1EIJA

Nmr ensemble of methanobacterium thermoautotrophicum protein 1615
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
MRQQLEMQKKQIMMQILTPEARSRLANLRLTRPDFVEQIELQLIQLAQMGRVRSKITDEQLKELLKRVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MTH1615
publication title Structural proteomics of an archaeon.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 17
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2000-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 1eijA00
2FH0A 2CRUA 2K6BA 1EIJA 2JXNA
chains in the Genus database with same CATH superfamily
3B7QA 4K0KM 1YSYA 2Y21A 4M9ZA 5GKNA 3GP1A 2Q2EB 3W0FA 3GLGE 4DV6M 3VK8A 3HX3A 4LJ9A 4LF5M 4NXMM 1IFYA 1SXJD 2QPAA 4FWHA 4B3TM 1Z5AA 1NHGC 2D7EA 4IBKA 4NRVA 5KO3A 3GLGA 2UUAM 1LTMA 4KODA 4B7FA 2F4VM 1IN7A 3VKGA 4LF8M 1L8QA 5E26A 3F92A 1PJJA 4HL4A 4FCWA 2O01F 5DFLA 5F3WA 2R46A 2RKOA 2RGOA 2V6ZM 4LRSA 4NL4H 1Z59A 2V1CA 3SYKA 1R4GA 4JYAM 1WXQA 5EJCA 1GL7A 4JI7M 2XF3A 4M9SA 1VG5A 1WHCA 1K82A 1QZEA 2DWNA 2N35A 2L4FA 4LJ5A 4RF1A 1T6OA 4W5WA 2G8LA 1VEGA 4LF9M 2E5LM 1QUSA 5EP1A 1TDHA 4GC9A 3W0LB 4UN2B 4OVZA 3SHGB 3B74A 2G3QA 1GO5A 1MX0A 3KOWE 4QOZC 2Z4SA 2CWBA 1OTRA 3K2LA 4R3DA 3TPZA 3FYCA 2VIIA 3VDPA 2ZM6M 4GKKM 3FYDA 1E32A 1MU5A 3D8LA 1L2CA 2V1UA 1PRBA 3PVSA 3KXEC 1VDDA 4FCTA 2XEPA 2EKFA 5FTLA 4DR7M 4Z8XA 4RNAA 3SAVA 1SXJB 2OPFA 2XLJA 1IN4A 3HU1A 1J5EM 1YLAA 4LFCM 2L2DA 2R65A 1HT2E 2DHYA 2WSCF 2K9DA 3R9XB 4Z6YA 3SARA 1WGNA 4PCZA 3GLHE 2B3TA 2DAIA 1GJSA 1NNUC 1KYIA 1WGLA 2ZTCA 1NJGA 4FVMA 1YE9A 2JP7A 1D0LA 3FUUA 2CRUA 3GLHA 3J2PB 3ZH9B 4PDGA 4IBFA 3T15A 3PFIA 4DUZM 5FTNA 3K1JA 2KNAA 2Y0TA 4OW0A 3IHPA 4FW9A 4GH9A 3K9PA 3GLFE 4AQYM 3UMMA 1QVRA 3IG8A 1IY1A 3GLIE 2CV1A 4LF6M 3GLFA 2I7PA 4NC6A 3L29A 3SASA 3GLIA 2X8AA 4DV3M 1BVSA 2WSEF 3L2AA 2KHHA 4DUYM 3VDUA 1JR3E 1N77A 4LFBM 3LVVA 1QZMA 2Z7JA 4DV5M 1NHWC 1W5SA 1NV9A 1JR3A 3SYLA 1GKIA 1JB0F 5ITQA 1TGUA 4G4QA 4GITA 4GC5A 3A42A 1PM5A 3QYEA 1AUAA 3QWLA 4Q7JA 3L25A 1SG9A 3THGA 3U61B 1QYRA 2CE7A 4CISA 1R7RA 3UZUA 2DVWB 3T6PA 3GRVA 1TH2A 4GHAA 3HKPA 4FWGA 4DV7M 2J5YA 2QHOB 1HNZM 3TWMA 1V34A 2ZTDA 1NO1A 1EFUB 2BWEA 5IREB 4AZFA 3U6QA 4LGMA 3I51A 3C9PA 4JV5M 4GHLA 4HEOA 4JN6A 4QHSA 2C9OA 3AL0C 2DAGA 3HHXA 4RKUF 3AFHA 4I5SA 1J7KA 1Z5BA 4AW4A 1PJTA 1V33A 3U6CA 1LV7A 2FE8A 1DGHB 2DNAA 3U6EA 2EA0A 1IBLM 3DA1A 3LMMA 1FNNA 4G3OA 1D0KA 4GKJM 4WURA 2AHMA 2ZAMA 4MGKE 3KW6A 4CGYB 8CATA 2FFJA 2G5GX 2C5RA 3H4MA 2UXBM 1VDLA 1EE8A 2F5OA 3FUXA 2CP8A 3T1HM 4YHHM 5C18A 2EO2A 3K8ZA 2QBYB 2KNZA 2OQ4A 2XFSA 2R6FA 4IIWA 5JI2E 1ZAEA 1MJGM 2BJWA 2EUCA 3SATA 3SBJA 2HHHM 3AKZA 3UK6A 2FH0A 4QNMA 2Z4RA 3BXWA 4IBBA 3AOEC 4LFAM 4NOOB 3GQ5A 5BR8M 1G59A 2CHVA 3Q8GA 2DKLA 1IBKM 2NQ8C 1K3WA 1G41A 1NY5A 3RGPA 4AG5A 1DV0A 3GRYA 2LBCA 1IY2A 4B3RM 4M0DA 1R2YA 1NY6A 2EKKA 1GABA 4ANRA 4AKHA 1ZV1A 4AG6A 2F5SA 3M7GA 4B3SM 5L8RF 1TR8A 2RRUA 4L4UA 2R44A 3B89A 3CGWA 2DZOB 3HHWA 2D7GA 5BPVA 3FTCA 3WHKA 3ZCBB 3ZC7B 1IM2A 2JWSA 3RFWA 4JI5M 2LVQD 2VDBB 2HCBA 3GQ3A 1T43A 3U60B 4LGYA 2LXEA 5LMUM 1HQYE 4IBDA 1OIPA 3KDSE 3U5ZB 1IXSB 4JXJA 4D82A 1I94M 4MB7A 1L1ZA 2LHCA 1YUBA 2BNKA 4X62M 4LJ7A 2UU9M 3QYBA 2CEAA 1ZQ9A 3FE3A 3U6SA 1WR1B 4NXNM 3C58A 4DR1M 2F5NA 1E94E 3U6DA 4D81A 2CHQA 2L7IA 2Z3XA 1X37A 3E4RA 1VEKA 4CHTB 1JQJC 2K47A 1ZMUA 3VFDA 3GRUA 7CATA 1L1TA 3ZQJA 4LY6A 4FWDA 1G71A 2LWXA 3R8FA 2MJ5B 2CV2A 1XWIA 2DENA 1E9SA 2QCUA 1TTEA 1TF0B 4X65M 4LJAA 1GJTA 3ILKA 3I01M 1ZMWA 4MM3B 4HLQA 1IN6A 3FD9A 3PXGA 4LZZA 4DBGB 3B7NA 2L09A 3L28A 3BOSA 3FKEA 3IECA 4L8RC 1VEJA 5C1BA 1HNWM 2UUCM 4I4LA 4DV0M 1G4AE 1UFZA 4JI8M 2F5PA 2KNVA 5ITYA 1XMOM 1PJSA 2DAMA 1SXJE 4NSOB 3KS4A 3E9SA 3FTEA 5KQ8A 4GRIA 1N36M 3FUVA 1SXJA 3HZJA 2HL7A 3SAWA 4I81A 1TH3A 2HKJA 1ZMVA 4IBJA 4LF4M 1NVMA 3FTFA 2KXEA 2JUJA 4FCVA 1S3SA 2Y20A 2DWZB 2KW0A 3HY5A 3KOZE 2R4JA 4LJ8A 2JZ1A 1XXHB 4M9XA 1R6BX 1HNXM 1PJQA 2OO9A 4F1IA 1J09A 2Y0QA 1K3XA 4G4NA 1Q39A 1KFVA 2JA2A 5E6JA 3LCVB 2Z8YM 1RU3A 1XC8A 4QOSA 4LF7M 1IN5A 1GL6A 4L6V6 3I04M 1NV8A 1NJFA 5IWAM 1Z5CA 1T3TA 3HHYA 4NSRA 5FSWA 5EXXA 4B08A 3W67A 1AIPC 3JAMS 2CV0A 4ZPXA 4QNRA 2DAEA 4BLCA 2DZNB 3A46A 4P16A 2H5XA 4CJ6A 5IZ7D 3LVWA 2C98A 2QNJA 2ZBKB 2WSFF 1W5TA 3EIHA 3GPUA 1NNJA 5FTKA 4B7HA 1G3IA 2XZUA 1N78A 2O5RA 4OU7A 2D7HA 3TQSA 1IXZA 4L15A 1TDZA 3U61A 1QDRA 4FD2A 4IBCA 3WHLA 3HJSA 1XNRM 2R18A 5ITRA 2DWMA 3FUTA 1QUTA 4L16A 5DYGA 4X64M 2KRUA 1GVNA 5DYIA 2X4AA 2X49A 1QAMA 2A5YB 3W68A 1HR0M 2W82A 3TWLA 1DGGA 2QZ4A 3KSXA 2FS1A 1TH4A 2O25A 5DNYA 1QAQA 4AI6A 3GQ4A 4L78A 5EXPA 5EP4A 1OFIA 1WIVA 1DO0A 3SC3A 1DGHA 2QENA 3GLGB 3J7BA 3EIEA 4XBOA 5KPZA 2XGNA 3HGIA 3U6LA 3L27A 2M60A 2BJVA 5IT9S 4KLNA 4EIWA 1WJ7A 2LNHC 3GPYA 4M0WA 2QP9X 1R5LA 3NWLA 2FNAA 2JY7A 3J80S 5LMNM 3PNVA 1E9RA 1I4WA 3L26A 4B7GA 3JR5A 1N34M 2UUBM 2QBYA 1R2ZA 1QDTA 4P17A 3SHFA 4PT5A 1IY0A 3A98B 2JXNA 1EIJA 4GMQA 2P5TA 3M6AA 3BBZA 1OKSA 2R45A 4OVZB 4RF0A 3UJNA 4F2LA 4JI3M 3OTOM 3LQQA 2EJSA 3J27B 1NSFA 2XFTA 3HJ8A 3KOYE 3VK7A 2UXDM 4LZJA 3AJIB 2C9CA 2J7OA 5H37D 4PD2A 5ITUA 3MHVC 3E21A 4NRWA 3KSJA 2VQEM 2L4EA 1Q02A 1C1KA 1JR3D 2LTUA 3RE8A 1IXRC 1ORYB 2CFOA 4GEWA 4II7A 4LJ6A 4LRTA 3FRHA 1Q3BA 5ITTA 5EQTA 4BBAA 5KQDA 4DR3M 2LVNC 1P3QQ 4PDIA 2C96A 2J7NA 3E46A 4A3VB 1XHBA 1OIZA 3B9PA 1CUKA 1OQYA 3MMPA 1N32M 3GPXA 3T1YM 1L2DA 2KA6B 1D2NA 4KO8A 2VF8A 2WZJA 3CF6E 1PJIA 3U60A 3KP0E 3LCUA 4JI2M 3KFUG 1XMQM 3U6PA 2XSZA 3KOXE 1HJPA 2KZUA 3U5ZA 1IXSA 1GLNA 1FJGM 2I7NA 2HWJA 3M0EA 4JI0M 2KZSA 2YNMD 3V76A 4I8OA 5FTMA 4G4OA 4ITQA 2KRKA 4IJEA 3J7AS 3GLHB 3HU2A 3TE6A 4LG2A 1KSFX 3CF0A 4DR2M 5FTJA 1H6UA 2MH8A 4G6ZA 4XGIA 4DV4M 4DV1M 4IBEA 2DAKA 3AV0A 2R62A 3KS8A 2VF7A 3GRRA 3T38A 3GPPA 2MR9A 3GLFB 3NBXX 4MGZE 1VQ1A 2LVAA 3H4JA 2DWLA 3U6OA 4TUWA 3GLIB 2YQZA 1DGFA 4R7GA 1Z6TA 3C3DA 2C99A 1IN8A 5JI3E 3HWSA 3VLFB 4G4RA 2K0BX 4KHPM 2KEBA 5FLXS 1Q3CA 2CUZA 4DR4M 4MGIE 1OFHA 4QHTA 1N33M 3K92A 1C7YA 2GQFA 2HAKA 2ZAOA 4OX9M 4IBIA 1IQPA 4CIZA 2DZLA 4WP2A 3PNYA 2JY6B 3RGSA 3I4YA 3U6MA 3K9OA 3SMPA 3VKHA 4KT0F 2LVOC 3C3EA 2RGHA 2ZANA 2JY8A 3KP1E 4MGHA 1F4IA 3SAUA 3MK6A 4YY3M 2BWBA 2DI0A 2XZFA 5ITXE 3B7ZA 2F5QA 3SMSA 4LJ4A 3FRIA 3JR4A 4MH0E 2JNHA 2JY5A 2MGWA 3CF2A 1XXHE 1PGYA 1OAOC 3LW5F 4IBGA 5ITXA 2VQFM 3HJQA 2OOAA 4AKIA 1HQCA 2CHGA 2ERCA 5EXTA 5EP2A 4R71A 5A2QS 1A5TA 4JI6M 1XXHA 2DHRA 2KDLA 5KPRA 3DFZA 4BB9A 3CTWB 4X66M 4D80A 1G8PA 2DXIA 2LHGA 3AOEA 3A45A 4JI1M 2YFQA 4LCBA 2L7HA 1SXJC 2R4EA 3MJ5A 3I4VA 3IG5A 3KVWA 3J81S 2GNOA 1OJLA 1UM8A 5KPTA 2R0IA 4IJFA 1DGBA 5EP3A 1N75A 4Y28F 4DR5M 4AKGA 2LVPC 3D8BA 5EXSA 3LQRA 4MGYE 4B3MM 2MROB 1OAIA 1XNQM 2QQ8A 1IBMM 1Y8GA 3UGJA 4DV2M 2LH0A 3HHZA 2H1RA 4S12A 2OOBA 1V92A 2UXCM 3DOAA 1XB2B 3DZDA 2JZ0A 2YR0A 3AOGA 2L6OA 3Q8XA 1D0MA 2K6BA 2XSZD 2APLA 3FUWA 3QAUA 3FTDA 2M5ZA 4DR6M 2FOIC 4REZA 2QSFX 3SFZA 1QAOA 1QQWA 1DO2A 2XH9A 3NBIA 3TWKA 3GO8A 1HT1E 1L2BA 3HU3A 1MN3A 4GIPA 4WW0A 4JI4M 4XK8F 3TL4X 1QANA
chains in the Genus database with same CATH topology
2FH0A 2CRUA 2K6BA 1EIJA 2JXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH0 A;  2CRU A;  2K6B A;  1EIJ A;  2JXN A; 
#chains in the Genus database with same CATH topology
 3B7Q A;  4K0K M;  1YSY A;  2Y21 A;  4M9Z A;  5GKN A;  3GP1 A;  2Q2E B;  3W0F A;  3GLG E;  4DV6 M;  3VK8 A;  3HX3 A;  4LJ9 A;  4LF5 M;  4NXM M;  1IFY A;  1SXJ D;  2QPA A;  4FWH A;  4B3T M;  1Z5A A;  1NHG C;  2D7E A;  4IBK A;  4NRV A;  5KO3 A;  3GLG A;  2UUA M;  1LTM A;  4KOD A;  4B7F A;  2F4V M;  1IN7 A;  3VKG A;  4LF8 M;  1L8Q A;  5E26 A;  3F92 A;  1PJJ A;  4HL4 A;  4FCW A;  2O01 F;  5DFL A;  5F3W A;  2R46 A;  2RKO A;  2RGO A;  2V6Z M;  4LRS A;  4NL4 H;  1Z59 A;  2V1C A;  3SYK A;  1R4G A;  4JYA M;  1WXQ A;  5EJC A;  1GL7 A;  4JI7 M;  2XF3 A;  4M9S A;  1VG5 A;  1WHC A;  1K82 A;  1QZE A;  2DWN A;  2N35 A;  2L4F A;  4LJ5 A;  4RF1 A;  1T6O A;  4W5W A;  2G8L A;  1VEG A;  4LF9 M;  2E5L M;  1QUS A;  5EP1 A;  1TDH A;  4GC9 A;  3W0L B;  4UN2 B;  4OVZ A;  3SHG B;  3B74 A;  2G3Q A;  1GO5 A;  1MX0 A;  3KOW E;  4QOZ C;  2Z4S A;  2CWB A;  1OTR A;  3K2L A;  4R3D A;  3TPZ A;  3FYC A;  2VII A;  3VDP A;  2ZM6 M;  4GKK M;  3FYD A;  1E32 A;  1MU5 A;  3D8L A;  1L2C A;  2V1U A;  1PRB A;  3PVS A;  3KXE C;  1VDD A;  4FCT A;  2XEP A;  2EKF A;  5FTL A;  4DR7 M;  4Z8X A;  4RNA A;  3SAV A;  1SXJ B;  2OPF A;  2XLJ A;  1IN4 A;  3HU1 A;  1J5E M;  1YLA A;  4LFC M;  2L2D A;  2R65 A;  1HT2 E;  2DHY A;  2WSC F;  2K9D A;  3R9X B;  4Z6Y A;  3SAR A;  1WGN A;  4PCZ A;  3GLH E;  2B3T A;  2DAI A;  1GJS A;  1NNU C;  1KYI A;  1WGL A;  2ZTC A;  1NJG A;  4FVM A;  1YE9 A;  2JP7 A;  1D0L A;  3FUU A;  2CRU A;  3GLH A;  3J2P B;  3ZH9 B;  4PDG A;  4IBF A;  3T15 A;  3PFI A;  4DUZ M;  5FTN A;  3K1J A;  2KNA A;  2Y0T A;  4OW0 A;  3IHP A;  4FW9 A;  4GH9 A;  3K9P A;  3GLF E;  4AQY M;  3UMM A;  1QVR A;  3IG8 A;  1IY1 A;  3GLI E;  2CV1 A;  4LF6 M;  3GLF A;  2I7P A;  4NC6 A;  3L29 A;  3SAS A;  3GLI A;  2X8A A;  4DV3 M;  1BVS A;  2WSE F;  3L2A A;  2KHH A;  4DUY M;  3VDU A;  1JR3 E;  1N77 A;  4LFB M;  3LVV A;  1QZM A;  2Z7J A;  4DV5 M;  1NHW C;  1W5S A;  1NV9 A;  1JR3 A;  3SYL A;  1GKI A;  1JB0 F;  5ITQ A;  1TGU A;  4G4Q A;  4GIT A;  4GC5 A;  3A42 A;  1PM5 A;  3QYE A;  1AUA A;  3QWL A;  4Q7J A;  3L25 A;  1SG9 A;  3THG A;  3U61 B;  1QYR A;  2CE7 A;  4CIS A;  1R7R A;  3UZU A;  2DVW B;  3T6P A;  3GRV A;  1TH2 A;  4GHA A;  3HKP A;  4FWG A;  4DV7 M;  2J5Y A;  2QHO B;  1HNZ M;  3TWM A;  1V34 A;  2ZTD A;  1NO1 A;  1EFU B;  2BWE A;  5IRE B;  4AZF A;  3U6Q A;  4LGM A;  3I51 A;  3C9P A;  4JV5 M;  4GHL A;  4HEO A;  4JN6 A;  4QHS A;  2C9O A;  3AL0 C;  2DAG A;  3HHX A;  4RKU F;  3AFH A;  4I5S A;  1J7K A;  1Z5B A;  4AW4 A;  1PJT A;  1V33 A;  3U6C A;  1LV7 A;  2FE8 A;  1DGH B;  2DNA A;  3U6E A;  2EA0 A;  1IBL M;  3DA1 A;  3LMM A;  1FNN A;  4G3O A;  1D0K A;  4GKJ M;  4WUR A;  2AHM A;  2ZAM A;  4MGK E;  3KW6 A;  4CGY B;  8CAT A;  2FFJ A;  2G5G X;  2C5R A;  3H4M A;  2UXB M;  1VDL A;  1EE8 A;  2F5O A;  3FUX A;  2CP8 A;  3T1H M;  4YHH M;  5C18 A;  2EO2 A;  3K8Z A;  2QBY B;  2KNZ A;  2OQ4 A;  2XFS A;  2R6F A;  4IIW A;  5JI2 E;  1ZAE A;  1MJG M;  2BJW A;  2EUC A;  3SAT A;  3SBJ A;  2HHH M;  3AKZ A;  3UK6 A;  2FH0 A;  4QNM A;  2Z4R A;  3BXW A;  4IBB A;  3AOE C;  4LFA M;  4NOO B;  3GQ5 A;  5BR8 M;  1G59 A;  2CHV A;  3Q8G A;  2DKL A;  1IBK M;  2NQ8 C;  1K3W A;  1G41 A;  1NY5 A;  3RGP A;  4AG5 A;  1DV0 A;  3GRY A;  2LBC A;  1IY2 A;  4B3R M;  4M0D A;  1R2Y A;  1NY6 A;  2EKK A;  1GAB A;  4ANR A;  4AKH A;  1ZV1 A;  4AG6 A;  2F5S A;  3M7G A;  4B3S M;  5L8R F;  1TR8 A;  2RRU A;  4L4U A;  2R44 A;  3B89 A;  3CGW A;  2DZO B;  3HHW A;  2D7G A;  5BPV A;  3FTC A;  3WHK A;  3ZCB B;  3ZC7 B;  1IM2 A;  2JWS A;  3RFW A;  4JI5 M;  2LVQ D;  2VDB B;  2HCB A;  3GQ3 A;  1T43 A;  3U60 B;  4LGY A;  2LXE A;  5LMU M;  1HQY E;  4IBD A;  1OIP A;  3KDS E;  3U5Z B;  1IXS B;  4JXJ A;  4D82 A;  1I94 M;  4MB7 A;  1L1Z A;  2LHC A;  1YUB A;  2BNK A;  4X62 M;  4LJ7 A;  2UU9 M;  3QYB A;  2CEA A;  1ZQ9 A;  3FE3 A;  3U6S A;  1WR1 B;  4NXN M;  3C58 A;  4DR1 M;  2F5N A;  1E94 E;  3U6D A;  4D81 A;  2CHQ A;  2L7I A;  2Z3X A;  1X37 A;  3E4R A;  1VEK A;  4CHT B;  1JQJ C;  2K47 A;  1ZMU A;  3VFD A;  3GRU A;  7CAT A;  1L1T A;  3ZQJ A;  4LY6 A;  4FWD A;  1G71 A;  2LWX A;  3R8F A;  2MJ5 B;  2CV2 A;  1XWI A;  2DEN A;  1E9S A;  2QCU A;  1TTE A;  1TF0 B;  4X65 M;  4LJA A;  1GJT A;  3ILK A;  3I01 M;  1ZMW A;  4MM3 B;  4HLQ A;  1IN6 A;  3FD9 A;  3PXG A;  4LZZ A;  4DBG B;  3B7N A;  2L09 A;  3L28 A;  3BOS A;  3FKE A;  3IEC A;  4L8R C;  1VEJ A;  5C1B A;  1HNW M;  2UUC M;  4I4L A;  4DV0 M;  1G4A E;  1UFZ A;  4JI8 M;  2F5P A;  2KNV A;  5ITY A;  1XMO M;  1PJS A;  2DAM A;  1SXJ E;  4NSO B;  3KS4 A;  3E9S A;  3FTE A;  5KQ8 A;  4GRI A;  1N36 M;  3FUV A;  1SXJ A;  3HZJ A;  2HL7 A;  3SAW A;  4I81 A;  1TH3 A;  2HKJ A;  1ZMV A;  4IBJ A;  4LF4 M;  1NVM A;  3FTF A;  2KXE A;  2JUJ A;  4FCV A;  1S3S A;  2Y20 A;  2DWZ B;  2KW0 A;  3HY5 A;  3KOZ E;  2R4J A;  4LJ8 A;  2JZ1 A;  1XXH B;  4M9X A;  1R6B X;  1HNX M;  1PJQ A;  2OO9 A;  4F1I A;  1J09 A;  2Y0Q A;  1K3X A;  4G4N A;  1Q39 A;  1KFV A;  2JA2 A;  5E6J A;  3LCV B;  2Z8Y M;  1RU3 A;  1XC8 A;  4QOS A;  4LF7 M;  1IN5 A;  1GL6 A;  4L6V 6;  3I04 M;  1NV8 A;  1NJF A;  5IWA M;  1Z5C A;  1T3T A;  3HHY A;  4NSR A;  5FSW A;  5EXX A;  4B08 A;  3W67 A;  1AIP C;  3JAM S;  2CV0 A;  4ZPX A;  4QNR A;  2DAE A;  4BLC A;  2DZN B;  3A46 A;  4P16 A;  2H5X A;  4CJ6 A;  5IZ7 D;  3LVW A;  2C98 A;  2QNJ A;  2ZBK B;  2WSF F;  1W5T A;  3EIH A;  3GPU A;  1NNJ A;  5FTK A;  4B7H A;  1G3I A;  2XZU A;  1N78 A;  2O5R A;  4OU7 A;  2D7H A;  3TQS A;  1IXZ A;  4L15 A;  1TDZ A;  3U61 A;  1QDR A;  4FD2 A;  4IBC A;  3WHL A;  3HJS A;  1XNR M;  2R18 A;  5ITR A;  2DWM A;  3FUT A;  1QUT A;  4L16 A;  5DYG A;  4X64 M;  2KRU A;  1GVN A;  5DYI A;  2X4A A;  2X49 A;  1QAM A;  2A5Y B;  3W68 A;  1HR0 M;  2W82 A;  3TWL A;  1DGG A;  2QZ4 A;  3KSX A;  2FS1 A;  1TH4 A;  2O25 A;  5DNY A;  1QAQ A;  4AI6 A;  3GQ4 A;  4L78 A;  5EXP A;  5EP4 A;  1OFI A;  1WIV A;  1DO0 A;  3SC3 A;  1DGH A;  2QEN A;  3GLG B;  3J7B A;  3EIE A;  4XBO A;  5KPZ A;  2XGN A;  3HGI A;  3U6L A;  3L27 A;  2M60 A;  2BJV A;  5IT9 S;  4KLN A;  4EIW A;  1WJ7 A;  2LNH C;  3GPY A;  4M0W A;  2QP9 X;  1R5L A;  3NWL A;  2FNA A;  2JY7 A;  3J80 S;  5LMN M;  3PNV A;  1E9R A;  1I4W A;  3L26 A;  4B7G A;  3JR5 A;  1N34 M;  2UUB M;  2QBY A;  1R2Z A;  1QDT A;  4P17 A;  3SHF A;  4PT5 A;  1IY0 A;  3A98 B;  2JXN A;  1EIJ A;  4GMQ A;  2P5T A;  3M6A A;  3BBZ A;  1OKS A;  2R45 A;  4OVZ B;  4RF0 A;  3UJN A;  4F2L A;  4JI3 M;  3OTO M;  3LQQ A;  2EJS A;  3J27 B;  1NSF A;  2XFT A;  3HJ8 A;  3KOY E;  3VK7 A;  2UXD M;  4LZJ A;  3AJI B;  2C9C A;  2J7O A;  5H37 D;  4PD2 A;  5ITU A;  3MHV C;  3E21 A;  4NRW A;  3KSJ A;  2VQE M;  2L4E A;  1Q02 A;  1C1K A;  1JR3 D;  2LTU A;  3RE8 A;  1IXR C;  1ORY B;  2CFO A;  4GEW A;  4II7 A;  4LJ6 A;  4LRT A;  3FRH A;  1Q3B A;  5ITT A;  5EQT A;  4BBA A;  5KQD A;  4DR3 M;  2LVN C;  1P3Q Q;  4PDI A;  2C96 A;  2J7N A;  3E46 A;  4A3V B;  1XHB A;  1OIZ A;  3B9P A;  1CUK A;  1OQY A;  3MMP A;  1N32 M;  3GPX A;  3T1Y M;  1L2D A;  2KA6 B;  1D2N A;  4KO8 A;  2VF8 A;  2WZJ A;  3CF6 E;  1PJI A;  3U60 A;  3KP0 E;  3LCU A;  4JI2 M;  3KFU G;  1XMQ M;  3U6P A;  2XSZ A;  3KOX E;  1HJP A;  2KZU A;  3U5Z A;  1IXS A;  1GLN A;  1FJG M;  2I7N A;  2HWJ A;  3M0E A;  4JI0 M;  2KZS A;  2YNM D;  3V76 A;  4I8O A;  5FTM A;  4G4O A;  4ITQ A;  2KRK A;  4IJE A;  3J7A S;  3GLH B;  3HU2 A;  3TE6 A;  4LG2 A;  1KSF X;  3CF0 A;  4DR2 M;  5FTJ A;  1H6U A;  2MH8 A;  4G6Z A;  4XGI A;  4DV4 M;  4DV1 M;  4IBE A;  2DAK A;  3AV0 A;  2R62 A;  3KS8 A;  2VF7 A;  3GRR A;  3T38 A;  3GPP A;  2MR9 A;  3GLF B;  3NBX X;  4MGZ E;  1VQ1 A;  2LVA A;  3H4J A;  2DWL A;  3U6O A;  4TUW A;  3GLI B;  2YQZ A;  1DGF A;  4R7G A;  1Z6T A;  3C3D A;  2C99 A;  1IN8 A;  5JI3 E;  3HWS A;  3VLF B;  4G4R A;  2K0B X;  4KHP M;  2KEB A;  5FLX S;  1Q3C A;  2CUZ A;  4DR4 M;  4MGI E;  1OFH A;  4QHT A;  1N33 M;  3K92 A;  1C7Y A;  2GQF A;  2HAK A;  2ZAO A;  4OX9 M;  4IBI A;  1IQP A;  4CIZ A;  2DZL A;  4WP2 A;  3PNY A;  2JY6 B;  3RGS A;  3I4Y A;  3U6M A;  3K9O A;  3SMP A;  3VKH A;  4KT0 F;  2LVO C;  3C3E A;  2RGH A;  2ZAN A;  2JY8 A;  3KP1 E;  4MGH A;  1F4I A;  3SAU A;  3MK6 A;  4YY3 M;  2BWB A;  2DI0 A;  2XZF A;  5ITX E;  3B7Z A;  2F5Q A;  3SMS A;  4LJ4 A;  3FRI A;  3JR4 A;  4MH0 E;  2JNH A;  2JY5 A;  2MGW A;  3CF2 A;  1XXH E;  1PGY A;  1OAO C;  3LW5 F;  4IBG A;  5ITX A;  2VQF M;  3HJQ A;  2OOA A;  4AKI A;  1HQC A;  2CHG A;  2ERC A;  5EXT A;  5EP2 A;  4R71 A;  5A2Q S;  1A5T A;  4JI6 M;  1XXH A;  2DHR A;  2KDL A;  5KPR A;  3DFZ A;  4BB9 A;  3CTW B;  4X66 M;  4D80 A;  1G8P A;  2DXI A;  2LHG A;  3AOE A;  3A45 A;  4JI1 M;  2YFQ A;  4LCB A;  2L7H A;  1SXJ C;  2R4E A;  3MJ5 A;  3I4V A;  3IG5 A;  3KVW A;  3J81 S;  2GNO A;  1OJL A;  1UM8 A;  5KPT A;  2R0I A;  4IJF A;  1DGB A;  5EP3 A;  1N75 A;  4Y28 F;  4DR5 M;  4AKG A;  2LVP C;  3D8B A;  5EXS A;  3LQR A;  4MGY E;  4B3M M;  2MRO B;  1OAI A;  1XNQ M;  2QQ8 A;  1IBM M;  1Y8G A;  3UGJ A;  4DV2 M;  2LH0 A;  3HHZ A;  2H1R A;  4S12 A;  2OOB A;  1V92 A;  2UXC M;  3DOA A;  1XB2 B;  3DZD A;  2JZ0 A;  2YR0 A;  3AOG A;  2L6O A;  3Q8X A;  1D0M A;  2K6B A;  2XSZ D;  2APL A;  3FUW A;  3QAU A;  3FTD A;  2M5Z A;  4DR6 M;  2FOI C;  4REZ A;  2QSF X;  3SFZ A;  1QAO A;  1QQW A;  1DO2 A;  2XH9 A;  3NBI A;  3TWK A;  3GO8 A;  1HT1 E;  1L2B A;  3HU3 A;  1MN3 A;  4GIP A;  4WW0 A;  4JI4 M;  4XK8 F;  3TL4 X;  1QAN A; 
#chains in the Genus database with same CATH homology
 2FH0 A;  2CRU A;  2K6B A;  1EIJ A;  2JXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...