1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords PHOSPHONOACETATE HYDROLASE
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
3MK2A 3BDGA 1E1ZP 4KM4A 5C66A 4KJGA 1KH4A 3NVLA 1AJCA 1AJBA 2GSNA 3WAYA 4N7TA 1ELYA 5EGEA 1EJJA 3NKMA 3IGZB 4LRDA 5LIAA 1ALKA 4UPLA 3NKRA 4GTYA 2GA3A 1HQAA 2W5TA 4KAVA 1Y7AA 3UN2A 1ZEDA 1N2LA 3UNYA 4CYSA 3NKNA 1EW8A 2W8SA 3E2DA 3UO0A 1ALHA 1FSUA 1O98A 4MIVA 1P49A 1KH7A 5KXAA 5HRTA 1ED9A 4UPIA 5IJSA 2W5VA 2IUCB 4KJDA 5K4PA 2ANHA 2D1GA 2RH6A 1EI6A 1ELXA 3Q3QA 3BDGB 2W8DA 4LREA 1Y6VA 3T02A 1URAA 3MK0A 3NKOA 3B5QA 2GSUA 1HDHA 3BDFA 3T00A 3IDDA 4MY4A 3WAXA 4QAXA 4UORA 1AUKA 5GOVA 5DLWA 2X98A 5TJ3A 4GTZA 3CMRA 5LQQA 2W5SA 2GLQA 3M8YA 4ZG6A 4UPKA 5L0KA 1ANJA 3BDHA 2W5XA 1N2KA 4LRCA 2G9YA 3WBHA 4LR2A 4CXUA 1KH9A 5LRNA 4LQYA 4CXSA 2XR9A 5DLVA 2VQRA 4LR8A 4FDIA 4TN0A 4LR7A 1ALIA 2IFYA 3UN3A 3M8WA 3TWZA 5INHA 3NKPA 1EW9A 1EW2A 1EQJA 2XRGA 3IGYB 4MHXA 4UPHA 5EGHA 3WAVA 3DPCA 1SHNA 3OT9A 1ZEBA 2QZUA 1ANIA 2GSOA 4ZG9A 2W5RA 1B8JA 5L0BA 5DLTA 4ZGAA 1AJAA 3TG0A 3SZZA 5IJQA 1E2SP 4NWJA 4CXKA 1ALJA 1ED8A 4CYRA 1KHJA 4ZG7A 1K7HA 4LRAA 1E33P 3WAWA 4B56A 4LRBA 1ELZA 2IUCA 3DYCA 1URBA 4UOPA 3TX0A 1E3CP 1KHLA 3KD8A 4KAYA 1KHNA 4GTXA 1ZEFA 3NKQA 3A52A 4LRFA 3LXQA 2W5WA 1KH5A 4GTWA 4UOOA 4NWXA 3SZYA 3M7VA 5LRMA 3UN5A 4YR1A 1SHQA 4FDJA 3ED4A 5GRRA 2W5QA 3T01A 1HJKA 2ZKTA 5AJ9A 5L0EA 1O99A 3M8ZA 1AJDA 3MK1A 1KHKA 4LR9A
chains in the Genus database with same CATH superfamily
2NVQK 3A8IA 3MK2A 1I3QC 1YCLA 1E1ZP 2WB1L 1AJCA 1WOPA 3AQPA 2NVYC 3TFIA 3GTJC 1ELYA 3NKMA 5LIAA 4UPLA 2A69A 2JA7C 1HQAA 4KAVA 1N2LA 3UNYA 1TWFK 3NKNA 3OREA 4LK0A 4OIOA 2E2JK 2NVTC 2R93A 4A3MK 4AH6A 3GTLC 5TMFA 1DCHA 1P49A 3HOUK 5HRTA 2XCOA 1I3QA 3VA7A 1TWCA 4UPIA 1TWGK 2W5VA 1I6VA 3EQLA 5FLMC 4A3KC 4A3DK 2P5MA 4KM9A 1EI6A 1XZPA 4G7HA 2YU9A 2W8DA 1B4AA 4FM9A 3S16K 4LJZA 3NKOA 3B5QA 1TWCK 1HQMA 2NVQC 1WSRA 3BP8C 3GTPK 5GOVA 4A3JK 5DLWA 3S1NK 3I4MK 5IORA 1SMYA 3M8YA 3H0GA 4GFQA 4KMAA 3K7AC 5FLMK 4CXSA 1BS2A 1ALIA 4A3MC 4J3NA 3BUEA 4QJVA 1F7VA 1SFOC 4A3LK 1VJEA 4YG2A 1EQRA 1EW2A 4MEXA 1EQJA 4UPHA 5CJ9A 4XLPA 3WAVA 3DPCA 1ANIA 5IYBK 3OT9A 2O5JA 5L0BA 5DLTA 1Y1WA 2Y0SL 1VLOA 3S15K 3FKIA 4X6AC 1XXBA 3S16C 1ALJA 2JA6K 4P5BA 4A3GK 3N3YA 1IQ0A 4ZG7A 1Y1WC 1E33P 4B56A 2IUCA 3IPJA 5CHPA 3FHZA 3L4JA 1E3CP 3KD8A 1I50K 2BE5A 1DD5A 4GTEA 1WSVA 1WORA 4LRFA 2FQTA 1GE9A 4BXXK 3PO3C 1J6VA 4P5AA 3SZYA 4G0UA 1DCOA 3M7VA 5LRMA 4YR1A 1SHQA 4KATA 2VUMK 2EBBA 3HOWC 3AD8C 3H0GC 1WOOA 1O99A 1SFOK 4A3LC 1TWHA 1AJDA 3BDGA 4OINA 4M1XA 1HI9A 1ZVUA 1VGXA 1Y1WK 2R7ZK 3NVLA 3RZDC 4GZYA 4DDQA 5M5XK 3WAYA 1J6XA 3GTOC 5IP7K 2JA6A 4GTYA 4LLGA 4LK1A 3GTGK 1Y7AA 3UN2A 4CYSA 1IBAA 4O2DA 4GT9A 1Y1VC 1WOSA 1EW8A 2W8SA 3UO0A 3HOYC 2E2HA 1K83A 1O98A 4KMUA 1KH7A 1XZPB 3FOEA 1ZQ1C 1X31C 4LR9A 1XPPA 1VRQC 5IJSA 3GTKK 4MEYA 2D1GA 3GTMK 1O29A 4ZH4A 1R9TK 2JA7A 4C3HC 2R92K 3S0XA 3BDGB 4AYBL 4WJ4A 5IP7C 3NUHA 3MK0A 2Y0SD 2GSUA 2NVYA 1HDHA 3IDDA 1XZQB 4MY4A 4C3IK 4XSXA 1XXCA 4RMFA 3CMRA 3HXAA 4OIRA 3TTGA 4A3DC 2JA5K 1Y1VA 4A3BC 4BLAA 2E2HC 4LRCA 2G9YA 5E68A 3TFJA 2JH3A 2E2IC 1PJ5A 2A6HA 3OPFA 2R93K 3WBHA 3PO2K 3GTOA 1YNJA 3M3YC 4BKWA 5JVOA 3M8WA 4XLNA 4A3IK 3HOVC 3NKPA 5EGHA 3IGYB 3I4MC 1WCMC 1V5VA 4KB2A 3S14K 4KARA 5L46A 3S1MK 1SHNA 2QZUA 4G0VA 2GSOA 1TWHC 2W5RA 1B8JA 4ZG9A 4KN4A 5IJQA 2ZFZA 4NOIA 1IL2A 2R92C 4AYBD 4GTCA 3GTQA 4CXKA 4G7ZA 1KHJA 1K7HA 2XCQA 3S2HK 2E2IK 1ZBSA 1IW7A 4C3JC 3TX0A 3ERED 1URBA 4UOPA 1IE0A 4Y7NC 1KHLA 3S2DC 4BLBA 4KAYA 4Q4ZA 3A52A 3A8KA 3LXQA 5IP9C 2W5WA 3GSIA 3LAJA 4UOOA 4C2MC 1WQHA 3S1RC 2B63A 3H3VD 1TWAC 3S14C 3GTLA 3S1MC 1EFWA 3I4NK 1HJKA 3GDZA 5AJ9A 4KN7A 1USOA 4YFNA 4PAAA 2JA5A 5IYDK 3GEEA 5JFEA 1YX2A 3S2HC 2ZUFA 3M4OK 4ILDA 2R7ZC 4BXXC 5D4DA 1KH4A 2P8TA 4LRDA 3IGZB 2YU9C 5IYCK 3HOWK 1PJ6A 1TWAK 1ISEA 2WAQD 5C3EK 4BBRK 2R92A 1JOEA 1FSUA 1TWCC 5M3FK 4XSZA 2PPBA 2V6TA 4MIVA 1F7UA 3S1NC 3GEIA 4BY7C 5IYDC 1RU0A 2V6SA 2IUCB 3S1RK 2ANHA 2W7VA 5HL8A 3PO3K 2PA8D 2A68A 1ELXA 1R9TA 3Q3QA 2JA7K 3I4NC 3OEPA 1TWAA 2B63C 1Y6VA 3HOXK 1URAA 1VH2A 2FQOA 4A3CK 4G7OA 4BBRC 3M4OC 4UORA 5C4XK 5LQQA 4KB4A 4A3EC 2GLQA 4ZG6A 4UPKA 2GAGC 1F9NA 4GTDA 1ANJA 3BDHA 1INNA 1N2KA 3S1QC 4BY1K 1G51A 3RZDK 5C3EC 5FJ8K 2JA6C 3FKIC 4LR2A 1KH9A 5LRNA 4LQYA 2XR9A 1IS1A 4LR8A 4TN0A 4LR7A 2RGRA 1DCPA 3UN3A 1AB4A 1EK8A 3A8JA 2B63K 3TWZA 4A93K 4PABA 1O27A 1O2AA 2CFAB 3GTPC 1TWGA 1WCMK 1O2BA 4FZBA 4P9SA 3CAGA 3S17C 5M3MK 4ZGAA 5C4JK 4Y52K 3TG0A 3SZZA 3HOXC 2NVTK 1E2SP 5IYBC 3M3YK 4CYRA 3GTGA 4KDDA 3G4CA 4BY1C 4QIWL 1J6WA 1WQFA 3WODA 3QX3A 3RZOK 4A3CC 2PMZL 4LRAA 5C44K 1TWGC 5IOSA 4A3EK 3CQZA 1ZEFA 5C4XC 1WCMA 3NKQA 2R7ZA 2JA8K 3LPXA 2XCRB 4GTWA 4NWXA 4C2MK 3CQZK 3GTQK 2A6EA 4A3FC 3S17K 3ED4A 1EH1A 4Q5SA 5GRRA 2W5QA 4A3GC 2E2IA 4OIQA 4WJ3M 4GTLA 3M8ZA 2E2JC 1ZXOA 5TMCA 2KWAA 3PO2C 4WILA 3H0GK 4MQ9A 4KM4A 5C66A 4KJGA 1F93A 2GSNA 3K7AK 4A3IC 3HOVK 1I50A 3GTPA 1AJBA 3HKZD 4N7TA 4Y52C 5C4JC 4GTAA 3GTJK 1B4BA 5EGEA 4OIPA 3GTMC 1EJJA 1ALKA 3MMLB 3NKRA 2GA3A 2VUMC 1TWHK 3RZOC 2W5TA 1WQGA 3GTQC 1ZEDA 4A3FK 3E2DA 1ALHA 3GTLK 3LAPA 5KXAA 2JA8C 1JVIA 1Y1VK 1ED9A 4A3JC 3S15C 4X6AK 4GTFA 1SFOA 1K83C 2GAHC 4KJDA 3GEHA 3CQZC 5K4PA 2CFAA 3GTOK 2RH6A 2V6UA 3AD7C 3HOZC 1TWFA 4GTBA 4LREA 3AQOA 3G4AA 1I50C 3T02A 1R9TC 5IOTA 5M5YK 3L4KA 1C0AA 3BDFA 3T00A 2CW0A 4KC6A 4KMDA 3WAXA 4QAXA 1AUKA 3GTKA 5TJ3A 2X98A 2E2HK 4GTZA 2W5SA 2Y3PA 2PHCB 5L0KA 4C3IC 3GTKC 3HKZL 3V4GA 2W5XA 1KQ4A 1O25A 1K83K 1O2FB 4YFXA 3FKIK 4CXUA 4KASA 5M5WK 4A3BK 3GTMA 5DLVA 2YU9K 1JQWA 5IYCC 2VQRA 4FDIA 2VUMA 3HOZK 2IFYA 1L0WA 1ZYRA 4KAWX 4Y7NK 4BBSC 3FOFA 2O5IA 5INHA 1EW9A 2XRGA 4MHXA 2WB1D 2NVXK 4XCHA 1I3QK 1BJTA 1YNNA 1I6HK 2D6FC 1ZEBA 3H3VL 1O26A 1O24A 3BP3A 2JA5C 1AJAA 4QJVB 1O28A 1UV7A 4BY7K 2NVYK 4NWJA 4KMHA 1BGWA 2R93C 1ED8A 2PA8L 3DXJA 4G0WA 1PJ7A 1WIHA 4LOWA 1ELZA 3DYCA 4LRBA 4A93C 3WAWA 3GTJA 3N0CA 1KHNA 4GTXA 3HOUC 3GIRA 3TFHA 3ADAC 1J98A 4C3HK 3AH5A 1KH5A 3S2DK 4C45A 1USMA 4A3KK 1BDFA 2NVXC 2ZUEA 3UN5A 2WAQL 1XZQA 1TWFC 2PMZD 3AD9C 5IP9K 3N0BA 1I6HC 4FDJA 4QIWD 3T01A 1XXAA 4JK1A 3GTGC 3S1QK 2ZKTA 5L0EA 4YFKA 3JSTA 4BBSK 4KM8A 5IOQA 5C44C 2NVXA 3MK1A 4C3JK 1KHKA 3HOYK
chains in the Genus database with same CATH topology
3MK2A 3BDGA 1E1ZP 4KM4A 5C66A 4KJGA 1KH4A 3NVLA 1AJCA 1AJBA 2GSNA 3WAYA 4N7TA 1ELYA 5EGEA 1EJJA 3NKMA 3IGZB 4LRDA 5LIAA 1ALKA 4UPLA 3NKRA 4GTYA 2GA3A 1HQAA 2W5TA 4KAVA 1Y7AA 3UN2A 1ZEDA 1N2LA 3UNYA 4CYSA 3NKNA 1EW8A 2W8SA 3E2DA 3UO0A 1ALHA 1FSUA 1O98A 4MIVA 1P49A 1KH7A 5KXAA 5HRTA 1ED9A 4UPIA 5IJSA 2W5VA 2IUCB 4KJDA 5K4PA 2ANHA 2D1GA 2RH6A 1EI6A 1ELXA 3Q3QA 3BDGB 2W8DA 4LREA 1Y6VA 3T02A 1URAA 3MK0A 3NKOA 3B5QA 2GSUA 1HDHA 3BDFA 3T00A 3IDDA 4MY4A 3WAXA 4QAXA 4UORA 1AUKA 5GOVA 5DLWA 2X98A 5TJ3A 4GTZA 3CMRA 5LQQA 2W5SA 2GLQA 3M8YA 4ZG6A 4UPKA 5L0KA 1ANJA 3BDHA 2W5XA 1N2KA 4LRCA 2G9YA 3WBHA 4LR2A 4CXUA 1KH9A 5LRNA 4LQYA 4CXSA 2XR9A 5DLVA 2VQRA 4LR8A 4FDIA 4TN0A 4LR7A 1ALIA 2IFYA 3UN3A 3M8WA 3TWZA 5INHA 3NKPA 1EW9A 1EW2A 1EQJA 2XRGA 3IGYB 4MHXA 4UPHA 5EGHA 3WAVA 3DPCA 1SHNA 3OT9A 1ZEBA 2QZUA 1ANIA 2GSOA 4ZG9A 2W5RA 1B8JA 5L0BA 5DLTA 4ZGAA 1AJAA 3TG0A 3SZZA 5IJQA 1E2SP 4NWJA 4CXKA 1ALJA 1ED8A 4CYRA 1KHJA 4ZG7A 1K7HA 4LRAA 1E33P 3WAWA 4B56A 4LRBA 1ELZA 2IUCA 3DYCA 1URBA 4UOPA 3TX0A 1E3CP 1KHLA 3KD8A 4KAYA 1KHNA 4GTXA 1ZEFA 3NKQA 3A52A 4LRFA 3LXQA 2W5WA 1KH5A 4GTWA 4UOOA 4NWXA 3SZYA 3M7VA 5LRMA 3UN5A 4YR1A 1SHQA 4FDJA 3ED4A 5GRRA 2W5QA 3T01A 1HJKA 2ZKTA 5AJ9A 5L0EA 1O99A 3M8ZA 1AJDA 3MK1A 1KHKA 4LR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MK2 A;  3BDG A;  1E1Z P;  4KM4 A;  5C66 A;  4KJG A;  1KH4 A;  3NVL A;  1AJC A;  1AJB A;  2GSN A;  3WAY A;  4N7T A;  1ELY A;  5EGE A;  1EJJ A;  3NKM A;  3IGZ B;  4LRD A;  5LIA A;  1ALK A;  4UPL A;  3NKR A;  4GTY A;  2GA3 A;  1HQA A;  2W5T A;  4KAV A;  1Y7A A;  3UN2 A;  1ZED A;  1N2L A;  3UNY A;  4CYS A;  3NKN A;  1EW8 A;  2W8S A;  3E2D A;  3UO0 A;  1ALH A;  1FSU A;  1O98 A;  4MIV A;  1P49 A;  1KH7 A;  5KXA A;  5HRT A;  1ED9 A;  4UPI A;  5IJS A;  2W5V A;  2IUC B;  4KJD A;  5K4P A;  2ANH A;  2D1G A;  2RH6 A;  1EI6 A;  1ELX A;  3Q3Q A;  3BDG B;  2W8D A;  4LRE A;  1Y6V A;  3T02 A;  1URA A;  3MK0 A;  3NKO A;  3B5Q A;  2GSU A;  1HDH A;  3BDF A;  3T00 A;  3IDD A;  4MY4 A;  3WAX A;  4QAX A;  4UOR A;  1AUK A;  5GOV A;  5DLW A;  2X98 A;  5TJ3 A;  4GTZ A;  3CMR A;  5LQQ A;  2W5S A;  2GLQ A;  3M8Y A;  4ZG6 A;  4UPK A;  5L0K A;  1ANJ A;  3BDH A;  2W5X A;  1N2K A;  4LRC A;  2G9Y A;  3WBH A;  4LR2 A;  4CXU A;  1KH9 A;  5LRN A;  4LQY A;  4CXS A;  2XR9 A;  5DLV A;  2VQR A;  4LR8 A;  4FDI A;  4TN0 A;  4LR7 A;  1ALI A;  2IFY A;  3UN3 A;  3M8W A;  3TWZ A;  5INH A;  3NKP A;  1EW9 A;  1EW2 A;  1EQJ A;  2XRG A;  3IGY B;  4MHX A;  4UPH A;  5EGH A;  3WAV A;  3DPC A;  1SHN A;  3OT9 A;  1ZEB A;  2QZU A;  1ANI A;  2GSO A;  4ZG9 A;  2W5R A;  1B8J A;  5L0B A;  5DLT A;  4ZGA A;  1AJA A;  3TG0 A;  3SZZ A;  5IJQ A;  1E2S P;  4NWJ A;  4CXK A;  1ALJ A;  1ED8 A;  4CYR A;  1KHJ A;  4ZG7 A;  1K7H A;  4LRA A;  1E33 P;  3WAW A;  4B56 A;  4LRB A;  1ELZ A;  2IUC A;  3DYC A;  1URB A;  4UOP A;  3TX0 A;  1E3C P;  1KHL A;  3KD8 A;  4KAY A;  1KHN A;  4GTX A;  1ZEF A;  3NKQ A;  3A52 A;  4LRF A;  3LXQ A;  2W5W A;  1KH5 A;  4GTW A;  4UOO A;  4NWX A;  3SZY A;  3M7V A;  5LRM A;  3UN5 A;  4YR1 A;  1SHQ A;  4FDJ A;  3ED4 A;  5GRR A;  2W5Q A;  3T01 A;  1HJK A;  2ZKT A;  5AJ9 A;  5L0E A;  1O99 A;  3M8Z A;  1AJD A;  3MK1 A;  1KHK A;  4LR9 A; 
#chains in the Genus database with same CATH topology
 2NVQ K;  3A8I A;  3MK2 A;  1I3Q C;  1YCL A;  1E1Z P;  2WB1 L;  1AJC A;  1WOP A;  3AQP A;  2NVY C;  3TFI A;  3GTJ C;  1ELY A;  3NKM A;  5LIA A;  4UPL A;  2A69 A;  2JA7 C;  1HQA A;  4KAV A;  1N2L A;  3UNY A;  1TWF K;  3NKN A;  3ORE A;  4LK0 A;  4OIO A;  2E2J K;  2NVT C;  2R93 A;  4A3M K;  4AH6 A;  3GTL C;  5TMF A;  1DCH A;  1P49 A;  3HOU K;  5HRT A;  2XCO A;  1I3Q A;  3VA7 A;  1TWC A;  4UPI A;  1TWG K;  2W5V A;  1I6V A;  3EQL A;  5FLM C;  4A3K C;  4A3D K;  2P5M A;  4KM9 A;  1EI6 A;  1XZP A;  4G7H A;  2YU9 A;  2W8D A;  1B4A A;  4FM9 A;  3S16 K;  4LJZ A;  3NKO A;  3B5Q A;  1TWC K;  1HQM A;  2NVQ C;  1WSR A;  3BP8 C;  3GTP K;  5GOV A;  4A3J K;  5DLW A;  3S1N K;  3I4M K;  5IOR A;  1SMY A;  3M8Y A;  3H0G A;  4GFQ A;  4KMA A;  3K7A C;  5FLM K;  4CXS A;  1BS2 A;  1ALI A;  4A3M C;  4J3N A;  3BUE A;  4QJV A;  1F7V A;  1SFO C;  4A3L K;  1VJE A;  4YG2 A;  1EQR A;  1EW2 A;  4MEX A;  1EQJ A;  4UPH A;  5CJ9 A;  4XLP A;  3WAV A;  3DPC A;  1ANI A;  5IYB K;  3OT9 A;  2O5J A;  5L0B A;  5DLT A;  1Y1W A;  2Y0S L;  1VLO A;  3S15 K;  3FKI A;  4X6A C;  1XXB A;  3S16 C;  1ALJ A;  2JA6 K;  4P5B A;  4A3G K;  3N3Y A;  1IQ0 A;  4ZG7 A;  1Y1W C;  1E33 P;  4B56 A;  2IUC A;  3IPJ A;  5CHP A;  3FHZ A;  3L4J A;  1E3C P;  3KD8 A;  1I50 K;  2BE5 A;  1DD5 A;  4GTE A;  1WSV A;  1WOR A;  4LRF A;  2FQT A;  1GE9 A;  4BXX K;  3PO3 C;  1J6V A;  4P5A A;  3SZY A;  4G0U A;  1DCO A;  3M7V A;  5LRM A;  4YR1 A;  1SHQ A;  4KAT A;  2VUM K;  2EBB A;  3HOW C;  3AD8 C;  3H0G C;  1WOO A;  1O99 A;  1SFO K;  4A3L C;  1TWH A;  1AJD A;  3BDG A;  4OIN A;  4M1X A;  1HI9 A;  1ZVU A;  1VGX A;  1Y1W K;  2R7Z K;  3NVL A;  3RZD C;  4GZY A;  4DDQ A;  5M5X K;  3WAY A;  1J6X A;  3GTO C;  5IP7 K;  2JA6 A;  4GTY A;  4LLG A;  4LK1 A;  3GTG K;  1Y7A A;  3UN2 A;  4CYS A;  1IBA A;  4O2D A;  4GT9 A;  1Y1V C;  1WOS A;  1EW8 A;  2W8S A;  3UO0 A;  3HOY C;  2E2H A;  1K83 A;  1O98 A;  4KMU A;  1KH7 A;  1XZP B;  3FOE A;  1ZQ1 C;  1X31 C;  4LR9 A;  1XPP A;  1VRQ C;  5IJS A;  3GTK K;  4MEY A;  2D1G A;  3GTM K;  1O29 A;  4ZH4 A;  1R9T K;  2JA7 A;  4C3H C;  2R92 K;  3S0X A;  3BDG B;  4AYB L;  4WJ4 A;  5IP7 C;  3NUH A;  3MK0 A;  2Y0S D;  2GSU A;  2NVY A;  1HDH A;  3IDD A;  1XZQ B;  4MY4 A;  4C3I K;  4XSX A;  1XXC A;  4RMF A;  3CMR A;  3HXA A;  4OIR A;  3TTG A;  4A3D C;  2JA5 K;  1Y1V A;  4A3B C;  4BLA A;  2E2H C;  4LRC A;  2G9Y A;  5E68 A;  3TFJ A;  2JH3 A;  2E2I C;  1PJ5 A;  2A6H A;  3OPF A;  2R93 K;  3WBH A;  3PO2 K;  3GTO A;  1YNJ A;  3M3Y C;  4BKW A;  5JVO A;  3M8W A;  4XLN A;  4A3I K;  3HOV C;  3NKP A;  5EGH A;  3IGY B;  3I4M C;  1WCM C;  1V5V A;  4KB2 A;  3S14 K;  4KAR A;  5L46 A;  3S1M K;  1SHN A;  2QZU A;  4G0V A;  2GSO A;  1TWH C;  2W5R A;  1B8J A;  4ZG9 A;  4KN4 A;  5IJQ A;  2ZFZ A;  4NOI A;  1IL2 A;  2R92 C;  4AYB D;  4GTC A;  3GTQ A;  4CXK A;  4G7Z A;  1KHJ A;  1K7H A;  2XCQ A;  3S2H K;  2E2I K;  1ZBS A;  1IW7 A;  4C3J C;  3TX0 A;  3ERE D;  1URB A;  4UOP A;  1IE0 A;  4Y7N C;  1KHL A;  3S2D C;  4BLB A;  4KAY A;  4Q4Z A;  3A52 A;  3A8K A;  3LXQ A;  5IP9 C;  2W5W A;  3GSI A;  3LAJ A;  4UOO A;  4C2M C;  1WQH A;  3S1R C;  2B63 A;  3H3V D;  1TWA C;  3S14 C;  3GTL A;  3S1M C;  1EFW A;  3I4N K;  1HJK A;  3GDZ A;  5AJ9 A;  4KN7 A;  1USO A;  4YFN A;  4PAA A;  2JA5 A;  5IYD K;  3GEE A;  5JFE A;  1YX2 A;  3S2H C;  2ZUF A;  3M4O K;  4ILD A;  2R7Z C;  4BXX C;  5D4D A;  1KH4 A;  2P8T A;  4LRD A;  3IGZ B;  2YU9 C;  5IYC K;  3HOW K;  1PJ6 A;  1TWA K;  1ISE A;  2WAQ D;  5C3E K;  4BBR K;  2R92 A;  1JOE A;  1FSU A;  1TWC C;  5M3F K;  4XSZ A;  2PPB A;  2V6T A;  4MIV A;  1F7U A;  3S1N C;  3GEI A;  4BY7 C;  5IYD C;  1RU0 A;  2V6S A;  2IUC B;  3S1R K;  2ANH A;  2W7V A;  5HL8 A;  3PO3 K;  2PA8 D;  2A68 A;  1ELX A;  1R9T A;  3Q3Q A;  2JA7 K;  3I4N C;  3OEP A;  1TWA A;  2B63 C;  1Y6V A;  3HOX K;  1URA A;  1VH2 A;  2FQO A;  4A3C K;  4G7O A;  4BBR C;  3M4O C;  4UOR A;  5C4X K;  5LQQ A;  4KB4 A;  4A3E C;  2GLQ A;  4ZG6 A;  4UPK A;  2GAG C;  1F9N A;  4GTD A;  1ANJ A;  3BDH A;  1INN A;  1N2K A;  3S1Q C;  4BY1 K;  1G51 A;  3RZD K;  5C3E C;  5FJ8 K;  2JA6 C;  3FKI C;  4LR2 A;  1KH9 A;  5LRN A;  4LQY A;  2XR9 A;  1IS1 A;  4LR8 A;  4TN0 A;  4LR7 A;  2RGR A;  1DCP A;  3UN3 A;  1AB4 A;  1EK8 A;  3A8J A;  2B63 K;  3TWZ A;  4A93 K;  4PAB A;  1O27 A;  1O2A A;  2CFA B;  3GTP C;  1TWG A;  1WCM K;  1O2B A;  4FZB A;  4P9S A;  3CAG A;  3S17 C;  5M3M K;  4ZGA A;  5C4J K;  4Y52 K;  3TG0 A;  3SZZ A;  3HOX C;  2NVT K;  1E2S P;  5IYB C;  3M3Y K;  4CYR A;  3GTG A;  4KDD A;  3G4C A;  4BY1 C;  4QIW L;  1J6W A;  1WQF A;  3WOD A;  3QX3 A;  3RZO K;  4A3C C;  2PMZ L;  4LRA A;  5C44 K;  1TWG C;  5IOS A;  4A3E K;  3CQZ A;  1ZEF A;  5C4X C;  1WCM A;  3NKQ A;  2R7Z A;  2JA8 K;  3LPX A;  2XCR B;  4GTW A;  4NWX A;  4C2M K;  3CQZ K;  3GTQ K;  2A6E A;  4A3F C;  3S17 K;  3ED4 A;  1EH1 A;  4Q5S A;  5GRR A;  2W5Q A;  4A3G C;  2E2I A;  4OIQ A;  4WJ3 M;  4GTL A;  3M8Z A;  2E2J C;  1ZXO A;  5TMC A;  2KWA A;  3PO2 C;  4WIL A;  3H0G K;  4MQ9 A;  4KM4 A;  5C66 A;  4KJG A;  1F93 A;  2GSN A;  3K7A K;  4A3I C;  3HOV K;  1I50 A;  3GTP A;  1AJB A;  3HKZ D;  4N7T A;  4Y52 C;  5C4J C;  4GTA A;  3GTJ K;  1B4B A;  5EGE A;  4OIP A;  3GTM C;  1EJJ A;  1ALK A;  3MML B;  3NKR A;  2GA3 A;  2VUM C;  1TWH K;  3RZO C;  2W5T A;  1WQG A;  3GTQ C;  1ZED A;  4A3F K;  3E2D A;  1ALH A;  3GTL K;  3LAP A;  5KXA A;  2JA8 C;  1JVI A;  1Y1V K;  1ED9 A;  4A3J C;  3S15 C;  4X6A K;  4GTF A;  1SFO A;  1K83 C;  2GAH C;  4KJD A;  3GEH A;  3CQZ C;  5K4P A;  2CFA A;  3GTO K;  2RH6 A;  2V6U A;  3AD7 C;  3HOZ C;  1TWF A;  4GTB A;  4LRE A;  3AQO A;  3G4A A;  1I50 C;  3T02 A;  1R9T C;  5IOT A;  5M5Y K;  3L4K A;  1C0A A;  3BDF A;  3T00 A;  2CW0 A;  4KC6 A;  4KMD A;  3WAX A;  4QAX A;  1AUK A;  3GTK A;  5TJ3 A;  2X98 A;  2E2H K;  4GTZ A;  2W5S A;  2Y3P A;  2PHC B;  5L0K A;  4C3I C;  3GTK C;  3HKZ L;  3V4G A;  2W5X A;  1KQ4 A;  1O25 A;  1K83 K;  1O2F B;  4YFX A;  3FKI K;  4CXU A;  4KAS A;  5M5W K;  4A3B K;  3GTM A;  5DLV A;  2YU9 K;  1JQW A;  5IYC C;  2VQR A;  4FDI A;  2VUM A;  3HOZ K;  2IFY A;  1L0W A;  1ZYR A;  4KAW X;  4Y7N K;  4BBS C;  3FOF A;  2O5I A;  5INH A;  1EW9 A;  2XRG A;  4MHX A;  2WB1 D;  2NVX K;  4XCH A;  1I3Q K;  1BJT A;  1YNN A;  1I6H K;  2D6F C;  1ZEB A;  3H3V L;  1O26 A;  1O24 A;  3BP3 A;  2JA5 C;  1AJA A;  4QJV B;  1O28 A;  1UV7 A;  4BY7 K;  2NVY K;  4NWJ A;  4KMH A;  1BGW A;  2R93 C;  1ED8 A;  2PA8 L;  3DXJ A;  4G0W A;  1PJ7 A;  1WIH A;  4LOW A;  1ELZ A;  3DYC A;  4LRB A;  4A93 C;  3WAW A;  3GTJ A;  3N0C A;  1KHN A;  4GTX A;  3HOU C;  3GIR A;  3TFH A;  3ADA C;  1J98 A;  4C3H K;  3AH5 A;  1KH5 A;  3S2D K;  4C45 A;  1USM A;  4A3K K;  1BDF A;  2NVX C;  2ZUE A;  3UN5 A;  2WAQ L;  1XZQ A;  1TWF C;  2PMZ D;  3AD9 C;  5IP9 K;  3N0B A;  1I6H C;  4FDJ A;  4QIW D;  3T01 A;  1XXA A;  4JK1 A;  3GTG C;  3S1Q K;  2ZKT A;  5L0E A;  4YFK A;  3JST A;  4BBS K;  4KM8 A;  5IOQ A;  5C44 C;  2NVX A;  3MK1 A;  4C3J K;  1KHK A;  3HOY K; 
#chains in the Genus database with same CATH homology
 3MK2 A;  3BDG A;  1E1Z P;  4KM4 A;  5C66 A;  4KJG A;  1KH4 A;  3NVL A;  1AJC A;  1AJB A;  2GSN A;  3WAY A;  4N7T A;  1ELY A;  5EGE A;  1EJJ A;  3NKM A;  3IGZ B;  4LRD A;  5LIA A;  1ALK A;  4UPL A;  3NKR A;  4GTY A;  2GA3 A;  1HQA A;  2W5T A;  4KAV A;  1Y7A A;  3UN2 A;  1ZED A;  1N2L A;  3UNY A;  4CYS A;  3NKN A;  1EW8 A;  2W8S A;  3E2D A;  3UO0 A;  1ALH A;  1FSU A;  1O98 A;  4MIV A;  1P49 A;  1KH7 A;  5KXA A;  5HRT A;  1ED9 A;  4UPI A;  5IJS A;  2W5V A;  2IUC B;  4KJD A;  5K4P A;  2ANH A;  2D1G A;  2RH6 A;  1EI6 A;  1ELX A;  3Q3Q A;  3BDG B;  2W8D A;  4LRE A;  1Y6V A;  3T02 A;  1URA A;  3MK0 A;  3NKO A;  3B5Q A;  2GSU A;  1HDH A;  3BDF A;  3T00 A;  3IDD A;  4MY4 A;  3WAX A;  4QAX A;  4UOR A;  1AUK A;  5GOV A;  5DLW A;  2X98 A;  5TJ3 A;  4GTZ A;  3CMR A;  5LQQ A;  2W5S A;  2GLQ A;  3M8Y A;  4ZG6 A;  4UPK A;  5L0K A;  1ANJ A;  3BDH A;  2W5X A;  1N2K A;  4LRC A;  2G9Y A;  3WBH A;  4LR2 A;  4CXU A;  1KH9 A;  5LRN A;  4LQY A;  4CXS A;  2XR9 A;  5DLV A;  2VQR A;  4LR8 A;  4FDI A;  4TN0 A;  4LR7 A;  1ALI A;  2IFY A;  3UN3 A;  3M8W A;  3TWZ A;  5INH A;  3NKP A;  1EW9 A;  1EW2 A;  1EQJ A;  2XRG A;  3IGY B;  4MHX A;  4UPH A;  5EGH A;  3WAV A;  3DPC A;  1SHN A;  3OT9 A;  1ZEB A;  2QZU A;  1ANI A;  2GSO A;  4ZG9 A;  2W5R A;  1B8J A;  5L0B A;  5DLT A;  4ZGA A;  1AJA A;  3TG0 A;  3SZZ A;  5IJQ A;  1E2S P;  4NWJ A;  4CXK A;  1ALJ A;  1ED8 A;  4CYR A;  1KHJ A;  4ZG7 A;  1K7H A;  4LRA A;  1E33 P;  3WAW A;  4B56 A;  4LRB A;  1ELZ A;  2IUC A;  3DYC A;  1URB A;  4UOP A;  3TX0 A;  1E3C P;  1KHL A;  3KD8 A;  4KAY A;  1KHN A;  4GTX A;  1ZEF A;  3NKQ A;  3A52 A;  4LRF A;  3LXQ A;  2W5W A;  1KH5 A;  4GTW A;  4UOO A;  4NWX A;  3SZY A;  3M7V A;  5LRM A;  3UN5 A;  4YR1 A;  1SHQ A;  4FDJ A;  3ED4 A;  5GRR A;  2W5Q A;  3T01 A;  1HJK A;  2ZKT A;  5AJ9 A;  5L0E A;  1O99 A;  3M8Z A;  1AJD A;  3MK1 A;  1KHK A;  4LR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...