1EJ8A

Crystal structure of domain 2 of the yeast copper chaperone for superoxide dismutase (lys7) at 1.55 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
SSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPIECFNESDLGKNLYSGKTFLSAPLPTWQLIGRSFVISKSLNHPENEPSSVKDYSFLGVIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYS7
publication title X-ray crystallographic and analytical ultracentrifugation analyses of truncated and full-length yeast copper chaperones for SOD (LYS7): a dimer-dimer model of LYS7-SOD association and copper delivery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2000-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ej8A00
1OZUA 4A7UA 4A7VA 1SOSA 2VR8A 1F1AA 1OALA 2XJKA 1SXSA 2ZKYA 2VR6A 2WWOA 1BZOA 2VR7A 3ECWA 1IBHA 5KBLA 2AQPA 1F18A 5KBKA 2WZ5A 2AQQA 3S0PA 1XTMA 1KMGA 3CE1A 3RE0A 2AEOA 3KM1A 3KBEA 2E47A 1Z9PA 2R27A 4A7GF 4A7TA 3CQPA 1N19A 1CB4A 1SXBA 5CU9A 1ESOA 1HL4A 2ZKWA 1MFMA 3KM2A 2WZ0A 2XJLA 4FF9A 1B4TA 2LU5A 1HL5A 2GBUA 2NNXA 1YSOA 3GTTA 5KBMA 1SDAB 2WWNA 2AQNA 1SXAA 1JCVA 2Q2LA 1XSOA 3F7LA 3K91A 1RK7A 2C9VA 1E9QA 3GQFA 2WZ6A 1PZSA 1S4IA 2APSA 4OH2A 3CQQA 1SRDA 4A7SA 3T5WA 1E9QB 1BA9A 1IBBA 1IBDA 3HW7A 1YAIA 4B3EA 4U4IA 4BCZA 2C9SA 1YAZA 3GZQA 2GBVA 4MCNA 3L9EA 2Z7YA 2WYZA 4N3TA 4BCYA 3ECUA 4A7GA 2K4WA 4OJAA 3PU7A 1U3NA 1OAJA 1DO5A 2AQRA 3H2PA 1PTZA 2C9UA 1L3NA 1EJ8A 4MCMA 2E46A 2ZKXA 1E9PA 3KH3A 2Z7UA 3HFFA 2Z7ZA 1CBJA 3QQDA 1UXMA 1DSWA 3H2QA 3F7KA 1OEZW 1E9PB 1Q0EA 4BD4A 1IB5A 1COBA 3HOGA 3QQDB 1SPDA 1PU0A 2WYTA 3GZPA 3GTVA 2AF2A 3MKGA 1TO4A 1SDYA 1N18A 2ZOWA 2AQSA 2Z7WA 3SODB 4L05A 2V0AA 3ECVA 1UXLA 3KH4A 3L9YA 2AQTA 1FUNA 2SODB 1Z9NA 1B4LA 2JLPA 1TO5A 1IBFA 1E9OA 2GBTA 1JK9A 4A7QA 3GZOA 1F1GA 1AZVA 1E9OB 2WKOF 4N3UA 3MNDA 1EQWA 1F1DA 1XTLA 1JK9B 1SXZA 1SXNA 3KBFA 1P1VA 1SXCA 2WKOA 1OZTG 3LTVA 1QUPA 2JCWA
chains in the Genus database with same CATH superfamily
1NC2A 1F1AA 4X5WB 4N0UE 2IH1B 4OVUA 1MHPH 4TULL 4HWZB 4JKKA 3VFWA 3VFRA 3FUEA 1JNNH 4S1RL 1JZDC 3NH7L 5B4MC 4MA7H 4C56D 2DMBA 4DP1X 4R0LB 1UKSA 1MPAH 3MLRL 3NRQA 1DANU 4JVWA 5IREA 4LNVA 4YX2H 3WS3B 1HHKB 1YNKH 1TJIH 4XC1H 3DMMA 1UVQB 1UUSA 1KLFA 1M3JA 1ZDQA 4K2UL 2LU4A 2ZX8A 3RILA 2APXA 4GKOA 5I28A 3QRLA 2OTPA 1T89A 1U8JA 1FFQA 1URIA 5D5ME 3LKQA 4JQXC 2N7AA 1X5IA 3S34L 2JJTA 4QRPB 4AT6B 1PS3A 1YN6A 2HG5B 3RL1A 2PETA 5DJYA 4JFEE 4XBEL 4AEIL 3ML8A 4XVJL 4XMTA 3UAFA 3L3IA 2NR6C 3IDMA 1I3GH 2VERA 4HJ0C 1T0NB 4HETA 3UAJD 1X5LA 4DGIH 2QZ5A 3KYKH 3LIZH 2R7EB 4OLVH 4ZUWB 2NY2C 4L8SC 3QI9C 1FVDA 3FT0A 3P9LB 1AKPA 3MRNB 3GZQA 3WUWB 1BEXA 4WGVB 1CTNA 3ARBD 3T0EE 4JFED 4CRPA 2TAAA 3O6FA 3JWNG 3UCQA 1TCMA 3QJXA 2GUOA 5F7MC 1KBGL 2FBOJ 5I8KL 3P3YA 1GS7A 1AE6L 1PTZA 4LSQL 3QIBC 1W9XA 3BQUA 1S46A 2BZDA 4J7RA 1NH6A 2EH8L 3C6LA 3GRWA 3T0ED 1MCFA 2Y3NA 2QPDB 4NI6A 3UBFA 2BSTB 5AW0B 4PP1D 1RVFH 3SYCA 2K9UA 3V4UL 2UZYA 4XBGA 1OGSA 1E4JA 1P7KB 3LVTA 4XWGH 5IKCA 2X10A 4LARH 1FGVH 2J56A 2NY0D 2NYZA 1FBIL 2Y1ZA 5L2JB 2A6JA 1HAUA 5JHBA 2WLMA 1AS6A 3UDWA 4WEMB 2A73A 3D69A 4PY7A 5C0BA 4TV3A 1VAHA 3TTYA 1HINH 4LQFH 1QG3A 1KYDA 2IPKA 3R0NA 4GBXA 3EH2A 4XP1H 5KZCB 3VSUA 2DEWX 4WI7A 1HWWA 3BOVA 3TBVA 3GPEA 1UA7A 2FEJA 4JFUA 4PRNA 2EIZA 2AXHA 4IRJA 1TU2B 1AZZC 4XAKE 2EXYD 2XA8H 1LEGA 1CTOA 3IN2A 3FRPB 2OLDA 1BFSA 2VN3A 4NRZB 1WHPA 1G4RA 3BD4A 4JZJB 4N2HA 3B7RL 2XPGB 2WWMC 3O8XD 1LK2B 1BQKA 3RWFB 3UBXG 4TRPL 4UNVA 3H4HA 2CJUL 2H9GA 2WZAA 2Z8RA 3MCLH 1RZQA 3C60B 3TFKD 4RIRA 4Y19A 4AK2A 4G42A 5T1LA 2Y69B 4XAKD 2C26A 1N59A 2OBGA 3TT3L 4KDVA 5EF1A 3DIFA 2OJEB 4PFEA 4I9XA 3KWUA 1O5PA 3R06B 3RWGB 4WTXA 1EUUA 5DDHB 4HISA 5F89A 2J72A 3ZVVA 3MGTB 2WO4A 1MIML 3TS8A 2NY3C 4KNSA 3LXBA 4ZO7A 5E6RB 5INCA 1EPFA 3QR1A 3ZYOA 1J5DA 3ISYA 3VD4A 4OCXH 4Q56A 3KS0H 5HJ3B 5B39A 4DOHE 1OP3K 2KZWA 3WD5L 1MY5A 1KEMH 5E94A 2W65A 3MRMA 5E24E 4M6OH 2NNAA 2HTLD 1YY9C 1LWJA 4HW6A 5E08L 3B34A 1YMMA 3HRZA 4TSAH 5FHBL 4EVNA 1WDAA 2X6VA 5EU5A 3TOPA 1JF5A 4NP9A 3RX9A 1DVQA 1SHWA 3ZDZB 3HBPA 1L7IL 2LAGB 2WBJB 1I9EA 3E6HA 1AIFA 1A3RH 1EZVY 3UZQB 2Y25A 1QEWA 4K07A 2J43A 1RKRA 1BFTA 8FABA 4F7CB 3AMKA 4FFVC 1NBCA 1UYWH 4IS6A 1CLZL 3QYNA 2YARA 3T0AA 3QQ3B 3W5NA 3MZTA 1UJ3A 2VXVH 3CFIC 1JGEA 1UFUA 4MMZA 3DJRA 5HHOD 4ZFGH 4DAGH 4M6NL 5T5NF 2BS8A 1SZNA 3DX0A 3POCA 3MFGB 4HMEA 2VUKA 3IVKB 3NSJA 3NJFA 4H8PA 4YN3A 2OR8A 1OVZA 2AVFA 7TAAA 4U1LA 3ZKNC 3DXAE 5D71L 5D9SA 3QRGL 2E74C 2WQRA 3EBIA 3BEWB 3QE5A 3QUXD 1RZ8A 3ARUA 3UTTA 1GZPA 4KRPB 3VFNB 5FV2A 2K3TA 2JIXA 5GRJL 2YAMA 1MCRA 4AGLA 3S35X 1AY1H 3OLGA 4FG6D 2X4TB 1WICA 1JZJA 4XH2B 1BAGA 1OF2B 3CCHA 2EE3A 3HC4H 4MVBD 4ZOAA 1S7TB 3WAJA 4B50A 2R69L 5HDBE 4P46B 2XOTA 3UJTH 43CAA 1DCEA 2XQ0A 2IGFL 4OM1H 3MNZA 4UT7L 4TUJA 3CFCH 2FLMA 1M42A 4YDZA 1PZ3A 1H6EA 3CHXA 3HI6H 4JM2A 4KXZI 2A6KB 2E75C 5EU4B 5C0JA 3O2DL 4OCMC 4MMXC 4TLSA 1PLBA 2ITCA 2JFCA 3CLEH 3K6OA 4FXLA 5K9JL 2H2SC 3QDJB 2HVKB 3MJ7A 3NT0A 4PRAA 1GZQA 4G7VH 5IK3B 1IE5A 3AY4C 5GSVA 4DO4A 1PKQB 5JORA 1O0VA 4GRWB 3C5JA 4ZSOB 1WBXB 3ULSA 3GMLA 1R5VB 2C9PA 3RZCA 3I85A 3MRQB 4JFWA 3ZTJG 3PWUA 2FEDC 3C5ZB 4ZTOL 3FK3A 3DVGB 3C6SB 2TRYA 1SDAB 4HS6A 4MJJA 4XN5A 3B3IB 5DHDA 2WNKA 4F15C 5EF3A 2WNWA 1XO8A 4QRPE 4ZX5A 3T6QC 1IQWL 3L3GB 2R0KL 2TSAA 1ACYL 3AITA 1SY6H 1B0GB 3L2NA 3MUUA 4CN1A 4ELDA 1J1PL 4XODA 3QIWA 4HEMA 1WT5C 4L1DA 4XCCL 2Z91B 3EADA 3GLEA 1XZ0A 4CAGA 1D2OA 4HUWB 1Z0MA 4HOZA 3JV6B 3OKMA 4UCFA 5JPMC 2WJ5A 2LLGA 4L9LA 4MDJB 4YHNA 4ODHL 2XN2A 3HG5A 4QRPD 4ODTH 5K59E 4XWOD 2F08A 1KB5A 4AV4A 1YUHB 1EEZB 3DRTA 1NFDF 2NUPA 2DQGH 4P5MA 1CWVA 4L0ZA 4B60A 1ZK5A 2KT6A 4NZJA 5BS0E 4HU2A 3GSNA 4G7QB 2NNRA 4WHCA 5D1XE 2VDKH 4L1SA 1SJHB 1Y18B 3AB0B 4M6ML 5AYUL 3IETA 5TGBB 5GZNC 5EOCH 1AHWB 1JZHA 3VXTB 2YGVA 4DZBB 1HCZA 2W07A 3V0GA 4GO8A 1J5OH 1N0XL 3CTTA 1CBVL 1GGUA 2CHNA 4H5SA 2JB6B 4XMUA 2XN0A 4HUMB 5ESAB 5MI0B 1XF3A 3CZGA 5D1XD 3GDBA 3AUWB 2GT9A 5DVNA 4EIUA 1D5ZB 4JFXA 4G6MH 1YQVL 3WY3A 1F4XL 1FCCA 4BKLA 5I71B 2QVTA 3MREB 3WXWL 1E5BA 1OB1A 4WHTA 4C56A 3WEAA 3LHAA 4JKPL 5FUCE 1A1NA 4YEFA 3MBXL 3UTPD 4N0UA 5B1BB 3MX0A 1QBBA 2KC0A 3D0LB 3JV4B 4PLOB 4CC4A 2G75B 3WKYA 5DFVC 2XPZA 2B5IB 9CGTA 3NABH 1Q9OB 4O02H 4WV1A 1AYRA 1P6AB 2P1YA 3IBEA 3JUZA 1MJJB 2KERA 1WFJA 2OP4H 1BZOA 2Y6SD 5EF2A 2CRYA 4MQSB 4O4YH 4OR1A 2P8MB 3NRFA 2Y7LA 4XP5H 2DZEA 5D2NC 4PCKA 1J86A 2CK2A 3FQRA 3NP3A 2H6PA 4OT1H 5KZCD 3L4UA 3UAJA 3ILDA 2EACA 1T3FA 1WBYA 4QHLA 5D5MA 4YJZL 2EIDA 1BVOA 3WNMA 1QPXA 2DD8L 4MMYA 5IESH 5K9KB 3GIZH 1I9IL 5IHUH 3UACA 3CSPA 2HVJB 2FJHA 4QMEA 1P5UC 5E2WL 3ARBA 2JELL 2X3CA 1P84J 4JFEA 4UTAL 3P73B 4FF9A 3G5VB 1DTUA 3D18A 4GSRA 3JZ7A 3ETTA 4GI8A 3QWOB 2CR3A 2EE0A 4MJIB 3C60D 1F58L 1BQHG 3BUPA 3E7JA 4MLSA 3T0EA 4JE0A 1UM6H 2VDLL 5DMIH 1V7NL 1G9MH 1SLWA 5IJVB 1CXKA 4JO2L 1ETB1 3WFDL 3N50A 4PJEB 4IJTA 5E2UL 3V6ZB 4F7TB 4JPQA 1U4FA 2BOBA 3OR7B 4HUUA 4JUSA 2EEDA 3WTXA 5HI3C 3VTTA 1HOEA 2PPFA 1FHGA 4F80A 3F5WB 2W59A 3CXHJ 4GP5B 4P3WA 3VH8G 3DMMC 3WIFA 4MBRA 5DD6B 4HGMA 4XC3H 1I1AB 3SCMC 1WV7T 5JA9A 2V8LA 4JVPA 1NCBL 4M5YL 4XP9L 4X4KA 4JFPA 2AABL 1HEZA 4HHGA 3KR3H 1T89C 2HJLB 3BUIA 3JWOC 1BM3H 3U46B 1KN4H 4PM1A 3MKGA 5KS9A 5JOFA 2WBJD 1X5YA 3RLSA 4AIZB 5F9AC 5D7IB 1IAOB 4FQ2L 1HZHL 4RVBA 5TF0A 3CIAA 2EC9T 2ZT9C 2JQZA 1UT1A 2JLPA 2Q76A 2AJXL 4M03A 1KLUB 2UY6B 4PRPB 3O8XA 2VDRB 4OFKA 4H40A 2DH2A 2X5PA 2WQVA 4HFWA 3GXIA 2EDEA 4BZ2A 3O6FC 1G1CA 4FQ1L 4UM8B 4X98A 5HVGB 3MOBH 1JXFA 2YN5A 3VI3F 3MA7A 5E6YA 2AJZB 1KTBA 4RWYL 3BH4A 5CILL 1LQBC 1ZE3H 4R2GC 3L1OH 4GG8A 4FAAB 4BGLA 3BPCB 4KRPD 4YFLI 3C6LC 2NMSA 1G94A 3U30C 4TSBL 4XNMB 5I1AA 2BM3A 4FABH 2KKQA 5CKAA 4AYSA 2ZCLH 3BDBA 1JK8A 4A2FA 2IVFC 3F7RA 5I5MA 5AWNL 3TP4A 5MEQB 4HDIB 4P46D 2H32H 3UCRA 1P84K 2VO8A 2VRAA 3X2QB 3VD5A 3QULA 5JQHC 3ZKMC 4DP0X 1UWEL 4NN7C 2NTSP 1TZHB 3IMSA 4TQEH 4F1ZA 4EUPB 2C9QA 1RUPL 3AXLA 2XQYK 1UCBH 3AT0A 3APDA 3E9UA 5BZXA 1G1KA 3PQYB 5I17B 2YD6A 3CVIL 1JYWA 4WWKB 4ZTPH 1LK3L 4E9TA 4ZUTB 4GRWE 1C16A 2H1LM 5IEKB 1IE4A 1U58B 2PNDA 3D34A 4G8AC 4N9OB 3PDOB 5D2LF 4LRIC 1SOKA 1MAML 2EZ0C 3RFZB 3QDJD 1AZUA 1WAAE 4GH7B 1SLUA 1DFBL 4GBXC 5HHXL 2X1QA 4AMKL 5CR1A 2ROXA 32C2B 4AY0A 2Y24A 3CFKB 4ELKB 4MXVE 4QHNB 3FU7A 2J25A 3T3MF 3DHPA 1UKQA 5E8PB 3CXHK 3V4VA 1GTFA 5ITFA 1LE9B 3C5ZD 4HLZG 5TPWH 4J3OH 4TVPE 1M71B 4OZHE 4X4XA 3SIKA 1VFMA 3BYYA 3H6JA 3ILQC 3ET9F 1NMBL 2ADFH 4G5ZL 1HDMB 4N0FB 3EUUA 4XMPL 2Q7YB 3UG3A 2CMRH 4X6CB 2OSWA 3VJ6B 4GT7A 3QUXA 4ZFOB 3G04A 4H1LH 4KZ0A 4YHMH 2VR9A 3S7GA 2VUYA 2FYYB 5F7WC 4TVPD 4OF8A 5DSCA 4YHIB 3VACA 1YEFH 1ONQB 2JLLA 4ODVL 3FNKA 4YSAA 1N5YL 3S48A 4YUEL 4PMFA 2HVBA 4Z7NF 3NN8A 3ESNA 2Z4TA 5EV7A 4P4RB 1IKNA 3BKML 4I5BB 4UBDD 4AXWB 1D9KB 3VRIB 3R18A 4ZNCD 3OKEB 1H8SA 1MH5B 1WFNA 2X2HA 2FT7A 5F0LB 4AYDC 4YHOH 3V8OA 5CJ8A 7CGTA 1IGIL 2I60L 2R23A 3HIZA 2W0FB 1ODUA 1HYSD 2KPWA 1DSFL 4UAHA 1ZJAA 4AGMA 3F05A 3QNXB 3CIQA 2DLFL 3X1FA 1CLCA 2F53E 3BGMB 3R1GH 4X5WA 2F15A 2IH1A 4FFYH 4HLJA 4XRCB 1RJZB 3DECA 4DKFH 4HWZA 4RMTA 1IC5L 3MLVL 5IUSA 4F7KA 3O0LA 4NZTL 4UDTB 4ZTEA 5KYWB 1A66A 1I3RB 4R0LA 2HH0H 1UJ3C 3MLXL 3UJJL 3NP4A 4IIQB 1HHKA 4XR8C 2KZ1B 4UQ9A 3WS3A 1DQVA 3WJLA 4X99B 5JW3H 1UVQA 1T0MA 1DN0B 1W0WB 3PAYA 4NBZB 2F58L 4ZDHB 3QPXL 4NS0A 4ALAC 1BQUA 2X6UA 4UV7L 4FNLH 4D9RE 4ES9A 4MRCA 5BPPA 1A7RL 3KVQA 3BRDA 5BJTB 3LXAA 4QRPA 3TH4T 3LQAL 4KNUA 3NPZB 1CICB 2HG5A 4W9JC 5EIIB 3U9WA 2PXYB 3VD0A 4WUKH 1QTSA 3LS4H 3PXJA 4D9RD 2ZWNA 2R7EA 4ZUWA 4WEEA 3NPSC 5HGAB 2EDQA 3VGAC 4MJIE 3P9LA 5GZOD 3S3BB 3MRNA 3WUWA 2IOMA 4R3SB 5CCKH 4XNUH 2HLFD 2RA1A 1DANT 3KJ6L 2UVEA 1ROCA 3WN5B 3D87B 4ZW5A 2YEQA 4UTBL 4BSVB 4G1MB 4N3TA 3W39B 2QHRL 1H8OA 4K94C 1RAMA 4QYAA 5EO1B 4PJEE 5AKRA 5FWQA 4LCVA 3PAZA 3QUHA 1NAMH 4MJID 5D1XA 4PS8A 1AGBB 3WFZA 2DOCA 2VN6A 4HSAC 4D0BB 4HG4J 2AK4B 2BSTA 3GXDA 2HX8A 4X4ME 1HWHB 5AAPA 1A7NH 3VGFA 3QCUH 4YDMA 3RZCC 1CLVA 4RMSA 1P7KA 3NJGA 1NFIB 3I2CH 4LLUB 3SGJA 4XP4L 4HPYH 4MYWB 5F3HB 3U25A 3MI6A 2D3LA 2GI7A 5F7EH 1SDYA 5L2JA 4GKLA 4DH2A 2A9NL 3IFNH 5AW6B 1YEWA 1JWSB 2A7BA 4OCNC 3VFGL 3QRFM 1LO3H 4QRSB 3HZVB 1JYNA 2X28A 4AEHH 1QFUH 3A4EA 1I1AD 5D7IE 4W68A 4XMKH 4Z6AT 1U8IB 3QIWC 2GFBA 2RQ8A 5EEXA 4L3FA 4HPOL 1SUHA 3OAYK 4JG5A 4K5OA 5BZWB 4XPGL 4PRPE 3RGVB 4KZDL 3FKUS 2Q2EB 1RSFA 4HWNA 2D0FA 2O6FA 4LL9A 1SUJA 4I3SL 4ZXBB 5AZ2H 1TU2A 1JBJA 3TVMB 1LMKA 5IQ7H 4NHCL 3FRPA 2N56A 4CU6A 4YBQD 4NRZA 3GI9H 2W95A 4PRPD 3CZEA 1FLTX 4JZJA 1S78D 2XPGA 1HTYA 1LK2A 4JRYB 4OZFG 3RWFA 4I77L 4X8XA 4UT9A 3C60A 3RKDC 1L9TA 3ZHFA 1Q9KB 5FV1L 5KW9L 3RX5A 4MZRA 2NYYC 3AT8A 4B9IA 3V5KB 3RWGA 5FYLL 4NJAL 4B9JA 2ZKHL 4R4ND 5DDHA 1UWGL 1G6RL 2UXFA 3MGTA 2E9JA 2ZWSA 4OF0A 4RMBA 5LNDA 3MACH 3SN6N 4L8BB 4Y16B 4ZAKC 2VZSA 4O2EB 1OM3L 1QYGH 2IBZY 3TO2B 4PY8I 3VI3B 3H9YA 4M4RB 5HJ3A 3SDYL 2Q7AA 2X4SB 1RU9L 3K91A 1GGBH 5FC9A 4DK3A 4DTGL 4XNDA 3DYPA 1HS6A 4TNFA 3PQYD 1CFSB 4N2DA 4WWKD 1PY9A 2VM9A 4C83B 4GS7B 3U6XA 4UI2A 4BCZA 4C47A 5D4IA 1OAZH 4MSWB 4X7SH 1GKEA 4BCYA 3VXQA 1MHHA 3DPDA 3MDJA 4PWHA 2WBJA 2YXVA 4UOW1 4XXCA 3A47A 1JTOA 1QACA 4C8XA 4EEEA 4F7CA 5AB0A 4HCGA 4O2CB 2X4QB 2NSXA 3UAJC 3WU1A 2QSTA 3QQ3A 1HC1A 4X6CE 4UV4L 3PDGA 1J18A 1JI1A 1WIUA 1E3FA 4K9EC 5E00A 5A40E 1ADQL 5DURB 1I31A 1JGVL 1JL8A 3B9AA 4RAUB 4YLBA 2D31B 4GP8B 1SDDB 5D2LB 3IVKA 1COBA 3B2PA 2Y1YA 4JPSA 1TO4A 1TQBC 2G2RB 3BEWA 5JQ6H 1JZEA 4E9QA 4OGZA 1T1ZB 1E4XL 3FAXA 2CGRH 3VFNA 3IE4A 3IMBA 3AABA 3T3MB 2X4TA 3BVNB 4XH2A 3FTGB 1OF2A 3GSWB 3OLIA 3EYUH 2B3RA 4NO0B 1S7TA 4DETA 3FUMA 2EH7L 4WLCA 2CBOA 3WEBA 5DS2A 3FUHA 2ENJA 4XMZA 1H15B 4P46A 4PTTB 5F71A 5D1QB 1NIEA 3BDXA 2ARJQ 3SDDB 4AGQA 4UT6A 1D9KD 3EUDA 1KXHA 4MJ6B 3X3GH 2OS7A 4AJYV 5C6TL 3MLSH 3V9EA 1KEGH 3O3EB 2A6KA 2G3ZA 2VR6A 3TYGL 3LKOB 1JV2B 3LCYA 2FECL 1DDTA 3DKHA 3TEZA 4P0DA 3H53A 4WEUD 4EKJA 2WTPA 2E4TA 3P0YL 3QDJA 4S2SB 2HVKA 2TSBA 3P9WB 2DQJH 1GSKA 2BWDA 1A4BA 3BHBB 5IK3A 2XN9B 4Z0BL 1HESA 2J1XA 2J4WH 3OBAA 1RULL 1SM3L 4ZSOA 1R5VA 3MRQA 3DV4A 2Z9TA 5TD4A 3R4RA 1TQWA 3VGBA 3WSQH 5AFAA 5EOQL 3C5ZA 5KBPA 1WAAA 3EO0B 2AAVA 3DVGA 5KVFE 3C6SA 5M95B 4F1SA 3DPBB 3O8XC 3SQBB 2NNXA 3B3IA 1UM5L 4Z7UF 1DJXA 2B1AL 4H8QA 4QTFA 2DM4A 3FB7B 3L3GA 4TSCH 2ALAA 3QCVL 4K7PX 3BPLB 4JHBA 1B0GA 1L9SA 3CH8A 1X5FA 5FYKE 1Z9LA 4FCAA 4OZHA 2Z91A 5DD3H 5J89A 1AACA 4LSPL 4HUWA 3JV6A 1H3WM 4MDJA 4OF5A 3LY6A 4PHXA 4X0NA 1JNLL 1V27A 5T3XE 1RZIB 1Q8MA 1CICD 4HQQL 1KJ2H 2EO9A 3HCVB 2KDYA 2PXYD 1IFHH 4F8QA 1P7QB 5HYJE 4I85A 1DEEB 1YUHA 1EEZA 2DEYX 1CFQB 2XYCA 4N0CD 4TULH 4FADA 2Y06L 1H3XA 2A83B 5E95B 1R6VA 1RUQL 5DHVH 3VQ2C 4S1RH 2X05A 3NH7H 2OMBA 5T3XD 1NUFA 4AM0B 1JE6A 1Y18A 5IQLA 1KBPA 4Y4FC 3GBDA 3NFPB 5TGBA 1UENA 3MLRH 3VXTA 2D9QB 4KVCL 2AK4E 3NFNB 2A1WL 4GKNB 3A3YB 5B38B 1ACZA 1BREA 5JIDA 2VRKA 3DX4A 3DARA 3FUDA 2JB6A 5ESAA 3ZJAA 4JKLA 5I2IB 2ICWB 1SN2A 5KSAB 5GJTH 1TTUA 1URLA 4HALA 2WIMA 2X2UA 3MREA 4AYFB 1OGAB 2ZAHA 2AK4D 3QFGA 3EJTA 1OAKH 1MCIA 1HOCA 3S34H 2ZF8A 4NM8L 2YRBA 4DP2X 2ZUUA 4AEIH 3D0LA 1MCLA 3JV4A 1C8QA 4XVJH 5DWUL 2Q87A 1JVKA 3UGEA 2G75A 4X7EC 4Y2DB 2R29A 1L0YA 4OLYL 4V2BA 1Q9OA 3ZSSA 1WFUA 4NPYB 2H3NB 1MJJA 1TZGL 2EE2A 3FBKA 1XGTB 3S5LG 1PF3A 3I6SA 2P8MA 3JUYA 4BCXA 4NQUA 1KBGH 5ICXB 3R7RA 3K6SB 1SF5A 5I8KH 4S1DD 2E7LA 4HJTA 1AE6H 1YVLA 2ZXAA 3AQZA 5CGTA 5C0ND 3H54A 4ERSH 3RGVD 3CJJA 2EH8H 4JRYE 2OMTB 2XV6B 1E0OB 3RI5K 1IKNC 4J8RB 5GZOA 4ZXBD 5K9KA 4W6YB 2FVNA 2HVJA 3TVMD 3V4UH 4P05A 4U1GC 2PYFB 5I6XB 2BSCA 2W92A 1QMUA 3P73A 4NP4H 4NO2B 3FULA 4DN4L 3HNVL 3G5VA 4JRYD 4NQCB 2O26U 3MRLB 1FBIH 4DK5A 3QWOA 5CCHE 4MJIA 4BXSV 1WSST 1E4KC 3VWKC 4ONHB 3K2IA 2CAKA 4OI9A 1JZ7A 2L04A 1R4XA 4K3HA 2NXYB 3FL7A 3MXVH 4FQPA 5IJVA 4QKXB 2OX5B 3ATEA 2FHFA 4PJEA 5E4EB 2BZCA 4QO1B 2A77L 4Y16D 5I1EH 3OR7A 4ZFQA 2EDXA 5C92A 4HJJH 4K8RC 4R0LC 3BN3B 3DOIA 3DBXB 1PLGL 4X4MA 4LCIL 3F5WA 1DJSA 5J6HB 5EBWB 5DD6A 4BFFA 3NEXA 5AG9A 4Q4EA 1I1AA 3IK2A 4YPGB 5L4MA 4KVNL 1AXSB 3VFMA 2P26A 2OI9B 2HJLA 4TRPH 4Z3FA 1UXMA 3VGDA 2ZXCA 3U46A 4HCIA 1ITCA 1VERA 3QJVB 3VWJC 4BINA 3K0WA 3KEHA 1CFTB 2N1TE 4G5AA 3TT3H 1ZHKB 4M62L 4AIZA 5D7IA 1IAOA 4P8QA 2XVGA 1JG9A 2K3HA 2DKUA 3ZT6A 4B9PA 4ECNA 4Z7WF 2YAHA 2X4RA 4JGUA 3MRRB 4Y9BA 5ALBL 1G5AA 1KLUA 3KH4A 3O3DA 2UY6A 3NIFF 4PRPA 3GSXB 4JY4B 1ZLSL 3ZE0B 2YA1A 4Z7VF 4WSJA 2Z1PA 4GSQA 5DURD 1HT6A 2C9XA 2VXUL 2QV4A 4PBWD 1XGYL 4NX0A 4UM8A 5GGTA 4ENED 1EZLA 4KFMA 1B6UA 5KSBF 3ULVE 3NJJA 1LILA 2CDEB 1RZGB 3OHXB 2AJZA 2Y0SA 3WD5H 2BVTA 2WNGA 1L9PA 1D7CA 4BFRA 5D1QE 1YZZA 5D1XC 4E9XA 3DVIA 3BPCA 5E08H 4KTYA 2PLTA 5FHBH 5LBSH 4W81A 1I82A 2RB8A 4FNTA 4Q0XL 4XNMA 5TK2A 2GTWB 2KLRA 2X3BA 3ULVD 1LQSR 4PG2C 1DQLL 1YC8A 4NO0D 1W6WA 1Z5LB 4U6TA 4GB9A 5BUGA 2YGNA 1TKWB 3H7BB 2E7MA 5MEQA 4HDIA 5D1QD 2LLNA 1NCUA 2AQPA 4K5PA 4M5ZL 5IW6B 4FYTA 4JCWA 3SDDD 1TZHA 1CLZH 4EUPA 2IC2A 4WW2F 2LFEA 5I17A 3D4CA 3PQYA 2XN9E 4WWKA 3IDXH 5DD5L 1O5DT 2ZYHA 4M6NH 2D03H 4ZUTA 2EIKB 5IEKA 5LXVA 1ID2A 3N1PC 3BKYL 3PDOA 4LHJB 2FATL 5AB9A 3RFZA 2ED7A 2WZ0A 1KIRB 4HEPA 2QT6A 5D71H 3QRGH 4Z3TA 2YAFA 3O41B 1RPQA 1C7TA 1I7ZA 2XN9D 4QRFA 5GGVY 2QJDA 4C4BA 3U9PH 2ICEB 1IT9L 3WXVH 5GRJH 32C2A 4HIEB 3CFKA 4ELKA 4QHNA 1PD1A 4YEEA 3BAJA 2FNBA 1O6SB 5E8PA 1I7RA 3DTXB 1NCAL 3L81A 3IU4H 1LE9A 2B0SL 1A5FL 1QPKA 1M71A 2R69H 4E9SA 2FX8H 1MIEL 5CKGA 2MKLC 5F7HA 4N0FA 2D7QA 1HDMA 2Q7YA 3L3KB 3VJ6A 4X6CA 2QR0B 2VMDA 1IZJA 1MFCH 5DMJB 1J0IA 1AG0A 2IWKA 5AYQA 2DQFB 3ES6B 3PRZA 3IAGC 2Z4QB 2FYYA 4LP4A 5LHDA 2OK0L 2ISDA 3O2DH 1ONQA 4LSVL 4HC1A 4R8WL 4ELMF 1T7YA 3NCWA 5CLYA 5K9JH 3O81A 3HNTL 3VX1A 1FO0H 1G9NL 1P7QD 4I5BA 4HK3J 5ITBL 4AXWA 1D9KA 4M48L 4ODUB 3VRIA 4OU3A 4APXB 3OKEA 1OARL 4BK5C 2Y7QB 2EKSB 1MH5A 3AQDA 3AU1A 2ATAA 2R0ZL 2K6ZA 2NDFA 2YWZA 4L2YA 4ZTOH 1U33A 1NOAA 2V5MA 1U2HA 3L4YA 4JPKH 1KCUH 2W0FA 3TF4A 3FQ2A 2YWYA 4HT1L 1A9BB 3QNXA 4APQB 1KJMB 1IQWH 1R5IB 3BGMA 5IVNA 1ACYH 1J1PH 3IM1A 4XRCA 2WBJC 1RJZA 5KSAD 2Y2YA 4WIQA 4YQXL 4BQ6A 1U41A 5E23A 2JCWA 2MSPA 1OGAD 4DVBB 1SOSA 4UDTA 5KYWA 3VD9A 1KACB 4ODHH 5AW7B 1I3RA 4CN6A 4IU3A 3LV3B 3NVQA 1WG3A 2HWZL 3OAZK 4IIQA 3TBWB 4YVNA 4LFHG 1IL1A 1AYOA 4X99A 4XGZB 3O2WL 3T8VA 4Z7QF 4Y2DD 3LD8C 1DN0A 3ZYZA 4DPCX 2J1ZA 1TETL 3PJSB 4ZDHA 2BHZA 4B5ZA 4QKTA 1MCQA 2J2ZB 4JW3A 2NCMA 2W5PA 2M83A 4M6MH 1M53A 1X5ZA 2IWFA 3IBOA 1UJTA 2YGPA 1KCLA 3ZTEA 5BJTA 3RU8L 5T5FH 1DL7L 1CICA 1JXJA 1YPZF 4F37F 1CBVH 5EIIA 3Q2NA 1Z2KA 3CUPB 4W9KC 5HDQL 5L8LB 1OSYA 3VFOB 5CHNB 4DN3L 1CXHA 5B8CB 1X4ZA 2BSBA 1KCRL 3RWDB 1J12A 2YLKA 1F4XH 3QCTL 4NQCE 1IC0A 5HGAA 3IF1B 4XX1G 3WXWH 2XN1A 2C9VA 3QUYB 4JKPH 1K6QL 3MBXH 3WN5A 5BW7A 4BSVA 4G1MA 1KDIA 1B2YA 1IIIA 1UUNA 4YLCA 4NQCD 4C4KT 4ZMNA 4HIQA 5EO1A 1D6EB 4KHXL 4UANA 1M05B 4NWTL 4N2BA 4FG4A 1AGBA 2WUBL 3AJ7A 1RZPA 1PEWA 2OSLB 3OPUA 4L8DB 1W8NA 1ZWIA 4D0BA 1I8IB 4NQEE 2NXYD 3O9WC 1V05A 2AK4A 4GQRA 5EO9A 4ES8A 2D7NA 4DO6A 5K69A 5EPMB 4NCC1 5JA8B 5F1NB 2J1KA 3EH3B 2BRRL 4AG4L 3VG0H 4JDEB 1NFIA 4LLUA 2WPGA 3C5ZC 4KGJA 5DZJA 1F6FB 5F3HA 4AV5A 3WY4A 1ND0B 4GW1B 2R1WB 2DD8H 15C8L 4OGXL 1JWSA 3NOIA 1I9IH 4QRSA 3HZVA 1ZLVH 2WZPD 5E2WH 2VQ1B 4MS8D 4UTAH 5E6IC 1U8IA 1CD1B 2B15A 2QVMA 3ZW3A 2AQTA 3ESMA 1BAFL 4TVUA 4JHUA 3H3BC 5BZWA 3ZE0E 1HJCA 2GW5A 4TQ8A 5IJKC 1CGYA 1OTTD 3RGVA 2E8YA 3IGKA 4PB9L 1NCGA 2RMNA 3B2UD 3D06A 4XI5D 4NUMA 2VN4A 1FFPB 1J9SA 1M57B 4F5CE 2VDLH 4ZXBA 1V7NH 2P5EB 3TVMA 3EBGA 1N8ZB 4KRMB 4JO2H 2JI2A 3WFDH 3BSZL 5JHLL 3BZEB 2E56A 4B3VA 2X53A 3BAEL 4JRYA 4MQTB 3AB0C 3HAEB 5LGJB 5E6UB 4WSKA 2ZUQC 2WN3A 4B5EA 3RDTB 1VKXB 1Q9KA 1DZ0A 3W82A 2JE8A 3V5KA 5MI0C 1QUNB 2NDGA 3X14B 3MRDB 2AEOA 1NCBH 1S7UA 4XP9H 4U31A 5GS3A 2AABH 2PPCA 1OQOA 2IOOA 2ZXGA 4G9FB 4Z7VB 4YSRA 5ECGA 4Y16A 5JHMA 2ADJB 4O2EA 1Q38A 3TO2A 5I19L 3L4ZA 3VI3A 3AROA 5KEZA 2HB0A 1OCCB 4LLWB 3LQMA 4M4RA 1KSRA 2DWSA 1U8PB 3CC5B 4FQ2H 1BF5A 1F97A 2X4SA 4P2OB 3MROB 2YC1B 4M7JL 1Y6NR 2ZP8A 2UZPA 4YXKL 2AJXH 1CFSA 3C2AL 2GC4C 4KJQC 4BELD 4C83A 1PIGA 3MV7B 5AW5B 1IKFL 2I9LB 2OL3H 1MKFA 4MSWA 4QHKJ 4RWYH 3RX8A 4H2CA 3S35L 4Y88A 3T0BA 5CILH 1E3XA 4YHPB 2LFGA 2FE0A 2Y9RT 1DQML 2X4QA 4WW2B 4UQAA 5IR1B 1RK0B 3MV8B 2MEJB 2CR6A 3OMIB 3II3A 2LR4A 3P4OA 4KKBD 5J3HC 4RAUA 2CKBL 2D31A 4IHOB 1SDDA 3BJ91 4GRLC 5AWNH 4Q6IC 4YDVB 1FNHA 3D2UB 1AR2A 1QX1A 2DWEB 1UWEH 2BFVL 2G2RA 2VXQL 1F3DH 4LPXA 3WO3B 1RUPH 1XEDA 1WVZA 3BFQG 1T1ZA 3FCBA 3CVIH 4BEIA 1CF1A 1LK3H 2X4NB 4WK4B 3K4DA 1I9RL 3BVNA 4Z78B 5EA0L 3FTGA 3GMNB 2EDTA 2EXWC 5I1DB 3FSWA 1N64L 1WQVT 3GSWA 2A74C 3QPQC 4NO0A 4AJWA 1HXYB 4HUXB 5IB3B 3AUVA 1MAMH 1TCRB 1H15A 4PTTA 4LAJH 5D1QA 5JW4Q 4X6DF 2BLFA 1DFBH 5HHXH 4DVRL 2J6EA 3EJYC 2YPVA 2A9BA 1RIHH 4GLRH 3MKKA 2B1HH 4AQ8A 1IQDB 1R33A 5T3ZE 3O3EA 3LKOA 1JV2A 3QNFA 1FHNA 2B4CC 4FEIA 2HT3D 2XUWA 1J05B 1BP3B 1XF4B 4S2SA 1NMBH 1X9LA 3HG2A 4G5ZH 4APQD 3IJSB 3BHBA 1GH7A 1T1XB 1CU4L 2XN9A 4O5LL 1YO4A 1INQB 2X12A 1TQCC 3DUHA 4PLJC 1A6ZB 3CFJB 4MJHA 2VDQL 2YAPA 2JKSA 2F68X 4ODVH 5KYXB 2Y07L 3CQPA 3EO0A 4YUEH 1SN0A 4HS8L 5AKVA 2A9ML 2NY1B 1S78C 1A02N 2ADYA 3DPBA 3SQBA 3SKOB 3BKMH 4HAKA 3ARDB 3QJUB 3FB7A 4HHAB 4B9YA 2XJLA 4TUUA 4YZWA 4KK8D 3GKZA 1QPPA 5DMGC 1T1WB 4XE5B 4PGJA 3OKLB 3RBGA 2WCPA 1IGIH 2I60H 5C1MB 4BZ1L 3E3QE 1FC1A 1PSKH 2OPCA 3VFVB 1KB3A 1F4WH 1RZIA 2PPAA 3HCVA 2DLFH 5ELIA 1PDKB 5M7QA 4Y1SA 1P7QA 1DEEA 2ODHA 1CFQA 2XTLA 3VXRB 4WJG3 2WYZA 4KI5F 1U8HB 1GYWA 1IC5H 2A83A 3MLVH 3QO1A 3EJCA 4NQVB 4DGWC 3ALWA 3QORB 1CVSC 3LSOB 4NZTH 4F57L 5HHMB 2V3EA 1E8YA 1M9WA 2BSED 4AM0A 2WXGA 3QUYD 5IWLC 4HF5L 1BYPA 1HQRB 1WWBX 4F7MB 3RVXD 1NGPH 2YQ3A 3MLXH 3UJJH 2XU9A 2J1WA 4MAYC 4KQ3L 2QVFB 4GKNA 4LLAA 4N22A 1FFOB 5K33A 1BXAA 5KJRL 5HTSA 5F7UA 2Q3AA 4YR6B 5JR1L 2YD7A 5FX3A 2F58H 2ICWA 4D94A 5I2IA 1IM9B 3QPXH 3ZRSA 5GS0C 5KSAA 3RFZC 2WXNA 1WZ1L 4M56A 3CSYB 2JKIS 4AYFA 1OGAA 4NZ8A 1A7RH 2Y5TB 1AIZA 1T04A 1U8CB 3LQAH 3TA3A 3UP1A 5K1NA 2CE6A 1GYUA 4OJCA 1PW3A 2ZF9A 4OKDA 1KCVL 3N85L 4Y2DA 4ANXA 1U4EA 4A7QA 1A6WH 5EZJB 4LSTL 4XO3A 2P4AB 3IJ7A 4NPYA 4XT1C 3OAUL 1SXZA 4N20A 5SWSB 2GTZB 3KJ6H 4KV5F 2WCSA 1XGTA 3C5XA 2AK1L 4IK6A 4J3OF 4A7UA 2P5EE 5ICXA 5EO0B 5F88B 3K6SA 5AW2B 2GY7B 5C0FB 1OP3H 3VW3L 4Z23A 1CGXA 1OP5K 2OMTA 5CJQL 3T1WA 1G0YR 3F6JA 3FB8B 3GBML 1J9QA 3NJXA 3GJFB 2E9GA 4J8RA 4XNZB 4CC1A 2P5ED 4OF6A 3ZE1B 4YHLL 4ZUUB 2BCKB 2PYFA 2X3AA 3UJIL 4NO2A 1T83C 2IPTL 3Q3GA 2VRQA 4BFBD 3SDXF 3ZHLA 1IIKA 2MIZA 4XP4H 1Y1UA 1VA9A 1EX0A 4NQCA 1RMFL 3MRLA 3SQOL 4P9HL 4G9FE 4PSPA 3M1CA 2CUAA 4MNGB 2A9NH 3RDTD 3GLAA 3VFGH 4ONHA 4GI9A 2WXIA 3T08A 1AGEB 3KDMB 2YD5A 4LOEA 5LGKA 1GIGL 4Q9QL 2C4FT 5LO7A 1ETA1 2OAAA 5DQ9A 3VXSB 2CRZA 3V0DA 2A6DB 1IUZA 2OX5A 4NERA 4HPOH 2DQIL 4G9FD 4CKQA 4QO1A 1H0DB 1PEZA 4XPGH 2OULB 5ICUA 4KZDH 4Y9EA 2AXWA 3BPOC 1UQSB 3DBXA 3MV7E 1H19A 4UAOC 4I3SH 4P2OD 5J6HA 4JRXB 4LT7A 2Q5BA 3LRLA 1BQ5A 5EBWA 2WZPA 4Z5RB 4ZNEE 1U3HB 3JSSA 4YPGA 4B9KC 1AXSA 4Q6YA 4JY5L 1OV8A 4KOBA 3ZT5A 5AW8B 4AM0Q 5EEZA 1CXFA 4IDLA 5DYFA 3MV7D 2J44A 1ASPA 2G9HB 2ROYA 1CFTA 2VLRE 3LKRB 4FNRA 5IB2B 1IAIH 1ZHKA 3QT2A 4XCFL 1F6LL 3PWVB 5FLUA 3T2NH 3U83A 1WZLA 2Q3XA 1KBWA 4GXFA 2ZKHH 2ZPKL 4JKNA 4L37B 1G6RH 3BYTA 1RLBA 4N0CC 1PD0A 4OKVB 3VA2C 2HT4D 3GTVA 3MV8D 2XTJC 4LMQI 3OSVA 2XFXA 3DHMA 3ARZA 1E7UA 3CZFB 3GSXA 4JY4A 2VR4A 1U42A 3WS6C 2QL1A 1OM3H 2D9CA 4X9FA 2EABA 4WHYH 3GSRA 4CMHC 3UMTA 2E8ZA 2RFXA 1Z9SB 2EYSB 2CDEA 1RZGA 1RU9H 3OHXA 3D2UD 1PNCA 5AAWC 4LCCB 2D7OA 2EDOA 3KPOB 4K71B 5EEUA 2A9DA 2GSGB 3RGBA 4DTGH 5AB2A 3TN0B 5EC2B 3KD4A 4NKDB 2O1AA 1JIBA 5CXPA 2GTWA 4WSGA 5AOLA 5AOIA 1GCYA 5DVMA 4DKAA 5F97E 1Z5LA 2OSYA 2VR8A 3NCBB 4LIQH 3GHEL 1ZT7B 4TTDD 5L6YL 2XJKA 1TKWA 3FUIA 3H7BA 1VGKB 3MLUH 3VD7A 4O9HH 4LLQB 3J07A 2K7QA 3MU3A 5IW6A 1XMWA 3ARGB 4W9EC 4NBYB 4JFZL 1T5KA 3JT0A 5F8RC 3G5YB 3H4FA 1PY4A 4Y5XB 2CNZA 4RDQF 4AJ0A 4KZEL 3KGRA 3B5HA 1JGVH 5FIEA 4F33B 3OGOE 2VDNB 4V1DB 1FG2B 2E86A 4GSXA 3BGFB 5IIEB 5CCGE 1MF2L 3JWOL 4X6DB 1KIRA 4S1DC 4DERA 1KN2L 4YDJA 3O41A 4PWFA 2Q8BL 3PWNB 2BNRB 4AQZA 3ALXA 4HWUA 3K0YA 1E4XH 1THCA 2ICEA 4WW1B 5DVOA 5F3BB 1FL6B 4HIEA 3EYVB 5AVXB 5CIPH 2NXZB 4WHDA 3F8UB 1GXEA 2J8UF 4FJYA 3BC9A 1O6SA 3T0XA 3DTXA 1NOFA 4Y4KC 5DC4B 3UEQA 3VRLE 2Y5QA 1FIGL 2P8PB 3OXSB 3Q8AA 2XQBH 4IBSA 2NY1D 4NZRL 3AG4B 3W11C 2EDLA 3L3KA 1YAIA 4TQIA 1T6WA 3ARDD 2QR0A 4LCWB 5HHQA 3UBGA 5C6TH 2DQFA 3ES6A 3HA0A 4JHWL 2Z4QA 3TYGH 4A2GA 1XIWB 4HGKC 2APBA 3VXRE 4ZUVB 2BHYA 4LPVA 2WNXA 4BV1A 1JPGB 1JPFB 3GRWL 2CXKA 4HBCL 3OD3A 2G60L 4K3DH 3RPIA 4P4KB 5C86A 5J11B 3P0YH 5HHME 4FMKA 1IGYB 4M5SA 2CGYA 5I1JL 1NEPA 3L2LA 4Z0BH 1Z6JT 3GMPB 5H37H 3V0AC 1IC7L 3Q2WA 4ODUA 3VXRD 4APXA 1SM3H 2Y7QA 3GSVB 2EKSA 1WGVA 2NZ1A 4MXQD 1MJ7L 3EYQD 3WDIA 3QORD 1NLBL 2D8KA 2I26N 4KXAA 5EOQH 5HHMD 3UP6A 3SYQA 3H2WA 5C70A 2P5PA 1NUGA 2ED6A 1NBVH 5B3JF 1A9BA 1JAEA 4DHLA 4APQA 1EHAA 1U8LB 1UM5H 3WEOA 2B1AH 2J57A 1R1CA 1RHHB 1KJMA 1R5IA 3CFBB 3QCVH 1FVEB 2F9BT 1IM9D 1UZ8B 4EUPG 2VDML 3NACL 2WKOF 4LSPH 2GEQA 5CF3A 3KBFA 5DEZA 3FU5A 3SDCC 4DVBA 4UM9B 4GG6F 2X1WL 1G7LB 3WTTA 1JNLH 2O30A 4MJ2A 3V4PB 4HQQH 5SWSE 3GFUA 3LV3A 2WP3O 1P53A 3TBWA 2X70B 1IEHA 4HEPG 2VLMD 3NQIA 2ZWLT 4XGZA 1AQDB 3BUQA 3PJSA 2ZX7A 4HU8A 3FQWB 1BVLB 2XHNA 1UZ6F 2J2ZA 1T80A 5A6LA 1UWYA 4TL5A 5KVMC 5SWSD 1IGCL 4G43B 2V33A 4EPSA 5AW1B 4RMUA 3LN9A 4UB0H 4E0RB 2A1WH 1ZGLB 3MYJB 5HJGA 2JJUA 3ZE1E 3CHRA 4RZCB 5HPOA 5JIIA 2OCCB 3WUZA 3ULVC 3PHQB 3CUPA 5GSRB 5ILTL 1VFAB 3VFOA 5CHNA 4ZX3A 2P7TB 5B8CA 3RWDA 4IRSC 2G3XA 3ZPDA 1VDGA 3IF1A 2RIKA 3U6XS 1PLCA 4MNGE 1BJ8A 5AALA 2BSEA 2MHAB 3QUYA 1ZLWK 2F2HA 4AQ8C 1NOLA 2CO4A 1HZKA 4J4PD 5DWUH 3VMOA 4R7DB 2BVQA 2ZSWB 3VXSE 2CO3A 1D6EA 5E6ZA 1NJ9B 2FT8A 1M7DB 4OLYH 4B0MB 1M05A 4JFYB 4JG1L 1Z0NA 2X0UA 3ESPA 4X83A 1U30A 4L8DA 2N3JA 2OSLA 3TTSA 3K8MA 1I8IA 2F5AL 1TZGH 2AEQL 4HAGA 3ZTDC 2YGQA 5EPMA 3VXSD 4JRXE 5K1JA 5F1NA 1AC6A 3SDXB 2XZCL 1IU1A 4JDEA 1BEYL 4L3CB 3HN8A 3Q1SL 4IRZH 2BSSA 4H1LG 2QQLL 1ND0A 1HKLL 4GW1A 1UD6A 5K39B 2R1WA 2ZAIA 2VDPB 4RFNB 3V79C 1E9PB 5IVXB 5KOVC 4JRXD 1FRGL 4YHKL 3MRJB 1U3HD 2VQ1A 4ALAL 2COQA 4DN4H 3HNVH 1YNTF 4RGNB 2AZAA 2C3WA 1VPOL 4NZFA 4PLKD 4UWQB 4ZS7L 4YSQA 4W9GC 5D96C 5B1KA 4YH6A 1H3VA 1IGJB 3WI9A 1C5CL 1FFPA 1D6VH 5ERWB 3S36H 2P5EA 1K4DB 2D7MA 1OCZB 1N8ZA 1UOVA 4RMRA 1EZVX 3VA6A 2JJSA 1OT2A 4X4YB 3BZEA 5CM1A 4G59C 2YKLL 3L1GA 3IPFA 1HK6A 1YJDC 4YE4H 5BMFH 1GY1A 4XPTL 3QAZC 3VE0B 1U92B 2QPSA 3HAEA 2Y6TE 1GJIA 3T71A 4H26B 5LGJA 4YBLC 1FP5A 1PLGH 5FM4A 3RDTA 4LCIH 1VRSA 3ZL4H 1VKXA 2WQXA 3NBNA 2WIIB 3X14A 3TN0D 2OYPA 3MRDA 4KVNH 1K9TA 3DX7B 3N41F 4FQXB 4LVOB 2QTEA 4URTB 4DGVH 3CE1A 3ZIMA 4G9FA 4Y5YC 3RIAK 1F00I 5IBLC 1U8MB 2ADJA 4U1MB 1M6OB 3NZHL 3TA3C 2IPUG 3B1TA 4M62H 1OKEA 4DKEH 4LLWA 5DRZB 4PBDA 3CC5A 1U8PA 5AKSA 4OZIE 3KGSA 4M1DL 3MROA 4P2OA 5D4HA 4QT5B 2DM3A 5I6NA 3ARGD 2WLHA 4IKLA 4D8OA 4Y2DC 4RFOL 5ALBH 5INDB 2BNRE 4ZS6D 4L4JA 3VU2A 1LLAA 2O5XL 1XGYH 3MV7A 1U8QB 2ZP0T 2I9LA 4UZGA 4V1DD 1DQTA 1O9WA 3L13A 4M93B 4LIQE 1G6VK 1WZKA 3RTQC 5HI4D 1NAMB 3VDBA 4ZFZB 4WKZB 4ZD3L 2YUXA 2BNRD 4YHPA 1G84A 3BFWA 3P4NB 4WK0B 1LYQA 3WMPA 4WW2A 5IR1A 1RK0A 3MV8A 4QGYA 2NXZD 4G6JH 3SE4A 3ZKXB 4Q0XH 4AC2A 4HCRA 3BLKA 1DQLH 2BERA 4LCWE 2VW6A 2ZQKA 1IAII 4IHOA 5ICZB 5I6XC 3GHPA 4LP5A 5D7SH 3D2UA 3MCG1 4U2YA 3GMOB 3ULUF 3AREB 3DI3B 4FA7B 3F7KA 1CDCA 4LCWD 3ZQ9A 1G0DA 2J8UB 3OC8A 5DD5H 2X4NA 1M7IB 3SDAB 1XIWD 2C34A 3SY0B 4Z78A 3GMNA 1ZANH 5I1DA 4MASA 3S4SB 3BKYH 1HXYA 1QBLL 2HFEB 4HUXA 4P4KD 5IB3A 2IWEA 1TCRA 5E4EC 2LVCA 2GG1A 5J12C 1GKOA 3QIUB 3EFDL 1MFUA 2YGOA 3MUZ1 1ZTXE 2Y36L 1KDJA 4OLUL 4R5VA 3QG7L 1UH3A 2O4EA 3T1FB 5F96L 1N4XL 1FH5H 2FO8A 3L16A 1E8WA 1IQDA 1UWXH 1NCAH 3QUGA 1DBJH 4Z3EA 2B0SH 1A5FH 2I5YL 2P43B 4H13C 2P44B 3F2LA 1J05A 2HTKD 5C07B 1G7PB 4KKZA 1XF4A 2E9BA 4OCRL 4RNRB 5GGRB 2KQMA 4FLRA 1AG6A 3IJSA 4U0RB 2WWOA 1T1XA 2NQDA 5LLIC 1BOGB 1INQA 1NKOA 3L1FA 4KI5D 3E8UL 1FH2A 3CFJA 2OK0H 4HOWA 12E8H 4AQOA 2LW3A 4KITB 4R8WH 4R97C 2ED9A 4UM9D 3KLDA 5KVEE 3WFBH 5KYXA 4PVNA 1RLWA 2XX0A 3TEUA 2UWEF 3HNTH 4A2DA 1A4KB 1G9NH 1AMYA 3SKOA 5ITBH 4TM9A 5FO9B 5DQJB 4HHAA 4BFNA 4M48H 1OARH 1CGVA 3MUJA 1T1WA 1G43A 3BVUA 1DHKA 1MFBL 6FABL 3OKLA 4LLVB 1QW8A 4GG6B 2DF3A 5C0IB 4HT1H 3S96B 1JZ2A 3VFVA 2FD6H 2P80D 3FPXA 5D1ZI 5DK2B 2FO4B 1PDKA 3I9IA 1SEQL 2K8MA 2WQSA 1S3KH 3ZHDA 4TPRH 3VXRA 4D3CH 2FECI 4YQXH 1T6BX 2WANA 3HG4A 4NQVA 3QORA 1IC4L 3GZKA 3LSOA 3OAYH 1BYNA 1HQRA 3MGOB 4F7MA 4HLEA 3KLKA 3A67L 2HWZH 4JN1L 5LQBL 5FGBC 1FFOA 2G0KA 3O2WH 2ZUYA 3I74A 5ADPL 3MYZA 4YR6A 3R8QA 3FO1B 1TETH 3BE1L 1YNLL 1IM9A 2GBAA 1AZNA 1KELL 3VQLA 2C1OB 4WY7L 3H3PL 3QJQB 3ARSA 3CSYA 3HG1E 1NA8A 3OKNB 4PV9B 2P3YA 2Y5TA 3M46A 4WTQA 5IVXE 2X7LB 2OW7A 3RU8H 1U8CA 1UGNA 1DL7H 2AJYL 2QGCA 3UO1H 2AFNA 2VC2L 2CD0A 2DV6A 4XO8A 5HDQH 3MNMA 3LB6C 5LAXB 4QNPE 3BP5B 3O45B 5C3IA 4DN3H 5DVKA 3HB3B 2DN7A 3QCTH 5EZJA 5BXFB 4WK2B 4F27A 4ADIA 4OVVA 1RP9A 2X1PA 5SWSA 2BZ7A 5GGSB 2GTZA 3T2PA 4C4KO 1K6QH 1TZOA 4CUCA 1M2VB 4AZUA 5EO0A 3C75A 5F88A 4RGND 4XMLL 1C9SA 1UC6A 4ZO9A 4NWTH 4PH8A 5T1DL 2I69A 1OT1A 3OB0K 1MHCB 2WUBH 3RGHA 3FB8A 5CN3A 1DJYA 4ABQA 3GJFA 1YY8B 5EU7E 3VD3A 3WJMB 1VACB 4ZUUA 3K4ZA 2BCKA 5GJSH 5CEZH 1OOAA 2ITDB 1WAPA 1UOLA 4J12A 4N2EA 3K5RA 4J4PA 1HZLA 3EG9B 4HCFA 4XTRC 1JGLL 1HI6B 3RE0A 2E27L 1QRKA 1I8MB 5FO7B 3T6VA 5JXEA 4FYQA 5F6HJ 4MNGA 1U8NA 5H2BB 15C8H 4OGXH 1QLRB 1AGEA 3KDMA 1X9UA 4N9GB 3ARRA 4FQCL 1AP2B 2FHBA 2L7EA 4M8RA 4FQXD 3VXSA 2A6DA 1BAFH 4HSQA 4K7FA 3GGWB 3LJ3A 2Q20A 2JTDA 4WWOA 4XVUD 3OM3B 1MW0A 4XPBL 5JZ7D 1P1ZB 4L0YA 2V6HA 2VW7A 4UU9B 3IJ9A 3ZU8A 2VH5L 3V4VL 3GMRB 5FHAL 1T7XA 4KQ0A 2ARWA 2XWBB 2OJZL 4JRXA 1MRFL 4JREB 4Z5RA 1KFGA 1U3HA 2B59B 2XT1B 2DQCL 4AC4A 1FE8H 3BSZH 3N41B 3SE8L 1K5NB 1NFAA 3U36B 3CVHL 3V0FA 3AQYA 4L3EB 3BAEH 4PJDF 3NCYS 1ZVHA 4PRBB 1L7TL 3MCYA 4QIRA 1YYML 1JZ3A 4EI5B 2G9HA 3QJRB 2AV7B 4KPHL 5IB2A 1BLNB 3LKRA 4PREB 5J57B 3GINA 5TE7H 3KLAB 2KQNA 3PWVA 1JZ8A 3MLPA 4YLQT 4EXPX 4L37A 5IFHH 3LKSB 4LXFA 4MHHI 4OKVA 4KU1A 4PWGA 4JKMA 3OL2A 1INEL 1H3PH 5C8JB 3CZFA 1HH9B 3DV6B 3CWGA 4XHQA 2J8UE 5I19H 1HAWA 5FEBA 1B0RB 1Z9SA 2C3VB 2EYSA 3U2IA 2FBRA 4ZMZA 3BPNC 1CQKA 4LCCA 4M7JH 3KPOA 1JDCA 3II2A 3ARED 3DJTA 2DLEA 2GSGA 1IRAY 4YXKH 2J6WA 5EC2A 1NM9A 3C2AH 3QUZB 3ZTNL 4NKDA 1YRKA 4YZFF 2Z0BA 2W9DL 5ICYB 2XWJB 3FF8A 3SDAD 4D8PA 3WO4B 3A24A 4FXKB 5GS2H 4NQSB 2X6BA 3MLYH 3S35H 1VGKA 2MOVA 4FS0A 3QIUD 1N8OE 4ICXA 3RIKA 2PP7A 2XIIA 5C07E 3U4KA 1J8KA 1DQMH 3ARGA 4N6RB 1E2ZA 3G5YA 1II4E 4JCLA 3N0PB 1OLLA 1I8KB 4Y5XA 3KGUA 5CLXA 5DJ0B 5GS1C 1KOAA 4KWUA 2HT2D 4QUOA 2CKBH 2WKGA 4F33A 1FG2A 3N40P 3PUCA 5B3SB 5CFHA 2DQMA 1WFOA 2R2CA 5C07D 5IIEA 3RY6C 1A65A 4NWUL 2BFVH 1ZSHA 2VXQH 3PWNA 5DUBB 2BNRA 1KCSL 2DYSB 4A2EA 3GMQA 4PCSA 4F2EA 5ACLA 1AOZA 1G9EA 5KVGE 4RBPH 4WW1A 5F3BA 1FL6A 3EYVA 4HUCA 5D72L 3CZLA 1VJSA 3NZUA 4WDIB 1ZPLA 5EA0H 5B7FA 1LL1A 2WJ7A 2H6OA 2F18A 1CO1A 2DY2A 3RYMA 4L8CB 1PZAA 1IJ9A 4FHJA 1MEXH 3QBTB 3GMMB 2P8PA 2X6CA 3OXSA 1LJMA 1MPAL 4FYRA 4GG6E 4N24A 3QHFL 4DVRH 3NTCL 4NZUL 2VQ4A 5I1LB 1YNKL 4PJGB 3EZJB 4XC1L 1E5UI 2XKSA 4P2CG 5CZRA 1FG9C 4XOAA 3WTUA 1BZ8A 4V11A 4LCWA 1PG7X 2P45B 3RDTC 1S7RB 1WWAX 3B9KB 4L48A 3U4EB 2QSCL 3WFEH 1A14H 3FTVA 4ZUVA 3EO9L 1JPGA 1JPFA 2ZYIA 1K8DB 4JQIA 2ZOLB 5FAAA 3EAKA 4P4KA 2BP5M 5DT1L 2H5UA 3EHBB 1EJOL 1IGYA 3IT8D 1WITA 1Z32X 1JHLH 4O5LH 1MAKA 1MCNA 3S3DB 5E4IA 4Z7OB 3HE7C 2C3GA 2UZIL 3GWJA 5FYJH 4DP9X 2E7CA 2JKXA 1ZS2A 3BN9D 3GSVA 2EDJA 4CJ1A 2VDQH 3SKMB 5I1GL 1OANA 2WYTA 5F2FA 3FOLB 4DP8X 4ZMLA 1HHHB 3STZA 2X2YA 1NWPA 3L45A 1U8LA 1MSPA 2AXFB 1CXLA 1ACXA 1RHHA 3ZLQC 1FLRH 5IFAH 3NA9L 1FVEA 3IDYB 1SOXA 5IQNA 3ZHKA 2O93L 1UZ8A 4EI6B 4A37A 1IBFA 2DBJA 2VE6B 3K74B 4ZFFB 3WLWC 4UM9A 3PGDB 4BZ1H 1G7LA 5JTWA 3V4PA 3C08L 3FH8A 1MVFA 1J8HE 1OTUC 1X5JA 2X70A 4IGBB 5H4ZA 4JPIB 4X5PA 1OAQH 4WWID 1CMOA 4AE0A 1AQDA 5CWSB 1J1XH 3HB3D 3FQWA 2ID5A 5LXGL 1BVLA 2AQ3A 2R1YB 3APFA 3F85A 4UT9L 4WU7B 1YEIL 4YGVB 4F57H 2DIBA 4P5RA 1K5WA 3Q7JA 2JCCB 1MJ8L 4G43A 2P49B 1P4LB 4E0RA 2P80A 3MYJA 4KQ3H 4AQ1C 1ZGLA 3G5WA 4RZCA 4QJ4B 2NOYA 3FUKA 4HJUA 5KJRH 3PHQA 4JGJA 5JR1H 4MTMA 1FZOB 5GSRA 1VFAA 2QKIC 2P7TA 1HCYA 2CKNA 1A3ZA 1HCVA 1BVNT 1WZ1H 2FL5B 4E9RA 4PTUB 4S0TD 4HULB 1MW1A 2MHAA 1JN6B 2WXJA 1IAKB 1WZMA 3VXNB 3UC2A 1M56B 2C3HA 2PABA 1MCWM 1UXSB 3RUGF 4R7DA 2E9WA 2ZSWA 1KCVH 1YQ2A 2FUTA 3N85H 4PQXA 1KYAA 4FQQB 4O51B 2OCJA 1NJ9A 5J56B 1M7DA 4JFYA 2ZE0A 4B96A 4LSTH 1ORQB 2Z3FA 4IU2B 1GCFA 3K6NA 4EN2A 3OAUH 1DJGA 4MQXC 3BI9X 2EDRA 3WTSA 1O75A 2AK1H 2UY7B 5CMAB 3IMRA 2EIEA 4GXVH 1HVXA 1C5DB 3WNKA 1TFPA 1AI1H 5CEZE 2APWA 1DLHB 4EI0A 3VW3H 4L3CA 4IBTA 3VUAA 3DYOA 5TE6H 4Z95L 1VSCA 4FTDA 5CJQH 4I2XB 5JLZB 3GBMH 2DL9A 1AXIB 2ZICA 5K39A 2HPTA 1E9PA 5IVXA 4F8TA 3EZ8A 4KGLA 1MUJB 2Y2WA 4M00A 3MRJA 4K4KA 5EDXA 4OJDH 5AEAA 5A2KH 3UJIH 3LRSB 4X5QA 4BWUA 4BFKA 2BVUA 3ZZQA 4L3ED 3BO8B 1X3DA 1MFEL 3CVDA 5KUMA 1DUYA 1CF8L 1RMFH 1E30A 3RHWF 4NFDA 4P9HH 4EI5D 4GUQA 4D2NA 2Z7WA 3HNSL 5A2AA 1IGJA 4I0PC 3EO1B 3L5IA 4G6FB 4I1NB 1A3RL 1XF1A 1Z9NA 3I3BA 1YYCA 3AY2A 4PJXF 1ROWA 1GIGH 4IHBA 2D0GA 5ERWA 5I0XA 5L7XH 4Q9QH 2PR4L 2ZAGA 1FZKB 4PG9B 5FXCH 4Y8DC 2DQIH 4X4YA 4L9DA 4Q9CA 4PJDB 4UT6L 4CU8A 2Q10A 4DAGL 4Z3JA 4NB7A 1U92A 1TXKA 5AZEL 4H26A 1XD0A 3MTRA 4ACPA 1Z9OA 3MJ9A 4FKEA 2R9HD 4Y1TA 1KYFA 3FONB 3H7LA 2X42A 2WIIA 1MHEB 3A4DA 4KROC 3W2DL 4LGRB 3QUZD 3ULUE 3DX7A 2YD2A 4FQXA 4JY5H 4OGAD 3J27A 1CLYL 2F8OA 2I9TB 1U8MA 2D3JA 1AD9B 1IFRA 3QW9A 4U1MA 1M6OA 4P2RE 2KI6A 1NZRA 2HUEA 4WFGD 2EDWA 4XCFH 5DRZA 4I88A 3ULUD 2ZPKH 5DFTA 4QT5A 1F02I 3GUTB 5INDA 3VVVA 2XIBA 5DHYA 3N42F 3TFBA 3QWRD 4EMZA 1U8QA 2DQEL 3LPOA 4HUNB 4TVPL 4G8GB 1CXEA 1NAMA 3CLEL 4ZFZA 4W4OA 3FAWA 3GNMH 4WKZA 1S4IA 3D4GA 4Y8AA 4D9QE 4RZKA 3P4NA 4N1CA 3F7VB 4KXBA 4RRPG 2PCYA 3BH9B 1BA9A 4PJGE 4NUGH 4JFSA 1GY2A 5F7LB 4JFDB 5KVDE 1GSMA 3O4LB 2KZBA 3C5SB 4LOUD 3L4CA 3LQAC 5MHSD 4J3WA 2DQHL 3ECUA 3GHEH 4PUBH 3HMXA 5HD8C 1W15A 4C4UA 5ICZA 4WI4A 3DX3A 3S97C 4RSVA 2GQHA 2CU9A 3PV6B 3GMOA 1GGCL 4JFZH 2YZ8A 3AREA 5EWIL 1LO0H 4IQHA 3WTVA 3HFFA 3E9TA 4QRAA 3TZVB 2D4FA 2J8UA 3B9KD 4Z7OE 4KZEH 1M7IA 3SDAA 4E2OA 1IGML 5JDJA 1TLMA 3OAZH 5DJCB 1MFVA 3BT0A 1P5VA 2ATPB 2HFEA 3HAEG 5E2JA 2AHIA 1MF2H 2YRZA 2ZUSA 5I5IA 2DWTA 3EHBD 4HPHA 2RTTA 3N06B 3QIUA 3GJEB 4N5EC 2Q8BH 3IMVA 4BWTA 3CZUB 1O6VA 1BBDL 4OLZL 3KXFB 1QATA 2CO7B 3T65B 2BVEA 2DQGL 3T1FA 1SQMA 3P40A 1QSZA 1ZT1B 4F58H 4BH7B 2NYKA 5LG6A 4L4TB 2BRQA 2R29L 1XF5B 5SWZB 3HC0B 5DUML 5AVYB 4BQ9A 2ZUWA 2YPKB 1FIGH 3LDBC 2G30A 3KPRB 2XBTA 4YIQB 1G7PA 5C07A 4RAHA 3W0WB 3Q43A 4NZRH 4RNRA 3ZUCA 5GGRA 2ZSVB 5CZVL 5FECB 3T8MA 4AKOA 1BOGA 5C7XL 1PFCA 3IFLH 4AV0A 5FYJE 4PD4K 2YS4A 3HS0C 4FQHB 1LGVA 4JHWH 1LP9F 2F54B 3UROR 4ZT1A 3KYAA 5EUKA 1U2CA 5BQDA 3GRWH 2FLBT 1PMYA 2G60H 4LLDA 1HN1A 5G2NA 3BVXA 2DJ4A 2JCCE 3FTZA 5I1JH 4YSOA 1A4KA 3DROB 4IGBD 4KTDL 3MRFB 2YMTA 3U6RB 5FO9A 5DQJA 1IC7H 3APCA 4CMMA 2E47A 1HX0A 4R26L 1G5GA 1MJ7H 2DBLH 1FFRA 4ZX4A 1M7UA 3WTYA 5IQ9B 1NLBH 4K71C 4LLVA 3CH1A 1MCDA 3WGUB 4GG6A 2YR3A 5C0IA 2XYBA 4FN0A 1GGTA 4JKWA 5DK2A 1P6FA 1ZLEA 3ZXAC 2FO4A 4UINH 2WWNA 4KJPD 2PP8A 2F5BL 1XH1A 4N2FA 3CSGA 2V2TB 4M1GL 1TJGL 3GBNH 2VDMH 3NACH 2XWEA 2P5WE 5A1AA 3K1KC 2CUMA 1BZ7B 3RWJB 3WNIA 4YC2C 3BVVA 3GIZL 2JQMA 3RB7A 5E99L 1QVOB 3MGOA 4GT0A 2YFNA 3ZOAA 2B4CL 3ESVF 4XN9A 5MERB 2XKUA 2AQRA 1RSYA 3KLLA 1W16A 1Y07A 1X9RA 1ZDSA 4IIZA 4IKJA 5HI4C 2C1OA 1S9KC 4B9FA 4JCMA 5FCUH 1IGCH 3OKNA 4I2XE 1ZGLM 3U7YH 5ESVB 4PV9A 5CAYB 1EBAA 5J06A 2X7LA 2J73A 1JPEA 4LDEB 3KBPA 1EAQA 4M9PA 4KK6D 3FHQA 1NBZB 5LAXA 5MENE 5ILTH 3BP5A 3O45A 3UYOD 3V2AR 4KAQL 1KPVB 2VDRL 1H5BB 3E0GA 3KL5A 5BXFA 4FL4B 4XBPB 4PCYA 4QXTB 2EDFA 3RNQB 5DC9B 2G3MA 1E28B 3VQMA 1PJ9A 1M2VA 4GKSB 3ZK0A 2P48B 4B0MM 4U1IB 1EIBA 2Z8WC 1MRCL 2A6IB 2VAJA 3KR3L 2DI7A 1IV8A 3WKML 1BM3L 5I1GH 3V0WL 4PJDE 3CN1A 3TV8A 1MHCA 2O6PA 3WFHB 5J11C 2NSMA 4XO4A 1ILUA 2WQ8A 4G6FD 1CC3A 2IQ9L 1YY8A 2AJVH 1XH2A 4YL4A 5DFWH 2AEQH 2FX9L 3T3PF 3WJMA 1VACA 3MR9B 2ITDA 3SPCA 1B9KA 2XZCH 2E5EA 4HIHB 1BEYH 3EG9A 5E7BA 2DMKA 1HI6A 3Q1SH 5GRUL 5TDOB 2AQQA 4LU5L 1I8MA 1ET7A 1OGTA 5FO7A 2QQLH 4MA1B 1W2KT 5DRXB 4QLWA 1CS6A 5D1ZC 1G1OA 3M7OA 5H2BA 2XVKA 3IN0A 1QLRA 4PJXB 3KLHC 5I1KL 2XWXA 4EKXA 5GS0L 4N9GA 2PP9A 1R5WB 3LOWA 1AP2A 1G87A 2LABA 4LKXB 1A7QL 3FF7A 3GGWA 4W4NA 4KK9D 1NMCC 4M6AA 2AXGB 1P1ZA 3TWYA 4ZS7H 4C58B 5A16B 4UU9A 5EG6C 2LAAA 1E4HA 1FSKC 3ECQA 4BXVA 1C5CH 3GMRA 4JAMB 5DJ2B 4G8GE 1CFVL 2XWBA 4X80H 1F8TL 4A7SA 3FPYA 4BQBA 3BIBX 2B59A 3RA7L 2PO6B 3P4MB 1UCBL 1K5NA 3U36A 4KO9A 1AAJA 4L3EA 1PKOA 1INDL 3D9AL 4XPTH 1PCSA 4XN1A 3UIYA 4B41A 1J9TA 4PRBA 4JFDE 4G8GD 3OWRA 2AV7A 4YSCA 1DVTA 1BLNA 4PREA 4HC1L 3KLAA 5DZNA 1BXUA 3VFPB 4OQ1A 3LKSA 5GGQL 1KTCA 4PJ8B 3HKZA 1A6UL 1LM8V 1VIWA 4JFDD 1DSWA 1F90L 4ZW8A 3O4LD 1X7QA 3N42B 1HH9A 3T6XA 1LDPL 1LDSA 3DV6A 4FTVB 1FL5A 3QXTA 3B5GA 3ZE2F 3O0RL 5D7HA 4I7ZC 1BOYA 3NZHH 2B3IA 3KL3A 4OCYL 3SY6A 4E5XA 1B0RA 3HRPA 1A4CA 2IGLA 4M02A 2UUDK 5J4MA 2EUWA 4FXGC 3RWCB 2CMRL 1N0LB 1U3JA 3KPNB 2OTUB 4RFOH 3PIQB 4Z3GA 1JCKA 3D1MC 3QUZA 1G1YA 2EXTA 3TZVD 3L5WB 4YHML 3KXFE 5ICYA 2XWJA 4FXKA 1XQ4A 4NENB 4NQSA 5IW3A 2Y7NA 4MWFB 3S5YA 3MNDA 1BBJB 1KC5L 5SWZE 3AWEA 4ZD3H 2D3VA 1MCWW 4PJFF 2HRHA 3LTVA 3KPRE 1OY3B 3CFUA 4QRUB 4N6RA 3W0WE 3KXFD 2ZKMX 1DBML 1KB5H 3F62A 3WMQA 3V7AE 1I8KA 5DJ0A 4L4TD 3DYMA 2AP2A 5J6SA 5SWZD 1KTLB 1ZXQA 3QWRA 2F54E 2E3VA 5I73C 4YHOL 1CFBA 1P4BL 3ELAT 2VKXA 3MLZH 3IRPX 3KPRD 4WNQB 1OB0A 5KVFL 2R2HB 3W0WD 3O11B 1X4XA 3OMNB 4GEIA 2PW1B 2ZNWA 2FAUA 5DUBA 3EFFB 4BFIA 1DQJB 1C7SA 3L48A 1S6NA 3X1BA 1N19A 5FYKL 3TESA 2F54D 3STBA 2AEPL 4WDIA 1HL4A 1QLEH 2WTOA 1J8SA 5FGSA 1AMXA 4L8CA 2C1PB 4IOSD 1PZ5B 3GMMA 2VL4A 1XGUB 1X6NA 3OKOB 2HH0L 5T3XL 1WK0A 3EFDH 2MMXA 4IOFD 5KJ4A 5I1LA 4PSRA 4PJGA 2VITB 2Y36H 3G6JB 4OLUH 3QG7H 3ARFB 5EU7C 2BSRB 4JZNB 4KKAC 5F96H 5F6IB 5HYSB 2F7PA 1S7RA 1Q0XH 3B9KA 4OFDA 2C9RA 3U4EA 5HDLA 7PAZA 3LRGA 2I5YH 4KBPA 5B3NA 1TTCA 4DP6X 4IJ3B 1K8DA 3NSYA 5GRZA 4JO4L 2ZOLA 3FOMB 4G82A 1AQMA 4E9VA 3DTDA 1B88A 5B1JA 4G3YL 5JZ7C 4GW4B 1L9QA 2W94A 3E8UH 3LS4L 2CNYA 4PIBA 4P49A 4KH2A 2IDTA 4HUVB 4NUJB 3SKMA 2P28B 4RGOL 3BGAA 4G1EA 5AVZB 4BD4A 3FOLA 5BO1L 1I85A 1HHHA 3HC2A 1OP5H 5CUSL 3BXNB 2AXFA 1TQUA 5C0BE 4PGZA 4FLSA 2UX6A 4M93C 2Z34A 1GOGA 4I8DA 4XN2A 3D6GA 3M7FB 1BW8A 3GXUB 1F86A 1Z5HA 2ENYA 2JKLA 1MFBH 1UXLA 4W9DC 2VE6A 1F13A 1IFGA 2APFA 3UERA 1PL3A 2MCAA 4ZFFA 3NJLA 4WHYG 3FFCB 5HYFA 4TLTA 1Y0LB 3PGDA 1L0QA 3FU0A 3GC3A 4XN8A 1ILSA 2YUVA 2FSEB 4KTEL 5CD5D 3T2LA 5JPNB 1SEQH 4IGBA 2K1MA 4JPIA 3UEZA 3PREA 2EEFA 3DX1A 3J8F7 3V0EA 5CWSA 3BVTA 4MJ4A 3EXLA 1S5HB 4BA8A 2R1YA 4WU7A 4YGVA 1IC4H 3IFNL 5KBDA 2HLEB 2XV2A 2ZKYA 2IALB 2Y7OA 2CBMA 5DUPL 2JCCA 1QFUL 5D70L 1P4LA 5CEYB 4AK1A 2O5ZL 4WTWA 1BFVL 3K4AA 3H85A 3SD5A 3SGKC 2WD0A 5ADPH 4IW4C 4PW4A 1FZOA 3BE1H 1YNLH 4FKHA 4R96A 3V0IA 5KUKA 1KELH 1D5RA 3LEVL 3H3PH 4WWNA 5EC1B 4QRBA 3CDZB 2FL5A 3T0VA 3RVVD 3C2SA 4NCC2 5K9QI 1GYVA 4NN5C 1MNNA 1JN6A 5G55A 2BS71 2AJYH 2EC9U 5IQ7L 5I8OH 1IAKA 3VXNA 2R69A 3Q06A 3GI9L 3I6GB 3ZL1A 3MRPB 4AOFA 4L2LA 3BAXA 1UXSA 1YEHH 4FQQA 4O51A 1MCBA 4YDLB 1UM4H 2WBXA 1ORQA 2BP3A 3L3OB 4IU2A 3K71B 2ETWA 2F7RA 4IBVA 2YBRB 1AZBA 2OTWB 2UY7A 4HUKB 1C5DA 3W1ZA 3HZMB 1F41A 1UHVA 1PZDA 2PTVA 3MACL 4JDZB 3B7YA 1P0SE 2VDOB 3OTTA 4MA8L 4XMLH 5T1DH 4FQJH 1OP4A 2AANA 3S36X 5FB8B 5E5RB 3KNBB 5HGHB 5C0AB 1SHMA 3EOAB 4I2XA 5IOPB 5JLZA 5EEYA 2BY3A 5I15L 1CE1L 2Y7SA 4WF7A 1GGBL 4MZ3A 2VMEA 1V10A 2PO6D 2X6MA 3LRSA 1CQYA 5E2VH 3THML 3SD2A 1JGLH 3UTTE 3BO8A 2E27H 5H37G 4M43L 2L0DA 4GY4A 5JW4R 1S3RA 1OAZL 2GYSA 4X7SL 3CFNA 3ULVL 3FO9B 5FF6B 3EO1A 4AGOA 1EFQA 2XXGA 1ZD6A 3NJMA 4FQCH 4N4YB 4PJ8D 2ZCZA 1FZKA 3HMWL 4PG9A 3TASA 2IQAB 2GSIB 2WLZA 5D6DA 2J6EL 4EN3C 3VD1A 1PY0A 2ZNXA 4PJDA 2A38A 3P3RA 4FTVD 4XPBH 3DUUB 4KXZH 4M7ZC 2A2QT 2QQNL 3R0MA 3V0VB 1G9NC 3HJ0A 2VH5H 3V4VH 1MZZA 3PJNA 4IDJL 5FHAH 4HIJB 2WXMA 3K6DA 4QRRE 2OJZH 3FONA 3SB3A 1MRFH 1B0WA 4JZOB 1MHEA 2DQCH 2K7PA 3SE8H 3NSFA 1WEJL 3CVHH 1LO2L 4XNBA 2XZAL 2WXFA 3CDCA 1L7TH 4AUYA 1YYMH 3ZE2B 1AD9A 2QQKL 1SJEB 3VFUB 4EIBA 4ZMXA 1JPTL 3KS0J 2E6JA 3LEYL 1YG9A 5IP4A 1N12A 4Z18A 4JNXA 2J5LB 4KJWD 3WHE0 4XPAH 3GUTA 1INEH 4A7TA 1J0HA 3X3GL 3QR0A 3TL5A 1E2VA 2EYTB 3ZDXF 2GJ6B 1YMHB 3UABA 1DUZB 1NGWB 2DRUA 5L4JA 2OKMA 4G8GA 4M8UA 4UMSA 1HL5A 2DW5A 2HYMA 3AS1A 4H25B 4R4BB 4ONFL 5E7FA 1HNYA 3C8KB 3NGBB 5ESQA 2IEPA 1DVXA 2C7FA 3F7VA 1OHQA 3BH9A 3G6JE 4JFDA 5JYMA 3O4LA 4TLUA 1MRDL 1KGJA 3C5SA 4CVZB 2XZQH 5ALCL 4AJVA 4GKZB 1YJDL 4HJIA 4JMXA 3SPVB 1WAEA 3PV6A 3CBRA 4PJ9B 3O6KL 2MQ3A 3AG1B 5BNXD 3IGLA 3ARFD 1S9VB 4U7MA 4P23C 4JDVB 3TZVA 3FQ1A 4GAAA 3KPSB 5FYLE 3U7AA 4Q52A 2WOYA 5F7DB 1D5BB 2J3SA 5DJCA 5JOPE 4U1NA 1DJIA 4WO4C 3VFSB 2ATPA 2V2XB 4DP7X 4U2ZA 3ZZLA 4NWUH 4C56E 4N25A 3PNRB 3IWVA 1KJ2L 1MVUB 3CV5A 3GJEA 1KCSH 1IFHL 3MRGB 4BUQA 1CFMA 5FYLD 3KXFA 5HDWA 4FNQA 1KPRB 3KWTA 2CO7A 3T65A 3TPUA 4MHHG 5D72H 1B0IA 2DQTL 1ZT1A 5LNGA 4BH7A 5JOPD 3UZEA 4L4TA 3POHA 1ZIAA 1XF5A 5SWZA 3HC0A 4PI2A 1L0PA 2XI9A 3I75B 1UACL 1NGZB 2YPKA 1TTAA 1QR4A 2IAMB 2XQYG 4QHKI 4BM7A 3KPRA 4YIQA 5DEJA 3TCTA 1UFGA 3B2DC 5BUAA 3W0WA 3FFCE 4BFGA 3QHFH 3NTCH 4NZUH 2ZSVA 5FECA 2WAHA 1NCOA 3C09C 3DK2A 5AVWB 2QELA 5AOKA 3TBYB 3WFCL 4KHTH 1ZLWH 3FSOA 1GGIL 4FQHA 2F54A 5GJTL 5L8JB 2QSCH 3NIGB 4FOMA 2EIBA 5EZIL 4FA6A 3EO9H 1JWUB 3PL6B 4YNYB 3FFCD 1J0KA 4QTHB 1EK3A 1LMIA 1IGFH 1OAKL 2MRYA 5IJBC 4IOSA 4KMQA 5DT1H 3LXUX 3L1EA 1EJOH 2BIOA 2DB8A 2XPYA 2WO3B 5I66B 3DROA 5AVQB 3MRFA 3U6RA 2UZIH 2KDGA 4M4PA 2FEEL 1OCRB 3RPKA 3UOAB 1U9KA 1SYSB 1KZQA 2VLLB 3T4AC 5D7JC 2QGBA 3LHPL 5IQ9A 4KUZL 1OPOA 2ENQA 4Y2OB 3QARA 4TOYL 2V17H 4Q58C 3E6FB 2RACA 4RA0C 5JW5B 3D48R 1JUFB 3NA9H 1TPXC 2HXAA 2V2TA 2WC7A 4H0LC 1SXAA 4ERSL 1NUDA 1T1YB 4MNHB 1BZ7A 3OLDA 3RWJA 3BJLA 1QHQA 1SRDA 2V5SA 3C08H 1TZAA 5DEGB 3E2HB 5EOCJ 4NP4L 5DJZB 3RJQB 5MERA 1QP1A 5LUMA 4IBQA 4N86A 2Q8AL 5CBEB 5JIQA 1QQDB 5LXGH 4UT9H 1YEIH 3EH4B 3WMSA 5KS9E 1PX3A 4O2FB 3HS9A 5C0AE 1MJ8H 1VENA 2I07B 3KJ4B 5ESVA 3RNKB 5AL8A 5ANMB 4EZJA 2E76C 3MXVL 3D8MA 3IS1X 4LBEB 1DQDL 3D4YA 1ACCA 1NBZA 4PWIA 2XG5B 4CNIB 4P2YA 5FA4B 2ARJB 2V5RA 4HJJL 3UBXB 3LNEA 1KPVA 3C9NB 4TSCL 3HR5B 1H5BA 5FGCB 4ILDA 5C0AD 1OAXH 2GK0B 5ISZB 1A6TB 3BKJL 5DJ6B 4QXTA 2ZTBA 3VXMB 4PJHF 3SOTA 4L1HA 5F7KC 1NDGB 1GGYA 4G2AA 2WXRA 1A7BA 1E28A 5KBNC 4GKSA 1GZHC 4U1IA 3RG1C 2A6IA 3GJFK 1Q1JL 3REVB 2GEEA 4RDBA 4Q9BA 2HMID 3FQNB 5IY5B 1OO2A 4NXKA 4CW1B 4YK4C 3WFHA 1JGUL 2B08A 3EF7A 1NC4B 1P1VA 1TEFA 4XCEB 3VXUB 1CI5A 1BCIA 1RZJL 2KUTA 3DTUB 3WG7B 3MR9A 3U0TB 1NBQA 3H9ZA 4OV5A 1FORL 4HIHA 5ES4B 3S2AA 5TDOA 4Z95H 4ODBD 2F19L 1NMAH 4LLYB 3UGXA 1QSEB 3CN0A 1QBML 3O4OB 2HSIA 1Z1WA 5F7FA 1B6DA 4PJXA 1KULA 3S8GB 2PN5A 4PY8J 5AVRB 4MA3B 4QDGA 1R5WA 2FNWA 1RZKL 3FUNA 1Z9PA 2ATKB 3LNFA 2WGNB 4LKXA 4N0YL 4FFTA 1SGKA 1EEYB 2CHZA 3WCYA 5LBSL 1MFEH 2HRGA 1CF8H 3W5MA 4N8VG 2HJFB 2AXGA 1JVOA 3CU1A 3GSUB 4R7NB 5A16A 5HHOE 1XF2A 3HNSH 4BA0A 1TEYA 2WSPA 4C59B 1FPTL 3FJTA 4GUCA 4IGBC 3GTTA 4JAMA 2A9AA 5DJ2A 4L1LA 1W0YT 2PR4H 2YN3A 4X7DC 3SO3C 2PO6A 4KKCC 3P4MA 2DJSA 5K93A 1SMDA 1X5HA 4IKNA 4JL1A 1QFWI 4PJCF 4UT6H 4YAQB 5CN1A 5C2BL 5L0QC 2AJSL 4BQCA 3IDXL 4NKMB 2GJ6D 2D