1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
b'TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHONOACETATE HYDROLASE
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
3MK2A 2W5RA 3NVLA 3DPCA 1AJAA 1KHLA 3IGZB 3BDGA 4LRDA 1EJJA 4LRCA 4UPHA 1B8JA 2W8SA 2GLQA 1HDHA 2GSUA 3NKMA 5LIAA 4LR9A 1ALHA 2D1GA 1SHNA 1URAA 4N7TA 1ZEDA 4ZG6A 1E1ZP 5GRRA 2X98A 3ED4A 3M7VA 4GTWA 3NKRA 3E2DA 3WAVA 2ANHA 2XRGA 4KJGA 4UPLA 1ALIA 5DLWA 4B56A 5HRTA 3M8YA 1Y6VA 1EW8A 3BDHA 4MHXA 4MIVA 4LR8A 1ANJA 1EI6A 3NKPA 2IUCB 1EQJA 1P49A 3WAXA 3MK1A 4UORA 3TX0A 2GA3A 4UPIA 1KH4A 1ED8A 5INHA 1E3CP 4NWXA 2G9YA 1KHJA 2W8DA 2XR9A 4GTZA 4LRFA 3A52A 4FDIA 5AJ9A 3UO0A 4TN0A 5DLVA 1ELXA 3NKQA 5IJQA 5K4PA 2VQRA 1ELYA 3UN3A 5L0BA 5C66A 1O98A 1KH7A 4CXKA 2IFYA 3T02A 3M8ZA 5IJSA 1ELZA 4NWJA 4CYRA 4LRAA 2W5XA 1SHQA 1K7HA 1E33P 5LQQA 1ANIA 4FDJA 1ZEBA 1URBA 1KH5A 2W5WA 1AJCA 1FSUA 1O99A 4UOPA 3UNYA 3SZYA 4LR7A 1N2LA 2W5SA 3CMRA 5DLTA 4MY4A 5EGHA 3Q3QA 1ED9A 3SZZA 4QAXA 3TWZA 5L0EA 3M8WA 4YR1A 4LREA 5GOVA 5TJ3A 5LRMA 3DYCA 3WAYA 4ZGAA 3KD8A 4KJDA 3T01A 3NKNA 3T00A 1AUKA 1AJDA 3IGYB 4CXSA 3LXQA 2GSOA 1E2SP 1ALJA 2QZUA 4LQYA 3BDFA 3IDDA 5EGEA 3WBHA 3MK0A 1ALKA 2W5TA 1KHKA 1N2KA 2IUCA 3NKOA 3WAWA 1KHNA 3BDGB 3UN5A 3UN2A 1ZEFA 2GSNA 2ZKTA 4ZG9A 3TG0A 3B5QA 4GTXA 5KXAA 4UPKA 1Y7AA 2W5VA 4CXUA 4UOOA 4GTYA 4CYSA 1AJBA 4KAYA 5L0KA 1EW9A 2W5QA 4ZG7A 5LRNA 1HQAA 1HJKA 4KM4A 4KAVA 4LRBA 1KH9A 1EW2A 2RH6A 4LR2A 3OT9A
chains in the Genus database with same CATH superfamily
1XZPA 3HOVK 3NVLA 2NVXA 1AJAA 3IPJA 4LRDA 1WSVA 2YU9A 1I50C 2W8SA 3GDZA 4MQ9A 2GSUA 2R7ZK 3PO2C 3HOXC 2CFAB 1ALHA 1O2FB 3HKZD 3HOYK 4BBSK 1K83C 3EQLA 1C0AA 3GTGA 4BBRK 1ZEDA 3AD8C 1ZVUA 5GRRA 3M7VA 1XXBA 4BY1C 3GEIA 2O5JA 3NKRA 3E2DA 1ZBSA 3RZDC 2V6SA 5DLWA 5D4DA 2V6TA 3TTGA 4KMHA 1TWHK 2R7ZA 3L4KA 1P49A 1L0WA 3S14C 4C2MC 4A3MC 3MK1A 1I50K 4UORA 1TWCK 5FJ8K 1WIHA 3M4OK 2GA3A 1DCOA 4KAWX 3PO2K 3HOXK 2G9YA 1DCHA 3AQOA 1K83K 1BDFA 3S2DC 4GTZA 2ZUEA 1IS1A 5AJ9A 2JA8C 3CQZC 4OIQA 1ELXA 4BY1K 3I4MC 1TWHA 5C66A 3RZDK 1KH7A 4GT9A 4YG2A 4A3BC 1EFWA 1ELZA 3NUHA 2D6FC 1VLOA 3N3YA 1I50A 1SHQA 4GTBA 1TWCA 1K7HA 1E33P 5LQQA 1O2AA 4YFKA 3S14K 4C2MK 4A3MK 1K83A 1FSUA 1O28A 3SZYA 4BXXC 4A3JC 4C3IC 2KWAA 2JH3A 1TWGC 3SZZA 1SMYA 3TWZA 2PA8D 5L0EA 3N0CA 3WODA 1HI9A 4OIRA 2JA8K 1G51A 3CQZK 4LREA 5GOVA 1XZQA 4A3LK 5C44C 3DYCA 3I4MK 2JA7A 1F93A 4G0UA 1PJ7A 4KN7A 4WJ4A 3LXQA 1XZPB 1GE9A 3IDDA 5EGEA 3MK0A 1TWAC 2FQTA 1KHKA 5CHPA 3N0BA 2E2JC 2WAQD 2Y0SD 4GTXA 5KXAA 1Y7AA 2W5VA 4BXXK 4P5BA 4GTCA 3CQZA 4A3JK 3AQPA 1F7UA 1TWGK 4QIWL 5LRNA 3S16C 5M5WK 3QX3A 3TFHA 3GTLC 3GTGC 1KH9A 4QJVA 5C44K 3HOVC 4FZBA 3MK2A 2PMZD 5L46A 2WB1D 3GTPC 3IGZB 1WCMC 4KMDA 4G0VA 3BDGA 5IOQA 1TWAK 2E2JK 3TFJA 1HDHA 3NKMA 2ZUFA 1TWGA 4BKWA 3S1NK 2D1GA 1SHNA 1URAA 4BBSC 1I3QC 3HOYC 2NVYC 4N7TA 2A6HA 4XLNA 4A3GC 4ZG6A 2X98A 1I6HC 4YFXA 3S2HC 3S16K 2ANHA 4KJGA 3GTLK 1ALIA 4B56A 4ZH4A 1TWAA 1Y6VA 4GTFA 1X31C 4KB4A 1TWHC 1ISEA 1USOA 3GTPK 1ANJA 1EI6A 1WCMK 3NKPA 3ERED 1EQJA 1O25A 3WAXA 3BP8C 1AB4A 3A8IA 4ILDA 1TWCC 3M4OC 3S1MC 4UPIA 3M3YC 4JK1A 3H3VD 1JQWA 1J6XA 4NWXA 1IW7A 1I3QK 1XXAA 2NVYK 4MEYA 1J98A 3GTLA 1BGWA 4A3GK 1VRQC 1DD5A 3MMLB 5DLVA 2P8TA 1I6HK 3UN3A 5K4PA 5L0BA 3GTPA 5HL8A 3S2HK 1WCMA 1XZQB 5IP7K 3T02A 4A3DC 1WSRA 4LRAA 3FOEA 4C3JC 2JA7C 4GTLA 4A3CK 3AD9C 1Y1WC 2W5WA 1I3QA 2PPBA 2NVYA 3HOUK 1IL2A 3UNYA 4LR7A 4A3KK 3GIRA 3S1MK 1N2LA 3M3YK 1PJ5A 4MY4A 3V4GA 4M1XA 5EGHA 1ED9A 1F7VA 4G7HA 2E2IC 4YR1A 2Y3PA 3HKZL 4A3LC 4KDDA 4QJVB 1AUKA 1B4AA 3IGYB 4A93C 3L4JA 4A3DK 3BDFA 3WBHA 1Y1VK 2XCOA 1ALKA 3LPXA 3HOZC 3NKOA 4C3JK 2JA7K 3BDGB 3UN2A 3OPFA 2B63C 2GSNA 3GTKC 1Y1WK 4GTAA 1YNNA 4UPKA 4CYSA 1RU0A 1WQHA 4YFNA 5L0KA 3GEEA 3GTQC 1EW9A 2W5QA 1USMA 4J3NA 1IBAA 4ZG7A 2JA5C 1XPPA 4KAVA 4O2DA 2E2IK 2RH6A 4AYBD 1Y1VA 1O27A 1O24A 4G7ZA 4A3FC 3OT9A 2FQOA 2W5RA 1O2BA 1WORA 1KHLA 4LK1A 4A93K 1Y1WA 5E68A 3JSTA 1EJJA 3A8JA 1O26A 1WQGA 1O29A 5JVOA 3HOZK 4BLBA 5C4XK 3S1RC 2GLQA 4KB2A 5IORA 2B63K 1DCPA 3GTKK 5LIAA 3BUEA 1WOPA 4LR9A 3S1NC 4KM9A 4KASA 2P5MA 2E2IA 5M3FK 3GTQK 4KMUA 4OIOA 4PAAA 4FM9A 2JA5K 4GTWA 3FOFA 1R9TC 2VUMC 2XRGA 5IOSA 4Y52C 3M8YA 1KQ4A 4LJZA 4A3FK 2XCQA 1UV7A 2NVQC 5TMFA 2PA8L 4GTEA 1EW8A 1ZQ1C 3BDHA 3RZOK 3GTKA 2B63A 4LR8A 4AYBL 1VH2A 3K7AC 2RGRA 2PHCB 1WOSA 1WOOA 4KARA 3S1RK 3TX0A 2V6UA 3GTQA 1ED8A 1E3CP 2JA5A 3GTOC 1JVIA 2WAQL 2Y0SL 2W8DA 2XR9A 1IE0A 1YCLA 3A52A 5IYBC 3S1QC 3UO0A 4GFQA 5IJQA 2VQRA 1ZXOA 1R9TK 3CAGA 3TFIA 5IYCC 5IP7C 2VUMK 3M8ZA 1BJTA 4NWJA 4Y52K 4CYRA 3I4NC 2W5XA 2NVQK 1YX2A 4A3CC 3FKIC 3K7AK 4FDJA 5CJ9A 1URBA 1KH5A 2PMZL 2WB1L 3HOUC 1AJCA 1O99A 4UOPA 4A3KC 2W5SA 3CMRA 4XSZA 2EBBA 3GTMC 4A3IK 3Q3QA 3LAPA 3GTOK 1HQMA 4NOIA 1R9TA 2VUMA 4QAXA 5IYBK 3S1QK 5LRMA 4ZGAA 4KJDA 3T01A 3NKNA 3T00A 5IYCK 4CXSA 1IQ0A 3OEPA 2GSOA 1E2SP 1ALJA 4LQYA 3I4NK 4G7OA 1Y1VC 1N2KA 1KHNA 5IYDC 3OREA 1VJEA 3FKIK 1ZEFA 1ZYRA 4ZG9A 3GTOA 3B5QA 3TG0A 3BP3A 4Q5SA 4GTYA 1YNJA 1AJBA 4GZYA 3GTMK 4KN4A 3GEHA 4Q4ZA 1EK8A 2O5IA 1HQAA 1HJKA 4KM4A 3H3VL 2JA6C 1F9NA 4LLGA 4C3HC 4LRBA 1EW2A 4LR2A 3VA7A 3S0XA 2GAHC 3DPCA 1XXCA 3FKIA 3A8KA 1INNA 4LOWA 4XCHA 1EH1A 4LRCA 4UPHA 1B8JA 2W7VA 5C4XC 4DDQA 1TWFC 5IYDK 5TMCA 3GTMA 3S15C 2ZFZA 3H0GC 4XSXA 1V5VA 1E1ZP 3ED4A 1JOEA 5JFEA 3WAVA 3PO3C 2JA6K 2A6EA 4C3HK 4UPLA 4C45A 5HRTA 2E2HC 1SFOC 4MHXA 3G4CA 3RZOC 5IP9C 2BE5A 2IUCB 2R93C 3GSIA 1TWFK 2CFAA 4QIWD 3S15K 1KH4A 2NVTC 5INHA 1J6VA 3H0GK 2JA6A 1B4BA 3HXAA 3S2DK 1KHJA 4LRFA 3AD7C 3S17C 4FDIA 4OINA 4A3EC 4TN0A 2R92C 5M5YK 3NKQA 1ELYA 4WJ3M 4Y7NC 1I6VA 4BLAA 2XCRB 3PO3K 4P5AA 1O98A 4CXKA 2IFYA 2CW0A 5IJSA 3GTJC 3FHZA 3AH5A 4A3BK 2E2HK 5C3EC 1SFOK 1J6WA 1TWFA 3ADAC 4P9SA 5IP9K 3HOWC 3G4AA 2NVXC 1ANIA 1ZEBA 5M3MK 4LK0A 2R93K 3H0GA 3DXJA 2YU9C 4G0WA 5DLTA 4BY7C 5FLMC 2NVTK 4C3IK 1PJ6A 4A3IC 1EQRA 4KC6A 4X6AC 5C4JC 3S17K 2E2HA 3M8WA 1SFOA 5TJ3A 4A3EK 2R92K 1WQFA 3WAYA 2A69A 3KD8A 2A68A 4Y7NK 1AJDA 4MEXA 1BS2A 4RMFA 3GTJK 4KATA 2QZUA 2R93A 5C3EK 2W5TA 4PABA 2IUCA 3WAWA 4GTDA 4WILA 3UN5A 3HOWK 2NVXK 4KM8A 4KMAA 2R7ZC 2ZKTA 4CXUA 4UOOA 2YU9K 3LAJA 5M5XK 4BY7K 5FLMK 4BBRC 4KAYA 2R92A 4X6AK 4AH6A 3GTJA 2GAGC 5C4JK 3GTGK 4OIPA 4MIVA 4XLPA 5IOTA 1VGXA
chains in the Genus database with same CATH topology
3MK2A 2W5RA 3NVLA 3DPCA 1AJAA 1KHLA 3IGZB 3BDGA 4LRDA 1EJJA 4LRCA 4UPHA 1B8JA 2W8SA 2GLQA 1HDHA 2GSUA 3NKMA 5LIAA 4LR9A 1ALHA 2D1GA 1SHNA 1URAA 4N7TA 1ZEDA 4ZG6A 1E1ZP 5GRRA 2X98A 3ED4A 3M7VA 4GTWA 3NKRA 3E2DA 3WAVA 2ANHA 2XRGA 4KJGA 4UPLA 1ALIA 5DLWA 4B56A 5HRTA 3M8YA 1Y6VA 1EW8A 3BDHA 4MHXA 4MIVA 4LR8A 1ANJA 1EI6A 3NKPA 2IUCB 1EQJA 1P49A 3WAXA 3MK1A 4UORA 3TX0A 2GA3A 4UPIA 1KH4A 1ED8A 5INHA 1E3CP 4NWXA 2G9YA 1KHJA 2W8DA 2XR9A 4GTZA 4LRFA 3A52A 4FDIA 5AJ9A 3UO0A 4TN0A 5DLVA 1ELXA 3NKQA 5IJQA 5K4PA 2VQRA 1ELYA 3UN3A 5L0BA 5C66A 1O98A 1KH7A 4CXKA 2IFYA 3T02A 3M8ZA 5IJSA 1ELZA 4NWJA 4CYRA 4LRAA 2W5XA 1SHQA 1K7HA 1E33P 5LQQA 1ANIA 4FDJA 1ZEBA 1URBA 1KH5A 2W5WA 1AJCA 1FSUA 1O99A 4UOPA 3UNYA 3SZYA 4LR7A 1N2LA 2W5SA 3CMRA 5DLTA 4MY4A 5EGHA 3Q3QA 1ED9A 3SZZA 4QAXA 3TWZA 5L0EA 3M8WA 4YR1A 4LREA 5GOVA 5TJ3A 5LRMA 3DYCA 3WAYA 4ZGAA 3KD8A 4KJDA 3T01A 3NKNA 3T00A 1AUKA 1AJDA 3IGYB 4CXSA 3LXQA 2GSOA 1E2SP 1ALJA 2QZUA 4LQYA 3BDFA 3IDDA 5EGEA 3WBHA 3MK0A 1ALKA 2W5TA 1KHKA 1N2KA 2IUCA 3NKOA 3WAWA 1KHNA 3BDGB 3UN5A 3UN2A 1ZEFA 2GSNA 2ZKTA 4ZG9A 3TG0A 3B5QA 4GTXA 5KXAA 4UPKA 1Y7AA 2W5VA 4CXUA 4UOOA 4GTYA 4CYSA 1AJBA 4KAYA 5L0KA 1EW9A 2W5QA 4ZG7A 5LRNA 1HQAA 1HJKA 4KM4A 4KAVA 4LRBA 1KH9A 1EW2A 2RH6A 4LR2A 3OT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MK2 A;  2W5R A;  3NVL A;  3DPC A;  1AJA A;  1KHL A;  3IGZ B;  3BDG A;  4LRD A;  1EJJ A;  4LRC A;  4UPH A;  1B8J A;  2W8S A;  2GLQ A;  1HDH A;  2GSU A;  3NKM A;  5LIA A;  4LR9 A;  1ALH A;  2D1G A;  1SHN A;  1URA A;  4N7T A;  1ZED A;  4ZG6 A;  1E1Z P;  5GRR A;  2X98 A;  3ED4 A;  3M7V A;  4GTW A;  3NKR A;  3E2D A;  3WAV A;  2ANH A;  2XRG A;  4KJG A;  4UPL A;  1ALI A;  5DLW A;  4B56 A;  5HRT A;  3M8Y A;  1Y6V A;  1EW8 A;  3BDH A;  4MHX A;  4MIV A;  4LR8 A;  1ANJ A;  1EI6 A;  3NKP A;  2IUC B;  1EQJ A;  1P49 A;  3WAX A;  3MK1 A;  4UOR A;  3TX0 A;  2GA3 A;  4UPI A;  1KH4 A;  1ED8 A;  5INH A;  1E3C P;  4NWX A;  2G9Y A;  1KHJ A;  2W8D A;  2XR9 A;  4GTZ A;  4LRF A;  3A52 A;  4FDI A;  5AJ9 A;  3UO0 A;  4TN0 A;  5DLV A;  1ELX A;  3NKQ A;  5IJQ A;  5K4P A;  2VQR A;  1ELY A;  3UN3 A;  5L0B A;  5C66 A;  1O98 A;  1KH7 A;  4CXK A;  2IFY A;  3T02 A;  3M8Z A;  5IJS A;  1ELZ A;  4NWJ A;  4CYR A;  4LRA A;  2W5X A;  1SHQ A;  1K7H A;  1E33 P;  5LQQ A;  1ANI A;  4FDJ A;  1ZEB A;  1URB A;  1KH5 A;  2W5W A;  1AJC A;  1FSU A;  1O99 A;  4UOP A;  3UNY A;  3SZY A;  4LR7 A;  1N2L A;  2W5S A;  3CMR A;  5DLT A;  4MY4 A;  5EGH A;  3Q3Q A;  1ED9 A;  3SZZ A;  4QAX A;  3TWZ A;  5L0E A;  3M8W A;  4YR1 A;  4LRE A;  5GOV A;  5TJ3 A;  5LRM A;  3DYC A;  3WAY A;  4ZGA A;  3KD8 A;  4KJD A;  3T01 A;  3NKN A;  3T00 A;  1AUK A;  1AJD A;  3IGY B;  4CXS A;  3LXQ A;  2GSO A;  1E2S P;  1ALJ A;  2QZU A;  4LQY A;  3BDF A;  3IDD A;  5EGE A;  3WBH A;  3MK0 A;  1ALK A;  2W5T A;  1KHK A;  1N2K A;  2IUC A;  3NKO A;  3WAW A;  1KHN A;  3BDG B;  3UN5 A;  3UN2 A;  1ZEF A;  2GSN A;  2ZKT A;  4ZG9 A;  3TG0 A;  3B5Q A;  4GTX A;  5KXA A;  4UPK A;  1Y7A A;  2W5V A;  4CXU A;  4UOO A;  4GTY A;  4CYS A;  1AJB A;  4KAY A;  5L0K A;  1EW9 A;  2W5Q A;  4ZG7 A;  5LRN A;  1HQA A;  1HJK A;  4KM4 A;  4KAV A;  4LRB A;  1KH9 A;  1EW2 A;  2RH6 A;  4LR2 A;  3OT9 A; 
#chains in the Genus database with same CATH topology
 1XZP A;  3HOV K;  3NVL A;  2NVX A;  1AJA A;  3IPJ A;  4LRD A;  1WSV A;  2YU9 A;  1I50 C;  2W8S A;  3GDZ A;  4MQ9 A;  2GSU A;  2R7Z K;  3PO2 C;  3HOX C;  2CFA B;  1ALH A;  1O2F B;  3HKZ D;  3HOY K;  4BBS K;  1K83 C;  3EQL A;  1C0A A;  3GTG A;  4BBR K;  1ZED A;  3AD8 C;  1ZVU A;  5GRR A;  3M7V A;  1XXB A;  4BY1 C;  3GEI A;  2O5J A;  3NKR A;  3E2D A;  1ZBS A;  3RZD C;  2V6S A;  5DLW A;  5D4D A;  2V6T A;  3TTG A;  4KMH A;  1TWH K;  2R7Z A;  3L4K A;  1P49 A;  1L0W A;  3S14 C;  4C2M C;  4A3M C;  3MK1 A;  1I50 K;  4UOR A;  1TWC K;  5FJ8 K;  1WIH A;  3M4O K;  2GA3 A;  1DCO A;  4KAW X;  3PO2 K;  3HOX K;  2G9Y A;  1DCH A;  3AQO A;  1K83 K;  1BDF A;  3S2D C;  4GTZ A;  2ZUE A;  1IS1 A;  5AJ9 A;  2JA8 C;  3CQZ C;  4OIQ A;  1ELX A;  4BY1 K;  3I4M C;  1TWH A;  5C66 A;  3RZD K;  1KH7 A;  4GT9 A;  4YG2 A;  4A3B C;  1EFW A;  1ELZ A;  3NUH A;  2D6F C;  1VLO A;  3N3Y A;  1I50 A;  1SHQ A;  4GTB A;  1TWC A;  1K7H A;  1E33 P;  5LQQ A;  1O2A A;  4YFK A;  3S14 K;  4C2M K;  4A3M K;  1K83 A;  1FSU A;  1O28 A;  3SZY A;  4BXX C;  4A3J C;  4C3I C;  2KWA A;  2JH3 A;  1TWG C;  3SZZ A;  1SMY A;  3TWZ A;  2PA8 D;  5L0E A;  3N0C A;  3WOD A;  1HI9 A;  4OIR A;  2JA8 K;  1G51 A;  3CQZ K;  4LRE A;  5GOV A;  1XZQ A;  4A3L K;  5C44 C;  3DYC A;  3I4M K;  2JA7 A;  1F93 A;  4G0U A;  1PJ7 A;  4KN7 A;  4WJ4 A;  3LXQ A;  1XZP B;  1GE9 A;  3IDD A;  5EGE A;  3MK0 A;  1TWA C;  2FQT A;  1KHK A;  5CHP A;  3N0B A;  2E2J C;  2WAQ D;  2Y0S D;  4GTX A;  5KXA A;  1Y7A A;  2W5V A;  4BXX K;  4P5B A;  4GTC A;  3CQZ A;  4A3J K;  3AQP A;  1F7U A;  1TWG K;  4QIW L;  5LRN A;  3S16 C;  5M5W K;  3QX3 A;  3TFH A;  3GTL C;  3GTG C;  1KH9 A;  4QJV A;  5C44 K;  3HOV C;  4FZB A;  3MK2 A;  2PMZ D;  5L46 A;  2WB1 D;  3GTP C;  3IGZ B;  1WCM C;  4KMD A;  4G0V A;  3BDG A;  5IOQ A;  1TWA K;  2E2J K;  3TFJ A;  1HDH A;  3NKM A;  2ZUF A;  1TWG A;  4BKW A;  3S1N K;  2D1G A;  1SHN A;  1URA A;  4BBS C;  1I3Q C;  3HOY C;  2NVY C;  4N7T A;  2A6H A;  4XLN A;  4A3G C;  4ZG6 A;  2X98 A;  1I6H C;  4YFX A;  3S2H C;  3S16 K;  2ANH A;  4KJG A;  3GTL K;  1ALI A;  4B56 A;  4ZH4 A;  1TWA A;  1Y6V A;  4GTF A;  1X31 C;  4KB4 A;  1TWH C;  1ISE A;  1USO A;  3GTP K;  1ANJ A;  1EI6 A;  1WCM K;  3NKP A;  3ERE D;  1EQJ A;  1O25 A;  3WAX A;  3BP8 C;  1AB4 A;  3A8I A;  4ILD A;  1TWC C;  3M4O C;  3S1M C;  4UPI A;  3M3Y C;  4JK1 A;  3H3V D;  1JQW A;  1J6X A;  4NWX A;  1IW7 A;  1I3Q K;  1XXA A;  2NVY K;  4MEY A;  1J98 A;  3GTL A;  1BGW A;  4A3G K;  1VRQ C;  1DD5 A;  3MML B;  5DLV A;  2P8T A;  1I6H K;  3UN3 A;  5K4P A;  5L0B A;  3GTP A;  5HL8 A;  3S2H K;  1WCM A;  1XZQ B;  5IP7 K;  3T02 A;  4A3D C;  1WSR A;  4LRA A;  3FOE A;  4C3J C;  2JA7 C;  4GTL A;  4A3C K;  3AD9 C;  1Y1W C;  2W5W A;  1I3Q A;  2PPB A;  2NVY A;  3HOU K;  1IL2 A;  3UNY A;  4LR7 A;  4A3K K;  3GIR A;  3S1M K;  1N2L A;  3M3Y K;  1PJ5 A;  4MY4 A;  3V4G A;  4M1X A;  5EGH A;  1ED9 A;  1F7V A;  4G7H A;  2E2I C;  4YR1 A;  2Y3P A;  3HKZ L;  4A3L C;  4KDD A;  4QJV B;  1AUK A;  1B4A A;  3IGY B;  4A93 C;  3L4J A;  4A3D K;  3BDF A;  3WBH A;  1Y1V K;  2XCO A;  1ALK A;  3LPX A;  3HOZ C;  3NKO A;  4C3J K;  2JA7 K;  3BDG B;  3UN2 A;  3OPF A;  2B63 C;  2GSN A;  3GTK C;  1Y1W K;  4GTA A;  1YNN A;  4UPK A;  4CYS A;  1RU0 A;  1WQH A;  4YFN A;  5L0K A;  3GEE A;  3GTQ C;  1EW9 A;  2W5Q A;  1USM A;  4J3N A;  1IBA A;  4ZG7 A;  2JA5 C;  1XPP A;  4KAV A;  4O2D A;  2E2I K;  2RH6 A;  4AYB D;  1Y1V A;  1O27 A;  1O24 A;  4G7Z A;  4A3F C;  3OT9 A;  2FQO A;  2W5R A;  1O2B A;  1WOR A;  1KHL A;  4LK1 A;  4A93 K;  1Y1W A;  5E68 A;  3JST A;  1EJJ A;  3A8J A;  1O26 A;  1WQG A;  1O29 A;  5JVO A;  3HOZ K;  4BLB A;  5C4X K;  3S1R C;  2GLQ A;  4KB2 A;  5IOR A;  2B63 K;  1DCP A;  3GTK K;  5LIA A;  3BUE A;  1WOP A;  4LR9 A;  3S1N C;  4KM9 A;  4KAS A;  2P5M A;  2E2I A;  5M3F K;  3GTQ K;  4KMU A;  4OIO A;  4PAA A;  4FM9 A;  2JA5 K;  4GTW A;  3FOF A;  1R9T C;  2VUM C;  2XRG A;  5IOS A;  4Y52 C;  3M8Y A;  1KQ4 A;  4LJZ A;  4A3F K;  2XCQ A;  1UV7 A;  2NVQ C;  5TMF A;  2PA8 L;  4GTE A;  1EW8 A;  1ZQ1 C;  3BDH A;  3RZO K;  3GTK A;  2B63 A;  4LR8 A;  4AYB L;  1VH2 A;  3K7A C;  2RGR A;  2PHC B;  1WOS A;  1WOO A;  4KAR A;  3S1R K;  3TX0 A;  2V6U A;  3GTQ A;  1ED8 A;  1E3C P;  2JA5 A;  3GTO C;  1JVI A;  2WAQ L;  2Y0S L;  2W8D A;  2XR9 A;  1IE0 A;  1YCL A;  3A52 A;  5IYB C;  3S1Q C;  3UO0 A;  4GFQ A;  5IJQ A;  2VQR A;  1ZXO A;  1R9T K;  3CAG A;  3TFI A;  5IYC C;  5IP7 C;  2VUM K;  3M8Z A;  1BJT A;  4NWJ A;  4Y52 K;  4CYR A;  3I4N C;  2W5X A;  2NVQ K;  1YX2 A;  4A3C C;  3FKI C;  3K7A K;  4FDJ A;  5CJ9 A;  1URB A;  1KH5 A;  2PMZ L;  2WB1 L;  3HOU C;  1AJC A;  1O99 A;  4UOP A;  4A3K C;  2W5S A;  3CMR A;  4XSZ A;  2EBB A;  3GTM C;  4A3I K;  3Q3Q A;  3LAP A;  3GTO K;  1HQM A;  4NOI A;  1R9T A;  2VUM A;  4QAX A;  5IYB K;  3S1Q K;  5LRM A;  4ZGA A;  4KJD A;  3T01 A;  3NKN A;  3T00 A;  5IYC K;  4CXS A;  1IQ0 A;  3OEP A;  2GSO A;  1E2S P;  1ALJ A;  4LQY A;  3I4N K;  4G7O A;  1Y1V C;  1N2K A;  1KHN A;  5IYD C;  3ORE A;  1VJE A;  3FKI K;  1ZEF A;  1ZYR A;  4ZG9 A;  3GTO A;  3B5Q A;  3TG0 A;  3BP3 A;  4Q5S A;  4GTY A;  1YNJ A;  1AJB A;  4GZY A;  3GTM K;  4KN4 A;  3GEH A;  4Q4Z A;  1EK8 A;  2O5I A;  1HQA A;  1HJK A;  4KM4 A;  3H3V L;  2JA6 C;  1F9N A;  4LLG A;  4C3H C;  4LRB A;  1EW2 A;  4LR2 A;  3VA7 A;  3S0X A;  2GAH C;  3DPC A;  1XXC A;  3FKI A;  3A8K A;  1INN A;  4LOW A;  4XCH A;  1EH1 A;  4LRC A;  4UPH A;  1B8J A;  2W7V A;  5C4X C;  4DDQ A;  1TWF C;  5IYD K;  5TMC A;  3GTM A;  3S15 C;  2ZFZ A;  3H0G C;  4XSX A;  1V5V A;  1E1Z P;  3ED4 A;  1JOE A;  5JFE A;  3WAV A;  3PO3 C;  2JA6 K;  2A6E A;  4C3H K;  4UPL A;  4C45 A;  5HRT A;  2E2H C;  1SFO C;  4MHX A;  3G4C A;  3RZO C;  5IP9 C;  2BE5 A;  2IUC B;  2R93 C;  3GSI A;  1TWF K;  2CFA A;  4QIW D;  3S15 K;  1KH4 A;  2NVT C;  5INH A;  1J6V A;  3H0G K;  2JA6 A;  1B4B A;  3HXA A;  3S2D K;  1KHJ A;  4LRF A;  3AD7 C;  3S17 C;  4FDI A;  4OIN A;  4A3E C;  4TN0 A;  2R92 C;  5M5Y K;  3NKQ A;  1ELY A;  4WJ3 M;  4Y7N C;  1I6V A;  4BLA A;  2XCR B;  3PO3 K;  4P5A A;  1O98 A;  4CXK A;  2IFY A;  2CW0 A;  5IJS A;  3GTJ C;  3FHZ A;  3AH5 A;  4A3B K;  2E2H K;  5C3E C;  1SFO K;  1J6W A;  1TWF A;  3ADA C;  4P9S A;  5IP9 K;  3HOW C;  3G4A A;  2NVX C;  1ANI A;  1ZEB A;  5M3M K;  4LK0 A;  2R93 K;  3H0G A;  3DXJ A;  2YU9 C;  4G0W A;  5DLT A;  4BY7 C;  5FLM C;  2NVT K;  4C3I K;  1PJ6 A;  4A3I C;  1EQR A;  4KC6 A;  4X6A C;  5C4J C;  3S17 K;  2E2H A;  3M8W A;  1SFO A;  5TJ3 A;  4A3E K;  2R92 K;  1WQF A;  3WAY A;  2A69 A;  3KD8 A;  2A68 A;  4Y7N K;  1AJD A;  4MEX A;  1BS2 A;  4RMF A;  3GTJ K;  4KAT A;  2QZU A;  2R93 A;  5C3E K;  2W5T A;  4PAB A;  2IUC A;  3WAW A;  4GTD A;  4WIL A;  3UN5 A;  3HOW K;  2NVX K;  4KM8 A;  4KMA A;  2R7Z C;  2ZKT A;  4CXU A;  4UOO A;  2YU9 K;  3LAJ A;  5M5X K;  4BY7 K;  5FLM K;  4BBR C;  4KAY A;  2R92 A;  4X6A K;  4AH6 A;  3GTJ A;  2GAG C;  5C4J K;  3GTG K;  4OIP A;  4MIV A;  4XLP A;  5IOT A;  1VGX A; 
#chains in the Genus database with same CATH homology
 3MK2 A;  2W5R A;  3NVL A;  3DPC A;  1AJA A;  1KHL A;  3IGZ B;  3BDG A;  4LRD A;  1EJJ A;  4LRC A;  4UPH A;  1B8J A;  2W8S A;  2GLQ A;  1HDH A;  2GSU A;  3NKM A;  5LIA A;  4LR9 A;  1ALH A;  2D1G A;  1SHN A;  1URA A;  4N7T A;  1ZED A;  4ZG6 A;  1E1Z P;  5GRR A;  2X98 A;  3ED4 A;  3M7V A;  4GTW A;  3NKR A;  3E2D A;  3WAV A;  2ANH A;  2XRG A;  4KJG A;  4UPL A;  1ALI A;  5DLW A;  4B56 A;  5HRT A;  3M8Y A;  1Y6V A;  1EW8 A;  3BDH A;  4MHX A;  4MIV A;  4LR8 A;  1ANJ A;  1EI6 A;  3NKP A;  2IUC B;  1EQJ A;  1P49 A;  3WAX A;  3MK1 A;  4UOR A;  3TX0 A;  2GA3 A;  4UPI A;  1KH4 A;  1ED8 A;  5INH A;  1E3C P;  4NWX A;  2G9Y A;  1KHJ A;  2W8D A;  2XR9 A;  4GTZ A;  4LRF A;  3A52 A;  4FDI A;  5AJ9 A;  3UO0 A;  4TN0 A;  5DLV A;  1ELX A;  3NKQ A;  5IJQ A;  5K4P A;  2VQR A;  1ELY A;  3UN3 A;  5L0B A;  5C66 A;  1O98 A;  1KH7 A;  4CXK A;  2IFY A;  3T02 A;  3M8Z A;  5IJS A;  1ELZ A;  4NWJ A;  4CYR A;  4LRA A;  2W5X A;  1SHQ A;  1K7H A;  1E33 P;  5LQQ A;  1ANI A;  4FDJ A;  1ZEB A;  1URB A;  1KH5 A;  2W5W A;  1AJC A;  1FSU A;  1O99 A;  4UOP A;  3UNY A;  3SZY A;  4LR7 A;  1N2L A;  2W5S A;  3CMR A;  5DLT A;  4MY4 A;  5EGH A;  3Q3Q A;  1ED9 A;  3SZZ A;  4QAX A;  3TWZ A;  5L0E A;  3M8W A;  4YR1 A;  4LRE A;  5GOV A;  5TJ3 A;  5LRM A;  3DYC A;  3WAY A;  4ZGA A;  3KD8 A;  4KJD A;  3T01 A;  3NKN A;  3T00 A;  1AUK A;  1AJD A;  3IGY B;  4CXS A;  3LXQ A;  2GSO A;  1E2S P;  1ALJ A;  2QZU A;  4LQY A;  3BDF A;  3IDD A;  5EGE A;  3WBH A;  3MK0 A;  1ALK A;  2W5T A;  1KHK A;  1N2K A;  2IUC A;  3NKO A;  3WAW A;  1KHN A;  3BDG B;  3UN5 A;  3UN2 A;  1ZEF A;  2GSN A;  2ZKT A;  4ZG9 A;  3TG0 A;  3B5Q A;  4GTX A;  5KXA A;  4UPK A;  1Y7A A;  2W5V A;  4CXU A;  4UOO A;  4GTY A;  4CYS A;  1AJB A;  4KAY A;  5L0K A;  1EW9 A;  2W5Q A;  4ZG7 A;  5LRN A;  1HQA A;  1HJK A;  4KM4 A;  4KAV A;  4LRB A;  1KH9 A;  1EW2 A;  2RH6 A;  4LR2 A;  3OT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...