1EJNA

Urokinase plasminogen activator b-chain inhibitor complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title (4-aminomethyl)phenylguanidine derivatives as nonpeptidic highly selective inhibitors of human urokinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejnA01
4MNXA 1IHTH 2P59A 1DT2A 1MH0A 1J17T 3M5OA 1LPKB 4X1NU 1CGHA 1ANEA 3VB6A 3T2NA 3QTVH 1HB0B 1FI8A 2BY5X 4WJG2 4D9RA 1AKSB 2FOFA 1BOQA 3QK1A 1HAOH 3SUEA 4FU7A 1UVTH 2NU4E 3ODDA 5GPIB 3U1IB 1DUAA 3B23B 1MKXK 1Y3YA 4NSYA 1VITH 1GBTA 1ZYOA 1FLEE 1ZLRA 5EW2H 1P11E 1YYY1 5HM9A 4NIVA 1TWXB 3RXQA 1F7ZA 1SFQB 5DP8A 1FIWA 2C8WB 4GHQA 1C5MD 5L2ZH 5EXLA 5JBCS 4K3JA 1LPGB 2UWPA 3KL6A 3OY6U 5TCCA 4UONA 2C4FH 2Z7FE 3E0PB 3QDZB 2EEKA 4OS5A 5FXLA 4AFSA 2PKAA 2PKSC 4D76A 5A8YA 2CV3A 4FUIA 1C9TA 5FCKA 4D8NA 5HM2A 1N6YA 4XBBA 1W10U 2TPIZ 4O97A 3EYDA 1GCDA 5GXPA 1C2FA 5C5OA 2GV6A 1C1RA 4K60A 3ZZAA 2BQWB 1GHAF 5JYIA 3RUOA 2WINI 2BZAA 5C1UA 1EXFA 3P17H 4TWYA 3SBKA 2XBWA 1ELTA 4B1TA 3U9AH 1ZJKA 4XFQA 2Z9JA 2J38A 3SI3H 1CGJE 1DANH 2PSYA 4X8UH 3Q00A 7LPRA 4FUDA 1SGIB 4FU8A 1CA0B 2Z3CA 4DY7B 1VGCC 1AWHB 2B7DH 1KSNA 1DXWA 2VWLA 4DGJA 1GBCA 3HKJB 3BF6H 1HV7A 1UK2A 4JYUH 1HLTH 1W11U 2UUKB 4RKJB 2AYWA 4ABDA 1RTKA 2A4QA 1TAWA 1Z6EA 1V2UT 1S5SA 2FI4E 2BQ6B 3GISB 4GVUA 2H9HA 4R8TB 1GCTC 1O2SA 1FNIA 1V2KT 1Z8GA 3Q77A 1ELAA 1ESTA 2FP7B 1DVAH 2QXIA 1GJBB 1PPZA 4LOYH 3ATWA 2ZZUH 2A2QH 5EW1H 4BAMB 2P93A 2A32A 4DOQA 2QF3A 1DWBH 3K2UA 1TA2A 1DFPA 3C27B 1TLDA 5A0CA 1HAPH 1PQ5A 1NRRH 3P8NA 1YCPM 4PROA 3VXEH 1F0RA 3M3VA 1K1IA 2XYAA 1O5FH 5LPFA 1QBOA 3RDZA 5DP5A 4GAWA 4I8LA 3V7TA 1OKXA 3I78A 1G32B 1QQ4A 1C2GA 1ZSLA 2SGAA 3RLWH 1E37B 1C5YB 2WYJA 1P2NA 3A87A 5C1YA 4X8VH 5F8ZA 1DICA 1S85A 2DE8A 1K1OA 2BY7X 3R3GB 1H4WA 1AGJA 4ZKNU 2O9QA 2F9VA 2PGBB 3LGYA 3RXKA 2F9OA 1HXEH 2B8OH 4YLUA 3TGIE 2VGCC 1DXPA 2D1JA 2XCNA 3UWJH 4D7FA 1TGBA 3MH4A 2OC7A 1RTFB 2J2UA 4X8SH 5AF9H 2AH4X 1C1UH 1WV7H 3SN8A 4HZHA 4TY6A 4FUHA 1IQMA 3RXAA 1V2TT 1C4Y2 3BTQE 1PPEE 2EI6A 2GV7A 3P8GA 4Q2KA 1UTQA 3SZNA 3MMGA 5FPSA 1YPJH 1EUFA 4BXSA 1GBBA 2P8OB 2FYQA 3QGJA 4MNVA 1HJ8A 2FOCA 3RMMH 3ZZBA 1E34B 1SR5C 4AG2A 4K1EA 1C1NA 2CN0H 4I32A 1LVBA 3MNSA 3T5FH 2RCEA 1V2PT 4MVNA 3SO3A 4H6SB 2OD3B 3UOUA 3ZVCA 3MYWA 2CF8H 1YPLH 1ZGIA 2GMTB 1ZPCA 2FEQH 2F9BH 1SPJA 3GDSA 1Y5UT 4INHA 3F9HA 1EB2A 2ZDKA 1ARBA 1W0ZU 1HDTH 1GBFA 3MNBA 1HJAB 1MZAA 4NIYA 3SGQE 1O5GH 1GMDG 2AGEX 1SLWB 4CBOA 5PTPA 1RTLA 3NZIA 3A7TA 1TOCB 3BSQA 3PWCA 1GI7B 4K8YA 4A1TA 4A7IB 1LVMA 3RXUA 2O8LA 2A2XH 4KTSA 3ZYEA 4ABEA 1C2DA 1TONA 4WH6A 5CHAC 2QA9E 3RXTA 3RXDA 1BJVA 3V12A 5A2MH 1LDTT 3SV2H 2FLRH 1GJCB 2UUJB 3SJOA 1H8IH 3E1XB 1N1LA 4A92A 1FAKH 2QYIA 3MU0A 1CE5A 1H9LB 3FZZA 3QZQA 4ZMAH 4AFQA 1CT0E 1BMMH 1EOLA 2QC2A 4BNRA 3BTME 5F03A 1C5VA 1SG8B 2RG3A 1W7GH 1SSXA 3ESTA 4ASHA 1A3BH 2OINA 5JBTA 4WXVA 1TBRH 1S81A 3KGPA 4WWYA 3GCNA 1H8DH 2BVSH 4I31A 4ABBA 3A83A 2Y7XA 2R9PA 3B8JA 1WQVH 1YLDA 3L33A 3URDA 5BRRE 1QBNA 2JETC 3NKKA 4E7NA 3PV4A 2FOAA 1O2MA 1BCUH 3GY2A 4YESB 1P8VC 3OSYA 2IOTA 1TBQH 3BIUH 2V0BA 1AVGH 1XUJA 1Z71A 3EA8A 1P9SA 1PYTD 4K8BA 2AGGX 2QAAA 2AMDA 4E7RG 1WCZA 3HATH 4ZROA 4ZH8A 1FXYA 1NY22 1NS3A 2GX4A 1Q31A 1LHFH 3BEIB 2ESTE 1CT4E 1QB1A 3U1JB 2ZG0H 1C4V2 1TQ7B 4A1VA 1GBDA 4TWWA 2WPMS 1Q2WA 5DP3A 4GLYA 2GT8A 3BTGE 1W7XH 1SOTA 1LQDB 1V2VT 1KLIH 2Y5GA 2QXHA 3PROA 1O34A 3U8TH 4ABIA 1C1TA 3UFAA 2ZGBH 2PKSB 1Y3WA 2FMJA 2VH6A 4AB9A 4AZ2B 1FZZA 3D62A 3UWIA 4Q7ZA 1QFKH 2GP9B 4UEHH 1V2JT 1NO9H 4ABAA 3SNEA 2BDIA 2ZQ2A 4BAQB 1GBHA 1TRMA 1B0FA 4IC6A 1TA6A 1EAXA 1EOJA 1EX3A 1ZZZA 2Y80A 2ZHQH 4FUEA 4Y7AA 1ZHMA 4MNWA 2A1DB 1PPBH 1SGCA 2FESH 4X6MA 3VPKA 2O8WA 1C5PA 1HIAB 1P9UA 2FS9A 4JCNA 2ANKH 3KEEA 2XC5A 1VGCB 4INKA 2EI7A 1GHAG 1E38B 1K9OE 1FAXA 1MKWH 1AN1E 1QURH 3GY7A 1P05A 3ELAH 4Z6AH 2QY0B 1NFUA 1SOZA 5FX6A 1EP6A 1GI4A 4K1SA 3ZZ3A 2ZFPH 3P8OA 2B5TB 5IYTA 4X1PU 1QB6A 5E2OA 4AG1A 1ZTLA 5JPMH 2P3UB 1C1PA 1Z1JA 3D49H 3LGVA 1W8BH 1SGNE 1GCTB 1EAIA 1RS0A 3QUMP 1NN6A 1C5TA 1BTUA 1SLXB 2ZECA 3NWUA 5E0GA 1KTTB 5GCHG 4DIIH 1SLVB 2V3HH 2ILNA 3A80A 4KELA 3RXIA 2ZEBA 3D23A 4CREA 3KIDU 3HGNA 4B2BA 4MG3A 3P6ZB 3ZVBA 4YOJA 2EC9H 2TRMA 1SGTA 5K7RA 1O3IA 3SQHE 2RA0A 3TGKE 2WPLS 1SVPA 2R0LA 2WV4A 4KTCA 2FOHA 3E0NB 3ZZ9A 1O3LA 5JBAS 5JB9S 1LMWB 1WQSA 1KXEA 2G81E 4CHAB 4NA9H 1FY3A 2F9PA 2VIOA 1C4U2 2BD8A 1D6RA 1VZQH 1QIXB 2BY6X 4NZQA 1O3AA 1W13U 2WPIS 3H7OA 1O2LA 4UFFH 1GJ6A 3NCLA 2BDCA 4AYYB 3S0NA 1ZMLA 2VIPA 4CRDA 1A7SA 3SU2A 4VGCC 1NFYA 1MQ5A 1BTPA 1ORFA 3BG8A 2OBQA 1HNEE 2ZGJA 2ZDNA 1K1LA 1JBUH 1C5RA 2FDAA 1G3CA 1BUIA 5EU8A 1FPCH 1BMAA 3TU7H 1C9PA 2VGCB 2XC0A 9ESTA 2VVVA 5GWZA 1GI8B 4BAOB 2ZWLH 1ZHRA 3WY8A 3LH3A 3STJA 3KQBA 1G3EA 2HNTC 1O2OA 1G9IE 2F9UA 3RXRA 4BTTB 1HJ9A 3IG6B 2ZHWH 3K6YA 2AFQB 4JZDH 1C5OH 4D9QA 1F0UA 1O2KA 2VNTA 1A46H 2KAIB 2ZGXH 1SB1H 1TMTH 3OTJE 3KCGH 3VB3A 3QGNB 2WPKS 6GCHF 3SNCA 3MNCA 2P3TB 2IN2A 3ZZ4A 1W12U 2FZZA 2ZTZA 1BA8B 3PLKA 1K1JA 1DY9A 1SL3A 5HGGA 3DT0H 3BTKE 1CHOF 2FOEA 4Y10E 1O2NA 2ZO3H 3PTBA 3TNSA 1TFXA 3BTHE 3EA7A 1ELEE 1UVPA 1DPOA 1O5AB 3KNXA 1UHBA 3QLPH 1A5GH 1AKSA 2CF9H 4CRGA 5LH8A 2C8XB 2ZNKH 1A3EH 7ESTE 3A7XA 4JMYA 1EB1H 4ZUHA 1ZSJA 2ZPSA 2STAE 1C5LH 2EA3A 2OCVB 1V2OT 2YNBA 5DP6A 2VVUA 1VR1H 2AIPA 2BD3A 2PR3A 4XDEA 1TYNA 3TJOA 2FS8A 5CHAB 2AIQA 1GJAB 2GZ7A 1ZOMA 2UUFB 3RM2H 3A86A 1ETRH 2FLBH 3TVJB 1W14U 1AUJA 1T8NA 1FN8A 1UVUH 2V3OH 5EGMA 1P2OA 2PUXB 4SGAE 2Z9GA 2Z9KA 1LTOA 2BX4A 4CR5A 1EPTA 1DITH 1O32A 2JH6D 4I8JA 2PFEA 1ELCA 2VIQA 1LHEH 2ALVA 1TPOA 4I7YH 4BXWA 1TMBH 5H4IB 1C5QA 1QB9A 5E0JA 1GHWH 3LU9B 1YPEH 5JB8S 1O2UA 3EQ0H 2GCTC 3LC5A 2FX6A 3HPTB 4ISIH 1PYTC 1GDUA 3ZZCA 2SGDE 2ZF0H 1O2PA 2DUCA 1J16A 2PSXA 2JETB 1HCGA 4ZKRU 2VWOA 4NIXA 4U2WA 3T27A 1V6DA 2HRVA 1RGQA 1PQ7A 3MOCA 4IW4E 3E6PH 1GVKB 3E16B 3Q76A 2A0QB 2WV5A 1O3DA 3KF2A 3OY5U 3SNAA 2G4UA 1TGNA 1TNGA 1O5BB 1KLJH 3DUXH 3NPSA 1HPGA 4Y8ZA 5DO4H 1Y59T 2FIRH 2G52A 3FFGA 4WH8A 2ZPRA 4X6PA 8GCHF 1SQTA 4CRFA 4Q80A 1MAXA 1ZTJA 4IBLH 5DP9A 1GPZA 5HMAA 1VITG 1OWDA 1PPHE 1OWKA 3E90B 3OU0A 4GSOA 2VJ1A 3BEUA 4FUFA 3RXVA 2VU8E 3L6PA 2OUAA 1OX1A 1NRPH 2AS9A 1GHBF 2GT7A 1K1PA 2PTCE 3UY9A 2XW9A 3M5LA 3SOSA 4NA7A 3PTNA 3UREA 1X7AC 2SNVA 3M3TA 4TYDA 1DOJA 3UQVA 1AO5A 2WPHS 1SC8U 2BLVA 3SV7A 1WAYB 2Z9IA 4MNYA 4IGDA 2ZDLA 4M7GA 1G30B 5GCHF 1XX9A 1A0HB 1V2QT 4Y0YE 4YOGA 3SV9A 3GY8A 3ZZDA 1SGRE 1GWAA 1C2JA 1CVWH 5DGJA 1AU8A 1NFXA 1DDJA 2NU2E 1BITA 1ZSKA 2VB0A 1HAZB 1VCWA 2GZ8A 1L4ZA 1XVMA 1QY6A 1VCPA 4QT8C 1KXAA 4F49A 3M36A 4ESTE 1GI6A 3RU4T 2OBOA 2ANMH 1GMHF 3A7YA 4UFDH 4XBDA 1EAUA 1EKBB 2WPJS 3GOVB 4UE7H 4ZKSU 4LZ4B 4NSVA 3M5MA 1ACBE 4NFFA 2R2MB 2QN5T 5A09A 2H2ZA 3KHVA 2ZDMA 2P3FH 1QL9A 1FY8E 2G4TA 3MU1A 1FIZA 1ABIH 5LPEA 1WBGB 2XXLA 1SGFG 1XUHA 1S0QA 3C1KA 4JK6A 3T29A 1V2RT 2ZIQH 4K69A 1K22H 5EOKA 4YT6H 3UNSA 3MH6A 1SQAA 3FP6E 2HPQH 1QRZA 1AIXH 4FUCA 3RMNH 2NWNA 2FO9A 1W2KH 3TJUA 1GJ7B 1P01A 2RDLA 2Q6FA 1G37A 2ZU2A 2G55A 3SV8A 1OYTH 5DPAA 5L30H 2FODA 3A8DA 2DE9A 1P0SH 1EP5A 3ZZ8A 2OC8A 1ZPZA 4ISNA 2F3CE 4I8GA 2FTLE 1TX7A 3PB1E 1RD3B 2GTBA 1G2MA 4X2WA 1Y3XA 2AMPA 2ZHDA 3QX5H 3PO1C 4TPYA 4A1XA 3TJVA 3Q3XA 2ZA5A 4XE4A 3UNRA 1ZHPA 1OP2A 2P95A 3RMOH 5T3HA 1Z6JH 1GMCF 2XNIA 4VGCB 1KDQA 2Z3DA 2OTVA 4IN1A 2Z9LA 3BV9B 1N8OC 1J15A 2ZI2H 1NM6A 4ABJA 3LIWA 1ZPBA 5B6OA 1AHTH 1DLEA 1EJAA 4DIHH 1XVOA 1NU9A 1LHCH 2FWWA 2A5IA 1CBWC 1O3BA 4JZFH 1JRTA 4X2YA 2BDGA 1IHSH 2SGPE 1NROH 1P2KA 1P12E 1UTPA 1C5SA 3PLPA 2YOLA 1ANBA 4SGBE 4NG9H 1GDNA 2J9NA 4ISHH 2HLCA 3V3MA 1W3CA 4YZUA 1SGYE 1V2LT 1BDAA 1MTUA 1GDQA 1TALA 4BAKB 2P16A 1Z1IA 3G01A 2GD4B 3KN2A 3P92A 3LOXA 3SGBE 3UUZA 5CMXH 1ZMNA 2J34A 1LHGH 4B71A 4R0IA 1W0YH 1HAVA 1FDPA 1BT7A 1TMUH 3RXLA 1DWEH 1O38A 3UTUH 5L6NH 3F9GA 3MNXA 3TK5A 4B75A 4I8HA 5AHGH 2A4GA 1DSTA 2AERH 6GCHG 3FZDA 1KXBA 1NT1A 2BLQA 2XWAA 5FX5A 1QJ1B 5LPRA 1BRUP 2ZDVH 1GHZA 2JKHA 3M7QA 4WMDA 1MTVA 2ZU3A 1PFXC 1THPB 3A8AA 5E8EH 4B2CA 3VB5A 1AFEH 2FYRA 1A5IA 2A7JA 1HGTH 3TPIZ 1CHOG 5F8TA 3ODFA 1O3PB 3LH1A 1OXGA 2BY9X 1LVYA 2BLOA 3MU8A 1HAIH 1V2ST 4ZXYH 4FVDA 1YGCH 1P57B 3MI4A 1KXDA 2HNTE 3VXFH 1C2EA 4OS4A 2J95A 3KQCA 1VITF 5SGAE 2W3IA 3MO3A 2ZHFH 5F6MA 3PMJA 4YTAA 3FP8E 3BN9A 4LXBH 2Y5FA 1HXFH 4JZEH 3HK6B 1O3CA 4B73A 5EXMA 2ZCKP 1UTOA 1P3EA 4O3UA 1DLKB 3BEFB 2GCTB 4O3TA 3AASA 1A2CH 3JZ2B 1C2KA 2BMGB 1SLUB 3A7VA 3S9AA 5FHTA 1FQ3A 1EAWA 1YCPH 1BMNH 2BTCE 4RN6A 2O8UA 4FUJA 2ZKSA 2Z3EA 2TBSA 1RXPA 2ZGHA 1EPTC 1GI0A 3PYHA 1AB9C 4JK5A 1HIAA 3T26A 3TNTA 1GJ5H 4NZLA 1B7XB 1DX5M 1QA7A 4BAHB 1O3NA 1QCPA 1MUEB 2ZU4A 5BPEA 2BD7A 1YF4A 1IQEA 2XBVA 2JH0D 3ZZ6A 1TIOA 2Q1JA 3SJKA 1BQYA 2NU3E 1S0RA 4HI3A 1CQQA 1DY8A 1JIMA 3LDXH 3O8CA 3GCHC 7GCHF 5HXFA 1TX6A 3F9EA 4Y8YA 2H9TH 4F4OC 3EGKH 1U6QA 2H5CA 1GG6C 2PTNA 2ZCHP 4DT7B 3SU6A 3U98H 2VH0A 3M5NA 5CE1A 1QNJA 4AYVB 6LPRA 1P3CA 8GCHG 3GY5A 4FVBA 4AGKA 2QV1A 4Z0KA 4LZ1H 2B0FA 3GY6A 4ABGA 2W7UA 5C67A 1HBTH 2HGTH 3DFJA 1XUKA 3T25A 1ABJH 2F9NA 1B5GH 1ZRKA 1C1OA 4YT7H 1JMOH 3RP2A 3UQOA 1GHBG 2XWBI 1TPSA 1SGFA 2R2WU 3GY4A 3PMBB 4UFEH 3PMAB 1YCPK 1IQHA 5F8XA 3MFJA 4ISLA 3BTTE 2THFB 4B76A 4GCHF 1IOEA 1P02A 1MTNC 1QL7A 1K1NA 1KYNA 2BD5A 2ANYA 4Y79A 3SGAE 2ODPA 1GBEA 2PWXA 2STBE 3TK9A 2BY8X 3H7TA 2BX3A 2LNCA 3GYLB 1NFWA 2TGPZ 3ZVGA 3ZZ7A 3E3TA 1GI9B 2A5KA 2ZC9H 1F5LA 5ABWA 1P03A 3FP7E 2OP9A 2VIVA 3MH7A 1GI3A 3SQEE 4AORA 3ATMA 3A84A 1MU8B 2C3SA 3ZVAA 1H9HE 1OP0A 4Y0ZE 1AD8H 3LGUA 2SFAA 1FUJA 2CJIA 3RXCA 1GMHG 3ZVDA 1KY9A 1RFNA 1O3HA 3CS7A 5C20A 2J92A 3RC5A 4DJZB 1EJMA 1S84A 1G3BA 3LGIA 3RC4A 2CHAC 4INLA 1O37A 3SJ8A 1ANCA 1SFIA 1IQLA 3HK3B 3FVFB 2VINA 3N7OA 1C5WB 2GGVB 1O2WA 3MH5A 2C90B 4NCYA 2D2DA 1YPGH 1ANDA 5FCRA 1E0FD 2Y6TA 1Z8JB 4B2AA 1YPKH 2AGIX 3UR9A 1FONA 5E2PA 4LK4A 5ESBA 1AZ8A 3KQDA 4IC5A 3A8CA 1THSH 4BOHA 2ZHEH 1BTZA 3SU5A 3PO1B 1MD7A 2LPRA 2G5VA 4Q7XA 2WUCA 4X2VA 2VWMA 3ATKA 1ETSH 2ALPA 2ZCLP 1DWCH 2C8YB 2CXVA 3GY3A 4X2XA 1SGQE 1BMLA 1N8OB 1GBJA 4CRAA 3DD2H 2ZDAH 1FN6A 2OLGA 1QBVH 1C2IA 4U32A 1GGDC 3VEQB 1LKAA 1ID5H 1IQNA 4Y76A 3OYPA 1IQJA 1CBWB 1EZQA 2HOBA 2K1QA 1NU7B 3Q3YA 5EXNA 1QRWA 3RXMA 2WUBA 1GMCG 2V6NA 4OS2A 3CS0A 2ZFTA 1MAYA 1HAHH 5K0HA 4IS5A 4WF8A 1O0DH 5DKMA 1T7CA 3LJOA 1O31A 1TGSZ 2PLXA 4ZHMU 4BANB 4HTCH 1J8AA 1ELFA 4X8TH 3U8OH 1E36B 3HKIB 4J2YB 1NRSH 1QTFA 3M61U 3VGCC 2H9EH 1BTHH 2D26C 2G5NA 4CR9A 4DURA 1F0TA 2A5AA 1GBIA 1TX8A 3CENA 1JIRA 2ZP0H 1ESAA 5IDKA 1AE8H 1C5UA 5TCAA 1EASA 2VVCA 1BRAA 1ZRBA 2ZU5A 5T6DA 3M7UA 1O2GH 2FTMA 1P2JA 4WMEA 3T28A 1O2VA 1DUEA 2W3KA 2HWLB 1K2I1 3PM3A 1TABE 3TH3H 1C5XB 3NUMA 1LVOA 2BOHB 1D3TB 1T8MA 2H1UA 2PGQB 1O3OA 2BZ6H 1SGPE 5LGOA 1RRKA 4KGAA 1N6XA 1Y5AT 3V13A 1JOUB 3SV6A 2BOKA 3GCTF 1BRBE 2Z6BD 2FPZA 1LHDH 1GJ9B 5T6GA 5A0AE 2I6QA 1A0LA 5FPYA 2Y82A 4HFPB 3EA9A 4NWKA 1QGFA 4WMFA 3ZV8A 1GHYH 1P2MA 1T4VH 1KIGH 5EPYA 3SUFA 1UHBB 1C1WH 1PJPA 2W26A 1IQFA 2ZPQA 3LGTA 3BTDE 2ZFQH 3ZYDA 1Y8TA 2JH5D 1Y3UA 1CU1A 3LJJA 2Y81A 3QZRA 2BQ7B 1WU1A 1D3QB 3SUDA 5DP4A 1TE0A 6CHAC 1K28D 1JXPA 1M9UA 1UVOA 2SNWA 3PLBA 3BTWE 1GVLA 5L2YH 1O3EA 2P94A 3AW0A 1XXFA 1PPCE 2GKVE 2C8ZB 1VJ9U 4X1SU 3KQEA 1C2LA 1NTPA 2VIWA 3MO9A 3A88A 3BG4C 2R3UA 3GDUA 2XTTB 1EPTB 1AB9B 1NRQH 1NRNH 3M7TA 4TY7A 1F5KU 4Y8XA 5AFZH 1GJDB 1C1MA 1NC6A 1XM1A 3F9FA 1XXDA 1QQUA 2ANWA 1T32A 4AOQA 3LONA 1THRH 3RXSA 1MBQA 1XMNB 3SI4H 1O33A 3GCOA 1S6HA 2BM2A 3SJIA 1Y5BT 1WYKA 2XC4A 1GI2A 2R3YA 1LKBA 1AFQC 1UCYE 1O3KA 2W5EA 4DG4A 3SU3A 4JYVH 3TLOA 1MMJN 4XOJA 1GBKA 1JRSA 3GCHB 1GJ4H 1S6FA 5J4SA 1C5NH 3UNQA 1GG6B 2A4OA 1LQEA 1O36A 4X1QU 1RJXB 3GDVA 1TRNA 1C2MA 2HALA 1O5DH 2H5DA 1TOMH 2PKAB 5I25A 1QA0A 1DM4B 2NU0E 2H6MA 1O3GA 1WTGH 4RKOB 7GCHG 5GDSH 3AAUA 4IN2A 1EATA 4XSKU 1ELBA 5A8ZA 2A7HA 8LPRA 4OS1A 1NZQH 1LO6A 1WOFA 2IPHA 8ESTE 4CH8B 1OP8A 1O2JA 1MTNB 2ZTYA 1AWFH 2SGFE 1UMAH 1KXCA 2QXGA 1YC0A 3E91A 2D8WA 2HNTF 5C2ZA 1UJ1A 1CHGA 4BTUB 1HAXB 3S9BA 2AMQA 2Q6DA 3IITA 3RU4D 3O8BA 3RXEA 2ASUB 1A5HA 1FY5A 2F91A 4HGCA 1HUTH 1UK4A 1TGTA 1BZXE 4O9VA 4Y11E 1WUNH 2J4IA 4ZHLU 4KP0A 1LPZB 1QJ7B 1BTYA 4CHAC 2HVXA 4GCHG 1IQKA 4MDSA 1ZTKA 1C1VH 1RIWC 4K2YA 4YO9A 3QN7A 1L0ZA 1FY1A 3EAJA 4UDWH 1J14A 1AI8H 2PV9B 4TPIZ 2FX4A 4NA8A 4OS7A 3RXFA 1AY6H 3SW2B 3S69A 3K6ZA 1SMFE 2ULLA 3LC3A 1NESE 2VWNA 2CHAB 4JZ1A 1TNIA 1BIOA 2QGRA 3QTOH 2BDBA 4CRBA 2BD4A 1VCQA 1V3XA 2HPPH 1KXFA 5FPTA 1BBRE 4A6LA 1GBLA 1ELDE 3ZVEA 1O2IA 3F68H 5I46H 3LT3A 3RLYH 1FMGA 3TIUA 1UTJA 1S83A 3SHAH 2F83A 1SHYA 4OGYA 1UCYH 3S7KB 1O5CB 1OYQA 4X6NA 2TIOA 1F2SE 3NXPA 1O2TA 4AB8A 1IQGA 1ELGA 5ESTE 2FI3E 5DJ7A 3STIA 1YPMH 4U30A 3ZV9A 2G8TA 1YM0A 4IMQA 1GI5A 3OX7U 1GGDB 2C93B 3QO6A 1SQOA 2VIDA 1ESBA 5C3NA 3A85A 3QWCH 3LGWA 1V2WT 3LPRA 1K21H 1OWEA 2PUQH 3ATIA 4GHTA 1P09A 1YLCA 2BXTH 3AAVA 5AVDA 1D4PB 3TK6A 2M5TA 1CSOE 1G3DA 4Y7BA 2GCHF 3RU4E 4FU9A 1OS8A 1AZZA 3MTYA 3A7WA 1O2ZA 1O2QA 1SHHB 1KDQB 1P2QA 1OPHB 2QCYA 1GBMA 2BYAX 5FAHA 3PMHB 1BHXF 2FI5E 3SORA 3TJNA 2FXRA 3VGCB 4U01A 1IQIA 1O3JA 3GYMA 1CT2E 3RXPA 1Z8RA 2BD2A 3O8DA 1L1GA 3SU1A 5FBEA 3RXBA 3MWIU 1O30A 1ZJDA 1MCVA 3UIRA 5EG4A 3O8RA 2PW8H 2BXUH 1T4UH 2BVXH 2G51A 3ITIA 4FUBA 3VB7A 4BTIB 3DHKH 2I6SA 4B74A 1EQ9A 1FPHH 1UCYK 4Y71A 3EDXB 4O03A 4YM9A 1GBAA 2ZFRH 1F92A 3ZVFA 4NIWA 1WSSH 2ZQ1A 4IMZA 1YBWA 2BVRH 3W95A 1HAVB 1Z7KA 1O2RA 1GI1A 1O3MA 3RXHA 3S9CA 1MTWA 1H1BA 1P04A 1EZUC 1A61H 4KTUA 3L3TA 3A81A 1YPHE 1SGDE 1MTSA 2RA3A 1CA8B 3E8LA 3SU0A 2B9LA 2FOGA 1AUTC 1AVXA 4YOIA 4ZAEA 1Y3VA 3URCA 2Y7ZA 1BBRH 1BHXB 3B9FH 4THNH 1GHXH 4WVPE 1XUIA 3GCTG 1L1NA 1L4DA 1UTMA 1O3FA 2TGDA 1HAYB 3ATLA 1DSUA 6CHAB 3M35A 4H42U 3RMLH 4NWLA 2ODYB 2OQ5A 3UPEA 3TITA 1CO7E 4DW2U 2CMYA 5EQSA 4DVAU 1QHRB 1MD8A 3M3SA 2ZGCA 1PPGE 1L2EA 3JZ1B 1TPPA 1A0JA 2QXJA 2SGQE 2XCFA 1UTLM 3BG4B 1EJNA 3BTFE 4AFUA 1QJ6B 2IJOB 1G2LA 3RXOA 3U69H 4NGAH 3TH2H 1MZDA 3A8BA 3FAOA 2OC1A 1PPFE 1L1JA 5FBIA 4Q7YA 1TBZH 3FANA 4JYTA 5EODA 4MTBA 2A45B 1BJUA 1CA0C 1T31A 4ISOA 1IAUA 1XUFA 1JWTA 4H4FA 1DS2E 5EPNA 5GIBA 6ESTA 1F5RA 3MO6A 5DP7A 3UOPA 4MPVA 1OWJA 2O8TA 5A8XA 2TGAA 2SGEE 3MHWU 2Q6GA 1AFQB 4OS6A 1TNJA 3LKWA 1UVSH 2W7SA 5T6FA 3HGPA 1V2MT 4E05H 1GJ8B 3R0FA 3A82A 4ABHA 1ELVA 4D7GA 4DCDA 1YKTA 2GVFA 1UTKA 1TGCA 1FY4A 2R0KA 1D6WA 3P8FA 1O2YA 2FOBA 3K9XB 3V0XA 2ODQA 1BBRK 3T62A 1TPAE 3SU4A 1C5ZB 1B0EA 1MCTA 1UO6A 1D9IA 5HYOA 5J4QA 2ZTXA 4GUXA 2GDDA 5JBBS 2EI8A 4ZXXH 1O2HA 1DWDH 4K5ZA 3BIVH 4MLFB 3AW1A 2UUYA 1Z8IB 4X6OA 1ARCA 3DFLA 2FOMB 4ZHAA 2NU1E 3F1SB 3UR6A 1K1MA 5GJ4B 3ENSB 4A5TS 1PQ8A 1TB6H 1TRYA 4MPWA 5A0BA 3I29A 3RC6A 2OXSA 3D65E 1SGEE 4X0WU 1OOKB 3GICB 1OWIA 2XRCA 3F6UH 4UFGH 1SI5H 1D3PB 2XBYA 2KAIA 1BTXA 9LPRA 1SBWA 2Y5HA 3TGJE 2BB4A 2ZU1A 3SNDA 1C2HA 2A7CA 4WXIA 4JZIA 7KMEH 1D3DB 1TNLA 3VB4A 1P10A 2BDYA 4CH2B 4X1RU 1VJAU 1F0SA 1EZSC 1PQAA 1J9CH 2GDEH 1ZR0A 3CP7A 1AMHA 3SJ9A 2BD9A 3P70B 3RXJA 1C1SA 1AQ7A 4RSPA 1BB0B 1MQ6A 1V2NT 5TJXA 1GVZA 1RIWB 1MBMA 2AEIH 2ZFSA 3I77A 2OC0A 4AN7A 1A1RA 2J94A 2O8MA 5DK1A 3W94A 2BLWA 3PWBA 1T8LA 3P95A 4K1TA 1BTWA 1KTSB 4KKDA 2BDAA 1HRTH 4XBCA 2UWLA 3A89A 4GPGA 5G4BA 2P8OC 3MU4A 4FUGA 3U8RH 1MKWK 1QR3E 2Z94A 1CGIE 3SHCH 1Q3XA 3MU5A 4AGJA 1GMDF 4CRCA 3AVZA 4MPXA 1FV9A 1S82A 5C5NA 3SNBA 5E0HA 4I8KA 1TQ0B 1YPHC 1LCYA 3ZZ5A 1AE5A 4CBNA 5EQRA 2A31A 2BDHA 2GMTC 3RM0H 1GHVH 3TH4H 4I33A 1UK3A 3Q3KA 1ETTH 1O39A 3NK8A 2CGAA 1MU6B 3BTEE 3SUGA 1HJAC 1HAGE 3A7ZA 1MKXH 4WY3A 2WYGA 4E06H 5AFYH 1HFDA 5DG6A 1QRXA 8KME2 1EZXC 2YNAA 1UTNA 5C1XA 1O2XA 3M37A 2G00A 4MQAA 3IWMA 2V35A 4FXGH 2GZ9A 2PHBA 1DE7H 4NFEA 5EQQA 4OGXA 1INCA 1GL1A 1O35A 2XBXA 3EE0B 3K65B 1BRCE 1TNKA 1C1QA 1A4WH 1OWHA 1WTHD 4UD9H 3RXGA 2TGTA 2OQUA 2ZFFH 4ZKOU 5ETXA 3VFEA 2QF0A 2BHGA 5JDUB 1XKAC 3DA9B 4AX9H 1HYLA 1NPMA 1P2IA 1H9IE 1OSSA 1XKBC 2QIQA 1P06A 1KLTA 1FJSA 1O5EH 4H6TA 1XUGA 1QL8A 3H5CB 4AFZA 4J1YA 1E35B 1ZGVA 1G36A 2A4RA 4YLQH 1ZMJA 3S7HB 1AVWA 2FM2A 4MPUA 4ABFA 1T8OA 2UWOA 1TNHA 4Y6DA 1YP9A 2GCHG 1GL0E
chains in the Genus database with same CATH superfamily
4MNXA 1IHTH 2P59A 1DT2A 1MH0A 1J17T 3M5OA 1LPKB 2JDID 4X1NU 1CGHA 1ANEA 3VB6A 3T2NA 3QTVH 1HB0B 1FI8A 2BY5X 4WJG2 4D9RA 1AKSB 2FOFA 1BOQA 3QK1A 1HAOH 3SUEA 4FU7A 1UVTH 2NU4E 3ODDA 5GPIB 3U1IB 1DUAA 3B23B 1MKXK 1Y3YA 4NSYA 1VITH 1GBTA 1ZYOA 1FLEE 1ZLRA 5EW2H 1P11E 1YYY1 5HM9A 4NIVA 1TWXB 3RXQA 1F7ZA 1SFQB 5DP8A 1FIWA 2C8WB 4GHQA 1C5MD 5L2ZH 5EXLA 5JBCS 4K3JA 1LPGB 2UWPA 3KL6A 3OY6U 5TCCA 4UONA 2C4FH 2Z7FE 3E0PB 3QDZB 2EEKA 4OS5A 5FXLA 4AFSA 2PKAA 4HG6A 2PKSC 4D76A 5A8YA 2CV3A 4FUIA 1C9TA 3SYJA 5FCKA 4D8NA 5HM2A 1N6YA 4XBBA 1W10U 2TPIZ 4O97A 3EYDA 1GCDA 5GXPA 1E1RD 1C2FA 5C5OA 2GV6A 1C1RA 4K60A 3ZZAA 2BQWB 1GHAF 5JYIA 2XNDD 3RUOA 2WINI 2BZAA 3DCLA 5C1UA 1EXFA 3P17H 4TWYA 3SBKA 2XBWA 1ELTA 4B1TA 3U9AH 1ZJKA 4XFQA 2Z9JA 2J38A 3SI3H 1CGJE 1DANH 2PSYA 4X8UH 3Q00A 7LPRA 4FUDA 1SGIB 4FU8A 1CA0B 2Z3CA 4DY7B 1VGCC 1AWHB 2B7DH 1KSNA 1DXWA 2VWLA 5HIZA 3WWBA 4DGJA 1GBCA 3HKJB 3BF6H 1HV7A 1UK2A 4JYUH 1HLTH 1W11U 2UUKB 4RKJB 2AYWA 4ABDA 1RTKA 2A4QA 1TAWA 1Z6EA 2WHXA 1V2UT 1S5SA 2FI4E 2BQ6B 3GISB 4GVUA 1YWUA 2H9HA 4R8TB 1GCTC 1O2SA 1FNIA 1YLNA 1V2KT 1Z8GA 3Q77A 4F48B 1ELAA 1ESTA 2FP7B 1DVAH 2QXIA 1GJBB 3FO8D 1PPZA 4LOYH 3ATWA 2ZZUH 2A2QH 5EW1H 4BAMB 2P93A 2A32A 4DOQA 2QF3A 1DWBH 3K2UA 1TA2A 1DFPA 3C27B 1TLDA 5A0CA 2J97A 1HAPH 1PQ5A 1NRRH 3P8NA 1YCPM 4PROA 3VXEH 1F0RA 3M3VA 1K1IA 2XYAA 1O5FH 5LPFA 1QBOA 3RDZA 5DP5A 4GAWA 4I8LA 3V7TA 1OKXA 3I78A 1G32B 4ACAA 1S6LA 1QQ4A 1C2GA 1ZSLA 1K0HA 2SGAA 3RLWH 1E37B 1C5YB 2WYJA 1P2NA 3A87A 5C1YA 4X8VH 5F8ZA 1DICA 1S85A 2L74A 2DE8A 1K1OA 2BY7X 3R3GB 1H4WA 1AGJA 4ZKNU 2O9QA 2F9VA 2PGBB 3LGYA 2V7QD 3RXKA 2F9OA 1HXEH 2B8OH 4YLUA 3TGIE 2VGCC 1DXPA 2D1JA 2XCNA 3UWJH 4D7FA 1TGBA 3MH4A 2OC7A 1RTFB 2J2UA 4X8SH 5AF9H 2AH4X 1C1UH 1WV7H 3SN8A 5HKKD 4HZHA 4TY6A 4FUHA 1IQMA 3RXAA 1V2TT 1C4Y2 3BTQE 1PPEE 2EI6A 2GV7A 3P8GA 4Q2KA 1UTQA 3SZNA 3MMGA 4P00A 5FPSA 1YPJH 1EUFA 4BXSA 1GBBA 2P8OB 2FYQA 3QGJA 4MNVA 1HJ8A 2FOCA 3RMMH 3ZZBA 1E34B 1SR5C 4AG2A 5EIYA 4K1EA 1C1NA 2CN0H 4I32A 1LVBA 2YMSB 3MNSA 3T5FH 2RCEA 1V2PT 4MVNA 3SO3A 4H6SB 2OD3B 3UOUA 3ZVCA 4ACBA 3MYWA 4Q4LA 2CF8H 1YPLH 1ZGIA 2GMTB 1ZPCA 2FEQH 2F9BH 1SPJA 3GDSA 1Y5UT 4INHA 3F9HA 1EB2A 2ZDKA 1ARBA 1W0ZU 1HDTH 1GBFA 3MNBA 1HJAB 1MZAA 4NIYA 3SGQE 1QZ8A 1O5GH 1GMDG 2AGEX 1SLWB 4CBOA 5PTPA 1RTLA 3NZIA 3A7TA 1TOCB 3BSQA 3PWCA 1GI7B 4K8YA 4A1TA 4A7IB 1LVMA 3RXUA 2O8LA 2A2XH 4KTSA 3ZYEA 4ABEA 1C2DA 1TONA 4WH6A 5CHAC 2QA9E 3RXTA 3RXDA 3ZIAD 1BJVA 3V12A 5A2MH 1LDTT 3SV2H 2FLRH 1GJCB 2UUJB 3SJOA 1H8IH 3E1XB 1N1LA 4A92A 1FAKH 3N99A 2QYIA 3MU0A 1CE5A 1H9LB 3FZZA 3QZQA 4ZMAH 4AFQA 1CT0E 1BMMH 1EOLA 2QC2A 4BNRA 3BTME 5GNDA 5F03A 1C5VA 1SG8B 2RG3A 1W7GH 1SSXA 3ESTA 4ASHA 1A3BH 2OINA 5JBTA 4WXVA 1TBRH 1S81A 3KGPA 4WWYA 3GCNA 1H8DH 2BVSH 4I31A 3PV5A 4ABBA 3A83A 2Y7XA 2R9PA 3B8JA 1WQVH 1YLDA 3L33A 3URDA 5BRRE 1QBNA 2JETC 3NKKA 4E7NA 3PV4A 2FOAA 1O2MA 1BCUH 3GY2A 4YESB 1P8VC 3OSYA 2IOTA 1TBQH 3BIUH 2V0BA 1AVGH 1XUJA 1Z71A 3EA8A 1P9SA 1PYTD 4K8BA 2AGGX 2QAAA 2AMDA 4E7RG 1WCZA 3HATH 4ZROA 4ZH8A 1FXYA 1NY22 1NS3A 2GX4A 4ASUD 1Q31A 1LHFH 2WZQA 3BEIB 2ESTE 1CT4E 1QB1A 3U1JB 2ZG0H 1C4V2 1TQ7B 4A1VA 1GBDA 4TWWA 2WPMS 1Q2WA 5DP3A 4GLYA 2GT8A 4FOUC 3BTGE 1W7XH 1SOTA 1LQDB 1V2VT 1KLIH 2Y5GA 2QXHA 4ZCNA 1OHHD 3PROA 1O34A 3U8TH 4ABIA 1C1TA 3UFAA 2ZGBH 2F4LA 2PKSB 1Y3WA 2FMJA 2VH6A 4AB9A 4AZ2B 1FZZA 3D62A 3UWIA 4Q7ZA 1QFKH 2GP9B 4UEHH 1V2JT 1NO9H 4XRNA 4ABAA 3SNEA 2BDIA 2ZQ2A 4BAQB 1GBHA 1TRMA 4P02A 1B0FA 4IC6A 1TA6A 1EAXA 1EOJA 1EX3A 1ZZZA 2Y80A 2ZHQH 4FUEA 4Y7AA 1ZHMA 4MNWA 2A1DB 1PPBH 1SGCA 2FESH 4X6MA 3VPKA 1C5PA 1P9UA 1HIAB 2FS9A 2O8WA 4JCNA 1MABB 2ANKH 3KEEA 2XC5A 1VGCB 4INKA 2EI7A 1GHAG 1E38B 2KCPA 1K9OE 1FAXA 1MKWH 1AN1E 1QURH 3GY7A 1P05A 3ELAH 4Z6AH 3MQKC 2QY0B 1NFUA 1SOZA 5FX6A 5HIYA 1EP6A 1GI4A 4K1SA 3ZZ3A 2ZFPH 3P8OA 2F43B 2B5TB 5IYTA 4X1PU 1QB6A 5E2OA 4AG1A 1ZTLA 5JPMH 2P3UB 1C1PA 1Z1JA 3D49H 3LGVA 1W8BH 5EJLA 1SGNE 1GCTB 1EAIA 1RS0A 3QUMP 1NN6A 2J98A 1C5TA 1BTUA 1SLXB 2ZECA 3NWUA 5E0GA 1W0JD 1KTTB 5GCHG 4DIIH 1SLVB 2V3HH 2ILNA 3A80A 4KELA 3RXIA 2ZEBA 3D23A 4CREA 3KIDU 3HGNA 4B2BA 4MG3A 4Z1MD 3P6ZB 3ZVBA 4YOJA 2EC9H 2TRMA 1SGTA 5K7RA 1O3IA 3SQHE 2RA0A 3TGKE 2WPLS 1SVPA 2HLDD 2R0LA 2WV4A 4KTCA 2FOHA 3E0NB 5C17A 3ZZ9A 1O3LA 5JBAS 5JB9S 1LMWB 1WQSA 1KXEA 2G81E 4CHAB 4NA9H 1FY3A 2F9PA 2VIOA 1C4U2 2BD8A 1D6RA 1VZQH 1QIXB 2BY6X 5IK2D 4NZQA 1O3AA 1W13U 2WPIS 3H7OA 1O2LA 4UFFH 1GJ6A 3NCLA 2BDCA 4AYYB 3S0NA 1ZMLA 2VIPA 4CRDA 1A7SA 3SU2A 4VGCC 1NFYA 1MQ5A 1BTPA 1ORFA 3BG8A 2OBQA 1HNEE 3CNRA 2ZGJA 2ZDNA 2QE7D 1K1LA 1JBUH 1C5RA 2FDAA 1G3CA 1BUIA 5EU8A 1FPCH 4TT3D 1BMAA 3TU7H 1C9PA 2VGCB 2XC0A 9ESTA 2VVVA 5GWZA 1GI8B 4BAOB 2ZWLH 1ZHRA 3WY8A 3LH3A 3STJA 3KQBA 1G3EA 2HNTC 1O2OA 2EY4C 1G9IE 2F9UA 3RXRA 4BTTB 1HJ9A 1VKYA 3IG6B 2ZHWH 3K6YA 2AFQB 4JZDH 1C5OH 4D9QA 1F0UA 1O2KA 2VNTA 1A46H 2KAIB 2ZGXH 1SB1H 1TMTH 3OTJE 3KCGH 3VB3A 3QGNB 2WPKS 6GCHF 3SNCA 3MNCA 2P3TB 2IN2A 3ZZ4A 1W12U 2FZZA 2ZTZA 1BA8B 3PLKA 1K1JA 1DY9A 1SL3A 5HGGA 3DT0H 3BTKE 1CHOF 2FOEA 4Y10E 1O2NA 2ZO3H 3PTBA 3TNSA 1TFXA 4DT4A 3BTHE 3EA7A 2AHME 1ELEE 1UVPA 3UB0A 1DPOA 1O5AB 3KNXA 1UHBA 3QLPH 1A5GH 1AKSA 2CF9H 4CRGA 5LH8A 4F55A 2C8XB 2ZNKH 1A3EH 7ESTE 3A7XA 4JMYA 1EB1H 4ZUHA 1ZSJA 2ZPSA 2STAE 1C5LH 2EA3A 2OCVB 1V2OT 2YNBA 5DP6A 2VVUA 1VR1H 2AIPA 2BD3A 2PR3A 4XDEA 1TYNA 3TJOA 2FS8A 5CHAB 2HVYB 2AIQA 1GJAB 2GZ7A 1ZOMA 2UUFB 3RM2H 3A86A 1ETRH 2FLBH 3TVJB 1W14U 1AUJA 1T8NA 2WPDD 1FN8A 1UVUH 2V3OH 5EGMA 1P2OA 2PUXB 4SGAE 2Z9GA 2Z9KA 1LTOA 2BX4A 4CR5A 2OK5A 1EPTA 1DITH 1O32A 2JH6D 3PRBA 4I86A 4I8JA 2PFEA 3KQ5A 1ELCA 2VIQA 1LHEH 2ALVA 1TPOA 4I7YH 2LP6A 4BXWA 1TMBH 5H4IB 1C5QA 1QB9A 5E0JA 1GHWH 3LU9B 1YPEH 5JB8S 1O2UA 3EQ0H 2GCTC 3LC5A 2FX6A 3HPTB 4ISIH 1PYTC 1GDUA 3ZZCA 2SGDE 2ZF0H 1O2PA 3F0PA 2DUCA 1J16A 2PSXA 2JETB 1HCGA 4ZKRU 2VWOA 4NIXA 4U2WA 3T27A 1V6DA 2HRVA 1RGQA 1PQ7A 3MOCA 4IW4E 3E6PH 1GVKB 3E16B 3Q76A 2A0QB 3OFND 1BMFD 1O3DA 2WV5A 3KF2A 3OY5U 3SNAA 2G4UA 1TGNA 1TNGA 1O5BB 1KLJH 3DUXH 3NPSA 1HPGA 4Y8ZA 5DO4H 1Y59T 2FIRH 2G52A 3FFGA 4WH8A 2ZPRA 4X6PA 8GCHF 1SQTA 4CRFA 4Q80A 1MAXA 1ZTJA 4IBLH 5DP9A 1GPZA 5HMAA 1VITG 1OWDA 1PPHE 1OWKA 3E90B 3OU0A 4GSOA 2VJ1A 3BEUA 4FUFA 3RXVA 2VU8E 3L6PA 2OUAA 1OX1A 1NRPH 2AS9A 1GHBF 2GT7A 1K1PA 2PTCE 3UY9A 2XW9A 3M5LA 3SOSA 4NA7A 3PTNA 3UREA 1X7AC 2SNVA 3M3TA 4TYDA 1DOJA 3UQVA 1AO5A 2WPHS 1SC8U 2BLVA 3SV7A 1WAYB 2Z9IA 4MNYA 4IGDA 2ZDLA 4M7GA 5EJ1A 1G30B 5GCHF 1XX9A 1A0HB 1V2QT 4Y0YE 4YOGA 3SV9A 3GY8A 3ZZDA 1SGRE 1GWAA 1C2JA 1CVWH 4XD7D 5KEDA 5DGJA 1AU8A 1NFXA 1DDJA 2NU2E 1BITA 1ZSKA 3OEED 2VB0A 1HAZB 1VCWA 2GZ8A 1L4ZA 1XVMA 1QY6A 1VCPA 4QT8C 1KXAA 1NBMD 4F49A 3M36A 4ESTE 1GI6A 3RU4T 2OBOA 2ANMH 1GMHF 3A7YA 4UFDH 4XBDA 1EAUA 1EKBB 2WPJS 3GOVB 4UE7H 4ZKSU 4LZ4B 2VBCA 4NSVA 3M5MA 1ACBE 4NFFA 2R2MB 2QN5T 5A09A 2H2ZA 3KHVA 2ZDMA 2QF5A 2P3FH 1QL9A 1FY8E 2G4TA 3MU1A 1FIZA 1ABIH 5LPEA 1WBGB 2XXLA 1SGFG 1XUHA 1S0QA 2IPQX 3C1KA 4JK6A 3T29A 1V2RT 2ZIQH 4K69A 1K22H 5EOKA 4YT6H 3UNSA 3MH6A 1SQAA 3FP6E 2HPQH 1QRZA 1AIXH 4FUCA 3RMNH 2NWNA 2FO9A 1W2KH 3TJUA 1GJ7B 2JJ2D 1P01A 2RDLA 2W6ID 2Q6FA 1G37A 2ZU2A 2G55A 3SV8A 1OYTH 5DPAA 5L30H 2FODA 3A8DA 2DE9A 4AC9A 1P0SH 1EP5A 3ZZ8A 2OC8A 1ZPZA 4ISNA 2F3CE 4I8GA 2FTLE 1TX7A 3PB1E 1RD3B 2GTBA 1G2MA 4X2WA 1Y3XA 2AMPA 2ZHDA 3QX5H 3PO1C 4TPYA 4A1XA 4TSFD 3TJVA 3Q3XA 2ZA5A 4XE4A 3UNRA 1ZHPA 1OP2A 2P95A 3RMOH 5T3HA 1Z6JH 1GMCF 2XNIA 4VGCB 1KDQA 2Z3DA 2OTVA 4IN1A 2Z9LA 3BV9B 1N8OC 1J15A 2ZI2H 1NM6A 4ABJA 5KECA 3LIWA 1ZPBA 5B6OA 1AHTH 1DLEA 1EJAA 4DIHH 1XVOA 1NU9A 1LHCH 2FWWA 2A5IA 1CBWC 1O3BA 4JZFH 1JRTA 4X2YA 2BDGA 1IHSH 2KCOA 2SGPE 1NROH 3KYGA 3N7EA 1P2KA 1P12E 1UTPA 1C5SA 3PLPA 2YOLA 1ANBA 4SGBE 4NG9H 1GDNA 2J9NA 4ISHH 2HLCA 5F53A 3V3MA 1W3CA 4YZUA 1SGYE 1V2LT 1BDAA 1MTUA 1GDQA 1TALA 4BAKB 2P16A 1Z1IA 3G01A 2GD4B 3KN2A 3P92A 3LOXA 3SGBE 3UUZA 5CMXH 1ZMNA 2J34A 1LHGH 4B71A 4R0IA 1W0YH 1HAVA 1FDPA 1BT7A 1TMUH 3RXLA 1DWEH 1O38A 3UTUH 5L6NH 3F9GA 3MNXA 3TK5A 4B75A 4I8HA 5AHGH 2A4GA 1DSTA 2AERH 6GCHG 3FZDA 1KXBA 1NT1A 2BLQA 2XWAA 5FX5A 4RT1A 1QJ1B 5LPRA 1BRUP 2ZDVH 1GHZA 2JKHA 3M7QA 4WMDA 1MTVA 2ZU3A 1PFXC 1THPB 3A8AA 5E8EH 4B2CA 3VB5A 1AFEH 2FYRA 1A5IA 2A7JA 1HGTH 3TPIZ 1CHOG 5F8TA 3ODFA 1O3PB 3LH1A 3GS9A 1OXGA 2BY9X 1LVYA 5KGOA 2BLOA 3MU8A 1HAIH 1V2ST 4ZXYH 4FVDA 1YGCH 1P57B 3MI4A 1KXDA 2HNTE 3VXFH 1C2EA 4OS4A 2J95A 3KQCA 1VITF 5SGAE 2W3IA 3MO3A 2ZHFH 5F6MA 3PMJA 4YTAA 3FP8E 3BN9A 4LXBH 2Y5FA 3H09A 2WV9A 1HXFH 4JZEH 3HK6B 1O3CA 4B73A 5EXMA 2J5UA 2ZCKP 1UTOA 1P3EA 4O3UA 1DLKB 3BEFB 2GCTB 4O3TA 3AASA 1A2CH 3JZ2B 1C2KA 2BMGB 1COWD 1SLUB 3A7VA 3S9AA 5FHTA 1FQ3A 1EAWA 1YCPH 1BMNH 2BTCE 4RN6A 2O8UA 4FUJA 2ZKSA 2Z3EA 2K0QA 2TBSA 1RXPA 2ZGHA 1EPTC 1GI0A 3PYHA 1AB9C 4JK5A 3SZEA 1HIAA 3T26A 3TNTA 1GJ5H 4NZLA 2IJD1 1B7XB 1DX5M 1QA7A 4BAHB 1O3NA 1QCPA 1MUEB 2ZU4A 5BPEA 2BD7A 1YF4A 1IQEA 2XBVA 2JH0D 3ZZ6A 1TIOA 2Q1JA 3SJKA 1BQYA 2NU3E 1S0RA 4HI3A 1CQQA 1DY8A 1JIMA 3LDXH 3O8CA 3GCHC 7GCHF 5HXFA 1TX6A 3F9EA 4Y8YA 2H9TH 4F4OC 3EGKH 1U6QA 2KCAA 2H5CA 1GG6C 2PTNA 2ZCHP 4DT7B 3SU6A 3U98H 2VH0A 3M5NA 5CE1A 1QNJA 2V3MA 4AYVB 6LPRA 1P3CA 8GCHG 2WSSD 3GY5A 4FVBA 4AGKA 2QV1A 4Z0KA 4LZ1H 2B0FA 3GY6A 4ABGA 2W7UA 5C67A 1HBTH 2HGTH 3DFJA 1XUKA 3T25A 1ABJH 2F9NA 1B5GH 1ZRKA 1C1OA 4YT7H 1JMOH 3RP2A 3UQOA 1GHBG 2XWBI 1TPSA 1SGFA 2R2WU 3GY4A 3PMBB 4UFEH 3PMAB 1YCPK 3F0OA 1IQHA 5F8XA 3MFJA 4ISLA 3BTTE 2THFB 3OAAD 4B76A 4GCHF 1IOEA 1P02A 1MTNC 1QL7A 1K1NA 1KYNA 2BD5A 2ANYA 4Y79A 3SGAE 2ODPA 1GBEA 2PWXA 2STBE 3TK9A 2BY8X 3H7TA 2BX3A 2LNCA 3GYLB 1NFWA 2TGPZ 3ZVGA 3ZZ7A 3E3TA 1GI9B 2A5KA 2ZC9H 1F5LA 5ABWA 1P03A 3FP7E 2OP9A 2VIVA 3MH7A 1GI3A 3SQEE 3WWFA 4AORA 3ATMA 3A84A 1MU8B 2C3SA 3ZVAA 1H9HE 1OP0A 4Y0ZE 1AD8H 3LGUA 2SFAA 1FUJA 2CJIA 3RXCA 1GMHG 3ZVDA 1KY9A 1RFNA 1O3HA 3CS7A 5C20A 2J92A 3RC5A 4DJZB 1EJMA 1S84A 4RT0A 1G3BA 3LGIA 3RC4A 3UAIC 2CHAC 4INLA 1O37A 3SJ8A 1ANCA 1SFIA 1IQLA 3HK3B 3FVFB 2VINA 3N7OA 1C5WB 2GGVB 1O2WA 3MH5A 2C90B 4NCYA 2D2DA 1YPGH 1ANDA 5FCRA 1E0FD 2Y6TA 1Z8JB 4B2AA 1YPKH 2AGIX 3UR9A 1FONA 5E2PA 4LK4A 5ESBA 1AZ8A 3KQDA 4IC5A 3A8CA 1THSH 4BOHA 2ZHEH 1BTZA 3SU5A 3PO1B 1MD7A 2LPRA 2G5VA 4Q7XA 2WUCA 4X2VA 2VWMA 3ATKA 1ETSH 2ALPA 5EJZA 2ZCLP 1DWCH 2C8YB 2CXVA 3GY3A 4X2XA 1FX0B 1SGQE 1BMLA 1N8OB 1GBJA 4CRAA 3DD2H 2ZDAH 1FN6A 2OLGA 1QBVH 1C2IA 4U32A 1GGDC 3VEQB 1LKAA 1ID5H 1IQNA 4Y76A 3OYPA 1IQJA 1CBWB 1EZQA 2HOBA 2K1QA 1NU7B 3Q3YA 5EXNA 1QRWA 3RXMA 2WUBA 3DSGA 1GMCG 2V6NA 4OS2A 3CS0A 2ZFTA 1MAYA 1HAHH 5K0HA 4IS5A 4WF8A 1O0DH 5DKMA 1T7CA 3LJOA 1O31A 1TGSZ 2PLXA 4ZHMU 4BANB 4HTCH 1J8AA 1ELFA 4X8TH 3U8OH 1E36B 3HKIB 4J2YB 1NRSH 1QTFA 3M61U 3VGCC 2H9EH 1BTHH 2D26C 2G5NA 4CR9A 4DURA 1F0TA 2A5AA 1GBIA 1TX8A 3CENA 1JIRA 2ZP0H 1ESAA 2KZ4A 5IDKA 1AE8H 1C5UA 5TCAA 1EASA 2VVCA 1BRAA 1ZRBA 2ZU5A 5T6DA 3M7UA 1O2GH 2FTMA 1P2JA 4WMEA 3T28A 1O2VA 1DUEA 2W3KA 2HWLB 1K2I1 3PM3A 1TABE 3TH3H 4B6FA 1C5XB 3NUMA 1LVOA 3W1EA 2BOHB 1D3TB 1T8MA 2H1UA 2PGQB 1O3OA 2BZ6H 2L6OA 1SGPE 5LGOA 1RRKA 4KGAA 1N6XA 1Y5AT 3V13A 1JOUB 3SV6A 2BOKA 4M9FA 3GCTF 1BRBE 2Z6BD 2FPZA 1KMHB 1LHDH 1GJ9B 5T6GA 5A0AE 2I6QA 1A0LA 5FPYA 2Y82A 4HFPB 3EA9A 4NWKA 1QGFA 4WMFA 3FOAA 3ZV8A 1GHYH 1P2MA 1T4VH 5C94A 1KIGH 5EPYA 3SUFA 1UHBB 1C1WH 1PJPA 2W26A 1IQFA 2ZPQA 3LGTA 3BTDE 2ZFQH 3ZYDA 2JIZD 1Y8TA 2JH5D 1Y3UA 1CU1A 3LJJA 2Y81A 3QZRA 2BQ7B 1WU1A 1D3QB 3SUDA 3F3BA 5DP4A 2RFKC 1TE0A 6CHAC 1K28D 1JXPA 1M9UA 1UVOA 2SNWA 3PLBA 3BTWE 1GVLA 5L2YH 1O3EA 2P94A 3AW0A 1XXFA 1PPCE 2GKVE 2C8ZB 1VJ9U 4X1SU 3KQEA 1C2LA 1NTPA 2VIWA 3MO9A 3A88A 3BG4C 2R3UA 3GDUA 2XTTB 1EPTB 1AB9B 1NRQH 1NRNH 3M7TA 4TY7A 1F5KU 4Y8XA 5AFZH 1GJDB 1C1MA 1NC6A 1XM1A 5FL7D 3F9FA 1XXDA 1QQUA 2ANWA 1T32A 4AOQA 3LONA 1THRH 3RXSA 1MBQA 1XMNB 3SI4H 1O33A 3GCOA 1S6HA 3F2GA 2BM2A 3SJIA 1Y5BT 1WYKA 2JJ1D 1GI2A 2R3YA 2XC4A 1LKBA 1AFQC 1UCYE 1O3KA 2W5EA 4DG4A 3SU3A 4JYVH 3TLOA 1MMJN 4XOJA 1GBKA 1JRSA 3GCHB 1GJ4H 1S6FA 5J4SA 1C5NH 3UNQA 1GG6B 2A4OA 1LQEA 1O36A 4X1QU 1RJXB 3GDVA 1TRNA 1C2MA 2HALA 1O5DH 2H5DA 1TOMH 2PKAB 5I25A 3F2FA 1QA0A 1DM4B 2NU0E 3U28C 2H6MA 1O3GA 1WTGH 2W6JD 4Q63A 4RKOB 2CK3D 3NRLA 7GCHG 5GDSH 3AAUA 4IN2A 1EATA 4XSKU 1ELBA 5A8ZA 2A7HA 8LPRA 4OS1A 1NZQH 1LO6A 1WOFA 2IPHA 8ESTE 4CH8B 1OP8A 1O2JA 1MTNB 2ZTYA 1AWFH 2SGFE 1UMAH 1KXCA 2QXGA 1YC0A 3E91A 2D8WA 2HNTF 5C2ZA 1UJ1A 2M2AA 1CHGA 4BTUB 1HAXB 3S9BA 2AMQA 2Q6DA 3IITA 3RU4D 3O8BA 3RXEA 2ASUB 1A5HA 1FY5A 2F91A 4HGCA 1HUTH 1UK4A 1TGTA 1BZXE 4O9VA 4OM9A 4Y11E 1WUNH 2J4IA 4ZHLU 4KP0A 4FETA 1LPZB 1QJ7B 1BTYA 2KR7A 1WDIA 4CHAC 2HVXA 4GCHG 1IQKA 4MDSA 1ZTKA 1C1VH 1RIWC 4K2YA 4YO9A 3QN7A 1L0ZA 1FY1A 3EAJA 4UDWH 1J14A 1AI8H 2PV9B 4TPIZ 2FX4A 4NA8A 4OS7A 3RXFA 1AY6H 3SW2B 3S69A 3K6ZA 1SMFE 2ULLA 3LC3A 1NESE 2VWNA 2CHAB 4JZ1A 5CDFE 2KCYA 1TNIA 1BIOA 2QGRA 3QTOH 2BDBA 4CRBA 2BD4A 1VCQA 1V3XA 2HPPH 1WXRA 3PRDA 1KXFA 5FPTA 1BBRE 4A6LA 1GBLA 1ELDE 3ZVEA 1O2IA 3F68H 5I46H 3LT3A 3RLYH 1FMGA 3TIUA 1UTJA 3F2HA 1S83A 3SHAH 1NBME 2F83A 1SHYA 4OGYA 3EE7A 1UCYH 3S7KB 1O5CB 1OYQA 2YMSD 4X6NA 2TIOA 1F2SE 3NXPA 1O2TA 4AB8A 1IQGA 1ELGA 5ESTE 2FI3E 5DJ7A 3STIA 1YPMH 4U30A 3ZV9A 2G8TA 1YM0A 4IMQA 1GI5A 3OX7U 1GGDB 2C93B 3QO6A 1SQOA 2VIDA 1ESBA 4RI0A 5C3NA 3A85A 3QWCH 2XOKD 1V2WT 3LGWA 3LPRA 1K21H 1OWEA 2PUQH 3ATIA 4GHTA 1P09A 1YLCA 1YY3A 3VG8A 2BXTH 3AAVA 5AVDA 1D4PB 3WW7A 3TK6A 2M5TA 1CSOE 1G3DA 4Y7BA 2GCHF 3RU4E 4FU9A 1OS8A 1AZZA 3MTYA 3A7WA 1O2ZA 1O2QA 1SHHB 1KDQB 1P2QA 1OPHB 2QCYA 2RDEA 1GBMA 2BYAX 5FAHA 3PMHB 1BHXF 2FI5E 3SORA 3TJNA 2FXRA 3VGCB 4U01A 1IQIA 1O3JA 3GYMA 1CT2E 3RXPA 1Z8RA 2BD2A 3O8DA 1L1GA 3SU1A 2KM0A 5FBEA 3RXBA 3MWIU 1O30A 1ZJDA 1MCVA 3OE7D 3UIRA 5EG4A 3O8RA 2PW8H 2BXUH 1T4UH 2BVXH 2G51A 3ITIA 4FUBA 3VB7A 4BTIB 3DHKH 2I6SA 4B74A 1EQ9A 1FPHH 1UCYK 4Y71A 3EDXB 4O03A 4YM9A 1W0KD 1GBAA 4YXWD 4B6EA 2ZFRH 1F92A 1E79D 3ZVFA 3DSOA 4NIWA 1WSSH 2ZQ1A 4IMZA 1YBWA 2BVRH 3W95A 1HAVB 1Z7KA 1O2RA 1GI1A 1O3MA 3RXHA 3S9CA 1MTWA 1H1BA 1P04A 1EZUC 1A61H 4KTUA 3L3TA 3A81A 1YPHE 1SGDE 1MTSA 2RA3A 1CA8B 3E8LA 3SU0A 2B9LA 2FOGA 1AUTC 1AVXA 4YOIA 4ZAEA 1Y3VA 3URCA 2Y7ZA 1BBRH 1BHXB 3B9FH 4THNH 1GHXH 4WVPE 1XUIA 5DN6D 3GCTG 1L1NA 1L4DA 1UTMA 1O3FA 2TGDA 1HAYB 3ATLA 1DSUA 6CHAB 3M35A 4H42U 3RMLH 4NWLA 2ODYB 2OQ5A 3UPEA 3TITA 1CO7E 4DW2U 3FKSD 2CMYA 5EQSA 4DVAU 1QHRB 1MD8A 3M3SA 2ZGCA 1PPGE 1L2EA 3JZ1B 1TPPA 1A0JA 2QXJA 2SGQE 2XCFA 1UTLM 3BG4B 1EJNA 3BTFE 4AFUA 3OEHD 1QJ6B 2IJOB 5DSFA 1G2LA 3RXOA 3U69H 4NGAH 3TH2H 1MZDA 3A8BA 3FAOA 2OC1A 1PPFE 1L1JA 5FBIA 4Q7YA 1TBZH 3FANA 4JYTA 5EODA 4MTBA 2A45B 1BJUA 1CA0C 1T31A 2PP6A 2QF4A 4ISOA 1IAUA 1XUFA 1JWTA 4H4FA 1DS2E 5EPNA 5GIBA 6ESTA 1F5RA 2LELA 3MO6A 5DP7A 3UOPA 4MPVA 1OWJA 2O8TA 5A8XA 2EQNA 2TGAA 2SGEE 1H8ED 3MHWU 2Q6GA 1AFQB 4OS6A 1TNJA 3LKWA 1EFRD 1UVSH 2W7SA 5T6FA 3HGPA 1V2MT 4E05H 1GJ8B 3FN8A 3R0FA 3A82A 4ABHA 1ELVA 4D7GA 4DCDA 1YKTA 2GVFA 3AK5A 1UTKA 1TGCA 1FY4A 2R0KA 1D6WA 3P8FA 1O2YA 2FOBA 3K9XB 3V0XA 2ODQA 1BBRK 3T62A 1TPAE 3SU4A 1C5ZB 1B0EA 1MCTA 1UO6A 1D9IA 5HYOA 5J4QA 2ZTXA 5T1VA 4GUXA 2GDDA 5JBBS 2EI8A 4ZXXH 1O2HA 1DWDH 4K5ZA 3BIVH 4MLFB 3AW1A 2UUYA 1Z8IB 4X6OA 1ARCA 3DFLA 2FOMB 4ZHAA 2NU1E 3F1SB 3UR6A 1K1MA 5GJ4B 3ENSB 4A5TS 1PQ8A 1TB6H 1TRYA 4MPWA 5A0BA 3I29A 5B6LA 3RC6A 2OXSA 3D65E 1SGEE 4X0WU 1OOKB 3GICB 1OWIA 2XRCA 3F6UH 4UFGH 1SI5H 1D3PB 3PV2A 2XBYA 2KAIA 1BTXA 9LPRA 1SBWA 2Y5HA 3TGJE 2BB4A 2ZU1A 3SNDA 1C2HA 5C0UA 2A7CA 4WXIA 4JZIA 7KMEH 1D3DB 1TNLA 1E1QD 3VB4A 1P10A 2BDYA 4CH2B 4X1RU 1VJAU 1F0SA 1EZSC 1PQAA 1J9CH 2GDEH 1ZR0A 3CP7A 1AMHA 3SJ9A 2BD9A 3P70B 3RXJA 1C1SA 1AQ7A 4RSPA 1BB0B 1MQ6A 1V2NT 5TJXA 1GVZA 3OTPA 1RIWB 1MBMA 2AEIH 2ZFSA 3I77A 2OC0A 4AN7A 1A1RA 2J94A 2O8MA 5DK1A 3W94A 2BLWA 3PWBA 1T8LA 3P95A 2J98B 4K1TA 1BTWA 1KTSB 4KKDA 2BDAA 1HRTH 4XBCA 2UWLA 3A89A 4GPGA 5G4BA 2P8OC 3MU4A 4FUGA 3U8RH 1MKWK 1QR3E 2Z94A 1SKYE 1CGIE 3SHCH 1Q3XA 2KFWA 3MU5A 4AGJA 1GMDF 4CRCA 3AVZA 4MPXA 1FV9A 1S82A 5C5NA 3SNBA 5E0HA 2YMSC 4I8KA 1UW7A 1TQ0B 1YPHC 2GJGA 1LCYA 3ZZ5A 1AE5A 4CBNA 5EQRA 2A31A 2BDHA 2GMTC 3RM0H 1GHVH 3TH4H 4I33A 5CHBA 1H8HD 1UK3A 3Q3KA 1ETTH 1O39A 3NK8A 2CGAA 1MU6B 3DSPA 3BTEE 3SUGA 1HJAC 1HAGE 3A7ZA 1MKXH 4WY3A 2WYGA 4E06H 5AFYH 1HFDA 5DG6A 1QRXA 8KME2 1EZXC 2YNAA 1UTNA 5C1XA 1O2XA 3M37A 2G00A 4MQAA 3IWMA 2V35A 4FXGH 5C0TA 2GZ9A 2PHBA 1DE7H 4NFEA 5EQQA 4OGXA 1INCA 1GL1A 1O35A 2XBXA 3EE0B 3K65B 1BRCE 1TNKA 1C1QA 1A4WH 1OWHA 1WTHD 4UD9H 3RXGA 2TGTA 2OQUA 2KX4A 2ZFFH 4ZKOU 5ETXA 3VFEA 2QF0A 2BHGA 3KYFA 5JDUB 1XKAC 3DA9B 4AX9H 1HYLA 1NPMA 1P2IA 3N7DA 1H9IE 1OSSA 1XKBC 2QIQA 1P06A 1KLTA 1FJSA 1O5EH 4H6TA 1XUGA 1QL8A 3H5CB 4AFZA 4J1YA 1E35B 1ZGVA 1G36A 2A4RA 4YLQH 1ZMJA 1SQRA 3S7HB 1AVWA 2K8IA 2FM2A 4MPUA 4ABFA 1T8OA 2UWOA 1TNHA 4Y6DA 1YP9A 2GCHG 1GL0E
chains in the Genus database with same CATH topology
4MNXA 1IHTH 2P59A 1DT2A 1MH0A 1J17T 3M5OA 1LPKB 4X1NU 1CGHA 1ANEA 3VB6A 3T2NA 3QTVH 1HB0B 1FI8A 2BY5X 4WJG2 4D9RA 1AKSB 2FOFA 1BOQA 3QK1A 1HAOH 3SUEA 4FU7A 1UVTH 2NU4E 3ODDA 5GPIB 3U1IB 1DUAA 3B23B 1MKXK 1Y3YA 4NSYA 1VITH 1GBTA 1ZYOA 1FLEE 1ZLRA 5EW2H 1P11E 1YYY1 5HM9A 4NIVA 1TWXB 3RXQA 1F7ZA 1SFQB 5DP8A 1FIWA 2C8WB 4GHQA 1C5MD 5L2ZH 5EXLA 5JBCS 4K3JA 1LPGB 2UWPA 3KL6A 3OY6U 5TCCA 4UONA 2C4FH 2Z7FE 3E0PB 3QDZB 2EEKA 4OS5A 5FXLA 4AFSA 2PKAA 2PKSC 4D76A 5A8YA 2CV3A 4FUIA 1C9TA 5FCKA 4D8NA 5HM2A 1N6YA 4XBBA 1W10U 2TPIZ 4O97A 3EYDA 1GCDA 5GXPA 1C2FA 5C5OA 2GV6A 1C1RA 4K60A 3ZZAA 2BQWB 1GHAF 5JYIA 3RUOA 2WINI 2BZAA 5C1UA 1EXFA 3P17H 4TWYA 3SBKA 2XBWA 1ELTA 4B1TA 3U9AH 1ZJKA 4XFQA 2Z9JA 2J38A 3SI3H 1CGJE 1DANH 2PSYA 4X8UH 3Q00A 7LPRA 4FUDA 1SGIB 4FU8A 1CA0B 2Z3CA 4DY7B 1VGCC 1AWHB 2B7DH 1KSNA 1DXWA 2VWLA 4DGJA 1GBCA 3HKJB 3BF6H 1HV7A 1UK2A 4JYUH 1HLTH 1W11U 2UUKB 4RKJB 2AYWA 4ABDA 1RTKA 2A4QA 1TAWA 1Z6EA 1V2UT 1S5SA 2FI4E 2BQ6B 3GISB 4GVUA 2H9HA 4R8TB 1GCTC 1O2SA 1FNIA 1V2KT 1Z8GA 3Q77A 1ELAA 1ESTA 2FP7B 1DVAH 2QXIA 1GJBB 1PPZA 4LOYH 3ATWA 2ZZUH 2A2QH 5EW1H 4BAMB 2P93A 2A32A 4DOQA 2QF3A 1DWBH 3K2UA 1TA2A 1DFPA 3C27B 1TLDA 5A0CA 1HAPH 1PQ5A 1NRRH 3P8NA 1YCPM 4PROA 3VXEH 1F0RA 3M3VA 1K1IA 2XYAA 1O5FH 5LPFA 1QBOA 3RDZA 5DP5A 4GAWA 4I8LA 3V7TA 1OKXA 3I78A 1G32B 1QQ4A 1C2GA 1ZSLA 2SGAA 3RLWH 1E37B 1C5YB 2WYJA 1P2NA 3A87A 5C1YA 4X8VH 5F8ZA 1DICA 1S85A 2DE8A 1K1OA 2BY7X 3R3GB 1H4WA 1AGJA 4ZKNU 2O9QA 2F9VA 2PGBB 3LGYA 3RXKA 2F9OA 1HXEH 2B8OH 4YLUA 3TGIE 2VGCC 1DXPA 2D1JA 2XCNA 3UWJH 4D7FA 1TGBA 3MH4A 2OC7A 1RTFB 2J2UA 4X8SH 5AF9H 2AH4X 1C1UH 1WV7H 3SN8A 4HZHA 4TY6A 4FUHA 1IQMA 3RXAA 1V2TT 1C4Y2 3BTQE 1PPEE 2EI6A 2GV7A 3P8GA 4Q2KA 1UTQA 3SZNA 3MMGA 5FPSA 1YPJH 1EUFA 4BXSA 1GBBA 2P8OB 2FYQA 3QGJA 4MNVA 1HJ8A 2FOCA 3RMMH 3ZZBA 1E34B 1SR5C 4AG2A 4K1EA 1C1NA 2CN0H 4I32A 1LVBA 3MNSA 3T5FH 2RCEA 1V2PT 4MVNA 3SO3A 4H6SB 2OD3B 3UOUA 3ZVCA 3MYWA 2CF8H 1YPLH 1ZGIA 2GMTB 1ZPCA 2FEQH 2F9BH 1SPJA 3GDSA 1Y5UT 4INHA 3F9HA 1EB2A 2ZDKA 1ARBA 1W0ZU 1HDTH 1GBFA 3MNBA 1HJAB 1MZAA 4NIYA 3SGQE 1O5GH 1GMDG 2AGEX 1SLWB 4CBOA 5PTPA 1RTLA 3NZIA 3A7TA 1TOCB 3BSQA 3PWCA 1GI7B 4K8YA 4A1TA 4A7IB 1LVMA 3RXUA 2O8LA 2A2XH 4KTSA 3ZYEA 4ABEA 1C2DA 1TONA 4WH6A 5CHAC 2QA9E 3RXTA 3RXDA 1BJVA 3V12A 5A2MH 1LDTT 3SV2H 2FLRH 1GJCB 2UUJB 3SJOA 1H8IH 3E1XB 1N1LA 4A92A 1FAKH 2QYIA 3MU0A 1CE5A 1H9LB 3FZZA 3QZQA 4ZMAH 4AFQA 1CT0E 1BMMH 1EOLA 2QC2A 4BNRA 3BTME 5F03A 1C5VA 1SG8B 2RG3A 1W7GH 1SSXA 3ESTA 4ASHA 1A3BH 2OINA 5JBTA 4WXVA 1TBRH 1S81A 3KGPA 4WWYA 3GCNA 1H8DH 2BVSH 4I31A 4ABBA 3A83A 2Y7XA 2R9PA 3B8JA 1WQVH 1YLDA 3L33A 3URDA 5BRRE 1QBNA 2JETC 3NKKA 4E7NA 3PV4A 2FOAA 1O2MA 1BCUH 3GY2A 4YESB 1P8VC 3OSYA 2IOTA 1TBQH 3BIUH 2V0BA 1AVGH 1XUJA 1Z71A 3EA8A 1P9SA 1PYTD 4K8BA 2AGGX 2QAAA 2AMDA 4E7RG 1WCZA 3HATH 4ZROA 4ZH8A 1FXYA 1NY22 1NS3A 2GX4A 1Q31A 1LHFH 3BEIB 2ESTE 1CT4E 1QB1A 3U1JB 2ZG0H 1C4V2 1TQ7B 4A1VA 1GBDA 4TWWA 2WPMS 1Q2WA 5DP3A 4GLYA 2GT8A 3BTGE 1W7XH 1SOTA 1LQDB 1V2VT 1KLIH 2Y5GA 2QXHA 3PROA 1O34A 3U8TH 4ABIA 1C1TA 3UFAA 2ZGBH 2PKSB 1Y3WA 2FMJA 2VH6A 4AB9A 4AZ2B 1FZZA 3D62A 3UWIA 4Q7ZA 1QFKH 2GP9B 4UEHH 1V2JT 1NO9H 4ABAA 3SNEA 2BDIA 2ZQ2A 4BAQB 1GBHA 1TRMA 1B0FA 4IC6A 1TA6A 1EAXA 1EOJA 1EX3A 1ZZZA 2Y80A 2ZHQH 4FUEA 4Y7AA 1ZHMA 4MNWA 2A1DB 1PPBH 1SGCA 2FESH 4X6MA 3VPKA 2O8WA 1C5PA 1HIAB 1P9UA 2FS9A 4JCNA 2ANKH 3KEEA 2XC5A 1VGCB 4INKA 2EI7A 1GHAG 1E38B 1K9OE 1FAXA 1MKWH 1AN1E 1QURH 3GY7A 1P05A 3ELAH 4Z6AH 2QY0B 1NFUA 1SOZA 5FX6A 1EP6A 1GI4A 4K1SA 3ZZ3A 2ZFPH 3P8OA 2B5TB 5IYTA 4X1PU 1QB6A 5E2OA 4AG1A 1ZTLA 5JPMH 2P3UB 1C1PA 1Z1JA 3D49H 3LGVA 1W8BH 1SGNE 1GCTB 1EAIA 1RS0A 3QUMP 1NN6A 1C5TA 1BTUA 1SLXB 2ZECA 3NWUA 5E0GA 1KTTB 5GCHG 4DIIH 1SLVB 2V3HH 2ILNA 3A80A 4KELA 3RXIA 2ZEBA 3D23A 4CREA 3KIDU 3HGNA 4B2BA 4MG3A 3P6ZB 3ZVBA 4YOJA 2EC9H 2TRMA 1SGTA 5K7RA 1O3IA 3SQHE 2RA0A 3TGKE 2WPLS 1SVPA 2R0LA 2WV4A 4KTCA 2FOHA 3E0NB 3ZZ9A 1O3LA 5JBAS 5JB9S 1LMWB 1WQSA 1KXEA 2G81E 4CHAB 4NA9H 1FY3A 2F9PA 2VIOA 1C4U2 2BD8A 1D6RA 1VZQH 1QIXB 2BY6X 4NZQA 1O3AA 1W13U 2WPIS 3H7OA 1O2LA 4UFFH 1GJ6A 3NCLA 2BDCA 4AYYB 3S0NA 1ZMLA 2VIPA 4CRDA 1A7SA 3SU2A 4VGCC 1NFYA 1MQ5A 1BTPA 1ORFA 3BG8A 2OBQA 1HNEE 2ZGJA 2ZDNA 1K1LA 1JBUH 1C5RA 2FDAA 1G3CA 1BUIA 5EU8A 1FPCH 1BMAA 3TU7H 1C9PA 2VGCB 2XC0A 9ESTA 2VVVA 5GWZA 1GI8B 4BAOB 2ZWLH 1ZHRA 3WY8A 3LH3A 3STJA 3KQBA 1G3EA 2HNTC 1O2OA 1G9IE 2F9UA 3RXRA 4BTTB 1HJ9A 3IG6B 2ZHWH 3K6YA 2AFQB 4JZDH 1C5OH 4D9QA 1F0UA 1O2KA 2VNTA 1A46H 2KAIB 2ZGXH 1SB1H 1TMTH 3OTJE 3KCGH 3VB3A 3QGNB 2WPKS 6GCHF 3SNCA 3MNCA 2P3TB 2IN2A 3ZZ4A 1W12U 2FZZA 2ZTZA 1BA8B 3PLKA 1K1JA 1DY9A 1SL3A 5HGGA 3DT0H 3BTKE 1CHOF 2FOEA 4Y10E 1O2NA 2ZO3H 3PTBA 3TNSA 1TFXA 3BTHE 3EA7A 1ELEE 1UVPA 1DPOA 1O5AB 3KNXA 1UHBA 3QLPH 1A5GH 1AKSA 2CF9H 4CRGA 5LH8A 2C8XB 2ZNKH 1A3EH 7ESTE 3A7XA 4JMYA 1EB1H 4ZUHA 1ZSJA 2ZPSA 2STAE 1C5LH 2EA3A 2OCVB 1V2OT 2YNBA 5DP6A 2VVUA 1VR1H 2AIPA 2BD3A 2PR3A 4XDEA 1TYNA 3TJOA 2FS8A 5CHAB 2AIQA 1GJAB 2GZ7A 1ZOMA 2UUFB 3RM2H 3A86A 1ETRH 2FLBH 3TVJB 1W14U 1AUJA 1T8NA 1FN8A 1UVUH 2V3OH 5EGMA 1P2OA 2PUXB 4SGAE 2Z9GA 2Z9KA 1LTOA 2BX4A 4CR5A 1EPTA 1DITH 1O32A 2JH6D 4I8JA 2PFEA 1ELCA 2VIQA 1LHEH 2ALVA 1TPOA 4I7YH 4BXWA 1TMBH 5H4IB 1C5QA 1QB9A 5E0JA 1GHWH 3LU9B 1YPEH 5JB8S 1O2UA 3EQ0H 2GCTC 3LC5A 2FX6A 3HPTB 4ISIH 1PYTC 1GDUA 3ZZCA 2SGDE 2ZF0H 1O2PA 2DUCA 1J16A 2PSXA 2JETB 1HCGA 4ZKRU 2VWOA 4NIXA 4U2WA 3T27A 1V6DA 2HRVA 1RGQA 1PQ7A 3MOCA 4IW4E 3E6PH 1GVKB 3E16B 3Q76A 2A0QB 2WV5A 1O3DA 3KF2A 3OY5U 3SNAA 2G4UA 1TGNA 1TNGA 1O5BB 1KLJH 3DUXH 3NPSA 1HPGA 4Y8ZA 5DO4H 1Y59T 2FIRH 2G52A 3FFGA 4WH8A 2ZPRA 4X6PA 8GCHF 1SQTA 4CRFA 4Q80A 1MAXA 1ZTJA 4IBLH 5DP9A 1GPZA 5HMAA 1VITG 1OWDA 1PPHE 1OWKA 3E90B 3OU0A 4GSOA 2VJ1A 3BEUA 4FUFA 3RXVA 2VU8E 3L6PA 2OUAA 1OX1A 1NRPH 2AS9A 1GHBF 2GT7A 1K1PA 2PTCE 3UY9A 2XW9A 3M5LA 3SOSA 4NA7A 3PTNA 3UREA 1X7AC 2SNVA 3M3TA 4TYDA 1DOJA 3UQVA 1AO5A 2WPHS 1SC8U 2BLVA 3SV7A 1WAYB 2Z9IA 4MNYA 4IGDA 2ZDLA 4M7GA 1G30B 5GCHF 1XX9A 1A0HB 1V2QT 4Y0YE 4YOGA 3SV9A 3GY8A 3ZZDA 1SGRE 1GWAA 1C2JA 1CVWH 5DGJA 1AU8A 1NFXA 1DDJA 2NU2E 1BITA 1ZSKA 2VB0A 1HAZB 1VCWA 2GZ8A 1L4ZA 1XVMA 1QY6A 1VCPA 4QT8C 1KXAA 4F49A 3M36A 4ESTE 1GI6A 3RU4T 2OBOA 2ANMH 1GMHF 3A7YA 4UFDH 4XBDA 1EAUA 1EKBB 2WPJS 3GOVB 4UE7H 4ZKSU 4LZ4B 4NSVA 3M5MA 1ACBE 4NFFA 2R2MB 2QN5T 5A09A 2H2ZA 3KHVA 2ZDMA 2P3FH 1QL9A 1FY8E 2G4TA 3MU1A 1FIZA 1ABIH 5LPEA 1WBGB 2XXLA 1SGFG 1XUHA 1S0QA 3C1KA 4JK6A 3T29A 1V2RT 2ZIQH 4K69A 1K22H 5EOKA 4YT6H 3UNSA 3MH6A 1SQAA 3FP6E 2HPQH 1QRZA 1AIXH 4FUCA 3RMNH 2NWNA 2FO9A 1W2KH 3TJUA 1GJ7B 1P01A 2RDLA 2Q6FA 1G37A 2ZU2A 2G55A 3SV8A 1OYTH 5DPAA 5L30H 2FODA 3A8DA 2DE9A 1P0SH 1EP5A 3ZZ8A 2OC8A 1ZPZA 4ISNA 2F3CE 4I8GA 2FTLE 1TX7A 3PB1E 1RD3B 2GTBA 1G2MA 4X2WA 1Y3XA 2AMPA 2ZHDA 3QX5H 3PO1C 4TPYA 4A1XA 3TJVA 3Q3XA 2ZA5A 4XE4A 3UNRA 1ZHPA 1OP2A 2P95A 3RMOH 5T3HA 1Z6JH 1GMCF 2XNIA 4VGCB 1KDQA 2Z3DA 2OTVA 4IN1A 2Z9LA 3BV9B 1N8OC 1J15A 2ZI2H 1NM6A 4ABJA 3LIWA 1ZPBA 5B6OA 1AHTH 1DLEA 1EJAA 4DIHH 1XVOA 1NU9A 1LHCH 2FWWA 2A5IA 1CBWC 1O3BA 4JZFH 1JRTA 4X2YA 2BDGA 1IHSH 2SGPE 1NROH 1P2KA 1P12E 1UTPA 1C5SA 3PLPA 2YOLA 1ANBA 4SGBE 4NG9H 1GDNA 2J9NA 4ISHH 2HLCA 3V3MA 1W3CA 4YZUA 1SGYE 1V2LT 1BDAA 1MTUA 1GDQA 1TALA 4BAKB 2P16A 1Z1IA 3G01A 2GD4B 3KN2A 3P92A 3LOXA 3SGBE 3UUZA 5CMXH 1ZMNA 2J34A 1LHGH 4B71A 4R0IA 1W0YH 1HAVA 1FDPA 1BT7A 1TMUH 3RXLA 1DWEH 1O38A 3UTUH 5L6NH 3F9GA 3MNXA 3TK5A 4B75A 4I8HA 5AHGH 2A4GA 1DSTA 2AERH 6GCHG 3FZDA 1KXBA 1NT1A 2BLQA 2XWAA 5FX5A 1QJ1B 5LPRA 1BRUP 2ZDVH 1GHZA 2JKHA 3M7QA 4WMDA 1MTVA 2ZU3A 1PFXC 1THPB 3A8AA 5E8EH 4B2CA 3VB5A 1AFEH 2FYRA 1A5IA 2A7JA 1HGTH 3TPIZ 1CHOG 5F8TA 3ODFA 1O3PB 3LH1A 1OXGA 2BY9X 1LVYA 2BLOA 3MU8A 1HAIH 1V2ST 4ZXYH 4FVDA 1YGCH 1P57B 3MI4A 1KXDA 2HNTE 3VXFH 1C2EA 4OS4A 2J95A 3KQCA 1VITF 5SGAE 2W3IA 3MO3A 2ZHFH 5F6MA 3PMJA 4YTAA 3FP8E 3BN9A 4LXBH 2Y5FA 1HXFH 4JZEH 3HK6B 1O3CA 4B73A 5EXMA