1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHONOACETATE HYDROLASE
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
4LR8A 3M8YA 1ZEDA 3T00A 2XRGA 4FDIA 2XR9A 5C66A 1E1ZP 2GLQA 1EW2A 4KM4A 5HRTA 3T01A 4CXSA 3WAXA 1AJDA 3OT9A 3UO0A 2QZUA 5AJ9A 1K7HA 2G9YA 4LR9A 4LRAA 1KH5A 5EGHA 5DLVA 4LQYA 3SZYA 1B8JA 4MHXA 1KHJA 3NKRA 4LRCA 1ALKA 3IDDA 1AJBA 1E33P 2ANHA 4KJGA 1AJCA 4CYRA 3SZZA 4ZGAA 4UPHA 3LXQA 2RH6A 3WBHA 4ZG9A 1KH4A 5LRMA 2W5WA 5GOVA 2GSNA 1ELYA 5EGEA 3BDHA 1O99A 3WAYA 1ZEBA 2W5XA 4LRDA 1URBA 1KHKA 2GSUA 4GTYA 1Y6VA 3NKMA 1Y7AA 1ZEFA 2W5TA 1URAA 3B5QA 3NKNA 4N7TA 4KAVA 2W5SA 4LRFA 2GSOA 3UNYA 5LIAA 3ED4A 3NKPA 1AUKA 3E2DA 1ANJA 3M8WA 1KHLA 4YR1A 1EJJA 3MK2A 4QAXA 4CXUA 1HDHA 1N2KA 3IGZB 3TWZA 3A52A 3BDFA 4GTZA 1EQJA 1P49A 2VQRA 4KAYA 1E3CP 1ED9A 1SHNA 3T02A 4UOOA 4CYSA 2W8DA 3MK0A 5INHA 4GTWA 3NKOA 3UN3A 4UPIA 4UPLA 4KJDA 1HJKA 1ELXA 5K4PA 1ANIA 4LREA 1HQAA 3UN5A 1FSUA 4UPKA 5IJSA 3BDGB 4UORA 5L0EA 4MIVA 4LRBA 2GA3A 3BDGA 5IJQA 3NVLA 1E2SP 1ED8A 3CMRA 4LR2A 5DLWA 1EW8A 4TN0A 3TG0A 1KH7A 1ALHA 1SHQA 4LR7A 2W5RA 1KH9A 5L0BA 4NWXA 2W5VA 4UOPA 1N2LA 2D1GA 2IFYA 4NWJA 1ALIA 2W8SA 3MK1A 5TJ3A 3Q3QA 1EI6A 1ALJA 2X98A 3IGYB 5LRNA 5KXAA 1O98A 4GTXA 3DPCA 3WAWA 2W5QA 3M7VA 3TX0A 1KHNA 3DYCA 3WAVA 1EW9A 3UN2A 4CXKA 2IUCB 3M8ZA 4FDJA 4MY4A 4B56A 4ZG7A 1AJAA 2IUCA 4ZG6A 5L0KA 2ZKTA 3KD8A 5LQQA 3NKQA 5DLTA 5GRRA 1ELZA
chains in the Genus database with same CATH superfamily
3T00A 2XRGA 1BGWA 4XSXA 4A3JK 2PPBA 3HOZC 2PA8D 3ERED 3TFHA 5HRTA 4GT9A 1HQMA 1YNNA 2FQTA 5AJ9A 4XSZA 5TMCA 5EGHA 5DLVA 4A3CK 3S14K 1ISEA 3RZOK 1KHJA 3OEPA 3M4OC 1RU0A 4QJVB 4KB2A 2JA5C 4LRCA 2JA5A 2CW0A 1L0WA 4BBSK 5IYDK 1TWHA 3IDDA 2ANHA 2NVYC 1Y1VC 3GTOK 2XCQA 4GTDA 4A3FK 3HOXK 3JSTA 4WJ4A 4CYRA 3SZZA 3M3YC 3LXQA 2PHCB 3GTKC 2JA6C 3GTKA 2JA6A 1KH4A 2W5WA 1I50K 2GSNA 4A3BC 3BDHA 1O99A 1B4BA 1TWHK 4C3HC 3HOWC 3HOYK 2W5XA 2D6FC 1PJ7A 4MEXA 3GTQC 3GTQA 4Q5SA 4GTYA 3NKMA 1Y7AA 1ZEFA 4G0WA 5M3MK 3S1MC 2NVQK 1DCOA 4RMFA 4BXXK 3NKNA 1IBAA 1Y1WC 2W5SA 1I3QC 2R93K 5C3EK 3IPJA 4Y7NC 1SFOK 5LIAA 3GTLC 3ED4A 1XXCA 3NKPA 3BP8C 1KQ4A 1KHLA 4J3NA 4MQ9A 1EFWA 1EJJA 4CXUA 4A3KC 4QIWD 1DCPA 1WSVA 4G0VA 2E2IK 3GTJA 1EQJA 1R9TK 4C3IK 1ZVUA 3TTGA 3UN3A 1IQ0A 4GTWA 4BY7C 1HJKA 1ELXA 1O28A 4GTLA 1FSUA 4A3EK 3BDGB 2GA3A 1O2AA 4YFKA 3FKIC 1ZXOA 3GSIA 2YU9C 5DLWA 1EW8A 3H0GK 1VLOA 4TN0A 3GTGA 3TG0A 3A8IA 4Y52C 1SHQA 4O2DA 3S1RC 1TWAK 2W5VA 1N2LA 4M1XA 2B63A 1USOA 5KXAA 1J6WA 3GTMK 5IOSA 3DPCA 2JA7K 2W5QA 4XLPA 4GTAA 3DYCA 4BLAA 4A3IC 1O2BA 3GTGK 2ZUEA 3H3VD 2PMZD 1GE9A 5C4JK 2V6TA 2NVTC 4ZH4A 3NKQA 1ELZA 4GTCA 3S16C 1ZEDA 5M5WK 4FDIA 3I4MK 4KATA 1DD5A 4BBRK 2GLQA 5IP9K 2KWAA 2E2HA 4YFNA 1WIHA 4C2MK 4BLBA 3PO2K 3PO3C 1K7HA 3VA7A 2G9YA 1EQRA 2R7ZK 4LR9A 4LRAA 1ZBSA 2ZFZA 1TWCA 4KMHA 1WQGA 4A3JC 3V4GA 4A93K 1O29A 5C44K 2NVXC 3LAJA 4A3LK 2E2HK 4OIQA 4WILA 1WSRA 4G7OA 1XPPA 2JH3A 3S14C 3RZDK 4C3JC 4ZGAA 3K7AK 3NUHA 2R92K 1TWCK 3S2DK 3HOVK 4BBSC 2VUMA 5HL8A 1USMA 3GEEA 3OREA 5EGEA 5E68A 1HI9A 3WAYA 3GTOA 4X6AK 1URBA 1KHKA 5C4XC 4A3FC 3HOXC 4KMAA 3GDZA 4KAWX 5IOTA 4QIWL 1I50A 4N7TA 4A3DC 2VUMK 1TWHC 5IORA 3N0CA 4MEYA 4LRFA 3N0BA 4FM9A 1WCMA 1V5VA 5IYBK 1WQHA 4P9SA 1TWGK 2NVQC 3M8WA 3S2HK 2CFAA 2WAQD 1I6HC 4JK1A 4QAXA 1N2KA 3LAPA 2R93C 5IYCC 2R93A 1TWFK 3A52A 3IGZB 3HOUK 2BE5A 2GAHC 1ED9A 1SHNA 1SFOC 1SFOA 4A3GK 3OPFA 4NOIA 1WCMK 4G7HA 4KN4A 1ANIA 1HQAA 3HOZK 5FLMK 1XXBA 1XXAA 2Y3PA 4YFXA 2E2IA 1R9TA 4C3IC 1KH7A 5JFEA 4LR7A 4A3MC 2ZUFA 3H3VL 1KH9A 2A6EA 4NWXA 5L0BA 2PMZL 2IFYA 4A3EC 3M4OK 4NWJA 5TJ3A 3MK1A 3Q3QA 4YG2A 2A68A 1O98A 3H0GC 3H0GA 3M7VA 2NVYK 1Y1VK 1VGXA 4AYBD 3GTJC 3WAVA 1INNA 2FQOA 2XCOA 1TWAA 4DDQA 4KMDA 1EW9A 3M3YK 3UN2A 4B56A 5M5YK 1AJAA 4ZG6A 3I4NC 3KD8A 3GTMA 5LQQA 3HOWK 4KB4A 4C3HK 2JA7A 4LOWA 5GRRA 3GTGC 3DXJA 3M8YA 1JQWA 4P5BA 2XR9A 2B63C 3GTPA 1EW2A 1O26A 1Y1WK 4KM4A 3T01A 1WORA 1I3QK 3HKZL 4LJZA 3S1QK 2QZUA 3FOEA 4Y7NK 2O5JA 3I4MC 3SZYA 4BBRC 4MHXA 3G4CA 1PJ5A 3NKRA 2EBBA 1ALKA 4A3KK 1O2FB 3GTPK 1PJ6A 4PAAA 4BY1C 3PO2C 2R7ZC 2R7ZA 1AJCA 3AD7C 4UPHA 4A93C 4KASA 5FJ8K 5LRMA 5C44C 1ELYA 3FKIK 2YU9K 2E2HC 3S1NC 2JA8C 4LRDA 4Y52K 2GSUA 3RZDC 3S15K 3K7AC 5IOQA 1TWCC 2R92A 2W5TA 3ADAC 1JVIA 3HOVC 2WAQL 3L4KA 4LK0A 1YX2A 3AQPA 5TMFA 4X6AC 1ZQ1C 3HKZD 4A3IK 3UNYA 1G51A 4A3CC 1EK8A 1AUKA 3RZOC 2E2JK 1F9NA 2CFAB 4YR1A 2VUMC 5IYDC 1IL2A 3QX3A 1HDHA 1I6VA 2NVTK 1JOEA 1P49A 1K83K 1ZYRA 3GTOC 1E3CP 3T02A 4UOOA 4CYSA 4UPLA 3MK0A 5INHA 3NKOA 3CQZK 1TWGA 4KM8A 4LREA 3UN5A 2RGRA 2Y0SD 1B4AA 4UORA 4MIVA 5IJQA 1I50C 4G7ZA 1TWFC 1TWFA 1E2SP 1ED8A 4AYBL 2A69A 3BUEA 3HOYC 3S17K 3PO3K 1ALHA 4A3GC 1WCMC 4C45A 2D1GA 1VRQC 1ALIA 4GTFA 5FLMC 4BXXC 1SMYA 2P5MA 1EI6A 1XZQA 4ILDA 3BP3A 1ALJA 2NVXK 3WAWA 5IP7K 3TX0A 2V6UA 1KHNA 3FHZA 5C3EC 4PABA 4C3JK 1XZPA 1YCLA 4FDJA 3A8KA 2IUCA 1BS2A 2GAGC 1YNJA 1WOOA 2ZKTA 2WB1D 3GEHA 1DCHA 2NVYA 1Y1VA 1AB4A 2E2IC 5DLTA 1R9TC 4LR8A 5C4XK 2A6HA 1WQFA 1EH1A 1E1ZP 5C66A 3AQOA 2JA5K 4A3DK 4CXSA 2XCRB 3WAXA 3L4JA 1VH2A 4OIPA 1AJDA 3OT9A 3UO0A 4GFQA 1KH5A 1TWAC 4LQYA 1B8JA 1O24A 4FZBA 4WJ3M 4Q4ZA 4QJVA 1Y1WA 3GTKK 2JA6K 4XLNA 1I6HK 1I3QA 5IYCK 4A3BK 4LLGA 1AJBA 3GTMC 1E33P 3S1QC 1IE0A 2JA7C 1WOSA 4KJGA 4KMUA 5M3FK 3GEIA 1BDFA 3GTQK 3GTLA 4G0UA 1C0AA 3S1MK 2RH6A 3WBHA 3LPXA 4ZG9A 5C4JC 5GOVA 1J98A 3GTPC 1ZEBA 4OIRA 3N3YA 1F7VA 4A3MK 4AH6A 1Y6VA 5L46A 2O5IA 3GTLK 4GTEA 1URAA 3AD9C 3B5QA 5JVOA 5IP9C 4KAVA 3FKIA 2YU9A 4C2MC 4XCHA 3A8JA 3GTJK 2GSOA 1O27A 3GIRA 3S15C 2Y0SL 4LK1A 4BY7K 3E2DA 4OIOA 1ANJA 2W7VA 1F93A 1BJTA 3TFJA 3I4NK 3MK2A 1F7UA 3TWZA 4KN7A 3S0XA 1J6XA 3BDFA 4A3LC 4GTZA 4KDDA 2VQRA 4KAYA 4KC6A 4GTBA 4BKWA 2W8DA 5CHPA 3EQLA 4OINA 4UPIA 4GZYA 5D4DA 5M5XK 4KJDA 3S1RK 3G4AA 2E2JC 5K4PA 2PA8L 2R92C 2B63K 3S2DC 4UPKA 3AH5A 5IJSA 5L0EA 4LRBA 3CAGA 3BDGA 1UV7A 3HXAA 3NVLA 3CMRA 3AD8C 1K83C 4LR2A 1K83A 1O25A 1X31C 5CJ9A 1WOPA 2W5RA 3CQZC 3CQZA 1J6VA 3WODA 4UOPA 3FOFA 3TFIA 2V6SA 2W8SA 1XZQB 2WB1L 4KM9A 2X98A 3IGYB 5LRNA 4GTXA 3S17C 4BY1K 1IW7A 4P5AA 3S16K 1VJEA 5IYBC 1XZPB 1TWGC 4CXKA 2IUCB 3M8ZA 2P8TA 4MY4A 4ZG7A 5L0KA 3S2HC 4KARA 3MMLB 2NVXA 3S1NK 5IP7C 3HOUC 1IS1A 2JA8K
chains in the Genus database with same CATH topology
4LR8A 3M8YA 1ZEDA 3T00A 2XRGA 4FDIA 2XR9A 5C66A 1E1ZP 2GLQA 1EW2A 4KM4A 5HRTA 3T01A 4CXSA 3WAXA 1AJDA 3OT9A 3UO0A 2QZUA 5AJ9A 1K7HA 2G9YA 4LR9A 4LRAA 1KH5A 5EGHA 5DLVA 4LQYA 3SZYA 1B8JA 4MHXA 1KHJA 3NKRA 4LRCA 1ALKA 3IDDA 1AJBA 1E33P 2ANHA 4KJGA 1AJCA 4CYRA 3SZZA 4ZGAA 4UPHA 3LXQA 2RH6A 3WBHA 4ZG9A 1KH4A 5LRMA 2W5WA 5GOVA 2GSNA 1ELYA 5EGEA 3BDHA 1O99A 3WAYA 1ZEBA 2W5XA 4LRDA 1URBA 1KHKA 2GSUA 4GTYA 1Y6VA 3NKMA 1Y7AA 1ZEFA 2W5TA 1URAA 3B5QA 3NKNA 4N7TA 4KAVA 2W5SA 4LRFA 2GSOA 3UNYA 5LIAA 3ED4A 3NKPA 1AUKA 3E2DA 1ANJA 3M8WA 1KHLA 4YR1A 1EJJA 3MK2A 4QAXA 4CXUA 1HDHA 1N2KA 3IGZB 3TWZA 3A52A 3BDFA 4GTZA 1EQJA 1P49A 2VQRA 4KAYA 1E3CP 1ED9A 1SHNA 3T02A 4UOOA 4CYSA 2W8DA 3MK0A 5INHA 4GTWA 3NKOA 3UN3A 4UPIA 4UPLA 4KJDA 1HJKA 1ELXA 5K4PA 1ANIA 4LREA 1HQAA 3UN5A 1FSUA 4UPKA 5IJSA 3BDGB 4UORA 5L0EA 4MIVA 4LRBA 2GA3A 3BDGA 5IJQA 3NVLA 1E2SP 1ED8A 3CMRA 4LR2A 5DLWA 1EW8A 4TN0A 3TG0A 1KH7A 1ALHA 1SHQA 4LR7A 2W5RA 1KH9A 5L0BA 4NWXA 2W5VA 4UOPA 1N2LA 2D1GA 2IFYA 4NWJA 1ALIA 2W8SA 3MK1A 5TJ3A 3Q3QA 1EI6A 1ALJA 2X98A 3IGYB 5LRNA 5KXAA 1O98A 4GTXA 3DPCA 3WAWA 2W5QA 3M7VA 3TX0A 1KHNA 3DYCA 3WAVA 1EW9A 3UN2A 4CXKA 2IUCB 3M8ZA 4FDJA 4MY4A 4B56A 4ZG7A 1AJAA 2IUCA 4ZG6A 5L0KA 2ZKTA 3KD8A 5LQQA 3NKQA 5DLTA 5GRRA 1ELZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LR8 A;  3M8Y A;  1ZED A;  3T00 A;  2XRG A;  4FDI A;  2XR9 A;  5C66 A;  1E1Z P;  2GLQ A;  1EW2 A;  4KM4 A;  5HRT A;  3T01 A;  4CXS A;  3WAX A;  1AJD A;  3OT9 A;  3UO0 A;  2QZU A;  5AJ9 A;  1K7H A;  2G9Y A;  4LR9 A;  4LRA A;  1KH5 A;  5EGH A;  5DLV A;  4LQY A;  3SZY A;  1B8J A;  4MHX A;  1KHJ A;  3NKR A;  4LRC A;  1ALK A;  3IDD A;  1AJB A;  1E33 P;  2ANH A;  4KJG A;  1AJC A;  4CYR A;  3SZZ A;  4ZGA A;  4UPH A;  3LXQ A;  2RH6 A;  3WBH A;  4ZG9 A;  1KH4 A;  5LRM A;  2W5W A;  5GOV A;  2GSN A;  1ELY A;  5EGE A;  3BDH A;  1O99 A;  3WAY A;  1ZEB A;  2W5X A;  4LRD A;  1URB A;  1KHK A;  2GSU A;  4GTY A;  1Y6V A;  3NKM A;  1Y7A A;  1ZEF A;  2W5T A;  1URA A;  3B5Q A;  3NKN A;  4N7T A;  4KAV A;  2W5S A;  4LRF A;  2GSO A;  3UNY A;  5LIA A;  3ED4 A;  3NKP A;  1AUK A;  3E2D A;  1ANJ A;  3M8W A;  1KHL A;  4YR1 A;  1EJJ A;  3MK2 A;  4QAX A;  4CXU A;  1HDH A;  1N2K A;  3IGZ B;  3TWZ A;  3A52 A;  3BDF A;  4GTZ A;  1EQJ A;  1P49 A;  2VQR A;  4KAY A;  1E3C P;  1ED9 A;  1SHN A;  3T02 A;  4UOO A;  4CYS A;  2W8D A;  3MK0 A;  5INH A;  4GTW A;  3NKO A;  3UN3 A;  4UPI A;  4UPL A;  4KJD A;  1HJK A;  1ELX A;  5K4P A;  1ANI A;  4LRE A;  1HQA A;  3UN5 A;  1FSU A;  4UPK A;  5IJS A;  3BDG B;  4UOR A;  5L0E A;  4MIV A;  4LRB A;  2GA3 A;  3BDG A;  5IJQ A;  3NVL A;  1E2S P;  1ED8 A;  3CMR A;  4LR2 A;  5DLW A;  1EW8 A;  4TN0 A;  3TG0 A;  1KH7 A;  1ALH A;  1SHQ A;  4LR7 A;  2W5R A;  1KH9 A;  5L0B A;  4NWX A;  2W5V A;  4UOP A;  1N2L A;  2D1G A;  2IFY A;  4NWJ A;  1ALI A;  2W8S A;  3MK1 A;  5TJ3 A;  3Q3Q A;  1EI6 A;  1ALJ A;  2X98 A;  3IGY B;  5LRN A;  5KXA A;  1O98 A;  4GTX A;  3DPC A;  3WAW A;  2W5Q A;  3M7V A;  3TX0 A;  1KHN A;  3DYC A;  3WAV A;  1EW9 A;  3UN2 A;  4CXK A;  2IUC B;  3M8Z A;  4FDJ A;  4MY4 A;  4B56 A;  4ZG7 A;  1AJA A;  2IUC A;  4ZG6 A;  5L0K A;  2ZKT A;  3KD8 A;  5LQQ A;  3NKQ A;  5DLT A;  5GRR A;  1ELZ A; 
#chains in the Genus database with same CATH topology
 3T00 A;  2XRG A;  1BGW A;  4XSX A;  4A3J K;  2PPB A;  3HOZ C;  2PA8 D;  3ERE D;  3TFH A;  5HRT A;  4GT9 A;  1HQM A;  1YNN A;  2FQT A;  5AJ9 A;  4XSZ A;  5TMC A;  5EGH A;  5DLV A;  4A3C K;  3S14 K;  1ISE A;  3RZO K;  1KHJ A;  3OEP A;  3M4O C;  1RU0 A;  4QJV B;  4KB2 A;  2JA5 C;  4LRC A;  2JA5 A;  2CW0 A;  1L0W A;  4BBS K;  5IYD K;  1TWH A;  3IDD A;  2ANH A;  2NVY C;  1Y1V C;  3GTO K;  2XCQ A;  4GTD A;  4A3F K;  3HOX K;  3JST A;  4WJ4 A;  4CYR A;  3SZZ A;  3M3Y C;  3LXQ A;  2PHC B;  3GTK C;  2JA6 C;  3GTK A;  2JA6 A;  1KH4 A;  2W5W A;  1I50 K;  2GSN A;  4A3B C;  3BDH A;  1O99 A;  1B4B A;  1TWH K;  4C3H C;  3HOW C;  3HOY K;  2W5X A;  2D6F C;  1PJ7 A;  4MEX A;  3GTQ C;  3GTQ A;  4Q5S A;  4GTY A;  3NKM A;  1Y7A A;  1ZEF A;  4G0W A;  5M3M K;  3S1M C;  2NVQ K;  1DCO A;  4RMF A;  4BXX K;  3NKN A;  1IBA A;  1Y1W C;  2W5S A;  1I3Q C;  2R93 K;  5C3E K;  3IPJ A;  4Y7N C;  1SFO K;  5LIA A;  3GTL C;  3ED4 A;  1XXC A;  3NKP A;  3BP8 C;  1KQ4 A;  1KHL A;  4J3N A;  4MQ9 A;  1EFW A;  1EJJ A;  4CXU A;  4A3K C;  4QIW D;  1DCP A;  1WSV A;  4G0V A;  2E2I K;  3GTJ A;  1EQJ A;  1R9T K;  4C3I K;  1ZVU A;  3TTG A;  3UN3 A;  1IQ0 A;  4GTW A;  4BY7 C;  1HJK A;  1ELX A;  1O28 A;  4GTL A;  1FSU A;  4A3E K;  3BDG B;  2GA3 A;  1O2A A;  4YFK A;  3FKI C;  1ZXO A;  3GSI A;  2YU9 C;  5DLW A;  1EW8 A;  3H0G K;  1VLO A;  4TN0 A;  3GTG A;  3TG0 A;  3A8I A;  4Y52 C;  1SHQ A;  4O2D A;  3S1R C;  1TWA K;  2W5V A;  1N2L A;  4M1X A;  2B63 A;  1USO A;  5KXA A;  1J6W A;  3GTM K;  5IOS A;  3DPC A;  2JA7 K;  2W5Q A;  4XLP A;  4GTA A;  3DYC A;  4BLA A;  4A3I C;  1O2B A;  3GTG K;  2ZUE A;  3H3V D;  2PMZ D;  1GE9 A;  5C4J K;  2V6T A;  2NVT C;  4ZH4 A;  3NKQ A;  1ELZ A;  4GTC A;  3S16 C;  1ZED A;  5M5W K;  4FDI A;  3I4M K;  4KAT A;  1DD5 A;  4BBR K;  2GLQ A;  5IP9 K;  2KWA A;  2E2H A;  4YFN A;  1WIH A;  4C2M K;  4BLB A;  3PO2 K;  3PO3 C;  1K7H A;  3VA7 A;  2G9Y A;  1EQR A;  2R7Z K;  4LR9 A;  4LRA A;  1ZBS A;  2ZFZ A;  1TWC A;  4KMH A;  1WQG A;  4A3J C;  3V4G A;  4A93 K;  1O29 A;  5C44 K;  2NVX C;  3LAJ A;  4A3L K;  2E2H K;  4OIQ A;  4WIL A;  1WSR A;  4G7O A;  1XPP A;  2JH3 A;  3S14 C;  3RZD K;  4C3J C;  4ZGA A;  3K7A K;  3NUH A;  2R92 K;  1TWC K;  3S2D K;  3HOV K;  4BBS C;  2VUM A;  5HL8 A;  1USM A;  3GEE A;  3ORE A;  5EGE A;  5E68 A;  1HI9 A;  3WAY A;  3GTO A;  4X6A K;  1URB A;  1KHK A;  5C4X C;  4A3F C;  3HOX C;  4KMA A;  3GDZ A;  4KAW X;  5IOT A;  4QIW L;  1I50 A;  4N7T A;  4A3D C;  2VUM K;  1TWH C;  5IOR A;  3N0C A;  4MEY A;  4LRF A;  3N0B A;  4FM9 A;  1WCM A;  1V5V A;  5IYB K;  1WQH A;  4P9S A;  1TWG K;  2NVQ C;  3M8W A;  3S2H K;  2CFA A;  2WAQ D;  1I6H C;  4JK1 A;  4QAX A;  1N2K A;  3LAP A;  2R93 C;  5IYC C;  2R93 A;  1TWF K;  3A52 A;  3IGZ B;  3HOU K;  2BE5 A;  2GAH C;  1ED9 A;  1SHN A;  1SFO C;  1SFO A;  4A3G K;  3OPF A;  4NOI A;  1WCM K;  4G7H A;  4KN4 A;  1ANI A;  1HQA A;  3HOZ K;  5FLM K;  1XXB A;  1XXA A;  2Y3P A;  4YFX A;  2E2I A;  1R9T A;  4C3I C;  1KH7 A;  5JFE A;  4LR7 A;  4A3M C;  2ZUF A;  3H3V L;  1KH9 A;  2A6E A;  4NWX A;  5L0B A;  2PMZ L;  2IFY A;  4A3E C;  3M4O K;  4NWJ A;  5TJ3 A;  3MK1 A;  3Q3Q A;  4YG2 A;  2A68 A;  1O98 A;  3H0G C;  3H0G A;  3M7V A;  2NVY K;  1Y1V K;  1VGX A;  4AYB D;  3GTJ C;  3WAV A;  1INN A;  2FQO A;  2XCO A;  1TWA A;  4DDQ A;  4KMD A;  1EW9 A;  3M3Y K;  3UN2 A;  4B56 A;  5M5Y K;  1AJA A;  4ZG6 A;  3I4N C;  3KD8 A;  3GTM A;  5LQQ A;  3HOW K;  4KB4 A;  4C3H K;  2JA7 A;  4LOW A;  5GRR A;  3GTG C;  3DXJ A;  3M8Y A;  1JQW A;  4P5B A;  2XR9 A;  2B63 C;  3GTP A;  1EW2 A;  1O26 A;  1Y1W K;  4KM4 A;  3T01 A;  1WOR A;  1I3Q K;  3HKZ L;  4LJZ A;  3S1Q K;  2QZU A;  3FOE A;  4Y7N K;  2O5J A;  3I4M C;  3SZY A;  4BBR C;  4MHX A;  3G4C A;  1PJ5 A;  3NKR A;  2EBB A;  1ALK A;  4A3K K;  1O2F B;  3GTP K;  1PJ6 A;  4PAA A;  4BY1 C;  3PO2 C;  2R7Z C;  2R7Z A;  1AJC A;  3AD7 C;  4UPH A;  4A93 C;  4KAS A;  5FJ8 K;  5LRM A;  5C44 C;  1ELY A;  3FKI K;  2YU9 K;  2E2H C;  3S1N C;  2JA8 C;  4LRD A;  4Y52 K;  2GSU A;  3RZD C;  3S15 K;  3K7A C;  5IOQ A;  1TWC C;  2R92 A;  2W5T A;  3ADA C;  1JVI A;  3HOV C;  2WAQ L;  3L4K A;  4LK0 A;  1YX2 A;  3AQP A;  5TMF A;  4X6A C;  1ZQ1 C;  3HKZ D;  4A3I K;  3UNY A;  1G51 A;  4A3C C;  1EK8 A;  1AUK A;  3RZO C;  2E2J K;  1F9N A;  2CFA B;  4YR1 A;  2VUM C;  5IYD C;  1IL2 A;  3QX3 A;  1HDH A;  1I6V A;  2NVT K;  1JOE A;  1P49 A;  1K83 K;  1ZYR A;  3GTO C;  1E3C P;  3T02 A;  4UOO A;  4CYS A;  4UPL A;  3MK0 A;  5INH A;  3NKO A;  3CQZ K;  1TWG A;  4KM8 A;  4LRE A;  3UN5 A;  2RGR A;  2Y0S D;  1B4A A;  4UOR A;  4MIV A;  5IJQ A;  1I50 C;  4G7Z A;  1TWF C;  1TWF A;  1E2S P;  1ED8 A;  4AYB L;  2A69 A;  3BUE A;  3HOY C;  3S17 K;  3PO3 K;  1ALH A;  4A3G C;  1WCM C;  4C45 A;  2D1G A;  1VRQ C;  1ALI A;  4GTF A;  5FLM C;  4BXX C;  1SMY A;  2P5M A;  1EI6 A;  1XZQ A;  4ILD A;  3BP3 A;  1ALJ A;  2NVX K;  3WAW A;  5IP7 K;  3TX0 A;  2V6U A;  1KHN A;  3FHZ A;  5C3E C;  4PAB A;  4C3J K;  1XZP A;  1YCL A;  4FDJ A;  3A8K A;  2IUC A;  1BS2 A;  2GAG C;  1YNJ A;  1WOO A;  2ZKT A;  2WB1 D;  3GEH A;  1DCH A;  2NVY A;  1Y1V A;  1AB4 A;  2E2I C;  5DLT A;  1R9T C;  4LR8 A;  5C4X K;  2A6H A;  1WQF A;  1EH1 A;  1E1Z P;  5C66 A;  3AQO A;  2JA5 K;  4A3D K;  4CXS A;  2XCR B;  3WAX A;  3L4J A;  1VH2 A;  4OIP A;  1AJD A;  3OT9 A;  3UO0 A;  4GFQ A;  1KH5 A;  1TWA C;  4LQY A;  1B8J A;  1O24 A;  4FZB A;  4WJ3 M;  4Q4Z A;  4QJV A;  1Y1W A;  3GTK K;  2JA6 K;  4XLN A;  1I6H K;  1I3Q A;  5IYC K;  4A3B K;  4LLG A;  1AJB A;  3GTM C;  1E33 P;  3S1Q C;  1IE0 A;  2JA7 C;  1WOS A;  4KJG A;  4KMU A;  5M3F K;  3GEI A;  1BDF A;  3GTQ K;  3GTL A;  4G0U A;  1C0A A;  3S1M K;  2RH6 A;  3WBH A;  3LPX A;  4ZG9 A;  5C4J C;  5GOV A;  1J98 A;  3GTP C;  1ZEB A;  4OIR A;  3N3Y A;  1F7V A;  4A3M K;  4AH6 A;  1Y6V A;  5L46 A;  2O5I A;  3GTL K;  4GTE A;  1URA A;  3AD9 C;  3B5Q A;  5JVO A;  5IP9 C;  4KAV A;  3FKI A;  2YU9 A;  4C2M C;  4XCH A;  3A8J A;  3GTJ K;  2GSO A;  1O27 A;  3GIR A;  3S15 C;  2Y0S L;  4LK1 A;  4BY7 K;  3E2D A;  4OIO A;  1ANJ A;  2W7V A;  1F93 A;  1BJT A;  3TFJ A;  3I4N K;  3MK2 A;  1F7U A;  3TWZ A;  4KN7 A;  3S0X A;  1J6X A;  3BDF A;  4A3L C;  4GTZ A;  4KDD A;  2VQR A;  4KAY A;  4KC6 A;  4GTB A;  4BKW A;  2W8D A;  5CHP A;  3EQL A;  4OIN A;  4UPI A;  4GZY A;  5D4D A;  5M5X K;  4KJD A;  3S1R K;  3G4A A;  2E2J C;  5K4P A;  2PA8 L;  2R92 C;  2B63 K;  3S2D C;  4UPK A;  3AH5 A;  5IJS A;  5L0E A;  4LRB A;  3CAG A;  3BDG A;  1UV7 A;  3HXA A;  3NVL A;  3CMR A;  3AD8 C;  1K83 C;  4LR2 A;  1K83 A;  1O25 A;  1X31 C;  5CJ9 A;  1WOP A;  2W5R A;  3CQZ C;  3CQZ A;  1J6V A;  3WOD A;  4UOP A;  3FOF A;  3TFI A;  2V6S A;  2W8S A;  1XZQ B;  2WB1 L;  4KM9 A;  2X98 A;  3IGY B;  5LRN A;  4GTX A;  3S17 C;  4BY1 K;  1IW7 A;  4P5A A;  3S16 K;  1VJE A;  5IYB C;  1XZP B;  1TWG C;  4CXK A;  2IUC B;  3M8Z A;  2P8T A;  4MY4 A;  4ZG7 A;  5L0K A;  3S2H C;  4KAR A;  3MML B;  2NVX A;  3S1N K;  5IP7 C;  3HOU C;  1IS1 A;  2JA8 K; 
#chains in the Genus database with same CATH homology
 4LR8 A;  3M8Y A;  1ZED A;  3T00 A;  2XRG A;  4FDI A;  2XR9 A;  5C66 A;  1E1Z P;  2GLQ A;  1EW2 A;  4KM4 A;  5HRT A;  3T01 A;  4CXS A;  3WAX A;  1AJD A;  3OT9 A;  3UO0 A;  2QZU A;  5AJ9 A;  1K7H A;  2G9Y A;  4LR9 A;  4LRA A;  1KH5 A;  5EGH A;  5DLV A;  4LQY A;  3SZY A;  1B8J A;  4MHX A;  1KHJ A;  3NKR A;  4LRC A;  1ALK A;  3IDD A;  1AJB A;  1E33 P;  2ANH A;  4KJG A;  1AJC A;  4CYR A;  3SZZ A;  4ZGA A;  4UPH A;  3LXQ A;  2RH6 A;  3WBH A;  4ZG9 A;  1KH4 A;  5LRM A;  2W5W A;  5GOV A;  2GSN A;  1ELY A;  5EGE A;  3BDH A;  1O99 A;  3WAY A;  1ZEB A;  2W5X A;  4LRD A;  1URB A;  1KHK A;  2GSU A;  4GTY A;  1Y6V A;  3NKM A;  1Y7A A;  1ZEF A;  2W5T A;  1URA A;  3B5Q A;  3NKN A;  4N7T A;  4KAV A;  2W5S A;  4LRF A;  2GSO A;  3UNY A;  5LIA A;  3ED4 A;  3NKP A;  1AUK A;  3E2D A;  1ANJ A;  3M8W A;  1KHL A;  4YR1 A;  1EJJ A;  3MK2 A;  4QAX A;  4CXU A;  1HDH A;  1N2K A;  3IGZ B;  3TWZ A;  3A52 A;  3BDF A;  4GTZ A;  1EQJ A;  1P49 A;  2VQR A;  4KAY A;  1E3C P;  1ED9 A;  1SHN A;  3T02 A;  4UOO A;  4CYS A;  2W8D A;  3MK0 A;  5INH A;  4GTW A;  3NKO A;  3UN3 A;  4UPI A;  4UPL A;  4KJD A;  1HJK A;  1ELX A;  5K4P A;  1ANI A;  4LRE A;  1HQA A;  3UN5 A;  1FSU A;  4UPK A;  5IJS A;  3BDG B;  4UOR A;  5L0E A;  4MIV A;  4LRB A;  2GA3 A;  3BDG A;  5IJQ A;  3NVL A;  1E2S P;  1ED8 A;  3CMR A;  4LR2 A;  5DLW A;  1EW8 A;  4TN0 A;  3TG0 A;  1KH7 A;  1ALH A;  1SHQ A;  4LR7 A;  2W5R A;  1KH9 A;  5L0B A;  4NWX A;  2W5V A;  4UOP A;  1N2L A;  2D1G A;  2IFY A;  4NWJ A;  1ALI A;  2W8S A;  3MK1 A;  5TJ3 A;  3Q3Q A;  1EI6 A;  1ALJ A;  2X98 A;  3IGY B;  5LRN A;  5KXA A;  1O98 A;  4GTX A;  3DPC A;  3WAW A;  2W5Q A;  3M7V A;  3TX0 A;  1KHN A;  3DYC A;  3WAV A;  1EW9 A;  3UN2 A;  4CXK A;  2IUC B;  3M8Z A;  4FDJ A;  4MY4 A;  4B56 A;  4ZG7 A;  1AJA A;  2IUC A;  4ZG6 A;  5L0K A;  2ZKT A;  3KD8 A;  5LQQ A;  3NKQ A;  5DLT A;  5GRR A;  1ELZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...