1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords PHOSPHONOACETATE HYDROLASE
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
5LRMA 4KM4A 1B8JA 1ED8A 3NKPA 1KHLA 3UN2A 4ZG6A 3TG0A 3DYCA 4GTZA 3T01A 1ANJA 1KH4A 4UORA 5HRTA 1ELXA 2D1GA 3E2DA 1ALKA 1URAA 1Y6VA 2GLQA 2GSUA 3LXQA 3OT9A 5C66A 1ALIA 3WBHA 5DLWA 3UO0A 2W5SA 2W5XA 2W5RA 3DPCA 1P49A 1E3CP 3MK2A 2W5TA 1KHJA 3A52A 4N7TA 2ANHA 4LR7A 5L0KA 4GTWA 1ELYA 5L0EA 3IDDA 3MK0A 3M8WA 2W5WA 1ED9A 4UPKA 4ZG7A 1O99A 2G9YA 1ZEFA 1AUKA 3WAVA 1FSUA 3IGYB 3MK1A 4KAYA 1KH5A 1ALJA 4KJGA 2XR9A 4GTYA 1ANIA 3T02A 3WAWA 1HQAA 3M7VA 1EI6A 3WAYA 4CXKA 5DLTA 1URBA 4YR1A 3KD8A 3NKRA 3NVLA 3CMRA 4UPHA 4ZGAA 3ED4A 5DLVA 3BDGA 1EW8A 1Y7AA 3TWZA 1O98A 4UPIA 5EGEA 1HDHA 4MHXA 1ZEDA 3B5QA 2W8DA 4LRCA 5GOVA 1SHNA 4LR8A 3NKQA 1HJKA 3WAXA 1E2SP 3BDGB 1ELZA 2QZUA 1N2KA 3SZYA 3UN5A 5EGHA 4LREA 3M8ZA 5LQQA 4FDIA 3IGZB 1KH9A 2GSNA 2VQRA 4UPLA 1ZEBA 4LQYA 3BDFA 3TX0A 2IUCB 4GTXA 3NKMA 2W5VA 2GA3A 1SHQA 5GRRA 5L0BA 1KH7A 1K7HA 5TJ3A 4TN0A 1EQJA 1AJCA 3M8YA 5IJQA 5KXAA 3NKOA 1KHNA 1E33P 4QAXA 4FDJA 2ZKTA 3T00A 4LRBA 2RH6A 2GSOA 5LRNA 1AJAA 5AJ9A 5LIAA 3Q3QA 4UOPA 4UOOA 1N2LA 2IUCA 3NKNA 4LRAA 4CXSA 5IJSA 4KJDA 1ALHA 5K4PA 1EW2A 4MY4A 4CXUA 2XRGA 2W5QA 4CYRA 4LR9A 3UN3A 4KAVA 1EJJA 1EW9A 2IFYA 4NWJA 4MIVA 3SZZA 4LR2A 4LRFA 4B56A 2W8SA 4NWXA 1KHKA 4LRDA 2X98A 1AJBA 3BDHA 4CYSA 4ZG9A 1AJDA 5INHA 3UNYA 1E1ZP
chains in the Genus database with same CATH superfamily
5LRMA 4KM4A 1XZQA 4A3IC 1KHLA 3UN2A 5IYDC 4Q5SA 3GTLA 3S14K 4G7HA 4PABA 2V6SA 3T01A 1I50A 3AD7C 4A3KK 4G0WA 3I4MC 4GTLA 1KH4A 4UORA 1VH2A 5HRTA 1IW7A 1PJ5A 5IORA 1B4BA 2O5IA 2R93K 4BY7C 1Y6VA 1Y1WA 3HOYC 1Y1VC 4BY1C 4NOIA 2W5RA 1TWFK 1P49A 4XSXA 4BXXK 3A52A 4C3HK 4XLNA 2PHCB 1EQRA 1O26A 2E2HC 2R7ZC 4LR7A 1ELYA 4BBSK 5C4JC 3WODA 3AQOA 4P9SA 3S16C 1ED9A 4UPKA 1EFWA 1DCHA 1USOA 3OREA 3IGYB 2XCQA 1XXAA 5C4XC 3H0GC 3N0CA 1XZPB 2JH3A 3S17C 2XR9A 4LOWA 1Y1WC 3T02A 4KM8A 3M7VA 1EI6A 3WAYA 4A3GC 1URBA 4YR1A 4M1XA 1TWAC 3HOUK 3BP8C 5DLVA 5IP7C 3HOZC 3HOXK 3IPJA 4LK0A 1ISEA 1K83K 5CHPA 1SFOK 4PAAA 3OEPA 4BLBA 4A3EK 4G0UA 5FLMK 3S16K 4OIPA 3FOFA 1ZYRA 3GTMA 4FZBA 4QJVA 1RU0A 3WAXA 1E2SP 2A68A 3BDGB 2A6EA 5IYCK 4C3HC 2RGRA 3RZOK 1WSVA 1N2KA 2NVYC 4GFQA 2NVXC 3UN5A 1ZQ1C 5LQQA 4FDIA 2R93C 1XXBA 4LK1A 3H0GA 5E68A 3NKMA 2W5VA 4P5BA 1SHQA 1TWHK 3G4CA 5TJ3A 1XZPA 3K7AC 2V6UA 5C3EC 4C3IC 2A6HA 4A93K 2JA5K 3FKIK 5C44K 2GAHC 1JOEA 3A8IA 2PMZL 4YG2A 1XPPA 3HOXC 1TWCA 4QAXA 3H3VL 3T00A 4YFXA 1O2AA 4QIWD 1WORA 3GTKA 3HOVK 4Y7NK 1INNA 4CXSA 1O28A 3OPFA 1L0WA 5K4PA 1I50C 4Y52K 1WOPA 2ZUEA 3RZDC 4LR9A 3GEHA 1EJJA 4Y7NC 1IQ0A 4MIVA 4LRFA 2NVYA 2NVXA 3HXAA 2NVQC 3GTJC 4LRDA 1AJBA 3BDHA 1AJDA 1I3QC 2PA8L 2ZUFA 3HOUC 3L4KA 4XLPA 4GZYA 4LLGA 3PO3C 4KATA 1AB4A 3CQZC 3M3YC 1J6VA 3S1NK 4A3GK 3DYCA 3S1RK 1ELXA 2D1GA 3E2DA 3ADAC 5C66A 1URAA 1WQGA 3OT9A 3H0GK 3WBHA 3UO0A 3PO2K 4GTFA 2W5SA 3DPCA 3MK2A 1E3CP 3M3YK 3S1NC 2B63K 4KMUA 1DCOA 4YFNA 3GTQC 2JA6A 2W5TA 4N7TA 3GTMC 3GTPK 4GTEA 2XCRB 5C4JK 4KASA 4BBSC 4A3FK 1I6HC 3IDDA 1O24A 1ZXOA 3MK0A 4ZG7A 1TWGK 3AQPA 1TWCK 1ZEFA 1AUKA 4KN4A 1FSUA 1TWHC 2FQTA 1GE9A 4BY7K 3TFHA 5IP7K 3HOZK 3EQLA 3QX3A 4OINA 4KC6A 3GTLC 1SMYA 1HQAA 5M3MK 4FM9A 1WIHA 3HOWC 5M3FK 2E2HA 3WAWA 5DLTA 1J6WA 3RZOC 3NKRA 1WCMC 4XSZA 5IOSA 3PO3K 3L4JA 3BDGA 4BBRK 1TWHA 1Y7AA 4UPIA 1ZVUA 1SFOC 3GTQA 3B5QA 2W8DA 1BS2A 4GT9A 4KDDA 1SHNA 5M5XK 3CAGA 2E2IC 1IS1A 1ELZA 3S1QC 5EGHA 2NVTK 1R9TK 2E2JC 1IBAA 1KQ4A 3GTGK 4KM9A 2GSNA 1KH9A 1ZEBA 2IUCB 4GTXA 5TMFA 5C4XK 4A3JK 1KH7A 3N0BA 1EQJA 4RMFA 4A3MC 4A93C 3M8YA 2E2IA 4A3EC 3GIRA 3S0XA 3GTGA 5IJQA 5IOTA 4WJ4A 3S15K 1E33P 4FDJA 5IOQA 1AJAA 4A3CC 5AJ9A 1Y1VK 4BY1K 4UOPA 4UOOA 2IUCA 4KMHA 5IJSA 2VUMC 4MY4A 1B4AA 3N3YA 5IYCC 2W5QA 4CYRA 3UN3A 4KAVA 4KAWX 2IFYA 4XCHA 1O29A 4LR2A 3SZZA 5FLMC 2D6FC 4KMAA 2W8SA 1F7UA 2FQOA 1F93A 4O2DA 1KHKA 2JA7A 1I3QK 5TMCA 3M4OK 3UNYA 3GTOK 3GEIA 3GTPC 3MMLB 3NKPA 1R9TA 2VUMA 1TWGA 5IP9K 1ZBSA 4ZG6A 2ZFZA 3TG0A 4A3BK 2BE5A 1VGXA 1X31C 1DD5A 3RZDK 1ANJA 3S1QK 4G0VA 4DDQA 4YFKA 3GTLK 1ALKA 2GSUA 3FOEA 2WB1L 4A3LK 3GTOA 1BGWA 5DLWA 2JA5A 3CQZK 3JSTA 2P8TA 2JA7K 2ANHA 5L0KA 3M4OC 5FJ8K 5L0EA 3HKZL 1C0AA 4GTAA 4X6AC 3M8WA 2W5WA 1TWAA 1O99A 3H3VD 3WAVA 2O5JA 4C45A 4J3NA 2B63C 3GTQK 4QIWL 1ALJA 4KJGA 3G4AA 1Y1VA 1O2BA 1PJ6A 1O27A 2KWAA 5IYBC 1XXCA 1IL2A 2PPBA 4GTDA 3LAPA 3CQZA 3S2DC 3A8KA 3S14C 4WJ3M 3V4GA 4OIOA 2WAQL 3CMRA 3NVLA 3ED4A 4OIRA 1EW8A 5D4DA 4MEYA 5C44C 4C3JK 4MEXA 3FKIC 3TWZA 5EGEA 1O98A 3HKZD 1PJ7A 1HDHA 3GTKK 3TFIA 3GTMK 4MHXA 2B63A 4LRCA 1I6VA 2R92K 4JK1A 4LR8A 4C3JC 3NKQA 2JA8C 1HJKA 5CJ9A 4G7OA 5L46A 4C2MC 1JQWA 1VJEA 3NUHA 4KN7A 4QJVB 3SZYA 3M8ZA 2WB1D 4Q4ZA 2Y3PA 2VQRA 1WQHA 3TX0A 3S15C 2Y0SL 4BLAA 5IYBK 2GA3A 5GRRA 5L0BA 1VLOA 4TN0A 2YU9K 1WOOA 1TWGC 4BBRC 1WOSA 3FHZA 3GTJA 2R92A 1KHNA 2WAQD 1J6XA 2E2HK 2RH6A 3GEEA 2R93A 1K83A 2EBBA 3S2HC 2JA7C 2E2JK 4MQ9A 5LIAA 4LRAA 1EW2A 3TFJA 2A69A 3ERED 2JA8K 3I4NC 4A3KC 3I4MK 4GTCA 4KB2A 4KB4A 1EW9A 3GSIA 1J98A 1TWCC 2JA5C 4A3BC 4NWXA 1UV7A 2GAGC 4CYSA 2R7ZK 2V6TA 1YNNA 1B8JA 1ED8A 1TWAK 2NVQK 5M5YK 3GTGC 3PO2C 4A3JC 3A8JA 4GTZA 1F7VA 3I4NK 2GLQA 3LXQA 1TWFA 3VA7A 1ALIA 3S17K 2W5XA 4G7ZA 1SFOA 3AH5A 5IYDK 1KHJA 1YNJA 1USMA 4C2MK 5JVOA 3S1MK 1WCMA 4GTWA 3GTPA 3AD9C 2CW0A 2G9YA 3S1MC 1YCLA 3MK1A 1V5VA 2PMZD 4AYBL 3LAJA 4BXXC 4KAYA 1KH5A 3LPXA 1WCMK 4GTBA 4GTYA 1ANIA 2VUMK 3AD8C 1WQFA 2CFAB 3S2DK 4CXKA 2XCOA 5JFEA 1VRQC 1XZQB 2Y0SD 3KD8A 2NVTC 4BKWA 3DXJA 3S2HK 3GTOC 4UPHA 4ZGAA 1JVIA 2JA6C 4LJZA 1ZEDA 2YU9C 4P5AA 1O25A 1EH1A 4A3MK 5GOVA 2R7ZA 3GDZA 4AYBD 2W7VA 1I50K 4Y52C 4ILDA 2QZUA 1BJTA 3S1RC 1YX2A 2NVYK 2NVXK 4KARA 4A3CK 4LREA 3HOVC 1DCPA 2P5MA 3IGZB 3HOWK 4UPLA 4A3IK 1IE0A 4LQYA 1Y1WK 3BDFA 1I3QA 2E2IK 1O2FB 3FKIA 1BDFA 4A3DK 1K7HA 3BUEA 1HI9A 5C3EK 5IP9C 1AJCA 3K7AK 4X6AK 2JA6K 4OIQA 3TTGA 5HL8A 2CFAA 5KXAA 3NKOA 4KMDA 2ZKTA 3GTJK 2YU9A 4LRBA 2GSOA 5LRNA 1HQMA 1F9NA 1R9TC 3Q3QA 1TWFC 1N2LA 3NKNA 4A3LC 3HOYK 4KJDA 1ALHA 4CXUA 4WILA 5M5WK 2XRGA 1WSRA 2PA8D 2R92C 4NWJA 4ZH4A 3BP3A 4B56A 1G51A 4C3IK 1K83C 1EK8A 3GTKC 2X98A 4A3DC 4ZG9A 5INHA 4A3FC 1I6HK 4AH6A 1E1ZP
chains in the Genus database with same CATH topology
5LRMA 4KM4A 1B8JA 1ED8A 3NKPA 1KHLA 3UN2A 4ZG6A 3TG0A 3DYCA 4GTZA 3T01A 1ANJA 1KH4A 4UORA 5HRTA 1ELXA 2D1GA 3E2DA 1ALKA 1URAA 1Y6VA 2GLQA 2GSUA 3LXQA 3OT9A 5C66A 1ALIA 3WBHA 5DLWA 3UO0A 2W5SA 2W5XA 2W5RA 3DPCA 1P49A 1E3CP 3MK2A 2W5TA 1KHJA 3A52A 4N7TA 2ANHA 4LR7A 5L0KA 4GTWA 1ELYA 5L0EA 3IDDA 3MK0A 3M8WA 2W5WA 1ED9A 4UPKA 4ZG7A 1O99A 2G9YA 1ZEFA 1AUKA 3WAVA 1FSUA 3IGYB 3MK1A 4KAYA 1KH5A 1ALJA 4KJGA 2XR9A 4GTYA 1ANIA 3T02A 3WAWA 1HQAA 3M7VA 1EI6A 3WAYA 4CXKA 5DLTA 1URBA 4YR1A 3KD8A 3NKRA 3NVLA 3CMRA 4UPHA 4ZGAA 3ED4A 5DLVA 3BDGA 1EW8A 1Y7AA 3TWZA 1O98A 4UPIA 5EGEA 1HDHA 4MHXA 1ZEDA 3B5QA 2W8DA 4LRCA 5GOVA 1SHNA 4LR8A 3NKQA 1HJKA 3WAXA 1E2SP 3BDGB 1ELZA 2QZUA 1N2KA 3SZYA 3UN5A 5EGHA 4LREA 3M8ZA 5LQQA 4FDIA 3IGZB 1KH9A 2GSNA 2VQRA 4UPLA 1ZEBA 4LQYA 3BDFA 3TX0A 2IUCB 4GTXA 3NKMA 2W5VA 2GA3A 1SHQA 5GRRA 5L0BA 1KH7A 1K7HA 5TJ3A 4TN0A 1EQJA 1AJCA 3M8YA 5IJQA 5KXAA 3NKOA 1KHNA 1E33P 4QAXA 4FDJA 2ZKTA 3T00A 4LRBA 2RH6A 2GSOA 5LRNA 1AJAA 5AJ9A 5LIAA 3Q3QA 4UOPA 4UOOA 1N2LA 2IUCA 3NKNA 4LRAA 4CXSA 5IJSA 4KJDA 1ALHA 5K4PA 1EW2A 4MY4A 4CXUA 2XRGA 2W5QA 4CYRA 4LR9A 3UN3A 4KAVA 1EJJA 1EW9A 2IFYA 4NWJA 4MIVA 3SZZA 4LR2A 4LRFA 4B56A 2W8SA 4NWXA 1KHKA 4LRDA 2X98A 1AJBA 3BDHA 4CYSA 4ZG9A 1AJDA 5INHA 3UNYA 1E1ZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LRM A;  4KM4 A;  1B8J A;  1ED8 A;  3NKP A;  1KHL A;  3UN2 A;  4ZG6 A;  3TG0 A;  3DYC A;  4GTZ A;  3T01 A;  1ANJ A;  1KH4 A;  4UOR A;  5HRT A;  1ELX A;  2D1G A;  3E2D A;  1ALK A;  1URA A;  1Y6V A;  2GLQ A;  2GSU A;  3LXQ A;  3OT9 A;  5C66 A;  1ALI A;  3WBH A;  5DLW A;  3UO0 A;  2W5S A;  2W5X A;  2W5R A;  3DPC A;  1P49 A;  1E3C P;  3MK2 A;  2W5T A;  1KHJ A;  3A52 A;  4N7T A;  2ANH A;  4LR7 A;  5L0K A;  4GTW A;  1ELY A;  5L0E A;  3IDD A;  3MK0 A;  3M8W A;  2W5W A;  1ED9 A;  4UPK A;  4ZG7 A;  1O99 A;  2G9Y A;  1ZEF A;  1AUK A;  3WAV A;  1FSU A;  3IGY B;  3MK1 A;  4KAY A;  1KH5 A;  1ALJ A;  4KJG A;  2XR9 A;  4GTY A;  1ANI A;  3T02 A;  3WAW A;  1HQA A;  3M7V A;  1EI6 A;  3WAY A;  4CXK A;  5DLT A;  1URB A;  4YR1 A;  3KD8 A;  3NKR A;  3NVL A;  3CMR A;  4UPH A;  4ZGA A;  3ED4 A;  5DLV A;  3BDG A;  1EW8 A;  1Y7A A;  3TWZ A;  1O98 A;  4UPI A;  5EGE A;  1HDH A;  4MHX A;  1ZED A;  3B5Q A;  2W8D A;  4LRC A;  5GOV A;  1SHN A;  4LR8 A;  3NKQ A;  1HJK A;  3WAX A;  1E2S P;  3BDG B;  1ELZ A;  2QZU A;  1N2K A;  3SZY A;  3UN5 A;  5EGH A;  4LRE A;  3M8Z A;  5LQQ A;  4FDI A;  3IGZ B;  1KH9 A;  2GSN A;  2VQR A;  4UPL A;  1ZEB A;  4LQY A;  3BDF A;  3TX0 A;  2IUC B;  4GTX A;  3NKM A;  2W5V A;  2GA3 A;  1SHQ A;  5GRR A;  5L0B A;  1KH7 A;  1K7H A;  5TJ3 A;  4TN0 A;  1EQJ A;  1AJC A;  3M8Y A;  5IJQ A;  5KXA A;  3NKO A;  1KHN A;  1E33 P;  4QAX A;  4FDJ A;  2ZKT A;  3T00 A;  4LRB A;  2RH6 A;  2GSO A;  5LRN A;  1AJA A;  5AJ9 A;  5LIA A;  3Q3Q A;  4UOP A;  4UOO A;  1N2L A;  2IUC A;  3NKN A;  4LRA A;  4CXS A;  5IJS A;  4KJD A;  1ALH A;  5K4P A;  1EW2 A;  4MY4 A;  4CXU A;  2XRG A;  2W5Q A;  4CYR A;  4LR9 A;  3UN3 A;  4KAV A;  1EJJ A;  1EW9 A;  2IFY A;  4NWJ A;  4MIV A;  3SZZ A;  4LR2 A;  4LRF A;  4B56 A;  2W8S A;  4NWX A;  1KHK A;  4LRD A;  2X98 A;  1AJB A;  3BDH A;  4CYS A;  4ZG9 A;  1AJD A;  5INH A;  3UNY A;  1E1Z P; 
#chains in the Genus database with same CATH topology
 5LRM A;  4KM4 A;  1XZQ A;  4A3I C;  1KHL A;  3UN2 A;  5IYD C;  4Q5S A;  3GTL A;  3S14 K;  4G7H A;  4PAB A;  2V6S A;  3T01 A;  1I50 A;  3AD7 C;  4A3K K;  4G0W A;  3I4M C;  4GTL A;  1KH4 A;  4UOR A;  1VH2 A;  5HRT A;  1IW7 A;  1PJ5 A;  5IOR A;  1B4B A;  2O5I A;  2R93 K;  4BY7 C;  1Y6V A;  1Y1W A;  3HOY C;  1Y1V C;  4BY1 C;  4NOI A;  2W5R A;  1TWF K;  1P49 A;  4XSX A;  4BXX K;  3A52 A;  4C3H K;  4XLN A;  2PHC B;  1EQR A;  1O26 A;  2E2H C;  2R7Z C;  4LR7 A;  1ELY A;  4BBS K;  5C4J C;  3WOD A;  3AQO A;  4P9S A;  3S16 C;  1ED9 A;  4UPK A;  1EFW A;  1DCH A;  1USO A;  3ORE A;  3IGY B;  2XCQ A;  1XXA A;  5C4X C;  3H0G C;  3N0C A;  1XZP B;  2JH3 A;  3S17 C;  2XR9 A;  4LOW A;  1Y1W C;  3T02 A;  4KM8 A;  3M7V A;  1EI6 A;  3WAY A;  4A3G C;  1URB A;  4YR1 A;  4M1X A;  1TWA C;  3HOU K;  3BP8 C;  5DLV A;  5IP7 C;  3HOZ C;  3HOX K;  3IPJ A;  4LK0 A;  1ISE A;  1K83 K;  5CHP A;  1SFO K;  4PAA A;  3OEP A;  4BLB A;  4A3E K;  4G0U A;  5FLM K;  3S16 K;  4OIP A;  3FOF A;  1ZYR A;  3GTM A;  4FZB A;  4QJV A;  1RU0 A;  3WAX A;  1E2S P;  2A68 A;  3BDG B;  2A6E A;  5IYC K;  4C3H C;  2RGR A;  3RZO K;  1WSV A;  1N2K A;  2NVY C;  4GFQ A;  2NVX C;  3UN5 A;  1ZQ1 C;  5LQQ A;  4FDI A;  2R93 C;  1XXB A;  4LK1 A;  3H0G A;  5E68 A;  3NKM A;  2W5V A;  4P5B A;  1SHQ A;  1TWH K;  3G4C A;  5TJ3 A;  1XZP A;  3K7A C;  2V6U A;  5C3E C;  4C3I C;  2A6H A;  4A93 K;  2JA5 K;  3FKI K;  5C44 K;  2GAH C;  1JOE A;  3A8I A;  2PMZ L;  4YG2 A;  1XPP A;  3HOX C;  1TWC A;  4QAX A;  3H3V L;  3T00 A;  4YFX A;  1O2A A;  4QIW D;  1WOR A;  3GTK A;  3HOV K;  4Y7N K;  1INN A;  4CXS A;  1O28 A;  3OPF A;  1L0W A;  5K4P A;  1I50 C;  4Y52 K;  1WOP A;  2ZUE A;  3RZD C;  4LR9 A;  3GEH A;  1EJJ A;  4Y7N C;  1IQ0 A;  4MIV A;  4LRF A;  2NVY A;  2NVX A;  3HXA A;  2NVQ C;  3GTJ C;  4LRD A;  1AJB A;  3BDH A;  1AJD A;  1I3Q C;  2PA8 L;  2ZUF A;  3HOU C;  3L4K A;  4XLP A;  4GZY A;  4LLG A;  3PO3 C;  4KAT A;  1AB4 A;  3CQZ C;  3M3Y C;  1J6V A;  3S1N K;  4A3G K;  3DYC A;  3S1R K;  1ELX A;  2D1G A;  3E2D A;  3ADA C;  5C66 A;  1URA A;  1WQG A;  3OT9 A;  3H0G K;  3WBH A;  3UO0 A;  3PO2 K;  4GTF A;  2W5S A;  3DPC A;  3MK2 A;  1E3C P;  3M3Y K;  3S1N C;  2B63 K;  4KMU A;  1DCO A;  4YFN A;  3GTQ C;  2JA6 A;  2W5T A;  4N7T A;  3GTM C;  3GTP K;  4GTE A;  2XCR B;  5C4J K;  4KAS A;  4BBS C;  4A3F K;  1I6H C;  3IDD A;  1O24 A;  1ZXO A;  3MK0 A;  4ZG7 A;  1TWG K;  3AQP A;  1TWC K;  1ZEF A;  1AUK A;  4KN4 A;  1FSU A;  1TWH C;  2FQT A;  1GE9 A;  4BY7 K;  3TFH A;  5IP7 K;  3HOZ K;  3EQL A;  3QX3 A;  4OIN A;  4KC6 A;  3GTL C;  1SMY A;  1HQA A;  5M3M K;  4FM9 A;  1WIH A;  3HOW C;  5M3F K;  2E2H A;  3WAW A;  5DLT A;  1J6W A;  3RZO C;  3NKR A;  1WCM C;  4XSZ A;  5IOS A;  3PO3 K;  3L4J A;  3BDG A;  4BBR K;  1TWH A;  1Y7A A;  4UPI A;  1ZVU A;  1SFO C;  3GTQ A;  3B5Q A;  2W8D A;  1BS2 A;  4GT9 A;  4KDD A;  1SHN A;  5M5X K;  3CAG A;  2E2I C;  1IS1 A;  1ELZ A;  3S1Q C;  5EGH A;  2NVT K;  1R9T K;  2E2J C;  1IBA A;  1KQ4 A;  3GTG K;  4KM9 A;  2GSN A;  1KH9 A;  1ZEB A;  2IUC B;  4GTX A;  5TMF A;  5C4X K;  4A3J K;  1KH7 A;  3N0B A;  1EQJ A;  4RMF A;  4A3M C;  4A93 C;  3M8Y A;  2E2I A;  4A3E C;  3GIR A;  3S0X A;  3GTG A;  5IJQ A;  5IOT A;  4WJ4 A;  3S15 K;  1E33 P;  4FDJ A;  5IOQ A;  1AJA A;  4A3C C;  5AJ9 A;  1Y1V K;  4BY1 K;  4UOP A;  4UOO A;  2IUC A;  4KMH A;  5IJS A;  2VUM C;  4MY4 A;  1B4A A;  3N3Y A;  5IYC C;  2W5Q A;  4CYR A;  3UN3 A;  4KAV A;  4KAW X;  2IFY A;  4XCH A;  1O29 A;  4LR2 A;  3SZZ A;  5FLM C;  2D6F C;  4KMA A;  2W8S A;  1F7U A;  2FQO A;  1F93 A;  4O2D A;  1KHK A;  2JA7 A;  1I3Q K;  5TMC A;  3M4O K;  3UNY A;  3GTO K;  3GEI A;  3GTP C;  3MML B;  3NKP A;  1R9T A;  2VUM A;  1TWG A;  5IP9 K;  1ZBS A;  4ZG6 A;  2ZFZ A;  3TG0 A;  4A3B K;  2BE5 A;  1VGX A;  1X31 C;  1DD5 A;  3RZD K;  1ANJ A;  3S1Q K;  4G0V A;  4DDQ A;  4YFK A;  3GTL K;  1ALK A;  2GSU A;  3FOE A;  2WB1 L;  4A3L K;  3GTO A;  1BGW A;  5DLW A;  2JA5 A;  3CQZ K;  3JST A;  2P8T A;  2JA7 K;  2ANH A;  5L0K A;  3M4O C;  5FJ8 K;  5L0E A;  3HKZ L;  1C0A A;  4GTA A;  4X6A C;  3M8W A;  2W5W A;  1TWA A;  1O99 A;  3H3V D;  3WAV A;  2O5J A;  4C45 A;  4J3N A;  2B63 C;  3GTQ K;  4QIW L;  1ALJ A;  4KJG A;  3G4A A;  1Y1V A;  1O2B A;  1PJ6 A;  1O27 A;  2KWA A;  5IYB C;  1XXC A;  1IL2 A;  2PPB A;  4GTD A;  3LAP A;  3CQZ A;  3S2D C;  3A8K A;  3S14 C;  4WJ3 M;  3V4G A;  4OIO A;  2WAQ L;  3CMR A;  3NVL A;  3ED4 A;  4OIR A;  1EW8 A;  5D4D A;  4MEY A;  5C44 C;  4C3J K;  4MEX A;  3FKI C;  3TWZ A;  5EGE A;  1O98 A;  3HKZ D;  1PJ7 A;  1HDH A;  3GTK K;  3TFI A;  3GTM K;  4MHX A;  2B63 A;  4LRC A;  1I6V A;  2R92 K;  4JK1 A;  4LR8 A;  4C3J C;  3NKQ A;  2JA8 C;  1HJK A;  5CJ9 A;  4G7O A;  5L46 A;  4C2M C;  1JQW A;  1VJE A;  3NUH A;  4KN7 A;  4QJV B;  3SZY A;  3M8Z A;  2WB1 D;  4Q4Z A;  2Y3P A;  2VQR A;  1WQH A;  3TX0 A;  3S15 C;  2Y0S L;  4BLA A;  5IYB K;  2GA3 A;  5GRR A;  5L0B A;  1VLO A;  4TN0 A;  2YU9 K;  1WOO A;  1TWG C;  4BBR C;  1WOS A;  3FHZ A;  3GTJ A;  2R92 A;  1KHN A;  2WAQ D;  1J6X A;  2E2H K;  2RH6 A;  3GEE A;  2R93 A;  1K83 A;  2EBB A;  3S2H C;  2JA7 C;  2E2J K;  4MQ9 A;  5LIA A;  4LRA A;  1EW2 A;  3TFJ A;  2A69 A;  3ERE D;  2JA8 K;  3I4N C;  4A3K C;  3I4M K;  4GTC A;  4KB2 A;  4KB4 A;  1EW9 A;  3GSI A;  1J98 A;  1TWC C;  2JA5 C;  4A3B C;  4NWX A;  1UV7 A;  2GAG C;  4CYS A;  2R7Z K;  2V6T A;  1YNN A;  1B8J A;  1ED8 A;  1TWA K;  2NVQ K;  5M5Y K;  3GTG C;  3PO2 C;  4A3J C;  3A8J A;  4GTZ A;  1F7V A;  3I4N K;  2GLQ A;  3LXQ A;  1TWF A;  3VA7 A;  1ALI A;  3S17 K;  2W5X A;  4G7Z A;  1SFO A;  3AH5 A;  5IYD K;  1KHJ A;  1YNJ A;  1USM A;  4C2M K;  5JVO A;  3S1M K;  1WCM A;  4GTW A;  3GTP A;  3AD9 C;  2CW0 A;  2G9Y A;  3S1M C;  1YCL A;  3MK1 A;  1V5V A;  2PMZ D;  4AYB L;  3LAJ A;  4BXX C;  4KAY A;  1KH5 A;  3LPX A;  1WCM K;  4GTB A;  4GTY A;  1ANI A;  2VUM K;  3AD8 C;  1WQF A;  2CFA B;  3S2D K;  4CXK A;  2XCO A;  5JFE A;  1VRQ C;  1XZQ B;  2Y0S D;  3KD8 A;  2NVT C;  4BKW A;  3DXJ A;  3S2H K;  3GTO C;  4UPH A;  4ZGA A;  1JVI A;  2JA6 C;  4LJZ A;  1ZED A;  2YU9 C;  4P5A A;  1O25 A;  1EH1 A;  4A3M K;  5GOV A;  2R7Z A;  3GDZ A;  4AYB D;  2W7V A;  1I50 K;  4Y52 C;  4ILD A;  2QZU A;  1BJT A;  3S1R C;  1YX2 A;  2NVY K;  2NVX K;  4KAR A;  4A3C K;  4LRE A;  3HOV C;  1DCP A;  2P5M A;  3IGZ B;  3HOW K;  4UPL A;  4A3I K;  1IE0 A;  4LQY A;  1Y1W K;  3BDF A;  1I3Q A;  2E2I K;  1O2F B;  3FKI A;  1BDF A;  4A3D K;  1K7H A;  3BUE A;  1HI9 A;  5C3E K;  5IP9 C;  1AJC A;  3K7A K;  4X6A K;  2JA6 K;  4OIQ A;  3TTG A;  5HL8 A;  2CFA A;  5KXA A;  3NKO A;  4KMD A;  2ZKT A;  3GTJ K;  2YU9 A;  4LRB A;  2GSO A;  5LRN A;  1HQM A;  1F9N A;  1R9T C;  3Q3Q A;  1TWF C;  1N2L A;  3NKN A;  4A3L C;  3HOY K;  4KJD A;  1ALH A;  4CXU A;  4WIL A;  5M5W K;  2XRG A;  1WSR A;  2PA8 D;  2R92 C;  4NWJ A;  4ZH4 A;  3BP3 A;  4B56 A;  1G51 A;  4C3I K;  1K83 C;  1EK8 A;  3GTK C;  2X98 A;  4A3D C;  4ZG9 A;  5INH A;  4A3F C;  1I6H K;  4AH6 A;  1E1Z P; 
#chains in the Genus database with same CATH homology
 5LRM A;  4KM4 A;  1B8J A;  1ED8 A;  3NKP A;  1KHL A;  3UN2 A;  4ZG6 A;  3TG0 A;  3DYC A;  4GTZ A;  3T01 A;  1ANJ A;  1KH4 A;  4UOR A;  5HRT A;  1ELX A;  2D1G A;  3E2D A;  1ALK A;  1URA A;  1Y6V A;  2GLQ A;  2GSU A;  3LXQ A;  3OT9 A;  5C66 A;  1ALI A;  3WBH A;  5DLW A;  3UO0 A;  2W5S A;  2W5X A;  2W5R A;  3DPC A;  1P49 A;  1E3C P;  3MK2 A;  2W5T A;  1KHJ A;  3A52 A;  4N7T A;  2ANH A;  4LR7 A;  5L0K A;  4GTW A;  1ELY A;  5L0E A;  3IDD A;  3MK0 A;  3M8W A;  2W5W A;  1ED9 A;  4UPK A;  4ZG7 A;  1O99 A;  2G9Y A;  1ZEF A;  1AUK A;  3WAV A;  1FSU A;  3IGY B;  3MK1 A;  4KAY A;  1KH5 A;  1ALJ A;  4KJG A;  2XR9 A;  4GTY A;  1ANI A;  3T02 A;  3WAW A;  1HQA A;  3M7V A;  1EI6 A;  3WAY A;  4CXK A;  5DLT A;  1URB A;  4YR1 A;  3KD8 A;  3NKR A;  3NVL A;  3CMR A;  4UPH A;  4ZGA A;  3ED4 A;  5DLV A;  3BDG A;  1EW8 A;  1Y7A A;  3TWZ A;  1O98 A;  4UPI A;  5EGE A;  1HDH A;  4MHX A;  1ZED A;  3B5Q A;  2W8D A;  4LRC A;  5GOV A;  1SHN A;  4LR8 A;  3NKQ A;  1HJK A;  3WAX A;  1E2S P;  3BDG B;  1ELZ A;  2QZU A;  1N2K A;  3SZY A;  3UN5 A;  5EGH A;  4LRE A;  3M8Z A;  5LQQ A;  4FDI A;  3IGZ B;  1KH9 A;  2GSN A;  2VQR A;  4UPL A;  1ZEB A;  4LQY A;  3BDF A;  3TX0 A;  2IUC B;  4GTX A;  3NKM A;  2W5V A;  2GA3 A;  1SHQ A;  5GRR A;  5L0B A;  1KH7 A;  1K7H A;  5TJ3 A;  4TN0 A;  1EQJ A;  1AJC A;  3M8Y A;  5IJQ A;  5KXA A;  3NKO A;  1KHN A;  1E33 P;  4QAX A;  4FDJ A;  2ZKT A;  3T00 A;  4LRB A;  2RH6 A;  2GSO A;  5LRN A;  1AJA A;  5AJ9 A;  5LIA A;  3Q3Q A;  4UOP A;  4UOO A;  1N2L A;  2IUC A;  3NKN A;  4LRA A;  4CXS A;  5IJS A;  4KJD A;  1ALH A;  5K4P A;  1EW2 A;  4MY4 A;  4CXU A;  2XRG A;  2W5Q A;  4CYR A;  4LR9 A;  3UN3 A;  4KAV A;  1EJJ A;  1EW9 A;  2IFY A;  4NWJ A;  4MIV A;  3SZZ A;  4LR2 A;  4LRF A;  4B56 A;  2W8S A;  4NWX A;  1KHK A;  4LRD A;  2X98 A;  1AJB A;  3BDH A;  4CYS A;  4ZG9 A;  1AJD A;  5INH A;  3UNY A;  1E1Z P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...