1EJMA

Crystal structure of the bpti ala16leu mutant in complex with bovine trypsin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substitutions at the P(1) position in BPTI strongly affect the association energy with serine proteinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/inhibitor
molecule keywords BETA-TRYPSIN
total genus 57
structure length 223
sequence length 223
chains with identical sequence C, E
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejmA02
1QBVH 2GZ9A 2GKVE 1O2NA 5DP8A 3SQHE 4AOQA 3E90B 4X2VA 2D1JA 2EEKA 1V6DA 2A5KA 4IMQA 2NU4E 1SL3A 4Y11E 5EGMA 1AWHB 2ZIQH 1C1OA 1WV7H 2SGEE 1E36B 2VIWA 1LHDH 1S5SA 4BXWA 1XVOA 5L30H 2FWWA 1GMDG 3UUZA 3NPSA 1OKXA 3SV2H 3ZVCA 1V2RT 1ZLRA 1OWJA 1HAOH 2DUCA 1O3GA 3U8OH 1ETRH 1O39A 4NGAH 2NU3E 4NIXA 3K9XB 4SGAE 2FOEA 2SFAA 5LPFA 1BQYA 1CGIE 1UTKA 4AN7A 4ZXYH 2ANMH 2NU1E 3BV9B 4WVPE 1XUGA 1C5RA 1SGYE 5C1XA 2BLWA 2AIQA 1C2HA 3ATKA 2UWLA 3SGQE 1T4UH 1SC8U 3M3VA 4FU8A 1Z7KA 2BVXH 2ZFTA 3SV9A 2ZO3H 2BY7X 1TPSA 3UWIA 1O3AA 3O8BA 1CHOG 1JOUB 2QN5T 2AMQA 1RRKA 1GJ4H 1CVWH 1BBRH 2R9PA 2BY5X 3KF2A 2ZPQA 1P9SA 1C2EA 1SQAA 3L6PA 2J4IA 4ABJA 4JZFH 3PV4A 1BDAA 4ABIA 3MH6A 1GVLA 4WF8A 3CENA 1Q2WA 2QV1A 1BCUH 5TJXA 5B6OA 2HNTF 4CRFA 1S84A 1C2FA 1F0TA 3RMLH 3GDSA 1DXWA 2I6QA 4KTCA 1OP8A 4DW2U 3PLKA 2B8OH 2BYAX 5GCHF 1TGCA 2LNCA 1Y3YA 1BRAA 1NROH 3BTWE 1DVAH 2A1DB 3MO9A 4INHA 1BMNH 2F83A 1HBTH 4BAOB 1XKBC 2ZU1A 3AAUA 3URCA 3A88A 1Z8RA 2VU8E 4FU7A 2J34A 3TJOA 3QUMP 4ESTE 3ZZCA 1FY1A 3MOCA 2FOGA 1GBTA 1Z8IB 1GMHG 2AMDA 5GXPA 1TMUH 4DJZB 2XBXA 3SOSA 1TQ0B 3RXFA 1MTWA 1RJXB 1VJAU 2ILNA 1O2YA 2O9QA 4BOHA 4Q7YA 4ZHLU 1TMTH 1G9IE 4NA7A 4ZROA 1FPCH 3RP2A 3LIWA 2H9EH 4Y0ZE 2FOFA 1DM4B 3A7VA 1SOZA 2YNBA 4GUXA 4ZAEA 2BXUH 1QB9A 1DY8A 4BAKB 1C5OH 3GISB 1O5CB 1OWEA 2OINA 3Q3YA 1YCPH 3TH4H 1XXDA 3RM0H 2OC8A 3F9EA 1QBNA 2BOHB 4TY6A 3O8DA 2P8OB 4X8VH 1W14U 4ZUHA 4A6LA 1Y5AT 1VCPA 2VH0A 2WPJS 2ZFRH 2PFEA 1CBWC 4B75A 1ABJH 2GVFA 4TWWA 1UVOA 3PO1C 2FODA 4OGYA 2P3FH 1YF4A 1A4WH 4Y7AA 4ABGA 1AE8H 1WCZA 5C67A 2DE8A 2VH6A 3OY6U 2WPKS 1O5FH 1V2QT 1S81A 2C8ZB 1QBOA 1DY9A 1L1JA 2G5NA 4KTSA 4AYVB 1C5QA 1MCVA 3TNTA 3ZV8A 1CSOE 1XUJA 3L3TA 5EW2H 1SQOA 1GI1A 3TK6A 2QAAA 2ZU4A 4MLFB 4Y10E 1MD7A 4QT8C 4ABDA 1DLKB 1QHRB 3T26A 2XBWA 1Q31A 2YNAA 3NK8A 2OBOA 4IMZA 1G3CA 2H2ZA 1V2JT 1YYY1 3TH3H 2AH4X 3GY7A 4XE4A 5LPRA 1G3EA 1C2JA 2ANYA 2P3UB 3PB1E 5GDSH 2B9LA 4UFDH 2BD7A 4D8NA 3NUMA 1C5TA 4K1EA 3HPTB 1EZSC 1BMLA 2O8MA 2R2WU 3QGJA 4O03A 3GCHB 3RLYH 3RXOA 5L2ZH 3UIRA 2HPPH 3ODDA 3F1SB 5E8EH 4ZKOU 1UTNA 5AHGH 3MNSA 1AUJA 1IQIA 1A61H 1PFXC 1VITF 1WTGH 2V3HH 1QJ7B 4JZ1A 3U98H 4AB8A 1S0RA 1A0HB 3K6ZA 1HNEE 1KXCA 3SUEA 1MKWH 1AWFH 2J92A 2ZGHA 1TGBA 2BY8X 3SJIA 5F6MA 1SPJA 4AFZA 8GCHG 2WPHS 3QLPH 2B5TB 4AGKA 5CE1A 5PTPA 1PYTC 2BB4A 2FP7B 1HAXB 3SU2A 2FO9A 4JZEH 1F92A 1W7XH 3MU0A 2A4GA 1UK3A 3M5LA 4FUGA 1O3HA 4X2XA 5BPEA 1GVKB 1SGPE 1ZTLA 4WY3A 1CGHA 1WOFA 4GCHF 4DURA 7GCHG 3SNDA 3S7HB 4K1SA 3QZQA 1ESBA 3C27B 2GZ7A 3IG6B 3WY8A 1TRMA 2BD4A 5DP6A 2XBVA 4ZKNU 2F91A 1WQVH 1NRSH 3C1KA 3BIUH 4MPXA 5F8XA 1N8OB 4MNYA 1TWXB 4U01A 2CXVA 4KELA 1EB2A 5LGOA 3MO3A 3F9HA 5DG6A 2RG3A 3M61U 1GHXH 2FTMA 2D8WA 2BD9A 2SGFE 7ESTE 2Z3DA 5AFYH 1W3CA 1TPPA 3E16B 3I77A 1PPHE 4NZQA 1FNIA 2NU0E 2ZWLH 1DWCH 1V2MT 1Y8TA 3TK9A 1ELFA 3ITIA 4Y7BA 1KDQA 2ZHDA 1BJVA 1NU7B 3SI3H 3SNAA 1SVPA 1BHXB 4WH8A 2ZDAH 2J38A 1GI5A 1UVTH 1AFQB 3DUXH 1ELVA 5ESBA 1H8IH 1D3PB 1V2PT 3VGCC 3DA9B 5JB9S 2H9HA 1LKBA 4FXGH 4H6SB 5EOKA 1P01A 4O3TA 4ISIH 3A7TA 3EA8A 1OXGA 4X6OA 1BMAA 4VGCB 1DITH 3NCLA 1AVXA 1C5PA 3MTYA 4PROA 3UWJH 5DP5A 1DSUA 3A89A 4Y0YE 2UUYA 1DWEH 2AFQB 3KHVA 4FUJA 2B0FA 1AGJA 1B0EA 1CA0B 1EPTB 3SUFA 4BXSA 1JRTA 1EXFA 1C5YB 2D2DA 1XUFA 1YPLH 3SNCA 2GCHF 3P6ZB 3SO3A 1L4DA 3GYMA 2FDAA 3HK3B 1NRQH 5F8TA 1H8DH 1AI8H 3RXJA 1TB6H 3A8CA 4B73A 3LH1A 4DCDA 3SU0A 2G52A 1PPGE 4H6TA 5C1UA 3VB6A 1TX6A 2ZDMA 4ABBA 1J17T 1O3IA 4ZHAA 1A2CH 1O3FA 1DPOA 3E3TA 1NFYA 2H5CA 1EQ9A 1FAXA 4Y71A 2PLXA 4U2WA 1MU8B 1FI8A 3SW2B 1EX3A 3BG8A 3BTGE 3RMOH 1HAPH 1O2KA 3A8DA 2Y5GA 1ANEA 4D76A 1CQQA 1HB0B 1AO5A 3RC4A 2AGIX 4TYDA 1IQMA 2STAE 2JKHA 1O3LA 2VIOA 3BEIB 4AFUA 1HPGA 3T27A 3Q3XA 2ANWA 1LMWB 2HLCA 1G2LA 1O36A 3A7YA 3FAOA 3R0FA 1O2UA 1GHYH 3KL6A 3ZV9A 1GBAA 1ZGVA 3LGUA 3SQEE 4FVDA 1NPMA 1NRNH 1F0RA 3GY6A 1PPZA 2SNWA 1QRWA 2F9NA 1C2MA 2THFB 5G4BA 4LZ1H 2A7CA 1K1PA 4J1YA 4WXVA 1RGQA 3SU6A 2GGVB 2XTTB 3MH5A 4X1RU 3TJNA 4ABEA 3PTBA 2GTBA 2VWLA 1G3DA 1VCQA 1QGFA 1NFXA 2AIPA 1KTTB 4BANB 1HLTH 1O3EA 3NKKA 4B71A 2BD5A 2J2UA 1HCGA 1MH0A 4MG3A 3I78A 1GBCA 1P05A 1TOMH 2JETC 3A87A 2BDAA 5DO4H 1SGQE 1GHBG 2VNTA 1GI7B 2QF0A 3ZZ6A 3M7QA 1J14A 2XBYA 3E91A 2ZTZA 2RCEA 2GMTB 3M3TA 1ZPZA 4YESB 3GCOA 1K22H 1UTJA 5FX5A 3LT3A 4H42U 4TWYA 3KQBA 3RXKA 1K9OE 3LJJA 1A5GH 5FCKA 3JZ2B 3V7TA 1ZHMA 2H6MA 1GWAA 1BBRE 1O2ZA 4U32A 4CBOA 3UOUA 3EYDA 3MU5A 3FP7E 2EC9H 4X1SU 4YM9A 5FXLA 3A8AA 1RTLA 4OS2A 4LK4A 1CHOF 3W94A 3PM3A 4MPWA 2TRMA 1ELEE 4Q7XA 3BTEE 1ZJDA 2G8TA 3KQDA 2QXGA 1GBKA 4DOQA 2H1UA 1TNJA 1JMOH 1ARBA 2TGPZ 4IN1A 3HKJB 3AW1A 1P2JA 1OWDA 4DVAU 3K65B 3MHWU 3AASA 1CHGA 1KXFA 1V2TT 3GDVA 1RIWB 3U1IB 4X8SH 1SGRE 1Y3XA 2FOHA 5T6GA 1ZJKA 1H1BA 1THSH 4U30A 1VZQH 2SNVA 3BSQA 4OS1A 5E2OA 1DSTA 3N7OA 1V2NT 3SBKA 1O3MA 5EG4A 1ABIH 2EI6A 1GJ5H 2WYGA 5EODA 1O5BB 4YOJA 2PTNA 1GDNA 1UHBA 2R0KA 3MH4A 4GPGA 1V2VT 2RA0A 1QNJA 4UE7H 1JIMA 2XC5A 3H7TA 3L33A 1V2ST 4IC5A 2V0BA 1LDTT 5JYIA 4BTIB 3BG4C 1UK4A 1BBRK 3VPKA 1AZZA 1LPZB 1YPHE 1EOJA 1KDQB 1FLEE 4D9RA 3A86A 3TU7H 4DIHH 1OP2A 5GIBA 1BA8B 1ELBA 3A7ZA 2QC2A 3LOXA 1TOCB 5L2YH 2ZU5A 1C2KA 9ESTA 4B2CA 2AS9A 3U8TH 2FYRA 8KME2 3UQVA 5EXMA 3MH7A 5A09A 1LQEA 1YKTA 2WPIS 2VVVA 3PMHB 3CS0A 3W95A 1AD8H 3Q76A 1FXYA 3GCNA 1W13U 1VITG 5T6DA 3BG4B 3UREA 3QN7A 3ZZ9A 4TY7A 1AN1E 1BIOA 1SR5C 4JYUH 2PUQH 3U69H 2A4OA 4NA9H 4XOJA 4KGAA 1MU6B 2WUCA 4ZKSU 1BTZA 6GCHG 3A7WA 3KQCA 2QA9E 4VGCC 1RTKA 1GG6B 2ZI2H 3M5MA 5FPTA 3SZNA 1P0SH 4DIIH 2HALA 5EXLA 3SI4H 1DICA 5FCRA 5GJ4B 4ZH8A 3MU8A 1ZTJA 3H7OA 3RMMH 1TBRH 1ZPCA 5A8ZA 1C2DA 1YPJH 2A7JA 4I8KA 2F9VA 2A7HA 4JK6A 2VIPA 5JBCS 1KXBA 1P2IA 3A82A 3PWCA 1AVGH 3RXHA 2RDLA 1MKWK 3B8JA 3D49H 1G32B 2ZTXA 1TGTA 1SGFG 7LPRA 4MDSA 1QA0A 2WYJA 1GMCF 1MBQA 2PGQB 4AX9H 4FUDA 1GI0A 4NZLA 1A3EH 1O2GH 1XX9A 2XNIA 1V2KT 1YCPM 4Z6AH 2JH5D 2AGEX 2K1QA 1C1QA 1O0DH 1EB1H 2ZZUH 1ELCA 1W0ZU 3AVZA 3EA7A 3LPRA 1BJUA 1CA0C 1EPTC 4FU9A 2GMTC 3GCTF 3T25A 2ZQ1A 1LPKB 1P03A 2ODQA 4UD9H 3T5FH 1Z6EA 3BTDE 1QB6A 1O38A 3LONA 1A0JA 2R3UA 2Z6BD 1SGFA 4FUCA 3KCGH 1EJMA 2ALVA 2FI4E 3RXVA 1GGDB 4FUIA 3EE0B 2V6NA 5J4SA 2ZDNA 1N6XA 2EI7A 3EDXB 5DJ7A 1N1LA 3RU4T 2G81E 1W10U 1JBUH 2A31A 2BX4A 1XUHA 1TRNA 4Q80A 2XRCA 1DWDH 1FJSA 2Q6GA 5IYTA 1YBWA 4A7IB 3RXIA 1B0FA 1T8LA 3ATLA 5BRRE 1ACBE 1MTSA 1DOJA 1BUIA 3OYPA 4TPIZ 3SU1A 1TNKA 4Y8YA 1EPTA 4ISLA 5C1YA 1OPHB 2GCTC 3ZZAA 2F9OA 3PWBA 3QTVH 3ZZ3A 4I8LA 1EJNA 3PMAB 4WWYA 3TH2H 1ZZZA 2NWNA 4GSOA 2GZ8A 5E0GA 1PPFE 3A84A 4IC6A 3RC5A 1ZSJA 1BTYA 1IQKA 1LVYA 1MBMA 1O3KA 3P8NA 2F9UA 5HM2A 1O3BA 2PTCE 1B7XB 4H4FA 4JK5A 4AZ2B 3LDXH 1UTPA 1XKAC 1MCTA 1TABE 1P2QA 3T28A 1IQGA 4MQAA 1CT2E 2C8XB 2O8TA 1C5NH 4NCYA 4AORA 3RUOA 1W12U 1UJ1A 1A5HA 1TGNA 3IITA 1CE5A 1C5UA 2CF8H 2LPRA 2A32A 2HWLB 1C5SA 1HIAA 1ZOMA 1EZXC 1K1MA 3BF6H 1WSSH 1KXEA 4Y8ZA 4CBNA 1K1LA 2BOKA 4D7FA 2PR3A 4X1NU 1SBWA 1OSSA 4I8HA 2A4RA 1CU1A 2BDYA 2DE9A 1RXPA 1TNIA 4JMYA 4CHAB 1P09A 1O2PA 1FONA 3LC3A 1YPMH 1LKAA 1GPZA 2C93B 1QJ1B 2Y82A 2G5VA 1C1SA 1ANCA 1RD3B 4WMDA 1LVBA 2ZNKH 3QK1A 1L2EA 4AYYB 2PWXA 3UY9A 1G36A 2GX4A 1C4Y2 3Q77A 4ZMAH 1N8OC 1HYLA 4B74A 5FPYA 3NWUA 3RC6A 8GCHF 1G2MA 1ZHRA 3GY2A 5A8XA 4BTTB 1KY9A 4INLA 4D7GA 1UK2A 1BT7A 3UFAA 1H9HE 1TIOA 2BD3A 1O2RA 2STBE 5EPYA 4JZDH 1TONA 2Z9JA 3GICB 3ATMA 1W2KH 2AYWA 1C2GA 3SN8A 2Z3CA 6ESTA 1HIAB 2R3YA 4A1VA 3PYHA 5FHTA 2ZHWH 4CH8B 1ZRKA 1VITH 3LGIA 3LGWA 1XMNB 1SGTA 1FUJA 1EOLA 4XFQA 1HJAC 3GY8A 2AERH 2CGAA 4UFFH 5FAHA 5ETXA 3FANA 1ELAA 4R0IA 5IDKA 1FZZA 3GYLB 3FZZA 3ZVAA 1F7ZA 1BTUA 4ZHMU 3KQEA 4HI3A 4XDEA 1GHBF 1NO9H 8ESTE 1AB9C 1MUEB 1O35A 1O2MA 2R2MB 1KLTA 1TBQH 2SGQE 2OC0A 2XW9A 3FZDA 1P2KA 5C20A 1AUTC 5CHAC 1DFPA 5C5NA 4E06H 4A1XA 2W5EA 2O8UA 3QO6A 1AHTH 3I29A 4NFFA 1EZQA 4MPUA 1YP9A 5DP7A 2GDDA 2EA3A 2FEQH 1ANBA 1WQSA 1EATA 3P92A 1TPOA 2TIOA 5T3HA 2ZTYA 1O5EH 2Z7FE 1O2LA 5AFZH 3S7KB 1MTVA 1WYKA 2H5DA 3ODFA 4ZXXH 4RKOB 2ZDVH 3ZVEA 2O8WA 1YC0A 4NG9H 2O8LA 2G00A 3B9FH 2UWPA 2XC4A 2C8WB 2ZECA 2GT8A 1BITA 5DP3A 3U9AH 4WMEA 2ZGBH 2HVXA 1Y5UT 3BTFE 5H4IB 4ASHA 1IOEA 2F3CE 1GI9B 2Z9LA 1M9UA 1J16A 3OSYA 1E35B 3P8GA 2JH6D 1QIXB 4I8JA 1C9TA 3F68H 3F9GA 1SOTA 3ZVGA 3UR9A 1C5WB 1SGIB 1FIWA 2BY9X 2W3KA 3A81A 3ELAH 2ZU3A 4A92A 2VINA 1L0ZA 1WAYB 1P06A 2Y7ZA 3S9AA 4K8YA 1MTNC 4OS7A 5E0JA 3SJKA 1LHCH 1HAGE 2AEIH 2FMJA 2ZGCA 3KGPA 1XUIA 2ODYB 3LC5A 2FYQA 4AGJA 1J8AA 1V3XA 3RXTA 1BHXF 1O2WA 4R8TB 3S69A 1ELTA 4FUBA 1BRCE 1GHVH 2V3OH 1JXPA 5C2ZA 1P02A 5J4QA 3SUDA 1GBIA 4THNH 2TBSA 4M7GA 2ZP0H 2P59A 1GBEA 2V35A 3MMGA 2BQ7B 4O3UA 1C5ZB 1GCTC 2VB0A 4MNXA 4CRAA 4UFGH 1ZMNA 4DG4A 3O8CA 3DT0H 2ZU2A 1BTWA 5FX6A 2XCNA 4B2BA 1C5MD 3PTNA 4Z0KA 1O2SA 1QURH 3ENSB 1QA7A 2PHBA 1SLWB 4LZ4B 1E38B 1BOQA 2ZKSA 3HGNA 1F5RA 5HGGA 1GMDF 2SGAA 2KAIA 2WV4A 1GHZA 2ASUB 1FDPA 5DP4A 2QXJA 1P8VC 2VGCB 1UVUH 4F49A 4ISOA 2IPHA 7GCHF 1UTLM 1GI6A 3M5NA 1GJDB 2C4FH 3RXEA 2XWAA 1ZHPA 2FZZA 4F4OC 1LPGB 4MNVA 2TPIZ 2QF3A 1AVWA 2A45B 2FLBH 5SGAE 1UCYK 2BMGB 1QQUA 4JCNA 3A8BA 5A0AE 1E34B 3UTUH 2P16A 2ZC9H 1LO6A 1BB0B 3RM2H 1DLEA 4BAHB 1EP6A 1O30A 3H5CB 4JYTA 2JH0D 3SGAE 3F6UH 1JIRA 2YOLA 1AB9B 2HOBA 5EQRA 3Q3KA 5GCHG 2PGBB 1TRYA 4NFEA 1C5LH 1XM1A 5EXNA 1IQJA 1LVMA 2GT7A 3M3SA 1HAHH 3TK5A 1FIZA 1UTQA 1GI8B 4HGCA 1UVSH 1A46H 3E8LA 2W7UA 1O3JA 1RS0A 1G3BA 4O97A 1P2MA 2Q1JA 2QXIA 3ZZ5A 1Z1IA 4NSYA 1GHAF 1TLDA 3KN2A 4XSKU 3QWCH 3K2UA 2HRVA 4GHQA 3A85A 3GCHC 1YPKH 2ZHQH 3K6YA 1TA2A 1V2OT 2BDCA 1QTFA 3LKWA 3RXDA 2M5TA 2FX6A 2OC7A 2PW8H 2TGTA 3OTJE 2XYAA 1HFDA 1FY5A 1YLCA 2OTVA 4SGBE 3RXRA 3ZZDA 2BDIA 5EQQA 1ESAA 3VB3A 5CMXH 4HTCH 2OLGA 3BN9A 1QJ6B 4B1TA 2BX3A 1SLVB 5K7RA 1GJ9B 1DDJA 1MAYA 1MKXK 2HGTH 4NIVA 4K1TA 4K69A 4B76A 1O5GH 4YOGA 3LJOA 4E05H 1GDQA 1GL0E 2Y5HA 1EAXA 1T8OA 1Y3UA 3SNBA 1D6WA 3TVJB 2FOMB 5C5OA 2GV6A 1F5LA 1LHFH 1ZMLA 5JPMH 3S9BA 1RTFB 3VEQB 1NN6A 3VB4A 3ZVFA 3A83A 2WV5A 3E0NB 3KNXA 3SJ8A 4B2AA 5F03A 4IGDA 1P04A 1ZPBA 3UPEA 1E0FD 4A1TA 2VGCC 3MU4A 1S6HA 1C1TA 1GJ7B 1UO6A 4YT7H 1YPEH 6LPRA 1T8MA 5HMAA 1OWIA 4CRCA 1W0YH 1FQ3A 1KXAA 2Y81A 2VWMA 1H4WA 1CA8B 3SU4A 1K1IA 3GOVB 1O2HA 2UUFB 1GDUA 1DT2A 3M7TA 5EQSA 1P57B 3PROA 5JBTA 2ODPA 4INKA 2Z94A 2BDBA 2J95A 1DWBH 4KP0A 5I25A 1ZTKA 3S0NA 1FMGA 5DPAA 4AG1A 2UUKB 3BTKE 3LGVA 1MZAA 3RXSA 3DFJA 2Y6TA 4UDWH 4RSPA 2P8OC 2ZFQH 6GCHF 1H9IE 3GY3A 1K1OA 3B23B 4Y8XA 3TNSA 2FI3E 4D9QA 1EAIA 4LOYH 1GMCG 4UFEH 2QGRA 2BVRH 2GDEH 4K2YA 2HPQH 1GJ6A 1O3OA 1GI2A 3RXQA 1WUNH 3UNSA 1ARCA 1PQ7A 1DXPA 1QB1A 2CN0H 1U6QA 1NY22 2SGPE 3RMNH 1ZGIA 4ABHA 1F5KU 3OY5U 3HKIB 1UMAH 1TNLA 2FX4A 1EP5A 2FOCA 2ZF0H 1GBBA 3RXGA 3VXFH 1F2SE 2QIQA 2GCTB 1LHGH 1O2IA 4GAWA 3SUGA 1ID5H 1HAZB 1A5IA 3MFJA 1LCYA 1QFKH 1TX8A 1QL7A 2WPLS 4A5TS 1UVPA 3F9FA 3UOPA 1G30B 1FN6A 1TNHA 4CREA 2GP9B 1B5GH 3MO6A 3EAJA 2WPMS 1CT4E 1QCPA 4NWKA 3SJ9A 4E7NA 3SNEA 5JB8S 1TALA 2BLOA 1UCYH 1A7SA 1OWKA 2H9TH 2PV9B 1MMJN 1EAWA 6CHAC 4RN6A 1SB1H 1OYQA 3P95A 4K60A 1O31A 3V13A 3BTTE 1HJ8A 3BEUA 1O32A 1NS3A 1O3NA 3ATIA 4X8UH 3RU4D 3Q00A 4YO9A 1GHWH 2BY6X 7KMEH 1FY8E 1Q3XA 2ESTE 5CHAB 1GCDA 1SG8B 2BZ6H 1NM6A 2P95A 1GMHF 2IJOB 3NXPA 1AY6H 1HJAB 3QZRA 4AB9A 1HJ9A 3BIVH 3FP6E 3TPIZ 3ZZBA 3KIDU 1TAWA 3LGTA 1F0UA 1HRTH 2QXHA 2PKAA 3CS7A 2A4QA 1D6RA 3D23A 2D26C 1C5VA 1HAYB 2TGDA 1KLJH 1KTSB 3QX5H 4GLYA 4I33A 1DUAA 1O5DH 2XWBI 5GWZA 4K3JA 2GV7A 3ZZ8A 5EW1H 4FVBA 1IQLA 1GI4A 4X6NA 2FXRA 4ISHH 4CR9A 5LPEA 5C3NA 1A1RA 5DK1A 1HAVB 1PPCE 5HM9A 3RXBA 3G01A 1O33A 2ZCHP 2AMPA 3M35A 5ESTE 4MPVA 4Y76A 2ALPA 3RXLA 1P10A 1GL1A 5K0HA 1MTUA 1TMBH 2BHGA 3KEEA 1BTHH 1ETTH 1TE0A 5A8YA 3UNQA 3PMBB 2XC0A 1TX7A 3RXPA 3D65E 2BD2A 5I46H 1GJAB 2GCHG 3P70B 4KKDA 2FI5E 1LHEH 4I31A 2CMYA 1FY4A 1SLXB 3TGKE 4JYVH 3HK6B 2CJIA 2C90B 3EGKH 1HXEH 1S0QA 4NSVA 3MI4A 4DY7B 1NC6A 2HNTC 3BTHE 1GI3A 3QGNB 5EPNA 1XXFA 1HAVA 5EU8A 1TFXA 5DP9A 1C1VH 1AU8A 2QYIA 1GBJA 1ZSKA 4YT6H 1O5AB 3GDUA 4J2YB 1MZDA 1DS2E 4I32A 1OX1A 2HNTE 2R0LA 1D3QB 1W7GH 1EKBB 1LTOA 4DT7B 3SV6A 4XBDA 1FY3A 2IN2A 4CHAC 1BRBE 2FS8A 3V0XA 4I7YH 1T8NA 3UNRA 1GVZA 1HGTH 1V2UT 3IWMA 1OP0A 1HAIH 2PSXA 2ZDKA 2ZPSA 3ZVDA 1TA6A 2OP9A 2BM2A 1VJ9U 3ATWA 2OQUA 1Y3VA 3P17H 2P94A 3A7XA 3SU5A 1QY6A 1P3CA 2ZFPH 2ZFSA 1P12E 1SHHB 1O3CA 2WINI 2JETB 1GJ8B 1SQTA 4X0WU 1S6FA 3M36A 4NA8A 3SV8A 1Z8JB 2FPZA 4TPYA 1NT1A 3AAVA 2OUAA 3M5OA 1TNGA 1FV9A 1GG6C 4XBCA 2C3SA 3EA9A 3PLBA 2VVUA 1T7CA 2BTCE 5FBIA 1PPEE 1L1GA 1IHSH 3QDZB 1DE7H 2RA3A 1QR3E 3V3MA 3OX7U 1NFWA 1NU9A 1SGDE 5JDUB 1KIGH 3A80A 1FPHH 5DGJA 1O2QA 3LH3A 1HV7A 1JWTA 5JBAS 3GY4A 1C4U2 5HXFA 2B7DH 4MTBA 3T2NA 4YTAA 3TGJE 3GY5A 2Z3EA 1S82A 1K21H 3V12A 2FTLE 4OS5A 1AQ7A 1BZXE 1H9LB 1RIWC 5LH8A 1NRRH 4IW4E 1C2IA 2BQ6B 4FUEA 2FOAA 1KLIH 1ZR0A 3OU0A 1IQNA 2BQWB 1G37A 4WXIA 1CT0E 1THPB 1ZRBA 2BDHA 1X7AC 5A2MH 1NRPH 2J94A 1W8BH 1HXFH 3R3GB 1SMFE 1ELGA 1MQ6A 3BTME 3AW0A 5FPSA 1S83A 1SGEE 1GJBB 3RXAA 4I8GA 1FAKH 4Q2KA 3EQ0H 4E7RG 2ZQ2A 1QQ4A 2P93A 4DGJA 2ZCKP 1AIXH 1MAXA 1A3BH 2Z9IA 3SU3A 2ZA5A 1O2XA 1CGJE 2VJ1A 4K5ZA 5TCAA 1C4V2 1SI5H 4BNRA 3ZYEA 4NIWA 3LGYA 4HFPB 3SORA 3VXEH 3QTOH 1GHAG 1QRZA 1UTMA 2QY0B 2FOBA 1O3DA 2CHAC 4Q7ZA 4Y79A 3TJVA 4MVNA 2EI8A 1Y3WA 2BLVA 5AF9H 1SFQB 2W3IA 2CV3A 1LVOA 2F9BH 2PKAB 1N6YA 4Y6DA 3STJA 1MD8A 1IQFA 1EZUC 2OQ5A 1PPBH 1PYTD 1W11U 1JRSA 1ORFA 1QRXA 2FLRH 3MU1A 4YLQH 2Y7XA 1IHTH 1GGDC 1NFUA 3M7UA 1J9CH 3SGBE 2UUJB 4CRDA 2ZFFH 3E6PH 4GHTA 1XVMA 2BD8A 2KAIB 8LPRA 4XBBA 1INCA 1YCPK 3E0PB 3URDA 2J9NA 1SSXA 2ZG0H 3ZYDA 3D62A 4O9VA 3P8FA 4ABFA 4JZIA 4X6MA 3DD2H 2GD4B 4X1QU 1TBZH 1O2OA 2BLQA 4IS5A 5L6NH 1AFEH 4OGXA 3TLOA 1HUTH 1YGCH 3RXCA 1NESE 1TQ7B 1F0SA 1WBGB 3PLPA 3ESTA 1OOKB 4MNWA 3MNXA 1K2I1 1C1PA 4ZKRU 4X8TH 4GCHG 1KYNA 1PJPA 1YPHC 1C9PA 1C1RA 2Z9GA 2ULLA 3MNBA 1PQ8A 4IBLH 1DANH 3BEFB 2ZPRA 2W7SA 3RU4E 3SJOA 1HDTH 1AFQC 1K28D 1MQ5A 4LXBH 2CHAB 4OS4A 1O34A 1P9UA 1WTHD 1NZQH 1O2JA 1C1WH 3TGIE 3MNCA 1PQAA 1O3PB 3P8OA 2VIVA 3VB5A 2WUBA 3SV7A 4AG2A 1D3DB 2Z9KA 1SGCA 1YLDA 3DFLA 3DHKH 2BXTH 1V2WT 1VCWA 1OYTH 5T6FA 3U8RH 3ZZ4A 1O37A 2XCFA 1UHBB 1KXDA 1TGSZ 1GBMA 1YM0A 1T32A 4KTUA 3MYWA 1AKSA 4UEHH 3PMJA 1ANDA 1C1UH 1ESTA 1VGCC 1BTXA 1ZYOA 1ELDE 3STIA 1P3EA 2PKSB 1WU1A 2VWNA 5ABWA 1AZ8A 2W26A 4YZUA 2ANKH 1K1NA 2OD3B 3FP8E 5AVDA 2XXLA 3S9CA 5DKMA 4OS6A 1RFNA 2OBQA 2TGAA 3RDZA 4BAMB 1EAUA 1CO7E 1V2LT 4AFQA 2Y5FA 5GPIB 4NWLA 2PSYA 1SLUB 3HATH 1P2OA 2FESH 3NZIA 1GJCB 1P2NA 1S85A 5A0CA 1Y5BT 2OCVB 1GBDA 1J15A 1A0LA 1AE5A 3M37A 3PO1B 2OXSA 1O2TA 1K1JA 2ZHEH 1GBLA 2PKSC 1OS8A 2FIRH 3TIUA 1VGCB 2G4UA 1BRUP 1BMMH 1C2LA 4WJG2 1PQ5A 2UWOA 1O2VA 2ZDLA 2P3TB 2VVCA 3FVFB 1Z71A 1ZMJA 1TYNA 3GCTG 1C1MA 2VWOA 1MTNB 3UQOA 4AFSA 3T29A 3TITA 4BTUB 2ZGJA 2OC1A 9LPRA 2A0QB 2C8YB 1Y59T 1TPAE 3BTQE 1D3TB 5JBBS 4ABAA 1GBHA 3UR6A 1AKSB 1L4ZA 3SHAH 4X6PA 1DUEA 1GCTB 2G51A 1SGNE 1UCYE 4RKJB 2Q6FA 2BVSH 4CRBA 2IOTA 1ZSLA 3LU9B 4WMFA 1NTPA 4X2YA 1AMHA 1C5XB 3O8RA 5A0BA 1OWHA 4HZHA 1LQDB 2I6SA 1GBFA 1C1NA 4ISNA 1THRH 2A2QH 2VIQA 4FUFA 5E2PA 3TJUA 1IQEA 1VR1H 3VB7A 1L1NA 2ZCLP 1SFIA 4YLUA 1P11E 1QL8A 1KSNA 3JZ1B 2FM2A 2G4TA 1EUFA 4FUHA 1BTPA 1SHYA 1YPGH 5HYOA 1XUKA 2AGGX 4NIYA 4WH6A 1UTOA 3MWIU 2A5AA 6CHAB 2F9PA 1IAUA 3U1JB 1EASA 5F8ZA 1MKXH 4BAQB 4K8BA 1ETSH 2Q6DA 3SHCH 3ZZ7A 2A2XH 2VIDA 3CP7A 5FBEA 1QL9A 4X2WA 3VFEA 1E37B 4CRGA 1DX5M 3E1XB 2BZAA 2A5IA 2ZEBA 4CR5A 2ZHFH 2NU2E 1Z8GA 1EJAA 3HGPA 3RXMA 5E0HA 2CF9H 3RXUA 1D4PB 1Z1JA 2SGDE 2Y80A 3VGCB 1D9IA 3RLWH 4YOIA 3ZVBA 4UONA 5TCCA 4GVUA 1IQHA 2FS9A 1T31A 2ZGXH 2G55A 2QCYA 3FFGA 2PUXB 2BDGA 4CH2B 3T62A 4IN2A 1Z6JH 1T4VH 1CBWB 4X1PU 1FN8A
chains in the Genus database with same CATH superfamily
1QBVH 2GZ9A 2GKVE 1O2NA 5DP8A 3SQHE 4AOQA 3E90B 4X2VA 2D1JA 2EEKA 3DSPA 1V6DA 2A5KA 3WWFA 4IMQA 2NU4E 1SL3A 4Y11E 5EGMA 1AWHB 2ZIQH 1C1OA 1WV7H 2SGEE 1E36B 2VIWA 1LHDH 1S5SA 4BXWA 1XVOA 5L30H 2FWWA 1GMDG 3UUZA 3NPSA 1OKXA 3SV2H 3ZVCA 1V2RT 1ZLRA 1OWJA 1HAOH 2DUCA 1O3GA 3U8OH 1ETRH 1O39A 4NGAH 2NU3E 4NIXA 3K9XB 4SGAE 2FOEA 2SFAA 5LPFA 1BQYA 1CGIE 1UTKA 4AN7A 4ZXYH 2ANMH 2NU1E 3BV9B 3F2FA 4WVPE 1XUGA 1C5RA 1SGYE 5C1XA 3PRBA 2BLWA 2AIQA 1C2HA 3ATKA 4ZCNA 2UWLA 3SGQE 1T4UH 1SC8U 3M3VA 4FU8A 1Z7KA 2BVXH 2ZFTA 3SV9A 2ZO3H 2BY7X 1TPSA 3UWIA 1O3AA 3O8BA 1CHOG 1JOUB 2QN5T 2AMQA 1RRKA 5KGOA 1GJ4H 1CVWH 1BBRH 2R9PA 2BY5X 3KF2A 2ZPQA 1P9SA 1C2EA 1SQAA 3L6PA 2J4IA 4ABJA 4JZFH 3PV4A 1BDAA 4ABIA 3MH6A 1GVLA 4WF8A 3CENA 1Q2WA 2QV1A 1BCUH 5TJXA 5B6OA 2HNTF 4CRFA 1S84A 1C2FA 1F0TA 2KCAA 3RMLH 3GDSA 1DXWA 2I6QA 4KTCA 1OP8A 4DW2U 3PLKA 2B8OH 2BYAX 5GCHF 1TGCA 2LNCA 1Y3YA 1BRAA 1NROH 3BTWE 1DVAH 2A1DB 3MO9A 4INHA 1BMNH 2F83A 1HBTH 4BAOB 1XKBC 2ZU1A 3AAUA 3URCA 3A88A 1Z8RA 2VU8E 4FU7A 2J34A 3TJOA 3QUMP 4ESTE 3ZZCA 1FY1A 3MOCA 2FOGA 1GBTA 1Z8IB 4DT4A 1GMHG 2AMDA 5GXPA 1TMUH 4DJZB 2XBXA 3SOSA 1TQ0B 3FOAA 3RXFA 2L74A 1MTWA 1RJXB 1VJAU 2ILNA 1O2YA 2O9QA 4BOHA 4Q7YA 4ZHLU 1TMTH 1G9IE 3ZIAD 4NA7A 4ZROA 1FPCH 3RP2A 2WV9A 3LIWA 2H9EH 1YWUA 4Y0ZE 5F53A 2FOFA 1DM4B 3A7VA 1SOZA 2YNBA 4GUXA 4ZAEA 5B6LA 2BXUH 1QB9A 1DY8A 4BAKB 1C5OH 3GISB 1O5CB 1OWEA 2OINA 3Q3YA 1YCPH 3TH4H 1XXDA 3RM0H 2OC8A 2PP6A 3F9EA 1QBNA 2BOHB 2XOKD 4TY6A 3O8DA 2P8OB 4X8VH 1W14U 4ZUHA 4A6LA 1BMFD 1Y5AT 1VCPA 2VH0A 2WPJS 2ZFRH 2PFEA 1CBWC 4B75A 1ABJH 2GVFA 4TWWA 1UVOA 3PO1C 2FODA 4OGYA 2P3FH 1YF4A 1A4WH 4Y7AA 4ABGA 1AE8H 1WCZA 5C67A 2RFKC 2DE8A 2VH6A 3OY6U 2WPKS 1O5FH 1V2QT 1S81A 2C8ZB 2J97A 2WSSD 1QBOA 1DY9A 1L1JA 2G5NA 4KTSA 4AYVB 1C5QA 1MCVA 3TNTA 3ZV8A 1CSOE 1XUJA 3L3TA 5EW2H 1SQOA 1GI1A 3TK6A 3PV2A 2QAAA 3GS9A 2ZU4A 4MLFB 4Y10E 2J5UA 1MD7A 4QT8C 4ABDA 1DLKB 1QHRB 3T26A 2XBWA 1Q31A 2YNAA 3NK8A 2OBOA 2W6ID 4IMZA 4Z1MD 1G3CA 2H2ZA 1V2JT 1YYY1 3TH3H 2AH4X 3GY7A 4XE4A 5LPRA 1G3EA 1C2JA 2ANYA 2P3UB 3PB1E 5GDSH 2B9LA 4UFDH 2BD7A 4D8NA 3NUMA 1C5TA 3PRDA 4K1EA 3HPTB 1EZSC 1BMLA 2O8MA 2R2WU 3QGJA 4O03A 4TSFD 3GCHB 3RLYH 5EIYA 3RXOA 5HKKD 5L2ZH 3UIRA 2HPPH 3ODDA 3F1SB 5E8EH 2HLDD 4ZKOU 1UTNA 5AHGH 3MNSA 1AUJA 1IQIA 1A61H 1PFXC 1VITF 1WTGH 2V3HH 1QJ7B 4JZ1A 3U98H 4XD7D 4AB8A 1S0RA 1A0HB 3K6ZA 1HNEE 1KXCA 3SUEA 1MKWH 1AWFH 2J92A 2ZGHA 1TGBA 2BY8X 3SJIA 5F6MA 1SPJA 4AFZA 8GCHG 2WPHS 4RT1A 3QLPH 2B5TB 4AGKA 5CE1A 5PTPA 1PYTC 2BB4A 1H8ED 2FP7B 1HAXB 3SU2A 2FO9A 4JZEH 1F92A 1W7XH 3MU0A 2A4GA 1UK3A 3M5LA 4FUGA 1O3HA 4X2XA 5BPEA 1GVKB 1SGPE 1ZTLA 4WY3A 1CGHA 3H09A 1WOFA 4GCHF 4DURA 7GCHG 3SNDA 3S7HB 4K1SA 3QZQA 1ESBA 3C27B 2GZ7A 3IG6B 3WY8A 1TRMA 2BD4A 5DP6A 2XBVA 4ZKNU 2F91A 1WQVH 1NRSH 3C1KA 3BIUH 4MPXA 5F8XA 1N8OB 4MNYA 1TWXB 4U01A 5IK2D 2CXVA 1W0JD 4KELA 1EB2A 5LGOA 3MO3A 3F9HA 5DG6A 2RG3A 3M61U 1GHXH 2FTMA 2D8WA 2BD9A 2SGFE 7ESTE 2Z3DA 5AFYH 1W3CA 1TPPA 3E16B 3I77A 1PPHE 4NZQA 1FNIA 2NU0E 2ZWLH 1DWCH 1V2MT 1Y8TA 3TK9A 1ELFA 3ITIA 4Y7BA 1KDQA 2ZHDA 1BJVA 1NU7B 3SI3H 1E1RD 3SNAA 4Q63A 1SVPA 1BHXB 4WH8A 2ZDAH 2J38A 1GI5A 1YY3A 1UVTH 1AFQB 3DUXH 1ELVA 5ESBA 1H8IH 1D3PB 1V2PT 3VGCC 3DA9B 5JB9S 2H9HA 1FX0B 1LKBA 4FXGH 4H6SB 5EOKA 1P01A 4O3TA 4ISIH 3A7TA 3EA8A 1OXGA 4X6OA 1BMAA 4VGCB 1DITH 3NCLA 1AVXA 1C5PA 3MTYA 4PROA 3UWJH 5DP5A 1DSUA 3A89A 4Y0YE 3FN8A 2UUYA 1OHHD 1DWEH 2AFQB 3KHVA 4FUJA 2B0FA 1AGJA 1B0EA 1CA0B 1EPTB 3SUFA 4BXSA 1JRTA 4B6EA 1EXFA 1C5YB 2D2DA 1XUFA 1YPLH 4XRNA 3SNCA 2GCHF 3P6ZB 3SO3A 1L4DA 3GYMA 2FDAA 3HK3B 1NRQH 5F8TA 1H8DH 1AI8H 3RXJA 1TB6H 3A8CA 3VG8A 4B73A 3LH1A 4DCDA 3SU0A 2G52A 1PPGE 4H6TA 5C1UA 3VB6A 1TX6A 2ZDMA 4ABBA 1J17T 1O3IA 4ZHAA 1A2CH 1O3FA 1DPOA 3E3TA 1NFYA 2H5CA 1EQ9A 1FAXA 4Y71A 2PLXA 1E79D 1MU8B 2L6OA 4U2WA 1FI8A 3SW2B 1EX3A 3BG8A 3BTGE 3RMOH 1HAPH 1O2KA 3A8DA 2Y5GA 1ANEA 4D76A 1CQQA 1HB0B 1AO5A 3RC4A 2AGIX 4TYDA 1IQMA 2STAE 2JKHA 1O3LA 2VIOA 3BEIB 4AFUA 1HPGA 3T27A 3Q3XA 2ANWA 1LMWB 2HLCA 1G2LA 1O36A 3A7YA 3FAOA 3R0FA 1O2UA 1GHYH 3KL6A 3ZV9A 1GBAA 1ZGVA 3LGUA 3SQEE 4FVDA 1NPMA 1NRNH 1F0RA 3GY6A 1PPZA 2SNWA 1QRWA 2F9NA 1C2MA 2THFB 5G4BA 4LZ1H 2A7CA 1K1PA 4J1YA 4WXVA 1RGQA 3SU6A 2GGVB 2XTTB 3MH5A 4X1RU 3TJNA 4ABEA 3PTBA 2GTBA 2VWLA 1G3DA 1VCQA 1QGFA 3F2HA 1NFXA 2AIPA 1KTTB 4ACAA 4BANB 1HLTH 1O3EA 3NKKA 4B71A 2BD5A 2J2UA 1HCGA 1MH0A 4MG3A 3I78A 1GBCA 1P05A 1TOMH 2JETC 3A87A 2BDAA 5DO4H 1SGQE 1GHBG 2VNTA 1GI7B 1SQRA 2QF0A 3ZZ6A 3M7QA 1J14A 2XBYA 3E91A 2ZTZA 2RCEA 2GMTB 3M3TA 1ZPZA 4YESB 3GCOA 1K22H 1UTJA 5FX5A 3LT3A 4H42U 4TWYA 3KQBA 3MQKC 3RXKA 1K9OE 3LJJA 1A5GH 5FCKA 3JZ2B 3V7TA 1ZHMA 2H6MA 1GWAA 1BBRE 1O2ZA 4U32A 4CBOA 3UOUA 3EYDA 3MU5A 3FP7E 2EC9H 4X1SU 4YM9A 5FXLA 3A8AA 1RTLA 4OS2A 4LK4A 1CHOF 1VKYA 3W94A 3PM3A 4MPWA 2TRMA 1ELEE 4Q7XA 3BTEE 1ZJDA 2G8TA 3KQDA 2QXGA 1GBKA 4DOQA 3WWBA 2H1UA 1TNJA 1JMOH 1ARBA 2TGPZ 4IN1A 3HKJB 3AW1A 1P2JA 1OWDA 4DVAU 3K65B 3F0PA 3MHWU 3OAAD 3AASA 1CHGA 1KXFA 1V2TT 3GDVA 1RIWB 3U1IB 4X8SH 1SGRE 1Y3XA 2FOHA 5T6GA 1ZJKA 1H1BA 1THSH 4U30A 1VZQH 2SNVA 3BSQA 4OS1A 5E2OA 1DSTA 2YMSB 3N7OA 1V2NT 3SBKA 1O3MA 5EG4A 1KMHB 1ABIH 2EI6A 1GJ5H 2WYGA 5EODA 1O5BB 4YOJA 2PTNA 2KM0A 1GDNA 1UHBA 2R0KA 3MH4A 4GPGA 1V2VT 2RA0A 1QNJA 4UE7H 1JIMA 2XC5A 3H7TA 5DSFA 3L33A 1V2ST 4IC5A 2V0BA 1LDTT 5JYIA 4BTIB 3DCLA 3BG4C 3WW7A 1UK4A 1BBRK 3VPKA 1AZZA 1LPZB 1YPHE 1EOJA 1KDQB 1FLEE 4D9RA 3A86A 3TU7H 4DIHH 1OP2A 5GIBA 1BA8B 1ELBA 3A7ZA 2QC2A 3LOXA 1TOCB 5L2YH 2ZU5A 1C2KA 9ESTA 3DSGA 4B2CA 2AS9A 3U8TH 2FYRA 8KME2 3UQVA 5EXMA 3MH7A 5A09A 1LQEA 1YKTA 2WPIS 2VVVA 3PMHB 3CS0A 3W95A 1AD8H 1NBME 3Q76A 1FXYA 3GCNA 1W13U 1VITG 5T6DA 3BG4B 3UREA 3QN7A 3ZZ9A 4TY7A 1AN1E 1BIOA 1SR5C 4JYUH 2PUQH 3U69H 5CDFE 2A4OA 4NA9H 4XOJA 4KGAA 1MU6B 2WUCA 4ZKSU 1BTZA 6GCHG 3A7WA 3KQCA 2QA9E 4VGCC 1RTKA 1GG6B 2ZI2H 3M5MA 5FPTA 3SZNA 4FETA 1P0SH 4DIIH 2HALA 5EXLA 3SI4H 1DICA 5FCRA 5GJ4B 4ZH8A 3MU8A 1ZTJA 3H7OA 3RMMH 1TBRH 1ZPCA 5A8ZA 1C2DA 1W0KD 1YPJH 2A7JA 4I8KA 2F9VA 2A7HA 2IJD1 2VIPA 4JK6A 5JBCS 3SZEA 1KXBA 1P2IA 3A82A 3PWCA 1AVGH 2J98B 3RXHA 2RDLA 1MKWK 3B8JA 3D49H 1G32B 2ZTXA 1TGTA 1SGFG 7LPRA 4MDSA 1QA0A 2LP6A 2WYJA 1GMCF 1MBQA 2PGQB 1SKYE 4AX9H 4FUDA 1GI0A 4NZLA 2WPDD 1A3EH 1O2GH 1XX9A 3F2GA 5EJLA 2XNIA 1V2KT 1YCPM 4Z6AH 2JH5D 2AGEX 2K1QA 1C1QA 2CK3D 1O0DH 1EB1H 2ZZUH 1ELCA 1W0ZU 3AVZA 3EA7A 3LPRA 1BJUA 1CA0C 1EPTC 4FU9A 2GMTC 3GCTF 3T25A 2ZQ1A 1LPKB 1P03A 2ODQA 4UD9H 3T5FH 1WDIA 1Z6EA 3BTDE 1QB6A 1O38A 3LONA 1A0JA 2R3UA 2Z6BD 1SGFA 4FUCA 3KCGH 1EJMA 2ALVA 2FI4E 3RXVA 1GGDB 4FUIA 3EE0B 3FO8D 2V6NA 5J4SA 2ZDNA 1N6XA 2EI7A 3EDXB 5DJ7A 1N1LA 3RU4T 2G81E 1W10U 1JBUH 2A31A 2BX4A 2W6JD 1XUHA 1TRNA 4Q80A 2XRCA 1DWDH 1FJSA 2Q6GA 5IYTA 4B6FA 1YBWA 4A7IB 3RXIA 5C0TA 1B0FA 1T8LA 5CHBA 3ATLA 5BRRE 1ACBE 1MTSA 1DOJA 1BUIA 3OYPA 4TPIZ 3SU1A 1TNKA 4Y8YA 1EPTA 4ISLA 5C1YA 1OPHB 2GCTC 3ZZAA 2F9OA 2WZQA 3PWBA 3QTVH 3ZZ3A 4I8LA 1EJNA 3PMAB 4WWYA 3TH2H 1ZZZA 2NWNA 4GSOA 1S6LA 2GZ8A 5E0GA 1PPFE 3A84A 4IC6A 3RC5A 1ZSJA 1BTYA 1IQKA 1LVYA 1MBMA 1O3KA 3P8NA 2F9UA 5HM2A 1O3BA 2PTCE 1B7XB 4H4FA 4JK5A 4AZ2B 3LDXH 1UTPA 1XKAC 1MCTA 1TABE 1P2QA 3T28A 1IQGA 4MQAA 1CT2E 2C8XB 2O8TA 1C5NH 4NCYA 4AORA 1H8HD 3RUOA 1W12U 1UJ1A 1A5HA 1TGNA 3IITA 1CE5A 1C5UA 2CF8H 2LPRA 5EJ1A 2A32A 2HWLB 1C5SA 1HIAA 1ZOMA 1EZXC 1K1MA 3BF6H 1WSSH 1KXEA 4Y8ZA 3NRLA 4CBNA 1K1LA 2BOKA 4D7FA 2PR3A 4X1NU 1SBWA 1OSSA 4I8HA 2A4RA 1CU1A 2BDYA 2DE9A 1RXPA 1TNIA 3AK5A 4JMYA 4CHAB 1P09A 1O2PA 1FONA 3LC3A 1YPMH 1LKAA 1GPZA 2C93B 1QJ1B 2XNDD 2Y82A 2G5VA 1C1SA 1ANCA 1RD3B 4WMDA 1LVBA 2ZNKH 3QK1A 1L2EA 2F43B 4AYYB 2PWXA 3UY9A 1G36A 2GX4A 1C4Y2 5EJZA 3Q77A 4ZMAH 1N8OC 1HYLA 4B74A 5FPYA 3NWUA 3RC6A 8GCHF 1G2MA 1ZHRA 3GY2A 5A8XA 4BTTB 1KY9A 4INLA 4D7GA 1UK2A 1BT7A 3UFAA 1H9HE 1TIOA 2BD3A 1O2RA 2STBE 5EPYA 4JZDH 1TONA 2Z9JA 3GICB 3ATMA 1E1QD 1W2KH 2AYWA 1C2GA 3SN8A 2Z3CA 6ESTA 1HIAB 2RDEA 2R3YA 4A1VA 3PYHA 5FHTA 2ZHWH 4CH8B 1ZRKA 1VITH 3LGIA 3LGWA 4TT3D 1XMNB 1SGTA 4ASUD 1FUJA 3OTPA 1EOLA 4XFQA 1HJAC 3GY8A 2AERH 2CGAA 5GNDA 4UFFH 5FAHA 5ETXA 3FANA 1ELAA 4R0IA 5IDKA 1FZZA 3GYLB 3FZZA 3ZVAA 1F7ZA 1BTUA 2V7QD 4ZHMU 3KQEA 4HI3A 4XDEA 3FKSD 1GHBF 1NO9H 4Q4LA 8ESTE 1AB9C 1MUEB 1O35A 1O2MA 2R2MB 1YLNA 1KLTA 1TBQH 2SGQE 2OC0A 2XW9A 3FZDA 1P2KA 5C20A 1AUTC 5CHAC 1DFPA 5C5NA 3OE7D 4E06H 4A1XA 2W5EA 2O8UA 3QO6A 1AHTH 3I29A 4NFFA 1EZQA 4MPUA 1YP9A 5DP7A 2GDDA 2QE7D 2EA3A 2FEQH 1ANBA 1WQSA 1EATA 3P92A 1TPOA 2TIOA 5T3HA 2ZTYA 1O5EH 2Z7FE 1O2LA 5AFZH 3S7KB 1MTVA 1WYKA 2H5DA 3ODFA 4ZXXH 4RKOB 2ZDVH 3ZVEA 2O8WA 1YC0A 4NG9H 2O8LA 1QZ8A 2G00A 3B9FH 2UWPA 2XC4A 2C8WB 2ZECA 2GT8A 1BITA 5DP3A 3U9AH 4WMEA 4RT0A 2ZGBH 2HVXA 1Y5UT 3BTFE 5H4IB 4ASHA 1IOEA 2F3CE 1GI9B 2Z9LA 1M9UA 1J16A 3OSYA 1E35B 3P8GA 2JH6D 1QIXB 4I8JA 1C9TA 3F68H 3F9GA 1SOTA 3ZVGA 3OEED 3UR9A 1C5WB 1SGIB 1FIWA 2BY9X 2W3KA 3A81A 2KFWA 3ELAH 2ZU3A 4A92A 2VINA 1L0ZA 1WAYB 1P06A 2Y7ZA 3S9AA 4K8YA 1MTNC 4OS7A 5E0JA 3SJKA 1LHCH 1HAGE 2AEIH 2FMJA 2ZGCA 3KGPA 1XUIA 2ODYB 3LC5A 2FYQA 4AGJA 1J8AA 1V3XA 3RXTA 1BHXF 1O2WA 4R8TB 3S69A 1ELTA 4FUBA 5C0UA 1BRCE 1GHVH 2V3OH 1JXPA 2EQNA 5C2ZA 1P02A 5J4QA 3SUDA 1GBIA 4THNH 2TBSA 1K0HA 4M7GA 2ZP0H 2P59A 1GBEA 2V35A 3MMGA 2BQ7B 4O3UA 1C5ZB 1GCTC 2VB0A 4MNXA 4CRAA 4UFGH 1ZMNA 4DG4A 3O8CA 3DT0H 2ZU2A 2VBCA 1BTWA 5FX6A 2XCNA 4B2BA 1C5MD 3PTNA 5C94A 4Z0KA 1O2SA 1QURH 3ENSB 1QA7A 2PHBA 2JIZD 1SLWB 4LZ4B 1E38B 1BOQA 2ZKSA 3HGNA 1F5RA 5HGGA 1GMDF 2SGAA 2KAIA 2WV4A 1GHZA 2ASUB 2V3MA 1FDPA 5DP4A 2QXJA 1P8VC 2VGCB 1UVUH 4F49A 4ISOA 2IPHA 7GCHF 1UTLM 1GI6A 3M5NA 1GJDB 2C4FH 3RXEA 2XWAA 1ZHPA 2FZZA 4F4OC 1LPGB 4MNVA 2TPIZ 2QF3A 1AVWA 2A45B 2FLBH 5SGAE 1UCYK 2BMGB 2KCYA 1QQUA 4JCNA 3A8BA 5A0AE 1E34B 3UTUH 2P16A 2ZC9H 1LO6A 1BB0B 3RM2H 5KECA 1DLEA 4BAHB 1EP6A 1O30A 3H5CB 3DSOA 4JYTA 4ACBA 2JH0D 3SGAE 3F6UH 1JIRA 2YOLA 1AB9B 2HOBA 5EQRA 3Q3KA 5GCHG 2PGBB 1TRYA 4NFEA 1C5LH 1XM1A 5EXNA 1IQJA 1LVMA 2GT7A 3M3SA 1HAHH 3TK5A 1FIZA 1UTQA 1GI8B 4HGCA 1UVSH 3UAIC 1A46H 3E8LA 2W7UA 1O3JA 1RS0A 1G3BA 4O97A 1P2MA 2Q1JA 2QXIA 3ZZ5A 1Z1IA 4NSYA 1GHAF 1TLDA 3KN2A 4RI0A 4XSKU 3QWCH 3K2UA 2HRVA 4GHQA 3A85A 3GCHC 1YPKH 2ZHQH 3K6YA 1TA2A 1V2OT 2BDCA 1QTFA 3LKWA 3RXDA 2M5TA 2FX6A 2OC7A 2PW8H 2TGTA 3OTJE 2XYAA 1HFDA 1FY5A 1YLCA 2OTVA 2M2AA 4SGBE 3RXRA 3ZZDA 2BDIA 5EQQA 1ESAA 3VB3A 2QF5A 5CMXH 4HTCH 1EFRD 2OLGA 3BN9A 1QJ6B 4B1TA 2BX3A 1SLVB 5K7RA 1GJ9B 1DDJA 1MAYA 1MKXK 2HGTH 4NIVA 4K1TA 4K69A 4B76A 1O5GH 4YOGA 3LJOA 4E05H 1GDQA 1GL0E 2Y5HA 1EAXA 1T8OA 1Y3UA 3SNBA 1D6WA 3TVJB 2FOMB 5C5OA 2GV6A 1F5LA 1LHFH 1ZMLA 5JPMH 3S9BA 1RTFB 3VEQB 1NN6A 3VB4A 3ZVFA 3A83A 2WV5A 3E0NB 3KNXA 3SJ8A 4B2AA 5F03A 2KCOA 4IGDA 1P04A 1ZPBA 3UPEA 1E0FD 4A1TA 2WHXA 2VGCC 3MU4A 1S6HA 1C1TA 1GJ7B 1UO6A 4YT7H 1YPEH 6LPRA 1T8MA 5HMAA 1OWIA 4CRCA 1W0YH 1FQ3A 1KXAA 2Y81A 2VWMA 1H4WA 1CA8B 3SU4A 1K1IA 3GOVB 1O2HA 2UUFB 1GDUA 1DT2A 3M7TA 5EQSA 1P57B 3PROA 5JBTA 2ODPA 4INKA 2Z94A 4I86A 2BDBA 2J95A 1DWBH 4KP0A 5I25A 1ZTKA 3S0NA 1FMGA 5DPAA 4AG1A 2UUKB 3BTKE 3LGVA 1MZAA 3RXSA 2KZ4A 3DFJA 2Y6TA 4UDWH 4RSPA 2P8OC 2ZFQH 6GCHF 1H9IE 3GY3A 5DN6D 1K1OA 3B23B 4Y8XA 3TNSA 2FI3E 4D9QA 1EAIA 4LOYH 1GMCG 4UFEH 2QGRA 2BVRH 2GDEH 4K2YA 2HPQH 1GJ6A 1O3OA 1MABB 1GI2A 3RXQA 1WUNH 3UNSA 1ARCA 1PQ7A 1DXPA 1QB1A 4OM9A 2CN0H 1U6QA 1NY22 2SGPE 3RMNH 1ZGIA 4ABHA 1F5KU 3OY5U 3HKIB 1UMAH 1TNLA 2FX4A 1EP5A 2FOCA 2ZF0H 1GBBA 3RXGA 3VXFH 1F2SE 2QIQA 2GCTB 2EY4C 1LHGH 1O2IA 4GAWA 3SUGA 1ID5H 1HAZB 1A5IA 3MFJA 1LCYA 1QFKH 1TX8A 1QL7A 2WPLS 4A5TS 1UVPA 3F9FA 3UOPA 1G30B 1FN6A 1TNHA 4CREA 2GP9B 1B5GH 3MO6A 4AC9A 3EAJA 4M9FA 2WPMS 1CT4E 1QCPA 4NWKA 3SJ9A 4E7NA 3SNEA 5JB8S 1TALA 2BLOA 1UCYH 1A7SA 1OWKA 2H9TH 2PV9B 1MMJN 1EAWA 6CHAC 4RN6A 1SB1H 1OYQA 3P95A 4K60A 1O31A 3V13A 3BTTE 1HJ8A 3BEUA 1O32A 1NS3A 1O3NA 3ATIA 4X8UH 3RU4D 3Q00A 4YO9A 1GHWH 2BY6X 7KMEH 1FY8E 1Q3XA 2ESTE 5CHAB 1GCDA 1SG8B 2BZ6H 1NM6A 2P95A 1GMHF 2IJOB 3NXPA 1AY6H 1HJAB 3QZRA 4AB9A 1HJ9A 3BIVH 5C17A 3FP6E 3TPIZ 1WXRA 3ZZBA 3KIDU 1TAWA 3LGTA 1F0UA 1COWD 1HRTH 2QXHA 2PKAA 3CS7A 2A4QA 1D6RA 3D23A 2D26C 1C5VA 1HAYB 2TGDA 1KLJH 1KTSB 3QX5H 4GLYA 4I33A 1DUAA 1O5DH 2XWBI 5GWZA 4K3JA 2GV7A 3ZZ8A 5EW1H 4FVBA 1IQLA 1GI4A 4X6NA 2FXRA 4ISHH 4CR9A 5LPEA 2JJ2D 5C3NA 1A1RA 5DK1A 1HAVB 1PPCE 5HM9A 5HIYA 3RXBA 3G01A 4P02A 1O33A 3KYGA 2ZCHP 2AMPA 3M35A 5ESTE 4MPVA 4Y76A 2ALPA 3RXLA 1P10A 4P00A 1GL1A 5K0HA 1MTUA 1TMBH 2BHGA 3KEEA 1BTHH 1ETTH 1TE0A 5A8YA 3UNQA 3PMBB 2XC0A 1TX7A 3RXPA 3D65E 2BD2A 5I46H 1GJAB 2GCHG 3P70B 4KKDA 2FI5E 1LHEH 2LELA 4I31A 2CMYA 1FY4A 1SLXB 3TGKE 4JYVH 3HK6B 2CJIA 3UB0A 2C90B 3EGKH 1HXEH 1S0QA 4NSVA 3MI4A 4DY7B 1NC6A 2HNTC 3BTHE 1GI3A 3F0OA 3QGNB 5EPNA 1XXFA 1HAVA 5EU8A 1TFXA 5DP9A 1C1VH 1AU8A 3OEHD 2QYIA 1GBJA 1ZSKA 4YT6H 1O5AB 2YMSD 3GDUA 4J2YB 1MZDA 4F48B 1DS2E 4I32A 1OX1A 2HNTE 2R0LA 1D3QB 1W7GH 4F55A 1EKBB 1LTOA 4DT7B 3SV6A 4XBDA 1FY3A 2IN2A 4CHAC 1BRBE 2FS8A 3V0XA 4I7YH 1T8NA 4YXWD 3UNRA 1GVZA 1HGTH 1V2UT 3IWMA 1OP0A 1HAIH 2PSXA 2ZDKA 2ZPSA 3ZVDA 1TA6A 2OP9A 2BM2A 1VJ9U 3ATWA 2OQUA 1Y3VA 3P17H 2P94A 3A7XA 3SU5A 1QY6A 1P3CA 2ZFPH 2ZFSA 1P12E 1SHHB 1O3CA 2WINI 2JETB 3EE7A 1GJ8B 1SQTA 4X0WU 1S6FA 3M36A 4NA8A 3SV8A 1Z8JB 2FPZA 4TPYA 1NT1A 2JDID 3AAVA 2OUAA 3M5OA 1TNGA 1FV9A 1GG6C 2K0QA 4XBCA 2C3SA 3EA9A 3PLBA 2VVUA 1T7CA 2BTCE 5FBIA 1PPEE 1L1GA 1IHSH 3QDZB 1DE7H 2RA3A 1QR3E 3V3MA 3OFND 3OX7U 1NFWA 1NU9A 1SGDE 5JDUB 1KIGH 3A80A 1FPHH 5DGJA 1O2QA 2K8IA 3LH3A 1HV7A 1JWTA 5JBAS 3GY4A 1C4U2 5HXFA 2B7DH 2GJGA 2KCPA 4MTBA 4HG6A 3T2NA 4YTAA 3TGJE 3GY5A 2Z3EA 1S82A 1K21H 3V12A 2FTLE 4OS5A 1AQ7A 1BZXE 1H9LB 1RIWC 5LH8A 1NRRH 4IW4E 1C2IA 2BQ6B 4FUEA 2FOAA 1KLIH 1ZR0A 3OU0A 1IQNA 2BQWB 1G37A 4WXIA 1CT0E 1THPB 1ZRBA 2BDHA 3KQ5A 1X7AC 5A2MH 1NRPH 2J94A 1W8BH 1HXFH 3R3GB 1SMFE 1ELGA 1MQ6A 3BTME 3AW0A 5FPSA 1S83A 1SGEE 1GJBB 3RXAA 4I8GA 1FAKH 4Q2KA 3EQ0H 4E7RG 2ZQ2A 1QQ4A 2P93A 4DGJA 2ZCKP 1AIXH 1MAXA 1A3BH 2Z9IA 3SU3A 2ZA5A 1O2XA 1CGJE 2VJ1A 4K5ZA 5T1VA 5TCAA 1C4V2 1SI5H 4BNRA 3ZYEA 4NIWA 3LGYA 4HFPB 3SORA 3VXEH 3QTOH 1GHAG 1QRZA 1UTMA 2QY0B 2FOBA 1O3DA 2CHAC 4Q7ZA 4Y79A 3TJVA 4MVNA 2EI8A 1Y3WA 2BLVA 5AF9H 1SFQB 2W3IA 2CV3A 1LVOA 2F9BH 2PKAB 1N6YA 4Y6DA 3STJA 2J98A 1MD8A 1IQFA 1EZUC 2OQ5A 1PPBH 1PYTD 1W11U 1JRSA 1ORFA 1QRXA 2FLRH 2JJ1D 3MU1A 4YLQH 2Y7XA 1IHTH 1GGDC 1NFUA 3M7UA 1J9CH 3SGBE 2UUJB 2KX4A 4CRDA 2ZFFH 3E6PH 4GHTA 1XVMA 2BD8A 2KAIB 8LPRA 4XBBA 1INCA 1YCPK 3E0PB 3URDA 2J9NA 1SSXA 2ZG0H 3ZYDA 3D62A 4O9VA 3P8FA 4ABFA 4JZIA 4X6MA 3DD2H 2GD4B 4X1QU 1TBZH 1O2OA 2BLQA 4IS5A 5L6NH 1AFEH 4OGXA 3TLOA 1HUTH 1YGCH 3RXCA 1NESE 1TQ7B 1F0SA 1WBGB 3PLPA 3ESTA 1OOKB 4MNWA 3MNXA 1K2I1 1C1PA 4ZKRU 4X8TH 4GCHG 1KYNA 1PJPA 2AHME 1YPHC 1C9PA 1C1RA 2Z9GA 2ULLA 2YMSC 3MNBA 1PQ8A 1UW7A 4IBLH 1DANH 3N7DA 3BEFB 2ZPRA 2W7SA 3RU4E 2OK5A 3SJOA 3SYJA 1HDTH 1AFQC 3CNRA 1K28D 1MQ5A 4LXBH 2CHAB 4OS4A 1O34A 3N7EA 1P9UA 1WTHD 1NZQH 1O2JA 1C1WH 3TGIE 3MNCA 2HVYB 1PQAA 1O3PB 3P8OA 1NBMD 2VIVA 3VB5A 2WUBA 3SV7A 4AG2A 1D3DB 2Z9KA 1SGCA 1YLDA 3DFLA 3DHKH 2BXTH 1V2WT 2QF4A 1VCWA 1OYTH 2F4LA 5T6FA 3U8RH 3ZZ4A 1O37A 2XCFA 1UHBB 1KXDA 1TGSZ 1GBMA 1YM0A 1T32A 5HIZA 4KTUA 3MYWA 1AKSA 4UEHH 3PMJA 3W1EA 1ANDA 1C1UH 1ESTA 1VGCC 1BTXA 1ZYOA 1ELDE 3STIA 1P3EA 2PKSB 1WU1A 2VWNA 5ABWA 1AZ8A 2W26A 4YZUA 2ANKH 1K1NA 2OD3B 3FP8E 5AVDA 2XXLA 3S9CA 5DKMA 4OS6A 1RFNA 2OBQA 2TGAA 3RDZA 4BAMB 1EAUA 1CO7E 1V2LT 4AFQA 2Y5FA 5GPIB 4NWLA 2PSYA 1SLUB 3HATH 1P2OA 2FESH 3NZIA 1GJCB 1P2NA 1S85A 5A0CA 1Y5BT 2OCVB 1GBDA 1J15A 1A0LA 1AE5A 3M37A 3PO1B 2OXSA 1O2TA 3PV5A 1K1JA 2ZHEH 1GBLA 2PKSC 1OS8A 2FIRH 3TIUA 1VGCB 2G4UA 1BRUP 1BMMH 1C2LA 4WJG2 1PQ5A 2UWOA 1O2VA 2ZDLA 2P3TB 4FOUC 2VVCA 3FVFB 1Z71A 1ZMJA 1TYNA 3GCTG 1C1MA 2VWOA 1MTNB 5FL7D 3UQOA 4AFSA 3T29A 3N99A 3TITA 4BTUB 2ZGJA 2OC1A 9LPRA 2A0QB 2C8YB 1Y59T 1TPAE 3BTQE 1D3TB 5JBBS 4ABAA 1GBHA 3UR6A 1AKSB 1L4ZA 3SHAH 4X6PA 1DUEA 1GCTB 2G51A 1SGNE 1UCYE 4RKJB 2Q6FA 2BVSH 4CRBA 2IOTA 2IPQX 1ZSLA 3LU9B 4WMFA 1NTPA 4X2YA 1AMHA 1C5XB 3O8RA 5A0BA 1OWHA 4HZHA 1LQDB 2I6SA 1GBFA 1C1NA 4ISNA 1THRH 2A2QH 2VIQA 4FUFA 5E2PA 3TJUA 1IQEA 1VR1H 3VB7A 1L1NA 2ZCLP 1SFIA 4YLUA 1P11E 1QL8A 1KSNA 3JZ1B 3KYFA 2FM2A 2G4TA 1EUFA 4FUHA 1BTPA 1SHYA 1YPGH 5HYOA 1XUKA 2AGGX 4NIYA 4WH6A 1UTOA 3MWIU 2A5AA 6CHAB 2F9PA 1IAUA 3U1JB 1EASA 5F8ZA 1MKXH 4BAQB 4K8BA 3F3BA 1ETSH 2Q6DA 3SHCH 3ZZ7A 2A2XH 2VIDA 3CP7A 5FBEA 1QL9A 4X2WA 3VFEA 1E37B 4CRGA 1DX5M 3E1XB 2BZAA 2A5IA 2ZEBA 4CR5A 2ZHFH 5KEDA 2NU2E 1Z8GA 3U28C 1EJAA 3HGPA 3RXMA 5E0HA 2CF9H 3RXUA 1D4PB 1Z1JA 2SGDE 2Y80A 3VGCB 1D9IA 3RLWH 4YOIA 3ZVBA 4UONA 5TCCA 4GVUA 1IQHA 2FS9A 1T31A 2ZGXH 2G55A 2QCYA 2KR7A 3FFGA 2PUXB 2BDGA 4CH2B 3T62A 4IN2A 1Z6JH 1T4VH 1CBWB 4X1PU 1FN8A
chains in the Genus database with same CATH topology
1QBVH 2GZ9A 2GKVE 1O2NA 5DP8A 3SQHE 4AOQA 3E90B 4X2VA 2D1JA 2EEKA 1V6DA 2A5KA 4IMQA 2NU4E 1SL3A 4Y11E 5EGMA 1AWHB 2ZIQH 1C1OA 1WV7H 2SGEE 1E36B 2VIWA 1LHDH 1S5SA 4BXWA 1XVOA 5L30H 2FWWA 1GMDG 3UUZA 3NPSA 1OKXA 3SV2H 3ZVCA 1V2RT 1ZLRA 1OWJA 1HAOH 2DUCA 1O3GA 3U8OH 1ETRH 1O39A 4NGAH 2NU3E 4NIXA 3K9XB 4SGAE 2FOEA 2SFAA 5LPFA 1BQYA 1CGIE 1UTKA 4AN7A 4ZXYH 2ANMH 2NU1E 3BV9B 4WVPE 1XUGA 1C5RA 1SGYE 5C1XA 2BLWA 2AIQA 1C2HA 3ATKA 2UWLA 3SGQE 1T4UH 1SC8U 3M3VA 4FU8A 1Z7KA 2BVXH 2ZFTA 3SV9A 2ZO3H 2BY7X 1TPSA 3UWIA 1O3AA 3O8BA 1CHOG 1JOUB 2QN5T 2AMQA 1RRKA 1GJ4H 1CVWH 1BBRH 2R9PA 2BY5X 3KF2A 2ZPQA 1P9SA 1C2EA 1SQAA 3L6PA 2J4IA 4ABJA 4JZFH 3PV4A 1BDAA 4ABIA 3MH6A 1GVLA 4WF8A 3CENA 1Q2WA 2QV1A 1BCUH 5TJXA 5B6OA 2HNTF 4CRFA 1S84A 1C2FA 1F0TA 3RMLH 3GDSA 1DXWA 2I6QA 4KTCA 1OP8A 4DW2U 3PLKA 2B8OH 2BYAX 5GCHF 1TGCA 2LNCA 1Y3YA 1BRAA 1NROH 3BTWE 1DVAH 2A1DB 3MO9A 4INHA 1BMNH 2F83A 1HBTH 4BAOB 1XKBC 2ZU1A 3AAUA 3URCA 3A88A 1Z8RA 2VU8E 4FU7A 2J34A 3TJOA 3QUMP 4ESTE 3ZZCA 1FY1A 3MOCA 2FOGA 1GBTA 1Z8IB 1GMHG 2AMDA 5GXPA 1TMUH 4DJZB 2XBXA 3SOSA 1TQ0B 3RXFA 1MTWA 1RJXB 1VJAU 2ILNA 1O2YA 2O9QA 4BOHA 4Q7YA 4ZHLU 1TMTH 1G9IE 4NA7A 4ZROA 1FPCH 3RP2A 3LIWA 2H9EH 4Y0ZE 2FOFA 1DM4B 3A7VA 1SOZA 2YNBA 4GUXA 4ZAEA 2BXUH 1QB9A 1DY8A 4BAKB 1C5OH 3GISB 1O5CB 1OWEA 2OINA 3Q3YA 1YCPH 3TH4H 1XXDA 3RM0H 2OC8A 3F9EA 1QBNA 2BOHB 4TY6A 3O8DA 2P8OB 4X8VH 1W14U 4ZUHA 4A6LA 1Y5AT 1VCPA 2VH0A 2WPJS 2ZFRH 2PFEA 1CBWC 4B75A 1ABJH 2GVFA 4TWWA 1UVOA 3PO1C 2FODA 4OGYA 2P3FH 1YF4A 1A4WH 4Y7AA 4ABGA 1AE8H 1WCZA 5C67A 2DE8A 2VH6A 3OY6U 2WPKS 1O5FH 1V2QT 1S81A 2C8ZB 1QBOA 1DY9A 1L1JA 2G5NA 4KTSA 4AYVB 1C5QA 1MCVA 3TNTA 3ZV8A 1CSOE 1XUJA 3L3TA 5EW2H 1SQOA 1GI1A 3TK6A 2QAAA 2ZU4A 4MLFB 4Y10E 1MD7A 4QT8C 4ABDA 1DLKB 1QHRB 3T26A 2XBWA 1Q31A 2YNAA 3NK8A 2OBOA 4IMZA 1G3CA 2H2ZA 1V2JT 1YYY1 3TH3H 2AH4X 3GY7A 4XE4A 5LPRA 1G3EA 1C2JA 2ANYA 2P3UB 3PB1E 5GDSH 2B9LA 4UFDH 2BD7A 4D8NA 3NUMA 1C5TA 4K1EA 3HPTB 1EZSC 1BMLA 2O8MA 2R2WU 3QGJA 4O03A 3GCHB 3RLYH 3RXOA 5L2ZH 3UIRA 2HPPH 3ODDA 3F1SB 5E8EH 4ZKOU 1UTNA 5AHGH 3MNSA 1AUJA 1IQIA 1A61H 1PFXC 1VITF 1WTGH 2V3HH 1QJ7B 4JZ1A 3U98H 4AB8A 1S0RA 1A0HB 3K6ZA 1HNEE 1KXCA 3SUEA 1MKWH 1AWFH 2J92A 2ZGHA 1TGBA 2BY8X 3SJIA 5F6MA 1SPJA 4AFZA 8GCHG 2WPHS 3QLPH 2B5TB 4AGKA 5CE1A 5PTPA 1PYTC 2BB4A 2FP7B 1HAXB 3SU2A 2FO9A 4JZEH 1F92A 1W7XH 3MU0A 2A4GA 1UK3A 3M5LA 4FUGA 1O3HA 4X2XA 5BPEA 1GVKB 1SGPE 1ZTLA 4WY3A 1CGHA 1WOFA 4GCHF 4DURA 7GCHG 3SNDA 3S7HB 4K1SA 3QZQA 1ESBA 3C27B 2GZ7A 3IG6B 3WY8A 1TRMA 2BD4A 5DP6A 2XBVA 4ZKNU 2F91A 1WQVH 1NRSH 3C1KA 3BIUH 4MPXA 5F8XA 1N8OB 4MNYA 1TWXB 4U01A 2CXVA 4KELA 1EB2A 5LGOA 3MO3A 3F9HA 5DG6A 2RG3A 3M61U 1GHXH 2FTMA 2D8WA 2BD9A 2SGFE 7ESTE 2Z3DA 5AFYH 1W3CA 1TPPA 3E16B 3I77A 1PPHE 4NZQA 1FNIA 2NU0E 2ZWLH 1DWCH 1V2MT 1Y8TA 3TK9A 1ELFA 3ITIA 4Y7BA 1KDQA 2ZHDA 1BJVA 1NU7B 3SI3H 3SNAA 1SVPA 1BHXB 4WH8A 2ZDAH 2J38A 1GI5A 1UVTH 1AFQB 3DUXH 1ELVA 5ESBA 1H8IH 1D3PB 1V2PT 3VGCC 3DA9B 5JB9S 2H9HA 1LKBA 4FXGH 4H6SB 5EOKA 1P01A 4O3TA 4ISIH 3A7TA 3EA8A 1OXGA 4X6OA 1BMAA 4VGCB 1DITH 3NCLA 1AVXA 1C5PA 3MTYA 4PROA 3UWJH 5DP5A 1DSUA 3A89A 4Y0YE 2UUYA 1DWEH 2AFQB 3KHVA 4FUJA 2B0FA 1AGJA 1B0EA 1CA0B 1EPTB 3SUFA 4BXSA 1JRTA 1EXFA 1C5YB 2D2DA 1XUFA 1YPLH 3SNCA 2GCHF 3P6ZB 3SO3A 1L4DA 3GYMA 2FDAA 3HK3B 1NRQH 5F8TA 1H8DH 1AI8H 3RXJA 1TB6H 3A8CA 4B73A 3LH1A 4DCDA 3SU0A 2G52A 1PPGE 4H6TA 5C1UA 3VB6A 1TX6A 2ZDMA 4ABBA 1J17T 1O3IA 4ZHAA 1A2CH 1O3FA 1DPOA 3E3TA 1NFYA 2H5CA 1EQ9A 1FAXA 4Y71A 2PLXA 4U2WA 1MU8B 1FI8A 3SW2B 1EX3A 3BG8A 3BTGE 3RMOH 1HAPH 1O2KA 3A8DA 2Y5GA 1ANEA 4D76A 1CQQA 1HB0B 1AO5A 3RC4A 2AGIX 4TYDA 1IQMA 2STAE 2JKHA 1O3LA 2VIOA 3BEIB 4AFUA 1HPGA 3T27A 3Q3XA 2ANWA 1LMWB 2HLCA 1G2LA 1O36A 3A7YA 3FAOA 3R0FA 1O2UA 1GHYH 3KL6A 3ZV9A 1GBAA 1ZGVA 3LGUA 3SQEE 4FVDA 1NPMA 1NRNH 1F0RA 3GY6A 1PPZA 2SNWA 1QRWA 2F9NA 1C2MA 2THFB 5G4BA 4LZ1H 2A7CA 1K1PA 4J1YA 4WXVA 1RGQA 3SU6A 2GGVB 2XTTB 3MH5A 4X1RU 3TJNA 4ABEA 3PTBA 2GTBA 2VWLA 1G3DA 1VCQA 1QGFA 1NFXA 2AIPA 1KTTB 4BANB 1HLTH 1O3EA 3NKKA 4B71A 2BD5A 2J2UA 1HCGA 1MH0A 4MG3A 3I78A 1GBCA 1P05A 1TOMH 2JETC 3A87A 2BDAA 5DO4H 1SGQE 1GHBG 2VNTA 1GI7B 2QF0A 3ZZ6A 3M7QA 1J14A 2XBYA 3E91A 2ZTZA 2RCEA 2GMTB 3M3TA 1ZPZA 4YESB 3GCOA 1K22H 1UTJA 5FX5A 3LT3A 4H42U 4TWYA 3KQBA 3RXKA 1K9OE 3LJJA 1A5GH 5FCKA 3JZ2B 3V7TA 1ZHMA 2H6MA 1GWAA 1BBRE 1O2ZA 4U32A 4CBOA 3UOUA 3EYDA 3MU5A 3FP7E 2EC9H 4X1SU 4YM9A 5FXLA 3A8AA 1RTLA 4OS2A 4LK4A 1CHOF 3W94A 3PM3A 4MPWA 2TRMA 1ELEE 4Q7XA 3BTEE 1ZJDA 2G8TA 3KQDA 2QXGA 1GBKA 4DOQA 2H1UA 1TNJA 1JMOH 1ARBA 2TGPZ 4IN1A 3HKJB 3AW1A 1P2JA 1OWDA 4DVAU 3K65B 3MHWU 3AASA 1CHGA 1KXFA 1V2TT 3GDVA 1RIWB 3U1IB 4X8SH 1SGRE 1Y3XA 2FOHA 5T6GA 1ZJKA 1H1BA 1THSH 4U30A 1VZQH 2SNVA 3BSQA 4OS1A 5E2OA 1DSTA 3N7OA 1V2NT 3SBKA 1O3MA 5EG4A 1ABIH 2EI6A 1GJ5H 2WYGA 5EODA 1O5BB 4YOJA 2PTNA 1GDNA 1UHBA 2R0KA 3MH4A 4GPGA 1V2VT 2RA0A 1QNJA 4UE7H 1JIMA 2XC5A 3H7TA 3L33A 1V2ST 4IC5A 2V0BA 1LDTT 5JYIA 4BTIB 3BG4C 1UK4A 1BBRK 3VPKA 1AZZA 1LPZB 1YPHE 1EOJA 1KDQB 1FLEE 4D9RA 3A86A 3TU7H 4DIHH 1OP2A 5GIBA 1BA8B 1ELBA 3A7ZA 2QC2A 3LOXA 1TOCB 5L2YH 2ZU5A 1C2KA 9ESTA 4B2CA 2AS9A 3U8TH 2FYRA 8KME2 3UQVA 5EXMA 3MH7A 5A09A 1LQEA 1YKTA 2WPIS 2VVVA 3PMHB 3CS0A 3W95A 1AD8H 3Q76A 1FXYA 3GCNA 1W13U 1VITG 5T6DA 3BG4B 3UREA 3QN7A 3ZZ9A 4TY7A 1AN1E 1BIOA 1SR5C 4JYUH 2PUQH 3U69H 2A4OA 4NA9H 4XOJA 4KGAA 1MU6B 2WUCA 4ZKSU 1BTZA 6GCHG 3A7WA 3KQCA 2QA9E 4VGCC 1RTKA 1GG6B 2ZI2H 3M5MA 5FPTA 3SZNA 1P0SH 4DIIH 2HALA 5EXLA 3SI4H 1DICA 5FCRA 5GJ4B 4ZH8A 3MU8A 1ZTJA 3H7OA 3RMMH 1TBRH 1ZPCA 5A8ZA 1C2DA 1YPJH 2A7JA 4I8KA 2F9VA 2A7HA 4JK6A 2VIPA 5JBCS 1KXBA 1P2IA 3A82A 3PWCA 1AVGH 3RXHA 2RDLA 1MKWK 3B8JA 3D49H 1G32B 2ZTXA 1TGTA 1SGFG 7LPRA 4MDSA 1QA0A 2WYJA 1GMCF 1MBQA 2PGQB 4AX9H 4FUDA 1GI0A 4NZLA 1A3EH 1O2GH 1XX9A 2XNIA 1V2KT 1YCPM 4Z6AH 2JH5D 2AGEX 2K1QA 1C1QA 1O0DH 1EB1H 2ZZUH 1ELCA 1W0ZU 3AVZA 3EA7A 3LPRA 1BJUA 1CA0C 1EPTC 4FU9A 2GMTC 3GCTF 3T25A 2ZQ1A 1LPKB 1P03A 2ODQA 4UD9H 3T5FH 1Z6EA 3BTDE 1QB6A 1O38A 3LONA 1A0JA 2R3UA 2Z6BD 1SGFA 4FUCA 3KCGH 1EJMA 2ALVA 2FI4E 3RXVA 1GGDB 4FUIA 3EE0B 2V6NA 5J4SA 2ZDNA 1N6XA 2EI7A 3EDXB 5DJ7A 1N1LA 3RU4T 2G81E 1W10U 1JBUH 2A31A 2BX4A 1XUHA 1TRNA 4Q80A 2XRCA 1DWDH 1FJSA 2Q6GA 5IYTA 1YBWA 4A7IB 3RXIA 1B0FA 1T8LA 3ATLA 5BRRE 1ACBE 1MTSA 1DOJA 1BUIA 3OYPA 4TPIZ 3SU1A 1TNKA 4Y8YA 1EPTA 4ISLA 5C1YA 1OPHB 2GCTC 3ZZAA 2F9OA 3PWBA 3QTVH 3ZZ3A 4I8LA 1EJNA 3PMAB 4WWYA 3TH2H 1ZZZA 2NWNA 4GSOA 2GZ8A 5E0GA 1PPFE 3A84A 4IC6A 3RC5A 1ZSJA 1BTYA 1IQKA 1LVYA 1MBMA 1O3KA 3P8NA 2F9UA 5HM2A 1O3BA 2PTCE 1B7XB 4H4FA 4JK5A 4AZ2B 3LDXH 1UTPA 1XKAC 1MCTA 1TABE 1P2QA 3T28A 1IQGA 4MQAA 1CT2E 2C8XB 2O8TA 1C5NH 4NCYA 4AORA 3RUOA 1W12U 1UJ1A 1A5HA 1TGNA 3IITA 1CE5A 1C5UA 2CF8H 2LPRA 2A32A 2HWLB 1C5SA 1HIAA 1ZOMA 1EZXC 1K1MA 3BF6H 1WSSH 1KXEA 4Y8ZA 4CBNA 1K1LA 2BOKA 4D7FA 2PR3A 4X1NU 1SBWA 1OSSA 4I8HA 2A4RA 1CU1A 2BDYA 2DE9A 1RXPA 1TNIA 4JMYA 4CHAB 1P09A 1O2PA 1FONA 3LC3A 1YPMH 1LKAA 1GPZA 2C93B 1QJ1B 2Y82A 2G5VA 1C1SA 1ANCA 1RD3B 4WMDA 1LVBA 2ZNKH 3QK1A 1L2EA 4AYYB 2PWXA 3UY9A 1G36A 2GX4A 1C4Y2 3Q77A 4ZMAH 1N8OC 1HYLA 4B74A 5FPYA 3NWUA 3RC6A 8GCHF 1G2MA 1ZHRA 3GY2A 5A8XA 4BTTB 1KY9A 4INLA 4D7GA 1UK2A 1BT7A 3UFAA 1H9HE 1TIOA 2BD3A 1O2RA 2STBE 5EPYA 4JZDH 1TONA 2Z9JA 3GICB 3ATMA 1W2KH 2AYWA 1C2GA 3SN8A 2Z3CA 6ESTA 1HIAB 2R3YA 4A1VA 3PYHA 5FHTA 2ZHWH 4CH8B 1ZRKA 1VITH 3LGIA 3LGWA 1XMNB 1SGTA 1FUJA 1EOLA 4XFQA 1HJAC 3GY8A 2AERH 2CGAA 4UFFH 5FAHA 5ETXA 3FANA 1ELAA 4R0IA 5IDKA 1FZZA 3GYLB 3FZZA 3ZVAA 1F7ZA 1BTUA 4ZHMU 3KQEA 4HI3A 4XDEA 1GHBF 1NO9H 8ESTE 1AB9C 1MUEB 1O35A 1O2MA 2R2MB 1KLTA 1TBQH 2SGQE 2OC0A 2XW9A 3FZDA 1P2KA 5C20A 1AUTC 5CHAC 1DFPA 5C5NA 4E06H 4A1XA 2W5EA 2O8UA 3QO6A 1AHTH 3I29A 4NFFA 1EZQA 4MPUA 1YP9A 5DP7A 2GDDA 2EA3A 2FEQH 1ANBA 1WQSA 1EATA 3P92A 1TPOA 2TIOA 5T3HA 2ZTYA 1O5EH 2Z7FE 1O2LA 5AFZH 3S7KB 1MTVA 1WYKA 2H5DA 3ODFA 4ZXXH 4RKOB