3V6H A;  1S1X A;  4IH6 A;  3VR1 A;  5LXY A;  2HHX A;  3IP0 A;  3ILO A;  1G2E A;  3QJL A;  3F56 A;  1XMQ J;  5B0C A;  2W4C A;  1X9M A;  2BDP A;  3UDV A;  1NJI T;  1AFI A;  2XWY A;  4K4V A;  2HFN A;  1SC4 B;  2ZH4 A;  4DR6 J;  4B3O B;  3KLI B;  4E8U A;  3N0V A;  2HQC A;  4P52 A;  3LPY A;  1UP1 A;  3DGP A;  5K5M A;  1YJR A;  3MD1 A;  1FWL A;  1TL3 B;  3JSM A;  3G4S S;  3TR5 A;  3M8R A;  5JJB A;  2NXN A;  3W8G A;  2CNL B;  2H4Y B;  4JI6 J;  5D77 A;  2LXI A;  2ZVS A;  3DLE A;  2YPY A;  1U1P A;  1VQY A;  4K5S A;  2PMH A;  4PPZ A;  3TRG A;  4C48 A;  3RU0 A;  3POT B;  1U6Z A;  2R3V A;  3GIK A;  2GHP A;  5DQG A;  3H5Y A;  4EBD A;  2PFD A;  1WHY A;  3ZZT A;  4IUF A;  4YOE A;  4RUC A;  3MFI A;  3CCW A;  3D0G E;  4M5J A;  2EWH A;  4WWS A;  3N5F A;  5KG1 A;  5LJ3 Y;  2VIC A;  2R7T A;  2LP4 A;  2YWG A;  2K3K A;  1RTD B;  7AT1 B;  2EFN A;  1PIL A;  5G0R B;  2KM8 B;  1XTZ A;  5HLF A;  1JLG B;  2R9L A;  4H4M A;  5DM6 Q;  4O44 B;  2XI3 A;  2VU5 A;  4FKY A;  4L76 A;  4UOG A;  2O5D A;  5AE2 A;  4OJH A;  4P7V A;  4LF9 J;  5JVH Q;  1CVJ A;  3ZZO A;  2B51 A;  2EG2 A;  3K2Y A;  3MEC A;  4TLR A;  1Q53 A;  4ELU A;  4Y0F A;  4J9Q A;  2ZBQ A;  5I3U A;  4F25 A;  2ZEJ A;  1OY6 A;  4V19 J;  3BYR A;  4XDC A;  2GGP A;  3KLE B;  1U6B A;  2A10 A;  4WKR A;  1YSJ A;  1YBU A;  1GH8 A;  1SPB P;  4HDG A;  5IOL A;  1EB0 A;  4NCA A;  4NLV A;  4ID5 A;  3O6Q A;  2CPF A;  1VQN S;  5T7L B;  3BO4 A;  3TAN A;  5C42 A;  1WTF A;  1M5H A;  1N5Y B;  1WKL A;  3GG1 A;  1TZ0 A;  2IA6 A;  1LFP A;  2FJV A;  2DCL A;  2W7O A;  3KYL A;  3HM9 A;  2AJ4 A;  2HWT A;  1SC6 A;  1NB2 A;  3UWT A;  1NZA A;  1VMB A;  4JV1 A;  5CCL A;  1C4A A;  2XMT A;  3H7H B;  3R9L A;  3RUB L;  4Z37 A;  4KO0 A;  2R42 A;  4IO9 Q;  4IDK B;  2GW8 A;  3EZ5 A;  1TL7 B;  3TJA A;  1FA0 A;  4GO5 X;  1RBL A;  3OTO J;  2U1A A;  5DG7 A;  2WVC A;  1B0V A;  3FZ2 A;  5LSL A;  4PR6 A;  5D0H A;  5CD4 A;  3GV5 B;  2DNZ A;  3CGI A;  3G86 A;  3VGV A;  2Y8Y A;  3PYF A;  2W2Q P;  1Y3J A;  3OQ2 A;  1OS5 A;  2B4V A;  3R5D A;  3UD5 A;  1B7Y B;  1PC5 A;  3HZE A;  1FRM A;  2BRL A;  1NXI A;  2DO0 A;  4DR5 F;  3NL0 A;  1RA6 A;  1WTB A;  4FNI A;  4TY8 A;  2MKC A;  3ILI A;  3J7Y U;  3DLH A;  2YKN A;  5EX0 A;  4DPX A;  4PUO B;  2PDA A;  4CI0 B;  3HD1 A;  3GCW P;  3TQE A;  2ZD1 B;  3ZO7 A;  1FES A;  4E98 A;  2QA2 A;  4M5K A;  4DF4 A;  1HBM A;  2V0N A;  3DRP B;  5H9E K;  2D3O R;  1RWK B;  1MW7 A;  3DHX A;  3KDO A;  2IDE A;  5E41 A;  2GVZ B;  4NML A;  2C28 A;  1V3Z A;  2M3D A;  3C3L A;  4FVM A;  5M2U A;  4I6Y A;  4ZKA A;  4RL1 A;  3NNA A;  2DNH A;  4LR7 A;  1HNZ F;  2KH9 A;  2LQB A;  4DX7 A;  2QL7 B;  2FYX A;  4JI5 J;  1FK9 A;  1OO0 B;  1S1T A;  2C3P A;  3VGU A;  2J0S D;  3GU0 A;  3JQM A;  4ZOS A;  3MCS A;  2IHR 1;  4EO8 A;  4RWW A;  4LRC A;  2ALZ A;  4DSE A;  3EGZ A;  1U09 A;  2YPZ A;  4RNH A;  2V6A A;  2MXY A;  3BSO A;  4TQS A;  2F7V A;  4IFY A;  2FJW A;  2KXF A;  3QPI A;  4QU7 A;  1PCA A;  4CLP A;  3QIP A;  3C8Y A;  5HAO A;  4CM0 A;  5JUM A;  2HQI A;  3UCU P;  2CAJ A;  2ZVI A;  5B0D A;  1KVI A;  5KFT A;  4ZLJ A;  2G9O A;  4ANE A;  3SBM A;  2W8L A;  4NE9 C;  4R0E A;  2R2R A;  1N6Q A;  5E3C A;  1YRT A;  4K4Y A;  4DPU A;  3KHH A;  1BQM A;  3I5A A;  4U9R A;  1KBR A;  1NME B;  1VGY A;  3V2U C;  3D5M A;  5HJY A;  3QT8 A;  5IWA F;  4I2Q B;  4ECV A;  2CQ2 A;  3N01 A;  2HUR A;  1M5V C;  2E1R A;  2OPR A;  3UR3 C;  4CLZ A;  5DZ7 A;  5AE1 A;  5GAD U;  3VAL A;  4KHM A;  2RML A;  5LJ5 Y;  4WIQ A;  5D15 A;  3T1H J;  2YNG B;  2OP5 A;  2KU7 A;  3MM9 A;  4P2F A;  3HMJ G;  2QYG A;  3MMA A;  4EYI B;  3BV8 A;  1D9D A;  2MGZ B;  3DM2 B;  4DPO A;  3QSY B;  1T11 A;  1RTI B;  2IM2 A;  3BBC A;  1Q82 T;  1DTT A;  1NCL A;  1RI7 A;  4WFY A;  2F65 A;  4QZV B;  3V6J A;  1XWL A;  5HAT A;  4RBU A;  1R0A B;  4AND A;  2IJN A;  2E66 A;  3J80 U;  3PFO A;  2CPY A;  1S6P A;  2OPR B;  2OPP A;  4YB6 A;  5LOQ A;  4F2R A;  4A8F A;  4MIW A;  3AFG A;  3H2V E;  5HO4 A;  1X0F A;  2AU0 A;  4ZLL A;  4IQM A;  3UVJ A;  2QIF A;  2M0G B;  4L72 B;  5DDQ C;  4ECU A;  5D4P A;  1RLD A;  3BGU A;  2OML A;  2J0X A;  1UTA A;  4Y28 C;  4O3Q A;  4CLS A;  3VCD A;  2VV5 A;  1H2V Z;  4CNZ A;  4K4W A;  2KTQ A;  2DO4 A;  2DY1 A;  5GVQ A;  1Y5N B;  4OJG A;  4DN0 A;  3SCK E;  1Q95 G;  2JLE A;  3I5C A;  1S77 D;  4G1Q A;  3WC2 A;  3W9J A;  4B3S F;  4QOT A;  2OJ3 A;  3OHA A;  4LR8 A;  5LM7 E;  1KVK A;  1R43 A;  4YB7 A;  4JI3 F;  4JB8 B;  3OLA A;  2ZJQ Q;  1PC4 A;  3ISN C;  3R5J B;  4R5P B;  3D28 A;  1BHN A;  3CJQ A;  5BYS A;  3F0N A;  1R6V A;  3AAW B;  4ZN3 A;  3HSG A;  2WVE A;  2C2O B;  1HLW A;  3KLI A;  3ZFV A;  1X0P A;  3LGH A;  1X4D A;  3EJM A;  3WZ0 A;  3EVO A;  4C11 B;  2NUH A;  4J9P A;  2MQO A;  3IC1 A;  3W60 A;  4BLG A;  1NHV A;  2WBR A;  3TVZ A;  4U8V A;  3MM7 A;  3QJJ A;  1U1M A;  3PKM A;  3DC2 A;  3CC7 S;  3S8S A;  1HWU A;  1TKX B;  3I0R A;  1ZS6 A;  1U1K A;  3BYP A;  3L7U A;  1UFK A;  2RKI B;  4NZ7 A;  3NKY A;  1QD1 A;  1O5J A;  5KFZ A;  2KN4 A;  4OX6 A;  1ZPV A;  4PG4 A;  3KFW X;  2CQP A;  1I51 B;  5CYQ B;  1DQ9 A;  4OHY A;  5C42 B;  5KFK A;  4YR0 A;  1RUS A;  3IFE A;  2VDI A;  1Y7P A;  1D3W A;  3HI9 A;  3OTB A;  4CQ1 A;  4B3T F;  1WHX A;  3KJF B;  2PT0 A;  3PRD A;  1YIT S;  2FLL A;  4X4U A;  1OIA A;  1TL5 A;  5FDL A;  5KT5 A;  4O3R A;  4PWD A;  4Q2M A;  1JX4 A;  2AF6 A;  4JI7 J;  4A47 A;  3B8H A;  1QVG R;  2HFZ A;  2B9E A;  5FLX Y;  3O5T B;  5E33 A;  3VZH A;  1Z2Z A;  1IM6 A;  4ES2 A;  4XPC A;  3TW0 A;  3FFI B;  4FYW B;  4I7F B;  4WFZ A;  2HFS A;  4KT0 C;  4HLB A;  2KVQ E;  4OI4 A;  2B4P A;  4DZ6 A;  4LMZ A;  3LP1 B;  2KVI A;  2YWW A;  3EWG A;  1RKJ A;  1WOS A;  1LWC A;  2CAD A;  3AH6 A;  2ZKU A;  2FGO A;  4NYO A;  4LFA J;  1U25 A;  4HHH A;  2BV3 A;  4I0W A;  5J2P A;  1ZH5 A;  2GQQ A;  1HWJ A;  1NPR A;  3CO9 A;  3ENA A;  1WC0 A;  3BPS P;  3QMQ A;  3DOK B;  1QJH A;  3MM8 A;  4ID8 A;  1S9G B;  2F9J A;  4N77 A;  5D4N A;  4JI2 F;  3VAG A;  2DJW A;  3DOM B;  3TI0 A;  4FKX A;  2FTR A;  3MAA A;  3DLB A;  3SFU A;  4HAC B;  2QMU B;  1W7W A;  4RW6 B;  1NDP A;  3G71 S;  3JTP A;  5KT4 A;  1H2T Z;  4MH8 A;  2DXF A;  1X4F A;  1LW0 A;  3HFV A;  3J81 Y;  3V4I B;  1YHQ S;  4I67 A;  4NLD A;  2XZT B;  2KO1 A;  3IBC B;  4F4A A;  4C3M A;  3OJS A;  5D0R A;  1I5O B;  1MRO B;  2DIV A;  1AA1 B;  1IKV A;  1EHW A;  3HHN B;  1S9F A;  6AT1 B;  1WF1 A;  2BW7 A;  3GYG A;  4IG3 A;  4IYQ A;  2HHU A;  3MHY A;  3AOB A;  4C11 A;  3AA9 A;  1KOH A;  2CNN B;  2IAJ B;  3IR7 B;  4FYV B;  3SCJ E;  2FPH X;  4JBC A;  2WOM B;  5A6W A;  5G0R A;  4DQQ A;  1FJG J;  2GAG C;  5C25 A;  2MQN A;  3FCW A;  1NK4 A;  1J2V A;  1S0V A;  2OPS B;  2W1B A;  3J81 j;  1MRO A;  1CJK A;  1YTY A;  3KDN A;  3LWL A;  2EKY A;  3DRR A;  2MQQ A;  1EKR A;  4KHR A;  4DQR A;  3R1L A;  2UXC J;  2VOP A;  5IT9 Y;  3CC4 S;  5KFJ A;  4LF8 J;  4MFB B;  3B6B A;  5KFN A;  1YJN S;  2DNN A;  2H54 B;  4PXC A;  1KQS R;  3OPK A;  3WQP A;  4FBT A;  4PQU A;  1MN7 A;  3OD2 A;  3G96 A;  4LBH A;  5C7P A;  2LYV A;  2D1C A;  5A8K A;  4DCJ B;  5DDR C;  4JYA F;  3CDA A;  1OSC A;  1U24 A;  4OZL A;  2Q6C A;  3UD4 P;  2MQL A;  2CJQ A;  1R8C A;  2ZOM A;  3I0S B;  2HK3 A;  5AJ3 J;  3HK2 A;  4J5O A;  1LXN A;  4YEA A;  4RW7 A;  2Y1J A;  2L3M A;  2DHS A;  2BE7 D;  2E5I A;  3N79 A;  4ZVF A;  1PBA A;  4ZJO A;  5J1N A;  1JLB B;  3RTV A;  4LF7 J;  2ALY B;  4OLO A;  5D0G A;  2VBX A;  3D3C J;  2V68 A;  5B0G A;  2W8K A;  3KLV A;  1ZTW A;  1T7P A;  2ZJR Q;  4JI5 F;  2ZOG A;  3T1Y J;  5C24 B;  1GMU A;  2QX0 A;  1C1B B;  1SC1 B;  3MGJ A;  5ETK A;  1VQK S;  2XHC A;  3CO0 P;  4WP3 A;  1RCO B;  5ETN A;  3W64 A;  1J5O B;  1FJG F;  2AT1 B;  1J27 A;  1H7W A;  4DL0 C;  3OL6 A;  2QE5 A;  3DGV A;  4TY8 B;  5J2N B;  3MEK A;  3ELH A;  2I38 A;  3ZZZ A;  2HVZ A;  2VG5 A;  2QLJ B;  4RJV A;  3BQ2 A;  4UY8 5;  1B70 B;  3ILL A;  3W9I A;  2OHD A;  4H4K A;  1LKZ A;  4ECW A;  5KFV A;  4N76 A;  1V5V A;  2OEL A;  1X8D A;  3WX4 A;  3ZC4 A;  1RT4 B;  2GAH C;  2ZC3 A;  3MTJ A;  1IBC B;  1VQ8 S;  4ECZ A;  2WCX A;  1U0H B;  2ZFH A;  3AB4 B;  2K1R B;  2VKZ G;  1U48 A;  3MR7 A;  4A8X A;  4TXS A;  2R8G A;  2Y0B B;  3D6T B;  3QWP A;  1Y0H A;  4NCB A;  2HNZ B;  3BGF A;  5J1E B;  1KLM B;  2MLY A;  4A8S A;  1ZZF A;  2CNO B;  5CYM B;  4YP3 A;  2HLU A;  1TFW A;  2GMH A;  4HH0 A;  2MLZ A;  4ZVT B;  4FVC A;  4OI3 A;  1FNX H;  4RO0 A;  3QRR A;  4B3O A;  2BA9 A;  2J9D A;  2QZ8 A;  4QR1 A;  3CCL S;  1U02 A;  2C2N A;  1TUW A;  4Q0B A;  2G2Z A;  3VZI A;  2HS3 A;  2ZE2 B;  3K89 A;  4X64 F;  3HLU A;  3P5T L;  4KGK A;  1DJ0 A;  3BN7 A;  2PE8 A;  2CDQ A;  4NLT A;  3OR1 A;  4MKB A;  3TAP A;  2FC8 A;  2DNP A;  2E7W A;  2LXF A;  3HVA A;  1S7H A;  4KGV B;  2DH9 A;  5F8I A;  2JEJ A;  3HO1 A;  1YRU A;  2FHJ D;  3LAK A;  2AQ4 A;  2KRR A;  4K4T A;  5E5N A;  3ITH A;  4M94 A;  3KLH A;  2VFT A;  2CRL A;  2IYG A;  3MAH A;  3BGR B;  3NP5 A;  1P8G A;  3O44 A;  2VG6 B;  3PYD A;  4OI2 A;  1CJU B;  1REV B;  1X5T A;  1YLX A;  4PAA A;  2KI2 A;  2X1A A;  1RTD A;  3DLJ A;  4DV0 J;  2AGP A;  2IBO A;  1VBZ A;  3BDP A;  2N3O A;  2COL A;  2RF2 A;  4A8O A;  2IC3 B;  1F5C A;  1HI8 A;  1IR2 A;  1R8B A;  4F8R A;  4QU6 A;  4DV3 J;  1XR7 A;  1IKX A;  3AY0 A;  4TQR A;  1OPZ A;  2V4Q A;  2FLN A;  5DJB A;  4IKA A;  1RSC A;  3I9Z A;  1X4C A;  3MTK A;  1Z1Z A;  4MKV A;  5F0W A;  2JJ4 D;  5KOX A;  3MFH A;  1RWO B;  2QLB B;  1NO8 A;  3DRX A;  3MUV P;  1WOP A;  4LF8 F;  5K20 B;  4TNO A;  3I0S A;  4F4K A;  5GMK a;  5AXL A;  1S1U B;  2GO9 A;  2ZUG A;  3M05 A;  1SL1 A;  3EDQ B;  4Y2A A;  1N6Q B;  5ETO A;  1O0P A;  4O3O A;  1LK5 A;  1RHU B;  1UPP A;  4Z2X A;  5A8R B;  1OQ6 A;  4U95 A;  3R97 A;  3V81 B;  2ZZM A;  1VFJ A;  1RKI A;  2CJB A;  3FMB A;  1UA0 A;  1R89 A;  4OI6 A;  1FEH A;  3PIP Q;  4PQA A;  3TX8 A;  2R7V A;  4DCP B;  2E5L J;  1SQE A;  1YJ7 A;  1S5Z A;  3QNW B;  4QWD A;  4DS5 A;  4J9O A;  4ZIV A;  5AJ3 F;  3OVS A;  3CNQ P;  5KT7 A;  3OL9 A;  3QWU A;  3B54 A;  5CH7 B;  1ZPW X;  3DCA A;  3MCO A;  4Q0B B;  2BZ2 A;  1L3T A;  1FEE A;  4QBU A;  3J80 Y;  4F50 A;  3N9U C;  2RDD A;  2X3D A;  1NSA A;  3KLF A;  3KK2 A;  4IOB A;  2W2P P;  3PJ9 A;  4C97 A;  1LQ9 A;  2LVW A;  3QAE A;  3PTW A;  4U67 Q;  1HI0 P;  1CJV A;  4CT8 A;  1M90 T;  1PKU A;  1VQ5 S;  2HYI B;  3GIL A;  2DNQ A;  1L3S A;  1NH7 A;  4RWX A;  3VGT A;  4ED5 A;  2MQP A;  4A8K A;  4OZ2 A;  4LQ3 A;  1IQZ A;  3CIZ A;  3FSY A;  3KLG B;  1YBA A;  1RLC L;  3FSI A;  1TV6 A;  4X84 A;  4GKJ F;  2ZHO A;  3W2V A;  3RBX A;  2AW0 A;  1N5T A;  4OYB A;  3NGD A;  1WEX A;  2XS5 A;  2FJD B;  2V9K A;  3RAX A;  1D8Z A;  1NDC A;  1WOO A;  1F9F A;  2EPI A;  1FWK A;  3S01 A;  2MQ8 A;  3F44 A;  3RGI A;  3UPF A;  1HBU A;  4B3S J;  5IM0 B;  3OXG A;  1HBO B;  4A48 A;  2X1F A;  4DUY F;  1N54 B;  2B4U A;  3SIP B;  3PYG A;  4FYY B;  4URQ U;  3ZZR A;  4CNY A;  1TKD A;  1UVN A;  4K4Z A;  3K5L A;  3HP6 A;  1OWX A;  3L7O A;  1F2H A;  5F9L A;  3TAQ A;  3DN9 A;  1JK9 B;  4DFM A;  2J6S A;  2UXC F;  1QUP A;  1UEK A;  1YWX A;  1XEZ A;  3OV7 A;  3QIP B;  2OAU A;  3QT5 A;  2I5J B;  2B3T B;  3TEG A;  4C6A A;  1EAY C;  4NLX A;  4ZVQ B;  5JXS A;  4P71 A;  4NXM J;  2C3M A;  2PEB A;  3KKF A;  4J90 A;  2QMX A;  4DOZ A;  1APS A;  2JC1 A;  1UJ5 A;  5DET A;  1KN6 A;  1N5Q A;  2F8H A;  2BE9 B;  3ZZ0 A;  3N4W A;  4RW7 B;  1S76 D;  2H9Z A;  3TVK A;  4LBI A;  1CJU A;  1S6Q B;  4DV2 J;  4YS2 A;  4ENO A;  2BQ3 A;  4WK3 A;  3RR8 A;  4IR9 A;  2MMY A;  2NUU G;  2OEJ A;  3SFG A;  4ELT A;  3RW7 A;  4WYW A;  1ZM3 A;  3EX7 B;  1RWP B;  1RTH B;  2WON B;  4OX8 A;  3M2U A;  3VAH A;  3TAM B;  2DVI A;  1HBN B;  3PX4 A;  5KFI A;  2VA3 A;  4JI7 F;  1FJC A;  4ZVR B;  1RAC B;  2HPU A;  3GYX B;  1LK7 A;  3N6M A;  1VK3 A;  2HS0 A;  4X4T A;  3V6D A;  2BOA A;  4WPA A;  1S0M A;  1RHM B;  2G4B A;  5CCM A;  5FD1 A;  5ETR A;  5KFE A;  1T9X A;  1CUL B;  3M8Z A;  3CCQ S;  1P1L A;  2UU9 J;  2VFU A;  3OR2 A;  4R0J A;  4XPE A;  2AYB A;  2ZHA A;  2HZA A;  1TL4 A;  2PMZ D;  1R27 B;  4LSL A;  4DLE A;  4DSL A;  2Q79 A;  5AXN A;  4P2X A;  4ETX A;  1N36 J;  1WKK A;  1RWN B;  1LOU A;  2RNE A;  3E8O A;  1JXE A;  3U27 A;  1J5E F;  2R8K A;  5HBM A;  4JI2 J;  3T41 A;  1XMQ F;  1EP4 A;  4ZJQ A;  2B56 A;  2BE2 B;  4IG3 B;  1BMQ B;  4EK2 A;  1S7I A;  5HMY A;  5IT4 A;  5KFB A;  2DYA A;  4FNH A;  1KS2 A;  2WRM A;  3U1M A;  1I3O B;  1YZ6 A;  1RA7 A;  5CYM A;  1HNX F;  1N5Y A;  5J1E A;  3M1V B;  4KC5 A;  1VQ9 S;  1U1Q A;  1NK9 A;  4QYZ J;  3W1Y C;  4DG1 B;  1WC6 A;  2MHN A;  2XI2 A;  4PRF A;  2PI5 A;  2RD5 C;  3SDE B;  2W7A A;  1UJ6 A;  3CJT A;  1S1X B;  3MM8 B;  4RUH A;  4LBP A;  1DFD A;  2EFQ A;  4ZHR A;  1PJ6 A;  2J8A A;  4ED8 A;  2GMJ A;  5KG3 A;  4LFB F;  4OHZ A;  3BB5 A;  2RKI A;  4CLU A;  2NQP A;  2WZ1 A;  1NLK L;  2XCA A;  2A2C A;  3WC0 A;  2A1B A;  3NGR A;  4H4M B;  4WXO A;  3Q2S C;  3JB9 k;  4ECX A;  3NOG A;  5DLF A;  2VHG A;  3BO2 A;  5K8M A;  4KPY A;  2L9D A;  4ED2 A;  2HND A;  5FDL B;  3LAN A;  1FXL A;  2WVB A;  3I4H X;  1HMV A;  1VQ6 S;  1WEZ A;  1E6Y B;  1FNO A;  2HZC A;  1F60 B;  4M1K A;  4J9M A;  4DR2 F;  2XGP A;  2GX8 A;  2XY5 A;  4CYU B;  3TQ1 A;  4R8U B;  4FXV A;  4FS2 A;  1U49 A;  4GO7 X;  4OYI A;  1ULR A;  1TK5 A;  2F63 A;  2YVS A;  3AD7 C;  3C66 A;  3K5O A;  4K4X A;  3OT9 A;  4C4W A;  3SQG B;  3JXO A;  2YWH A;  4IG0 B;  4MMO A;  2KT5 A;  2I8E A;  3J7Z T;  3RAQ A;  4JI1 F;  1T03 A;  1VBK A;  1HW9 A;  3PO4 A;  3W2W A;  2DHG A;  5H9E J;  3N28 A;  4OYX A;  2Q43 A;  4QW9 A;  3D7S B;  2LQ5 A;  2PO4 A;  4B9L A;  2BAN A;  4YUD A;  4CO1 A;  2FC9 A;  1R7I A;  3UVJ B;  2HW3 A;  2KFZ A;  3IMQ J;  3T1H F;  3OSN A;  3CD7 A;  1FVS A;  5H1S V;  1AZS A;  3P5B P;  1PBU A;  1FKP A;  3M32 B;  4C8K A;  3R5C A;  5IT9 U;  1RU1 A;  1SJF A;  1SJ4 P;  3GR0 A;  1BWV A;  2W01 A;  4ZPT R;  3EUN A;  4F26 A;  1OPI A;  4U6P A;  2DR9 A;  1VS3 A;  1FTC A;  1VLY A;  2B9W A;  1IN0 A;  1KON A;  1D9A A;  2CG8 A;  3EIC A;  5C25 B;  4ZIW A;  3M6X A;  4PCQ A;  1IBL J;  3JSY A;  4FXW A;  3QAT A;  2DPJ A;  3FRZ A;  2CVI A;  4U8Y A;  1SKW A;  3RB6 A;  4JI6 F;  4DR2 J;  4O3N A;  3IA0 A;  3M2V B;  3W63 A;  1HQE A;  3UI3 A;  3IGN A;  2R4F A;  1D09 B;  2OPP B;  3A3O B;  5A8W A;  1S9G A;  3ET6 A;  1M1H A;  2XLI A;  2EW9 A;  5HP1 B;  3PX6 A;  1SB6 A;  3KHR A;  1SKR A;  1U1R A;  2YXL A;  3CB4 A;  2K7J A;  4IRK A;  3D6F B;  2A0F B;  3VHQ A;  3QZ8 A;  4ECY A;  1RB0 A;  3LAL A;  4UW2 A;  1T0T V;  5DZ6 A;  4KFB B;  4A46 A;  2MJU A;  5HRO B;  3G8Q A;  3GMG A;  4RW9 A;  3D68 A;  3P4U B;  3TZY A;  1XQI A;  2Z2Z A;  3CWJ A;  5A8W B;  3R1H A;  2HGL A;  3H2L A;  3BQ1 A;  3SZ2 A;  3PO5 A;  3BGO P;  4MK9 A;  2IRU A;  4J9N A;  4UOH A;  2BMB A;  2CQB A;  1VC0 A;  4L3K A;  1ROF A;  1HFE L;  1KVJ A;  2L48 A;  3PRV A;  4CTA B;  3GG0 A;  5JVG Q;  1S99 A;  3AA8 A;  1FF2 A;  3GJT B;  4RBT A;  5LMU J;  4W90 B;  3GLJ A;  5A2Q Y;  3NEK A;  2OPS A;  3K5P A;  1MG7 A;  3OTD A;  4X65 J;  3M8S A;  5LSO A;  3TUI C;  3DI6 A;  2CPI A;  3JYT A;  1RHQ B;  3BSA A;  5E3P A;  4DFJ A;  4FPI A;  5KFW A;  2XMU A;  2CZ9 A;  3TUJ C;  3UW1 A;  4P10 A;  5KFY A;  3GP9 A;  2B8Q A;  3M8Q B;  1FJE B;  1VRU A;  3GJQ B;  4ZPV R;  3FVY A;  3T6B A;  4LRF A;  3BR9 A;  3NBP B;  1HMV B;  1GNK A;  1EX8 A;  1YDL A;  1SI9 A;  3V4I A;  1FO1 A;  1C0T B;  3K8W A;  4IDK A;  2WVD A;  2HHS A;  4D3G A;  1UW9 A;  2O1P A;  2QN6 B;  3QGP A;  4EUV A;  4YDX A;  3M6W A;  3VAF A;  4LFB J;  4Q8E A;  1IKV B;  2NRE A;  3TAM A;  1K44 A;  3UD3 P;  4NLY A;  2I2Y A;  1NDK A;  5KAK A;  4DL5 A;  2KYZ A;  2BKO A;  3R3T A;  3SSQ A;  2RU9 A;  2WK4 A;  2EBG A;  2RDJ A;  3D1H A;  1VLO A;  4M63 A;  5KFF A;  2AHO B;  2W4P A;  2J7K A;  4ZMM A;  4XIU A;  2WB1 D;  1HNI B;  4J37 A;  5LMN F;  2EG1 A;  3CF5 Q;  2UU9 F;  3CDW A;  1XK8 A;  3NCP A;  4QWE A;  1S0O A;  2JEI A;  4OZ0 A;  4F3M A;  3RJM B;  4H4O A;  3FEY B;  1KP6 A;  2MKS A;  4Q43 A;  2L41 A;  1LW2 A;  3TWZ A;  2XS7 A;  3FQK A;  2Z56 B;  1G7C B;  4QPX A;  2YH1 A;  1QDU B;  2OFG X;  4OV1 A;  2OTL S;  3LPE A;  4ECR A;  2M8H A;  1BUX A;  1CS4 A;  1JLG A;  2RH3 A;  3DXB A;  1PGZ A;  4ILL A;  4LF9 F;  4DL2 A;  4ZCL A;  3RBZ A;  1S10 A;  3OUY A;  2KJV A;  3SDE A;  4OQJ A;  3KLH B;  2UUA J;  1R0B G;  1Q4R A;  4JUZ A;  2ZH1 A;  3M2V A;  4IO1 A;  3CCJ S;  2VUG A;  3QGG A;  7FDR A;  3GIJ A;  2VBZ A;  2WW8 A;  2XUL A;  3U02 A;  4RUB A;  5CD4 H;  2QEX S;  2V67 A;  2WW4 A;  1BLU A;  2XBP A;  4ZPC A;  2EBE A;  3HFZ B;  1X9W A;  2CA9 A;  1MU2 A;  2RAQ A;  2ZWO A;  1HNV A;  3AD8 C;  4ZHR B;  5B08 A;  4DUZ J;  4OX7 A;  3QSI A;  4YHH J;  1GMW A;  4CCH A;  3KOA A;  3HKW A;  4M5N A;  5IV4 A;  2MQM A;  1RXO B;  4ZVU B;  4LSL B;  5F9N A;  1F1B B;  3PYE A;  2X51 A;  3HSZ A;  1M5P C;  4X62 J;  1NB7 A;  4IH7 A;  2PFF B;  3H5S A;  1UWA A;  2ASY A;  1U6F A;  4O23 A;  4UOC A;  2QA4 G;  5KFA A;  2FJX A;  3PW4 A;  5EWF A;  2P6T A;  4I2P A;  1W2I A;  4OLP A;  4QJV A;  5GAG U;  4TU9 A;  4FS1 A;  5JMN A;  5HQ8 A;  1D1U A;  1S6P B;  3B82 A;  1QE1 B;  2DNO A;  2RUG A;  3VV2 B;  2J6U A;  2DRB A;  3MM6 B;  1JLE B;  1PJ7 A;  3GJR B;  2BW2 A;  3H8Y A;  3B4D A;  3NRB A;  4URG A;  3BSC A;  1VRT A;  1VQ4 S;  2D41 A;  2BYC A;  3I32 A;  4ERD A;  2J76 E;  4DR5 J;  1NK7 A;  1JXL A;  2DCU B;  2OD6 A;  3HVT A;  4L75 A;  1SBR A;  4Q44 A;  3JSM B;  3IWL A;  1R3N A;  3CJ4 A;  1W2B R;  2L9W A;  2XYG B;  5L38 A;  4B17 A;  1WF2 A;  1L3U A;  2HIQ A;  3P96 A;  4O3S A;  3KLF B;  3TA2 A;  1JMT A;  3EM1 A;  2J8S A;  1QAX A;  3IR6 B;  3G6X A;  1U47 A;  2ZD1 A;  1GMV A;  1QLN A;  1CPZ A;  1FE0 A;  4RX6 A;  3CJ2 A;  3DM2 A;  1H74 A;  1LFW A;  4HVZ A;  4JI1 J;  3D0I E;  2UUB F;  5DDP C;  3AXK A;  2IVM A;  4IR1 A;  2Y0S D;  1N33 J;  5F0U A;  2RIL A;  4CLK A;  4M5D B;  1WI8 A;  5K8P A;  1TL7 A;  3ETM A;  3K7R A;  1FHT A;  1RWU A;  4DU7 A;  1LNQ A;  3CJS A;  4OJ3 A;  2A6O A;  4CLT A;  2J7W A;  1AB8 A;  1JLC A;  1HBO A;  1N56 A;  4E2F B;  4TYB A;  1WKJ A;  2E1A A;  4Q45 A;  3CPW R;  3AOA A;  4PKD B;  4DF8 A;  3G8T A;  3KHG A;  3FC9 A;  2BJ8 A;  1HQU A;  2DGW A;  1SH2 A;  4J7C A;  4WK1 A;  5D8H B;  2EEY A;  2YKA A;  3BM7 A;  2DY9 A;  3D2W A;  1FFG B;  4K0K F;  3NWG A;  2JC0 A;  1IKX B;  1F3F A;  1TKZ A;  3ISZ A;  3UR0 A;  1NDL A;  2QGF B;  2VQF J;  4B3T J;  2E9Z A;  2VL1 A;  1F2G A;  2NPI A;  1M5O C;  2P9E A;  3C6T A;  3MPU B;  1NK6 A;  3MM6 A;  1JJ2 R;  3KXD A;  1EKS A;  1IKY A;  2DR5 A;  2CKW A;  3D67 A;  1N34 F;  2HHV A;  3AOD A;  2V8G A;  2B5J B;  3ONQ A;  4OZJ A;  4AE5 A;  1R0C B;  2UVW A;  3M9M B;  1BQN B;  5L1I A;  2CPH A;  2OPQ A;  4MYT A;  2CIM A;  2HBR B;  3T1A A;  4GC7 A;  3CTR A;  3IBF B;  1SH3 A;  5HQL A;  4WU3 A;  1HR0 F;  4X4N A;  4HYK A;  3TZX A;  3JQJ A;  2DGT A;  1DQ8 A;  3IXQ A;  3UO0 A;  2HLT A;  2RQK A;  5IQ6 A;  4JI8 F;  1T9Y A;  3CME S;  2UVV A;  4DPT A;  5ADZ A;  4MK8 A;  4TLQ A;  1H38 A;  2B0G A;  4O4R A;  3UN5 A;  3CIM A;  5I3Q A;  3BR8 A;  1YJV A;  2KZZ A;  3P6Y C;  4WU2 A;  1NKE A;  1HWI A;  2AEF A;  2DIT A;  2J5A A;  2RJZ A;  2CPD A;  2VKR A;  3BN4 A;  3HDS A;  1DTQ A;  1SQG A;  3Q8U A;  2FDN A;  3IRX A;  3PXG a;  4NX9 A;  1Y5L B;  5K14 A;  3PW5 A;  1JKH A;  2IPO B;  1BY9 A;  4OZN A;  1ZAW A;  4C98 A;  1D9F A;  4KGX B;  3UFC X;  2MB0 B;  3FEX B;  2X7I A;  4ECS A;  2HHW A;  1PAE X;  2D69 A;  2FJE B;  3O2I A;  3WDO A;  2F5G A;  1H0H B;  3K0J A;  3E2E A;  1Q78 A;  5I3P A;  4FF3 A;  4P6Q A;  2C2D A;  3M9N B;  1T9T A;  3KG0 A;  2W7P A;  1VJQ A;  2ZM6 F;  1GXL A;  2ZBI A;  3LO3 A;  2KRB A;  4P73 A;  4DV6 F;  4NXN J;  1MMN A;  1R31 A;  1XR6 A;  1T05 A;  1CEZ A;  1JKH B;  1FWP A;  1TR0 A;  3NCQ A;  2ZE2 A;  3OFH A;  4CP5 A;  2XLK A;  2YNH B;  2HAI A;  1I6J A;  1Q1K A;  1IR0 A;  2B7C B;  3FBE A;  4ED0 A;  1HNI A;  2DGX A;  2FVP A;  1IJF B;  2QLX A;  2WVF A;  1OY9 A;  5E3Q A;  4JV0 A;  2QFJ A;  4NZ0 A;  2KXN B;  1XIQ A;  2B9X A;  1X5S A;  2MZS A;  3OXF A;  8AT1 B;  3BJY A;  1NHU A;  1DBD A;  2P9C A;  1GEH A;  3HKZ D;  1EET A;  4ZJL A;  4GKK F;  2APO A;  2R2S A;  4NA2 A;  4P7T A;  3K58 A;  3HSJ A;  5KG2 A;  4HI1 A;  2HSE B;  2LCW A;  2HQF A;  3POT A;  4MYU A;  1RIS A;  2CJ9 A;  1CJV B;  3HVW A;  4KV8 A;  5KFO A;  3KK3 B;  4U96 A;  4DV5 F;  3HJV A;  4PG7 A;  4DR3 J;  1YJ9 S;  3ENW A;  4I4B A;  1JLA A;  2CQG A;  3W7B A;  3P8B B;  1IXK A;  4L74 A;  4JV5 F;  1VQS A;  2QSF A;  4I68 A;  4ZVE A;  3N5B A;  1S1V A;  4C8N A;  2UUB J;  1GXT A;  3NGU A;  4CH7 A;  1G6B A;  1SQF A;  2JEF A;  2GQC A;  4OFZ A;  2NCK L;  5KG6 A;  4WCE Q;  1RK8 A;  3SMZ A;  4CIO A;  1KSP A;  4KV8 B;  5KFL A;  2ACM A;  2VON A;  3US5 A;  3KNA A;  3OJU A;  2HQD A;  2X1G A;  5DM7 Q;  3D0H E;  3BDE A;  1NRK A;  3L7P A;  4DXL A;  1RTH A;  2VAS A;  4ETZ A;  5EGY A;  1NSK L;  1UVK A;  1TMM A;  2CJX B;  3HHL C;  3I96 A;  4KSE B;  3K59 A;  5L1K A;  1TVR B;  4DUZ F;  1P1T A;  3DLG A;  4NMX A;  4N47 A;  3DRS B;  2XMM A;  3ZTQ A;  4Z7C A;  4X4P A;  3OHB A;  5HJX A;  1S1W B;  1C2P A;  4FP9 A;  2ABY A;  3QZ7 A;  1VIS A;  1TAU A;  3GYN A;  1VIX A;  2BAB A;  2I6W A;  4X62 F;  2K2P A;  1MWQ A;  4G1I A;  1WUU A;  1YJT A;  2NSC A;  3GFH A;  1NND A;  1Q8K A;  1OYD A;  2BM0 A;  1FTR A;  2WOM A;  4RW9 B;  3UCG A;  4QWA A;  3IAM 9;  4Y00 A;  3TO8 A;  3MXH P;  2XY7 A;  1CS4 B;  4RW4 A;  4K0K J;  1LWC B;  3MMA B;  5IT0 A;  2A2D A;  4CH0 S;  3FBB A;  1WDT A;  3TUZ C;  5KFM A;  4XO0 A;  1F6T A;  2XC9 A;  4ZCI A;  4DR3 F;  3HVT B;  4NYZ A;  4G3I A;  3DOL B;  5IV3 A;  2FHM A;  1FKO A;  3A12 A;  4ES1 A;  2V2V A;  1AYE A;  1KKH A;  3ZZP A;  4ED7 A;  2P6S A;  1XC9 A;  2O3D A;  1KTV A;  5A0Y A;  1SXL A;  2AJ0 A;  1UEU A;  2XYH B;  3BKT A;  1P9Q C;  4NA3 A;  4PWW A;  2ERR A;  2DBB A;  3IN5 A;  3NNH A;  1GAO A;  2VQE F;  4AL5 A;  4AL6 A;  2NZC A;  1FRK A;  2LLZ A;  2R8H A;  2AEJ A;  4K2X A;  3R7B B;  2ATC B;  3A1Y G;  4USI A;  5EX3 A;  5A8K B;  2UP1 A;  3MPY A;  3LQV A;  5KG5 A;  4X4Q A;  3NLC A;  2W2N P;  2XMW A;  3UNG C;  3CJR A;  2L08 A;  1WAC A;  4WP9 A;  3W9H A;  2IAJ A;  1LW2 B;  1UPM B;  3OFG A;  5KT3 A;  4PZV A;  3M2R A;  3W8P A;  3AQO A;  1N0V C;  1RTZ A;  3GSD A;  3SXL A;  2YBV A;  4ZCM A;  4QPT A;  4RBV A;  1N33 F;  3I5B A;  2DIS A;  3RRH A;  3RR7 A;  4DS4 A;  4YY3 J;  2F4F A;  4R25 A;  2Q3P A;  4OX9 F;  1KEK A;  4FYD A;  4QIV A;  1M1G A;  4EWT A;  1REG X;  2FZC B;  3QT7 A;  2GIF A;  2VPY B;  5B0A A;  2YQ1 A;  3H25 A;  4NXM F;  3W62 A;  2G2Y A;  4DEZ A;  2DPI A;  3IG1 A;  4C8O A;  4J9K A;  3C19 A;  3BBF A;  1GTH A;  2BBE A;  1TKX A;  2BEF A;  2F40 A;  2PII A;  3I0R B;  1T3O A;  4GVL A;  4UZC A;  1VI7 A;  2BUN A;  3H98 A;  4ZP8 A;  5DDO C;  3KK1 B;  4DV2 F;  3PVX A;  5MAO A;  3IGV A;  1HW8 A;  2MY8 A;  2QG9 B;  1AXQ A;  2YKP A;  3M7V A;  4X66 J;  4ED3 A;  4NAS A;  3S7R A;  2XNR A;  1GQE A;  4USH A;  3QQC D;  1RT4 A;  1RBO B;  3EGV A;  3NNC A;  3I31 A;  2W24 A;  4NEZ A;  2VG6 A;  2CQC A;  3Q8P B;  1VQM S;  3NBP A;  1NPP A;  2VH7 A;  3CUN A;  3K5N A;  3T5H A;  2R2T A;  3L09 A;  1RHK B;  2QMW A;  2VFS A;  2VQF F;  4F0M A;  3FJ2 A;  4HTI A;  3PG9 A;  3MR3 A;  1NUE A;  1TFY A;  1C0T A;  1C1B A;  1Y00 A;  3FFI A;  1SV5 A;  4I7F A;  1KQG B;  5U47 A;  3ADA C;  3C6U A;  4FF4 A;  2CZ4 A;  2LEB A;  3GON A;  2JZ5 A;  1IBM F;  3VQS A;  4BWJ A;  1V3R A;  5DO2 A;  4DHV A;  2VPW B;  4MAK A;  3PCO B;  2HVH A;  1DLO A;  2VDH A;  4WE1 A;  1RT7 A;  3BGL A;  4X64 J;  2EC2 A;  1RWV B;  2RRB A;  4ZPA A;  2UUC F;  5BR8 F;  3RRG A;  1F5A A;  2M70 A;  3BKU A;  3IM8 A;  3M8P B;  5E2Q A;  1NAQ A;  2WSF C;  3D3B J;  3DI6 B;  5CYJ A;  4LQ9 A;  3GQC A;  1LWE A;  3DYA A;  4RUA A;  2FVQ A;  2QLW A;  2WBM A;  3T3F A;  3MPV A;  2DNG A;  4H4K C;  4KRW A;  5F41 A;  4FDF A;  1RQ0 A;  3QBC A;  4RU2 A;  3PRB A;  1WEY A;  1FJ7 A;  5BJR A;  2HVI A;  1CJT B;  1U0S A;  2M88 A;  3MI7 X;  1SJ3 P;  1U8S A;  2V8V A;  2LQ9 A;  4G1Q B;  5KOW A;  2LXU A;  3RAM A;  1JLE A;  1TUV A;  4TU8 A;  1A6L A;  3GV7 B;  4NLU A;  2GVD B;  2HIY A;  2XMV A;  2IFX A;  1TKT A;  4IFV B;  1ZM4 A;  1FRX A;  5GAE I;  2KG1 A;  3H5U A;  5HRO A;  3Q8Y A;  3CC2 S;  3CDU A;  4QQB A;  1MMD A;  3MEG B;  1VQO S;  5KFP A;  1RTJ A;  2OEM A;  3DKD A;  1RAJ A;  1UET A;  1JLF A;  3KJV A;  3DLG B;  4QWB A;  2ZH5 A;  1RDR A;  4EBE A;  2RIJ A;  2DR8 A;  3MAA B;  2W2M P;  4B9S A;  2CUY A;  3FKB A;  3OL7 A;  3FUY A;  1URR A;  2G0C A;  3L9Z A;  4C8Y A;  1OJ4 A;  2C2K B;  1HIY A;  2AV5 A;  3SQO P;  4ZVG A;  2IBK A;  1Z4U A;  1JB0 C;  1RAG B;  3PR5 B;  1RT6 B;  2HNY B;  4NLW A;  2KFN A;  3DRY A;  2N7C A;  3DGP B;  2MLX A;  3HF5 A;  4KIA A;  3C14 A;  2IVF B;  4W98 A;  2ZWP A;  2GHV C;  8RUC A;  2IMW P;  5F3Z A;  3G82 A;  4DPW A;  1NKC A;  2LEP A;  3IS9 B;  2VJV A;  1H6K X;  1I1G A;  1R8P A;  1RP5 A;  2FHK A;  2ZNY A;  4KBI A;  4OZ1 A;  1ZYQ A;  1L5U A;  3EVM A;  2LMI A;  1QSL A;  1MNE A;  4G65 A;  2KJW A;  5AXK A;  1LWX A;  1IJE B;  2M9K A;  3DLK A;  1V9O A;  3FCH A;  3B4M A;  4HT5 A;  2CPE A;  4CO0 A;  2YNG A;  3CE8 A;  1F5B A;  3ZXW A;  2F4V F;  2D3U A;  3HHL D;  5J2P B;  3D6H B;  1VHI A;  1OSD A;  1EQ0 A;  4PQU B;  4CDI A;  4NCG B;  1E6Y A;  2GS8 A;  1RJJ A;  4F36 A;  4RNF A;  5J1P A;  2J9D E;  2H5J B;  3DOM A;  4C9D A;  1B4S A;  3ICL A;  3M6V A;  1ELO A;  5A2Q U;  1IBK J;  4OX9 J;  3R7N B;  1S97 A;  5CAA A;  4KTQ A;  4ZA1 A;  1FRJ A;  4P72 A;  1SJQ A;  3CD6 S;  3W61 A;  3EDR B;  4EZ6 A;  3DMJ A;  3VWS A;  1ZM2 A;  2NYI A;  4ER8 A;  2OI2 A;  4WFB Q;  3CSK A;  2N82 B;  1VHF A;  4XK8 C;  2CVE A;  4NI2 B;  4OYO A;  2HMI B;  1RT1 A;  4RW8 B;  4LF6 J;  2OFH X;  1SL2 A;  1WOR A;  4ZVP B;  1XN9 A;  2YKN B;  5T7L A;  2NXC A;  1JLQ B;  3H59 A;  1C1C A;  3U1N A;  5A0Y B;  1IBL F;  4DR4 F;  3IG1 B;  4ANC A;  3IBW A;  1YG0 A;  1TAQ A;  1FKP B;  4RPF A;  3MUT P;  1NJX A;  3DLL Q;  1CJK B;  2K7K A;  3LH2 S;  4L6V 3;  3UDC A;  4DMZ A;  4USV A;  2W9B B;  3S6E A;  4CT9 A;  2CXE A;  2FJA B;  2J0W A;  2BJ7 A;  3FQL A;  4LSZ B;  2MKJ A;  3BQ0 A;  3DOK A;  2FHO B;  1KFS A;  2RT3 A;  4EO6 A;  2HRY A;  4Y2M A;  2K06 A;  3IM9 A;  2RU3 A;  2LQ8 A;  1L3V A;  3QT6 A;  4K59 A;  2NZ4 A;  1WD6 A;  3KJN B;  3MMB B;  2MZ1 A;  2HHQ A;  1Y11 A;  2AIR B;  2CYY A;  3ZTR A;  3M1V A;  2MJN A;  1SVD A;  2EXU A;  4BHQ A;  1IBK F;  2VA2 A;  4C0O C;  1JJ4 A;  5KFG A;  3T5J A;  1BGX T;  4RNM A;  4DX6 A;  3GIR A;  2B5J A;  1GT8 A;  4F04 B;  1XJW B;  1JJC B;  3L4B C;  3QGH A;  2GO8 A;  4B3M F;  1H2U X;  1TL1 B;  3JQK A;  2BR0 A;  3MCN A;  4DU8 A;  2IJR A;  3EXC X;  1BQM B;  5E0O A;  3Q8R B;  2DHA A;  1HR0 J;  1OY8 A;  2ROP A;  4IH5 A;  5C2C A;  3G87 A;  3GV8 B;  3M9O B;  1UVL A;  3PAC A;  1W26 A;  1VRQ C;  2HG4 A;  2EC0 A;  4OI1 A;  3EMT A;  2LU1 A;  4TYA A;  2HFO A;  5D6G A;  2DH8 A;  2E5G A;  2RQM A;  1JWW A;  1K1Q A;  4IRC A;  4OL8 A;  2B6A B;  2QJ3 A;  3MMC B;  3SV3 A;  3HCX A;  3IWX A;  3GFZ A;  4Y2I A;  1UZD A;  4EGL A;  2JLF A;  6FD1 A;  2NLW A;  3Q24 A;  2B9Y A;  4EBC A;  1FD2 A;  4NEY A;  4USJ C;  5GAD I;  1OMS A;  4RZR A;  4DR1 F;  4ZIT A;  4N56 A;  3KHL A;  1SKU B;  1IR1 A;  3ZZY A;  1S9E B;  2HVE A;  2Y3Y A;  4YB5 A;  1FD8 A;  4DCO B;  4UQT A;  4JI4 J;  4W92 B;  4RW4 B;  1MN9 A;  2GIQ A;  4PXB A;  1HA1 A;  3SSS A;  3T5L A;  4HH1 A;  4ED4 A;  1Y9O A;  1UL3 A;  3I4P A;  5B0F A;  2VBW A;  3AOC A;  3V6D B;  1P27 B;  2YWK A;  1ZET A;  4DSJ A;  1QSY A;  1ZM9 A;  4I64 A;  2MDA A;  4I6W A;  4OI0 A;  5EWE A;  3GIM A;  3OR2 B;  2H48 B;  3JTO A;  4WBF A;  1NBE B;  3K5M A;  3X3U A;  2NSB A;  1RAI B;  1SIZ A;  2QA4 S;  4UST A;  5EWG A;  1RT3 B;  3MUM P;  2AGO A;  2FZK B;  1M1K T;  1N32 J;  1NK5 A;  1S57 A;  1NKB A;  3VAI A;  3J7Z 5;  3G9C A;  1WDD A;  2EFO A;  4BC7 A;  1WEL A;  1FXD A;  3F73 A;  3IRX B;  3KG4 A;  1NJW A;  2GHW A;  4ZLN A;  4J91 A;  1TL1 A;  3A4T A;  3BH7 B;  3O1L A;  4FPR A;  2Y1R I;  4CM2 A;  2IM1 A;  1F9H A;  2MPU A;  2YX1 A;  2AGQ A;  4WZQ A;  3GE9 A;  4IOA Q;  4QYR A;  1YRX A;  2LQJ A;  2W9B A;  1IWA A;  1RTJ B;  2BVZ A;  3NS5 A;  3N6L A;  2ASJ A;  4KY3 A;  1LWF B;  3C16 B;  3ENQ A;  3CJK A;  4MK7 A;  5FJ4 A;  4IG0 A;  5H9F J;  3QO9 A;  4NLP A;  5IWA J;  4NLO A;  3PX0 A;  4C8Z A;  2QO3 A;  1X4A A;  3FBF A;  5EUH A;  2P5V A;  3KLE A;  2IMO A;  5F8H A;  2QL9 B;  3EPI A;  1U26 A;  2CPZ A;  3OSP A;  2BKN A;  2HGM A;  4F4Z A;  3R2C J;  2MZJ A;  2QV6 A;  1JLC B;  5AT1 B;  3QRP A;  4KJI A;  1S9E A;  2CJY B;  5L1L A;  3EXY A;  4LSN A;  1HQU B;  4A8M P;  3PV8 A;  3CDB A;  1KWM A;  3JAM U;  4PWU A;  3IO1 A;  1T02 A;  4DSK A;  1D0E A;  3OVB A;  3W3S A;  1MSW D;  1S49 A;  1KOO A;  2FIU A;  2OMO A;  1VIO A;  1TKZ B;  1S1U A;  4X4S A;  2FVC A;  4K4U A;  3PJW A;  2DK2 A;  2F1F A;  5HI7 A;  1DAR A;  5DQH A;  2QFI A;  4L73 A;  2BXJ A;  2E1P A;  2IIH A;  9RUB A;  3PHE A;  1HD1 A;  5B09 A;  1S0N A;  2PA3 A;  3HT3 A;  1UWB B;  3MPD A;  3QRQ A;  3C6U B;  3OLB A;  4HHJ A;  3I82 A;  5KTQ A;  3MED A;  1AUS L;  2Q1L A;  2YKM A;  5CZV A;  2CQH A;  4EYH B;  3H5X A;  1JLB A;  1FX2 A;  5HVH A;  2MKH A;  3LA0 A;  5D0E A;  1PSD A;  2PGC A;  1U7L A;  5LMN J;  1R8H A;  3J7A 1;  2GGP B;  2YNH A;  4FZV A;  2R7Q A;  1PYO B;  1VQ7 S;  1WSV A;  4M95 A;  2AJ1 A;  3MEE B;  5I42 A;  1K47 A;  4WYL A;  3GR1 A;  3T9Z A;  4ED1 A;  1FRH A;  4O4G B;  3LOU A;  4DFP A;  1FKA F;  2UVR A;  1T8E A;  2O67 A;  1FE4 A;  2KT2 A;  1HNW F;  3PNI A;  3OVA A;  3W5Y A;  9ATC B;  3R5A A;  4DV6 J;  2Z2Y B;  4LF2 A;  3U7J A;  2FD2 A;  4D3H A;  5K14 B;  1U2C A;  1DAX A;  4MFB A;  2VF3 A;  1NSQ A;  5IS2 A;  2RHS B;  2AYE A;  3R8Y A;  3SV4 A;  4DR1 J;  1Q81 T;  1MU2 B;  2PD1 A;  4ZVS B;  8ATC B;  1GX6 A;  3HX9 A;  2F3J A;  2D3O 1;  1PJ5 A;  1S72 S;  3M8W A;  3E51 A;  3VAJ A;  2AYM A;  3CCS S;  2MHE A;  4F02 A;  3BO3 A;  1REV A;  2VIH A;  5THW A;  1S4E A;  1UZH A;  2HNZ A;  4LF6 F;  1NJZ A;  1B7F A;  3MMC A;  2ILY A;  2Z57 B;  3OBI A;  2R8J A;  4WII A;  4I2P B;  4V1A k;  4LJM A;  4OYZ A;  1PIE A;  1HPZ B;  3K8V A;  3CJ0 A;  3DU5 A;  2V8P A;  2ZH6 A;  1Q5V A;  1RAB B;  2ACY A;  2HWI A;  1GTE A;  2LA6 A;  4P75 A;  4Q7A A;  4TKT A;  5K9F A;  1RYS A;  2GZO A;  3GFX A;  3FBC A;  3ZNJ 1;  2XZW A;  3KMQ A;  4YME A;  3LP0 B;  2QC3 A;  1RZM A;  3ITH B;  4M5H A;  1N4L A;  4URS A;  3IAS 9;  5L8R C;  5D3G A;  3EPG A;  1SV5 B;  4GKJ J;  1NK8 A;  3THV A;  4NRU A;  4B3R F;  4BS2 A;  2XMA A;  2VB6 A;  3QYY A;  3T6J A;  1S12 A;  2G2O A;  5AE3 A;  4GMK A;  3TOQ A;  2HZV A;  4QYZ K;  4NCG A;  1FVQ A;  4DL4 A;  1CQM A;  2V8H A;  4LRD A;  4EFA C;  4B3M J;  1TK8 A;  4PWD B;  2GFF A;  3M8P A;  4F4Y A;  2R7O A;  1VYA A;  3RB3 A;  4NLR A;  4KHP J;  2QT7 A;  2GIR A;  3R6G B;  2YKQ A;  3TVY A;  2LKZ A;  1HNZ J;  2CNK B;  3Q89 A;  4M5G A;  4OHV A;  4USW A;  3RBD A;  1RAH B;  1SCJ B;  1WHV A;  1Q16 B;  2CQ3 A;  3DRS A;  4R5P A;  2IDL A;  4WJB A;  2CJK A;  4JI0 J;  3PZP A;  1KNZ A;  3KJQ B;  4C7Q A;  1I94 F;  1NK0 A;  2HHT A;  3JSB A;  3THP A;  4LF4 F;  2MZQ A;  1ZA2 B;  1NEE A;  2HMI A;  4LIW A;  3DXS X;  3PM9 A;  4ITS A;  3CJK B;  1VQP S;  4DPY A;  3V81 A;  3RG6 A;  1HNV B;  2GML A;  3LW5 C;  2OGU A;  3Q86 A;  5ETL A;  4OHX A;  2QSW A;  5BXI A;  4EEY A;  1Y3K A;  1YGY A;  5IZH A;  4RNO A;  1B99 A;  3MEG A;  4JI4 F;  2ZH9 A;  2CQ4 A;  1X5P A;  2JRS A;  4B9T A;  1T95 A;  1FFS B;  2V63 A;  4DR4 J;  3I87 A;  3GWC A;  1U2F A;  4F3Q A;  5HAN A;  3GJS B;  1K8A T;  1O8B A;  2D9P A;  3T19 A;  1MLA A;  2FQQ B;  2PMW A;  3OTC A;  4DN9 A;  5HMW A;  1NPK A;  1N32 F;  1N34 J;  1VC6 A;  2M5Y A;  1RT5 B;  3ZNU A;  4F4X A;  3FCV A;  4A8Q A;  2RS2 A;  2XNQ A;  2VZ9 A;  3NS6 A;  2GQ2 A;  2IC3 A;  1MML A;  2AKW B;  5E3A A;  2KXH A;  3GTY X;  4C3L A;  2W25 A;  5M2P A;  3T1Y F;  4KHP F;  1U1N A;  1P6T A;  1H73 A;  1AUD A;  4ICL B;  3OW2 R;  1TUG B;  2PC6 A;  4USU A;  4AUK A;  1HYS A;  2RB7 A;  4OHW A;  1RT1 B;  4RW8 A;  3SI8 A;  1WC3 A;  2D74 B;  2DNY A;  3FDS A;  4OZ3 A;  4XTT A;  3MD3 A;  4PG5 A;  2GVD A;  4JI8 J;  2IVY A;  3TA1 A;  4ILM A;  3CVK A;  4NZ6 A;  2DNL A;  2KKH A;  3V4M A;  4KGZ B;  3UE2 A;  2ATL A;  2GJ2 A;  1ACM B;  2DGQ A;  1Q7Y T;  2E7V A;  2EFV A;  4DBQ A;  1T9V A;  2ADC A;  3FZB A;  2ZBC A;  5E3R A;  3QFW A;  1KDN A;  3GCX P;  3R7S B;  5T14 A;  3CMQ A;  1KLN A;  2MYF A;  4AXI A;  4DUY J;  4MIB A;  1DLO B;  4WE1 B;  1QAY A;  4JP8 A;  3RW6 A;  3C15 A;  3VQT A;  3VAK A;  2KYX A;  3GFY A;  2BAN B;  1N88 A;  1Q5Y A;  2YY3 A;  2V2Q A;  1X4G A;  2ZZT A;  3M30 A;  2B8P A;  2MTL A;  1TVR A;  4LF1 A;  2AJQ A;  4DLG A;  1EJ7 L;  1KR4 A;  1XR5 A;  2NXE A;  3M32 A;  3ZZU A;  1X31 C;  3H40 A;  2YH0 A;  4DQP A;  2HBQ B;  5E7O B;  2FVS A;  3BS9 A;  4NLS A;  2BE2 A;  1UVM A;  3WIU A;  2GCF A;  4N8N A;  4DV1 J;  4OJ1 A;  3QGI A;  1C4C A;  3VVT A;  4UTG A;  1YKW A;  5F8M A;  2V50 A;  2KG0 A;  1RWM B;  1GMW D;  2NYH A;  2HQG A;  3E3X A;  3H2U B;  4JOU A;  4FN5 A;  3ZTP A;  4CYU A;  2XLJ A;  4UT4 A;  4HAC A;  1EZZ B;  1DQA A;  1HQ2 A;  1S6O A;  1WSR A;  2YNI B;  2NPF A;  4O0I A;  4B9V A;  4DQS A;  2UXB J;  5MLC V;  1Q8B A;  3IR5 B;  3PW0 A;  3TNV A;  2QTW A;  3AT1 B;  3AB2 B;  5LMU F;  5F8J A;  3KK3 A;  2J0Q D;  2CWX A;  1VCT A;  3LP2 B;  1DHM A;  2POK A;  1IKY B;  2RE1 A;  1U2R A;  1VRU B;  2V4J B;  3V5R A;  4C8L A;  5IXU A;  3RB0 A;  2Y9H A;  4Z7Y A;  1P9Y A;  1U0H A;  2NS1 B;  1DUR A;  5LL6 d;  4ZPB A;  3A8I A;  1XNQ J;  3J7A N;  3A3N B;  4GVB B;  4KAI A;  1Q8I A;  2BRK A;  4A8Y A;  4DFK A;  4N41 A;  1XNR F;  2DB1 A;  2YX4 A;  3B78 A;  3K17 A;  3ETO A;  3MM9 B;  2RQC A;  1Q79 A;  4KE5 A;  1N5V A;  5KFX A;  3OUY B;  4HTJ A;  3KWM A;  4W4M A;  4DWI A;  3PKY A;  3MMJ A;  1ZBT A;  2HND B;  2M52 A;  3MCM A;  2P8I A;  2CG4 A;  2UUW A;  1CG2 A;  1D8Y A;  1HWK A;  2O66 A;  3J81 U;  3MED B;  1CC7 A;  4IRD A;  2KT3 A;  5CA5 A;  4X66 F;  2HKE A;  3JSR A;  4G1P A;  3D1O A;  4CO3 A;  1HWL A;  1WJ9 A;  2ILZ A;  4K7Q A;  4QIW D;  4LVN P;  1IM4 A;  4C3K A;  3W66 A;  2E7X A;  3ZTO A;  5BYQ A;  2IRX A;  3Q8Q B;  5B7W A;  2R8I A;  2FLP A;  1KHV A;  4BC9 A;  1IUJ A;  2OSQ A;  5GAG I;  3D1Q A;  3KUG A;  3TUP A;  2XMJ A;  2LA4 A;  3NS7 B;  5I4M A;  3A8E A;  4A4J A;  3VVU A;  1SUQ A;  2M2B A;  1SH0 A;  3LGN A;  2MKY A;  2KB2 A;  1UJ4 A;  4LVO P;  4Y34 A;  4Y2C A;  5HSP A;  3CJ3 A;  3QLH B;  2HGN A;  4AXJ A;  5GMD A;  2BQU A;  3HJF A;  5GAH I;  2XWX A;  4KYZ A;  1RT6 A;  2HNY A;  4Q2L A;  4C0B A;  3H4D A;  1HL6 A;  2U2F A;  2V2Z A;  2WSE C;  4V19 X;  4USK A;  1VK8 A;  2CZV C;  4ZN1 A;  2YNI A;  4UUX A;  1Q86 T;  2MZR A;  1RWX B;  4CH1 A;  2DT9 A;  3MAQ A;  2FJB B;  2YQ3 A;  1ARO P;  2R7R A;  3NMA A;  3SSR A;  1VRT B;  2DEJ A;  2HFV A;  2HHP A;  1MWZ A;  4LRB A;  5KT6 A;  2RUS A;  4DL3 A;  2J6T A;  2VC1 A;  1EP4 B;  2YTC A;  4CTA A;  1YI2 S;  3FRY A;  2DIU A;  4RU9 A;  5L39 A;  3NGS A;  1KC8 T;  3M6U A;  5KFR A;  2J9C A;  2XSJ B;  1SIW B;  4IQX A;  2CWK A;  1B3T A;  2UV8 G;  3Q23 A;  4RW6 A;  3UCZ P;  1VQL S;  1V5I B;  2ZBP A;  5KT2 A;  1VBX A;  5DRK A;  4DV4 J;  4M5I A;  5CHC B;  1RT5 A;  4B9N A;  1ITP A;  2ADB A;  1HBN A;  2H5E A;  4IFV A;  1B0P A;  5KFD A;  2Z0G A;  5KG4 A;  4OYM A;  2ZDP A;  3MWB A;  4O4G A;  2FY8 A;  1QAJ A;  4PYA A;  1K9M T;  2V8D A;  2E5J A;  1R8A A;  1UEV A;  4H54 A;  1ZAX A;  4YFU A;  3PW7 A;  1B0T A;  2QL5 B;  1S1V B;  4LT6 A;  1FKO B;  4PUO A;  4L3N A;  4X4V A;  2DH7 A;  1BQX A;  2VG7 A;  3CJ5 A;  4PYD A;  2G1H A;  3WHI A;  3G2X A;  4YY3 F;  4AQY J;  1M5S A;  2AZ1 A;  2BKP A;  3CXC R;  2GVZ A;  3OXL A;  1O51 A;  2V94 A;  3PJX A;  3KK2 B;  2C22 A;  1A9N B;  1XMO F;  2HFU A;  1RAO A;  3MOZ A;  4WP8 A;  2BAC A;  3EGN A;  2XM3 A;  1FDD A;  5LXR A;  3CW2 C;  1WF0 A;  2XYP B;  3DU6 A;  4LIR A;  4M8L A;  2XO7 A;  1X5O A;  5F8L A;  1I94 J;  1S48 A;  4MT1 A;  4UOF A;  1TK0 A;  2AX0 A;  5EN1 A;  1EET B;  3BEG B;  3BH6 B;  3NMR A;  1SL0 A;  3HD2 A;  2I1R A;  1S1W A;  4HR2 A;  4X4R A;  4DR6 F;  4DV1 F;  2DNM A;  2GJF A;  1WC5 A;  2Z2L A;  4CWB A;  1WG5 A;  4OYP A;  2OUG A;  1S79 A;  1LV5 A;  5DQI A;  1C0U A;  5D4O A;  2FY1 A;  1O6X A;  4LSN B;  1BD6 A;  2DGU A;  2R2U A;  1HYS B;  1CBK A;  3BGR A;  2HHH F;  1QAI A;  4PXE A;  4OZ5 A;  2GV1 A;  1IWG A;  2FVR A;  2C1E B;  4LF7 F;  2ZBR A;  4U7C A;  1HBM B;  3DRP A;  1YQH A;  4ZS6 A;  2JLG A;  3RBE A;  2R7S A;  2RVJ A;  3TAR A;  1T05 B;  2Z58 B;  4ZP9 A;  4XAK A;  3NGK A;  2VPZ B;  4PG8 A;  3BZQ A;  3OFF A;  3FNN A;  5CQG A;  1RU2 A;  4ID5 B;  3CCM S;  1LXJ A;  2JEG A;  3BSN A;  4DSF A;  1XNR J;  1NHK L;  3HHL A;  4OMF G;  1AZS B;  1KTQ A;  2BJ9 A;  4Y3C A;  3LP2 A;  2Q66 A;  4U7U D;  4PXD A;  2C3U A;  5CXT A;  3HT0 A;  5HLF B;  2BM1 A;  4J9S A;  2OKQ A;  5IC4 B;  2GNK A;  1TEL A;  1DTQ B;  2Z4P A;  5A8R A;  3C15 B;  2XHW A;  4RKU C;  2ZH2 A;  1EQM A;  3SCL E;  4KO0 B;  5ETM A;  3HXM A;  2ZH7 A;  2E1M C;  2DEI A;  2RS8 A;  1WC1 A;  1TKT B;  3SQG A;  1F9E B;  2V69 A;  3LUY A;  5HVF A;  4U7U K;  3G6E S;  5KFH A;  2CQD A;  2GJI A;  2UXD F;  4C8M A;  4QW8 A;  2HRT A;  2I9S A;  2NXJ A;  2DGO A;  2N7Y A;  4KH1 B;  4E0D A;  3DDK A;  3U1L A;  4NXN F;  1OQ3 A;  3R5B A;  4JI0 F;  1FFW B;  2N3L A;  3T5K A;  1F0X A;  3HFK A;  5D3G B;  3Q2T C;  3UDL A;  2P9G A;  2K3I A;  4EZ9 A;  2MZT A;  1UA1 A;  1HHS A;  2ZJP Q;  1H72 C;  1MWY A;  4WFX A;  2D7S A;  1NJY A;  1UCN A;  1Y10 A;  5B0B A;  5F8N A;  4A8W A;  2FHJ A;  4NI2 A;  2X1B A;  1K73 T;  2FB0 A;  2DR6 A;  4MTP A;  1WNE A;  2CPJ A;  2F8E X;  2W9C A;  4F3O A;  2PEH A;  3CJ8 A;  3OR1 B;  3D4J A;  5KFU A;  3G6Y A;  2IY5 B;  4FYX B;  2V2K A;  1HPZ A;  4NLQ A;  3SEO A;  5C2G A;  2BOP A;  2H51 B;  3QJP A;  2C3Y A;  1HAR A;  2EVZ A;  4J9L A;  1YBT A;  1HQE B;  1HBU B;  3NWR A;  4CLL A;  4ECQ A;  3V6K A;  3EVW A;  3VGS A;  3F41 A;  3BBB A;  1T9U A;  4I1T A;  1BXN A;  2Z2M A;  2F9D A;  2EK1 A;  1M0S A;  3NCR A;  1TL3 A;  2M7S A;  1ZOT A;  2OPQ B;  3MEC B;  4QIG A;  3E01 B;  3D9B A;  4ZPD A;  4BCA A;  4ZLP A;  3DOL A;  2F4V J;  4M5D A;  1RT2 A;  1KLM A;  3KNG A;  1DRZ A;  2RF2 B;  4DV3 F;  3DLE B;  3GB0 A;  4Y2K A;  1L3K A;  2KHD A;  2EKN A;  2OEK A;  2HBY B;  2W2O P;  1TQL A;  2Z30 B;  1H98 A;  3PDN A;  5C24 A;  2RRA A;  2KHC A;  5J2M A;  3JAM Y;  1LWF A;  3C16 A;  4QR0 A;  2BJ3 A;  5RUB A;  1QY7 A;  4J9U E;  4TU7 A;  3THT A;  3FMW A;  4AQY F;  1VDH A;  1X60 A;  5EDW A;  1GFW B;  4F0K A;  3QO9 B;  2FZG B;  3HZG A;  1PYS B;  2N4D A;  3M8Y A;  4ZP7 A;  4K4S A;  2V5H G;  2ZZN A;  4YHH F;  5IFM A;  1TU0 B;  1TV6 B;  2DHX A;  2W9A A;  3SYZ A;  2W4D A;  4ZCK A;  2HK2 A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  2HVE A;  2DY9 A;  3FKB A;  1MN7 A;  4HR2 A;  1MN9 A;  3EE3 A;  5C7P A;  3FBB A;  1F3F A;  1K44 A;  3BBC A;  1S5Z A;  1F6T A;  1NCL A;  1HIY A;  1NDK A;  1NDL A;  1NLK L;  3VVT A;  4AND A;  3NGR A;  3B54 A;  1U8W A;  3ZTP A;  4W98 A;  1S59 A;  4WBF A;  3PJ9 A;  3FBC A;  3EVM A;  1PKU A;  4KPC A;  2BX6 A;  3VGT A;  1JXV A;  1LWX A;  1S57 A;  2VU5 A;  4DI6 A;  4FKY A;  4UOG A;  1NHK L;  3BH7 B;  1BHN A;  1BUX A;  1NDC A;  4F36 A;  3WX8 A;  1B4S A;  1HLW A;  1VYA A;  3ELH A;  3Q8U A;  5IOL A;  4O0N A;  3EJM A;  5CAA A;  3Q89 A;  1HHQ A;  3EVO A;  4DUT A;  1WKL A;  1PAE X;  2DXE A;  3FBF A;  3BBF A;  1ZS6 A;  2BEF A;  3GPA A;  3L7U A;  1NB2 A;  3ZTO A;  4C6A A;  2AZ3 A;  2ZUA A;  3R9L A;  3EIC A;  4CP5 A;  3VVU A;  3Q86 A;  3FBE A;  4ANC A;  5BXI A;  3DDI A;  3VGV A;  1B99 A;  4ENO A;  1XIQ A;  1UCN A;  1NUE A;  3Q8V A;  4DZ6 A;  1LEO A;  3JS9 A;  1NPK A;  3MPD A;  3Q83 A;  3FCV A;  3ENA A;  4S0M A;  3ZTR A;  3NGS A;  1XQI A;  3EVW A;  3VGS A;  3FC9 A;  2CWK A;  4FKX A;  3BBB A;  1W7W A;  3EM1 A;  1NDP A;  3NGU A;  4UOH A;  2DXF A;  3VGU A;  2NCK L;  1WKK A;  3ZTS A;  3NGT A;  3PRV A;  5CAB A;  4F4A A;  1EHW A;  2DXD A;  4EK2 A;  1NSK L;  2DYA A;  3EMT A;  1NSQ A;  1KDN A;  3G2X A;  3ZTQ A;  4ANE A;  2AZ1 A;  3GP9 A;  2B8Q A;  3ETM A;  3FCW A;  4UOF A;  3Q8Y A;  3DKD A;  2HUR A;  1WKJ A;  2HVD A;  1BE4 A;  2B8P A;  1NSP A;  3B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...