1EIJA

Nmr ensemble of methanobacterium thermoautotrophicum protein 1615
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
MRQQLEMQKKQIMMQILTPEARSRLANLRLTRPDFVEQIELQLIQLAQMGRVRSKITDEQLKELLKRVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MTH1615
publication title Structural proteomics of an archaeon.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 17
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2000-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 1eijA00
2K6BA 1EIJA 2JXNA 2FH0A 2CRUA
chains in the Genus database with same CATH superfamily
2EKFA 3CGWA 3DA1A 1TF0B 3FE3A 3K9OA 2CV2A 2DWZB 3PVSA 1HR0M 2R0IA 4IBBA 1PGYA 3FRHA 4LJ9A 3TQSA 2CRUA 1N32M 4GH9A 3HKPA 1D0MA 2LVPC 2OOAA 2JP7A 1NJFA 2LXEA 2QQ8A 4LJ8A 3T38A 3VDPA 4D80A 1J5EM 4LF7M 2OOBA 2DI0A 2J7OA 4Q7JA 2CUZA 2LHGA 3RGPA 5IWAM 3HJQA 2KRKA 2K6BA 3W0FA 2VF8A 4B3SM 4DV4M 1Z5CA 2JXNA 2CWBA 5KPZA 3W67A 4UN2B 1NNUC 1DGFA 4LF4M 3I51A 1OJLA 1L1ZA 1DGGA 4LCBA 2MGWA 4BLCA 2FS1A 3SATA 2Y0QA 2C5RA 4LJ5A 1GJSA 1OKSA 2XLJA 3I01M 2D7GA 1IN5A 4FCWA 3PXGA 2KNAA 1YLAA 2CV0A 1TR8A 3GRYA 3KSJA 4DV2M 3AOGA 5EP3A 1KYIA 2DAGA 1KFVA 4DR7M 2M60A 2KA6B 1V92A 2K9DA 3B7ZA 4B3MM 3AV0A 4KODA 1Q39A 1UFZA 4G4RA 2JUJA 3TE6A 2J7NA 2Y21A 3VK7A 2R65A 4XGIA 3B9PA 3JR4A 5FTMA 1R2YA 2DAEA 1OFIA 1YUBA 2HWJA 1E9SA 2R62A 1Q02A 2YFQA 1PJIA 3B7QA 1I94M 1WGNA 2JWSA 1IBLM 4QOZC 4NSOB 1LV7A 4II7A 4AG6A 2UUBM 4D82A 1DGHA 3HX3A 1QVRA 1FJGM 2FFJA 3GPPA 4MGYE 1J09A 2ZANA 3KOXE 4GC9A 4L6V6 1NV9A 2ZBKB 3UJNA 3KS8A 2EA0A 1XMOM 3VK8A 2ZTDA 2DAMA 5BR8M 2LHCA 1T43A 2DAIA 3SYLA 1DV0A 4DR4M 1HJPA 1NJGA 2K0BX 4WW0A 3GP1A 4OVZA 2VDBB 1E9RA 5EJCA 3GLGE 3C58A 4JI2M 1OFHA 5ITYA 4RNAA 4JI3M 1L2DA 5EP1A 4DR2M 4D81A 3VLFB 1N75A 8CATA 3GPYA 4LRSA 4FD2A 1MJGM 3U5ZA 2YQZA 2L2DA 3K8ZA 1HQCA 2W82A 3VDUA 2R46A 4QNMA 2YR0A 1NO1A 4I81A 1XXHA 1L1TA 2UUAM 3CF2A 2DXIA 2EKKA 2KDLA 3GO8A 3GLIA 4JI0M 2KZUA 3GLHA 5LMUM 2BNKA 5FTKA 2VF7A 4Z8XA 5E6JA 1QZMA 4NOOB 1N33M 1ZMUA 3HU1A 1IY1A 3KOWE 5DFLA 3IG8A 1NY5A 3LVVA 4LJ7A 4KLNA 1BVSA 2DKLA 3HU3A 4IJFA 4AKGA 1V34A 1OQYA 1Z6TA 4FWHA 3FD9A 4DUYM 1OAOC 3BOSA 4IIWA 1XXHE 4BBAA 4XK8F 3GLFA 1IBKM 2XFTA 1CUKA 4IBGA 1E94E 3GLIE 2QZ4A 3HWSA 2O01F 1T3TA 5F3WA 2JY7A 3GLHE 1EFUB 1XHBA 2KXEA 2R4JA 3ZC7B 1HT1E 4B7GA 3TWMA 1OTRA 3MK6A 4GITA 3SHGB 1IXSB 1OIPA 3U61A 3J27B 2QBYB 2KNVA 1DGBA 3T1YM 2DHRA 3M6AA 3A98B 2Z7JA 1W5TA 2Z4SA 1SXJB 3IHPA 1L2CA 1XMQM 4BB9A 1TTEA 4MM3B 4M0WA 2DHYA 1JR3A 4LF6M 4XBOA 3R9XB 2FE8A 2FH0A 3KW6A 4RKUF 3TL4X 2CFOA 4JI4M 3U6DA 2KRUA 3SMSA 1WXQA 3KP0E 3T6PA 4DV1M 3BBZA 4PCZA 2LVQD 2ZAMA 3HGIA 1IN8A 3GRUA 1YSYA 2OQ4A 4JV5M 4CGYB 2XFSA 2C9CA 4G3OA 2RGHA 1C7YA 1K3WA 1EE8A 4K0KM 2JZ1A 2DZLA 4MGKE 2QPAA 1SXJD 1VG5A 5C18A 5JI3E 1G4AE 1JR3E 2Q2EB 4CJ6A 4LJ6A 3AL0C 1QDRA 4GKJM 2LVOC 2X4AA 2ZTCA 1IN6A 4DR6M 3ZCBB 2QNJA 1ZMWA 3LMMA 4L4UA 3V76A 4IBFA 4X62M 4JI7M 1GL7A 1HT2E 3U6LA 1R2ZA 3BXWA 3RFWA 3UZUA 2F5NA 2X8AA 3RGSA 3SFZA 4LFAM 1HNZM 4GMQA 2CHGA 3LW5F 4DV7M 4IJEA 1PJQA 2V1CA 3C3DA 4G4NA 4P16A 2CHVA 4IBJA 1MX0A 2DNAA 1UM8A 2DWMA 2QP9X 3A45A 3AOEA 2HL7A 2EJSA 3FTEA 2WZJA 3U60B 4B3RM 2RRUA 3MJ5A 2V6ZM 3FUTA 4NXNM 4QOSA 2L6OA 4IBEA 5L8RF 3KFUG 1QZEA 4R71A 3I4VA 3HJSA 4QHSA 2Z4RA 5FTJA 4MGZE 2XSZD 1QUTA 4DV0M 2L4EA 1TGUA 2XH9A 1PM5A 3SC3A 3A46A 2FNAA 2LVNC 3KOZE 4WURA 1N34M 2LWXA 3K2LA 3UMMA 3EIEA 3Q8GA 3FYCA 2JNHA 3VFDA 4PDIA 2OO9A 5DYGA 2JY5A 4B08A 4CIZA 2OPFA 2DAKA 3NBIA 1WHCA 4KO8A 1P3QQ 5FSWA 2X49A 4X65M 3B7NA 3DZDA 1IXRC 3J7BA 1G59A 1MU5A 3SYKA 1IY0A 1D0LA 1VEKA 3JAMS 2Z3XA 1ORYB 4JN6A 4MH0E 3SAWA 3PFIA 3GLGA 3VKHA 4QHTA 3LQQA 3GQ4A 4HEOA 4L16A 3GRRA 1HNWM 3C3EA 2O25A 3HHZA 5ITXA 4TUWA 2DWNA 1G71A 2ZAOA 3Q8XA 5KO3A 1XC8A 4GHLA 3AOEC 2QHOB 2MJ5B 3VKGA 2K47A 5EQTA 3IECA 3U6EA 3A42A 5ITRA 1SG9A 3J80S 1IQPA 2HHHM 4DR3M 4NRWA 1AIPC 2R44A 2LH0A 3K92A 1FNNA 2UUCM 1QQWA 3U6SA 4JI1M 3GQ5A 1QUSA 2A5YB 1IXSA 4FWGA 3PNVA 4FVMA 3WHLA 3B74A 1GO5A 3QWLA 4LY6A 1F4IA 4R7GA 1GJTA 2MH8A 1SXJA 4FCVA 5ITXE 4LGYA 1GABA 4JXJA 4HL4A 4L15A 3I04M 2QENA 4F2LA 2MROB 1TH2A 3SHFA 4FWDA 3ZQJA 7CATA 2GQFA 3LCVB 4IBCA 4AI6A 1C1KA 1VDDA 2F5OA 1LTMA 3SAVA 5EP2A 4CISA 4B3TM 1N78A 2XZFA 2HAKA 2L4FA 3E4RA 4LRTA 1A5TA 1RU3A 1EIJA 3NWLA 3DFZA 2APLA 1SXJE 1S3SA 2VQEM 3U6QA 4M9XA 2L7IA 2H1RA 2F5PA 5C1BA 3L27A 1IM2A 2JZ0A 3HZJA 4PT5A 3J81S 3R8FA 4KT0F 1K3XA 2UU9M 1NV8A 2P5TA 3LQRA 1Q3CA 3AFHA 2XZUA 4X66M 1T6OA 1VQ1A 4LFBM 1G41A 1K82A 1DGHB 2KNZA 1MN3A 5FTNA 2BWEA 2XSZA 3AJIB 1ZMVA 2GNOA 1L8QA 3CF6E 4OW0A 3ZH9B 2LNHC 4AG5A 3LCUA 4NC6A 1DO0A 1ZAEA 4B7HA 4M9SA 4M9ZA 2H5XA 4YHHM 1IN4A 3L29A 4QNRA 2ERCA 5EXSA 5ITUA 4I5SA 2WSCF 4LZZA 4OVZB 5BPVA 4LF8M 4L78A 2L09A 3HJ8A 4NSRA 1Z5BA 1N36M 4GHAA 1G8PA 1QAMA 4CHTB 3FTDA 3J2PB 4REZA 4G4QA 1QAOA 1TH4A 1KSFX 3QAUA 3GPXA 4JI6M 4DV3M 2C9OA 1IY2A 1XXHB 4GRIA 2NQ8C 4G6ZA 2QSFX 4RF0A 4DBGB 3L25A 3GLIB 1E32A 3GLHB 4LJAA 3FUUA 1VEGA 3FRIA 3TWKA 2UXBM 1H6UA 2CHQA 4MGHA 4NXMM 3KOYE 1TDHA 3CF0A 2HCBA 2EO2A 1J7KA 1HQYE 4KHPM 1JB0F 1Y8GA 2Y20A 5FLXS 2WSEF 2F4VM 3GLFB 4AW4A 1AUAA 4MGIE 2LBCA 1D2NA 1I4WA 2QCUA 4AQYM 2J5YA 4Z6YA 1Z5AA 1L2BA 1ZQ9A 2RGOA 1WIVA 2O5RA 3UGJA 3GRVA 2BJWA 3U61B 2CEAA 4DUZM 2RKOA 3D8BA 3WHKA 3SBJA 1PJJA 3M7GA 2Z8YM 3PNYA 3QYBA 2R18A 5DNYA 2DWLA 5IT9S 5EP4A 3SASA 3C9PA 1NNJA 2G8LA 4FCTA 3ILKA 4FW9A 4AKHA 5EXXA 2LVAA 1GKIA 2F5QA 3HHYA 2AHMA 3W68A 3FTCA 5LMNM 5IREB 4JI5M 3MMPA 2DVWB 1XWIA 1XB2B 1NHWC 3CTWB 2G5GX 4OX9M 2JA2A 4F1IA 2UXCM 1QDTA 2XGNA 2ZM6M 1PJSA 1D0KA 1HNXM 3HY5A 2LTUA 4LJ4A 1N77A 4DR1M 3U6CA 1XNRM 1JR3D 4IBIA 3W0LB 2CV1A 2KZSA 2R4EA 1DO2A 3FUWA 1NHGC 3SARA 1IFYA 4Y28F 5H37D 3RE8A 3T1HM 4GKKM 3L26A 5IZ7D 3D8LA 3HHXA 5DYIA 2XEPA 3K1JA 4ANRA 4DV6M 4HLQA 4JI8M 4S12A 4P17A 2D7HA 4LF5M 1NVMA 3NBXX 4IBKA 2E5LM 3B89A 4YY3M 3HHWA 3JR5A 1WR1B 2QBYA 1TDZA 1R6BX 3FUXA 1VDLA 4LG2A 1WGLA 3E21A 4OU7A 2N35A 3LVWA 4MB7A 2KHHA 4PD2A 3F92A 1IBMM 1Q3BA 4I4LA 4RF1A 2KW0A 4WP2A 4GEWA 4LF9M 4IBDA 2EUCA 3KS4A 2G3QA 3FTFA 2C96A 4GIPA 1TH3A 2FOIC 3EIHA 3TPZA 2BJVA 3H4JA 4LFCM 2D7EA 3QYEA 1NSFA 3H4MA 1XNQM 4X64M 1GLNA 2CE7A 2HKJA 5EXPA 1GVNA 4LGMA 5KPTA 2B3TA 1G3IA 4AZFA 5KPRA 2CP8A 2I7NA 3KXEC 1X37A 4W5WA 4B7FA 2Y0TA 1R7RA 2UXDM 3IG5A 5KQ8A 1IXZA 1JQJC 1YE9A 1R4GA 1QANA 3GLGB 1Z59A 1V33A 2WSFF 1IN7A 5ITTA 3M0EA 4GC5A 3KP1E 4M0DA 3FUVA 2KEBA 3SAUA 3I4YA 3THGA 2R45A 2I7PA 3KVWA 2C98A 4NRVA 5A2QS 5ITQA 1ZV1A 1R5LA 1SXJC 2VIIA 1QYRA 3HU2A 3GPUA 3U60A 1WJ7A 4A3VB 2BWBA 2C99A 2DZNB 3E9SA 3GQ3A 1GL6A 3T15A 3KDSE 4I8OA 4L8RC 4EIWA 2VQFM 3KSXA 3OTOM 4JYAM 4DV5M 2JY6B 3U6OA 2MR9A 1PRBA 4PDGA 4ITQA 4G4OA 3U5ZB 3K9PA 1VEJA 3FKEA 3FYDA 5FTLA 5JI2E 3UK6A 2DENA 2YNMD 3DOAA 4R3DA 3U6MA 2XF3A 4LZJA 5EXTA 5GKNA 4AKIA 4ZPXA 1QAQA 3GLFE 3E46A 2DZOB 3L28A 3MHVC 5KQDA 1OIZA 4NL4H 4DR5M 2R6FA 1W5SA 1NY6A 2M5ZA 2L7HA 3J7AS 3AKZA 1OAIA 2JY8A 5E26A 3TWLA 3U6PA 3SMPA 3L2AA 2F5SA 1PJTA 2V1UA
chains in the Genus database with same CATH topology
2K6BA 1EIJA 2JXNA 2FH0A 2CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6B A;  1EIJ A;  2JXN A;  2FH0 A;  2CRU A; 
#chains in the Genus database with same CATH topology
 2EKF A;  3CGW A;  3DA1 A;  1TF0 B;  3FE3 A;  3K9O A;  2CV2 A;  2DWZ B;  3PVS A;  1HR0 M;  2R0I A;  4IBB A;  1PGY A;  3FRH A;  4LJ9 A;  3TQS A;  2CRU A;  1N32 M;  4GH9 A;  3HKP A;  1D0M A;  2LVP C;  2OOA A;  2JP7 A;  1NJF A;  2LXE A;  2QQ8 A;  4LJ8 A;  3T38 A;  3VDP A;  4D80 A;  1J5E M;  4LF7 M;  2OOB A;  2DI0 A;  2J7O A;  4Q7J A;  2CUZ A;  2LHG A;  3RGP A;  5IWA M;  3HJQ A;  2KRK A;  2K6B A;  3W0F A;  2VF8 A;  4B3S M;  4DV4 M;  1Z5C A;  2JXN A;  2CWB A;  5KPZ A;  3W67 A;  4UN2 B;  1NNU C;  1DGF A;  4LF4 M;  3I51 A;  1OJL A;  1L1Z A;  1DGG A;  4LCB A;  2MGW A;  4BLC A;  2FS1 A;  3SAT A;  2Y0Q A;  2C5R A;  4LJ5 A;  1GJS A;  1OKS A;  2XLJ A;  3I01 M;  2D7G A;  1IN5 A;  4FCW A;  3PXG A;  2KNA A;  1YLA A;  2CV0 A;  1TR8 A;  3GRY A;  3KSJ A;  4DV2 M;  3AOG A;  5EP3 A;  1KYI A;  2DAG A;  1KFV A;  4DR7 M;  2M60 A;  2KA6 B;  1V92 A;  2K9D A;  3B7Z A;  4B3M M;  3AV0 A;  4KOD A;  1Q39 A;  1UFZ A;  4G4R A;  2JUJ A;  3TE6 A;  2J7N A;  2Y21 A;  3VK7 A;  2R65 A;  4XGI A;  3B9P A;  3JR4 A;  5FTM A;  1R2Y A;  2DAE A;  1OFI A;  1YUB A;  2HWJ A;  1E9S A;  2R62 A;  1Q02 A;  2YFQ A;  1PJI A;  3B7Q A;  1I94 M;  1WGN A;  2JWS A;  1IBL M;  4QOZ C;  4NSO B;  1LV7 A;  4II7 A;  4AG6 A;  2UUB M;  4D82 A;  1DGH A;  3HX3 A;  1QVR A;  1FJG M;  2FFJ A;  3GPP A;  4MGY E;  1J09 A;  2ZAN A;  3KOX E;  4GC9 A;  4L6V 6;  1NV9 A;  2ZBK B;  3UJN A;  3KS8 A;  2EA0 A;  1XMO M;  3VK8 A;  2ZTD A;  2DAM A;  5BR8 M;  2LHC A;  1T43 A;  2DAI A;  3SYL A;  1DV0 A;  4DR4 M;  1HJP A;  1NJG A;  2K0B X;  4WW0 A;  3GP1 A;  4OVZ A;  2VDB B;  1E9R A;  5EJC A;  3GLG E;  3C58 A;  4JI2 M;  1OFH A;  5ITY A;  4RNA A;  4JI3 M;  1L2D A;  5EP1 A;  4DR2 M;  4D81 A;  3VLF B;  1N75 A;  8CAT A;  3GPY A;  4LRS A;  4FD2 A;  1MJG M;  3U5Z A;  2YQZ A;  2L2D A;  3K8Z A;  1HQC A;  2W82 A;  3VDU A;  2R46 A;  4QNM A;  2YR0 A;  1NO1 A;  4I81 A;  1XXH A;  1L1T A;  2UUA M;  3CF2 A;  2DXI A;  2EKK A;  2KDL A;  3GO8 A;  3GLI A;  4JI0 M;  2KZU A;  3GLH A;  5LMU M;  2BNK A;  5FTK A;  2VF7 A;  4Z8X A;  5E6J A;  1QZM A;  4NOO B;  1N33 M;  1ZMU A;  3HU1 A;  1IY1 A;  3KOW E;  5DFL A;  3IG8 A;  1NY5 A;  3LVV A;  4LJ7 A;  4KLN A;  1BVS A;  2DKL A;  3HU3 A;  4IJF A;  4AKG A;  1V34 A;  1OQY A;  1Z6T A;  4FWH A;  3FD9 A;  4DUY M;  1OAO C;  3BOS A;  4IIW A;  1XXH E;  4BBA A;  4XK8 F;  3GLF A;  1IBK M;  2XFT A;  1CUK A;  4IBG A;  1E94 E;  3GLI E;  2QZ4 A;  3HWS A;  2O01 F;  1T3T A;  5F3W A;  2JY7 A;  3GLH E;  1EFU B;  1XHB A;  2KXE A;  2R4J A;  3ZC7 B;  1HT1 E;  4B7G A;  3TWM A;  1OTR A;  3MK6 A;  4GIT A;  3SHG B;  1IXS B;  1OIP A;  3U61 A;  3J27 B;  2QBY B;  2KNV A;  1DGB A;  3T1Y M;  2DHR A;  3M6A A;  3A98 B;  2Z7J A;  1W5T A;  2Z4S A;  1SXJ B;  3IHP A;  1L2C A;  1XMQ M;  4BB9 A;  1TTE A;  4MM3 B;  4M0W A;  2DHY A;  1JR3 A;  4LF6 M;  4XBO A;  3R9X B;  2FE8 A;  2FH0 A;  3KW6 A;  4RKU F;  3TL4 X;  2CFO A;  4JI4 M;  3U6D A;  2KRU A;  3SMS A;  1WXQ A;  3KP0 E;  3T6P A;  4DV1 M;  3BBZ A;  4PCZ A;  2LVQ D;  2ZAM A;  3HGI A;  1IN8 A;  3GRU A;  1YSY A;  2OQ4 A;  4JV5 M;  4CGY B;  2XFS A;  2C9C A;  4G3O A;  2RGH A;  1C7Y A;  1K3W A;  1EE8 A;  4K0K M;  2JZ1 A;  2DZL A;  4MGK E;  2QPA A;  1SXJ D;  1VG5 A;  5C18 A;  5JI3 E;  1G4A E;  1JR3 E;  2Q2E B;  4CJ6 A;  4LJ6 A;  3AL0 C;  1QDR A;  4GKJ M;  2LVO C;  2X4A A;  2ZTC A;  1IN6 A;  4DR6 M;  3ZCB B;  2QNJ A;  1ZMW A;  3LMM A;  4L4U A;  3V76 A;  4IBF A;  4X62 M;  4JI7 M;  1GL7 A;  1HT2 E;  3U6L A;  1R2Z A;  3BXW A;  3RFW A;  3UZU A;  2F5N A;  2X8A A;  3RGS A;  3SFZ A;  4LFA M;  1HNZ M;  4GMQ A;  2CHG A;  3LW5 F;  4DV7 M;  4IJE A;  1PJQ A;  2V1C A;  3C3D A;  4G4N A;  4P16 A;  2CHV A;  4IBJ A;  1MX0 A;  2DNA A;  1UM8 A;  2DWM A;  2QP9 X;  3A45 A;  3AOE A;  2HL7 A;  2EJS A;  3FTE A;  2WZJ A;  3U60 B;  4B3R M;  2RRU A;  3MJ5 A;  2V6Z M;  3FUT A;  4NXN M;  4QOS A;  2L6O A;  4IBE A;  5L8R F;  3KFU G;  1QZE A;  4R71 A;  3I4V A;  3HJS A;  4QHS A;  2Z4R A;  5FTJ A;  4MGZ E;  2XSZ D;  1QUT A;  4DV0 M;  2L4E A;  1TGU A;  2XH9 A;  1PM5 A;  3SC3 A;  3A46 A;  2FNA A;  2LVN C;  3KOZ E;  4WUR A;  1N34 M;  2LWX A;  3K2L A;  3UMM A;  3EIE A;  3Q8G A;  3FYC A;  2JNH A;  3VFD A;  4PDI A;  2OO9 A;  5DYG A;  2JY5 A;  4B08 A;  4CIZ A;  2OPF A;  2DAK A;  3NBI A;  1WHC A;  4KO8 A;  1P3Q Q;  5FSW A;  2X49 A;  4X65 M;  3B7N A;  3DZD A;  1IXR C;  3J7B A;  1G59 A;  1MU5 A;  3SYK A;  1IY0 A;  1D0L A;  1VEK A;  3JAM S;  2Z3X A;  1ORY B;  4JN6 A;  4MH0 E;  3SAW A;  3PFI A;  3GLG A;  3VKH A;  4QHT A;  3LQQ A;  3GQ4 A;  4HEO A;  4L16 A;  3GRR A;  1HNW M;  3C3E A;  2O25 A;  3HHZ A;  5ITX A;  4TUW A;  2DWN A;  1G71 A;  2ZAO A;  3Q8X A;  5KO3 A;  1XC8 A;  4GHL A;  3AOE C;  2QHO B;  2MJ5 B;  3VKG A;  2K47 A;  5EQT A;  3IEC A;  3U6E A;  3A42 A;  5ITR A;  1SG9 A;  3J80 S;  1IQP A;  2HHH M;  4DR3 M;  4NRW A;  1AIP C;  2R44 A;  2LH0 A;  3K92 A;  1FNN A;  2UUC M;  1QQW A;  3U6S A;  4JI1 M;  3GQ5 A;  1QUS A;  2A5Y B;  1IXS A;  4FWG A;  3PNV A;  4FVM A;  3WHL A;  3B74 A;  1GO5 A;  3QWL A;  4LY6 A;  1F4I A;  4R7G A;  1GJT A;  2MH8 A;  1SXJ A;  4FCV A;  5ITX E;  4LGY A;  1GAB A;  4JXJ A;  4HL4 A;  4L15 A;  3I04 M;  2QEN A;  4F2L A;  2MRO B;  1TH2 A;  3SHF A;  4FWD A;  3ZQJ A;  7CAT A;  2GQF A;  3LCV B;  4IBC A;  4AI6 A;  1C1K A;  1VDD A;  2F5O A;  1LTM A;  3SAV A;  5EP2 A;  4CIS A;  4B3T M;  1N78 A;  2XZF A;  2HAK A;  2L4F A;  3E4R A;  4LRT A;  1A5T A;  1RU3 A;  1EIJ A;  3NWL A;  3DFZ A;  2APL A;  1SXJ E;  1S3S A;  2VQE M;  3U6Q A;  4M9X A;  2L7I A;  2H1R A;  2F5P A;  5C1B A;  3L27 A;  1IM2 A;  2JZ0 A;  3HZJ A;  4PT5 A;  3J81 S;  3R8F A;  4KT0 F;  1K3X A;  2UU9 M;  1NV8 A;  2P5T A;  3LQR A;  1Q3C A;  3AFH A;  2XZU A;  4X66 M;  1T6O A;  1VQ1 A;  4LFB M;  1G41 A;  1K82 A;  1DGH B;  2KNZ A;  1MN3 A;  5FTN A;  2BWE A;  2XSZ A;  3AJI B;  1ZMV A;  2GNO A;  1L8Q A;  3CF6 E;  4OW0 A;  3ZH9 B;  2LNH C;  4AG5 A;  3LCU A;  4NC6 A;  1DO0 A;  1ZAE A;  4B7H A;  4M9S A;  4M9Z A;  2H5X A;  4YHH M;  1IN4 A;  3L29 A;  4QNR A;  2ERC A;  5EXS A;  5ITU A;  4I5S A;  2WSC F;  4LZZ A;  4OVZ B;  5BPV A;  4LF8 M;  4L78 A;  2L09 A;  3HJ8 A;  4NSR A;  1Z5B A;  1N36 M;  4GHA A;  1G8P A;  1QAM A;  4CHT B;  3FTD A;  3J2P B;  4REZ A;  4G4Q A;  1QAO A;  1TH4 A;  1KSF X;  3QAU A;  3GPX A;  4JI6 M;  4DV3 M;  2C9O A;  1IY2 A;  1XXH B;  4GRI A;  2NQ8 C;  4G6Z A;  2QSF X;  4RF0 A;  4DBG B;  3L25 A;  3GLI B;  1E32 A;  3GLH B;  4LJA A;  3FUU A;  1VEG A;  3FRI A;  3TWK A;  2UXB M;  1H6U A;  2CHQ A;  4MGH A;  4NXM M;  3KOY E;  1TDH A;  3CF0 A;  2HCB A;  2EO2 A;  1J7K A;  1HQY E;  4KHP M;  1JB0 F;  1Y8G A;  2Y20 A;  5FLX S;  2WSE F;  2F4V M;  3GLF B;  4AW4 A;  1AUA A;  4MGI E;  2LBC A;  1D2N A;  1I4W A;  2QCU A;  4AQY M;  2J5Y A;  4Z6Y A;  1Z5A A;  1L2B A;  1ZQ9 A;  2RGO A;  1WIV A;  2O5R A;  3UGJ A;  3GRV A;  2BJW A;  3U61 B;  2CEA A;  4DUZ M;  2RKO A;  3D8B A;  3WHK A;  3SBJ A;  1PJJ A;  3M7G A;  2Z8Y M;  3PNY A;  3QYB A;  2R18 A;  5DNY A;  2DWL A;  5IT9 S;  5EP4 A;  3SAS A;  3C9P A;  1NNJ A;  2G8L A;  4FCT A;  3ILK A;  4FW9 A;  4AKH A;  5EXX A;  2LVA A;  1GKI A;  2F5Q A;  3HHY A;  2AHM A;  3W68 A;  3FTC A;  5LMN M;  5IRE B;  4JI5 M;  3MMP A;  2DVW B;  1XWI A;  1XB2 B;  1NHW C;  3CTW B;  2G5G X;  4OX9 M;  2JA2 A;  4F1I A;  2UXC M;  1QDT A;  2XGN A;  2ZM6 M;  1PJS A;  1D0K A;  1HNX M;  3HY5 A;  2LTU A;  4LJ4 A;  1N77 A;  4DR1 M;  3U6C A;  1XNR M;  1JR3 D;  4IBI A;  3W0L B;  2CV1 A;  2KZS A;  2R4E A;  1DO2 A;  3FUW A;  1NHG C;  3SAR A;  1IFY A;  4Y28 F;  5H37 D;  3RE8 A;  3T1H M;  4GKK M;  3L26 A;  5IZ7 D;  3D8L A;  3HHX A;  5DYI A;  2XEP A;  3K1J A;  4ANR A;  4DV6 M;  4HLQ A;  4JI8 M;  4S12 A;  4P17 A;  2D7H A;  4LF5 M;  1NVM A;  3NBX X;  4IBK A;  2E5L M;  3B89 A;  4YY3 M;  3HHW A;  3JR5 A;  1WR1 B;  2QBY A;  1TDZ A;  1R6B X;  3FUX A;  1VDL A;  4LG2 A;  1WGL A;  3E21 A;  4OU7 A;  2N35 A;  3LVW A;  4MB7 A;  2KHH A;  4PD2 A;  3F92 A;  1IBM M;  1Q3B A;  4I4L A;  4RF1 A;  2KW0 A;  4WP2 A;  4GEW A;  4LF9 M;  4IBD A;  2EUC A;  3KS4 A;  2G3Q A;  3FTF A;  2C96 A;  4GIP A;  1TH3 A;  2FOI C;  3EIH A;  3TPZ A;  2BJV A;  3H4J A;  4LFC M;  2D7E A;  3QYE A;  1NSF A;  3H4M A;  1XNQ M;  4X64 M;  1GLN A;  2CE7 A;  2HKJ A;  5EXP A;  1GVN A;  4LGM A;  5KPT A;  2B3T A;  1G3I A;  4AZF A;  5KPR A;  2CP8 A;  2I7N A;  3KXE C;  1X37 A;  4W5W A;  4B7F A;  2Y0T A;  1R7R A;  2UXD M;  3IG5 A;  5KQ8 A;  1IXZ A;  1JQJ C;  1YE9 A;  1R4G A;  1QAN A;  3GLG B;  1Z59 A;  1V33 A;  2WSF F;  1IN7 A;  5ITT A;  3M0E A;  4GC5 A;  3KP1 E;  4M0D A;  3FUV A;  2KEB A;  3SAU A;  3I4Y A;  3THG A;  2R45 A;  2I7P A;  3KVW A;  2C98 A;  4NRV A;  5A2Q S;  5ITQ A;  1ZV1 A;  1R5L A;  1SXJ C;  2VII A;  1QYR A;  3HU2 A;  3GPU A;  3U60 A;  1WJ7 A;  4A3V B;  2BWB A;  2C99 A;  2DZN B;  3E9S A;  3GQ3 A;  1GL6 A;  3T15 A;  3KDS E;  4I8O A;  4L8R C;  4EIW A;  2VQF M;  3KSX A;  3OTO M;  4JYA M;  4DV5 M;  2JY6 B;  3U6O A;  2MR9 A;  1PRB A;  4PDG A;  4ITQ A;  4G4O A;  3U5Z B;  3K9P A;  1VEJ A;  3FKE A;  3FYD A;  5FTL A;  5JI2 E;  3UK6 A;  2DEN A;  2YNM D;  3DOA A;  4R3D A;  3U6M A;  2XF3 A;  4LZJ A;  5EXT A;  5GKN A;  4AKI A;  4ZPX A;  1QAQ A;  3GLF E;  3E46 A;  2DZO B;  3L28 A;  3MHV C;  5KQD A;  1OIZ A;  4NL4 H;  4DR5 M;  2R6F A;  1W5S A;  1NY6 A;  2M5Z A;  2L7H A;  3J7A S;  3AKZ A;  1OAI A;  2JY8 A;  5E26 A;  3TWL A;  3U6P A;  3SMP A;  3L2A A;  2F5S A;  1PJT A;  2V1U A; 
#chains in the Genus database with same CATH homology
 2K6B A;  1EIJ A;  2JXN A;  2FH0 A;  2CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...