1EJNA

Urokinase plasminogen activator b-chain inhibitor complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (4-aminomethyl)phenylguanidine derivatives as nonpeptidic highly selective inhibitors of human urokinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ejnA01
1QJ1B 1L4DA 1P2OA 4AG1A 1GHVH 2OUAA 2ALVA 3MU8A 4WMDA 1GI4A 4CRFA 1C5XB 1P02A 3M36A 1NROH 3TLOA 1HJ9A 1YPEH 2V3HH 3LT3A 5F8TA 5FX5A 1BTUA 5EOKA 1Z6JH 3GDUA 2G8TA 1A1RA 5EG4A 1B7XB 4TWWA 4TWYA 2Y7ZA 2ZG0H 1WV7H 3FP7E 3U8RH 2GMTB 4O9VA 4Y8YA 1WCZA 3AASA 1D3TB 2W3KA 3V13A 1FY4A 1FPCH 1KLTA 1EQ9A 2TGTA 1GHAF 1CBWB 1S82A 2BD2A 2ILNA 2ZFSA 3HGNA 2OXSA 4B2BA 3L6PA 1NRQH 3GDVA 1FXYA 2OC8A 3EQ0H 1O3KA 3MFJA 1KXAA 3ATMA 1O2MA 3SU0A 3TGKE 5F8XA 1C5YB 1Q31A 1TPSA 1UMAH 1BMAA 4XE4A 4YZUA 1HAHH 5FCKA 1EAWA 1YCPM 3GICB 4TPYA 1A46H 3MNXA 3A88A 4X1PU 3Q3YA 2NWNA 2JH6D 5TJXA 2OP9A 4H6SB 3RXMA 4RKOB 1SOZA 1F2SE 1ETSH 2EI7A 4ISOA 3SUGA 4U01A 1DICA 1SBWA 2GCTB 3SOSA 3M7QA 4AX9H 1P06A 3FZZA 1DXWA 2R3UA 3ZVCA 2CF8H 1P2NA 1GI2A 4TYDA 5HM2A 1ZPBA 1CA0C 2ZGBH 2GTBA 2F9OA 1AWHB 3SV8A 4O97A 1EP6A 1NT1A 1HFDA 1YPKH 5K7RA 1B0EA 3BTKE 1ELGA 1K1NA 2R9PA 4CHAC 4MPUA 3U8OH 1Y59T 3HK3B 2F9BH 2YNBA 2ZPSA 3Q76A 1CVWH 3SUDA 3EE0B 4FUDA 4CR5A 2VVVA 1WTHD 1C1WH 2B8OH 2WINI 2BDHA 1S81A 4JYVH 1C2HA 2SGAA 4ASHA 3TJVA 1HB0B 1SGQE 2H5CA 4ZUHA 1FPHH 1ZOMA 1A5IA 2BDBA 1HCGA 3BF6H 1C2FA 2A5KA 1ELAA 1F0RA 1AZZA 1F5RA 5GCHG 2STAE 3VEQB 3E8LA 3PLKA 1P57B 3SBKA 1C2JA 1O3LA 4DW2U 3PO1C 1DUEA 2R0KA 1O39A 3SU2A 1QFKH 1RRKA 3F9EA 1SQAA 2BYAX 1W11U 1EP5A 4H42U 3DHKH 1MAXA 2GX4A 1LKAA 1GBKA 1SFQB 2A7HA 4AZ2B 1P01A 2Z3CA 2RA3A 2HPQH 3KNXA 2BTCE 2WPHS 2ZPQA 4AG2A 1SLVB 1EZQA 1GJ8B 2C90B 1P2KA 2GZ9A 2WPIS 1ELCA 3CS7A 3RXQA 2HGTH 1TBQH 1TALA 3GCHB 3RUOA 2WUBA 2FX6A 1J15A 2IOTA 4NSVA 3UQOA 2BDAA 2FDAA 2ZWLH 3C1KA 1UTMA 1BBRE 1PQ5A 2G5VA 1O31A 1PYTC 1CT4E 5EXNA 1IAUA 1L2EA 1A3BH 4ISNA 1GBEA 1CA0B 5ESTE 2QAAA 2HNTF 2FP7B 3HK6B 4ZROA 1AE5A 2CF9H 5J4SA 3TGJE 1KDQB 1GI3A 1GJAB 1O5BB 4A5TS 3A86A 3M7UA 3KHVA 3L33A 1A5GH 2PKAB 4E05H 3N7OA 2B0FA 1TRMA 3BG8A 3R3GB 1KSNA 3EDXB 4D7FA 5DP6A 2NU2E 1Y8TA 4X1QU 3KF2A 1LDTT 4HTCH 3RMLH 1RTFB 1O2OA 1P04A 1WU1A 2TPIZ 1LO6A 3PWCA 1GJBB 2ZDVH 3VB7A 1O2UA 2BD7A 4X8TH 5L30H 3MO6A 2SNWA 1ANCA 3NUMA 1PPBH 3MH7A 2HVXA 1GI7B 2BD4A 3A87A 1OXGA 2VWOA 2FS9A 2GKVE 1WAYB 5EQSA 4A1TA 3GYLB 1C4Y2 1C2GA 1G2MA 1E38B 5DKMA 5FBIA 3VXEH 1S0RA 2A4RA 4I31A 1BTZA 1C5NH 1D6WA 1GMDF 1LHEH 3SJ9A 2CN0H 3I29A 1G3EA 1Z6EA 2C8ZB 3ZZ9A 4BTUB 2IJOB 4B73A 2A4GA 5DG6A 1K1MA 2XW9A 4X0WU 1HLTH 2IPHA 2GMTC 3ZZ3A 1HRTH 1SMFE 1P0SH 3VB4A 3ZZ7A 1C2MA 1QRXA 2JKHA 5EGMA 1MKXH 5C1XA 5FPTA 3LOXA 1O5EH 3SJIA 2BQWB 1V2JT 5GPIB 1IQEA 1V2ST 2H1UA 2XWBI 1P8VC 2A0QB 2AMQA 3PWBA 2FODA 4IN1A 3SHCH 1DY8A 2OD3B 1L0ZA 3GDSA 2BY6X 2Q6FA 3T25A 3SU1A 2UUKB 1PPHE 4E7RG 4ABFA 5LPRA 1FMGA 5B6OA 4Z0KA 5JB9S 1P3EA 4CR9A 3MU5A 1C5RA 4LOYH 3SU4A 4U32A 4LZ1H 3C27B 3GY2A 1PPEE 2Y5FA 1EZSC 1KTTB 2WPKS 4X1NU 5T6GA 3A8AA 4NSYA 3RXRA 2CHAB 3B8JA 4NZQA 5SGAE 1LPKB 2ZKSA 4IC5A 2BLOA 2WUCA 5EU8A 5GWZA 5J4QA 2PSXA 4FUGA 1EJMA 1JRTA 3LDXH 1HJAC 1G3BA 1EX3A 1V2UT 5LPFA 3LGWA 2NU4E 2FLBH 4ZHLU 1QJ7B 3RC5A 3RXJA 2AS9A 1GCTB 3RXHA 1Z8IB 1SLWB 3ZYEA 3RXEA 1YPGH 2C3SA 3M35A 5C5NA 2AMDA 5GXPA 4JK5A 2H9HA 4GVUA 3GCOA 5FBEA 3TPIZ 3I77A 2P8OC 4J1YA 2FMJA 3GY3A 1J9CH 1ORFA 3KCGH 4H6TA 4NA8A 4IW4E 3DD2H 2F9NA 2J95A 1DWBH 1WYKA 1NRPH 4X2VA 5IDKA 2PKSC 4FU7A 1BITA 1G37A 3KEEA 1KXDA 5F03A 3E0PB 3UREA 1O5GH 1LHGH 2O8MA 4Q7XA 1HAZB 1EKBB 1ZSKA 4ISHH 2ZFRH 4A6LA 1K22H 2P3UB 1NPMA 2Z9KA 2W7UA 2VH0A 4X2YA 4GHQA 1CU1A 1TNGA 1AGJA 1VR1H 2Z9GA 3RU4T 1BBRH 1O37A 2FOCA 3TK9A 1GBTA 1GHZA 1FY3A 1W0YH 2R0LA 1A0JA 1GI8B 2LNCA 4FUBA 2QV1A 1YM0A 1O3BA 5JBAS 4K5ZA 1TWXB 1HV7A 3ESTA 5IYTA 5C5OA 2FOAA 5LGOA 3A80A 1BZXE 1W14U 1G9IE 4X6PA 1SLXB 4WF8A 1UVUH 1OWKA 2THFB 4CRBA 3LC5A 2A5AA 5E8EH 1O2SA 2G81E 3EA7A 5EPYA 1GL0E 1CHOG 1VCQA 3SV2H 1K9OE 4I33A 2PUQH 1ZHRA 1UVOA 4K8BA 4KTSA 3DT0H 1UTKA 3P8FA 1UTNA 5DJ7A 4K60A 2XNIA 1YLCA 1FZZA 4RSPA 2FYQA 2PV9B 4NWKA 1HNEE 3QWCH 1GDQA 2WYGA 2OTVA 1SGFG 3RMMH 4Y71A 2XBVA 1O5DH 1RIWB 1CGJE 4UFDH 1N8OC 2TGPZ 3E16B 2A32A 3UOPA 1AKSA 2BY8X 1TB6H 2ANMH 1ETTH 3U98H 1GJDB 2C8YB 2ZIQH 1V2OT 1XX9A 1GI1A 3A89A 3ZZ6A 2O8UA 3AAVA 4Q2KA 5DP4A 1GBBA 3DFJA 4IMQA 2QF0A 1Y5AT 2ZEBA 2ZCKP 4DVAU 1EUFA 4O3TA 7ESTE 3E1XB 5C3NA 1O2VA 5A0CA 2G4TA 2FOHA 3A85A 1XUHA 4MNVA 3SNCA 1ZJDA 3BTGE 4ZMAH 3RDZA 1EOJA 3PROA 1P03A 4MLFB 5I25A 5C1UA 1DWDH 1Z8RA 1DANH 3SQEE 1CO7E 1O2XA 5EODA 4ZHAA 2ZFTA 1C5MD 1GBCA 3SN8A 1NS3A 4LXBH 4CRGA 3A7WA 3CP7A 1TX6A 3P8OA 1P05A 2HPPH 4IMZA 3F6UH 2VIOA 1YPJH 2FOGA 4GSOA 1YPLH 1OWEA 4X1RU 1MUEB 3SNEA 2ZDMA 2ZHFH 2GCTC 1MKWH 1P2MA 3UTUH 4WY3A 1QQ4A 3RXPA 4AYYB 5C2ZA 1QL7A 2A31A 1BRBE 2PGBB 3BTQE 3GCTF 3QK1A 3DA9B 4MG3A 1WOFA 4MPVA 1GJCB 9ESTA 2ZO3H 3EYDA 1T8OA 4VGCB 4I8KA 3TJNA 2QIQA 3VFEA 1GVKB 1BIOA 4BNRA 2ODQA 5EXMA 2HLCA 1F5LA 1INCA 1THSH 4TPIZ 5AFYH 2Y5GA 4NIVA 3A7XA 1NZQH 1E0FD 1C1NA 2VWLA 1IQGA 3ZYDA 1ELBA 1RXPA 2A2XH 1HXFH 3MHWU 1CHOF 3MMGA 1NFUA 1S5SA 3BTME 5A2MH 4JYUH 2VH6A 1HAXB 2VVCA 2I6SA 4FUIA 1BDAA 1XM1A 1QCPA 2HNTE 1MU8B 2QXIA 4MNWA 4E06H 1SPJA 3E3TA 4MVNA 2AIPA 4OS1A 2G55A 1CE5A 4SGAE 4JZDH 4ABEA 3LGIA 1WQVH 1RTKA 1MCVA 3S7HB 3SGAE 2HRVA 1TRYA 3ELAH 3BG4C 4X8VH 1D3DB 4HFPB 1FLEE 2BZ6H 2JH5D 2C4FH 2FXRA 5BPEA 1TAWA 1TOCB 3T28A 1O2KA 2ASUB 2Z7FE 3BEFB 3KN2A 2VJ1A 4JK6A 1C9PA 1N1LA 1MTWA 3TK6A 4MPWA 4ISIH 1BBRK 1HIAB 1C5TA 2VB0A 3Q00A 4F49A 1AUTC 2FTLE 1FY8E 2PKAA 2AH4X 4FUCA 3SJOA 1O38A 2V0BA 4NA7A 2ZFFH 3MTYA 4B75A 1UVTH 4CHAB 1O2LA 1O3OA 1GBMA 1TLDA 5HXFA 4K69A 1LVOA 2FI3E 1O3EA 2ZCHP 3MO3A 1Y3WA 5LPEA 1W8BH 1YGCH 2KAIA 3F9FA 1T31A 4AGJA 1VZQH 1ZMJA 2GDEH 1FV9A 5JBTA 3VB6A 1P11E 3MNCA 2TRMA 4NFFA 1KXFA 2BD3A 4AB8A 3GCTG 1PFXC 1W7XH 1H1BA 1JWTA 4LZ4B 1ZJKA 3TNTA 1V2VT 3V7TA 3PMHB 1OWJA 3LJJA 3ZVGA 1BMNH 2FEQH 3S9AA 1PPZA 2B9LA 5HM9A 1OP2A 3AW0A 1V3XA 1MU6B 1AI8H 2BY7X 4YT7H 1AFQC 4HI3A 1VGCC 3QLPH 3A7YA 1GVLA 1UO6A 4JZFH 5DP5A 1QL8A 4I8GA 1C5LH 7GCHG 1J14A 2XC5A 3HPTB 4H4FA 3TGIE 5F6MA 1LTOA 4ZKOU 1PPFE 5AHGH 1ZRKA 3UQVA 2Q6DA 1ZSLA 1C2EA 1ANBA 2P95A 2QXJA 1HAOH 2CV3A 1FN6A 3EA8A 5AF9H 1TPPA 3PLPA 4NA9H 1OYTH 1AN1E 4I8JA 1XUJA 4WVPE 1HYLA 1U6QA 3TH3H 1OPHB 4B2CA 1LHCH 2VNTA 1QB1A 1F0SA 1OP0A 3HGPA 1ZPZA 1GG6C 2H2ZA 3P6ZB 1TPAE 3ZZBA 4GPGA 2GDDA 3JZ2B 1GJ4H 2Z94A 1WTGH 3O8CA 1ZPCA 2BVXH 3FFGA 3M3SA 3SGQE 1OKXA 3BV9B 3MNBA 3A83A 5EPNA 1CBWC 3IG6B 2EC9H 1ETRH 4MPXA 1UCYK 1AFEH 1AE8H 1LQDB 2HNTC 2ZHEH 3QX5H 3SNAA 5E0HA 1QY6A 1CT0E 1KYNA 1GBJA 2A7CA 2ZHDA 5JDUB 4I32A 4BOHA 1V2LT 4KELA 4WJG2 1CGIE 1A5HA 2J2UA 2RDLA 5T6FA 5GCHF 4AFSA 3KQDA 3W95A 1BOQA 2Y6TA 2OC0A 1FONA 4RKJB 1IQHA 2QGRA 1ZGVA 3P95A 1QJ6B 2GD4B 2XCNA 3MU1A 2Z9LA 4BTIB 1MTUA 3SU6A 3K6YA 1O35A 3OU0A 4ABBA 1L1JA 1N6XA 4Y11E 1BB0B 2SFAA 2H6MA 3EA9A 3P8GA 4PROA 1D4PB 2OC7A 2SGPE 2UUFB 2AGGX 1ZSJA 1VJ9U 1V2QT 4WXIA 2DE8A 2UUYA 3EGKH 4I7YH 3RXVA 4GCHG 1UHBA 1RS0A 3RLWH 1L1GA 4X2XA 1A4WH 1Z71A 1YP9A 1LHDH 4BANB 1TGCA 1QQUA 2FTMA 1DWEH 2BY9X 3GY6A 2XXLA 2AGEX 2R2WU 2W7SA 1TNJA 2Z3EA 2EI6A 4UFGH 4D9RA 1FN8A 1ESAA 4AGKA 2Y7XA 2RCEA 3RXIA 3LC3A 4THNH 1WBGB 4YO9A 4I8LA 4YTAA 1K1LA 1MQ5A 4ABIA 1A2CH 1O2JA 2VIQA 2ZDKA 3OSYA 1GHXH 2BDIA 4DGJA 3QZRA 2TGAA 4K1EA 3PB1E 3ZVEA 3ODFA 3JZ1B 3RM2H 1AVXA 1KXEA 1OSSA 1OWHA 4AORA 3OY6U 3NWUA 4DOQA 2P3TB 1EZXC 4UFEH 5TCAA 1VITG 1UTPA 1QA7A 1TRNA 2Z9JA 1WQSA 3SUFA 2ZDNA 1QL9A 3SGBE 3WY8A 1UTOA 4BXSA 1RFNA 1C5ZB 1GMHF 2QC2A 5T6DA 4MDSA 1IQJA 2ZGCA 4UEHH 2OQUA 1FDPA 1HAGE 1BTHH 1Y3XA 1BMMH 1YF4A 2ULLA 1BHXB 2JETB 2BD9A 4Y8XA 3V3MA 1QURH 3D65E 1HAVA 1IQNA 1UVPA 2QY0B 1O2PA 1J8AA 3NPSA 3PMBB 4CRAA 1TBZH 6LPRA 4KTCA 2J4IA 3ATIA 1F0UA 5GIBA 2BLQA 3M61U 5C1YA 2SNVA 1ABIH 1GMCG 3K6ZA 2HWLB 3M5MA 1MTNB 2W26A 1IHSH 4YM9A 1V2TT 3NXPA 3BEUA 1UTLM 1TGSZ 4Q80A 2K1QA 4WH8A 2BX3A 1C1RA 3GY4A 2ZZUH 1DM4B 5G4BA 3BTEE 3SQHE 3QDZB 1SGCA 3SI3H 4XOJA 1K1JA 1BT7A 1HPGA 3LJOA 2UWPA 4XDEA 1IQMA 4SGBE 1A7SA 2OQ5A 5A0AE 2QA9E 2QN5T 5LH8A 4BAOB 1C5QA 1ZHPA 1CHGA 1QGFA 2BZAA 2QXHA 1RTLA 2ZQ1A 4UFFH 3PTNA 1P9UA 4ABAA 1P12E 4YOGA 1ZR0A 3O8DA 2DUCA 3LKWA 5A8YA 3BN9A 3ENSB 1C5OH 3UIRA 2FZZA 3RP2A 2CGAA 2YOLA 1CQQA 3LGYA 3LGTA 1IQKA 2VGCC 2ZDAH 3A8CA 5FHTA 1AB9B 3VGCC 2GT7A 1UCYH 3P17H 2PTNA 4ZXYH 1H8IH 4IGDA 4AYVB 4CH2B 1AVWA 4OGXA 3RXAA 3QUMP 1BCUH 1S85A 1O2RA 3BG4B 1GCTC 1TNHA 4FXGH 4M7GA 1T4UH 3BSQA 2PGQB 4X6MA 2FOFA 1GBHA 4YOJA 3O8RA 1EATA 1PYTD 3TVJB 1QRWA 3A84A 1O2WA 1UJ1A 1N6YA 1AU8A 1V6DA 1IOEA 2VU8E 4XSKU 5JBBS 3A7VA 4YLQH 2BVRH 1E35B 3SJ8A 1SL3A 1LMWB 3W94A 5FCRA 1ACBE 3KIDU 3UOUA 2H9EH 2BDGA 2A45B 5JPMH 5L2ZH 3Q77A 5DP3A 1AO5A 2CMYA 1C9TA 1QB6A 1UCYE 3KQCA 3CENA 2OBOA 1EB1H 2FESH 3LH3A 1ZMLA 2C8WB 2GGVB 2BDCA 4F4OC 1BTWA 5T3HA 1GPZA 1ANEA 2Z6BD 5K0HA 1SLUB 1TGNA 1F5KU 1TE0A 2ANWA 2AEIH 3QGNB 4IBLH 1CT2E 4U30A 1PPCE 2H9TH 2QF3A 5AVDA 3TNSA 2ZDLA 1S6FA 1ZLRA 5DP7A 8KME2 2WV4A 2SGEE 3ZZ5A 1AVGH 2FOBA 2ZHQH 3UY9A 1ELFA 4IS5A 1T8NA 2BVSH 3RXOA 3S0NA 1SFIA 1GGDC 1QNJA 2NU0E 5HGGA 1GMCF 4ZKSU 2SGQE 3RM0H 1SSXA 5E0GA 1ZGIA 1EXFA 1TABE 4LK4A 2ZU1A 1IQIA 4DJZB 3PLBA 2W5EA 1DPOA 5FX6A 5CHAC 5DPAA 4X1SU 4INHA 2D8WA 1MKXK 1O3PB 4UDWH 1P09A 4UONA 3TITA 1C5SA 3SU3A 2BQ7B 4RN6A 2TIOA 1EJNA 1ANDA 3QTVH 4A1XA 4DIIH 2UWLA 4ZH8A 1XXFA 3MO9A 3PTBA 2F9VA 1KXCA 5JBCS 1C2LA 6ESTA 4Q7YA 4IC6A 1A3EH 1PJPA 1TNKA 1W3CA 2GCHG 1OOKB 6GCHG 1AMHA 1NFWA 2G4UA 1XUKA 1O3CA 3BEIB 1BTXA 2BY5X 3SV7A 3RXUA 1MMJN 4BXWA 2FOMB 2OBQA 3FZDA 3OYPA 1O3FA 3SNDA 4WWYA 1GI0A 3BTDE 1TMBH 2FIRH 2STBE 1UK4A 5EXLA 4Y7AA 1DWCH 5EW2H 2D2DA 1XVMA 2VGCB 1S83A 2Q6GA 1SGPE 4GAWA 2J38A 4FVBA 3U8TH 2ANKH 1SGFA 4JZEH 1UK2A 4ZXXH 4U2WA 2WYJA 3M3VA 4KGAA 2P8OB 3MOCA 4TY6A 4NIYA 3PM3A 1SG8B 2ZGHA 1HGTH 4AOQA 4A92A 5A8XA 1GBFA 5ETXA 1TA6A 1ID5H 2QXGA 1ZTKA 1MBMA 3UFAA 1O2IA 4FUHA 2A7JA 4CBNA 4K3JA 2QCYA 3U69H 1A61H 1V2KT 1NU9A 1O0DH 1J17T 3RU4D 4JCNA 3B9FH 3ZV9A 2Y80A 1NESE 1S84A 1JXPA 1ABJH 3UNRA 3Q3KA 1C5VA 1YCPH 2XC0A 2ZPRA 1BHXF 1AKSB 1ELEE 1AQ7A 4WH6A 1SGNE 1S0QA 2UUJB 2ZU4A 1C2IA 3D62A 1AD8H 1T7CA 1EPTA 3AW1A 1SGIB 2QYIA 1P2JA 3G01A 1EOLA 3T26A 3NKKA 4ABHA 1AB9C 3VGCB 4WXVA 2SGFE 3F68H 1BRUP 2P59A 2A4QA 2ESTE 4NGAH 2OC1A 1O2QA 3GCNA 2G00A 3LONA 1SI5H 4B76A 1FAXA 1RD3B 1O3HA 3MH6A 1C5WB 1EAXA 1VCWA 3RC6A 5DP9A 4Y6DA 5HYOA 1G30B 3MU4A 3UR6A 1L1NA 2ZHWH 4X2WA 3HATH 1SVPA 1XKBC 4NFEA 1UTQA 4ZKRU 4WMFA 3U1IB 2J94A 1NFYA 1O2NA 3SNBA 3RXBA 3PV4A 5F8ZA 1GHAG 4R0IA 1TNLA 4FUJA 2OINA 3ZZAA 1UHBB 1O30A 1C1UH 1XXDA 7LPRA 1C5PA 2XC4A 2F9PA 3BTTE 1OX1A 1QRZA 4GUXA 2J92A 2GV7A 1V2RT 1O3MA 2ODPA 3LPRA 3S7KB 1BJUA 3ATLA 3VB3A 2F9UA 1V2MT 1NRNH 2RA0A 1DSUA 1KXBA 2V3OH 3RXDA 1T32A 4Y76A 3E0NB 3MH4A 1DITH 4DY7B 1BTPA 2TGDA 2XBWA 3MH5A 1SC8U 1T8LA 1GJ6A 4D76A 4FU9A 1LQEA 3BIVH 1O3IA 1EZUC 4NCYA 4NIXA 1NN6A 1DDJA 1RJXB 1SGRE 3RXLA 1O2HA 4R8TB 5AFZH 1YPHC 1J16A 1G2LA 4AN7A 2G5NA 1GGDB 4NG9H 3E90B 4K1SA 2EI8A 2G52A 1JIMA 4D8NA 1FNIA 2ZGXH 3MYWA 1EPTB 4OS7A 5I46H 1G36A 4X6OA 1ARBA 1TOMH 3Q3XA 1O33A 3H7TA 2OCVB 1DOJA 4DCDA 2Y81A 3S9CA 1C4V2 1KLIH 4AFQA 1TYNA 1AUJA 4YESB 4B1TA 1DFPA 1ESTA 1P2QA 2VIPA 5GJ4B 1O3JA 1YBWA 2FO9A 1ZRBA 2A5IA 2SGDE 4E7NA 2ZFQH 4ABGA 2V35A 5EQRA 1SOTA 3ZVBA 2GZ7A 3K2UA 3TIUA 1BRAA 5EW1H 1BUIA 1F7ZA 5FPSA 3KQBA 2AIQA 4Y79A 1GDUA 2F3CE 2ZQ2A 5L2YH 2DE9A 1N8OB 1TA2A 4XFQA 4BAHB 4TY7A 1GHBG 1YKTA 1HAVB 3OTJE 4UE7H 2FX4A 1C1TA 2O8TA 1DT2A 3A8DA 4CBOA 2O8LA 2BXTH 1MTSA 1GG6B 3F1SB 3L3TA 1AHTH 4MNXA 4NZLA 3U9AH 1H9LB 2ZU2A 4FUEA 1QIXB 1THPB 1VJAU 1TNIA 3H5CB 1P9SA 5TCCA 1HAIH 2EA3A 3SI4H 1TX8A 1MD8A 4J2YB 5A8ZA 1ELTA 1GI6A 2V6NA 4INLA 1L4ZA 1PQ7A 1W2KH 3D23A 1QB9A 3QGJA 3RXGA 4A1VA 2A4OA 1MD7A 3KL6A 3SHAH 3UPEA 1D3QB 2CXVA 1C2DA 2XRCA 1GBLA 1XMNB 3AAUA 1Q3XA 3NZIA 8GCHF 1MQ6A 1TGTA 1AY6H 3IITA 3MI4A 2KAIB 3TH2H 5GDSH 4KP0A 3UNQA 4QT8C 3TH4H 2P3FH 4Y0ZE 1D6RA 1DSTA 1G3DA 1JMOH 2P94A 3TU7H 1A0HB 1W10U 5FXLA 1W13U 1E34B 2Z3DA 3ZV8A 5DP8A 3QO6A 1TMTH 5ABWA 1W0ZU 3A7ZA 4YLUA 5DGJA 1DVAH 3GYMA 4WMEA 1C5UA 1LPGB 1O32A 2PSYA 2AMPA 1C4U2 4OS6A 2PTCE 3ZVDA 1VCPA 2BXUH 1HBTH 3FVFB 3GOVB 3SV9A 1AWFH 1HUTH 4I8HA 1BTYA 1KIGH 1S6HA 3LGVA 1O5CB 1CA8B 3A7TA 3URDA 4X8SH 2NU3E 2ZCLP 1Y3UA 4OS5A 2GZ8A 1HXEH 1K1PA 2J9NA 1KY9A 1DY9A 2PUXB 3H7OA 3SO3A 3QN7A 1VGCB 1TQ7B 4D9QA 3ZZCA 4ZHMU 2YNAA 1MCTA 3FANA 2VVUA 5C20A 1QA0A 2ODYB 1EPTC 1EB2A 3O8BA 3RU4E 1EASA 4DT7B 4GLYA 4XBDA 4HZHA 1SGEE 2B7DH 2ZGJA 1W12U 2BM2A 3FP6E 2GV6A 1ZMNA 3RMNH 1ELDE 3FAOA 1T4VH 3P8NA 2CHAC 1RGQA 3BTWE 2ZFPH 3RMOH 1O2YA 1O2GH 1K1OA 2UWOA 4AFUA 3ZZDA 3SV6A 1O3DA 3D49H 1TGBA 2XTTB 3NCLA 5FAHA 2EEKA 3BIUH 1CGHA 5CE1A 1C1MA 1FI8A 1V2NT 2FM2A 1F0TA 1GVZA 3FP8E 5C67A 1QTFA 1XUGA 1HJAB 1GL1A 1GWAA 2RG3A 4GCHF 1LVMA 3A81A 1V2WT 1HDTH 2I6QA 3GY7A 3M5LA 2CJIA 3IWMA 1GDNA 4ABJA 1DE7H 1C1OA 1O3AA 3DFLA 3RC4A 1JBUH 3SU5A 4KTUA 2P16A 4HGCA 1ELVA 3F9GA 1VITF 2H5DA 2VWNA 3AVZA 1FY1A 1FUJA 2FWWA 2WV5A 3ZZ8A 3RXCA 5CMXH 1GCDA 1QBOA 1THRH 1O2TA 5JB8S 3QZQA 4B2AA 2FI4E 1GI5A 3E91A 2XCFA 2ZC9H 4AB9A 1Q2WA 3TJUA 1HAYB 4Z6AH 1G32B 3VB5A 1YYY1 3MU0A 1SQTA 1KLJH 4CRDA 1JRSA 3SORA 3ZZ4A 1NY22 4Y7BA 2O9QA 1ZTJA 4Y10E 1OS8A 5L6NH 1FY5A 1E37B 1GJ9B 3ATKA 4ZAEA 1P2IA 1FAKH 3R0FA 4O03A 1O36A 4ISLA 1C2KA 3RXKA 3DUXH 1H8DH 1GI9B 2ZP0H 2WPJS 2FS8A 1K28D 1BMLA 4BAMB 4Q7ZA 1LCYA 1WSSH 2FOEA 5H4IB 1YPHE 1Y5BT 2XYAA 3NK8A 1WUNH 2FLRH 2ALPA 1YCPK 3T29A 1QR3E 3BTFE 3UNSA 4FVDA 5DK1A 1Z7KA 1UTJA 2FPZA 1LVYA 3TK5A 1ESBA 1FJSA 6CHAB 1GBAA 1SGDE 2C93B 1MTVA 1OWIA 1BA8B 2ZF0H 3E6PH 1C1SA 3GY8A 1LHFH 2BX4A 4MTBA 1OWDA 1SHYA 3STJA 3A8BA 1H9IE 1K21H 1YLDA 2XBYA 2AYWA 3STIA 2Y5HA 2A1DB 2PKSB 4INKA 2JETC 1KTSB 2HALA 1RIWC 4OS2A 2ZI2H 1SGYE 1C1PA 4OS4A 1XUIA 4XBBA 5DO4H 3M5OA 2W3IA 2Z9IA 1DXPA 1PPGE 1PQ8A 1ZTLA 3PO1B 1NRRH 2HOBA 2BMGB 4NIWA 3SW2B 1MAYA 3KQEA 1MH0A 1KDQA 1OYQA 1M9UA 4B74A 1K2I1 5A09A 1NC6A 2O8WA 3SUEA 2PHBA 3P70B 4JZIA 1T8MA 3T62A 2P93A 1TQ0B 2A2QH 4K8YA 7KMEH 1UVSH 4YOIA 2OLGA 4DIHH 2XWAA 1D9IA 2VWMA 4BAKB 4K1TA 1HAPH 8ESTE 2TBSA 1EAIA 5E2OA 1NU7B 1IHTH 1Z8JB 3GCHC 1MZAA 2ZTZA 2PLXA 1BRCE 3VPKA 3ODDA 1O3GA 1P3CA 4JMYA 1LPZB 1XUFA 1FIZA 1AFQB 2BLWA 2IN2A 2XBXA 2ZNKH 4K2YA 1IQFA 3B23B 2M5TA 1Z1JA 2BOKA 3SJKA 4B71A 3PMJA 1B5GH 3SZNA 1GMDG 2R3YA 1HJ8A 1TIOA 2PR3A 1MZDA 6CHAC 4CREA 3ITIA 2BOHB 1GBIA 3M7TA 4XBCA 5A0BA 1NO9H 2LPRA 1JOUB 8LPRA 2AFQB 1D3PB 3KGPA 3U1JB 2PWXA 2GVFA 1O2ZA 1IQLA 2Y82A 1DUAA 1EAUA 1LKBA 1TFXA 1X7AC 1QBNA 4OGYA 1DLKB 1NFXA 1VITH 3LH1A 3F9HA 1Y5UT 4CH8B 1NM6A 1ZHMA 4VGCC 4D7GA 1ZYOA 2VIVA 1AZ8A 3UR9A 1A0LA 1XKAC 3A82A 2D1JA 1ZZZA 1SGTA 3I78A 5JYIA 2ZTYA 1DS2E 3QTOH 4JYTA 2AERH 2ZECA 4ABDA 1F92A 5EQQA 1C1VH 4BAQB 1C1QA 1P10A 1GJ7B 1Z8GA 3V0XA 3M3TA 2WPLS 2ZU5A 4JZ1A 2ANYA 3OY5U 2J34A 1CSOE 1H4WA 1DLEA 1O3NA 2FYRA 4O3UA 3RLYH 1GHBF 5E0JA 3T2NA 4DURA 3RXFA 3TJOA 3K9XB 4UD9H 1SR5C 2B5TB 1TBRH 2GCHF 2VIDA 5E2PA 1Z1IA 4NWLA 2ZU3A 1O5FH 4BTTB 2BLVA 3ATWA 9LPRA 1UK3A 1TONA 4ZKNU 1BJVA 2G51A 1B0FA 6GCHF 3RXSA 2D26C 3BTHE 3T5FH 1OP8A 3V12A 1G3CA 1ARCA 3UUZA 2ZTXA 2BD5A 3LU9B 1HIAA 4Y8ZA 5CHAB 1TMUH 2FI5E 3PMAB 4X6NA 1FIWA 1MKWK 3P92A 1BQYA 3MWIU 1GHWH 1LVBA 5BRRE 3PYHA 2VINA 5HMAA 3LGUA 3LIWA 4MNYA 5FPYA 3URCA 1NRSH 5ESBA 1GMHG 3M5NA 1O34A 4KKDA 4DG4A 3CS0A 4Y0YE 1O5AB 2Q1JA 1QBVH 2F83A 3UWJH 1GBDA 3K65B 4IN2A 3S69A 2BHGA 2PFEA 1V2PT 4FUFA 1Y3VA 2C8XB 1SQOA 3ZVFA 4AFZA 8GCHG 2WPMS 3S9BA 1SHHB 1YC0A 1E36B 3T27A 1JIRA 1PQAA 1TPOA 7GCHF 2BQ6B 1AIXH 4FU8A 1GHYH 2VIWA 2BB4A 2PW8H 1Y3YA 1YPMH 3EAJA 2GP9B 4CRCA 4A7IB 2BD8A 1SB1H 3UWIA 2F91A 1H9HE 1FQ3A 1EJAA 1GJ5H 3RXTA 3GISB 1K1IA 1MBQA 4GHTA 1TX7A 3OX7U 1W7GH 1MTNC 5PTPA 4ESTE 4YT6H 2NU1E 2R2MB 1XVOA 4X8UH 3ZVAA 2GT8A 1DX5M 4MQAA 1NTPA 2ZA5A 1QHRB 3HKJB 3HKIB 2BDYA 3M37A 3GY5A 2AGIX 3MNSA 2JH0D 3VXFH
chains in the Genus database with same CATH superfamily
1QJ1B 4P00A 1L4DA 1P2OA 2CK3D 4AG1A 1GHVH 2OUAA 2ALVA 3MU8A 4WMDA 1GI4A 4CRFA 1C5XB 1P02A 3M36A 1NROH 3TLOA 1HJ9A 1YPEH 2V3HH 3LT3A 5F8TA 5FX5A 1BTUA 5EOKA 1Z6JH 3GDUA 2G8TA 1A1RA 5EG4A 1B7XB 4TWWA 3GS9A 2Y7ZA 2ZG0H 1E79D 1WV7H 3FP7E 4TWYA 3U8RH 2GMTB 4O9VA 1K0HA 4Y8YA 1WCZA 3AASA 1D3TB 2W3KA 3V13A 1FY4A 1FPCH 1KLTA 1EQ9A 2TGTA 1GHAF 1CBWB 1S82A 2BD2A 2ILNA 2ZFSA 3HGNA 2OXSA 4B2BA 3L6PA 1NRQH 3GDVA 1FXYA 2KFWA 2OC8A 3EQ0H 1O3KA 3MFJA 1KXAA 3ATMA 1O2MA 3SU0A 3TGKE 5F8XA 2QF4A 1C5YB 1Q31A 1TPSA 1UMAH 1BMAA 4XE4A 4YZUA 1HAHH 3KYFA 5FCKA 1EAWA 1YCPM 3GICB 4TPYA 1A46H 3MNXA 3PRBA 3A88A 4X1PU 3Q3YA 2NWNA 2JH6D 5TJXA 2OP9A 4H6SB 3RXMA 4RKOB 1SOZA 1F2SE 1ETSH 2EI7A 4ISOA 3SUGA 3OEHD 4U01A 1DICA 1SBWA 2GCTB 3SOSA 3M7QA 4AX9H 1P06A 3FZZA 1DXWA 2R3UA 3ZVCA 2CF8H 1P2NA 1GI2A 4TYDA 5HM2A 1ZPBA 1CA0C 2ZGBH 2GTBA 2F9OA 1AWHB 3SV8A 4O97A 1EP6A 1NT1A 1HFDA 1YPKH 5K7RA 1B0EA 3BTKE 5C0TA 1ELGA 1K1NA 2R9PA 4CHAC 4MPUA 3U8OH 1Y59T 3HK3B 2F9BH 2YNBA 2ZPSA 3Q76A 1CVWH 3SUDA 3EE0B 4FUDA 4CR5A 2VVVA 1WTHD 1C1WH 2B8OH 2WINI 2BDHA 1S81A 4JYVH 1C2HA 2SGAA 4ASHA 3TJVA 1HB0B 4Z1MD 3F0PA 1SGQE 2H5CA 4ZUHA 1FPHH 1ZOMA 3SYJA 1A5IA 2BDBA 1HCGA 3BF6H 1C2FA 2A5KA 1ELAA 1F0RA 1AZZA 1F5RA 5GCHG 2STAE 3VEQB 3E8LA 3PLKA 1P57B 3SBKA 1C2JA 1O3LA 4DW2U 3PO1C 1DUEA 2R0KA 1O39A 3SU2A 1QFKH 1RRKA 3F9EA 1SQAA 2BYAX 1YWUA 1W11U 1EP5A 4H42U 3DHKH 1MAXA 2GX4A 1LKAA 1GBKA 1SFQB 2A7HA 2KCPA 1P01A 2Z3CA 2RA3A 4AZ2B 2WSSD 2HPQH 3KNXA 2BTCE 2WPHS 2ZPQA 4AG2A 1SLVB 1EZQA 1GJ8B 2C90B 2KX4A 1P2KA 2GZ9A 2WPIS 1ELCA 3CS7A 3RXQA 2HGTH 1TBQH 1TALA 3GCHB 3RUOA 2WUBA 2FX6A 1J15A 2IOTA 4NSVA 3UQOA 2BDAA 2FDAA 2ZWLH 3C1KA 1UTMA 1BBRE 1PQ5A 2G5VA 1O31A 1PYTC 2LP6A 1CT4E 5EXNA 1IAUA 1L2EA 1A3BH 4ISNA 1GBEA 1CA0B 5ESTE 2QAAA 2HNTF 2FP7B 3DSOA 3HK6B 4ZROA 1AE5A 2CF9H 5J4SA 3TGJE 1KDQB 1GI3A 1GJAB 1O5BB 4A5TS 3A86A 3M7UA 3KHVA 3L33A 1A5GH 2KM0A 2PKAB 4E05H 3N7OA 2B0FA 3W1EA 1TRMA 3BG8A 3R3GB 1KSNA 3EDXB 4D7FA 5DP6A 2NU2E 1Y8TA 4X1QU 3KF2A 1LDTT 4HTCH 3RMLH 1RTFB 1O2OA 1P04A 1WU1A 2TPIZ 1LO6A 3PWCA 1GJBB 2ZDVH 3VB7A 1O2UA 2JJ2D 2BD7A 4X8TH 5L30H 3MO6A 2SNWA 1ANCA 3NUMA 1PPBH 3MH7A 2HVXA 1GI7B 2BD4A 3A87A 1OXGA 2VWOA 2FS9A 2GKVE 2F43B 4B6EA 1WAYB 5EQSA 4A1TA 3GYLB 1C4Y2 1C2GA 1G2MA 1E38B 5DKMA 5FBIA 3VXEH 1S0RA 2A4RA 4I31A 1BTZA 1C5NH 1D6WA 1GMDF 1LHEH 3SJ9A 5C0UA 2CN0H 3I29A 1G3EA 1Z6EA 2C8ZB 3ZZ9A 4BTUB 2IJOB 1COWD 4B73A 2A4GA 5DG6A 1K1MA 2XW9A 4X0WU 1HLTH 2IPHA 2GMTC 3ZZ3A 1HRTH 1SMFE 1P0SH 3VB4A 3ZZ7A 1VKYA 1C2MA 1QRXA 2JKHA 5EGMA 1MKXH 5C1XA 5FPTA 3LOXA 1O5EH 3SJIA 2BQWB 1V2JT 5GPIB 2XNDD 1IQEA 1V2ST 2H1UA 2XWBI 1P8VC 2A0QB 2AMQA 3PWBA 2FODA 4IN1A 3SHCH 1DY8A 2OD3B 1L0ZA 3GDSA 2BY6X 2Q6FA 3T25A 3SU1A 2UUKB 1PPHE 4E7RG 4ABFA 5LPRA 1FMGA 5B6OA 4Z0KA 5JB9S 1P3EA 4CR9A 3MU5A 1C5RA 4LOYH 3SU4A 4U32A 4LZ1H 3UB0A 3C27B 5EJ1A 3GY2A 1PPEE 2Y5FA 1EZSC 4ZCNA 4ASUD 1KTTB 2WPKS 4X1NU 5T6GA 2M2AA 3A8AA 4NSYA 3RXRA 2CHAB 3B8JA 4NZQA 5SGAE 2PP6A 1LPKB 2ZKSA 4IC5A 2BLOA 2WUCA 5EU8A 5GWZA 5J4QA 2PSXA 4FUGA 1EJMA 1JRTA 3LDXH 2RFKC 1HJAC 1G3BA 1EX3A 1V2UT 5LPFA 3LGWA 2NU4E 2AHME 2FLBH 5C94A 3F0OA 4ZHLU 1QJ7B 3RC5A 4AC9A 3RXJA 2AS9A 1GCTB 3RXHA 1Z8IB 1SLWB 3ZYEA 4RI0A 3RXEA 1YPGH 2C3SA 3M35A 5C5NA 2AMDA 5GXPA 4JK5A 2H9HA 4GVUA 3GCOA 5FBEA 3TPIZ 3I77A 2P8OC 4J1YA 2FMJA 3GY3A 1J9CH 1ORFA 3KCGH 4H6TA 4NA8A 4IW4E 3DD2H 2F9NA 2J95A 1DWBH 1WYKA 1NRPH 4X2VA 5IDKA 2PKSC 4FU7A 1BITA 1G37A 3KEEA 1KXDA 5F03A 3E0PB 3UREA 1O5GH 3OE7D 1LHGH 2EY4C 2O8MA 4Q7XA 1HAZB 1EKBB 1ZSKA 4ISHH 2ZFRH 4A6LA 2JDID 1K22H 2P3UB 1NPMA 2Z9KA 2W7UA 2VH0A 4X2YA 4GHQA 1CU1A 1TNGA 1AGJA 1VR1H 2Z9GA 5GNDA 3RU4T 2JIZD 1BBRH 1O37A 2FOCA 3TK9A 1GBTA 1GHZA 1FY3A 1W0YH 2R0LA 1A0JA 1GI8B 2LNCA 4FUBA 5F53A 2QV1A 1YM0A 1O3BA 5JBAS 4K5ZA 1TWXB 1HV7A 3ESTA 5IYTA 5C5OA 2FOAA 4ACAA 5LGOA 3A80A 1BZXE 5EJZA 1W14U 1G9IE 4X6PA 1SLXB 4WF8A 1UVUH 1OWKA 4XRNA 2THFB 4CRBA 3LC5A 2A5AA 5E8EH 1O2SA 2G81E 3EA7A 5EPYA 1GL0E 1CHOG 1VCQA 3SV2H 1K9OE 4I33A 2PUQH 3PRDA 1ZHRA 1UVOA 4K8BA 4KTSA 3DT0H 1UTKA 3P8FA 1UTNA 5DJ7A 4K60A 2XNIA 1YLCA 1FZZA 4RSPA 2FYQA 2PV9B 3DCLA 4NWKA 1HNEE 3QWCH 1GDQA 2WYGA 2OTVA 1SGFG 3RMMH 4Y71A 2XBVA 1O5DH 1RIWB 4B6FA 1CGJE 4UFDH 1N8OC 2TGPZ 3E16B 2A32A 3UOPA 1AKSA 5T1VA 2BY8X 1TB6H 2ANMH 1ETTH 3U98H 4XD7D 1GJDB 5KEDA 2C8YB 2ZIQH 1V2OT 1XX9A 1GI1A 3F3BA 3A89A 3ZZ6A 2O8UA 3AAVA 4Q2KA 5DP4A 1GBBA 3DFJA 4IMQA 3PV5A 2QF0A 1Y5AT 2ZEBA 2ZCKP 4DVAU 1EUFA 4O3TA 3OAAD 3E1XB 5C3NA 7ESTE 1O2VA 5A0CA 2G4TA 2FOHA 3A85A 1XUHA 4MNVA 3SNCA 1ZJDA 3BTGE 4ZMAH 3RDZA 1EOJA 3PROA 1P03A 4MLFB 5I25A 5C1UA 1DWDH 1Z8RA 1DANH 3SQEE 1CO7E 1O2XA 5EODA 4ZHAA 2ZFTA 1C5MD 1GBCA 3SN8A 1NS3A 4LXBH 4CRGA 3N99A 3N7DA 3A7WA 3CP7A 1TX6A 3P8OA 1P05A 2HPPH 4IMZA 3F6UH 1E1QD 2VIOA 1YPJH 2J98B 2FOGA 4GSOA 1YPLH 1OWEA 4X1RU 1MUEB 3SNEA 2ZDMA 2ZHFH 2GCTC 1MKWH 1P2MA 3UTUH 4WY3A 1QQ4A 3RXPA 4AYYB 5C2ZA 1QL7A 2A31A 1BRBE 2PGBB 3BTQE 3GCTF 3QK1A 3DA9B 4MG3A 1WOFA 4MPVA 1GJCB 9ESTA 2ZO3H 3EYDA 1T8OA 4VGCB 4I8KA 3TJNA 2QIQA 3VFEA 1GVKB 1BIOA 4BNRA 2ODQA 5EXMA 2HLCA 1F5LA 1INCA 1THSH 4TPIZ 5AFYH 2Y5GA 4NIVA 2EQNA 3A7XA 1NZQH 1E0FD 1C1NA 2VWLA 1IQGA 5KGOA 3ZYDA 1ELBA 1RXPA 2A2XH 1HXFH 3MHWU 1CHOF 3MMGA 1NFUA 1S5SA 3BTME 5A2MH 4JYUH 2VH6A 1HAXB 2VVCA 2I6SA 4FUIA 1BDAA 3WWBA 1XM1A 1QCPA 2HNTE 1MU8B 2QXIA 4MNWA 4E06H 1SPJA 3E3TA 4MVNA 2AIPA 4OS1A 2G55A 1CE5A 4SGAE 4JZDH 4ABEA 3LGIA 1WQVH 1RTKA 1MCVA 3S7HB 3SGAE 2HRVA 5HKKD 1TRYA 1SQRA 3ELAH 3BG4C 4X8VH 1D3DB 4HFPB 1FLEE 2BZ6H 2JH5D 2C4FH 1H8HD 2FXRA 5BPEA 1TAWA 1TOCB 3T28A 1O2KA 2ASUB 2Z7FE 3BEFB 3KN2A 2VJ1A 4JK6A 1C9PA 1N1LA 1MTWA 3TK6A 4MPWA 4ISIH 1BBRK 1HIAB 1C5TA 2VB0A 3Q00A 4F49A 1AUTC 2FTLE 1FY8E 2PKAA 2AH4X 4FUCA 3SJOA 1O38A 2V0BA 4NA7A 2ZFFH 3MTYA 4B75A 1UVTH 4CHAB 1O2LA 3F2HA 1O3OA 1GBMA 1TLDA 5HXFA 4K69A 1LVOA 2FI3E 2J98A 1O3EA 2ZCHP 3MO3A 1Y3WA 5LPEA 1W8BH 1YGCH 2KAIA 3F9FA 1T31A 4AGJA 1VZQH 1ZMJA 2GDEH 1FV9A 5JBTA 3VB6A 1P11E 3MNCA 2TRMA 4NFFA 1KXFA 2BD3A 4AB8A 3GCTG 1PFXC 1W7XH 1H1BA 1JWTA 4LZ4B 1ZJKA 3TNTA 1V2VT 3V7TA 3PMHB 1OWJA 3LJJA 3ZVGA 1BMNH 2FEQH 3S9AA 1PPZA 2B9LA 5HM9A 1OP2A 3AW0A 1V3XA 1MU6B 1AI8H 2BY7X 4YT7H 1AFQC 4HI3A 1VGCC 3QLPH 3A7YA 1GVLA 1UO6A 4JZFH 5DP5A 1QL8A 4I8GA 1C5LH 7GCHG 1J14A 2XC5A 3HPTB 4H4FA 3TGIE 5F6MA 1LTOA 4ZKOU 1PPFE 5AHGH 1ZRKA 3UQVA 2Q6DA 1ZSLA 1C2EA 1ANBA 2P95A 2QXJA 1HAOH 2CV3A 1S6LA 1FN6A 3EA8A 4FOUC 5AF9H 1TPPA 3PLPA 4NA9H 1OYTH 1AN1E 4I8JA 1XUJA 4WVPE 1HYLA 1U6QA 3TH3H 1OPHB 4B2CA 3DSGA 1LHCH 2VNTA 1QB1A 1F0SA 1OP0A 3HGPA 1ZPZA 1GG6C 2H2ZA 3P6ZB 1TPAE 3ZZBA 4GPGA 2GDDA 3JZ2B 1GJ4H 2Z94A 1WTGH 2WZQA 1ZPCA 3O8CA 2QE7D 2BVXH 3FFGA 3M3SA 3SGQE 1OKXA 3BV9B 3MNBA 1EFRD 3A83A 5EPNA 1CBWC 3IG6B 2EC9H 1ETRH 4MPXA 1UCYK 1AFEH 1AE8H 1LQDB 2HNTC 2QF5A 2ZHEH 3QX5H 3SNAA 5E0HA 1QY6A 1CT0E 1KYNA 1GBJA 2A7CA 2ZHDA 5JDUB 4I32A 4BOHA 1V2LT 4KELA 4HG6A 4WJG2 1CGIE 1A5HA 2J2UA 2RDLA 5T6FA 5GCHF 4AFSA 3KQDA 3U28C 3W95A 1BOQA 2Y6TA 2OC0A 1FONA 4RKJB 1IQHA 2QGRA 1ZGVA 3P95A 1QJ6B 2GD4B 2XCNA 3MU1A 2Z9LA 4BTIB 1MTUA 3SU6A 3K6YA 1O35A 3OU0A 4ABBA 1L1JA 1N6XA 4Y11E 1BB0B 2SFAA 2H6MA 3EA9A 3P8GA 4PROA 1D4PB 2OC7A 2SGPE 2UUFB 2AGGX 1ZSJA 3FOAA 1VJ9U 1V2QT 4WXIA 2DE8A 2UUYA 3EGKH 4I7YH 3RXVA 4GCHG 1UHBA 1RS0A 3RLWH 1L1GA 1NBME 3CNRA 3OEED 4X2XA 1A4WH 1Z71A 1YP9A 1LHDH 4BANB 1TGCA 1QQUA 2FTMA 1DWEH 2BY9X 5CDFE 3GY6A 3PV2A 2XXLA 2AGEX 2R2WU 2W7SA 1TNJA 2Z3EA 2EI6A 4UFGH 4D9RA 1FN8A 1ESAA 4AGKA 2Y7XA 2RCEA 3RXIA 3LC3A 4THNH 1WBGB 4YO9A 4I8LA 4YTAA 1K1LA 1MQ5A 4ABIA 1A2CH 1O2JA 2VIQA 2ZDKA 2JJ1D 1GHXH 3OSYA 2BDIA 3KYGA 4DGJA 3QZRA 2TGAA 4K1EA 3PB1E 3ZVEA 4TSFD 3ODFA 3JZ1B 3RM2H 1AVXA 1KXEA 1OSSA 1OWHA 4AORA 3OY6U 3NWUA 4DOQA 2P3TB 1EZXC 4UFEH 5TCAA 1VITG 1UTPA 1QA7A 1TRNA 2Z9JA 1WQSA 3SUFA 2ZDNA 1QL9A 3SGBE 3WY8A 1UTOA 4BXSA 1RFNA 1C5ZB 1GMHF 2QC2A 5T6DA 4MDSA 1IQJA 2ZGCA 4UEHH 2OQUA 1FDPA 1HAGE 1BTHH 1Y3XA 1BMMH 1YF4A 2ULLA 1BHXB 2JETB 2BD9A 4Y8XA 3V3MA 1QURH 3D65E 1HAVA 2WPDD 1IQNA 1UVPA 2QY0B 1O2PA 1J8AA 3NPSA 3PMBB 4CRAA 1TBZH 2OK5A 6LPRA 4KTCA 2J4IA 3ATIA 1OHHD 1F0UA 5GIBA 2BLQA 3M61U 5C1YA 2SNVA 1ABIH 1GMCG 3K6ZA 2HWLB 3M5MA 1MTNB 2W26A 1IHSH 4YM9A 1V2TT 3NXPA 3BEUA 1UTLM 1TGSZ 4Q80A 2K1QA 4WH8A 2BX3A 1C1RA 3GY4A 2ZZUH 1DM4B 5G4BA 3BTEE 3SQHE 3QDZB 1SGCA 3SI3H 4XOJA 1K1JA 1BT7A 1HPGA 3LJOA 2UWPA 4XDEA 1IQMA 4SGBE 1A7SA 2OQ5A 5A0AE 3SZEA 2QA9E 2QN5T 5LH8A 4BAOB 1C5QA 2KCYA 4I86A 2L6OA 1ZHPA 1CHGA 1QGFA 2BZAA 2QXHA 1RTLA 2ZQ1A 4UFFH 3PTNA 1P9UA 4P02A 4OM9A 1P12E 4YOGA 1ZR0A 4ABAA 3O8DA 2DUCA 3LKWA 5A8YA 3FO8D 3BN9A 3ENSB 1C5OH 3UIRA 2FZZA 3RP2A 2CGAA 2YOLA 1CQQA 3LGYA 3LGTA 1IQKA 2VGCC 2GJGA 2ZDAH 3A8CA 5FHTA 1AB9B 3VGCC 2GT7A 1UCYH 3P17H 2PTNA 4ZXYH 4Q4LA 1H8IH 4IGDA 4AYVB 4CH2B 1AVWA 4OGXA 3RXAA 3QUMP 1BCUH 1S85A 1O2RA 3BG4B 1GCTC 1TNHA 4FXGH 4M7GA 1T4UH 3BSQA 2PGQB 4X6MA 2FOFA 1GBHA 4FETA 4YOJA 3O8RA 1EATA 1PYTD 3TVJB 1QRWA 3A84A 1O2WA 1UJ1A 1N6YA 1AU8A 1V6DA 1IOEA 2VU8E 4XSKU 5JBBS 3A7VA 4YLQH 2BVRH 1E35B 3SJ8A 1SL3A 1LMWB 3W94A 5FCRA 1ACBE 3KIDU 3UOUA 2H9EH 2BDGA 2A45B 5JPMH 5L2ZH 3Q77A 5DP3A 1AO5A 2CMYA 1C9TA 1QB6A 1UCYE 3KQCA 3CENA 2OBOA 1EB1H 2FESH 3LH3A 1ZMLA 2C8WB 2GGVB 2BDCA 4F4OC 1BTWA 5T3HA 1GPZA 1ANEA 2Z6BD 5K0HA 1SLUB 1TGNA 1F5KU 1TE0A 2ANWA 2AEIH 1W0KD 3QGNB 4IBLH 1CT2E 4U30A 1PPCE 2H9TH 2QF3A 5AVDA 3TNSA 2ZDLA 1S6FA 1ZLRA 5DP7A 8KME2 2WV4A 2SGEE 3ZZ5A 1AVGH 2FOBA 2ZHQH 3UY9A 1ELFA 4IS5A 1T8NA 2BVSH 3RXOA 3S0NA 1SFIA 1GGDC 1QNJA 2NU0E 5HGGA 1GMCF 4ZKSU 2SGQE 3RM0H 1SSXA 5E0GA 1ZGIA 1EXFA 1TABE 4LK4A 2ZU1A 1IQIA 4DJZB 3PLBA 2W5EA 1DPOA 5FX6A 5CHAC 5DPAA 4X1SU 4INHA 2D8WA 1MKXK 1O3PB 4UDWH 1P09A 4UONA 3TITA 1C5SA 3SU3A 2BQ7B 4RN6A 2TIOA 1EJNA 1ANDA 5DSFA 3QTVH 4A1XA 4DIIH 2UWLA 4ZH8A 1XXFA 3MO9A 3PTBA 2F9VA 1KXCA 5JBCS 1C2LA 6ESTA 4Q7YA 4IC6A 1A3EH 1PJPA 1TNKA 1W3CA 2GCHG 1OOKB 6GCHG 1AMHA 1NFWA 2G4UA 1XUKA 1O3CA 3BEIB 1BTXA 2BY5X 3SV7A 2L74A 3RXUA 1MMJN 4BXWA 2FOMB 2OBQA 3FZDA 3OYPA 1O3FA 3SNDA 4WWYA 1GI0A 3BTDE 1TMBH 2FIRH 2STBE 1UK4A 5EXLA 4Y7AA 1DWCH 5EW2H 2D2DA 1XVMA 2VGCB 1S83A 2Q6GA 2J97A 1SGPE 4GAWA 2J38A 4FVBA 3U8TH 2ANKH 1SGFA 4JZEH 1UK2A 4ZXXH 1YLNA 4U2WA 2WYJA 3M3VA 4KGAA 2P8OB 3MOCA 4TY6A 4NIYA 3PM3A 1SG8B 2ZGHA 1HGTH 4AOQA 4A92A 5A8XA 1GBFA 5ETXA 1TA6A 1ID5H 2QXGA 1ZTKA 1MBMA 4M9FA 3UFAA 1O2IA 4FUHA 2A7JA 4CBNA 4K3JA 2QCYA 3U69H 1A61H 1V2KT 1NU9A 1O0DH 1J17T 3RU4D 4JCNA 3B9FH 3ZV9A 2Y80A 1NESE 1S84A 1JXPA 1ABJH 3UNRA 3Q3KA 1C5VA 1YCPH 2XC0A 2ZPRA 1BHXF 1AKSB 1ELEE 1AQ7A 4WH6A 2F4LA 1SGNE 1S0QA 2UUJB 2ZU4A 1C2IA 2HVYB 3D62A 1AD8H 1T7CA 1EPTA 3AW1A 1SGIB 2QYIA 1P2JA 3G01A 1EOLA 3T26A 3NKKA 4ABHA 1AB9C 3VGCB 4WXVA 2SGFE 3F68H 1BRUP 2KZ4A 2P59A 2A4QA 2ESTE 4NGAH 2OC1A 1O2QA 3GCNA 2G00A 3LONA 1SI5H 4B76A 1FAXA 1RD3B 1O3HA 3MH6A 1C5WB 1EAXA 1VCWA 3RC6A 5DP9A 4Y6DA 5HYOA 1G30B 1MABB 3MU4A 3UR6A 1L1NA 5CHBA 2ZHWH 4X2WA 2WHXA 3HATH 2W6JD 1SVPA 1XKBC 4NFEA 1UTQA 4ZKRU 4WMFA 3U1IB 2J94A 1NFYA 1O2NA 3SNBA 3RXBA 3PV4A 5F8ZA 1GHAG 4R0IA 1TNLA 4FUJA 2OINA 3ZZAA 1UHBB 1O30A 1C1UH 1XXDA 7LPRA 1C5PA 2XC4A 2F9PA 4ACBA 3BTTE 1OX1A 1QRZA 4GUXA 2J92A 2GV7A 5C17A 1V2RT 1O3MA 2ODPA 3LPRA 3S7KB 1BJUA 3ATLA 3VB3A 2F9UA 1V2MT 1NRNH 2RA0A 1DSUA 1KXBA 2V3OH 3RXDA 1T32A 3WW7A 4Y76A 3E0NB 3MH4A 1DITH 3AK5A 4DY7B 1BTPA 2TGDA 2XBWA 3MH5A 1SC8U 1T8LA 1GJ6A 2YMSC 4D76A 4FU9A 1LQEA 3BIVH 1O3IA 1EZUC 4NCYA 4NIXA 1NN6A 1DDJA 1RJXB 1SGRE 2VBCA 3RXLA 1O2HA 4R8TB 5AFZH 1YPHC 1J16A 1G2LA 4AN7A 2G5NA 1GGDB 4NG9H 3E90B 4K1SA 2EI8A 2G52A 1JIMA 4D8NA 1FNIA 2ZGXH 3MYWA 1EPTB 4OS7A 5I46H 1G36A 4X6OA 1ARBA 1TOMH 3Q3XA 1O33A 2LELA 3H7TA 2OCVB 1DOJA 4DCDA 2Y81A 3S9CA 1C4V2 1KLIH 4AFQA 1TYNA 1AUJA 4YESB 4B1TA 1DFPA 1ESTA 1P2QA 2VIPA 5GJ4B 1O3JA 1YBWA 2FO9A 1ZRBA 2A5IA 2SGDE 4E7NA 2ZFQH 4ABGA 2V35A 5EQRA 1SOTA 3ZVBA 2GZ7A 3K2UA 3TIUA 1BRAA 5EW1H 1BUIA 1F7ZA 5FPSA 3KQBA 2AIQA 4Y79A 1GDUA 2F3CE 2ZQ2A 5L2YH 2DE9A 1N8OB 1TA2A 4XFQA 4BAHB 4TY7A 1GHBG 5IK2D 1YKTA 2V7QD 1HAVB 3OTJE 4UE7H 2FX4A 1C1TA 2O8TA 1DT2A 3A8DA 4CBOA 2O8LA 2BXTH 1MTSA 1GG6B 3F1SB 3L3TA 1AHTH 4MNXA 4NZLA 3U9AH 1H9LB 3NRLA 2ZU2A 4FUEA 1QIXB 1THPB 3FKSD 3OTPA 1VJAU 1TNIA 3H5CB 1P9SA 5TCCA 1HAIH 2KR7A 2EA3A 3SI4H 4YXWD 1TX8A 1MD8A 4J2YB 5A8ZA 1ELTA 1GI6A 2V6NA 4INLA 1L4ZA 3H09A 1PQ7A 1W2KH 3D23A 1QB9A 1KMHB 3QGJA 3RXGA 4A1VA 2A4OA 1MD7A 3KL6A 3SHAH 3UPEA 1D3QB 2CXVA 1C2DA 2XRCA 1GBLA 1XMNB 2K0QA 1Q3XA 3AAUA 3NZIA 8GCHF 1MQ6A 1TGTA 1AY6H 3IITA 3MI4A 2KAIB 3TH2H 5GDSH 4KP0A 3UNQA 4QT8C 3TH4H 2P3FH 4Y0ZE 1D6RA 1DSTA 1G3DA 1JMOH 2P94A 3TU7H 1A0HB 1W10U 5FXLA 1W13U 1E34B 2Z3DA 4DT4A 3ZV8A 5DP8A 3QO6A 1TMTH 5ABWA 1W0ZU 5B6LA 3A7ZA 4YLUA 1E1RD 5DGJA 1DVAH 3GYMA 4WMEA 1C5UA 1LPGB 1O32A 2PSYA 2AMPA 4F48B 1C4U2 4OS6A 2PTCE 2J5UA 3ZVDA 1VCPA 2BXUH 1HBTH 2YMSB 3FVFB 3GOVB 3SV9A 1AWFH 1HUTH 4I8HA 1BMFD 1BTYA 1KIGH 1S6HA 3LGVA 1O5CB 1CA8B 3A7TA 3URDA 4X8SH 2NU3E 2ZCLP 1Y3UA 2YMSD 4OS5A 5DN6D 2GZ8A 1HXEH 1K1PA 2IPQX 2J9NA 1KY9A 4RT1A 1DY9A 2PUXB 3H7OA 3SO3A 3QN7A 1VGCB 1TQ7B 4D9QA 3ZZCA 4ZHMU 2YNAA 1MCTA 3FANA 2VVUA 5C20A 1QA0A 2ODYB 1EPTC 1EB2A 3O8BA 3RU4E 1EASA 4DT7B 4GLYA 4XBDA 4HZHA 2XOKD 1SGEE 2B7DH 2ZGJA 1W12U 2BM2A 3FP6E 2GV6A 3KQ5A 1ZMNA 3RMNH 1ELDE 3FAOA 1T4VH 3P8NA 2CHAC 1RGQA 3BTWE 2ZFPH 3RMOH 1O2YA 1O2GH 1K1OA 2UWOA 4AFUA 3ZZDA 3SV6A 1O3DA 3D49H 1TGBA 2XTTB 3NCLA 5FAHA 2EEKA 4TT3D 3BIUH 1CGHA 5CE1A 1C1MA 1FI8A 1V2NT 2FM2A 3VG8A 1UW7A 1F0TA 1GVZA 1QZ8A 3FP8E 4RT0A 5C67A 1QTFA 1XUGA 1HJAB 1GL1A 1GWAA 2RG3A 4GCHF 1LVMA 2WV9A 1V2WT 3A81A 1HDTH 2I6QA 3GY7A 3M5LA 2CJIA 3IWMA 1GDNA 4ABJA 1DE7H 1C1OA 1O3AA 3DFLA 3RC4A 1JBUH 5EJLA 3SU5A 4KTUA 2P16A 4HGCA 1ELVA 3F9GA 1VITF 2H5DA 2VWNA 3AVZA 1FY1A 1FX0B 1FUJA 2FWWA 2WV5A 3ZZ8A 3RXCA 5CMXH 1GCDA 1QBOA 1THRH 1WXRA 1O2TA 5JB8S 3QZQA 4B2AA 2FI4E 1GI5A 3E91A 2XCFA 2ZC9H 4AB9A 1Q2WA 3TJUA 1HAYB 4Z6AH 1G32B 3VB5A 1YYY1 3MU0A 1SQTA 1KLJH 4CRDA 1JRSA 2V3MA 3SORA 3ZZ4A 3F2FA 1NY22 4Y7BA 2O9QA 1ZTJA 4Y10E 1OS8A 5L6NH 1FY5A 1E37B 1GJ9B 3ATKA 4ZAEA 1P2IA 1FAKH 4F55A 3R0FA 4O03A 1O36A 4ISLA 1C2KA 3RXKA 3DUXH 1H8DH 1GI9B 2ZP0H 2WPJS 2FS8A 1K28D 1BMLA 4BAMB 4Q7ZA 1LCYA 1WSSH 2FOEA 5H4IB 1YPHE 1Y5BT 2XYAA 3NK8A 1WUNH 2FLRH 2ALPA 1YCPK 5HIYA 3T29A 1QR3E 4Q63A 3BTFE 3UNSA 4FVDA 5DK1A 1Z7KA 1UTJA 2FPZA 1LVYA 3TK5A 1ESBA 1FJSA 6CHAB 1GBAA 1SGDE 2C93B 2K8IA 1MTVA 1OWIA 1BA8B 2ZF0H 3E6PH 1C1SA 3GY8A 1LHFH 2BX4A 4MTBA 1OWDA 1SHYA 3STJA 3A8BA 1H9IE 1K21H 1YLDA 2XBYA 2AYWA 3STIA 2Y5HA 2A1DB 2PKSB 4INKA 2JETC 1KTSB 2HALA 1RIWC 4OS2A 2ZI2H 1SGYE 1C1PA 4OS4A 1XUIA 4XBBA 5DO4H 3M5OA 2W3IA 2Z9IA 1DXPA 1PPGE 1PQ8A 1ZTLA 3PO1B 1NRRH 2HOBA 2BMGB 3UAIC 3FN8A 4NIWA 1NBMD 3SW2B 1MAYA 3KQEA 1MH0A 1KDQA 1OYQA 1M9UA 4B74A 1K2I1 5A09A 1NC6A 2O8WA 3SUEA 2PHBA 3P70B 3EE7A 4JZIA 1T8MA 3T62A 2P93A 1TQ0B 2A2QH 4K8YA 7KMEH 1UVSH 4YOIA 2OLGA 4DIHH 2XWAA 1D9IA 2VWMA 4BAKB 4K1TA 1HAPH 8ESTE 2TBSA 1EAIA 5E2OA 1NU7B 1IHTH 1Z8JB 3GCHC 1MZAA 2ZTZA 2PLXA 1BRCE 3VPKA 3ODDA 1O3GA 1P3CA 4JMYA 1SKYE 1LPZB 1XUFA 1FIZA 1AFQB 2BLWA 2IN2A 2XBXA 2ZNKH 2KCAA 4K2YA 1IQFA 3B23B 2M5TA 1Z1JA 2BOKA 3SJKA 3F2GA 4B71A 3PMJA 1H8ED 1B5GH 3SZNA 1GMDG 2R3YA 1HJ8A 1TIOA 2PR3A 1MZDA 3WWFA 6CHAC 4CREA 3ITIA 3OFND 2BOHB 1GBIA 3M7TA 4XBCA 5A0BA 1NO9H 2LPRA 1JOUB 8LPRA 2AFQB 1D3PB 3KGPA 3U1JB 2PWXA 2GVFA 1O2ZA 1IQLA 2Y82A 1DUAA 1EAUA 1LKBA 1TFXA 1X7AC 1QBNA 4OGYA 1DLKB 1NFXA 1VITH 3LH1A 3F9HA 1Y5UT 4CH8B 5EIYA 1NM6A 1ZHMA 4VGCC 4D7GA 1ZYOA 2VIVA 1AZ8A 3UR9A 1A0LA 1XKAC 3A82A 2D1JA 1ZZZA 1SGTA 3I78A 5JYIA 2ZTYA 1DS2E 2RDEA 3QTOH 4JYTA 2AERH 2ZECA 3MQKC 4ABDA 1F92A 5EQQA 1C1VH 4BAQB 1C1QA 1P10A 1GJ7B 1Z8GA 3V0XA 3M3TA 2WPLS 1WDIA 2ZU5A 5KECA 4JZ1A 2ANYA 3OY5U 2J34A 1CSOE 1H4WA 1DLEA 1O3NA 2FYRA 4O3UA 3RLYH 1GHBF 5E0JA 3DSPA 3T2NA 4DURA 2HLDD 2IJD1 3RXFA 3TJOA 3K9XB 4UD9H 1SR5C 2B5TB 1TBRH 2GCHF 2VIDA 5E2PA 1Z1IA 4NWLA 2ZU3A 1O5FH 4BTTB 2BLVA 3ATWA 9LPRA 1UK3A 1TONA 1W0JD 4ZKNU 1BJVA 2G51A 1B0FA 6GCHF 3RXSA 2D26C 3BTHE 3T5FH 1OP8A 3V12A 1G3CA 1ARCA 3UUZA 2ZTXA 2BD5A 3LU9B 1HIAA 4Y8ZA 5CHAB 1TMUH 2FI5E 3PMAB 4X6NA 1FIWA 1MKWK 3P92A 1BQYA 3MWIU 1GHWH 1LVBA 5BRRE 3PYHA 2VINA 5HMAA 3LGUA 3LIWA 4MNYA 5FPYA 3N7EA 3URCA 1NRSH 5ESBA 5HIZA 1GMHG 3M5NA 1O34A 4KKDA 4DG4A 3CS0A 4Y0YE 1O5AB 2Q1JA 1QBVH 2F83A 3UWJH 1GBDA 3K65B 4IN2A 3ZIAD 3S69A 2BHGA 2PFEA 1V2PT 4FUFA 1Y3VA 2C8XB 1SQOA 3ZVFA 4AFZA 8GCHG 2W6ID 2WPMS 3S9BA 1SHHB 1YC0A 1E36B 3T27A 1JIRA 1PQAA 1TPOA 7GCHF 2BQ6B 1AIXH 4FU8A 1GHYH 2VIWA 2BB4A 2PW8H 1Y3YA 1YPMH 1YY3A 3EAJA 2GP9B 4CRCA 4A7IB 2BD8A 1SB1H 3UWIA 2F91A 1H9HE 1FQ3A 1EJAA 1GJ5H 3RXTA 3GISB 1K1IA 1MBQA 4GHTA 1TX7A 3OX7U 1W7GH 1MTNC 5PTPA 4ESTE 4YT6H 2NU1E 2R2MB 1XVOA 4X8UH 3ZVAA 2GT8A 1DX5M 5FL7D 4MQAA 1NTPA 2ZA5A 1QHRB 3HKJB 3HKIB 2BDYA 3M37A 3GY5A 2AGIX 2KCOA 3MNSA 2JH0D 3VXFH
chains in the Genus database with same CATH topology
1QJ1B 1L4DA 1P2OA 4AG1A 1GHVH 2OUAA 2ALVA 3MU8A 4WMDA 1GI4A 4CRFA 1C5XB 1P02A 3M36A 1NROH 3TLOA 1HJ9A 1YPEH 2V3HH 3LT3A 5F8TA 5FX5A 1BTUA 5EOKA 1Z6JH 3GDUA 2G8TA 1A1RA 5EG4A 1B7XB 4TWWA 4TWYA 2Y7ZA 2ZG0H 1WV7H 3FP7E 3U8RH 2GMTB 4O9VA 4Y8YA 1WCZA 3AASA 1D3TB 2W3KA 3V13A 1FY4A 1FPCH 1KLTA 1EQ9A 2TGTA 1GHAF 1CBWB 1S82A 2BD2A 2ILNA 2ZFSA 3HGNA 2OXSA 4B2BA 3L6PA 1NRQH 3GDVA 1FXYA 2OC8A 3EQ0H 1O3KA 3MFJA 1KXAA 3ATMA 1O2MA 3SU0A 3TGKE 5F8XA 1C5YB 1Q31A 1TPSA 1UMAH 1BMAA 4XE4A 4YZUA 1HAHH 5FCKA 1EAWA 1YCPM 3GICB 4TPYA 1A46H 3MNXA 3A88A 4X1PU 3Q3YA 2NWNA 2JH6D 5TJXA 2OP9A 4H6SB 3RXMA 4RKOB 1SOZA 1F2SE 1ETSH 2EI7A 4ISOA 3SUGA 4U01A 1DICA 1SBWA 2GCTB 3SOSA 3M7QA 4AX9H 1P06A 3FZZA 1DXWA 2R3UA 3ZVCA 2CF8H 1P2NA 1GI2A 4TYDA 5HM2A 1ZPBA 1CA0C 2ZGBH 2GTBA 2F9OA 1AWHB 3SV8A 4O97A 1EP6A 1NT1A 1HFDA 1YPKH 5K7RA 1B0EA 3BTKE 1ELGA 1K1NA 2R9PA 4CHAC 4MPUA 3U8OH 1Y59T 3HK3B 2F9BH 2YNBA 2ZPSA 3Q76A 1CVWH 3SUDA 3EE0B 4FUDA 4CR5A 2VVVA 1WTHD 1C1WH 2B8OH 2WINI 2BDHA 1S81A 4JYVH 1C2HA 2SGAA 4ASHA 3TJVA 1HB0B 1SGQE 2H5CA 4ZUHA 1FPHH 1ZOMA 1A5IA 2BDBA 1HCGA 3BF6H 1C2FA 2A5KA 1ELAA 1F0RA 1AZZA 1F5RA 5GCHG 2STAE 3VEQB 3E8LA 3PLKA 1P57B 3SBKA 1C2JA 1O3LA 4DW2U 3PO1C 1DUEA 2R0KA 1O39A 3SU2A 1QFKH 1RRKA 3F9EA 1SQAA 2BYAX 1W11U 1EP5A 4H42U 3DHKH 1MAXA 2GX4A 1LKAA 1GBKA 1SFQB 2A7HA 4AZ2B 1P01A 2Z3CA 2RA3A 2HPQH 3KNXA 2BTCE 2WPHS 2ZPQA 4AG2A 1SLVB 1EZQA 1GJ8B 2C90B 1P2KA 2GZ9A 2WPIS 1ELCA 3CS7A 3RXQA 2HGTH 1TBQH 1TALA 3GCHB 3RUOA 2WUBA 2FX6A 1J15A 2IOTA 4NSVA 3UQOA 2BDAA 2FDAA 2ZWLH 3C1KA 1UTMA 1BBRE 1PQ5A 2G5VA 1O31A 1PYTC 1CT4E 5EXNA 1IAUA 1L2EA 1A3BH 4ISNA 1GBEA 1CA0B 5ESTE 2QAAA 2HNTF 2FP7B 3HK6B 4ZROA 1AE5A 2CF9H 5J4SA 3TGJE 1KDQB 1GI3A 1GJAB 1O5BB 4A5TS 3A86A 3M7UA 3KHVA 3L33A 1A5GH 2PKAB 4E05H 3N7OA 2B0FA 1TRMA 3BG8A 3R3GB 1KSNA 3EDXB 4D7FA 5DP6A 2NU2E 1Y8TA 4X1QU 3KF2A 1LDTT 4HTCH 3RMLH 1RTFB 1O2OA 1P04A 1WU1A 2TPIZ 1LO6A 3PWCA 1GJBB 2ZDVH 3VB7A 1O2UA 2BD7A 4X8TH 5L30H 3MO6A 2SNWA 1ANCA 3NUMA 1PPBH 3MH7A 2HVXA 1GI7B 2BD4A 3A87A 1OXGA 2VWOA 2FS9A 2GKVE 1WAYB 5EQSA 4A1TA 3GYLB 1C4Y2 1C2GA 1G2MA 1E38B 5DKMA 5FBIA 3VXEH 1S0RA 2A4RA 4I31A 1BTZA 1C5NH 1D6WA 1GMDF 1LHEH 3SJ9A 2CN0H 3I29A 1G3EA 1Z6EA 2C8ZB 3ZZ9A 4BTUB 2IJOB 4B73A 2A4GA 5DG6A 1K1MA 2XW9A 4X0WU 1HLTH 2IPHA 2GMTC 3ZZ3A 1HRTH 1SMFE 1P0SH 3VB4A 3ZZ7A 1C2MA 1QRXA 2JKHA 5EGMA 1MKXH 5C1XA 5FPTA 3LOXA 1O5EH 3SJIA 2BQWB 1V2JT 5GPIB 1IQEA 1V2ST 2H1UA 2XWBI 1P8VC 2A0QB 2AMQA 3PWBA 2FODA 4IN1A 3SHCH 1DY8A 2OD3B 1L0ZA 3GDSA 2BY6X 2Q6FA 3T25A 3SU1A 2UUKB 1PPHE 4E7RG 4ABFA 5LPRA 1FMGA 5B6OA 4Z0KA 5JB9S 1P3EA 4CR9A 3MU5A 1C5RA 4LOYH 3SU4A 4U32A 4LZ1H 3C27B 3GY2A 1PPEE 2Y5FA 1EZSC 1KTTB 2WPKS 4X1NU 5T6GA 3A8AA 4NSYA 3RXRA 2CHAB 3B8JA 4NZQA 5SGAE 1LPKB 2ZKSA 4IC5A 2BLOA 2WUCA 5EU8A 5GWZA 5J4QA 2PSXA 4FUGA 1EJMA 1JRTA 3LDXH 1HJAC 1G3BA 1EX3A 1V2UT 5LPFA 3LGWA 2NU4E 2FLBH 4ZHLU 1QJ7B 3RC5A 3RXJA 2AS9A 1GCTB 3RXHA 1Z8IB 1SLWB 3ZYEA 3RXEA 1YPGH 2C3SA 3M35A 5C5NA 2AMDA 5GXPA 4JK5A 2H9HA 4GVUA 3GCOA 5FBEA 3TPIZ 3I77A 2P8OC 4J1YA 2FMJA 3GY3A 1J9CH 1ORFA 3KCGH 4H6TA 4NA8A 4IW4E 3DD2H 2F9NA 2J95A 1DWBH 1WYKA 1NRPH 4X2VA 5IDKA 2PKSC 4FU7A 1BITA 1G37A 3KEEA 1KXDA 5F03A 3E0PB 3UREA 1O5GH 1LHGH 2O8MA 4Q7XA 1HAZB 1EKBB 1ZSKA 4ISHH 2ZFRH 4A6LA 1K22H 2P3UB 1NPMA 2Z9KA 2W7UA 2VH0A 4X2YA 4GHQA 1CU1A 1TNGA 1AGJA 1VR1H 2Z9GA 3RU4T 1BBRH 1O37A 2FOCA 3TK9A 1GBTA 1GHZA 1FY3A 1W0YH 2R0LA 1A0JA 1GI8B 2LNCA 4FUBA 2QV1A 1YM0A 1O3BA 5JBAS 4K5ZA 1TWXB 1HV7A 3ESTA 5IYTA 5C5OA 2FOAA 5LGOA 3A80A 1BZXE 1W14U 1G9IE 4X6PA 1SLXB 4WF8A 1UVUH 1OWKA 2THFB 4CRBA 3LC5A 2A5AA 5E8EH 1O2SA 2G81E 3EA7A 5EPYA 1GL0E 1CHOG 1VCQA 3SV2H 1K9OE 4I33A 2PUQH 1ZHRA 1UVOA 4K8BA 4KTSA 3DT0H 1UTKA 3P8FA 1UTNA 5DJ7A 4K60A 2XNIA 1YLCA 1FZZA 4RSPA 2FYQA 2PV9B 4NWKA 1HNEE 3QWCH 1GDQA 2WYGA 2OTVA 1SGFG 3RMMH 4Y71A 2XBVA 1O5DH 1RIWB 1CGJE 4UFDH 1N8OC 2TGPZ 3E16B 2A32A 3UOPA 1AKSA 2BY8X 1TB6H 2ANMH 1ETTH 3U98H 1GJDB 2C8YB 2ZIQH 1V2OT 1XX9A 1GI1A 3A89A 3ZZ6A 2O8UA 3AAVA 4Q2KA 5DP4A 1GBBA 3DFJA 4IMQA 2QF0A 1Y5AT 2ZEBA 2ZCKP 4DVAU 1EUFA 4O3TA 7ESTE 3E1XB 5C3NA 1O2VA 5A0CA 2G4TA 2FOHA 3A85A 1XUHA 4MNVA 3SNCA 1ZJDA 3BTGE 4ZMAH 3RDZA 1EOJA 3PROA 1P03A 4MLFB 5I25A 5C1UA 1DWDH 1Z8RA 1DANH 3SQEE 1CO7E 1O2XA 5EODA 4ZHAA 2ZFTA 1C5MD 1GBCA 3SN8A 1NS3A 4LXBH 4CRGA 3A7WA 3CP7A 1TX6A 3P8OA 1P05A 2HPPH 4IMZA 3F6UH 2VIOA 1YPJH 2FOGA 4GSOA 1YPLH 1OWEA 4X1RU 1MUEB 3SNEA 2ZDMA 2ZHFH 2GCTC 1MKWH 1P2MA 3UTUH 4WY3A 1QQ4A 3RXPA 4AYYB 5C2ZA 1QL7A 2A31A 1BRBE 2PGBB 3BTQE 3GCTF 3QK1A 3DA9B 4MG3A 1WOFA 4MPVA 1GJCB 9ESTA 2ZO3H 3EYDA 1T8OA 4VGCB 4I8KA 3TJNA 2QIQA 3VFEA 1GVKB 1BIOA 4BNRA 2ODQA 5EXMA 2HLCA 1F5LA 1INCA 1THSH 4TPIZ 5AFYH 2Y5GA 4NIVA 3A7XA 1NZQH 1E0FD 1C1NA 2VWLA 1IQGA 3ZYDA 1ELBA 1RXPA 2A2XH 1HXFH 3MHWU 1CHOF 3MMGA 1NFUA 1S5SA 3BTME 5A2MH 4JYUH 2VH6A 1HAXB 2VVCA 2I6SA 4FUIA 1BDAA 1XM1A 1QCPA 2HNTE 1MU8B 2QXIA 4MNWA 4E06H 1SPJA 3E3TA 4MVNA 2AIPA 4OS1A 2G55A 1CE5A 4SGAE 4JZDH 4ABEA 3LGIA 1WQVH 1RTKA 1MCVA 3S7HB 3SGAE 2HRVA 1TRYA 3ELAH 3BG4C 4X8VH 1D3DB 4HFPB 1FLEE 2BZ6H 2JH5D 2C4FH 2FXRA 5BPEA 1TAWA 1TOCB 3T28A 1O2KA 2ASUB 2Z7FE 3BEFB 3KN2A 2VJ1A 4JK6A 1C9PA 1N1LA 1MTWA 3TK6A 4MPWA 4ISIH 1BBRK 1HIAB 1C5TA 2VB0A 3Q00A 4F49A 1AUTC 2FTLE 1FY8E 2PKAA 2AH4X 4FUCA 3SJOA 1O38A 2V0BA 4NA7A 2ZFFH 3MTYA 4B75A 1UVTH 4CHAB 1O2LA 1O3OA 1GBMA 1TLDA 5HXFA 4K69A 1LVOA 2FI3E 1O3EA 2ZCHP 3MO3A 1Y3WA 5LPEA 1W8BH 1YGCH 2KAIA 3F9FA 1T31A 4AGJA 1VZQH 1ZMJA 2GDEH 1FV9A 5JBTA 3VB6A 1P11E 3MNCA 2TRMA 4NFFA 1KXFA 2BD3A 4AB8A 3GCTG 1PFXC 1W7XH 1H1BA 1JWTA 4LZ4B 1ZJKA 3TNTA 1V2VT 3V7TA 3PMHB 1OWJA 3LJJA 3ZVGA 1BMNH 2FEQH 3S9AA 1PPZA 2B9LA 5HM9A 1OP2A 3AW0A 1V3XA 1MU6B 1AI8H 2BY7X 4YT7H 1AFQC 4HI3A 1VGCC 3QLPH 3A7YA 1GVLA 1UO6A 4JZFH 5DP5A 1QL8A 4I8GA 1C5LH 7GCHG 1J14A 2XC5A 3HPTB 4H4FA 3TGIE 5F6MA 1LTOA 4ZKOU 1PPFE 5AHGH 1ZRKA 3UQVA 2Q6DA 1ZSLA 1C2EA 1ANBA 2P95A 2QXJA 1HAOH 2CV3A 1FN6A 3EA8A 5AF9H 1TPPA 3PLPA 4NA9H 1OYTH 1AN1E 4I8JA 1XUJA 4WVPE 1HYLA 1U6QA 3TH3H 1OPHB 4B2CA 1LHCH 2VNTA 1QB1A 1F0SA 1OP0A 3HGPA 1ZPZA 1GG6C 2H2ZA 3P6ZB 1TPAE 3ZZBA 4GPGA 2GDDA 3JZ2B 1GJ4H 2Z94A 1WTGH 3O8CA 1ZPCA 2BVXH 3FFGA 3M3SA 3SGQE 1OKXA 3BV9B 3MNBA 3A83A 5EPNA 1CBWC 3IG6B 2EC9H 1ETRH 4MPXA 1UCYK 1AFEH 1AE8H 1LQDB 2HNTC 2ZHEH 3QX5H 3SNAA 5E0HA 1QY6A 1CT0E 1KYNA 1GBJA 2A7CA 2ZHDA 5JDUB 4I32A 4BOHA 1V2LT 4KELA 4WJG2 1CGIE 1A5HA 2J2UA 2RDLA 5T6FA 5GCHF 4AFSA 3KQDA 3W95A 1BOQA 2Y6TA 2OC0A 1FONA 4RKJB 1IQHA 2QGRA 1ZGVA 3P95A 1QJ6B 2GD4B 2XCNA 3MU1A 2Z9LA 4BTIB 1MTUA 3SU6A 3K6YA 1O35A 3OU0A 4ABBA 1L1JA 1N6XA 4Y11E 1BB0B 2SFAA 2H6MA 3EA9A 3P8GA 4PROA 1D4PB 2OC7A 2SGPE 2UUFB 2AGGX 1ZSJA 1VJ9U 1V2QT 4WXIA 2DE8A 2UUYA 3EGKH 4I7YH 3RXVA 4GCHG 1UHBA 1RS0A 3RLWH 1L1GA 4X2XA 1A4WH 1Z71A 1YP9A 1LHDH 4BANB 1TGCA 1QQUA 2FTMA 1DWEH 2BY9X 3GY6A 2XXLA 2AGEX 2R2WU 2W7SA 1TNJA 2Z3EA 2EI6A 4UFGH 4D9RA 1FN8A 1ESAA 4AGKA 2Y7XA 2RCEA 3RXIA 3LC3A 4THNH 1WBGB 4YO9A 4I8LA 4YTAA 1K1LA 1MQ5A 4ABIA 1A2CH 1O2JA 2VIQA 2ZDKA 3OSYA 1GHXH 2BDIA 4DGJA 3QZRA 2TGAA 4K1EA 3PB1E 3ZVEA 3ODFA 3JZ1B 3RM2H 1AVXA 1KXEA 1OSSA 1OWHA 4AORA 3OY6U 3NWUA 4DOQA 2P3TB 1EZXC 4UFEH 5TCAA 1VITG 1UTPA 1QA7A 1TRNA 2Z9JA 1WQSA 3SUFA 2ZDNA 1QL9A 3SGBE 3WY8A 1UTOA 4BXSA 1RFNA 1C5ZB 1GMHF 2QC2A 5T6DA 4MDSA 1IQJA 2ZGCA 4UEHH 2OQUA 1FDPA 1HAGE 1BTHH 1Y3XA 1BMMH 1YF4A 2ULLA 1BHXB 2JETB 2BD9A 4Y8XA 3V3MA 1QURH 3D65E 1HAVA 1IQNA 1UVPA 2QY0B 1O2PA 1J8AA 3NPSA 3PMBB 4CRAA 1TBZH 6LPRA 4KTCA 2J4IA 3ATIA 1F0UA 5GIBA 2BLQA 3M61U 5C1YA 2SNVA 1ABIH 1GMCG 3K6ZA 2HWLB 3M5MA 1MTNB 2W26A 1IHSH 4YM9A 1V2TT 3NXPA 3BEUA 1UTLM 1TGSZ 4Q80A 2K1QA 4WH8A 2BX3A 1C1RA 3GY4A 2ZZUH 1DM4B 5G4BA 3BTEE 3SQHE 3QDZB 1SGCA 3SI3H 4XOJA 1K1JA 1BT7A 1HPGA 3LJOA 2UWPA 4XDEA 1IQMA 4SGBE 1A7SA 2OQ5A 5A0AE 2QA9E 2QN5T 5LH8A 4BAOB 1C5QA 1ZHPA 1CHGA 1QGFA 2BZAA 2QXHA 1RTLA 2ZQ1A 4UFFH 3PTNA 1P9UA 4ABAA 1P12E 4YOGA 1ZR0A 3O8DA 2DUCA 3LKWA 5A8YA 3BN9A 3ENSB 1C5OH 3UIRA