1EJMA

Crystal structure of the bpti ala16leu mutant in complex with bovine trypsin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Substitutions at the P(1) position in BPTI strongly affect the association energy with serine proteinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/inhibitor
total genus 57
structure length 223
sequence length 223
chains with identical sequence C, E
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejmA02
2V35A 1U6QA 1UTJA 3RMMH 4DW2U 3CS7A 1QRXA 4AN7A 2Z3CA 1K1IA 1SGQE 1Y5BT 2ZO3H 3FVFB 2ZGHA 4ZH8A 1D6RA 5FPTA 1UCYE 2QC2A 2FLRH 1GJBB 1IQNA 3SV6A 5HM9A 4WF8A 2Q1JA 2EI6A 1ZMNA 1G3CA 3QO6A 5J4SA 3PROA 4K1SA 1G2LA 2VVVA 2GMTC 1T7CA 2GX4A 4VGCC 1EOJA 4DVAU 3P17H 5CMXH 2QGRA 1TB6H 1MTUA 4JYVH 1AGJA 1BBRH 2XNIA 1BTPA 4X6MA 1IOEA 3AVZA 4ISLA 1ELEE 2NU2E 2ZKSA 3FP7E 1W11U 2PKSC 4MG3A 4ZKRU 2UUJB 3C27B 1A1RA 2HPQH 1IQKA 1TIOA 1EPTC 5AHGH 4WWYA 2FOFA 3S9CA 3DT0H 2IN2A 3TU7H 1YCPK 2EC9H 2ZHWH 2BDHA 1GMHG 3ZVDA 1W7XH 3S7HB 2BB4A 2VVCA 3MU0A 2A5KA 1YLCA 1TNHA 2BOKA 3P6ZB 1BMNH 3ENSB 4A7IB 2ZGCA 3A8CA 1KTTB 1F7ZA 3GCHC 3SNBA 2SNVA 1S5SA 3NCLA 1XKBC 2AS9A 3RXVA 2HLCA 4KTUA 3V12A 3QDZB 2F83A 4IMQA 2QV1A 1ANDA 5I25A 3DHKH 5C20A 2Y81A 1P2KA 5T6DA 1MCVA 1W7GH 3MNSA 1MD8A 1O2XA 2BX3A 4FUDA 1EPTA 2O8UA 2SFAA 1HJAB 2ZI2H 1LVOA 1CT4E 5FPSA 1O38A 1TFXA 1IQEA 1A0JA 4BTTB 1FNIA 3F68H 1KXBA 4MVNA 2VGCC 3ZV9A 5DPAA 3BV9B 3SHAH 1CA0B 1GBHA 3LGYA 1FV9A 1EZXC 4OGYA 5AFZH 1IQFA 4ABBA 1V2QT 3VB4A 2O8MA 1MTVA 1THRH 4I31A 4MLFB 4E7RG 4MDSA 1C1OA 1N6YA 2WPLS 4D9RA 4FXGH 2BLQA 5FBIA 2C3SA 4K1TA 4A5TS 3QK1A 3M3SA 4JCNA 1FAXA 3HKJB 4CR5A 1ZYOA 1NS3A 1TQ7B 1LHGH 4INHA 4Q7XA 1V2OT 1A3EH 3VXEH 1CHOF 1E0FD 3GISB 1NFUA 4K69A 1JIRA 3ELAH 1LVMA 1UTPA 4H4FA 3R0FA 4UE7H 1MQ5A 2V3HH 2A2XH 2SGEE 1A2CH 4AOQA 5JB9S 3KN2A 2OC0A 2OC8A 3DA9B 1AFQB 1BT7A 1IHSH 2WINI 1NY22 1P09A 4J1YA 1TGSZ 2AMPA 3C1KA 1EKBB 4AB8A 2AGIX 3GCNA 1FY8E 2TRMA 2ZDKA 1Y59T 1BJVA 2ODYB 4B71A 3UOPA 1UTOA 3W95A 3UTUH 2UWPA 5E0JA 3SBKA 1UCYK 1TAWA 2ZHDA 3PWBA 2Z3EA 3E3TA 1EXFA 1ANEA 1GVLA 3BTHE 3S0NA 3CS0A 3A8BA 1SFIA 5GDSH 1OYQA 1O5AB 2A0QB 3QUMP 4AFUA 1AB9B 1TX7A 1SGIB 6ESTA 4RKJB 3TK9A 3GDVA 1HPGA 2RDLA 3ZZDA 4X6PA 1GI3A 1MMJN 2BMGB 3PMBB 4B2BA 5IYTA 4NFFA 1TONA 2C93B 2FYQA 2VWMA 2XXLA 4J2YB 1N1LA 4INKA 1EAXA 1UHBB 1K2I1 2HNTE 1OP8A 1V2VT 3U69H 2ZECA 3DD2H 1O5EH 1YPKH 3DUXH 4AZ2B 3LC5A 3RXAA 4Z6AH 2Z7FE 3RXEA 1H4WA 2ANYA 5T6GA 3RXHA 4FUHA 3SNEA 2UWLA 5FHTA 1O2SA 1PQ8A 3T2NA 1AVWA 4AFSA 2BY7X 4I8HA 2J4IA 2ZEBA 4TPYA 2ULLA 2K1QA 4NA7A 1BB0B 4BTUB 2H5CA 2W3IA 4ABFA 1CGHA 2UWOA 3I29A 3SV9A 1BHXF 5TCCA 4H6SB 4BXWA 1OSSA 2FS9A 3TIUA 1A5HA 1DWCH 5EOKA 1ANBA 3RXMA 3ATWA 2ZDLA 2CMYA 2PSYA 1GHZA 3SU0A 1M9UA 4X8SH 3RXQA 1OXGA 1ZJDA 1C1TA 4ZHAA 4CHAC 1IQJA 1DXWA 1QIXB 1V2PT 1XXFA 2FESH 4XBBA 3RXGA 5A0CA 2Q6GA 2HRVA 3M37A 2W7UA 1C1QA 1VZQH 1DWDH 1FN8A 1Z71A 3UWJH 3GY6A 1QRZA 2HVXA 2SGAA 4CREA 3MH7A 1HAVA 1JIMA 1HCGA 2F3CE 2IPHA 1GBCA 1HAPH 1WOFA 4INLA 1P10A 2G8TA 1QL9A 1QB9A 2GMTB 3ITIA 3MNXA 4VGCB 4UFGH 5C5OA 3AAVA 4MNXA 1JXPA 1KXFA 3GICB 4GSOA 4H6TA 5B6OA 1O3BA 3P92A 4KTCA 1AN1E 2XTTB 1O2RA 2PHBA 3RM0H 5FAHA 1GVKB 2C8XB 5ETXA 3MMGA 2PKSB 3TNSA 5GWZA 4X1RU 3T25A 1GJ7B 1O33A 1T32A 8GCHF 1EPTB 1NRRH 5ABWA 2VWNA 4AFZA 1SGPE 2P8OC 4X0WU 3M36A 2RA3A 2GT8A 1IQHA 2BD3A 5JBTA 3P8FA 1CGJE 4YOIA 2BZAA 3MNBA 3PTBA 1TGTA 1QBNA 1SHHB 3TGKE 4X2YA 1ESAA 3URCA 1J9CH 3GCHB 1Q2WA 2Q6FA 4Z0KA 3RU4D 2SGPE 2BD8A 3ZZ7A 2BDGA 3SU5A 4I33A 3P8NA 5EQRA 1O32A 3SJKA 3BTME 1G37A 1DICA 3NPSA 2BD5A 1KXCA 1ZTKA 2BD7A 4A92A 1P05A 1GBLA 3SGQE 1L0ZA 4ZROA 2C8ZB 1NZQH 1TPAE 3W94A 1CHGA 3MH4A 2RG3A 1MAYA 1O3IA 3ESTA 5F8TA 4KGAA 4FUBA 1THSH 1HV7A 3QX5H 2VGCB 1O37A 3RXLA 1BHXB 3FFGA 1S82A 5FBEA 1YF4A 1KY9A 2Z9GA 4X2WA 7GCHG 1FAKH 5EXLA 3SQHE 3BTKE 1C5RA 1ANCA 1SGDE 1GBAA 1ZR0A 2B7DH 1P3EA 4CH8B 2BLVA 4D76A 2OINA 2TPIZ 3TGIE 1NROH 2D1JA 1V2KT 1O3HA 3F9EA 3P8OA 4K3JA 3L3TA 5FXLA 1AUTC 1ETRH 4DJZB 3FZZA 4GLYA 2R3UA 3B9FH 4BXSA 3ZZ4A 4BANB 3SQEE 2I6QA 1PPFE 1EOLA 1GCDA 3S9BA 1O2JA 3A83A 3RXCA 2GGVB 3QN7A 4K8YA 1YPGH 1GJAB 3SZNA 2FTLE 1LDTT 1MKXK 2ZNKH 3SNCA 3RXUA 4ZXXH 1WYKA 2J95A 1ELTA 1L4DA 2TGAA 1HJ8A 1S0RA 4ABHA 1WTHD 4CRFA 1FJSA 1XUGA 1GBJA 5C5NA 1GI8B 1GI7B 2EI7A 3OY6U 1IQGA 1H9HE 4Y0YE 4ZMAH 4B2AA 1KLJH 2XYAA 1GHWH 2YOLA 2SNWA 1NO9H 3M7UA 4YTAA 1A7SA 1OWKA 2XBYA 5C1UA 3QZRA 1ZHPA 3K6ZA 4GAWA 3P70B 3D49H 1LTOA 4LOYH 3A7WA 1O3PB 4WVPE 1ZGIA 2QCYA 1Z8GA 2R3YA 3SOSA 3TPIZ 2ZGBH 2ZU1A 2FO9A 1SB1H 4NSVA 3ZZ6A 1YPEH 1UTLM 2BHGA 1KDQA 2Y5GA 1JMOH 1V2NT 1QNJA 3L6PA 1ELAA 1GHYH 1AWHB 1YC0A 1MKWK 2ANMH 1FPHH 2OBOA 1O3CA 2YNBA 1VCWA 1P2QA 1GDUA 1T8MA 1TQ0B 3Q77A 2ZZUH 1PQ5A 1LHCH 4TY7A 2O9QA 1AVXA 3KNXA 2ZF0H 3U8TH 1T4UH 1SGNE 4MPWA 1ZRBA 1D3PB 1O5CB 2FI4E 4MPXA 2DUCA 2Y7ZA 3MWIU 4TWWA 1C5TA 4X1PU 3FP8E 3VGCC 3PV4A 3UOUA 1Y5AT 1OWHA 3PMAB 3SU1A 1RTKA 3MOCA 1NU9A 4ZKSU 2HWLB 2GCHG 3HGNA 7ESTE 3U98H 5H4IB 1LQEA 3VB3A 1MTNC 2A7CA 4ASHA 1BQYA 1DFPA 1H1BA 3EQ0H 3TK5A 3MO9A 4XBDA 4RSPA 1FONA 1S6HA 1AKSA 1C5LH 3UR9A 3FZDA 3ZZ8A 1AQ7A 1C1MA 2VIQA 1O3DA 1AU8A 1AZ8A 2O8WA 2CN0H 2DE9A 4CHAB 4I8GA 4NFEA 5A0AE 4Q7YA 1D3TB 2ZPRA 3LOXA 4OS4A 4HFPB 2PUQH 4Y6DA 5GJ4B 1T8NA 1LHEH 2QAAA 1G3DA 1UVTH 1UTKA 4GCHG 2ZC9H 4OS2A 1WUNH 2OUAA 3MTYA 1GMDG 2XC0A 3AASA 5DP7A 1E35B 4DOQA 1YCPH 3BEIB 1J16A 3E16B 3MFJA 1GJDB 1BTHH 3RXJA 2XCFA 4YZUA 4OS5A 5GPIB 4D9QA 3UR6A 1L2EA 1C1NA 1C1UH 4AGJA 1ZZZA 4OS7A 1C9TA 3G01A 1YPJH 1FUJA 8GCHG 2BXTH 3SJ8A 1GHVH 2V0BA 4TYDA 1OWIA 1TPPA 1ABIH 1MTWA 2A1DB 2LPRA 3MU8A 1MCTA 2LNCA 2FPZA 1EP6A 2P8OB 3UPEA 4NIXA 1GBDA 1DM4B 1SG8B 1A3BH 5J4QA 2XRCA 3BTQE 2TGDA 1AE8H 4IN2A 4DY7B 3RUOA 3U1IB 1SQOA 3MHWU 3ATKA 1O30A 4X1SU 1QBOA 1QRWA 1MBMA 2CGAA 3E6PH 5HM2A 3U8OH 2VJ1A 5LGOA 1QB6A 1IQMA 1L1GA 1DWBH 1BRUP 2A7JA 2WYJA 2BLWA 5DJ7A 3EAJA 1PQAA 3A8AA 3ZYEA 2Z9LA 1P06A 1P2OA 1ZRKA 3PWCA 2BDIA 5CHAC 4AG1A 2P16A 4X1NU 3E1XB 3ATMA 4FUCA 4TWYA 2ZTYA 1CBWC 3OSYA 5LH8A 1NPMA 1OOKB 2FM2A 2ODQA 3RLWH 4THNH 2QF0A 2QXHA 4WXVA 1HIAA 5G4BA 3T28A 4JK6A 5AF9H 4FU9A 3SJOA 2QN5T 3Q00A 2F9PA 3U1JB 1ZGVA 2CF8H 3BF6H 1YP9A 3K9XB 3TH2H 4CRGA 2ZWLH 3ZYDA 2UUYA 8ESTE 1AZZA 1BMAA 1KLIH 1KLTA 4Q7ZA 1K1NA 1KXDA 3M7TA 3U8RH 1HAYB 3F9GA 3BSQA 1E37B 1DITH 1L1NA 3PLKA 1KTSB 1DOJA 1SR5C 1GGDC 4I7YH 2PSXA 1CGIE 1RXPA 5SGAE 3HATH 6GCHF 1W14U 1MU6B 1TMUH 4JK5A 1SLXB 1YPHE 1T4VH 3MU1A 2ZU4A 3VB7A 1UCYH 2ZTXA 3O8CA 1XVMA 2WV5A 1HRTH 1GJ5H 1V2MT 1SGYE 1TOCB 1F0TA 3PMHB 7GCHF 2FMJA 5EXNA 2QXIA 4GHQA 3ZZ9A 1O2ZA 3ZZ3A 1C5XB 1EJMA 2BXUH 1O3NA 1O5BB 2QXGA 3SV7A 1W2KH 1OKXA 3KEEA 4FUFA 5EG4A 2ZFRH 3A86A 1BTZA 1QFKH 2AGGX 2FDAA 1C1RA 3T26A 1C1PA 1XKAC 3QGNB 5DGJA 1YLDA 1ELCA 2ZA5A 1LQDB 1S0QA 1B7XB 2FODA 1EASA 4GPGA 4DG4A 1THPB 1P02A 3ATLA 1GCTC 2AIPA 1DUEA 3SI4H 1D9IA 7LPRA 1K28D 1RIWC 3GY2A 3SUFA 1ESTA 2A2QH 4I8JA 1ORFA 3JZ1B 2Y5FA 1AUJA 3F9HA 2R2MB 1E36B 4Y8XA 1NT1A 1ARCA 1XM1A 2XWAA 4YESB 1FY4A 1ZSJA 3UIRA 3K65B 5K7RA 4YT7H 1O2LA 3A7TA 1TNIA 5AFYH 2JETC 1QA7A 3QTVH 5JB8S 3LGVA 1AKSB 1KYNA 2PTNA 4JZDH 3NUMA 3BTDE 2OBQA 3A80A 5HXFA 1WV7H 1N8OC 3ATIA 4XOJA 1HDTH 1WTGH 3RMLH 5EU8A 2ZDAH 4UFFH 5DG6A 1TNKA 1YPLH 2EI8A 1LHFH 3CENA 4KKDA 1NESE 1PFXC 1HBTH 6LPRA 5C3NA 4UEHH 3VGCB 1YBWA 1GPZA 3Q76A 5PTPA 1XX9A 4UDWH 2ZFPH 4HI3A 4YOGA 1TYNA 1BIOA 1MTNB 1KXEA 2FLBH 3O8BA 3WY8A 1XUIA 4NSYA 2SGFE 2P94A 3GY7A 5LPRA 2GKVE 3QZQA 1B5GH 2NU0E 3MH6A 2FI3E 1CT2E 3RMOH 3I77A 5F8ZA 1P0SH 2FOGA 4DT7B 5HGGA 2B0FA 2F9OA 1BZXE 1HYLA 2XW9A 1ELDE 1Y3VA 2CF9H 2HNTC 1AMHA 2P59A 2ASUB 1P03A 4X2VA 4Y7BA 1EJNA 5EQSA 5IDKA 3SHCH 3UUZA 4JZEH 3MYWA 4GUXA 1YKTA 1IQLA 2GCHF 2A4OA 2C90B 5DP6A 1O2IA 2A4RA 1TLDA 4X2XA 4TPIZ 3BEFB 2SGQE 2ZCLP 2IJOB 5GCHG 2B9LA 2R2WU 1GI6A 5E2OA 2HGTH 3K2UA 1SGEE 1UK3A 1TRNA 1P04A 3Q3YA 1A46H 1JOUB 2H6MA 3KCGH 2FX4A 2A4GA 2XCNA 5JBCS 1SL3A 4I8LA 4CRAA 2FOMB 2ANKH 5DKMA 1FY1A 1LKAA 1ZMJA 1XXDA 2A45B 1W8BH 2Z3DA 2QF3A 3A88A 2CHAC 1OP0A 1ZHRA 1ZMLA 2W3KA 3RXBA 3I78A 5FCKA 3V3MA 3A7XA 1O2YA 3BIVH 4A1TA 1V2LT 1C2DA 2BY5X 2GP9B 3GCTG 5DP4A 4A1VA 4GCHF 1DX5M 1V3XA 2C8WB 3KGPA 1GMDF 3S9AA 1ETTH 4AYVB 1S84A 3TVJB 4AB9A 1H9IE 1O39A 1SVPA 1ZPCA 1PPGE 4NWLA 1ZOMA 4M7GA 5E0HA 1S85A 3TK6A 3GY8A 2FTMA 1CVWH 1K9OE 5L2YH 1DY8A 3F1SB 1WU1A 1UK4A 2QIQA 4RN6A 1DUAA 2PV9B 4X8VH 1TX8A 3M3VA 1GJ4H 1C2HA 2Y5HA 5CHAB 4U01A 2ZFQH 1K1LA 1P2JA 3O8DA 1K22H 2A5IA 4Y8YA 1CBWB 1LVBA 3SW2B 1B0EA 1BCUH 1D3DB 3SO3A 2FEQH 2AIQA 4K8BA 1V2UT 2PKAA 1TGCA 1BTWA 3F9FA 1GJ8B 1TA2A 4LZ1H 4AG2A 2BY6X 1AFEH 1EUFA 2BYAX 4YT6H 2WUBA 3EGKH 1Q31A 1F2SE 1Z6JH 3UNRA 1V2WT 2J9NA 1C4V2 1PPZA 1DLKB 1UJ1A 3F6UH 3ZZ5A 3SU6A 3RXOA 4A6LA 4YLQH 3KF2A 1GL0E 2GV6A 3ZVGA 1AVGH 1MKXH 4MTBA 4OS6A 2ZQ2A 3AW1A 2OD3B 3RXPA 3SJIA 3SUDA 6GCHG 1C5OH 1GGDB 1VR1H 3FANA 1SC8U 1HUTH 3MO6A 3Q3KA 2OC7A 2HNTF 4WY3A 1ZJKA 1PPEE 1NM6A 1C5VA 3UY9A 1O5FH 1C2EA 2XC4A 1ESBA 3RU4T 1TA6A 2GZ8A 3RXTA 4XFQA 1GWAA 4MPUA 1SLUB 1GMCG 4DIIH 1QR3E 4BAHB 1C5ZB 3GOVB 4XBCA 3T62A 1VCPA 1AD8H 1WAYB 2M5TA 1QY6A 1ZLRA 4HGCA 2NU3E 1EJAA 1NRSH 1ZTLA 3RXFA 3PYHA 3RXIA 4Y71A 5FX6A 1PPBH 1OX1A 3MU5A 1YGCH 1O5DH 1TBZH 1BJUA 1O2OA 4IBLH 2YNAA 1C5WB 1MKWH 3URDA 1HGTH 1P2MA 2ZU5A 1C2LA 1GCTB 3VPKA 1FZZA 1SSXA 1BMLA 2D8WA 3M5OA 3UQVA 2BVRH 1RIWB 1QGFA 3A7YA 3M5LA 1D6WA 1C1SA 2FI5E 1LCYA 1FXYA 2RA0A 4ZAEA 3LDXH 1GI2A 3L33A 3BTTE 3EE0B 1EB2A 1TWXB 3GY4A 1EX3A 4DIHH 1BTXA 4O03A 1O3GA 1G32B 2PR3A 1O2GH 2AEIH 1AO5A 4CBNA 5C1XA 1RTFB 1Z1IA 2JH5D 4NZQA 2JETB 4FU7A 1ELGA 4O3UA 1Y5UT 5K0HA 4MQAA 3KL6A 1AE5A 1EZQA 4IC6A 1ACBE 1SGRE 1K1MA 1O3FA 1ID5H 4X8UH 1N8OB 1FIWA 1C4U2 1HB0B 1ZSKA 1VITG 1V2ST 2ZDNA 1LVYA 1PQ7A 3KQCA 3K6YA 3EA8A 2BD2A 3RC5A 1O31A 4KTSA 1BTYA 1KXAA 1O3JA 1K1JA 2W5EA 2FOHA 1DPOA 1ZPBA 4HZHA 5EQQA 1F5KU 4YOJA 4D8NA 2ZHFH 3M5NA 2KAIA 3GY3A 2J38A 3H7OA 2OP9A 3ZZAA 5LPEA 1O3LA 1G36A 1TE0A 1O3AA 1V2JT 1QCPA 3PLPA 1W13U 3GYMA 1BRAA 2FOAA 3ZVCA 8LPRA 1EAWA 3VEQB 3LPRA 1T8LA 4NZLA 4O3TA 3RXDA 3BTGE 3SUGA 3B23B 4R0IA 4KELA 1XUKA 1L4ZA 1FMGA 2Y82A 1BMMH 4QT8C 1QURH 4F4OC 1TMTH 3LT3A 1HAVB 1C2MA 3LJOA 1HAZB 1RGQA 2WPHS 1GHBG 1O36A 4WH8A 1GBBA 1O3EA 2Y7XA 3IITA 4GVUA 2AMQA 4O9VA 2BOHB 2ZQ1A 2CXVA 1LHDH 1ABJH 3HPTB 1QQ4A 3ZZCA 1PJPA 3TITA 5C2ZA 1NRNH 1BBRE 2ZCHP 3A85A 4DCDA 1GBIA 3H7TA 2CV3A 3ZVFA 1VJ9U 1UTMA 2B5TB 1SGFA 4D7FA 3ZVAA 1PPHE 2HALA 1C2FA 2CHAB 1G2MA 3MNCA 1GI9B 3BG4C 2I6SA 3E0PB 4CH2B 2J94A 3HK3B 1FI8A 1HAOH 3A8DA 4WMEA 2PFEA 1GI1A 1CO7E 1ELFA 1TRYA 1UVPA 3DFJA 4AGKA 1IHTH 1O5GH 2BD4A 2PKAB 3D62A 5A8ZA 2RCEA 2VIDA 1QTFA 3ODDA 1AI8H 5GCHF 2V3OH 4B74A 1KSNA 1EQ9A 2NWNA 3JZ2B 1GG6C 4ZXYH 1UK2A 1UVOA 1MH0A 2BD9A 2VIPA 2FOEA 1Y3XA 2WPKS 3BIUH 1MTSA 2DE8A 3TJUA 1UHBA 1TNLA 5JYIA 1F0UA 1G3BA 3RC6A 3QLPH 3NK8A 1BRBE 2BQWB 1RJXB 1T31A 4WJG2 3O8RA 3P95A 1WSSH 1DANH 4E05H 1J17T 4Y79A 2W26A 3GCTF 2GTBA 4FUJA 1BRCE 2G5VA 2OTVA 2JH0D 2BLOA 1O2PA 1O3MA 4FUIA 1UO6A 3GDUA 4NG9H 3EA7A 5DK1A 4FVBA 1Z7KA 5EGMA 1O2WA 5ESTE 1BTUA 3A82A 1FY3A 4H42U 1TABE 4IMZA 1QA0A 4FUEA 1W12U 1VJAU 1AIXH 3HK6B 3UNSA 3E91A 2BM2A 3LGTA 1JRSA 2ZGXH 1OWDA 1MZDA 2F9NA 1TALA 3PMJA 3KQEA 2F91A 4IC5A 3LH1A 4ESTE 4ZKOU 4B75A 3T27A 1E34B 3SGBE 4XDEA 2SGDE 3NWUA 3T29A 3V7TA 1GDNA 1LPZB 1OPHB 4BTIB 1F0RA 2ZU3A 3S7KB 1P01A 1YM0A 2STAE 2VVUA 3RMNH 1XUJA 3VXFH 1F5RA 1W0ZU 4NCYA 2ZU2A 3UFAA 1O35A 4GHTA 5EXMA 4RKOB 2A7HA 2FP7B 1EAIA 4BNRA 2FZZA 1J14A 2G81E 4WMFA 1RRKA 1XMNB 3ODFA 4K2YA 4ZKNU 4BAMB 3SNAA 3A7ZA 4AYYB 1MD7A 3BEUA 1YYY1 3RP2A 1K1OA 1SGCA 3BN9A 5DP3A 4CRDA 1EATA 3B8JA 3OX7U 2WV4A 2Y6TA 3QWCH 4BAKB 5A8YA 4IGDA 2OQ5A 4ISHH 1QQUA 1GBKA 3BTFE 4MPVA 4LZ4B 3BTWE 1D4PB 2F9VA 4ABIA 1GI0A 2A31A 1Z8IB 4JZ1A 1TPSA 1FLEE 4AORA 1ZSLA 2GZ9A 4B2CA 2F9UA 2P3TB 1NFYA 1FIZA 3SU3A 3SV2H 2UUFB 1JRTA 4MNWA 1S81A 1H9LB 2TIOA 5EPYA 2P95A 1GVZA 1TNJA 1BBRK 3SU4A 1Q3XA 2ALPA 2AFQB 1KDQB 1F0SA 1O2QA 1SQTA 1VITH 1Y8TA 3M7QA 1GMCF 1UMAH 5C1YA 1LPKB 1O2MA 2KAIB 1QJ1B 1DLEA 3SN8A 2B8OH 1G3EA 1YPHC 1CA8B 4K1EA 2JH6D 2NU1E 4JMYA 1FDPA 1DXPA 2BDYA 2R9PA 3A89A 3RDZA 4IS5A 4U32A 2GZ7A 5TJXA 2WUCA 1NFXA 1Z8JB 1LO6A 1TGBA 1BDAA 1MU8B 2ZCKP 4X1QU 4YO9A 2VH6A 1SOZA 1O2VA 4ABEA 1PYTD 1DSTA 1MUEB 5A0BA 4D7GA 5JDUB 4ISNA 4U30A 1SMFE 2ZPQA 3LGIA 2C8YB 1O0DH 3TH3H 1RFNA 2FS8A 3SUEA 4CRBA 3R3GB 1XVOA 2P3UB 3UREA 2XC5A 1A61H 3ZVBA 1IQIA 3LC3A 5F8XA 1TBQH 2BX4A 3KHVA 4LK4A 1KIGH 2ILNA 2FWWA 3MU4A 3BG8A 3UNQA 1RS0A 3GYLB 5E8EH 1EAUA 1UTQA 1VITF 3PLBA 2AGEX 1C2JA 2WYGA 2J2UA 3LKWA 1CU1A 1O2KA 3SNDA 3QGJA 3SGAE 2Z9JA 4A1XA 1DT2A 1GHAG 2HOBA 2PLXA 2VIOA 2OC1A 3N7OA 3LONA 2ZHQH 2W7SA 1K21H 2AYWA 3EYDA 2GDDA 1SGTA 1S6FA 3TJVA 3LU9B 1HXFH 2FYRA 3PTNA 1G9IE 5C67A 2R0LA 4F49A 2GD4B 2VU8E 3OTJE 1ZHMA 2C4FH 3M3TA 1ZTJA 1NFWA 4K60A 6CHAC 2WPJS 3TNTA 2OQUA 1PYTC 3BG4B 1QBVH 4NWKA 1TX6A 1SI5H 5T3HA 1J15A 1T8OA 2D26C 2Z6BD 4WXIA 1HAGE 1TGNA 2VIWA 4AFQA 1DY9A 1GHBF 3PO1C 5EW1H 4TY6A 3VB5A 1DWEH 1HNEE 2XBVA 1CT0E 1A5IA 9LPRA 1W10U 3VFEA 1W0YH 2O8TA 1GG6B 3MH5A 4YM9A 3A7VA 2BTCE 4E7NA 3E0NB 1EZUC 2A4QA 1INCA 1E38B 5F03A 1A4WH 5AVDA 4MNYA 1AWFH 4ZHMU 3STJA 2J92A 1D3QB 4XSKU 4CRCA 1NN6A 2ZPSA 4FUGA 3GCOA 1HJ9A 3LJJA 1QL8A 3UQOA 3A81A 1VCQA 2OXSA 1JWTA 2ZTZA 4O97A 1HIAB 1ZPZA 1K1PA 1V2RT 1NTPA 2PW8H 2ZHEH 3U9AH 3HKIB 2GCTC 2TGTA 1HAXB 5EODA 2H5DA 1GI4A 2P93A 5DP8A 1C1WH 2BZ6H 3TLOA 5TCAA 1BUIA 4Q80A 5FPYA 1GDQA 5DO4H 2H9TH 2F9BH 4X8TH 1HFDA 2V6NA 1ELBA 4BOHA 3KIDU 4JYUH 1LPGB 2PTCE 3ZVEA 1QL7A 4CR9A 5L6NH 2QA9E 3GDSA 4U2WA 3D65E 4Y0ZE 2THFB 4UFEH 2VIVA 1SGFG 3TGJE 1GI5A 1OWJA 1RTLA 1HAHH 1SLWB 4E06H 4NGAH 3S69A 2ESTE 1VGCC 5HMAA 5A2MH 3LGWA 5F6MA 1TMBH 1O34A 5EW2H 2J34A 3MO3A 2BY9X 1C1VH 2EA3A 3A84A 4MNVA 3M61U 2BQ7B 1H8DH 4ZHLU 1SFQB 3RXRA 1FN6A 1MAXA 3H5CB 4JZIA 3AW0A 5ESBA 2VH0A 2OCVB 3HGPA 4B73A 3RM2H 2XWBI 4XE4A 2WPIS 2BQ6B 1Y3WA 1NU7B 4B1TA 2H2ZA 2TGPZ 3D23A 1F5LA 5A8XA 1C5NH 1SOTA 1DVAH 5DP9A 3LIWA 3BTEE 2R0KA 1DE7H 2ZDVH 2BDCA 4JYTA 1GJ9B 1TRMA 4IN1A 1GJ6A 4I8KA 4Y11E 2VB0A 1DS2E 3MI4A 1L1JA 4Y8ZA 2D2DA 1TNGA 3OYPA 1CQQA 4X6NA 2VNTA 5EPNA 2FOCA 3KQDA 4BAOB 1PPCE 1C5PA 4NIWA 1LMWB 2IOTA 1C5SA 4KP0A 3NZIA 1NC6A 5HYOA 1SHYA 1FPCH 4ZUHA 2QYIA 5L2ZH 5BPEA 1GMHF 3KQBA 2Y80A 1NRQH 4IW4E 1IAUA 1P2IA 1P8VC 2PGQB 4ISIH 4HTCH 3EDXB 1A0LA 1GHXH 4R8TB 1C5YB 1ARBA 1TOMH 1BA8B 2ZG0H 1XUHA 4NIYA 2OLGA 5JBAS 3IWMA 3EA9A 1XUFA 4BAQB 1EB1H 3OU0A 2ZDMA 3P8GA 4Y10E 4B76A 1C5MD 1GBMA 4ABJA 3RU4E 2XBWA 1WQSA 1DSUA 1QB1A 1J8AA 2AH4X 5FCRA 1HJAC 1NRPH 5I46H 2ALVA 5E0GA 3RXKA 4NA9H 2BDBA 1CHOG 1UVSH 1P9SA 5A09A 2NU4E 1OP2A 3RXSA 1C9PA 4NA8A 1SQAA 1HAIH 3UWIA 2Z9IA 5JPMH 1C2KA 1CA0C 1RD3B 4ABGA 3LH3A 1C5UA 3SI3H 1CSOE 3RLYH 1OWEA 4X6OA 3Q3XA 1G30B 2FX6A 2PUXB 1SBWA 3VB6A 3E8LA 3SV8A 2H9EH 2BVXH 5T6FA 1SPJA 4I32A 4AX9H 2CJIA 1O2HA 5E2PA 1YPMH 4CBOA 5L30H 1AHTH 1WBGB 2O8LA 1Y3UA 3NKKA 1C4Y2 1GJCB 3NXPA 1P3CA 3M35A 2ZP0H 5BRRE 1EZSC 1SLVB 4ABAA 2VWOA 1Y3YA 3CP7A 2GV7A 2P3FH 2GDEH 3M5MA 4YLUA 4DGJA 2Z9KA 2G55A 7KMEH 2ZFTA 4DURA 2ZIQH 2ZGJA 2BVSH 1MZAA 1F92A 3ZZBA 1ETSH 1P9UA 1HLTH 2UUKB 3FP6E 1N6XA 1AFQC 1FY5A 3FAOA 1GL1A 2A5AA 2GT7A 1OS8A 2H1UA 1QJ6B 4WH6A 3TJOA 2G52A 2GVFA 4SGBE 4JZFH 2BY8X 1C5QA 1YCPM 3AAUA 1CE5A 1WCZA 3V0XA 3TJNA 3SJ9A 4Y7AA 2G5NA 6CHAB 1V2TT 4WMDA 2FIRH 3PM3A 2BDAA 4K5ZA 5GIBA 5JBBS 2G4TA 1MQ6A 2FXRA 2G00A 1O2TA 2VINA 1GBEA 2FOBA 1AB9C 1BOQA 2G51A 3PO1B 2VWLA 3T5FH 1GHAF 2QY0B 2H9HA 4ABDA 4FU8A 1QHRB 3SORA 1O2NA 1Z6EA 3PB1E 4Y76A 3SU2A 1LKBA 3OY5U 1Z8RA 3QTOH 1A0HB 5FX5A 1P11E 1HXEH 3ZV8A 4LXBH 4OS1A 1MBQA 2TBSA 1Z1JA 1X7AC 5GXPA 1DDJA 1P57B 1TBRH 2Q6DA 3E90B 4OGXA 3STIA 1UVUH 2A32A 1O2UA 1OYTH 2PGBB 2JKHA 1BITA 1QJ7B 2WPMS 1ELVA 4SGAE 1FQ3A 3LGUA 4UD9H 2STBE 2G4UA 1V6DA 5DP5A 1AY6H 1TPOA 2Z94A 2ZFFH 2AMDA 5CE1A 9ESTA 1UTNA 3RC4A 4PROA 3V13A 4FVDA 2GCTB 2ODPA 1H8IH 3IG6B 2HPPH 1O3KA 4Q2KA 8KME2 1B0FA 3A87A 1P12E 4UONA 1P2NA 1C2GA 3DFLA 5LPFA 2PWXA 1O3OA 2AERH 3GY5A 1WQVH 2EEKA 2QXJA 3TH4H 2XBXA 1GBTA 1S83A 4ISOA 4UFDH 2ZFSA 1W3CA 1GBFA 4NIVA 1JBUH 1EP5A 1C2IA 1A5GH 1VGCB 2ANWA
chains in the Genus database with same CATH superfamily
3CNRA 2V35A 1U6QA 1UTJA 3RMMH 4DW2U 3CS7A 1QRXA 4AN7A 2Z3CA 1K1IA 1SGQE 1Y5BT 2ZO3H 3FVFB 2ZGHA 4ZH8A 1D6RA 5FPTA 1UCYE 2QC2A 2FLRH 1GJBB 1IQNA 3SV6A 5HM9A 4WF8A 2Q1JA 2EI6A 1ZMNA 1G3CA 3QO6A 5J4SA 3PROA 4K1SA 1G2LA 2VVVA 2GMTC 1T7CA 2GX4A 4VGCC 1EOJA 4DVAU 3P17H 3PRDA 5CMXH 2QGRA 1TB6H 1MTUA 4JYVH 1AGJA 1BBRH 2XNIA 1BTPA 4X6MA 1IOEA 3AVZA 4ISLA 1ELEE 2NU2E 2ZKSA 3FP7E 1W11U 2PKSC 4MG3A 4ZKRU 2UUJB 3C27B 1A1RA 2HPQH 1IQKA 1TIOA 1EPTC 5AHGH 4WWYA 2FOFA 3S9CA 3DT0H 2IN2A 5C17A 3TU7H 2VBCA 1YCPK 2EC9H 2ZHWH 2BDHA 1GMHG 3ZVDA 1W7XH 3S7HB 2BB4A 2VVCA 3MU0A 2A5KA 1YLCA 1TNHA 2BOKA 3PRBA 3P6ZB 1BMNH 3ENSB 4A7IB 4F48B 2ZGCA 3A8CA 1KTTB 1F7ZA 3GCHC 3SNBA 2SNVA 1S5SA 3NCLA 1XKBC 2AS9A 3RXVA 1NBME 2HLCA 4KTUA 3V12A 3QDZB 2F83A 4IMQA 2QV1A 1ANDA 5I25A 3DHKH 5C20A 2Y81A 1P2KA 5T6DA 1MCVA 2KCPA 1W7GH 3MNSA 1MD8A 1O2XA 2BX3A 4FUDA 2K8IA 1EPTA 2O8UA 2SFAA 1HJAB 2ZI2H 1LVOA 1CT4E 5FPSA 1O38A 1TFXA 1IQEA 5F53A 1A0JA 4BTTB 1FNIA 3F68H 1KXBA 4MVNA 2VGCC 3ZV9A 5DPAA 3BV9B 3SHAH 1CA0B 1GBHA 3LGYA 1FV9A 1EZXC 4OGYA 5AFZH 1IQFA 4ABBA 1V2QT 3VB4A 2O8MA 1MTVA 1THRH 4I31A 4MLFB 4E7RG 4MDSA 1C1OA 1N6YA 2WPLS 4D9RA 4FXGH 2BLQA 5FBIA 2C3SA 2KCAA 4K1TA 4A5TS 3QK1A 4M9FA 3M3SA 4JCNA 1FAXA 3HKJB 4CR5A 1ZYOA 1NS3A 1TQ7B 1LHGH 4INHA 4Q7XA 1V2OT 1A3EH 3VXEH 1CHOF 1E0FD 3GISB 1NFUA 4K69A 1JIRA 3ELAH 5EIYA 1LVMA 1UTPA 4H4FA 3R0FA 4UE7H 1MQ5A 2V3HH 2A2XH 2KFWA 2SGEE 1A2CH 4AOQA 5JB9S 3KN2A 2OC0A 5DN6D 2OC8A 3DA9B 1AFQB 1BT7A 1IHSH 2WINI 3N7DA 1NY22 1P09A 4J1YA 1TGSZ 2AMPA 3C1KA 1EKBB 4AB8A 2AGIX 3GCNA 1FY8E 2TRMA 2ZDKA 1Y59T 1BJVA 2ODYB 4B71A 3UOPA 1UTOA 1WXRA 3W95A 3UTUH 2UWPA 5E0JA 3SBKA 1UCYK 1TAWA 2ZHDA 3PWBA 2Z3EA 3E3TA 1EXFA 1ANEA 1GVLA 3BTHE 3S0NA 3CS0A 3A8BA 1SFIA 5GDSH 1OYQA 1O5AB 2A0QB 3QUMP 4AFUA 1AB9B 1TX7A 1SGIB 6ESTA 4RKJB 3TK9A 3GDVA 1HPGA 2RDLA 3ZZDA 4X6PA 1GI3A 1MMJN 5B6LA 2RFKC 2BMGB 3PMBB 4B2BA 5IYTA 4NFFA 1TONA 2C93B 2FYQA 2VWMA 2XXLA 3NRLA 4J2YB 1N1LA 4INKA 1EAXA 1UHBB 1YWUA 1K2I1 2HNTE 1OP8A 1V2VT 3U69H 2ZECA 3DD2H 1O5EH 1YPKH 3DUXH 4AZ2B 3LC5A 3RXAA 4Z6AH 2Z7FE 3RXEA 1H4WA 2ANYA 5T6GA 3RXHA 4FUHA 3SNEA 2UWLA 5FHTA 1O2SA 1PQ8A 3T2NA 1AVWA 4AFSA 2BY7X 4I8HA 2J4IA 2ZEBA 4TPYA 2ULLA 2K1QA 4NA7A 1BB0B 4BTUB 2H5CA 2W3IA 4ABFA 4B6FA 1CGHA 2UWOA 3I29A 3SV9A 1BHXF 5TCCA 4H6SB 4BXWA 1OSSA 2FS9A 3TIUA 1A5HA 1DWCH 5EOKA 1ANBA 2L74A 3RXMA 3ATWA 2ZDLA 2CMYA 2PSYA 1GHZA 3SU0A 1M9UA 4X8SH 3RXQA 1OXGA 2HLDD 1ZJDA 1C1TA 4ZHAA 4CHAC 1IQJA 1DXWA 1QIXB 1V2PT 1XXFA 2EY4C 2FESH 4XBBA 3RXGA 5A0CA 2Q6GA 1E1QD 2HRVA 3M37A 2W7UA 1C1QA 1VZQH 1DWDH 1FN8A 1Z71A 3UWJH 3GY6A 1QRZA 2HVXA 2SGAA 4CREA 3MH7A 1HAVA 1JIMA 1HCGA 2F3CE 2IPHA 1GBCA 1HAPH 1WOFA 4INLA 1P10A 2G8TA 1QL9A 1QB9A 5GNDA 2GMTB 3ITIA 3MNXA 4VGCB 4UFGH 5C5OA 3AAVA 4MNXA 1JXPA 1KXFA 3GICB 4GSOA 4H6TA 5B6OA 1O3BA 3P92A 4KTCA 1AN1E 2XTTB 1O2RA 2PHBA 5KECA 3RM0H 5FAHA 1GVKB 2C8XB 5ETXA 3MMGA 2PKSB 3TNSA 5GWZA 4X1RU 3T25A 1GJ7B 1O33A 1T32A 8GCHF 1EPTB 1NRRH 5ABWA 2VWNA 4AFZA 1SGPE 2P8OC 4X0WU 3M36A 2RA3A 2GT8A 1IQHA 2BD3A 5JBTA 3P8FA 1CGJE 4YOIA 2BZAA 3MNBA 3OTPA 3PTBA 1TGTA 1QBNA 1SHHB 3TGKE 4X2YA 1EFRD 1ESAA 3URCA 1J9CH 3GCHB 1Q2WA 2Q6FA 4Z0KA 3RU4D 2PP6A 2SGPE 2BD8A 3ZZ7A 2BDGA 3SU5A 4I33A 3P8NA 5EQRA 1O32A 3SJKA 3BTME 1G37A 4ZCNA 1DICA 3NPSA 2BD5A 1KXCA 1ZTKA 2BD7A 4A92A 1P05A 1GBLA 1BMFD 1L0ZA 3SGQE 4ZROA 2C8ZB 1NZQH 1TPAE 3W94A 1CHGA 3MH4A 2RG3A 1MAYA 4TSFD 1O3IA 3ESTA 5F8TA 4KGAA 2QF5A 4FUBA 1THSH 1K0HA 1HV7A 3QX5H 2VGCB 1O37A 3RXLA 1BHXB 3FFGA 1S82A 5FBEA 1YF4A 1KY9A 2Z9GA 4X2WA 7GCHG 1FAKH 5EXLA 3SQHE 5EJ1A 3BTKE 1C5RA 1ANCA 1SGDE 1GBAA 1ZR0A 2B7DH 1P3EA 4CH8B 2BLVA 4D76A 2OINA 2TPIZ 3TGIE 1NROH 2D1JA 1V2KT 2CK3D 1O3HA 3F9EA 3P8OA 4K3JA 3L3TA 5FXLA 1AUTC 1ETRH 4DJZB 3FZZA 4GLYA 3WW7A 2R3UA 3B9FH 4BXSA 3ZZ4A 4BANB 3SQEE 2I6QA 1PPFE 1EOLA 1GCDA 1QZ8A 2J98A 3S9BA 3OFND 1O2JA 3A83A 3RXCA 2GGVB 3QN7A 4K8YA 1YPGH 1GJAB 3SZNA 5CHBA 2FTLE 1LDTT 1MKXK 2ZNKH 3SNCA 3RXUA 4ZXXH 1WYKA 2J95A 1ELTA 1L4DA 2TGAA 1HJ8A 1S0RA 4ABHA 4XRNA 1WTHD 4CRFA 1FJSA 1XUGA 1GBJA 3PV2A 5C5NA 1GI8B 1GI7B 2EI7A 3OY6U 1IQGA 1H9HE 4Y0YE 4ZMAH 4B2AA 1KLJH 2XYAA 1GHWH 2YOLA 2SNWA 1NO9H 3M7UA 4YTAA 1A7SA 1OWKA 2XBYA 3KYFA 5C1UA 3QZRA 1ZHPA 3K6ZA 4GAWA 3P70B 3D49H 2F43B 1LTOA 4LOYH 3A7WA 1O3PB 4WVPE 2W6ID 1ZGIA 2QCYA 1Z8GA 2R3YA 3SOSA 3TPIZ 2ZGBH 2ZU1A 2FO9A 1SB1H 4NSVA 3ZZ6A 1YPEH 1UTLM 2BHGA 1KDQA 2Y5GA 3MQKC 1JMOH 1V2NT 1QNJA 3L6PA 1ELAA 1GHYH 1AWHB 1YC0A 1MKWK 2ANMH 1FPHH 4Z1MD 2OBOA 1O3CA 2YNBA 1VCWA 1P2QA 1GDUA 1T8MA 1TQ0B 3Q77A 2ZZUH 1PQ5A 1LHCH 4TY7A 2O9QA 1AVXA 3KNXA 2ZF0H 3U8TH 1T4UH 4ACBA 1SGNE 4MPWA 1ZRBA 1D3PB 1O5CB 2FI4E 4MPXA 2DUCA 2Y7ZA 3MWIU 4TWWA 1C5TA 4X1PU 3FP8E 3VGCC 3PV4A 3UOUA 1Y5AT 1OWHA 3PMAB 3SU1A 1RTKA 3MOCA 1NU9A 4ZKSU 2HWLB 3OEED 2GCHG 3HGNA 7ESTE 3U98H 5H4IB 1LQEA 3VB3A 1MTNC 2A7CA 4ASHA 1BQYA 1DFPA 1H1BA 3EQ0H 3TK5A 3MO9A 4XBDA 4RSPA 1FONA 1S6HA 1AKSA 1C5LH 3UR9A 3FZDA 3ZZ8A 3F3BA 1AQ7A 2JJ2D 1C1MA 2VIQA 1O3DA 1AU8A 1AZ8A 2O8WA 2RDEA 2CN0H 2DE9A 4CHAB 4I8GA 4NFEA 5A0AE 4Q7YA 1D3TB 2ZPRA 3LOXA 4OS4A 4HFPB 2PUQH 3UB0A 4Y6DA 2GJGA 3KYGA 3FOAA 5GJ4B 1T8NA 1LHEH 2QAAA 1G3DA 1UVTH 1UTKA 4GCHG 2ZC9H 4OS2A 1WUNH 2OUAA 3MTYA 1GMDG 2W6JD 2XC0A 3AASA 5DP7A 1E35B 4DOQA 1YCPH 3BEIB 1J16A 3E16B 3MFJA 1GJDB 1BTHH 3RXJA 2XCFA 4YZUA 4OS5A 5GPIB 4D9QA 3UR6A 1L2EA 1OHHD 1C1NA 1C1UH 3N7EA 1ZZZA 4AGJA 4OS7A 1C9TA 3G01A 1YPJH 1FUJA 8GCHG 2BXTH 3SJ8A 1GHVH 2V0BA 4TYDA 1OWIA 1TPPA 1ABIH 1MTWA 2A1DB 2LPRA 2WSSD 3MU8A 1MCTA 2LNCA 2J5UA 2FPZA 1EP6A 2P8OB 3UPEA 4NIXA 1GBDA 1DM4B 1SG8B 1A3BH 2WHXA 1NBMD 5J4QA 2XRCA 3BTQE 2TGDA 1AE8H 4IN2A 4DY7B 3RUOA 2WZQA 3U1IB 1SQOA 3MHWU 3ATKA 1O30A 4X1SU 1QBOA 1QRWA 1MBMA 2CGAA 3E6PH 5HM2A 3U8OH 2VJ1A 5LGOA 1QB6A 1IQMA 1L1GA 1DWBH 5EJZA 1BRUP 2A7JA 2WYJA 2BLWA 5DJ7A 3EAJA 1PQAA 3A8AA 2M2AA 2KZ4A 3ZYEA 2Z9LA 1P06A 1P2OA 1ZRKA 3PWCA 2BDIA 5CHAC 4AG1A 2K0QA 2P16A 4X1NU 3E1XB 3ATMA 4FUCA 4TWYA 2ZTYA 1CBWC 3OSYA 5LH8A 1NPMA 1OOKB 2FM2A 2ODQA 3DCLA 3RLWH 4THNH 2QF0A 2QXHA 4WXVA 1HIAA 5G4BA 3T28A 2J98B 4JK6A 5AF9H 4FU9A 3SJOA 2QN5T 3Q00A 2F9PA 3U1JB 1ZGVA 2CF8H 3BF6H 1YP9A 3K9XB 3TH2H 4CRGA 2ZWLH 3ZYDA 2UUYA 8ESTE 1AZZA 1BMAA 1KLIH 1KLTA 4Q7ZA 3F2FA 1K1NA 1KXDA 3M7TA 3U8RH 1HAYB 3F9GA 3BSQA 1E37B 1DITH 1L1NA 3PLKA 1KTSB 1DOJA 1SR5C 1GGDC 4I7YH 2PSXA 1CGIE 1RXPA 5SGAE 3HATH 6GCHF 1W14U 1WDIA 1MU6B 1TMUH 4JK5A 3UAIC 1SLXB 1YPHE 1T4VH 3MU1A 2ZU4A 3VB7A 1UCYH 2ZTXA 3O8CA 1XVMA 2WV5A 1HRTH 1GJ5H 1V2MT 1SGYE 1TOCB 1F0TA 3PMHB 7GCHF 2FMJA 5EXNA 2QXIA 4GHQA 3ZZ9A 1O2ZA 3ZZ3A 1C5XB 1EJMA 2BXUH 1O3NA 1O5BB 2QXGA 3SV7A 1W2KH 1OKXA 3KEEA 4FUFA 5EG4A 2ZFRH 3A86A 1BTZA 1QFKH 2AGGX 2FDAA 1C1RA 3F0PA 3T26A 1C1PA 1XKAC 3QGNB 5DGJA 1YLDA 1ELCA 2ZA5A 1LQDB 1S0QA 1B7XB 2FODA 1EASA 4GPGA 4TT3D 4DG4A 1THPB 1P02A 2AHME 3ATLA 1GCTC 2AIPA 1DUEA 3SI4H 3DSOA 3DSGA 1D9IA 7LPRA 1K28D 1RIWC 3GY2A 2LP6A 3SUFA 3SZEA 1ESTA 2A2QH 4I8JA 1ORFA 3JZ1B 2Y5FA 5DSFA 1AUJA 3F9HA 2R2MB 1E36B 4Y8XA 1NT1A 1ARCA 1XM1A 2XWAA 4YESB 1FY4A 1ZSJA 3UIRA 3K65B 5K7RA 4YT7H 1O2LA 3A7TA 1TNIA 5AFYH 2JETC 1QA7A 3QTVH 5JB8S 3LGVA 1AKSB 1KYNA 2PTNA 4JZDH 3NUMA 3BTDE 2OBQA 3A80A 5FL7D 5HXFA 1WV7H 1N8OC 3ATIA 4XOJA 1HDTH 1WTGH 3RMLH 5EU8A 2ZDAH 4UFFH 5DG6A 1TNKA 1YPLH 2EI8A 1LHFH 3CENA 4KKDA 1NESE 1PFXC 1HBTH 4Q63A 5C3NA 4UEHH 3VGCB 6LPRA 5IK2D 1YBWA 1GPZA 3Q76A 5PTPA 1XX9A 4UDWH 2ZFPH 4HI3A 4YOGA 1TYNA 1BIOA 1MTNB 1KXEA 1KMHB 2FLBH 3O8BA 3WY8A 1XUIA 4NSYA 2SGFE 2P94A 3GY7A 5LPRA 2GKVE 3QZQA 1B5GH 2NU0E 3MH6A 2FI3E 1CT2E 3RMOH 3I77A 5F8ZA 5KEDA 1P0SH 2FOGA 4DT7B 5HGGA 3GS9A 2B0FA 2F9OA 3OAAD 1BZXE 1HYLA 2XW9A 1ELDE 1Y3VA 3DSPA 2CF9H 2HNTC 1AMHA 2P59A 2ASUB 1P03A 4X2VA 4Y7BA 1EJNA 5EQSA 5IDKA 3SHCH 2KR7A 3UUZA 4JZEH 3MYWA 4GUXA 1YKTA 1IQLA 2GCHF 2A4OA 2C90B 5DP6A 1O2IA 2V7QD 2A4RA 1TLDA 4X2XA 4TPIZ 3BEFB 2SGQE 2ZCLP 2IJOB 5GCHG 2B9LA 2R2WU 1GI6A 5E2OA 2HGTH 3K2UA 1SGEE 1UK3A 1TRNA 1P04A 3Q3YA 1A46H 1JOUB 2H6MA 1COWD 3KCGH 2FX4A 2A4GA 2XCNA 5JBCS 1SL3A 4I8LA 4CRAA 2FOMB 2ANKH 5DKMA 1FY1A 1LKAA 1ZMJA 1XXDA 2A45B 1W8BH 2Z3DA 2QF3A 3A88A 2CHAC 1OP0A 1ZHRA 1ZMLA 2W3KA 3RXBA 3I78A 5FCKA 3V3MA 3A7XA 1O2YA 3BIVH 4A1TA 1V2LT 1C2DA 2BY5X 3EE7A 2GP9B 3GCTG 5DP4A 4A1VA 4GCHF 1DX5M 1V3XA 2C8WB 3KGPA 1GMDF 3S9AA 1ETTH 4AYVB 1S84A 3TVJB 4AB9A 1H9IE 1O39A 1SVPA 1ZPCA 1PPGE 2J97A 2WPDD 4NWLA 1ZOMA 4M7GA 5E0HA 1S85A 3TK6A 3GY8A 2FTMA 2KCOA 1CVWH 1K9OE 5CDFE 5L2YH 2KM0A 3F2HA 1DY8A 3F1SB 1WU1A 1UK4A 2QIQA 4RN6A 1DUAA 2PV9B 4X8VH 1TX8A 3M3VA 1GJ4H 1C2HA 2Y5HA 5CHAB 4U01A 2ZFQH 1K1LA 1P2JA 3O8DA 1K22H 2A5IA 4Y8YA 1CBWB 1LVBA 3SW2B 1B0EA 1BCUH 1D3DB 3SO3A 2FEQH 2AIQA 4K8BA 1V2UT 2PKAA 1TGCA 1BTWA 3F9FA 1GJ8B 1TA2A 4LZ1H 4AG2A 2BY6X 1AFEH 1EUFA 2BYAX 4YT6H 2WUBA 3EGKH 1Q31A 1F2SE 1Z6JH 3UNRA 1V2WT 2J9NA 1C4V2 1PPZA 1DLKB 1UJ1A 3F6UH 3ZZ5A 3SU6A 3RXOA 4A6LA 4YLQH 3KF2A 4XD7D 1GL0E 2GV6A 3FO8D 3ZVGA 1AVGH 1MKXH 4MTBA 4OS6A 2ZQ2A 3AW1A 2OD3B 3RXPA 3SJIA 3SUDA 6GCHG 1C5OH 1GGDB 1VR1H 3FANA 1SC8U 1HUTH 3MO6A 3Q3KA 2OC7A 2HNTF 4WY3A 4FETA 1ZJKA 1PPEE 1NM6A 1C5VA 3UY9A 1O5FH 1C2EA 2XC4A 1ESBA 3RU4T 1TA6A 2GZ8A 3RXTA 4XFQA 1GWAA 4MPUA 1SLUB 1GMCG 4DIIH 1QR3E 4BAHB 1C5ZB 3GOVB 4XBCA 3T62A 1VCPA 1AD8H 2F4LA 1WAYB 2M5TA 1QY6A 1ZLRA 4HGCA 2NU3E 1EJAA 1NRSH 1ZTLA 3RXFA 3PYHA 3RXIA 4Y71A 5FX6A 1PPBH 1OX1A 3MU5A 1YGCH 1O5DH 1TBZH 1BJUA 1O2OA 4IBLH 2YNAA 1C5WB 1MKWH 3URDA 1HGTH 1P2MA 2ZU5A 4RT0A 1C2LA 1GCTB 3VPKA 1FZZA 1SSXA 1BMLA 2D8WA 3M5OA 3UQVA 1FX0B 2BVRH 1RIWB 1QGFA 3A7YA 3M5LA 1D6WA 1MABB 1C1SA 2FI5E 1LCYA 1FXYA 2RA0A 4ZAEA 3LDXH 1GI2A 3L33A 3BTTE 3EE0B 1EB2A 1TWXB 3GY4A 4RT1A 1EX3A 4DIHH 1BTXA 4O03A 1O3GA 1G32B 2PR3A 1O2GH 2AEIH 1AO5A 4CBNA 5C1XA 1RTFB 1Z1IA 2JH5D 4NZQA 5HKKD 2JETB 3OE7D 4FU7A 1ELGA 4O3UA 1Y5UT 5K0HA 4MQAA 3KL6A 1AE5A 1EZQA 4IC6A 1ACBE 1SGRE 1K1MA 1O3FA 1ID5H 4X8UH 1N8OB 2V3MA 1FIWA 1C4U2 1HB0B 1ZSKA 1VITG 1V2ST 2ZDNA 1LVYA 1PQ7A 3KQCA 3K6YA 3EA8A 2BD2A 3RC5A 1O31A 4KTSA 1BTYA 1KXAA 1O3JA 1K1JA 2W5EA 2FOHA 1DPOA 1ZPBA 4HZHA 5EQQA 1F5KU 5T1VA 4YOJA 4D8NA 2ZHFH 2IJD1 3M5NA 2KAIA 3GY3A 2J38A 3H7OA 2QE7D 2OP9A 3ZZAA 5LPEA 1O3LA 1G36A 1TE0A 1O3AA 1V2JT 1QCPA 3PLPA 1W13U 3GYMA 1BRAA 2FOAA 3ZVCA 8LPRA 1EAWA 3VEQB 3LPRA 1T8LA 4NZLA 4O3TA 3RXDA 3BTGE 3SUGA 1E1RD 3B23B 4R0IA 4KELA 2YMSC 1XUKA 1L4ZA 1FMGA 2Y82A 1BMMH 4QT8C 1QURH 4F4OC 1TMTH 3LT3A 1HAVB 1C2MA 3LJOA 1HAZB 1RGQA 2WPHS 1GHBG 1O36A 4WH8A 1GBBA 1O3EA 2Y7XA 3IITA 4GVUA 2AMQA 5HIYA 1SQRA 4O9VA 2BOHB 2ZQ1A 2CXVA 4F55A 1LHDH 1ABJH 3HPTB 1QQ4A 3ZZCA 1PJPA 3TITA 5C2ZA 1NRNH 5C0TA 1BBRE 2ZCHP 3A85A 4DCDA 4P02A 1GBIA 3H7TA 2CV3A 3ZVFA 1VJ9U 1UTMA 2B5TB 1SGFA 4D7FA 3ZVAA 1PPHE 2HALA 1C2FA 2CHAB 1G2MA 3MNCA 1GI9B 3BG4C 2I6SA 3E0PB 4CH2B 2J94A 3HK3B 1FI8A 1HAOH 3A8DA 4WMEA 2PFEA 1GI1A 1CO7E 1ELFA 1TRYA 1UVPA 3DFJA 4AGKA 1IHTH 1O5GH 2BD4A 2PKAB 3D62A 5A8ZA 2RCEA 2VIDA 2HVYB 2KCYA 1QTFA 3ODDA 1AI8H 5GCHF 2V3OH 4B74A 1KSNA 1EQ9A 2NWNA 3JZ2B 1GG6C 4ZXYH 1UK2A 1YY3A 1UVOA 1MH0A 2BD9A 2VIPA 3FKSD 2FOEA 1Y3XA 2WPKS 3BIUH 1MTSA 2DE8A 3TJUA 1UHBA 1TNLA 5JYIA 1F0UA 1G3BA 3RC6A 3QLPH 3NK8A 1BRBE 2BQWB 1RJXB 1T31A 4WJG2 3O8RA 3P95A 1WSSH 1DANH 4E05H 1J17T 4Y79A 2W26A 3GCTF 2GTBA 4FUJA 1BRCE 2G5VA 2OTVA 2JH0D 2BLOA 1O2PA 1O3MA 4FUIA 1UO6A 3GDUA 4NG9H 3EA7A 1E79D 5DK1A 4FVBA 1Z7KA 5EGMA 1O2WA 5ESTE 1BTUA 3A82A 1FY3A 4H42U 1TABE 2XNDD 4IMZA 1QA0A 4FUEA 1W12U 1W0KD 1VJAU 1AIXH 3HK6B 3UNSA 3E91A 2BM2A 3LGTA 1JRSA 2ZGXH 1OWDA 1MZDA 2F9NA 1TALA 3PMJA 3KQEA 2F91A 4IC5A 3LH1A 4ESTE 4ZKOU 4B75A 3T27A 1E34B 3SGBE 4XDEA 4I86A 2SGDE 3NWUA 3T29A 3V7TA 1GDNA 1LPZB 1OPHB 4BTIB 1F0RA 2ZU3A 3S7KB 1P01A 1YM0A 2STAE 2VVUA 3RMNH 1XUJA 3VXFH 1F5RA 1W0ZU 4NCYA 2ZU2A 3UFAA 1O35A 4GHTA 5EXMA 4RKOB 2A7HA 2FP7B 1EAIA 4YXWD 4BNRA 2FZZA 1J14A 2G81E 4WMFA 1RRKA 1XMNB 3ODFA 4K2YA 4ZKNU 4BAMB 3SNAA 3A7ZA 4AYYB 1MD7A 3BEUA 1YYY1 3RP2A 1K1OA 1SGCA 3BN9A 5DP3A 4CRDA 1EATA 3B8JA 3OX7U 2WV4A 2Y6TA 1W0JD 3QWCH 4BAKB 5A8YA 4IGDA 2OQ5A 4ISHH 1QQUA 1GBKA 3BTFE 4MPVA 4LZ4B 3BTWE 1D4PB 2F9VA 4ABIA 1GI0A 2A31A 1Z8IB 3PV5A 4JZ1A 1TPSA 1FLEE 4AORA 1ZSLA 2GZ9A 4B2CA 2F9UA 2P3TB 1NFYA 1FIZA 3SU3A 3SV2H 2UUFB 1JRTA 4MNWA 1S81A 1H9LB 2TIOA 5EPYA 1GVZA 2P95A 1TNJA 1BBRK 3SU4A 1Q3XA 2ALPA 2AFQB 1KDQB 1F0SA 1O2QA 1SQTA 1VITH 1Y8TA 3M7QA 1GMCF 1UMAH 5C1YA 1LPKB 1O2MA 2KAIB 1QJ1B 1DLEA 4RI0A 3SN8A 2B8OH 1G3EA 1YPHC 1CA8B 1H8HD 4K1EA 2JH6D 2NU1E 4JMYA 1FDPA 1DXPA 2BDYA 2R9PA 3A89A 3RDZA 4IS5A 4U32A 2GZ7A 5TJXA 1S6LA 2WUCA 1NFXA 1Z8JB 1LO6A 1TGBA 1BDAA 1MU8B 2ZCKP 4X1QU 4YO9A 2VH6A 1SOZA 1O2VA 4ABEA 1PYTD 1DSTA 1MUEB 5A0BA 4D7GA 5JDUB 4ISNA 4U30A 3SYJA 1SMFE 2ZPQA 3LGIA 2C8YB 1O0DH 3TH3H 1RFNA 2FS8A 3SUEA 4CRBA 3R3GB 1XVOA 2P3UB 3UREA 2XC5A 1A61H 3ZVBA 1IQIA 3LC3A 5F8XA 1TBQH 1H8ED 2BX4A 3KHVA 4LK4A 1KIGH 2ILNA 2FWWA 3U28C 3MU4A 3BG8A 3UNQA 1RS0A 3GYLB 5E8EH 1EAUA 1UTQA 1VITF 3PLBA 2AGEX 2YMSB 1C2JA 2WYGA 2J2UA 3LKWA 1CU1A 1O2KA 3SNDA 2OK5A 3QGJA 3SGAE 2Z9JA 4A1XA 1DT2A 1GHAG 2HOBA 2PLXA 2VIOA 2OC1A 3N7OA 3LONA 2ZHQH 2W7SA 1K21H 2AYWA 3EYDA 2GDDA 1SGTA 1S6FA 3TJVA 3LU9B 3W1EA 1HXFH 2FYRA 3PTNA 1G9IE 5C67A 2R0LA 4F49A 2GD4B 2VU8E 2KX4A 3OTJE 1ZHMA 2C4FH 3M3TA 1ZTJA 1NFWA 4K60A 6CHAC 2WPJS 3TNTA 2OQUA 1PYTC 3BG4B 1QBVH 4NWKA 1TX6A 1SI5H 5T3HA 1J15A 1T8OA 2D26C 2Z6BD 1YLNA 3VG8A 4WXIA 1HAGE 1TGNA 2VIWA 3N99A 1DY9A 1GHBF 3PO1C 4AFQA 3AK5A 5EW1H 4TY6A 3VB5A 1DWEH 1HNEE 2XBVA 1CT0E 1A5IA 9LPRA 1W10U 3VFEA 1W0YH 2O8TA 1GG6B 3MH5A 4YM9A 3A7VA 4FOUC 2BTCE 4E7NA 3E0NB 1EZUC 2A4QA 3OEHD 2XOKD 1INCA 1E38B 5F03A 1A4WH 5AVDA 4MNYA 1AWFH 4ZHMU 3STJA 2J92A 1D3QB 4XSKU 4CRCA 1NN6A 2ZPSA 4FUGA 3GCOA 1HJ9A 3F0OA 3LJJA 1QL8A 3UQOA 5C0UA 3A81A 1VCQA 2JJ1D 2OXSA 1JWTA 2ZTZA 4O97A 1HIAB 1ZPZA 1K1PA 1V2RT 1NTPA 2PW8H 2ZHEH 3U9AH 3HKIB 2GCTC 2TGTA 1HAXB 5EODA 2H5DA 1GI4A 2P93A 5DP8A 1C1WH 2BZ6H 3TLOA 5TCAA 1BUIA 4Q80A 5FPYA 1GDQA 4ACAA 5DO4H 2H9TH 2F9BH 4X8TH 1HFDA 2V6NA 1ELBA 4BOHA 3KIDU 4JYUH 1LPGB 2PTCE 3ZVEA 1QL7A 4CR9A 5L6NH 2QA9E 3GDSA 4U2WA 3D65E 4Y0ZE 2THFB 4UFEH 2VIVA 1SGFG 3TGJE 1GI5A 1OWJA 1RTLA 1HAHH 1SLWB 4B6EA 4E06H 4NGAH 3S69A 3FN8A 2ESTE 1VGCC 5HMAA 5A2MH 3LGWA 5F6MA 1TMBH 1O34A 5EW2H 2J34A 3MO3A 2BY9X 1C1VH 2EA3A 3A84A 4MNVA 3M61U 2BQ7B 1H8DH 4ZHLU 1SFQB 3RXRA 1FN6A 1MAXA 3H5CB 3KQ5A 4JZIA 3AW0A 5ESBA 2VH0A 2OCVB 3HGPA 4B73A 3RM2H 2XWBI 4XE4A 2WPIS 5KGOA 2BQ6B 1Y3WA 1NU7B 4B1TA 2H2ZA 2TGPZ 3ZIAD 3D23A 1F5LA 5A8XA 1C5NH 1SOTA 1DVAH 5DP9A 3LIWA 3BTEE 2R0KA 1DE7H 2ZDVH 2BDCA 4JYTA 1GJ9B 1TRMA 4IN1A 1GJ6A 4I8KA 4Y11E 2VB0A 1DS2E 3MI4A 1L1JA 4Y8ZA 1UW7A 2D2DA 1TNGA 3OYPA 1CQQA 4X6NA 2VNTA 5EPNA 2FOCA 3KQDA 4BAOB 1PPCE 1C5PA 4NIWA 1LMWB 2IOTA 4HG6A 1C5SA 4KP0A 3NZIA 1NC6A 5HYOA 1SHYA 1FPCH 4ZUHA 2QYIA 5L2ZH 5BPEA 1GMHF 3KQBA 2Y80A 1NRQH 4ASUD 4IW4E 1IAUA 1P2IA 1P8VC 2PGQB 4ISIH 4HTCH 3EDXB 1A0LA 1GHXH 4R8TB 1C5YB 1ARBA 1TOMH 1BA8B 2ZG0H 1XUHA 4NIYA 2OLGA 5JBAS 3IWMA 3EA9A 2EQNA 1XUFA 4BAQB 1EB1H 3OU0A 4OM9A 2ZDMA 3P8GA 2LELA 4Y10E 4B76A 1C5MD 1GBMA 4ABJA 3RU4E 2XBWA 1WQSA 1DSUA 1SKYE 1QB1A 1J8AA 2AH4X 5FCRA 1HJAC 1NRPH 5I46H 2YMSD 2ALVA 5E0GA 3RXKA 4NA9H 2BDBA 1CHOG 1UVSH 1P9SA 5A09A 2NU4E 1OP2A 3RXSA 1C9PA 4NA8A 1SQAA 1HAIH 3UWIA 4Q4LA 2Z9IA 5JPMH 1C2KA 1CA0C 1RD3B 4ABGA 3LH3A 1C5UA 3SI3H 3WWFA 1CSOE 3RLYH 1OWEA 4X6OA 3Q3XA 1G30B 2FX6A 2PUXB 1SBWA 3VB6A 3E8LA 3SV8A 2QF4A 2H9EH 2BVXH 5T6FA 1SPJA 4I32A 4AX9H 2CJIA 1O2HA 5E2PA 1YPMH 4CBOA 4DT4A 5L30H 1AHTH 1WBGB 2O8LA 1Y3UA 3NKKA 1C4Y2 1GJCB 3NXPA 1P3CA 3M35A 2ZP0H 5BRRE 1EZSC 1SLVB 4ABAA 2VWOA 1Y3YA 3CP7A 2GV7A 2P3FH 2GDEH 3M5MA 4YLUA 4DGJA 2Z9KA 2G55A 7KMEH 2ZFTA 4DURA 2ZIQH 2ZGJA 2BVSH 1MZAA 1F92A 3ZZBA 1ETSH 3WWBA 1P9UA 1HLTH 2UUKB 3FP6E 1N6XA 1AFQC 1FY5A 3FAOA 1GL1A 2A5AA 2GT7A 1OS8A 2H1UA 1QJ6B 4WH6A 3TJOA 2G52A 2GVFA 4SGBE 4JZFH 2BY8X 4AC9A 1C5QA 1YCPM 3AAUA 1CE5A 1WCZA 3V0XA 3TJNA 3SJ9A 4Y7AA 2G5NA 2JIZD 6CHAB 1V2TT 4WMDA 2FIRH 3PM3A 2BDAA 4K5ZA 5GIBA 5JBBS 2G4TA 1MQ6A 2FXRA 2G00A 1O2TA 2VINA 1GBEA 2FOBA 1AB9C 1BOQA 2G51A 3PO1B 2VWLA 3T5FH 2L6OA 1GHAF 2QY0B 2H9HA 4P00A 4ABDA 4FU8A 1QHRB 3SORA 1O2NA 1Z6EA 3PB1E 4Y76A 3SU2A 1LKBA 2WV9A 3OY5U 1Z8RA 3QTOH 1A0HB 5FX5A 1P11E 2IPQX 1HXEH 3ZV8A 4LXBH 4OS1A 1MBQA 2TBSA 1Z1JA 1X7AC 5GXPA 1DDJA 1P57B 1TBRH 2Q6DA 3E90B 4OGXA 3STIA 5C94A 1UVUH 2A32A 1O2UA 1OYTH 2PGBB 2JKHA 1BITA 1QJ7B 2WPMS 1ELVA 4SGAE 1FQ3A 3LGUA 4UD9H 2STBE 2G4UA 1V6DA 5DP5A 1AY6H 1TPOA 2Z94A 2ZFFH 2AMDA 5CE1A 9ESTA 1UTNA 3RC4A 4PROA 3V13A 4FVDA 2GCTB 2ODPA 1H8IH 3IG6B 2HPPH 1O3KA 4Q2KA 2JDID 8KME2 1B0FA 3H09A 3A87A 5EJLA 1P12E 4UONA 1P2NA 1C2GA 3DFLA 5LPFA 2PWXA 1O3OA 2AERH 3F2GA 3GY5A 5HIZA 1WQVH 2EEKA 2QXJA 3TH4H 2XBXA 1GBTA 1S83A 4ISOA 4UFDH 2ZFSA 1W3CA 1GBFA 4NIVA 1JBUH 1EP5A 1C2IA 1A5GH 1VKYA 1VGCB 2ANWA
chains in the Genus database with same CATH topology
2V35A 1U6QA 1UTJA 3RMMH 4DW2U 3CS7A 1QRXA 4AN7A 2Z3CA 1K1IA 1SGQE 1Y5BT 2ZO3H 3FVFB 2ZGHA 4ZH8A 1D6RA 5FPTA 1UCYE 2QC2A 2FLRH 1GJBB 1IQNA 3SV6A 5HM9A 4WF8A 2Q1JA 2EI6A 1ZMNA 1G3CA 3QO6A 5J4SA 3PROA 4K1SA 1G2LA 2VVVA 2GMTC 1T7CA 2GX4A 4VGCC 1EOJA 4DVAU 3P17H 5CMXH 2QGRA 1TB6H 1MTUA 4JYVH 1AGJA 1BBRH 2XNIA 1BTPA 4X6MA 1IOEA 3AVZA 4ISLA 1ELEE 2NU2E 2ZKSA 3FP7E 1W11U 2PKSC 4MG3A 4ZKRU 2UUJB 3C27B 1A1RA 2HPQH 1IQKA 1TIOA 1EPTC 5AHGH 4WWYA 2FOFA 3S9CA 3DT0H 2IN2A 3TU7H 1YCPK 2EC9H 2ZHWH 2BDHA 1GMHG 3ZVDA 1W7XH 3S7HB 2BB4A 2VVCA 3MU0A 2A5KA 1YLCA 1TNHA 2BOKA 3P6ZB 1BMNH 3ENSB 4A7IB 2ZGCA 3A8CA 1KTTB 1F7ZA 3GCHC 3SNBA 2SNVA 1S5SA 3NCLA 1XKBC 2AS9A 3RXVA 2HLCA 4KTUA 3V12A 3QDZB 2F83A 4IMQA 2QV1A 1ANDA 5I25A 3DHKH 5C20A 2Y81A 1P2KA 5T6DA 1MCVA 1W7GH 3MNSA 1MD8A 1O2XA 2BX3A 4FUDA 1EPTA 2O8UA 2SFAA 1HJAB 2ZI2H 1LVOA 1CT4E 5FPSA 1O38A 1TFXA 1IQEA 1A0JA 4BTTB 1FNIA 3F68H 1KXBA 4MVNA 2VGCC 3ZV9A 5DPAA 3BV9B 3SHAH 1CA0B 1GBHA 3LGYA 1FV9A 1EZXC 4OGYA 5AFZH 1IQFA 4ABBA 1V2QT 3VB4A 2O8MA 1MTVA 1THRH 4I31A 4MLFB 4E7RG 4MDSA 1C1OA 1N6YA 2WPLS 4D9RA 4FXGH 2BLQA 5FBIA 2C3SA 4K1TA 4A5TS 3QK1A 3M3SA 4JCNA 1FAXA 3HKJB 4CR5A 1ZYOA 1NS3A 1TQ7B 1LHGH 4INHA 4Q7XA 1V2OT 1A3EH 3VXEH 1CHOF 1E0FD 3GISB 1NFUA 4K69A 1JIRA 3ELAH 1LVMA 1UTPA 4H4FA 3R0FA 4UE7H 1MQ5A 2V3HH 2A2XH 2SGEE 1A2CH 4AOQA 5JB9S 3KN2A 2OC0A 2OC8A 3DA9B 1AFQB 1BT7A 1IHSH 2WINI 1NY22 1P09A 4J1YA 1TGSZ 2AMPA 3C1KA 1EKBB 4AB8A 2AGIX 3GCNA 1FY8E 2TRMA 2ZDKA 1Y59T 1BJVA 2ODYB 4B71A 3UOPA 1UTOA 3W95A 3UTUH 2UWPA 5E0JA 3SBKA 1UCYK 1TAWA 2ZHDA 3PWBA 2Z3EA 3E3TA 1EXFA 1ANEA 1GVLA 3BTHE 3S0NA 3CS0A 3A8BA 1SFIA 5GDSH 1OYQA 1O5AB 2A0QB 3QUMP 4AFUA 1AB9B 1TX7A 1SGIB 6ESTA 4RKJB 3TK9A 3GDVA 1HPGA 2RDLA 3ZZDA 4X6PA 1GI3A 1MMJN 2BMGB 3PMBB 4B2BA 5IYTA 4NFFA 1TONA 2C93B 2FYQA 2VWMA 2XXLA 4J2YB 1N1LA 4INKA 1EAXA 1UHBB 1K2I1 2HNTE 1OP8A 1V2VT 3U69H 2ZECA 3DD2H 1O5EH 1YPKH 3DUXH 4AZ2B 3LC5A 3RXAA 4Z6AH 2Z7FE 3RXEA 1H4WA 2ANYA 5T6GA 3RXHA 4FUHA 3SNEA 2UWLA 5FHTA 1O2SA 1PQ8A 3T2NA 1AVWA 4AFSA 2BY7X 4I8HA 2J4IA 2ZEBA 4TPYA 2ULLA 2K1QA 4NA7A 1BB0B 4BTUB 2H5CA 2W3IA 4ABFA 1CGHA 2UWOA 3I29A 3SV9A 1BHXF 5TCCA 4H6SB 4BXWA 1OSSA 2FS9A 3TIUA 1A5HA 1DWCH 5EOKA 1ANBA 3RXMA 3ATWA 2ZDLA 2CMYA 2PSYA 1GHZA 3SU0A 1M9UA 4X8SH 3RXQA 1OXGA 1ZJDA 1C1TA 4ZHAA 4CHAC 1IQJA 1DXWA 1QIXB 1V2PT 1XXFA 2FESH 4XBBA 3RXGA 5A0CA 2Q6GA 2HRVA 3M37A 2W7UA 1C1QA 1VZQH 1DWDH 1FN8A 1Z71A 3UWJH 3GY6A 1QRZA 2HVXA 2SGAA 4CREA 3MH7A 1HAVA 1JIMA 1HCGA 2F3CE 2IPHA 1GBCA 1HAPH 1WOFA 4INLA 1P10A 2G8TA 1QL9A 1QB9A 2GMTB 3ITIA 3MNXA 4VGCB 4UFGH 5C5OA 3AAVA 4MNXA 1JXPA 1KXFA 3GICB 4GSOA 4H6TA 5B6OA 1O3BA 3P92A 4KTCA 1AN1E 2XTTB 1O2RA 2PHBA 3RM0H 5FAHA 1GVKB 2C8XB 5ETXA 3MMGA 2PKSB 3TNSA 5GWZA 4X1RU 3T25A 1GJ7B 1O33A 1T32A 8GCHF 1EPTB 1NRRH 5ABWA 2VWNA 4AFZA 1SGPE 2P8OC 4X0WU 3M36A 2RA3A 2GT8A 1IQHA 2BD3A 5JBTA 3P8FA 1CGJE 4YOIA 2BZAA 3MNBA 3PTBA 1TGTA 1QBNA 1SHHB 3TGKE 4X2YA 1ESAA 3URCA 1J9CH 3GCHB 1Q2WA 2Q6FA 4Z0KA 3RU4D 2SGPE 2BD8A 3ZZ7A 2BDGA 3SU5A 4I33A 3P8NA 5EQRA 1O32A 3SJKA 3BTME 1G37A 1DICA 3NPSA 2BD5A 1KXCA 1ZTKA 2BD7A 4A92A 1P05A 1GBLA 3SGQE 1L0ZA 4ZROA 2C8ZB 1NZQH 1TPAE 3W94A 1CHGA 3MH4A 2RG3A 1MAYA 1O3IA 3ESTA 5F8TA 4KGAA 4FUBA 1THSH 1HV7A 3QX5H 2VGCB 1O37A 3RXLA 1BHXB 3FFGA 1S82A 5FBEA 1YF4A 1KY9A 2Z9GA 4X2WA 7GCHG 1FAKH 5EXLA 3SQHE 3BTKE 1C5RA 1ANCA 1SGDE 1GBAA 1ZR0A 2B7DH 1P3EA 4CH8B 2BLVA 4D76A 2OINA 2TPIZ 3TGIE 1NROH 2D1JA 1V2KT 1O3HA 3F9EA 3P8OA 4K3JA 3L3TA 5FXLA 1AUTC 1ETRH 4DJZB 3FZZA 4GLYA 2R3UA 3B9FH 4BXSA 3ZZ4A 4BANB 3SQEE 2I6QA 1PPFE 1EOLA 1GCDA 3S9BA 1O2JA 3A83A 3RXCA 2GGVB 3QN7A 4K8YA 1YPGH 1GJAB 3SZNA 2FTLE 1LDTT 1MKXK 2ZNKH 3SNCA 3RXUA 4ZXXH 1WYKA 2J95A 1ELTA 1L4DA 2TGAA 1HJ8A 1S0RA 4ABHA 1WTHD 4CRFA 1FJSA 1XUGA 1GBJA 5C5NA 1GI8B 1GI7B 2EI7A 3OY6U 1IQGA 1H9HE 4Y0YE 4ZMAH 4B2AA 1KLJH 2XYAA 1GHWH 2YOLA 2SNWA 1NO9H 3M7UA 4YTAA 1A7SA 1OWKA 2XBYA 5C1UA 3QZRA 1ZHPA 3K6ZA 4GAWA 3P70B 3D49H 1LTOA 4LOYH 3A7WA 1O3PB 4WVPE 1ZGIA 2QCYA 1Z8GA 2R3YA 3SOSA 3TPIZ 2ZGBH 2ZU1A 2FO9A 1SB1H 4NSVA 3ZZ6A 1YPEH 1UTLM 2BHGA 1KDQA 2Y5GA 1JMOH 1V2NT 1QNJA 3L6PA 1ELAA 1GHYH 1AWHB 1YC0A 1MKWK 2ANMH 1FPHH 2OBOA 1O3CA 2YNBA 1VCWA 1P2QA 1GDUA 1T8MA 1TQ0B 3Q77A 2ZZUH 1PQ5A 1LHCH 4TY7A 2O9QA 1AVXA 3KNXA 2ZF0H 3U8TH 1T4UH 1SGNE 4MPWA 1ZRBA 1D3PB 1O5CB 2FI4E 4MPXA 2DUCA 2Y7ZA 3MWIU 4TWWA 1C5TA 4X1PU 3FP8E 3VGCC 3PV4A 3UOUA 1Y5AT 1OWHA 3PMAB 3SU1A 1RTKA 3MOCA 1NU9A 4ZKSU 2HWLB 2GCHG 3HGNA 7ESTE 3U98H 5H4IB 1LQEA 3VB3A 1MTNC 2A7CA 4ASHA 1BQYA 1DFPA 1H1BA 3EQ0H 3TK5A 3MO9A 4XBDA 4RSPA 1FONA 1S6HA 1AKSA 1C5LH 3UR9A 3FZDA 3ZZ8A 1AQ7A 1C1MA 2VIQA 1O3DA 1AU8A 1AZ8A 2O8WA 2CN0H 2DE9A 4CHAB 4I8GA 4NFEA 5A0AE 4Q7YA 1D3TB 2ZPRA 3LOXA 4OS4A 4HFPB 2PUQH 4Y6DA 5GJ4B 1T8NA 1LHEH 2QAAA 1G3DA 1UVTH 1UTKA 4GCHG 2ZC9H 4OS2A 1WUNH 2OUAA 3MTYA 1GMDG 2XC0A 3AASA 5DP7A 1E35B 4DOQA 1YCPH 3BEIB 1J16A 3E16B 3MFJA 1GJDB 1BTHH 3RXJA 2XCFA 4YZUA 4OS5A 5GPIB 4D9QA 3UR6A 1L2EA 1C1NA 1C1UH 4AGJA 1ZZZA 4OS7A 1C9TA 3G01A 1YPJH 1FUJA 8GCHG 2BXTH 3SJ8A 1GHVH 2V0BA 4TYDA 1OWIA 1TPPA 1ABIH 1MTWA 2A1DB 2LPRA 3MU8A 1MCTA 2LNCA 2FPZA 1EP6A 2P8OB 3UPEA 4NIXA 1GBDA 1DM4B 1SG8B 1A3BH 5J4QA 2XRCA 3BTQE 2TGDA 1AE8H 4IN2A 4DY7B 3RUOA 3U1IB 1SQOA 3MHWU 3ATKA 1O30A 4X1SU 1QBOA 1QRWA 1MBMA 2CGAA 3E6PH 5HM2A 3U8OH 2VJ1A 5LGOA 1QB6A 1IQMA 1L1GA 1DWBH 1BRUP 2A7JA 2WYJA 2BLWA 5DJ7A 3EAJA 1PQAA 3A8AA 3ZYEA 2Z9LA 1P06A 1P2OA 1ZRKA 3PWCA 2BDIA 5CHAC 4AG1A 2P16A 4X1NU 3E1XB 3ATMA 4FUCA 4TWYA 2ZTYA 1CBWC 3OSYA 5LH8A 1NPMA 1OOKB 2FM2A 2ODQA 3RLWH 4THNH 2QF0A 2QXHA 4WXVA 1HIAA 5G4BA 3T28A 4JK6A 5AF9H 4FU9A 3SJOA 2QN5T 3Q00A 2F9PA 3U1JB 1ZGVA 2CF8H 3BF6H 1YP9A 3K9XB 3TH2H 4CRGA 2ZWLH 3ZYDA 2UUYA 8ESTE 1AZZA 1BMAA 1KLIH 1KLTA 4Q7ZA 1K1NA 1KXDA 3M7TA 3U8RH 1HAYB 3F9GA 3BSQA 1E37B 1DITH 1L1NA 3PLKA 1KTSB 1DOJA 1SR5C 1GGDC 4I7YH 2PSXA 1CGIE 1RXPA 5SGAE 3HATH 6GCHF 1W14U 1MU6B 1TMUH 4JK5A 1SLXB 1YPHE 1T4VH 3MU1A 2ZU4A 3VB7A 1UCYH 2ZTXA 3O8CA 1XVMA 2WV5A 1HRTH 1GJ5H 1V2MT 1SGYE 1TOCB 1F0TA 3PMHB 7GCHF 2FMJA 5EXNA 2QXIA 4GHQA 3ZZ9A 1O2ZA 3ZZ3A 1C5XB 1EJMA 2BXUH 1O3NA 1O5BB 2QXGA 3SV7A 1W2KH 1OKXA 3KEEA 4FUFA 5EG4A 2ZFRH 3A86A 1BTZA 1QFKH 2AGGX 2FDAA 1C1RA 3T26A 1C1PA 1XKAC 3QGNB 5DGJA 1YLDA 1ELCA 2ZA5A 1LQDB 1S0QA 1B7XB 2FODA 1EASA 4GPGA 4DG4A 1THPB 1P02A 3ATLA 1GCTC 2AIPA 1DUEA 3SI4H 1D9IA 7LPRA 1K28D 1RIWC 3GY2A 3SUFA 1ESTA 2A2QH 4I8JA 1ORFA 3JZ1B 2Y5FA 1AUJA 3F9HA 2R2MB 1E36B 4Y8XA 1NT1A 1ARCA 1XM1A 2XWAA 4YESB 1FY4A 1ZSJA 3UIRA 3K65B 5K7RA 4YT7H 1O2LA 3A7TA 1TNIA 5AFYH 2JETC 1QA7A 3QTVH 5JB8S 3LGVA 1AKSB 1KYNA 2PTNA 4JZDH 3NUMA 3BTDE 2OBQA 3A80A 5HXFA 1WV7H 1N8OC 3ATIA 4XOJA 1HDTH 1WTGH 3RMLH 5EU8A 2ZDAH 4UFFH 5DG6A 1TNKA 1YPLH 2EI8A 1LHFH 3CENA 4KKDA 1NESE 1PFXC 1HBTH 6LPRA 5C3NA 4UEHH 3VGCB 1YBWA 1GPZA 3Q76A 5PTPA 1XX9A 4UDWH 2ZFPH 4HI3A 4YOGA 1TYNA 1BIOA 1MTNB 1KXEA 2FLBH 3O8BA 3WY8A 1XUIA 4NSYA 2SGFE 2P94A 3GY7A 5LPRA 2GKVE 3QZQA 1B5GH 2NU0E 3MH6A 2FI3E 1CT2E 3RMOH 3I77A 5F8ZA 1P0SH 2FOGA 4DT7B 5HGGA 2B0FA 2F9OA 1BZXE 1HYLA 2XW9A 1ELDE 1Y3VA 2CF9H 2HNTC 1AMHA 2P59A 2ASUB 1P03A 4X2VA 4Y7BA 1EJNA 5EQSA 5IDKA 3SHCH 3UUZA 4JZEH 3MYWA 4GUXA 1YKTA 1IQLA 2GCHF 2A4OA 2C90B 5DP6A 1O2IA 2A4RA 1TLDA 4X2XA 4TPIZ 3BEFB 2SGQE 2ZCLP 2IJOB 5GCHG 2B9LA 2R2WU 1GI6A 5E2OA 2HGTH 3K2UA 1SGEE 1UK3A 1TRNA 1P04A 3Q3YA 1A46H 1JOUB 2H6MA 3KCGH 2FX4A 2A4GA 2XCNA 5JBCS 1SL3A 4I8LA 4CRAA 2FOMB 2ANKH 5DKMA 1FY1A 1LKAA 1ZMJA 1XXDA 2A45B 1W8BH 2Z3DA 2QF3A 3A88A 2CHAC 1OP0A 1ZHRA 1ZMLA 2W3KA 3RXBA 3I78A 5FCKA 3V3MA 3A7XA 1O2YA 3BIVH 4A1TA 1V2LT 1C2DA 2BY5X 2GP9B 3GCTG 5DP4A 4A1VA 4GCHF 1DX5M 1V3XA 2C8WB 3KGPA 1GMDF 3S9AA 1ETTH 4AYVB 1S84A 3TVJB 4AB9A 1H9IE 1O39A 1SVPA 1ZPCA 1PPGE 4NWLA 1ZOMA 4M7GA 5E0HA 1S85A 3TK6A 3GY8A 2FTMA 1CVWH 1K9OE 5L2YH 1DY8A 3F1SB 1WU1A 1UK4A 2QIQA 4RN6A 1DUAA 2PV9B 4X8VH 1TX8A 3M3VA 1GJ4H 1C2HA 2Y5HA 5CHAB 4U01A 2ZFQH 1K1LA 1P2JA 3O8DA 1K22