1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords PHOSPHONOACETATE HYDROLASE
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
2GSOA 4QAXA 4CYRA 1ALIA 2GA3A 2W5XA 4KM4A 3UN5A 4KJDA 1Y6VA 2W5SA 2W5QA 3WAVA 2IUCB 3IDDA 1ANJA 2ANHA 3BDFA 4LQYA 4ZGAA 5DLVA 3TG0A 4NWXA 1Y7AA 2IUCA 5TJ3A 2G9YA 1EI6A 1ELZA 2W5TA 1E3CP 4LRCA 3WAWA 3M7VA 4N7TA 1EQJA 4LRBA 3UN2A 3A52A 4FDJA 4TN0A 1ELYA 3BDGA 3BDHA 3OT9A 4LRAA 5K4PA 3TX0A 3SZYA 5HRTA 3MK2A 4LR8A 1KH9A 3T02A 3CMRA 1AJCA 1E33P 4B56A 1HJKA 3KD8A 3SZZA 4FDIA 4KAVA 5DLTA 3UNYA 4GTWA 3LXQA 2X98A 4UOOA 1SHNA 1ELXA 4LRDA 2W8SA 1E2SP 5L0KA 1P49A 1KHLA 2ZKTA 3NKQA 1O98A 2QZUA 5INHA 5EGEA 5L0EA 4LREA 5GOVA 1K7HA 3M8WA 3WAXA 2RH6A 3NVLA 1EW8A 1E1ZP 3IGZB 1ZEDA 3TWZA 3DPCA 4CXKA 1ZEBA 4NWJA 4UPLA 1ALJA 4LR7A 5EGHA 3NKOA 3NKRA 3NKNA 1AJDA 4ZG6A 1ALKA 1ALHA 5AJ9A 4GTXA 1FSUA 4YR1A 1N2KA 2IFYA 1KH4A 1KHJA 4LRFA 1HDHA 1EW2A 1URAA 1KH5A 1SHQA 3BDGB 4CYSA 5LIAA 5KXAA 2GLQA 5LQQA 4GTYA 1HQAA 4UORA 2GSUA 3T01A 3M8YA 1ED9A 4MIVA 4LR2A 5IJQA 5GRRA 2D1GA 1AUKA 3T00A 4UOPA 3DYCA 1O99A 2XR9A 5DLWA 2XRGA 4ZG7A 1URBA 3IGYB 3NKPA 4UPHA 2VQRA 3UN3A 5C66A 4ZG9A 4LR9A 4CXSA 3M8ZA 1ED8A 3B5QA 1AJAA 4KJGA 2W5VA 1ANIA 3NKMA 3E2DA 3WBHA 5IJSA 1N2LA 4UPIA 1AJBA 2W8DA 3MK0A 5L0BA 3UO0A 5LRMA 1EJJA 4CXUA 4MHXA 1EW9A 3ED4A 4KAYA 4GTZA 2GSNA 2W5WA 1ZEFA 5LRNA 3Q3QA 4MY4A 1B8JA 1KHKA 4UPKA 3WAYA 1KHNA 1KH7A 2W5RA 3MK1A
chains in the Genus database with same CATH superfamily
5CJ9A 4BBSK 3H0GK 2E2JC 3H0GA 3UN5A 4KJDA 1R9TK 2W5SA 2W5QA 3IDDA 5JVOA 2YU9A 4LQYA 4ZGAA 4G7OA 2G9YA 2W5TA 1ZBSA 3HKZL 4LRCA 1DCPA 1J6VA 3G4CA 5IYCK 3S2DK 4G7HA 3K7AC 3M7VA 3FOEA 5IP7K 3A52A 1F7UA 1F7VA 4ILDA 1WOPA 3GTOA 5C4XK 4KMHA 1ZVUA 4XSZA 1O2FB 3SZYA 3MK2A 2WB1D 4YFNA 3GSIA 5C3EK 2PMZD 2V6SA 1TWAK 1KH9A 4B56A 1JOEA 1USMA 3KD8A 2EBBA 4Y52C 4KB2A 4A93C 3GDZA 2B63C 4KMUA 3LXQA 3HOVK 1WQHA 4QJVB 4LRDA 5IP9C 2E2IC 2JA7K 4G7ZA 2A6EA 1KHLA 2KWAA 5C4JC 2JA8C 1TWCK 1PJ5A 5D4DA 3GTJC 5M5YK 5L0EA 4KAWX 5TMCA 2NVXA 4LK1A 2PHCB 5GOVA 1VJEA 1F9NA 1K7HA 3M8WA 1IS1A 1O29A 2RH6A 3IGZB 4LJZA 1G51A 4CXKA 4NOIA 5IOSA 1VH2A 4A3EC 1SMYA 1TWGC 3S1RC 3NKNA 5FJ8K 1ALHA 1I6HC 4A3BC 1FSUA 2JA6C 1ISEA 3BP8C 1EFWA 4LOWA 4AYBD 2E2HC 3S14C 1SHQA 1ZXOA 4XLPA 4C3HK 4BXXC 5KXAA 1USOA 2GLQA 2A69A 4C3JK 2R7ZK 1XZPA 1IQ0A 4UORA 5M3MK 2NVTC 4GTEA 1TWHA 2VUMC 3M8YA 5GRRA 3WODA 4KC6A 3PO2K 4GTFA 1WORA 4MEYA 3GTJA 3FOFA 2VQRA 3UN3A 4ZG9A 4C2MK 3H3VD 1X31C 2E2IA 3GTLC 1AJAA 2RGRA 1ANIA 3NUHA 4C3IC 5FLMC 4A3CK 4KASA 3TFHA 4Y7NK 3QX3A 4WJ3M 4A3FC 3S2HC 2JA7A 1Y1WK 2GAGC 4KN4A 4WJ4A 3ED4A 1GE9A 1ZEFA 3PO3K 3FKIC 4UPKA 3AD7C 1KHNA 1KH7A 4X6AK 5IOQA 3I4MK 4BY7K 3HOUK 1WCMK 2W5XA 4PABA 4KM4A 1YNJA 2Y0SL 2JA5A 3WAVA 3GTOK 1IW7A 2P5MA 2R93K 2IUCA 3AD9C 4AYBL 1PJ6A 3S1QK 1XXBA 1O2BA 4A3DC 1B4AA 1EQJA 3G4AA 1WQFA 1SFOC 2YU9K 2CW0A 3GTMC 1WIHA 2NVQC 1O24A 3TX0A 3EQLA 3GTQA 5HRTA 1Y1VC 3GTGC 2XCRB 1XXAA 3L4JA 3HOYK 3S1MC 3T02A 2PA8L 1AJCA 4OIRA 1TWFK 2O5JA 1PJ7A 3SZZA 4FDIA 5M5XK 4BBSC 4KAVA 3UNYA 2BE5A 2E2JK 3GTGA 3GTPC 4A3IC 1I50K 4KM9A 2O5IA 3CAGA 4GT9A 3I4NC 1E2SP 3CQZA 2JA6A 2R92C 2QZUA 3BUEA 4A3KC 4A3MC 3RZDK 4A3JC 3GIRA 2PPBA 5M3FK 5IYCC 1I50A 4GZYA 3S16C 3S2DC 3NVLA 3M3YK 4AH6A 5C44C 2WB1L 3GEHA 4MEXA 3GTKC 3GTMA 5L46A 1AB4A 3LAPA 1SFOA 4BBRC 1TWFA 5C4XC 1AJDA 4J3NA 3RZOK 1ALKA 1KQ4A 2CFAA 4A3LK 5IYBC 5C3EC 4YR1A 1YCLA 3AQPA 3N3YA 4KB4A 4BLBA 1O2AA 2B63A 1EW2A 3FKIA 1KH5A 4JK1A 4KATA 3S1NC 3OPFA 2GSUA 2ZFZA 5IP9K 2E2IK 2JA7C 1ED9A 5IJQA 4LR2A 2JA8K 2XCQA 4LLGA 4MQ9A 3ADAC 2R93A 2D1GA 4UOPA 5DLVA 3GTJK 3OEPA 3TFJA 5C66A 3AD8C 1VRQC 4A3GC 1BDFA 4CXSA 1RU0A 3H3VL 3B5QA 2W5VA 4A3EK 3M4OK 1TWGK 1DCOA 1I3QK 3LPXA 3HOWC 4KDDA 1ZQ1C 3MK0A 3GTQK 3S0XA 1I6HK 1V5VA 2NVYK 4KMAA 2VUMA 3GTLA 3AQOA 4G0VA 1EW9A 2FQOA 4QIWD 4OIOA 2R92A 4KAYA 4GTZA 4P5BA 5LRNA 3Q3QA 3BP3A 4KMDA 4BY1C 1JVIA 3CQZC 3N0CA 4C3HC 1B8JA 3WAYA 4C3JC 2R7ZC 3S17C 2GSOA 1TWHC 3S15C 5IYDK 4QAXA 3A8KA 3HXAA 1L0WA 4FZBA 1J98A 3HOXC 4CYRA 2GA3A 1C0AA 1WCMA 4BLAA 3K7AK 3BDFA 1JQWA 1Y7AA 4NWXA 1EI6A 5HL8A 3ERED 3GTLK 1E3CP 1WOOA 1IE0A 1R9TC 4GTDA 5CHPA 4C3IK 3HOZK 3WAWA 4Y7NC 3MMLB 4A3FK 3S2HK 3LAJA 3BDHA 1O28A 4LRAA 2XCOA 5IP7C 4A93K 5TMFA 2JA5C 2A6HA 2PA8D 1HJKA 1J6XA 1I6VA 3HOUC 4GTWA 4XSXA 1WCMC 2X98A 4UOOA 1SHNA 2V6TA 1ELXA 2W8SA 5L0KA 1P49A 4KARA 4GTLA 3GTOC 2NVXK 3NKQA 1O25A 1DD5A 1TWCA 4P5AA 2R93C 2R7ZA 5INHA 1BS2A 3S1RK 1K83K 3TWZA 4G0WA 3DPCA 1TWCC 1ZEBA 4NWJA 1ALJA 5EGHA 3GTMK 4ZG6A 1WSRA 5AJ9A 1WOSA 1N2KA 3HOYC 3S1MK 4BXXK 2IFYA 3HKZD 3V4GA 4XCHA 4M1XA 4OINA 2JH3A 1KHJA 1TWFC 4A3BK 5IORA 4CYSA 5LIAA 1O26A 1XPPA 5LQQA 3GTPK 4GTYA 1HQAA 2E2HK 2WAQD 3H0GC 3I4NK 4C2MC 1O27A 3T00A 1AUKA 4YG2A 2XR9A 3DYCA 2XRGA 1URBA 3NKPA 5FLMK 3RZDC 4UPHA 4A3JK 3OREA 2VUMK 4Q4ZA 1F93A 2NVYA 3S16K 3PO2C 4LR9A 1ED8A 5C44K 1IBAA 1WQGA 1K83A 5IJSA 2A68A 3E2DA 1TWGA 4UPIA 1Y1WC 1AJBA 1XZQB 2Y0SD 5LRMA 3PO3C 5IYBK 4CXUA 5IOTA 4DDQA 3I4MC 3A8IA 4GTAA 1TWAC 3AH5A 4MY4A 1KHKA 1B4BA 2W5RA 3TTGA 4Y52K 2Y3PA 2B63K 3FHZA 1XZPB 1R9TA 3HOVC 2WAQL 1ALIA 2V6UA 1Y6VA 3S1QC 4Q5SA 4BY7C 2IUCB 5C4JK 1UV7A 1ANJA 2ANHA 3TG0A 4GFQA 5TJ3A 1ELZA 1BJTA 1SFOK 3M4OC 4GTBA 4N7TA 3GEIA 1Y1VK 4YFXA 2FQTA 4LRBA 3UN2A 4FDJA 2ZUFA 4TN0A 2CFAB 1ELYA 3BDGA 3OT9A 5K4PA 2JA6K 4LR8A 2W7VA 1IL2A 2YU9C 3CQZK 3CMRA 4A3IK 1E33P 3S14K 4G0UA 5JFEA 2PMZL 1TWHK 3GEEA 5IYDC 3GTGK 3S15K 5DLTA 2R92K 3HOXK 2D6FC 4A3KK 4A3MK 1YNNA 2NVTK 1VGXA 2ZKTA 3GTKA 1O98A 3M3YC 5EGEA 1HQMA 4QIWL 3GTKK 1VLOA 4LREA 1I50C 4XLNA 1I3QA 1EQRA 4BBRK 3WAXA 3HOZC 3N0BA 1EW8A 4LK0A 1E1ZP 4C45A 1ZEDA 3TFIA 4P9SA 1YX2A 1J6WA 4UPLA 4A3CC 4YFKA 4LR7A 3NKOA 3NKRA 1WSVA 3GTPA 4GTXA 1EH1A 1XXCA 4OIQA 1INNA 3IPJA 4O2DA 1EK8A 2JA5K 3S1NK 3RZOC 1KH4A 4LRFA 1HDHA 3A8JA 4A3LC 1URAA 3FKIK 3BDGB 1XZQA 4X6AC 1HI9A 3VA7A 3T01A 4KN7A 4MIVA 2ZUEA 2NVXC 4ZG7A 1O99A 5DLWA 3DXJA 3IGYB 2GAHC 5E68A 4KM8A 1Y1WA 1TWAA 3HOWK 1K83C 4ZH4A 3M8ZA 2E2HA 4FM9A 5M5WK 2NVYC 4KJGA 4A3DK 3NKMA 1BGWA 3WBHA 1N2LA 4A3GK 2W8DA 5L0BA 3UO0A 4OIPA 4BY1K 3L4KA 1EJJA 4RMFA 1ZYRA 2NVQK 4MHXA 1I3QC 4PAAA 1Y1VA 3GTQC 4QJVA 3S17K 3JSTA 1DCHA 2GSNA 2W5WA 2P8TA 4WILA 4BKWA 4GTCA 3MK1A
chains in the Genus database with same CATH topology
2GSOA 4QAXA 4CYRA 1ALIA 2GA3A 2W5XA 4KM4A 3UN5A 4KJDA 1Y6VA 2W5SA 2W5QA 3WAVA 2IUCB 3IDDA 1ANJA 2ANHA 3BDFA 4LQYA 4ZGAA 5DLVA 3TG0A 4NWXA 1Y7AA 2IUCA 5TJ3A 2G9YA 1EI6A 1ELZA 2W5TA 1E3CP 4LRCA 3WAWA 3M7VA 4N7TA 1EQJA 4LRBA 3UN2A 3A52A 4FDJA 4TN0A 1ELYA 3BDGA 3BDHA 3OT9A 4LRAA 5K4PA 3TX0A 3SZYA 5HRTA 3MK2A 4LR8A 1KH9A 3T02A 3CMRA 1AJCA 1E33P 4B56A 1HJKA 3KD8A 3SZZA 4FDIA 4KAVA 5DLTA 3UNYA 4GTWA 3LXQA 2X98A 4UOOA 1SHNA 1ELXA 4LRDA 2W8SA 1E2SP 5L0KA 1P49A 1KHLA 2ZKTA 3NKQA 1O98A 2QZUA 5INHA 5EGEA 5L0EA 4LREA 5GOVA 1K7HA 3M8WA 3WAXA 2RH6A 3NVLA 1EW8A 1E1ZP 3IGZB 1ZEDA 3TWZA 3DPCA 4CXKA 1ZEBA 4NWJA 4UPLA 1ALJA 4LR7A 5EGHA 3NKOA 3NKRA 3NKNA 1AJDA 4ZG6A 1ALKA 1ALHA 5AJ9A 4GTXA 1FSUA 4YR1A 1N2KA 2IFYA 1KH4A 1KHJA 4LRFA 1HDHA 1EW2A 1URAA 1KH5A 1SHQA 3BDGB 4CYSA 5LIAA 5KXAA 2GLQA 5LQQA 4GTYA 1HQAA 4UORA 2GSUA 3T01A 3M8YA 1ED9A 4MIVA 4LR2A 5IJQA 5GRRA 2D1GA 1AUKA 3T00A 4UOPA 3DYCA 1O99A 2XR9A 5DLWA 2XRGA 4ZG7A 1URBA 3IGYB 3NKPA 4UPHA 2VQRA 3UN3A 5C66A 4ZG9A 4LR9A 4CXSA 3M8ZA 1ED8A 3B5QA 1AJAA 4KJGA 2W5VA 1ANIA 3NKMA 3E2DA 3WBHA 5IJSA 1N2LA 4UPIA 1AJBA 2W8DA 3MK0A 5L0BA 3UO0A 5LRMA 1EJJA 4CXUA 4MHXA 1EW9A 3ED4A 4KAYA 4GTZA 2GSNA 2W5WA 1ZEFA 5LRNA 3Q3QA 4MY4A 1B8JA 1KHKA 4UPKA 3WAYA 1KHNA 1KH7A 2W5RA 3MK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSO A;  4QAX A;  4CYR A;  1ALI A;  2GA3 A;  2W5X A;  4KM4 A;  3UN5 A;  4KJD A;  1Y6V A;  2W5S A;  2W5Q A;  3WAV A;  2IUC B;  3IDD A;  1ANJ A;  2ANH A;  3BDF A;  4LQY A;  4ZGA A;  5DLV A;  3TG0 A;  4NWX A;  1Y7A A;  2IUC A;  5TJ3 A;  2G9Y A;  1EI6 A;  1ELZ A;  2W5T A;  1E3C P;  4LRC A;  3WAW A;  3M7V A;  4N7T A;  1EQJ A;  4LRB A;  3UN2 A;  3A52 A;  4FDJ A;  4TN0 A;  1ELY A;  3BDG A;  3BDH A;  3OT9 A;  4LRA A;  5K4P A;  3TX0 A;  3SZY A;  5HRT A;  3MK2 A;  4LR8 A;  1KH9 A;  3T02 A;  3CMR A;  1AJC A;  1E33 P;  4B56 A;  1HJK A;  3KD8 A;  3SZZ A;  4FDI A;  4KAV A;  5DLT A;  3UNY A;  4GTW A;  3LXQ A;  2X98 A;  4UOO A;  1SHN A;  1ELX A;  4LRD A;  2W8S A;  1E2S P;  5L0K A;  1P49 A;  1KHL A;  2ZKT A;  3NKQ A;  1O98 A;  2QZU A;  5INH A;  5EGE A;  5L0E A;  4LRE A;  5GOV A;  1K7H A;  3M8W A;  3WAX A;  2RH6 A;  3NVL A;  1EW8 A;  1E1Z P;  3IGZ B;  1ZED A;  3TWZ A;  3DPC A;  4CXK A;  1ZEB A;  4NWJ A;  4UPL A;  1ALJ A;  4LR7 A;  5EGH A;  3NKO A;  3NKR A;  3NKN A;  1AJD A;  4ZG6 A;  1ALK A;  1ALH A;  5AJ9 A;  4GTX A;  1FSU A;  4YR1 A;  1N2K A;  2IFY A;  1KH4 A;  1KHJ A;  4LRF A;  1HDH A;  1EW2 A;  1URA A;  1KH5 A;  1SHQ A;  3BDG B;  4CYS A;  5LIA A;  5KXA A;  2GLQ A;  5LQQ A;  4GTY A;  1HQA A;  4UOR A;  2GSU A;  3T01 A;  3M8Y A;  1ED9 A;  4MIV A;  4LR2 A;  5IJQ A;  5GRR A;  2D1G A;  1AUK A;  3T00 A;  4UOP A;  3DYC A;  1O99 A;  2XR9 A;  5DLW A;  2XRG A;  4ZG7 A;  1URB A;  3IGY B;  3NKP A;  4UPH A;  2VQR A;  3UN3 A;  5C66 A;  4ZG9 A;  4LR9 A;  4CXS A;  3M8Z A;  1ED8 A;  3B5Q A;  1AJA A;  4KJG A;  2W5V A;  1ANI A;  3NKM A;  3E2D A;  3WBH A;  5IJS A;  1N2L A;  4UPI A;  1AJB A;  2W8D A;  3MK0 A;  5L0B A;  3UO0 A;  5LRM A;  1EJJ A;  4CXU A;  4MHX A;  1EW9 A;  3ED4 A;  4KAY A;  4GTZ A;  2GSN A;  2W5W A;  1ZEF A;  5LRN A;  3Q3Q A;  4MY4 A;  1B8J A;  1KHK A;  4UPK A;  3WAY A;  1KHN A;  1KH7 A;  2W5R A;  3MK1 A; 
#chains in the Genus database with same CATH topology
 5CJ9 A;  4BBS K;  3H0G K;  2E2J C;  3H0G A;  3UN5 A;  4KJD A;  1R9T K;  2W5S A;  2W5Q A;  3IDD A;  5JVO A;  2YU9 A;  4LQY A;  4ZGA A;  4G7O A;  2G9Y A;  2W5T A;  1ZBS A;  3HKZ L;  4LRC A;  1DCP A;  1J6V A;  3G4C A;  5IYC K;  3S2D K;  4G7H A;  3K7A C;  3M7V A;  3FOE A;  5IP7 K;  3A52 A;  1F7U A;  1F7V A;  4ILD A;  1WOP A;  3GTO A;  5C4X K;  4KMH A;  1ZVU A;  4XSZ A;  1O2F B;  3SZY A;  3MK2 A;  2WB1 D;  4YFN A;  3GSI A;  5C3E K;  2PMZ D;  2V6S A;  1TWA K;  1KH9 A;  4B56 A;  1JOE A;  1USM A;  3KD8 A;  2EBB A;  4Y52 C;  4KB2 A;  4A93 C;  3GDZ A;  2B63 C;  4KMU A;  3LXQ A;  3HOV K;  1WQH A;  4QJV B;  4LRD A;  5IP9 C;  2E2I C;  2JA7 K;  4G7Z A;  2A6E A;  1KHL A;  2KWA A;  5C4J C;  2JA8 C;  1TWC K;  1PJ5 A;  5D4D A;  3GTJ C;  5M5Y K;  5L0E A;  4KAW X;  5TMC A;  2NVX A;  4LK1 A;  2PHC B;  5GOV A;  1VJE A;  1F9N A;  1K7H A;  3M8W A;  1IS1 A;  1O29 A;  2RH6 A;  3IGZ B;  4LJZ A;  1G51 A;  4CXK A;  4NOI A;  5IOS A;  1VH2 A;  4A3E C;  1SMY A;  1TWG C;  3S1R C;  3NKN A;  5FJ8 K;  1ALH A;  1I6H C;  4A3B C;  1FSU A;  2JA6 C;  1ISE A;  3BP8 C;  1EFW A;  4LOW A;  4AYB D;  2E2H C;  3S14 C;  1SHQ A;  1ZXO A;  4XLP A;  4C3H K;  4BXX C;  5KXA A;  1USO A;  2GLQ A;  2A69 A;  4C3J K;  2R7Z K;  1XZP A;  1IQ0 A;  4UOR A;  5M3M K;  2NVT C;  4GTE A;  1TWH A;  2VUM C;  3M8Y A;  5GRR A;  3WOD A;  4KC6 A;  3PO2 K;  4GTF A;  1WOR A;  4MEY A;  3GTJ A;  3FOF A;  2VQR A;  3UN3 A;  4ZG9 A;  4C2M K;  3H3V D;  1X31 C;  2E2I A;  3GTL C;  1AJA A;  2RGR A;  1ANI A;  3NUH A;  4C3I C;  5FLM C;  4A3C K;  4KAS A;  3TFH A;  4Y7N K;  3QX3 A;  4WJ3 M;  4A3F C;  3S2H C;  2JA7 A;  1Y1W K;  2GAG C;  4KN4 A;  4WJ4 A;  3ED4 A;  1GE9 A;  1ZEF A;  3PO3 K;  3FKI C;  4UPK A;  3AD7 C;  1KHN A;  1KH7 A;  4X6A K;  5IOQ A;  3I4M K;  4BY7 K;  3HOU K;  1WCM K;  2W5X A;  4PAB A;  4KM4 A;  1YNJ A;  2Y0S L;  2JA5 A;  3WAV A;  3GTO K;  1IW7 A;  2P5M A;  2R93 K;  2IUC A;  3AD9 C;  4AYB L;  1PJ6 A;  3S1Q K;  1XXB A;  1O2B A;  4A3D C;  1B4A A;  1EQJ A;  3G4A A;  1WQF A;  1SFO C;  2YU9 K;  2CW0 A;  3GTM C;  1WIH A;  2NVQ C;  1O24 A;  3TX0 A;  3EQL A;  3GTQ A;  5HRT A;  1Y1V C;  3GTG C;  2XCR B;  1XXA A;  3L4J A;  3HOY K;  3S1M C;  3T02 A;  2PA8 L;  1AJC A;  4OIR A;  1TWF K;  2O5J A;  1PJ7 A;  3SZZ A;  4FDI A;  5M5X K;  4BBS C;  4KAV A;  3UNY A;  2BE5 A;  2E2J K;  3GTG A;  3GTP C;  4A3I C;  1I50 K;  4KM9 A;  2O5I A;  3CAG A;  4GT9 A;  3I4N C;  1E2S P;  3CQZ A;  2JA6 A;  2R92 C;  2QZU A;  3BUE A;  4A3K C;  4A3M C;  3RZD K;  4A3J C;  3GIR A;  2PPB A;  5M3F K;  5IYC C;  1I50 A;  4GZY A;  3S16 C;  3S2D C;  3NVL A;  3M3Y K;  4AH6 A;  5C44 C;  2WB1 L;  3GEH A;  4MEX A;  3GTK C;  3GTM A;  5L46 A;  1AB4 A;  3LAP A;  1SFO A;  4BBR C;  1TWF A;  5C4X C;  1AJD A;  4J3N A;  3RZO K;  1ALK A;  1KQ4 A;  2CFA A;  4A3L K;  5IYB C;  5C3E C;  4YR1 A;  1YCL A;  3AQP A;  3N3Y A;  4KB4 A;  4BLB A;  1O2A A;  2B63 A;  1EW2 A;  3FKI A;  1KH5 A;  4JK1 A;  4KAT A;  3S1N C;  3OPF A;  2GSU A;  2ZFZ A;  5IP9 K;  2E2I K;  2JA7 C;  1ED9 A;  5IJQ A;  4LR2 A;  2JA8 K;  2XCQ A;  4LLG A;  4MQ9 A;  3ADA C;  2R93 A;  2D1G A;  4UOP A;  5DLV A;  3GTJ K;  3OEP A;  3TFJ A;  5C66 A;  3AD8 C;  1VRQ C;  4A3G C;  1BDF A;  4CXS A;  1RU0 A;  3H3V L;  3B5Q A;  2W5V A;  4A3E K;  3M4O K;  1TWG K;  1DCO A;  1I3Q K;  3LPX A;  3HOW C;  4KDD A;  1ZQ1 C;  3MK0 A;  3GTQ K;  3S0X A;  1I6H K;  1V5V A;  2NVY K;  4KMA A;  2VUM A;  3GTL A;  3AQO A;  4G0V A;  1EW9 A;  2FQO A;  4QIW D;  4OIO A;  2R92 A;  4KAY A;  4GTZ A;  4P5B A;  5LRN A;  3Q3Q A;  3BP3 A;  4KMD A;  4BY1 C;  1JVI A;  3CQZ C;  3N0C A;  4C3H C;  1B8J A;  3WAY A;  4C3J C;  2R7Z C;  3S17 C;  2GSO A;  1TWH C;  3S15 C;  5IYD K;  4QAX A;  3A8K A;  3HXA A;  1L0W A;  4FZB A;  1J98 A;  3HOX C;  4CYR A;  2GA3 A;  1C0A A;  1WCM A;  4BLA A;  3K7A K;  3BDF A;  1JQW A;  1Y7A A;  4NWX A;  1EI6 A;  5HL8 A;  3ERE D;  3GTL K;  1E3C P;  1WOO A;  1IE0 A;  1R9T C;  4GTD A;  5CHP A;  4C3I K;  3HOZ K;  3WAW A;  4Y7N C;  3MML B;  4A3F K;  3S2H K;  3LAJ A;  3BDH A;  1O28 A;  4LRA A;  2XCO A;  5IP7 C;  4A93 K;  5TMF A;  2JA5 C;  2A6H A;  2PA8 D;  1HJK A;  1J6X A;  1I6V A;  3HOU C;  4GTW A;  4XSX A;  1WCM C;  2X98 A;  4UOO A;  1SHN A;  2V6T A;  1ELX A;  2W8S A;  5L0K A;  1P49 A;  4KAR A;  4GTL A;  3GTO C;  2NVX K;  3NKQ A;  1O25 A;  1DD5 A;  1TWC A;  4P5A A;  2R93 C;  2R7Z A;  5INH A;  1BS2 A;  3S1R K;  1K83 K;  3TWZ A;  4G0W A;  3DPC A;  1TWC C;  1ZEB A;  4NWJ A;  1ALJ A;  5EGH A;  3GTM K;  4ZG6 A;  1WSR A;  5AJ9 A;  1WOS A;  1N2K A;  3HOY C;  3S1M K;  4BXX K;  2IFY A;  3HKZ D;  3V4G A;  4XCH A;  4M1X A;  4OIN A;  2JH3 A;  1KHJ A;  1TWF C;  4A3B K;  5IOR A;  4CYS A;  5LIA A;  1O26 A;  1XPP A;  5LQQ A;  3GTP K;  4GTY A;  1HQA A;  2E2H K;  2WAQ D;  3H0G C;  3I4N K;  4C2M C;  1O27 A;  3T00 A;  1AUK A;  4YG2 A;  2XR9 A;  3DYC A;  2XRG A;  1URB A;  3NKP A;  5FLM K;  3RZD C;  4UPH A;  4A3J K;  3ORE A;  2VUM K;  4Q4Z A;  1F93 A;  2NVY A;  3S16 K;  3PO2 C;  4LR9 A;  1ED8 A;  5C44 K;  1IBA A;  1WQG A;  1K83 A;  5IJS A;  2A68 A;  3E2D A;  1TWG A;  4UPI A;  1Y1W C;  1AJB A;  1XZQ B;  2Y0S D;  5LRM A;  3PO3 C;  5IYB K;  4CXU A;  5IOT A;  4DDQ A;  3I4M C;  3A8I A;  4GTA A;  1TWA C;  3AH5 A;  4MY4 A;  1KHK A;  1B4B A;  2W5R A;  3TTG A;  4Y52 K;  2Y3P A;  2B63 K;  3FHZ A;  1XZP B;  1R9T A;  3HOV C;  2WAQ L;  1ALI A;  2V6U A;  1Y6V A;  3S1Q C;  4Q5S A;  4BY7 C;  2IUC B;  5C4J K;  1UV7 A;  1ANJ A;  2ANH A;  3TG0 A;  4GFQ A;  5TJ3 A;  1ELZ A;  1BJT A;  1SFO K;  3M4O C;  4GTB A;  4N7T A;  3GEI A;  1Y1V K;  4YFX A;  2FQT A;  4LRB A;  3UN2 A;  4FDJ A;  2ZUF A;  4TN0 A;  2CFA B;  1ELY A;  3BDG A;  3OT9 A;  5K4P A;  2JA6 K;  4LR8 A;  2W7V A;  1IL2 A;  2YU9 C;  3CQZ K;  3CMR A;  4A3I K;  1E33 P;  3S14 K;  4G0U A;  5JFE A;  2PMZ L;  1TWH K;  3GEE A;  5IYD C;  3GTG K;  3S15 K;  5DLT A;  2R92 K;  3HOX K;  2D6F C;  4A3K K;  4A3M K;  1YNN A;  2NVT K;  1VGX A;  2ZKT A;  3GTK A;  1O98 A;  3M3Y C;  5EGE A;  1HQM A;  4QIW L;  3GTK K;  1VLO A;  4LRE A;  1I50 C;  4XLN A;  1I3Q A;  1EQR A;  4BBR K;  3WAX A;  3HOZ C;  3N0B A;  1EW8 A;  4LK0 A;  1E1Z P;  4C45 A;  1ZED A;  3TFI A;  4P9S A;  1YX2 A;  1J6W A;  4UPL A;  4A3C C;  4YFK A;  4LR7 A;  3NKO A;  3NKR A;  1WSV A;  3GTP A;  4GTX A;  1EH1 A;  1XXC A;  4OIQ A;  1INN A;  3IPJ A;  4O2D A;  1EK8 A;  2JA5 K;  3S1N K;  3RZO C;  1KH4 A;  4LRF A;  1HDH A;  3A8J A;  4A3L C;  1URA A;  3FKI K;  3BDG B;  1XZQ A;  4X6A C;  1HI9 A;  3VA7 A;  3T01 A;  4KN7 A;  4MIV A;  2ZUE A;  2NVX C;  4ZG7 A;  1O99 A;  5DLW A;  3DXJ A;  3IGY B;  2GAH C;  5E68 A;  4KM8 A;  1Y1W A;  1TWA A;  3HOW K;  1K83 C;  4ZH4 A;  3M8Z A;  2E2H A;  4FM9 A;  5M5W K;  2NVY C;  4KJG A;  4A3D K;  3NKM A;  1BGW A;  3WBH A;  1N2L A;  4A3G K;  2W8D A;  5L0B A;  3UO0 A;  4OIP A;  4BY1 K;  3L4K A;  1EJJ A;  4RMF A;  1ZYR A;  2NVQ K;  4MHX A;  1I3Q C;  4PAA A;  1Y1V A;  3GTQ C;  4QJV A;  3S17 K;  3JST A;  1DCH A;  2GSN A;  2W5W A;  2P8T A;  4WIL A;  4BKW A;  4GTC A;  3MK1 A; 
#chains in the Genus database with same CATH homology
 2GSO A;  4QAX A;  4CYR A;  1ALI A;  2GA3 A;  2W5X A;  4KM4 A;  3UN5 A;  4KJD A;  1Y6V A;  2W5S A;  2W5Q A;  3WAV A;  2IUC B;  3IDD A;  1ANJ A;  2ANH A;  3BDF A;  4LQY A;  4ZGA A;  5DLV A;  3TG0 A;  4NWX A;  1Y7A A;  2IUC A;  5TJ3 A;  2G9Y A;  1EI6 A;  1ELZ A;  2W5T A;  1E3C P;  4LRC A;  3WAW A;  3M7V A;  4N7T A;  1EQJ A;  4LRB A;  3UN2 A;  3A52 A;  4FDJ A;  4TN0 A;  1ELY A;  3BDG A;  3BDH A;  3OT9 A;  4LRA A;  5K4P A;  3TX0 A;  3SZY A;  5HRT A;  3MK2 A;  4LR8 A;  1KH9 A;  3T02 A;  3CMR A;  1AJC A;  1E33 P;  4B56 A;  1HJK A;  3KD8 A;  3SZZ A;  4FDI A;  4KAV A;  5DLT A;  3UNY A;  4GTW A;  3LXQ A;  2X98 A;  4UOO A;  1SHN A;  1ELX A;  4LRD A;  2W8S A;  1E2S P;  5L0K A;  1P49 A;  1KHL A;  2ZKT A;  3NKQ A;  1O98 A;  2QZU A;  5INH A;  5EGE A;  5L0E A;  4LRE A;  5GOV A;  1K7H A;  3M8W A;  3WAX A;  2RH6 A;  3NVL A;  1EW8 A;  1E1Z P;  3IGZ B;  1ZED A;  3TWZ A;  3DPC A;  4CXK A;  1ZEB A;  4NWJ A;  4UPL A;  1ALJ A;  4LR7 A;  5EGH A;  3NKO A;  3NKR A;  3NKN A;  1AJD A;  4ZG6 A;  1ALK A;  1ALH A;  5AJ9 A;  4GTX A;  1FSU A;  4YR1 A;  1N2K A;  2IFY A;  1KH4 A;  1KHJ A;  4LRF A;  1HDH A;  1EW2 A;  1URA A;  1KH5 A;  1SHQ A;  3BDG B;  4CYS A;  5LIA A;  5KXA A;  2GLQ A;  5LQQ A;  4GTY A;  1HQA A;  4UOR A;  2GSU A;  3T01 A;  3M8Y A;  1ED9 A;  4MIV A;  4LR2 A;  5IJQ A;  5GRR A;  2D1G A;  1AUK A;  3T00 A;  4UOP A;  3DYC A;  1O99 A;  2XR9 A;  5DLW A;  2XRG A;  4ZG7 A;  1URB A;  3IGY B;  3NKP A;  4UPH A;  2VQR A;  3UN3 A;  5C66 A;  4ZG9 A;  4LR9 A;  4CXS A;  3M8Z A;  1ED8 A;  3B5Q A;  1AJA A;  4KJG A;  2W5V A;  1ANI A;  3NKM A;  3E2D A;  3WBH A;  5IJS A;  1N2L A;  4UPI A;  1AJB A;  2W8D A;  3MK0 A;  5L0B A;  3UO0 A;  5LRM A;  1EJJ A;  4CXU A;  4MHX A;  1EW9 A;  3ED4 A;  4KAY A;  4GTZ A;  2GSN A;  2W5W A;  1ZEF A;  5LRN A;  3Q3Q A;  4MY4 A;  1B8J A;  1KHK A;  4UPK A;  3WAY A;  1KHN A;  1KH7 A;  2W5R A;  3MK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...