1EKEA

Crystal structure of class ii ribonuclease h (rnase hii) with mes ligand
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
222
Chain Sequence
MIIIGIDEAGRGPVLGPMVVCAFAIEKEREEELKKLGVKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNSINLNDIEINAFSKVAKNLIEKLNIRDDEIEIYIDACSTNTKKFEDSFKDKIEDIIKERNLNIKIIAEHKADAKYPVVSAASIIAKAERDEIIDYYKKIYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKSKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Crystal structure of archaeal RNase HII: a homologue of human major RNase H
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 79
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1ekeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ekeA01
1SUQA 4CESA 4I2PA 3WNHA 4CHZA 3RR7A 3V1QA 2KQ2A 3O4NA 3CQ8A 2HVIA 1VK0A 4CGIA 4FJ5A 1I3AA 1U48A 4FW2A 4GMJB 4CHPA 3AVIA 4M3RA 3KKSA 3MAQA 3L2RA 1TAUA 4CEBA 4FYDA 3K5NA 3S9HA 3LZJA 3D45A 3K59A 4J2AA 1U45A 2O4IA 5JS1A 4BE1A 1DTQA 3DOLA 2ITGA 3P1GA 1UA1A 4OKJA 3K5OA 3VQEA 4YNQA 1C0MA 3RMCA 2AJQA 5SWMA 4KTZA 4Z4GA 1C1BA 4LD0A 4B9LA 4J2DA 4CF9A 2B5JA 2G8FA 5C25A 4O4GA 2E6LA 2X74A 3HJFA 3SQ4A 1HYZA 1UA0A 1C0UA 4BDYA 4J2EA 1TKZA 1REVA 3BDPA 4PUOA 2KZZA 3QNNA 1B92A 3SQ0A 4Z4EA 2BE2A 1HJRA 3SYZA 3T19A 1IKXA 3TARA 3HPOA 1I39A 4B8CA 1NK6A 4DLEA 3ZSWA 4CJTA 4HCCA 2F8TA 3KD5E 4CJWA 1QE1A 3AVMA 3HT3A 5KTQA 4OPKA 3NH2A 5J2QA 4C8LA 4LH5A 1O1WA 2ATQA 4ZTFA 2QKKA 4HVJA 1HPZA 1X9WA 1Z26A 5HRSA 2Y1JA 3A2FA 3S3OA 1TK8A 4B9UA 4Z4IA 4NCGA 3VQQA 2W42A 1JL2A 2VG5A 4E7LA 1JLGA 1D8YA 1ITGA 1C6VA 3V1RA 3F9KA 4DSLA 1HQEA 1VSMA 3M8RA 3PX6A 5FROA 4DS4A 4CJUA 3SV3A 2E6MA 3VA0A 2YHBA 3OVNA 1KSPA 4G1QA 4CJFA 4EP4A 3MECA 4FLYA 4KI4A 4CHOA 4H8KA 4FLWA 2KW4A 3RRHA 5CZ2A 3QO9A 1NOZA 2VWJA 2KFNA 2YKMA 3V9UA 3L2WA 1TAQA 3OYBA 4O55A 1Y97A 1C1AA 3P5JA 4QOZB 1RT5A 1TK0A 3SUOA 4AHRA 4CEEA 3SNNA 1HMVA 2OZSA 3LAKA 1FKOA 1ZBUA 1CZBA 1VSJA 1C1CA 2IC3A 1YTAA 3ZT0A 2EHGA 3OYAA 2R7YA 4DQRA 3LALA 4M41A 4DFMA 4DSKA 3QIOA 3AVLA 4AH9A 1J54A 3QEPA 4LSLA 3TAGA 1QSSA 1C0TA 1BHLA 3HPHA 3NH1A 2HHUA 4H4MA 4CFCA 3MEGA 4C8KA 3LP1A 3SUNA 1LW2A 1G15A 2G8WA 2OYQA 4LY7A 2YNHA 1VSFA 1FXXA 5KRSA 2P5GA 3IG1A 5DMRA 5SZTA 3VQDA 3JYTA 4J2BA 1S9GA 4DTJA 3E01A 3TWHA 2G8VA 2E4LA 4FZXC 1WAJA 2A1SA 2IDOA 3LDSA 2HB5A 4TSXA 3QEWA 4OLAA 4F8RA 3KLIA 5HLFA 2HHTA 1TKDA 1TVRA 2LSNA 3EY1A 2FBVA 2D5RA 1S1WA 1U47A 1QSLA 1DLOA 4CIEA 1A5WA 1SKSA 1RT2A 2HNYA 3OYKA 3THVA 3DRPA 1W9HA 3AVHA 5C24A 4PA1A 2RN2A 3NAEA 5FRMA 2HNDA 4KHQA 1D5AA 3KK2A 3KD1E 3NH0A 3IS9A 3AVAA 4KV8A 3VQ8A 4E7HA 3AO2A 5HBMA 5CYMA 3K5LA 4B9NA 3AVFA 3QEIA 4ELTA 5K14A 1TKXA 3SJJA 4N56A 4NCAA 1A5VA 1IH7A 1RBRA 3DRSA 4HHTA 3AO4A 2NUBA 1L3TA 1Q9XA 4N76A 2G8IA 3DLEA 4DF8A 3HO1A 2F8SA 5FRNA 3V81A 3ZSZA 3OJUA 3U3YA 2RKIA 4CEDA 3ULDA 4KHYA 4DF4A 2VG7A 1JLEA 4E1MA 1TL1A 4FLTA 4DU1A 3QESA 1RTJA 3BGRA 5J2PA 1B9FA 3LPUA 3B6PA 4DG1A 1ZBIA 4CEFA 3C6TA 3NF7A 1QHTA 3SI6A 3DLHA 4B9MA 2DY4A 4Z4FA 4I2QA 4GW6A 4CIFA 1DTTA 3ZSVA 1IG9A 4DLGA 4KTWA 2HMIA 1J53A 2X78A 4CGGA 2PY5A 2DFEA 1JXBA 2X6NA 3DI6A 2BDPA 4CJEA 3I0SA 4CGHA 5T7BA 3NGYA 4CJQA 1RTDA 3VQ7A 4PY5A 3P83D 1NK7A 4FJ7A 4CFDA 1BQNA 4Q0BA 3KK1A 3PUFA 4CJ4A 4M3TA 1LAWA 1XHXA 1WLJA 3OYJA 3AA2A 1KLNA 3AV9A 4KB1A 1KFSA 4R5PA 4ELVA 1A5XA 1S1UA 1J5OA 1K6YA 1RT4A 2GV9A 3O3HA 2G8UA 1S1TA 3KJVA 3RMBA 4CJRA 4CGJA 1BIZA 3TR8A 4B9TA 3PX0A 3QETA 2HHWA 1VSEA 4EP5A 4Z4HA 4DFKA 4EZ6A 4CJ3A 1VSKA 5D3GA 1Q8IA 4ZHRA 4O0JA 4E1NA 4CE9A 2Q3SA 1EP4A 3V6DA 1U4BA 1VSLA 1BGXT 2D0CA 3CM5A 3LPTA 1SKWA 1Q9YA 1NOYA 1D9FA 3DLBA 3TAQA 3TANA 1HRHA 4LH4A 1QQCA 2Z1JA 3NBPA 1HNIA 4XIUA 3KLHA 1RT3A 1SKRA 3MXMA 2YKNA 4FW1A 4AHCA 5I42A 3NE6A 1SL1A 4CEQA 3CM6A 1QSYA 1TL3A 4CK2A 4DQSA 3C6UA 5KGWA 3NDKA 1HQUA 2Y1IA 4B8AB 4KPYA 2IAJA 1SV5A 1CZ9A 2YNFA 4CJSA 2HHVA 3I8DA 2PZSA 2PYLA 4FJMA 4CJVA 2OZMA 2JGUA 4DQPA 4DTNA 3TABA 4KHSA 3ZT1A 3OS0A 3OY9A 3AVKA 1RDCA 3DRRA 3HVRA 2BANA 4W5OA 1LAVA 5E41A 3ISNC 2ZD1A 4FM2A 4N5SA 4W5RA 3HPGA 4FK4A 1X1PA 3HL8A 3O3FA 4BE0A 1NK0A 2QKBA 1NKBA 1CXUA 4DSFA 1NKEA 1LWCA 3VA3A 4IG0A 3AA3A 3AVJA 3MXJA 1VSIA 5CZ1A 4CJPA 3JSMA 4HUFA 3M8PA 4PQUA 4ICLA 4DSEA 3V4IA 1VRUA 1WSIA 4E7JA 3NF6A 4KKOA 1RT6A 1UAXA 1N6QA 4CEZA 3AA4A 3NGIA 1UOCA 4IFYA 3VQ6A 3HM9A 1U49A 4CCHA 2XY5A 3ZSOA 2GUIA 1RDAA 3DOKA 3ASMA 1XHZA 3HXMA 3OYEA 1JL1A 2IGIA 2VG6A 4CJ5A 3WNFA 3LP2A 3DLGA 3QNOA 4OGCA 4FLUA 4BE2A 3O4QA 1ZBHA 1R0AA 2XRIA 3VQ9A 3VQ5A 4DU4A 1WNSA 1EKEA 3SQ2A 1BISA 4HUGA 5HP1A 1TK5A 1N5YA 2X6SA 3SUQA 3K5MA 4M3UA 4DFPA 3C95A 1BL3A 3OYGA 1HYVA 4B9SA 4E0DA 1GOAA 4JS4A 1RDDA 4CFAA 1T05A 2B6AA 1J9AA 3HVTA 3NGZA 2Z1HA 3OYFA 5J2NA 1YT3A 1NJXA 2OPRA 3AVBA 3NF8A 2XO7A 1NKCA 2FBXA 4I9LA 5C42A 3ZSRA 3V9SA 4FJJA 3U6FA 1GOCA 3PO5A 3ZT4A 4FJ8A 3AO3A 4HCBA 3AO5A 1ZBLA 4FXDA 3RRGA 3VN5A 3FFIA 3UIQA 4W5TA 4FVMA 2HHSA 4AHTA 3VQ4A 2QK9A 4JS5A 1EXQA 1KRPA 4CK1A 1IKYA 2XY7A 4DSIA 4KAZA 1WSHA 3M8QA 3OYNA 1RBSA 3SCXA 4KHNA 4FLXA 4CHNA 3L3UA 4OLBA 4O5BA 4BWMA 4FLVA 3LANA 4DSJA 3KIOA 4KI6A 3QEXA 3SUPA 4IDKA 3KTQA 2YNIA 3QERA 2VWKA 4FLZA 4AHUA 3ZSQA 4AHSA 4FM1A 3RWUA 4CF1A 3CFOA 3KKRA 4FZYA 1BI4B 1JLAA 1HYSA 4Q5VA 3TAPA 2GBZA 3ZCMA 2FBYA 1SL0A 2PYJA 4DMNA 3V1OA 4O44A 2IS3A 1RTHA 5JS2A 4KHWA 5HRNA 2OPQA 1JLCA 4OGEA 4O0IA 4DTRA 3NHGA 3S3MA 3DM2A 1BIUA 2YHAA 3AVCA 4NCBA 4HTUA 3NF9A 5EU7A 4CJKA 5KGXA 3OS2A 4WE1A 5DK5A 2ETJA 4CEAA 2HHQA 1L3SA 2B4JA 4C8MA 1FKPA 1RBTA 4E19A 3MEEA 3CYMA 4M3WA 4KRFA 2HVHA 3G0ZA 3O3GA 4IKFA 5KI6A 1RBVA 4DTUA 4BACA 3AVNA 4RW4A 3PX4A 1T8EA 1KCFA 2RPIA 3HK2A 3OYIA 4QCLA 4CF0A 2YNGA 3LAMA 3SV4A 1CXQA 4OKEA 4KREA 3AO1A 4M45A 4CERA 1LV5A 3H08A 4NYFA 3VQAA 1JKHA 2RF2A 4CHYA 3V9WA 3AA5X 4RW9A 2XY8A 3AVGA 4PWDA 3KK3A 4AHVA 1NJYA 3V9XA 5CYQA 2HW3A 1ZBFA 3L3VA 4CK3A 1L3UA 4BDPA 1IKWA 1RDBA 4I7FA 4DTMA 3SQ1A 1X9MA 1B9DA 4E7KA 3ITHA 2D0AA 3L2VA 4C8OA 4K8ZA 2Z1GA 4MQ3A 4DTXA 1ZYQA 4KHUA 2BGGA 1NK8A 1VSHA 1VSDA 1ASVA 1RT7A 3C94A 5KRTA 4FZZA 3VQPA 3OYLA 1FK9A 2FC0A 1XI1A 2P51A 1T03A 4N41A 4F4KA 3KLGA 1S1XA 3K57A 3KLEA 4FJLA 4B3OA 3QINA 4KFBA 1RT1A 3RTVA 4CFBA 4MFBA 2OPSA 1Z25A 2D0BA 1WSEA 3HP6A 4FJNA 1NK5A 1BQMA 1BCOA 1RILA 4JLHA 3PO4A 4Z0UA 4CF2A 4OKKA 2OPPA 3DMJA 1RBUA 3B6OA 3DLKA 3OYCA 4F3OA 4K8XA 4F3TA 2KFZA 1EX4A 4OJRA 4CGDA 1IKVA 1XC9A 4DU3A 4RW8A 3K58A 5HRRA 4I9QA 3I0RA 4Y1CA 3OYHA 3EZ5A 4Y1DA 3M8SA 1YVUA 3ZSYA 1TKTA 4W5QA 1X9SA 4B08A 3EYZA 3T3FA 1JLQA 3RMDA 1D9DA 3ZT2A 4FCYA 3HSTB 1XWLA 4BWJA 4LSNA 1NK4A 2FBTA 4CIGA 5FDLA 1JLBA 4FK2A 3WNEA 1KLMA 4FJHA 3L2UA 3QIPA 1KVBA 3TAMA 4FM0A 1ASUA 3RMAA 3PY8A 4FJ9A 1ASWA 1RCHA 3MEDA 3MXIA 3OJSA 3LWLA 3S3NA 1L5UA 1YTUA 2YV0X 3DLRA 3HP9A 1KFDA 4E3SA 3D0PA 2F96A 1CLQA 1T7PA 4ID5A 4FJIA 4HUEA 1NJZA 4OVLA 2DFFA 1WAFA 1S6QA 3OS1A 4FJKA 1GOBA 4YFUA 4GVMA 1S6PA 1S5JA 3ZSXA 4E89A 3V9ZA 4CJLA 4IBNA 3TAEA 1VRTA 1WN7A 1BI4A 3L2QA 3F73A 3ZT3A 4RW7A 4N47A 3KLFA 3ALYA 4RG8A 2P1JA 5CY4A 1JLFA 1W0HA 4UQGA 1NJWA 4M3XA 4IG3A 3IAYA 4CF8A 3NCIA 4CGFA 4JRPA 5HROA 4DFJA 1QTMA 4DQIA 3DYAA 4OPJA 4BDZA 3LP0A 1NK9A 1IO2A 1L3VA 4H4OA 4M3ZA 2HHXA 4NYNA 1LWFA 3TAFA 2A1RA 3WNGA 3U3GA 4DS5A 3NFAA 1WSFA 1WSGA 2DFHA 1TGOA 2EX3A 2O4GA 4CHQA 4ZTJA 1HNVA 4C8NA 3CFRA 4DQQA 2OA8A 1KVCA 1KVAA 1RNHA 3T1AA 1KTQA 4CECA 2ZE2A 3TI0A 4EZ9A 1BCMA 4E7IA 4M3YA 3G10A 5I3UA 4L8RB 5J1EA 4CEOA 4KO0A 4DTPA 3PV8A 1JXEA 3CG7A 3VQBA 3L8BA 1S1VA 4DTOA 1MU2A 1TV6A 2HNZA 3K2PA 3RR8A 4FJXA 3SZ2A 4DTSA 3SPZA 2G8KA 1SL2A 1F21A 4Z4CA 1RTIA 3LZIA 3SPYA 2KTQA 4F2SA 3LWMA 2DTUA 4DWIA 2I5JA 4AILC 1WSJA 2JLEA 2XHBA 2KZMA 1LW0A 3LP3A 1U04A 4W5NA 2ZQBA 4QAGA 2QXFA 3IRXA 2G8HA 3HYFA 3VQCA 1UWBA 2WONA 4ID1A 1QS4A 4ELUA 4FJGA 1EETA 3QLHA 4F2RA 4RW6A 4KB0A 1S9EA 5J2MA 3OYMA 2Z1IA 3CFPA 2XY6A 4B9VA 2P5OA 1LWEA 4M42A 4JRQA 5HRPA 4KTQA 2IOCA 3QEVA 2WOMA 4IFVA 4FK0A 3OYDA
chains in the Genus database with same CATH superfamily
3E0JB 3RR7A 2DA5A 3SZPA 2K9NA 3LNQA 4FW2A 4CHPA 3CCSN 3UKUA 3HTUA 3THXB 4IHVA 2LD5A 3DXMA 2AS5F 2G0EA 2QWOA 4BS9A 4J2DA 2OQRA 4IJNA 3DTKA 2O8DB 1C0UA 5F1RA 1I39A 4I01A 1NK6A 3HT3A 1FOXA 4LH5A 4XICA 5FD5A 3QPTA 3BY5A 1FOYA 2VG5A 1RUOA 1ITGA 4A5NA 4DSLA 1Z9CA 1I3QJ 1UELB 1Y8QB 3OVNA 1K79A 1HKQA 5FD6A 1IUFA 1RT5A 3W3DA 3SUOA 4CEEA 4BJ6C 1SD6A 4OU0A 2R7YA 2LREA 4M73A 3CHWA 3TAGA 4JP0A 5F0CA 4IEJA 1FWZA 3CDLA 3SBTA 2G8VA 2QQBA 4O8UA 2L4AA 2HNYA 2RN2A 4LFBK 3IKVA 2R92J 3C7JA 4BY7J 1QQOA 2PFUA 4OPAA 1V5FA 4UVAA 1VQMI 4LB6B 2XKOA 3O6WA 1U6GA 3A01B 3ULDA 2BVMA 1SFEA 3ZQLA 3CD6I 2QQ8A 5H6RA 5LFAA 2PLYA 2E2OA 3ZQFA 1OR7C 1NG7A 2JUCA 4CH7A 5F04A 3G1OA 3M1EA 4R5PA 1J5OA 4GGGA 1K6YA 1RT4A 4PJLA 3A5OC 1K9MO 5L3EA 2P5VA 1MH4A 3TAQA 1T38A 2Z1JA 4XIUA 1SD5A 2M8GX 3WGIA 2EINH 1XMQK 3CM6A 1HNWK 3L4IA 4BQOA 4DKWA 2PZSA 2JPBA 2F5FA 5HVQC 3C3WA 3WTXC 3KPHA 4HV5A 1QQMA 3CJ7A 5JLWA 2JA6J 3ISNC 2LTPA 2DLLA 4ENKA 4GV6A 3O3FA 2VLAA 1LWCA 1T3VA 4G6QA 4YIFA 1TQIA 1IV8A 1W5CC 3NF6A 3UB5A 3VQ6A 1BUPA 3IV5A 3DOKA 1G99A 2P6SA 2FD5A 1YJWN 4DU4A 3PO3J 4AU7A 4BR9A 1TK5A 3SUQA 3EUKL 4ZYHA 1D4XA 3C95A 2BY3A 1YYVA 3AVBA 2BE5F 4DV6K 3VN5A 4XRFA 4LG3A 2CQKA 3VWBA 1IKYA 1K8AO 4B3TK 2FOWA 4GV9A 3KX2A 5HRNA 2OPQA 1OH8A 3S3MA 3DM2A 5JHFA 2MGQA 2F9TA 1CF7B 2VQFK 3KZIC 3OSGA 1L3SA 4BAYA 2FLOA 2VBZA 1YJ9N 1FBQA 1ETKA 5K5RA 4WWCA 3RPUA 5EOYA 1XDSA 4MQVA 1OCOH 2E1NA 4C23A 3IUOA 1VQ8I 1FC3A 1IKWA 2PJRB 1S6LA 4DTXA 2P9IA 1HJOA 1V55H 4Q48A 4PL7A 2P9KB 1G59A 3L09A 1VQ6I 3FM3A 1X3UA 1IDZA 3RTVA 3VSLA 3DF8A 3ZN0A 1V4TA 1NK5A 3P31A 5HLHA 3LFUA 3RPUD 3B6OA 1MNEA 3K58A 2VPRA 4JEPA 2VN2A 1VFCA 3T7ZA 1YVUA 4W5QA 3K10A 5KPRA 1MMSA 2VBWA 3KYCB 3LAPA 3DP7A 3FXRA 4YELA 2ZJPL 3HSCA 1S6PA 2KKOA 1NGCA 3V9ZA 3G25A 2QXLA 2VODA 4OAYA 3F72A 1RI7A 2Y75A 1H9TA 1R6RA 1BI2A 4YOYA 1J59A 1P7IA 5CJ9A 4GVEA 3FIWA 1KTQA 2DTRA 3K4BA 1MBFA 2DDAA 2JWLA 1XNQK 4BJ5C 3SPYA 5M1NA 1VQNN 2JLEA 3HYFA 2IXSA 3CMEI 1OH7A 2LBFA 1IG8A 4RB3C 1RPWA 5FKKA 1S9EA 5KQDA 2Z99A 2IOCA 5GADP 2D2WA 3G71N 1U78A 1JGGA 1S3JA 5AIPA 2VE9A 4J2AA 3K59A 1IN8A 3C7NA 3K5OA 1C0MA 1Y8RB 2O8FB 2F5CA 2WV0A 5AONA 5GAEJ 3HTVA 1GLEG 2CGKA 2FF3B 2NRRA 3WUHA 2E60A 1Z6RA 3BDPA 3HUGA 1LEAA 3O9UA 1W7AA 2HFHA 4UV9A 3ZSWA 1P8ZA 3W0LA 5KTQA 3HOXJ 3WXLA 2WY8Q 3KLNA 5HRSA 5DTDA 3A2FA 1MSEC 2H6CA 2K86A 1YW7A 3U9GA 4CBXA 4NBQA 5K7HA 2H8RA 3BR5A 3V7SA 5LGNA 4N9HA 3RRHA 3EUAA 1NOZA 4J01A 5IT9Z 1R4MB 1DUXC 1TK0A 2DA1A 2DBBA 1FKOA 1ZTRA 4M41A 1ILYA 3IKTA 1OCRH 4PKGA 4BBRJ 4L9VA 2V1DA 1I6HJ 1WAJA 1O3SA 1E4FT 3KLIA 2CFXA 5CVUA 3WTYC 2CGJA 3VESA 4MLHA 2UU9K 1YVNA 1DLOA 1JHHA 3PSIA 1Q1HA 3KD1E 5AQZA 1UFMA 2DYRH 3R3LA 4RB2C 4RAGA 2WAEA 1TL1A 2PMUA 1BA0A 3U1DA 5AQQA 2OC6A 2EFQA 3FF5A 1UHWA 4H0EA 4FWLA 3ZGKA 4CCLA 2DO7A 3IMXA 4KN7X 4C1NI 2EILH 4FJ7A 4CJ4A 1LAWA 3S14J 4L5JA 3ZMTA 4KB1A 1DP3A 3BEXA 3AGKA 1VQMN 5LEKA 2QF7A 4CJRA 3HG9A 3ZPLA 4I6MB 2V7YA 3CD6N 3Q0UA 1NGFA 4LH4A 3BOQA 4NC6A 1RNLA 3O1WA 3UNGC 3RIRA 1J7KA 1X3NA 4PSXA 2HDCA 1YF5L 2NVTJ 5E8IA 2BOLA 3HVRA 1C0WA 2DJNA 4FPAA 5E41A 4D7NA 3WXKA 4N5SA 1BJAA 2HVSA 3PNYA 2GXGA 4GYGA 3ZCOA 3H35A 5CZ1A 4E7ZA 1T0FC 3C6HA 1VQ9I 1S22A 1XNRK 2HOTA 1YX5A 1JL1A 1MGTA 1WNSA 5BN8A 2XPWA 3TPQA 3CCEI 4RBOA 1LPQA 2WFBA 1SQKA 4B9SA 3OW2M 3OSFA 4HF2A 1GLAG 2O8CA 1ZBLA 5EF6A 1T08B 1R58A 3H5RA 5AQNA 4CK1A 2GOMA 4KAZA 3ZSQA 4JKCA 4R79A 3NWSA 4BC2A 3CJRB 3NHGA 2L9VA 4G7OF 1HKSA 2ASMA 3I4NJ 3MMVA 3T1YK 2HF3A 2P7CB 1MDUB 1N8RO 3A02A 4JI7K 1KCFA 4CI6A 3LAMA 3SV4A 4BRCA 4M3EA 5EZHA 5EG0A 1JKHA 2RF2A 3WT0A 4HX7A 1JCEA 5DS9A 5JLXA 1JCGA 5I9EB 4CD1A 2XVCA 2W1OA 3THWB 3V7RA 1IN4A 3J7ZO 4A0ZA 3GTPJ 1ASVA 5KRTA 4IPAA 3ZEUA 3F6VA 4R1HA 2BY1A 3EEQA 2HBMA 5IOYA 2CMPA 2HR3A 5D8KB 2CH5A 4OKKA 3W2AA 1ULYA 1VQ8N 1TKTA 1R7JA 4ON0A 3EYZA 2Q1ZB 5ERIA 3C0BA 4CIGA 3GO5A 1KVBA 2X9DA 3MXIA 3UE5A 1VQ6N 3DLRA 1J9IA 1BJZA 1OMIA 3S17J 1S3XA 4ID5A 4FJIA 4BRGA 1P6RA 4YFUA 3TAEA 4UUSA 1HOMA 2CW7A 4BRLA 2FSJA 3TEDA 4Y4RA 2HTJA 4NXMK 4NYNA 3S1MJ 2A1RA 4KMFA 3NFAA 2DFHA 5DM7L 4JHDB 4CW7B 5AIQA 1APLC 3PV8A 1JXEA 3VQBA 4DTOA 2UUZA 4I76A 4F52A 5E3LA 3JSOA 2KTQA 3M1FA 3LWMA 4DBRA 4QAGA 3QP5A 2G8HA 4MIMA 1ZG1A 3JXUA 4ID1A 4B9VA 5C15A 2PJPA 3KZBA 3SBGA 3K2AA 4BRNA 3MAQA 3F8CA 5DM6L 2HZTA 3P1GA 2HOEA 2Q36A 1C1BA 5JHUA 4U88A 2KIMA 4B9LA 3E5XA 2BW3B 3CMEN 2P5KA 3RSEB 4HSRA 1EWQA 5EGOA 4ISEA 1DQUA 3BR1A 5HS7A 2LNBA 1YAGA 3KD5E 2XPVA 3TO9A 4I0AA 3J80Z 4B1XB 2ATQA 1BOBA 1X9WA 3VF6A 4B9UA 1JLGA 2YUSA 1HQEA 1WUAA 2WAFA 3HL2A 3C6AA 3I53A 3IHUA 2XSDC 2JMWA 3S15J 5CZ2A 5GTHC 3QO9A 2XGXA 1QPIA 5FLMJ 3TL4X 3CC7N 2YR2A 4M3DA 4CCNA 4IQ4A 2FX0A 3I8BA 4FVUA 3QEPA 2P9UA 3EL2A 1C0TA 4CFCA 2YNHA 1VSFA 5F6FA 1YIJI 5C2FA 4K41A 1S9GA 4QSHA 4B3MK 3E01A 2VPLA 3VEYA 5BPIA 4TSXA 1BU6O 5C44J 5H2FC 2R7RA 1TKDA 4XR6A 2LSNA 3EY1A 3FK7A 4HNVA 2M30A 4DQ2A 2NS8A 2X51A 1V4SA 4KHQA 2M7AA 2MD0A 2V1UA 3RZOJ 3AVAA 2AQFA 4JYKA 3H36A 4YY3K 2P7VB 3CXCM 2I5UA 5FRNA 5AFUA 1SC7A 2E20A 2VG7A 4FLTA 1X1BA 1QHTA 2MC3A 3F2KA 3TTFA 1IJWC 4QIWN 2W6LA 1W0TA 1EO1A 3KK1A 3VB2A 5HDGA 3CERA 2R93J 1A5XA 4NB4A 3HGYA 2OTJN 2UXNA 1R5ID 3PIOL 2RNGA 3G73A 2UXDK 4L9NA 3C6UA 4KPYA 3ATUA 4DR1K 3CQXA 4FJMA 2JGUA 3FZFA 5J8FA 5KK1A 1U5TB 4W5RA 3VGLA 1D5YA 4GO1A 3HL8A 4M3BA 4IG0A 3MXJA 4EV0A 3I59A 4KKOA 2Z5UA 1N6QA 3SFZA 1BR4A 2K5CA 1FZPB 2VG6A 1KU7A 4M3GA 1UZCA 3CLOA 2E2QA 2PBDA 1XD7A 1MA9B 4E70A 3SJHA 2WTEA 1WB9A 4B1RA 2XO7A 2DT5A 4I9LA 1VQ9N 3DLLL 2GXBA 3S2DJ 4H5RA 3GFMA 2QBYA 3RQIA 4KHNA 2Q97A 3G4SN 1WJFA 3KP2A 4FLZA 4BXUA 3CCEN 1G3WA 3SZGA 4JV5K 4IO9L 4XSXF 5EZGA 4OGEA 1IJJA 5F0XA 3W6KB 4JKEA 2B4JA 1RBTA 1OKJA 2A40A 3G0ZA 3NQOA 4O8KA 5KI6A 4DTUA 1ENHA 3G1MA 1G3YA 1T8IA 1LJ9A 5AZJB 4CHYA 2W85A 3AVGA 3CCJN 1D3YA 1WCMJ 4HNTA 1PUFA 1HQCA 3ITHA 1IBMK 4MQ3A 2R0QC 3PO2J 3G6EI 5E1ZB 3K57A 1R59O 3ZETA 3KEQA 3S16J 1ZC6A 3LM2A 1X2NA 5D5UB 4EIAA 3F5TA 4XONA 2YX6A 4NQWB 3ZQGA 4B43A 4LSNA 1ZGWA 1JLBA 2UV1A 3H92A 4FJ9A 1VQPN 1I6XA 4JOMA 2FF6A 2L4MA 4CICA 4EM2A 1WN7A 1IV6A 4EFHA 4IOCF 4CGFA 4MFDA 4DQIA 4BDZA 2GA1A 5M5YJ 3R0JA 1LWFA 1L3LA 4H5WA 2F4IA 3HEFA 5DDGA 1ZRFA 2JQ7A 3OIOA 1BCMA 4M3YA 3RKXA 5J1EA 3SPZA 3E9LA 3RQ4A 3LZIA 2DU9A 4S04A 3VEXA 2I5JA 2JWKA 1U04A 3CCMI 1EH7A 5BQTA 2COMA 2IVPA 1LCUA 4KTQA 4F92B 1UMQA 1IXCA 4BROA 2HVIA 1KYWA 3W2VA 4CEBA 1HNXK 3L4QA 4OKJA 3F6OA 4BHCA 5A2QK 3RJPA 1XC5A 4LD0A 4BRDA 2B5JA 3SQ4A 4IDHA 2WAQN 4HPQA 4DGWB 1JJ8C 4FWSA 3I55I 2R7FA 1IUYA 1D8YA 4L5EA 3LSIA 5JVGL 1VSMA 4IEIA 3RKQA 3D1NI 4UY8O 4FLWA 1BIAA 5BRHA 3P5JA 1LVKA 4CCJA 4BG8A 1VSJA 5D5XB 4DFMA 3QIOA 3EETA 1YOVB 4EM0B 3VF4A 3ZQIA 1MWKA 2NVQJ 4WF9L 4ZYAA 1Q18A 4BRQA 3NAEA 2XUBA 2H6BA 2ISYA 3QB0A 2HOSA 2NVXJ 1LUJB 3AVFA 2JA5J 3KYLA 3DRSA 3S41A 3P38A 2VQCA 4EHUA 2RKIA 4CEDA 4ZH4F 1HA8A 1YIJN 4OMZA 4PJ0C 1ZBIA 3Q5FA 4I2QA 4CIFA 3ZQQA 2HYGD 5GAGJ 3VODA 4B1ZA 4BYYA 2NRHA 3TBIA 3IWFA 1P4WA 4B3AA 4Q0BA 2M34A 1YW8A 1USTA 2RHKA 5GIOA 2KFDA 4E1NA 3OOUA 1H1VA 1YI2I 1NOYA 1DU0A 1SKWA 3LA7A 5JVTA 2E1ZA 2HSTA 3KLHA 1QQIA 1FW6A 1MDMB 4FO0A 3T5XA 3GWZA 4C3IJ 4CJSA 2HHVA 1T6CA 2DJIA 3H5AA 3K6GA 4MTDA 5ADXA 4RGRA 3A03A 2HVQA 3DTIA 2W41A 3EKUA 1EF4A 3IH4A 3HHHA 3SMPA 5LJWA 3OMYA 2HPIA 1DGWY 3DWLE 3LDOA 3MX5A 3OYEA 1TP4A 4AQYK 1ZK8A 4IQJA 1YIOA 5HP1A 1WVRA 1X3ZB 3TKYA 3EUHC 5AQYA 4I98B 2MD5A 3O9TA 4EVIA 1G3TA 3FE1A 3J81K 3OTOK 1S5LC 2ZGYA 2D1HA 4XLPF 1NJIO 1ATSA 1ZREA 4OLBA 4BWMA 3SMSA 3KIOA 1KGSA 4L0ZB 3RWUA 2W57A 5E17F 2GBZA 4IOXA 2XASA 4CZZA 3QPLA 1FMVA 5KGXA 1HSJA 5DK5A 2ETJA 2LF7A 5AQUA 2HVHA 3TO7A 3PX4A 2O3FA 2Y9ZA 4CF0A 3GBTA 3F8MA 2ZMEC 3V9WA 4A93J 3AA5X 5FFXA 1T95A 1IRGA 2NZTA 1WSUA 5AQHA 3L2VA 4FE4A 1PVEA 2ZXJA 4MLEA 1ZYQA 2LKXA 2P51A 1B72B 4CYCB 2DPUA 5E3NA 2STWA 4IFEA 4PFPA 2EIKH 4EMSA 3HOYJ 1FTZA 2VB6A 3QBWA 1O3RA 1SS6A 3HP6A 4FJNA 3F23A 1IBLK 4E7SA 3FMQA 3SAHA 3LL7A 3K4JA 1AKHA 2F2EA 3LA2A 3RPQA 4HV6A 3C2HA 3PY8A 3G6EN 4BC3A 2L9SA 4XN0A 2DK5A 3ELKA 3BG6A 2K85A 4OVLA 1WAFA 2ICWG 2IVNA 4DNCA 4RW7A 3AL0B 3GZ5A 1R5HA 2WV1A 2FUG2 3CJCA 4FPBA 3TTCA 3M5RA 2Q0UA 2HNHA 4S0HB 4JX6A 3DTEA 1KVAA 4CECA 3TI0A 2OZUA 2ZE2A 4EZ9A 1KONA 1LDKB 3WE3A 1BW5A 3H3NO 3L8BA 1MU2A 3R8EA 5FO5A 5BS6A 4WQ4A 4DTSA 1TW2A 4I6MA 1HR0K 3J7AY 3Q0VA 3LP3A 3A5MC 3IFRA 1FOWA 3LWFA 4ELUA 1EETA 3W6VA 4IFVA 1FLIA 2Z16A 4CVNE 1XMKA 4D5FA 1KA8A 3KKSA 4M3RA 2CGPA 1TAUA 2O4IA 4DOZA 1NGIA 5JS1A 2ITGA 5AZIB 5ILVA 3MEXA 3M6GA 1MJBA 4BGAA 3OL3A 1A04A 2QGUA 1OQYA 1NH3A 2FSNA 3PFIA 1IXRC 1N34K 2K9MA 3GEZA 5LBQA 1JL2A 5IWAK 1FX7A 5CE3A 3F9KA 3HSEA 1T2KA 3A1YA 4CJUA 2FF4A 4Y13A 4CJFA 4I6ZA 2M0CA 3DXKB 2VWJA 1R22A 2JA7J 3M8JA 3O8MA 1VQ7N 2GOXB 1HMVA 4AVPA 1CZBA 2AA4A 4BQZA 5LGUA 4BQQA 3CDIA 1S72I 3UR3C 4XRSG 2OYQA 4IEEA 2XPUA 3OWTA 4YOWA 2HB5A 4FWMA 3PIPL 4B1UB 3MN6A 1BI3A 3BTLA 1ON1A 2K4JA 3H3UA 5CLSA 1SAXA 1W9HA 1D5AA 3HI0A 3JRFA 3AO2A 4XN3A 3VETA 1IH7A 4MEYF 3JRBA 3ZSZA 4YORA 4H4KC 3GFJA 1RTJA 2ZSIB 4OAZA 1JJ6C 2X6NA 1L0OC 3I0SA 2F48A 4XLCA 3Q9VA 2M4GA 4HLXA 4FWQA 4H0PA 3QPSA 1GLDG 4PK4A 3AV9A 1PUEE 2L7FP 3VPRA 3RMBA 1R23A 5H6QA 4KIGA 3JRHA 4O0JA 5EEHA 1U4BA 1MW7A 2CUFA 4M6XA 1ERDA 2IS6A 4CZLA 2L9NA 5I42A 3NE6A 1QSYA 4XKCA 2EBIA 4BXXJ 3JAMZ 1J2XA 4DQPA 2F4MB 4FM2A 4EGYA 1XGMA 2PAVA 1AA7A 2KISA 2ZMEA 1YI2N 3VEZA 4ILGB 4HUFA 4BEHA 1P4XA 2W7NA 3MN5A 2MYSA 3IAM2 4WXDA 2M3AA 4IFYA 3J7AO 3COAC 1X4OA 5M1FA 3ZSOA 2IVMA 2GUIA 4JHDA 3HXMA 4OGCA 3SEZA 1Q1VA 3TP0A 1EKEA 4JD2B 3HBTA 3FDYA 2FA5A 5EX5A 1HYVA 1OCZH 3NGZA 3OYFA 2HU9A 4FASD 3NF8A 3BTJA 3T8RA 3FISA 4FVMA 4HSTA 4LF4K 2LFBA 3KTQA 2YNIA 1R1VA 3SAFA 5M1PA 5E8GA 3WG7H 1WFXA 3M1CA 1NGJA 2A05A 2AQEA 3RSEA 4CCMA 2D4WA 3A0IX 2UUCK 2CU7A 2KQRA 2XGDA 2DQLA 3M4OJ 5C0YA 4RW4A 1R4NB 3N97A 4BRPA 2QW9A 5AFUH 1MBEA 1R9TJ 2V9KA 3BWGA 5IT9O 1RKWA 3HXLA 3KP5A 1RDBA 5F1JA 1X1AA 2EZHA 2QTDA 1VSHA 1NK8A 5BRFA 4RLFA 1RRJA 2CJJA 3T69A 2VGMA 4HOBA 3OYLA 2CWEA 3HOVJ 3GTKJ 3BTIA 4CFBA 4MFBA 1VAZA 1OFCX 1FYLA 2CV2A 4IX7A 4BXFA 3W2WA 2L3DA 5HRRA 3WEEB 3CIPA 3RMDA 2K40A 1O7FA 2NAZA 2NXNB 3CCRI 4OOIA 3V8JA 1W36C 2FSWA 1Y0NA 3SDBA 4CZEA 2LOOA 3L6QA 1LB2A 4GVMA 4A3CJ 5ILSA 2V6CA 3KZZA 5CY4A 1NJWA 5HLTA 4JRPA 3EKSA 2RC4A 3M9AA 2O03A 4ABZA 2M7BA 3ENBA 4CHQA 2EZKA 3CFRA 4DQQA 4AIKA 2WTUA 3V42A 1S1VA 4OIRF 4IXCA 2ZNYA 3U21A 5BRDA 1GUUA 4L9TA 2OAZA 4ZZDA 4M9ZA 4W5NA 2YSRA 2HQRA 2XY6A 1RETA 3QEVA 2QENA 4NC8A 5DV5A 2CFOA 3Q0WA 2DPDA 2KQ2A 3RKYA 3B6CA 4P55A 2B7EA 3K5NA 2CSOA 1U5TA 3CMAI 1UA1A 2NRXA 1NG9A 1R1UA 4IHYA 2RDPA 5ICEA 4ANJA 5DCMB 3HPOA 3IRQA 1BO5O 2QKKA 3JCUC 5D6FA 1VZ0A 4Z4IA 4G9YA 5F0FA 2AXTC 5KHDA 3M8RA 3LFKA 4H8KA 2NRWA 1TNSA 5LEJA 2CGLA 4U0YA 3F21A 5IOZA 5CQEA 2DMNA 2GTDA 1Z6TA 3WGHA 3LALA 2GWKA 1OYYA 3O9SA 2OZ6A 4PZJA 4EJOA 1IN7A 3MEGA 4C8KA 1R36A 4LF7K 2PMZN 4J2BA 5JFRA 3BUZB 2FBVA 2VQEK 1JI8A 4P5OA 1QSLA 1SKSA 3OBWA 3AVHA 4RA2A 4DUZK 1SD7A 2BY2A 4B9NA 2Z1DA 3CJTB 2DPNA 5K14A 2F8SA 2E5LK 3LSTA 3CQZJ 3B6PA 3H3VK 2RQPA 3J7ZI 1B9NA 3DI6A 2BDPA 4BR4A 1NLVA 4LD5A 2QWLA 3FXJA 5J1YA 3KFWX 3I5UA 5EXWA 3LSHA 5TKWA 3RVCA 3DEEA 4DV1K 4EZ6A 1TWFJ 1QO0D 2LRDA 2L5QA 4XKVA 4ISFA 4UVBA 2WUSA 1QZ5A 4NQWA 3TANA 3NBPA 1K78B 1J75A 3MXMA 3WTWC 5CKTA 1S7OA 3EYYA 5CYVA 2O7OA 1ZRCA 4MGRA 1VQ5I 2YU3A 1HXDA 2LK2A 4DV3K 1K4SA 4E6KG 5LJVA 1Y1VJ 1NKBA 4DSFA 2UUAK 4MLOA 4I09A 1R49A 2VBYA 2FQ4A 5AQGA 2DT7B 4MDAA 3QNOA 4NHJA 4A3GJ 2XRIA 4XLEA 5ICCA 3WHBA 3SQ2A 2KMUA 4S05A 3M8FA 1ETQA 3G1LA 3EE9A 3LSGA 2O8XA 1F9NA 3F8FA 4FXDA 1TQMA 1XSXA 2QK9A 4KHPK 3K1MA 4EAHD 3TSQA 3SCXA 3KHYA 3GMEA 4KUMA 1R00A 3HSRA 1EH6A 3THYA 2OCCH 5H1SQ 4KDPA 2PYJA 4DMNA 3ZOBA 4EQQA 2BVLA 4CJ7A 4XMYA 1JJ2M 1BIUA 4M63C 1VI0A 4HTUA 2WA0A 4LLLA 1NU0A 3EQLF 2R5ZA 3D6RA 2Y30A 3MEEA 4AIHA 3J80O 1A6QA 1OYIA 3K4KA 1RBVA 2YNGA 2ID6A 3CC4N 1Z91A 3MX2A 1GLCG 5HL7L 1NJYA 5CYQA 2ELJA 4DTMA 1BWFO 2H1LA 2ZJPF 1YO5C 1A35A 4DR4K 3DWLA 5IT9K 4RAFA 1TNTA 2WB1A 1T03A 4G8XA 1MNMC 1QZEA 3HOSA 2OPSA 2HBKA 2IGNA 2OTLI 1BCOA 2NVUB 1RBUA 3LMMA 1RC9A 4UV8A 1UG2A 3ZMZA 3I0RA 3KP3A 3EZ5A 3K1NA 2ME0A 1VHXA 1D9DA 4D0PA 4G94A 4V2FA 1GXPA 3H45C 3WQTA 3HC7A 1B8IB 1IGNA 5L3FA 4E3SA 5ADXH 2BXYA 3QQAA 4BY9C 1NJZA 1GOBA 4E89A 4IBNA 1NG6A 4X62K 1BI4A 3CCQN 5IP7J 2BGCA 2AP1A 3OIPA 4EJWA 2P9NA 3U9ZA 4JYAK 1L3VA 3K4NA 1IO2A 2W4SA 3E9PA 3ASNH 1T33A 4CCKA 1XTAA 1FY7A 4C8NA 4XBFA 2LF8A 4BR2A 1U9NA 4LIVA 5I3UA 4CEOA 3DFGA 2HNZA 2KLOA 2J5PA 3VSKA 3H9QA 1X2MA 1ZXOA 2LY9A 4BRFA 1W1WE 2OPTA 1OYWA 3U2RA 2Z2SB 4ENNA 4RW6A 5M1OA 2X85A 5HRPA 4HZFA 4FJ5A 1JCFA 1X4PA 1U45A 1V54H 3IH2A 2Z3YA 5DYMA 4YNQA 4A5MA 1PP7U 2XAGA 5GADJ 5BMZA 4O4GA 2E6LA 3CJBA 4J2EA 1X3MA 4C30A 3JW4A 2ESNA 2VC1A 3M3ZA 3ZR8X 2P0WA 2ZF5O 3NH2A 2M9HA 3C2BA 3S3OA 1TC3C 5IY5H 3AY9A 4N0BA 1C6VA 3V1RA 3HOZJ 4HW0A 2E1MB 3VA0A 3O08A 2ZJ2A 4FLYA 3F8BA 4B44A 5GPCA 1VQON 2LR8A 2KFNA 4P96A 1XG1A 4CZMA 1ZYRF 3CJNA 4FSVA 2HKXA 4RMNA 2IC3A 1YRNB 2EHGA 4A6EA 3AVLA 5KRSA 1WWXA 3BR3A 2EA2A 4ILHA 4BHBA 1Q82O 1X1DA 1U47A 3V8LA 2GAUA 4UNOA 3ZQ7A 4E7HA 4A3EJ 2QCOA 3C65A 2Z9OA 2IT0A 1Q9XA 5IYCJ 3BZ6A 3V81A 3JSPA 5KVRA 4RM3A 2KRCA 2QQ9A 2DMQA 2K27A 2YX7A 4KTWA 2W82A 4FWPA 4CGGA 1KQ0A 3ZLJA 4CGHA 4JK1X 3VQ7A 4F3QA 3MKZA 2VL8A 4CYCA 4LF6K 2FBHA 1FBSA 1BC8C 5AQKA 2QWQA 5IYBJ 3UKGA 3O3HA 1BIZA 3F3XA 1UB9A 1VSEA 1W7PA 3LPTA 1HRHA 1FIAA 2QWMA 2JA2A 2W24A 1KAXA 4AHCA 3TO6A 4CEQA 5M3MJ 2UXXA 5KGWA 1E0EA 4I7HA 2Y1IA 2IAJA 3CPEA 4LF8K 5J3LA 1LQ1A 4CJVA 3CCYA 3MWTA 1S7AA 3ZT1A 4KH4A 3X2QH 2VE8A 3DEWA 5E1WA 4HX4A 1C0GA 4LK1F 3BQZA 1HC8A 1W7PD 4DSEA 1WSIA 4MTEA 1T6DA 3KWIA 3CF2A 2A6EF 4CXFA 3LP2A 3QRFF 3VQ5A 3G2BA 1BISA 4BRIA 1N5YA 4BNCA 3BJAA 3A5LC 2YI1A 2QA4N 2ADUA 4GXOA 3U6FA 1O13A 3DBRB 3FFIA 2E2HJ 1HF0A 2VT3A 2KDZA 3OYNA 4CCOA 3BCAA 3LANA 1BI0A 2CYYA 2YCHA 3I4PA 4A3MJ 4FZYA 1J6ZA 1N77A 2DA4A 5JLHA 5AZIA 5L3BA 1D0YA 5TJJA 4XLNF 2XAUA 3NF9A 4CJKA 4JI4K 3AARA 3E7LA 2O8EA 4Y3OA 1YW9A 3E9OA 1YG2A 4DV0K 3J80K 4IWVA 4BR5A 1F43A 3AO1A 3WU2C 4UY8I 2VBXA 2E2PA 3AG1H 3I64A 2GEMA 4BDPA 5HDKA 3FKIJ 1KZHA 1VSDA 4F4KA 3E1YA 4ITVA 5B66C 2M4KA 2BTFA 4KFBA 4LFCK 1ZLKA 3PO4A 5ICFA 1NWKA 3DMJA 3TSUA 2M2EA 4YIRX 2ITMA 4A3FJ 3H9JA 3K7AJ 4GFBA 3ZT2A 4HA8A 2YJEA 1ZH5A 3QBXA 3IUCA 3DXJF 1XPXA 2O0YA 3HIFA 2NNYA 1NMNA 2Y69H 3QODA 1YQAA 1FJLA 2OTLN 3NARA 3TP3A 1O4XA 2XKPA 1W0HA 1HDPA 1DPUA 1QTMA 5AR0A 2XF6A 1GVJA 4HEA2 5DM6F 2R5YA 4DZJA 4WXHA 4QS8A 3VGMA 4PSWA 4JKHA 2LY1A 4EJTA 4E7IA 4L8RB 4CZIA 2NOGA 4IHTA 3K2PA 1OKRA 4ZJZA 1G3SA 3SQNA 2A42A 4EHTA 1BIBA 3IRXA 5JVHL 2WONA 5J2MA 3ASOH 2P5OA 4FHTA 4QS9A 3BY6A 3K2ZA 3V1QA 1WHUA 2E2JJ 5KAIC 3LZJA 1KQ8A 1UAAA 2QEXI 2KL4A 1ZARA 4JI8K 2VYPA 4DV7K 1ZN2A 1O3QA 3S1QJ 2NOJB 1QNTA 1OLTA 5C25A 2X74A 1REVA 2KZZA 5H20A 2XROA 1HJRA 1P2FA 4OINF 4JI6K 1QE1A 2JJ7A 1HPZA 3D0SA 4AYBN 3HRMA 2EZLA 2A6AA 1TT0A 2E6MA 2YHBA 3S1NJ 5KNLA 3ULEA 2MG4A 5F64A 2ZKZA 4WF2A 2L54A 1FYMA 3WTUC 2P5LC 5JI6A 4CYDA 3K9KA 3OR1C 3D2EB 4YOUA 3JTHA 4B3RK 2MA3A 1LW2A 1G15A 2E35A 4YOVA 1JKPC 4IRGA 3O4WA 5K1YA 4H5NA 1XSDA 1S1WA 1DGRM 3CESA 2NRAC 2EIJH 4B3SK 1H89C 1QZ6A 4MO7A 4XH5A 1YHQI 5CYMA 2KIUA 3I33A 3PIOF 4HDUA 1FNNA 3F8NA 1U2VA 3ATVA 2DFIA 2AO9A 1XMXA 4JK7A 3JR9A 4CEFA 4BKXA 4NO7A 3DU5A 4PGHA 3LSPA 1Y39A 3M07A 3P83D 4RB0A 2VI6A 2HBJA 4IOCL 1A5JA 4A2AA 2GZWA 1KLNA 2VKDA 3LSRA 4RM2A 3H0GJ 3MQ0A 2DT6A 1SMYF 2HHWA 1VSKA 2Z33A 2YS9A 3O9RA 2P9SA 3CM5A 4XL9A 4LFAK 4IHWA 3T1HK 4FW1A 2TDXA 4LOCA 1TL3A 4CK2A 2EH3A 4G9ZA 1Z7UA 2P9LB 3DLLF 4KHSA 1RDCA 4YEJA 2BANA 1OPCA 1S8NA 2RAEA 4H0OA 1KU2A 3VA3A 4JI3K 4NB5A 4LLNA 2WBMA 2CUZA 3CO6C 2GIVA 4G12A 3K70D 1JT0A 4CEZA 4Z6YA 4XM3A 4A3LJ 1P92A 4HQMA 4DJAA 2CG4A 2B63J 4EJVA 2P9PB 3VQ9A 1SFKA 1K6OA 2F5DA 1BL3A 3OYGA 4IO8A 4JS4A 2CRGA 2FBIA 4DR5K 2NS7A 4WYBA 4OWRB 3L1PA 3ZMDA 3AO5A 2Q31A 2E88A 3OHRA 5ED4A 2XY7A 1QHHD 1MBGA 1P7JA 2D1VA 3L3UA 4O5BA 4FX0A 5LLQA 2VWKA 4JBAA 4CF1A 5BPMA 2V79A 1LOTB 2FBYA 1RDUA 3V1OA 2DCEA 1RTHA 5JS2A 3GZ6A 4DTRA 4PKHA 1FMWA 2XRLA 3MKYB 1MMAA 2HHQA 4AYBA 1FKPA 5LRRA 2OA4A 2WBNA 4BACA 2CH6A 3QICA 3VYRB 4U67L 1LV5A 1EWRA 4YRVA 2A41A 2VCPA 2XY8A 4BVPA 2VQGA 2LBFB 3LDPA 4HG2A 4PHTX 2VONA 3ECHA 4E7KA 4XRSA 4J19A 1HPMA 2LVSA 4BVOA 3L00A 5E79C 2DDBA 1WJAA 5A2QZ 2IIRA 4LGWA 2ISZA 3FZLA 3C7NB 2R4GA 1R5GA 3KYDB 1IF1A 4Z0UA 4LLGF 4GNIA 2CQXA 1EX4A 3HUGB 3ZSYA 1Z0XA 5HLIA 3BP8A 3W3CA 1ZRDA 2A69F 1XWLA 1BN5A 1NGAA 3DPLC 5FFZA 2A61A 3B8AX 4FM0A 2PFBA 4A62A 3BLYA 2DFFA 2WADA 4M9XA 2GUPA 4M3XA 4IG3A 4IHSA 5FB2A 4C2UA 4DS5A 3GW2A 3HDDA 1TGOA 4DQ8A 2Q0OA 2OF7A 3ZMUA 2F9WA 2MLKA 2IAIA 2PX9A 2G8KA 2NVYJ 1F21A 1RTIA 4AILC 2XHBA 3CP8A 1IRZA 1X3WB 3VYTB 1UWBA 1K78A 5AQFA 3OR2C 3CFPA 3JAMO 1MBHA 3GYHX 4JRQA 2JA8J 2EV5A 3PLAA 3WNHA 2IA2A 3O4NA 3CQ8A 5C2DA 1VK0A 1KAYA 2JSPA 4HTLA 3NVKA 4M3FA 3DOLA 3U4LA 4LIUA 2XAFA 2DW4A 3BF1A 1UA0A 3QWLA 4QTRA 4Z4EA 3TARA 2ZFUA 1F5TA 4CJTA 2QSHX 2HQ5A 3BG9A 2HVRA 1U2WA 2XRNA 4OPKA 2XHKA 2L01A 4A61A 3PQJA 3WQUA 3PSFA 3ZYYX 5FROA 2Y31A 3SV3A 1C0FA 2HPMA 1KSPA 4CHUA 3OOPA 4BUPA 1JUPA 3GX4X 3CJQB 1TLHB 5BR9A 3OYAA 4DQRA 3CCVI 4X65K 4K2EA 4DSKA 1ZHFA 3CLQA 2P6TA 2K3FA 1QU3A 3DKYA 1V5EA 2F7TA 3RYRA 3IG1A 3ABTA 1DKGD 4OLAA 4F8RA 2KJBA 2D5RA 4A5BA 1A5WA 3THVA 3DRPA 4PA1A 4RCHA 3VPZA 5EEAA 4FL9A 3BJ6A 2XIGA 4N76A 3AO4A 1H8AC 3VENA 2ASOA 4Q4ZF 4Y7NJ 5E84A 3GG4A 3U3YA 1JLEA 3BTCA 3J81Z 1RIOH 5J2PA 5B5EC 4Z4FA 2Q8KA 4DLGA 2PY5A 2KDOA 2VJIA 1NTCA 2DFEA 1I27A 1U0JA 4A0YA 4CJEA 4CJQA 1RTDA 4MDBA 3HZ6A 3RZDJ 3PUFA 4F7ZA 4BGDA 3DCFA 1KFSA 2G8UA 4TV7A 2CS3A 3GTOJ 5D3GA 1XMOK 2L0KA 3KETA 5FLXO 2CV1A 4XORA 3H3OB 4WCEL 1NGGA 1DPRA 5C4XJ 2QI2A 4B8AB 1CZ9A 3SFIA 1QHGA 2J4RA 3DRRA 5EG0B 1E3HA 4JKGB 4BQLA 4HQEA 5B1AH 2BY0A 4BE0A 3H46O 1XMAA 3ULQB 4KA4A 3JSMA 3V4IA 2I10A 2MFZA 1RT6A 2G7HA 3K69A 1G2HA 3ZEUB 3FXUA 3B73A 2XY5A 4J00A 4II3A 2W84A 3VERA 1I1SA 1J5YA 3GXOA 2IRFG 3A8YA 4GYIA 2XAJA 1X19A 5DUIA 4KYWA 5J1UA 4M3UA 4DCHA 3PQKA 3V4GA 4E0DA 5D8LB 4AIJA 3HBLA 5L3DA 1NJXA 3MK6A 1GOCA 3K1PA 4NXNK 3CUOA 3P9IA 4FLXA 4FLVA 1FSEA 1K73O 5E1XA 3NRVA 3R6SA 1SL0A 5C4JJ 3I56I 1SEUA 3N4QA 3J7YP 3TU5A 1SFUA 2WY7Q 4K0KK 2EFNA 4JX4A 3GLXA 2Q2EA 3OV8A 4CZKA 1D1BA 4QCLA 3OYIA 4OX9K 3HRUA 4AHVA 2X48A 2KJCA 1ZBFA 4CK3A 4IVNA 2KHMA 4XQFA 4KHUA 1IDYA 3CI5A 1YRNA 3C94A 1YJWI 3MZYA 4FZZA 2JN6A 4IL6C 3TW6A 4ILJA 4B4CA 1GLJO 4G7HF 1BQMA 1RILA 2KFZA 3GL1A 1IKVA 4CGDA 1XC9A 2CV0A 1ETOA 1SAUA 1FEXA 4O6JA 2F4VK 3D2FA 2EIMH 5FDLA 2QZ8A 5BR8K 1DT9A 2ZJQL 1ASWA 3S3NA 4ASNA 2QLZA 3D0PA 1CLQA 3HRTA 4LFUA 5FKLA 5EDNA 5F1XA 4UB8C 1E17A 3FBNB 4V19S 3KLFA 4RG8A 3LM9A 3E66A 3DYAA 4OPJA 2W00A 1NK9A 2X1DA 3BF3A 1ZKGA 4W1UA 1YJ9I 5HDNA 3KP6A 3H0DA 2P9UB 1RNHA 1NNEA 4IOAF 2W48A 2KT0A 4DTPA 3ZMVA 4M6YA 5B3SH 2ZJRF 1W5SA 4MNUA 4N9IA 3R60A 2IS4A 3OYMA 4IXAA 1I1GA 2WOMA 2OCEA 1CGPA 3JAMK 4L18B 4A0XA 2QM3A 3I71A 5DEQA 1NGHA 2IS1A 3HM5A 1N25A 4LG0B 3AG3H 4KTZA 1ZLJA 1BR2A 1XQSC 3LSMA 4R8HA 3NMUA 3VF2A 2FOKA 4PUOA 1KU3A 4DV5K 3E5QA 3AG4H 1UHMA 5M1KA 5J2QA 1O1WA 1LNWA 4A57A 2L7MP 1JTXA 2GM4A 4KH5A 3T1BA 2JPCA 2K9QA 4G1QA 5F08A 3BR6A 1WJEA 4FETA 3I58A 1EQYA 4XOTA 3ZMSA 3OYBA 4GKJK 1Y97A 4M71A 2OZSA 3LAKA 3ZT0A 3CUQA 1J54A 5J40A 2BH1A 4LSLA 3NH1A 2HHUA 3KP7A 5FPEA 4H4MA 1VQNI 2P8TA 3GDQA 3LP1A 2G8WA 3TWHA 3TGNA 2A1SA 3FWEA 5GAHJ 2IDOA 5HLFA 3I59B 2DXIA 4DYQA 3EN9A 2D1KA 2HNDA 3DV8A 3PNVA 4KV8A 5HBMA 4YDUA 3CCVN 4QWQA 4ELTA 3GLLA 4UVCA 4HHTA 2V4JC 1EV7A 3GTMJ 3R1XA 3M8EA 4DG1A 3THXA 3SI6A 1DTTA 1TWAJ 2HMIA 2A3ZA 3E6BA 1ZG5A 1Z3XA 3TOAA 2O8DA 2QBYB 3CCUI 4PY5A 1XUPO 5ICGA 4DHYA 4M3TA 2IBDA 1XHXA 1WGXA 2G9WA 3A0BC 4B9TA 1EA3A 2FU4A 5CVRA 4CE9A 5J4YA 1VSLA 3O8GA 4QPQA 4YFNF 2K4BA 1HW2A 3HM8A 5FLXK 3D5LA 5C12A 1HQUA 2MH9A 2YNFA 4YOTA 2PYLA 5CVJA 4XLHA 4RGUA 5KQ8A 4QLCU 1P4AA 3VEPA 3FXMA 2EB7A 1KU9A 3FMRA 2ZD1A 3FK6A 2XF5A 1PUFB 2CQ7A 3IDHA 4CJPA 1DDNA 3M8PA 5JICA 2A6TA 4E7JA 2D45A 5LY3A 3ZETB 4PCQA 1XHZA 4BG9A 3KK7A 1IN5A 2JWTA 4KT5C 4BE2A 4H03B 3WG9A 2ZSHB 1Y1WJ 3K5MA 1QZYA 1GVDA 2DQRA 3A01A 4AVZA 1J9AA 2OPRA 1NKCA 5C42A 3ZT4A 3AO3A 3KE2A 2A3SA 4W5TA 3VQ4A 3MWMA 2GX9A 1EXQA 3E5UA 4HNUA 4G7ZF 3GTJJ 4XLFA 2I8DA 1WH5A 4FM1A 2STTA 3KKRA 1E2XA 3VYUB 2Y9YA 4OIOF 3QFPA 1JKQC 1QBJA 2O6GE 5EU7A 2Q0RA 3KEOA 4E19A 2E8AA 2ASPA 4CUGA 4II2A 4RLQA 1T8EA 2A07F 4KREA 1HKBA 2R7DA 3I56N 5HODA 1MBKA 2HDWA 2Z1GA 3LAJA 2E34A 2DMUA 4EEFG 2FC0A 1TZLA 4N41A 4X6AJ 1IV0A 3D2EA 3QINA 2HZDA 4CGZA 3ENOA 1VQKI 1Z25A 2D0BA 3EO3A 4Y0WA 3UKRB 2X1EA 4CF2A 3QOPA 3OYCA 2ECBA 4F3TA 2YJFA 4RWTA 2V52B 3OYHA 3LL3A 3WE2A 2FNAA 1RDWX 2UYTA 3WNEA 1KLMA 4OPHA 3RMAA 1S7EA 1BL0A 4LC9B 1YTUA 1KFDA 2FEZA 4WQ4C 2DOFA 4H0TB 3OS1A 3F73A 2VT2A 4LJZF 1FIPA 2XDVA 3NCIA 1A31A 3E3VA 1T44A 1CF7A 1JTYA 2ZFWA 3ZP5A 1V4RA 1FP2A 2OA8A 2O61A 3T1AA 4A3JJ 1FJGK 3CG7A 1TV6A 2QWPA 1YS6A 2VXDA 4XEIA 3VEWA 5LRSA 4OIPF 4H5VA 5AQRA 2XGCA 4F2RA 5M5WJ 2QWRA 3QDKA 2PJRA 3IP4B 4IJAA 4FK0A 2P9LA 1W97L 2E7WA 1X1CA 2P9KA 1D5VA 3H1VX 4P9FA 4BE1A 1DTQA 3VQEA 2XF7A 4F93B 4FE7A 3HTSB 2Q2RA 3HJFA 1MMDA 2OV7A 1BDGA 2QKLB 3R4KA 4LK0F 1W5TA 3ROUA 1WJBA 4P9UA 2A6HF 4O5VA 2F8TA 2ZXWH 1LEBA 2FMLA 2P9PA 4NCGA 2K9SA 4UUVA 2ETHA 2ZWHA 1REPC 1YUWA 3VMFB 4XLAA 4KI4A 3S32A 5F2RA 1O57A 3SJMA 2E5ZA 3L2WA 1C1AA 3CF5F 1YX3A 5ILUA 2JT1A 5M5XJ 1UCRA 5LMUK 1MBJA 2B0LA 2R7SA 4H0XB 1FXXA 4A69C 3JYTA 4BGBA 1B6AA 3K9TA 2DA7A 1Y0UA 4Y52J 4BQNA 4WFAL 2X6YA 3BR2A 3I9V2 1KYZA 1Q7YO 3IS9A 3K5LA 1R71A 4DF8A 4YIIA 4ZDPA 2EFOA 1SFXA 4DF4A 2CUJA 1POGA 3VTIA 1B9FA 3D5RC 5ELZA 3PNTA 3BCBA 2O8FA 2KKZA 4CBUA 5J4VA 3IWZA 4KFCA 2CH0A 2R7UA 1BM9A 4P1WA 5BPNA 4BRAA 5KCMA 4GRIA 2IA0A 1WLJA 4RB1A 1N32K 1S1UA 4FTHA 1JT6A 2A5XA 1DEJA 2E2NA 4CGJA 1RKTA 3PX0A 3SLCA 4CJ3A 2D0CA 5AQJA 1Q9YA 3CC7I 1TW3A 3JTGA 1FPQA 3BQYA 3BDDA 5D4RA 1OR7A 3CCUN 3ENHA 4FWRA 3CZ6A 3I8DA 3HGGA 3IAS2 2ZXIA 5IT3A 4NLBA 4RTFD 3ZRGA 3QFUA 2QKBA 3D7EO 1NKEA 2MLGA 1FOKA 1WRJA 2QSFX 2HXIA 3B6AA 4J8FA 2G7UA 3K4MA 3WNFA 3ERMA 1ZBHA 5FLVA 3N4MA 2QM1A 1OH5A 3LQQA 1AKHB 3VOEA 4DYCA 3HVTA 3CJAA 3V9SA 4FJ8A 1WKMA 3I4MJ 4MFEA 3MN7A 3RTRA 1RBSA 5FPDA 3CO7C 4HBLA 1Z1DA 1FP1D 2X1CA 3A2KA 3KEYA 2ZB9A 2NRZA 2OTJI 4GCVA 1YJNI 4C3HJ 1MH3A 4A3IJ 3GBGA 3AVCA 5J1RA 1XS9A 2EFWA 4E4HA 4UXNA 4BRHA 3H1QA 4BL0B 3ZX0A 5CR4A 4FOIA 2VJJA 4HWIA 3H3ZA 4UUTA 1ZR2A 2D5VA 4C9YA 4HF1A 4FQGA 1CXQA 5AQMA 4BC5A 4KIFA 2DAOA 2OBPA 3ML6A 3M7GA 2HW3A 2ECCA 1L3UA 1EJ9A 2D0AA 3CCMN 4ZYDA 4PGGA 1K8KB 1D1AA 2GLOA 1S1XA 1S9HA 3FXQA 4D9JA 1ZGAA 2E71A 2M45A 2XV4S 3GF2A 2B9SA 4PUSA 4RAZA 4I9QA 3KP4A 4B08A 3T3FA 4NLCA 3CPWM 4FWNA 2VUMJ 3G4SI 4Y33A 2GIZA 4PJMA 1ASUA 1FSHA 3P9CA 5HS8A 1T7PA 3CCLI 1HSTA 3EPZA 1MKMA 1VQKN 4BC4A 3I55N 4FJKA 3HZJA 1S5JA 3MDQA 5JLFA 1GDTA 3L2QA 2LG4A 4BR0A 2O8KA 1I94K 2E1CA 4M3ZA 2V6EA 3TAFA 1Y64A 2O4GA 1HNVA 3C2GA 2XAQA 4A3DJ 3G10A 2JRMA 1U5TC 3CCJI 4Z4CA 1P9QC 2D0OA 4F2SA 1U6ZA 1NGBA 2R7VA 5GP9A 3VOVA 3C18A 1LWEA 4M9SA 3THWA 1MD0A 3TMOA 3OYDA 1WJDA 3TW7A 2UUBK 3ISPA 2RREA 4JKGA 1HNZK 1IRXA 5DCFA 2VWBA 2AJQA 4YFXF 3DKWA 2Q1NA 2V9VA 1VQPI 3SYZA 4DLEA 3ZQHA 2GXAA 4NC7A 2FMYA 4C8LA 2FSKA 1ZELA 3CTAA 2NYXA 1PP8F 1SVMA 4HLYA 3VQQA 3AAPA 1D0ZA 1LDJA 1T56A 2LSOA 2HGCA 2FXUA 5F27A 3MECA 1HW1A 1LVAA 4CHOA 1O7LA 5D5WB 4HRIA 2HOAA 3VFZA 3R6MA 1MJAA 1LFPA 2QVOA 3HPHA 2EWNA 2K9LA 4HAMA 4NDLA 5DUKA 3SUNA 4V19K 2P5GA 5DMRA 2ZMEB 2LC2A 4N4NB 4BEHB 1VQLI 1ETYA 2UXCK 2XC7A 2J5OA 2V9PA 3KK2A 2HYJA 2RE2A 3S2WA 5J47A 1RR7A 1YS7A 1ZBSA 3I3LA 2IPQX 3SJJA 1XX5A 3HO1A 2G8IA 3DLEA 2VOPA 5AQTA 1ATRA 4E1MA 2RVCA 3O3KA 4DR3K 4DU1A 2VXZA 3BGRA 4E1JA 4B9MA 3DLHA 1JKRC 4X64K 1OVQA 2BW3A 2LKPA 2DA3A 3H9GA 5A2QO 2CQQA 2NRVA 4RAYA 3AA2A 4ELVA 3V8KA 3ID6A 4DBQA 2R7QA 5K7ZA 2BEOA 1S1TA 2K3PA 1Y6IA 5HOOA 3TR8A 4HX8A 3FZVA 5K5QA 2K7LA 3KCCA 4Z4HA 1Q8IA 2MC4A 1TT5B 3V6DA 1KAZA 1D9FA 3DLBA 1U8BA 2EPFA 1QPMA 4AWXB 1MMNA 3HB9A 5TGTA 5F0HA 5IP6A 2OZMA 4B1YB 2HXOA 1RZ4A 3OY9A 1XCBA 3E97A 3DBLB 2H8WA 2X4HA 3GTGJ 4FK4A 5BREA 3AVJA 2LH9A 2OUMA 2CW0F 4FOEA 3S2HJ 2E5NA 3REOA 4CDGA 1XDUA 1UAXA 3NGIA 3K0SA 2XSJC 3QOEA 2EZIA 3ECOA 1HKCA 3DLGA 1ATNA 1R0AA 5BPDA 4B1WB 4EJUA 4HUGA 3AAFA 4DIQA 1OCCH 4XSZF 4JI5K 4IRHA 4DR6K 2FNPA 1YT3A 1TTYA 3FZMA 2F5VA 5DD8A 2YHXA 4XOPA 1T0FA 4HCBA 5KAFC 2VKHA 1H88C 1MNDA 1TQPA 2JSCA 1KQSM 4DSIA 1Z05A 3M8QA 4KT6A 2WC9A 2PG4A 2IP2A 3WU1B 4ZYGA 1TWGJ 4AHSA 3WHCA 4LG0A 3CETA 3TAPA 1FYKA 4O0IA 5GTIC 3SHFA 1WPKA 4XKBA 4M3WA 3BG5A 3SYTA 2HKOA 3K0LA 2GA2A 1OVYA 4OKEA 4M45A 4CD3A 2V7FA 4RW9A 2RNJA 5D5VB 3GTLJ 3MFKA 1YJNN 2L02A 5GINA 1WJCA 1BC7C 4GY2B 1XGOA 2VJ5A 3SQ1A 4G6DA 2CO5A 1UJ8A 1B9DA 1X58A 3GVAA 2IVOA 2UWMA 4JAXA 3QYEA 4NNJA 3HOWJ 2W40A 2VKEA 4EM1A 2ZO4A 1TL8A 1HX1A 1ZG3A 4OJRA 4RW8A 4Y1CA 3VTHA 2KZGA 1KC8O 4WCGA 1HW5A 1NK4A 4FK2A 3QIPA 2OJED 4L5IA 5J6XA 5K7FA 1L5UA 2F96A 2V51B 3J81O 3ZT3A 4N47A 4LF5K 4UQGA 1A6IA 2DODA 4CF8A 4DFJA 2WB1N 4DYRA 1GT0C 1HLVA 3BG7A 4PDKA 1K83J 3OL4A 4ZTJA 2HBLA 4K43A 3CCLN 3WTSC 2VC0A 1SVOA 2WWYA 1S72N 5CVIA 5AZJA 1WSJA 2KZMA 2ZQBA 3T0YA 2HYFA 3WXMB 1QS4A 3WTVC 2E7XA 4M42A 5GAEP 2EK5A 1XSVA 2I7PA 1ETVA 4CGIA 1I3AA 3NEUA 4FWKA 4GMJB 3QYBA 5FJ8J 5BOXA 5EJCA 1Z7LA 5EVZA 2OD5A 1V5GA 4KISA 4WXCA 3FBIB 1QA6A 1ONVA 3RMCA 3ESWB 3K9JA 3A0HC 1IG7A 1HLUA 2YX4A 4RS8A 3JS6A 4EATA 1G6NA 3ZQCA 1B92A 1B4AA 2DN0A 3T19A 4YG2F 1IKXA 4MO4A 4BJTA 4OMYA 1B9MA 3A4CA 3MVPA 3GTQJ 4L0YB 4QS7A 1PYVA 1BW6A 3PX6A 1GLFO 3BG3A 1WJ5A 2KW4A 1Z3YA 3LQRA 5B1BH 2L7KA 4PJJA 1RESA 2IGOA 2HDDA 3SNNA 4A2BA 3PFYA 1NHAA 2MW8A 2TCTA 1HUXA 3WGGA 1W2BM 4HDVA 4LY7A 1ZR4A 2KZVA 4CZGA 1N36K 3P4IA 3GFLA 3QEWA 3CDHA 1G8XA 2HHTA 4OO1J 1RUNA 4AC0A 2DTZA 3OYKA 2HHHK 4DR7K 1I50J 5GIPA 2E1OA 4NCAA 4N56A 1L3TA 1BOAA 1ETWA 5FPNA 3OJUA 3HJEA 1NK3P 4B8XA 3C6TA 3BZCA 1VQLN 3AKZA 3NGYA 1GLLO 5IP9J 1NK7A 2F4OB 1BQNA 1WQ2A 2DOAA 2EJRA 3THYB 3UKRA 2PQ8A 3KJVA 1K61A 3Q9SA 1HDDC 3AL0C 4ZHRA 3S93A 2RV8A 2E2IJ 1EP4A 5LMNK 1VQ7I 2F6CA 5HNHA 1GHCA 4LF9K 2R5ZB 1QZZA 1RT3A 2H09A 2YKNA 2YHYA 4C3JJ 1J09A 3MZHA 4DQSA 3MCPA 2XB0X 2BUPA 3OS0A 3BROA 3AVKA 3GCMA 5CPRB 1NK0A 3AA3A 1VSIA 3BC8A 2ZC2A 4XKWA 4YHHK 4BR7A 1SAZA 3AA4A 1KXPA 4PFOA 2R7TA 4FLUA 2OQGA 1J5EK 4ZDOA 4WFBL 4DFPA 3EZWA 4U7DA 1RDDA 1LKXA 3HSFA 2B6AA 5J2NA 2HQNA 3ZSRA 4XNFA 2L9RA 3E6MA 3MZ8A 4A59A 2KPMA 4CZJA 3UIQA 3FM5A 3MCZA 1DGKN 2MBFA 2JUGA 4A3BJ 1TWHJ 4L9JA 3ABKH 5FPMA 4KI6A 2BHYA 3CQYA 3QEXA 4IDKA 5AQVA 3QERA 4AM7A 3CCRN 1BI4B 5BPLA 5BNGA 2BV6A 4Q5VA 2P9NB 2EV0A 4M74A 1NM1A 2YHAA 3E6CC 1YLFA 3ZX2A 3FMSA 4WE1A 4RGSA 2M87A 1ON2A 1MDMA 4BQAA 4DR2K 3JRCA 1LFUP 2D0PA 2ZNZA 2M1BA 3D5SC 4BU2A 3H08A 1RFQA 3SK3A 3KK3A 3QAHA 3EE8A 1SANA 3AAQA 3IH3A 4ZDLA 3DEUA 2P81A 1XGSA 3VQPA 4ESFA 3KLGA 3OBYA 4KBOA 1RT1A 2GWJA 4JLHA 1W0UA 3DLKA 2MH2A 3CMAN 4DU3A 1NGEA 1X9SA 1JLQA 4D5CA 5JMVA 4FCYA 4BWJA 3MAJA 2BBYA 2O8BB 4JKAA 2ESHA 5GPAA 2X6XA 2ZXHA 3MKWB 3JREA 2BXZA 4G6TB 2QWWA 4A3KJ 3FZHA 2OU2A 2KIFA 1JLFA 3BT9A 1TYQB 5HROA 3DKXA 3QU6A 3WNGA 1NMDA 1WSFA 2IGKA 1SL2A 2DMPA 2WAQA 1WZ2A 2LLKA 1E3OC 1K4TA 1SD4A 4U0VA 5E18F 3ONQA 3NVMA 4FJGA 3QLHA 1BI1A 1N78A 3JRGA 3Q7BA 3Q7CA 4L3QA 4Z94A 4I2PA 1U48A 1B72A 4A12A 2HF4A 3L2RA 1D1CA 3D45A 3R9PA 1OH6A 4PJNA 3O1BA 5C10A 5SWMA 1O3TA 3S1RJ 3GZNB 1SMTA 1SZ2A 1TKZA 1EH8A 3QNNA 2E36A 3P39A 1Y56A 3PUBA 4B8CA 1NBWA 1XCVA 3EDPA 4ZTFA 2RKHA 4HVJA 3A5NC 2UXBK 2R7XA 4E7LA 3GUDA 1W7PB 3JRDA 2O5RA 4X0GA 3SXYA 4CBWA 3F0CA 4NUBA 4EP4A 2BYVE 3U8XA 1IC8A 4O55A 3F9MA 5HLGA 1ZBUA 3R0AA 4LMYA 2IS2A 1B1BA 3K4LA 4A5AA 3CJ1A 4AH9A 1BHLA 5LL6Z 1VQ5N 2ELKA 1WI3A 2M0MA 2VGNA 3B02A 2E4LA 4AIDA 3LDSA 2GBYA 4AM6A 1VNDA 2LKSA 2QWNA 5C24A 1BA1A 5AQWA 1Z77A 5LHGA 1BBYA 5JR3A 1WH7A 3LSKA 1ESVA 2BZTA 1TKXA 4Z2YA 4AD9A 3WTTC 2NUBA 2ACJA 2RGVA 4D7MA 1QVTA 4IZZA 4KHYA 1JXSA 3BPXA 5MLCQ 3K70C 3NF7A 1QVGM 4GW6A 3DAWA 1K8KA 5T7BA 4JKFA 1CQTA 1A36A 1TBXA 3NWTA 4CFDA 2UZKA 4U0WA 3GE1A 3ZN1A 1XN7A 2ZCWA 3TSPA 2M5WA 4IOAL 3HOUJ 3QETA 5EEGA 2YU9J 5E3MA 2YHWA 2ZJRL 3DXKA 2HTSA 1SKRA 2O8EB 4V2GA 1P90A 1LE8B 3ABUA 3DU6A 3NDKA 1UG0A 2PEXA 2IW5A 1SV5A 1T6SA 2JVGA 4ISGA 2JK3A 3AG2H 3M3YJ 3UKUB 2MSYA 3LOCA 1CXUA 5DM7F 3DXMB 2KIQA 3MCAB 5GAHP 1VRUA 2BHZA 2TRTA 1AU7A 2VKVA 3ASMA 2LMDA 2DOEA 1R1TA 2KRFA 5AQIA 1B59A 3LDLA 4B3XA 2Z1HA 1WBDA 2DMTA 2FBXA 2R3SA 2PN6A 3K4CA 4CHNA 1Z21A 3HOTA 4AHUA 3TOBA 1E3MA 4F55A 4YOXA 2XGEA 2PMHA 3QP6A 3EUHA 2R5YB 4IHXA 4NCBA 4U7BA 3OS2A 4JKDA 4CEAA 1JUSA 2LP0A 1DP7P 4KNYA 3JRAA 4IKFA 4AUXA 1SVLA 3AVNA 3PM1A 3J7YJ 2RPIA 3CMYA 4WFNL 4CERA 1PDNC 3Q3SA 2ZJQF 2JRTA 2ME6A 4DW6A 4Q47A 4K8ZA 1PJRA 4O5FA 2NLXA 4MO5A 1XI1A 1FK9A 4CSWA 4Y17A 2FQ3A 3KZYA 4CO8A 4FJLA 3HRGA 4JKBA 2Y0MA 5LHHA 1D8KA 2RN7A 1H0MA 4JNEA 4JD2A 3PJRA 4ZZLA 1ZQ3P 4IRIA 5TRDA 1Z67A 3CP2A 4Y1DA 3M8SA 3EYIA 5IPAA 3HSTB 2FBTA 1S29A 2MABA 1YITI 4Y15A 1XC3A 4BY1J 3N05A 3HHGA 4FX4A 2E1YA 3H1CA 1S6QA 1F1ZA 1H9GA 1ITYA 1VRTA 2X6WA 3KWGA 3ALYA 3LDNA 3IAYA 3ULEB 4H4OA 4UB6C 4WQ5C 3U3GA 4FWOA 3HKZN 5E26A 4F9OA 3RCOA 1AOYA 2KHOA 1WBBA 4KO0A 3CC4I 4FJXA 3LDQA 3SZ2A 2CW8A 1T98A 4LITA 3FZKA 1RR8C 4DV4K 2R7WA 2QXFA 1G4DA 1MZBA 4KITB 1W4MA 4QPOA 2Y2ZA 2ZBKA 3NAUA 1SUQA 4CHZA 4I2OA 1JGSA 2H1KA 2HMPA 3AVIA 1U2VB 3S9HA 2LDUA 3O80A 3RKWA 4WK8F 3G3ZA 3H6EA 2DI3A 4CF9A 2HEOA 4Q5SF 1HYZA 2H3GX 4BDYA 3WEEA 2BE2A 3V7CA 2FXAA 3I54A 4HCCA 1T39A 2IGMA 3LSJA 2Y0SN 3SDGA 4OIQF 2XB5A 1Z26A 1K7AA 2Y1JA 4X1EA 3CCQI 2H94A 2FRHA 4KJZA 2NNNA 1MSFC 1QHAA 1D0XA 2P9SB 5CVVA 4H0YB 4DS4A 5FLXZ 3SZTA 2V1XA 3CC2I 4HF0A 2YKMA 1TAQA 4BRKA 4EGZA 4JI1K 2P9IB 1XGNA 1MJ9A 4IF4A 2I7NA 2PBIA 4IO9F 3WTZA 1QSSA 4B48A 1ORKA 3QU3A 4JI2K 3VYSB 3IKMA 3DQVC 3BR0A 3FX3A 5CQGA 4FZXC 1OCTC 2OANA 1GV2A 4XH4A 1VF9A 3E1SA 1RT2A 4C2TA 1JKOC 4I99C 3NH0A 1BG3A 3LA3A 3VQ8A 2L2OA 4HYEA 1VQ4I 5GAGP 4JN4A 1FTTA 2KP6A 4ENMA 3QEIA 2A68F 4M7YA 1RBRA 4IZ9A 3LPUA 2DY4A 2RQQA 1J53A 1QVFM 1JXBA 5M3FJ 4ZC3A 3FGUA 4GDFA 4O3MA 5DCMA 5FKOA 4ESJA 3OYJA 4BH9A 4WX9A 1E3PA 4DB3A 3R61A 5KPTA 1OJLA 4ENJA 3QPHA 1VQOI 4X66K 3U1KA 1MMGA 4EP5A 2DA6A 2Y48A 3O6BB 3JRIA 5AQSA 3VDXA 3RYPA 1NK2P 2QUFA 5C3EJ 1QGPA 3O9QA 2ZGZA 3ZXSA 5LHIA 3IRRA 4I0BA 4DTNA 3TABA 3DJCA 3I0TA 3HKZA 3HPGA 1YE9A 3HRSA 5KPZA 1ETXA 1OISA 5FKNA 1JUMA 4JK8A 3O8HA 4M72A 1E4GT 5AQLA 1U49A 4CCHA 3ABLH 4CJ5A 2V26A 1YFHA 2FBKA 2X6SA 3L9FA 4CFAA 4FJJA 3CJ9A 1U3EM 1WOQA 3PO5A 4XH1A 1M1KO 3RDIA 4FISA 3RRGA 5DD4A 4A2UA 3VEVA 1FBUA 5D4SA 1I5ZA 4JQFA 3CF5L 1ODDA 2E19A 2E1MC 1JLAA 1HYSA 2N8GA 3KVGA 4C2MJ 3QMLA 2JZYA 4KHWA 3QYFA 3FKJA 1JLCA 2Y0SA 3FHNA 3MN2A 2QKMB 4RGXA 5L3CA 3GFIA 4JI0K 2VIXA 4C8MA 4KRFA 1ACIA 5JVGF 4WQ5A 3F22A 4ESBA 1AWCA 4BREA 2ID3A 2IJLA 4NYFA 3VQAA 4AM3A 1HKTA 4PWDA 2GWRA 1N75A 3CMMA 3V9XA 4I7FA 1X9MA 3FXLA 2ZM6K 2M8EA 2BGGA 5J8CA 3P7NA 3GOIA 3O5BA 3KLEA 4H5TA 4B3OA 3U9DA 4H0VB 2IA1A 4K42A 2QA4I 4B1VA 1HCRA 1WSEA 2EV6A 4CA0A 1YTYA 4N4OB 2OPPA 5EY4A 4C1NK 4F3OA 3VGKA 2QEXN 2PI0A 1UHSA 3J8AA 3IL2A 2YPRA 3MD2A 5FKMA 3DLAA 2EFPA 4MEXF 1RCHA 3LWLA 4KN4X 2VQLA 5M1QA 4HUEA 3FR0A 2DA2A 1SFOJ 2C6YA 5BN9A 1GLBG 3FXOA 2P4WA 4B47A 4XRMA 3FHZA 1WSGA 2EX3A 3WXIA 2AXLA 1YITN 1J0RA 3MKLA 1KVCA 4BRMA 4KH6A 3OA9A 5AQOA 1N33K 3CCSI 1IAWA 4M6VA 1HBXG 3FFKB 2DTUA 2JTVA 1LW0A 1Q81O 4BHPA 2LY2A 3L0QA 3VQCA 2O8CB 2Z1IA 1U9OA 4CESA 3VEOA 2VJ4A 1YHQN 1IZ1A 4FYDA 4A6DA 3ID8A 5K5OA 2NNWA 2VOOA 4Z4GA 1W36D 2JVHA 4JX5A 2G8FA 2PMZA 3SQ0A 2HS5A 1WI9A 4CJWA 3AVMA 3CUQC 1B8IA 4PL8A 4B9QA 1D8JA 2W25A 1TK8A 1HKGA 2W42A 1ZAOA 3WU0A 3BPVA 2FJ1A 1AHDP 3FXKA 3V9UA 4QOZB 4LB5A 4AHRA 3S8PA 1BOTO 3C1DA 3WODF 4YDUC 1C1CA 1TUUA 1YTAA 2A5WA 1RGIA 1LFBA 3WXJA 5SZTA 3OIQA 3VQDA 4DTJA 3HYIA 4BBSJ 3CC2N 4KMUX 1TVRA 3ERED 3O2PE 2K02A 4CIEA 1F4KA 5FRMA 2R7OA 2AHQA 2VASA 4D1QA 1LDDA 1A5VA 1KD1O 2KRHA 4ZYEA 3QESA 1GLNA 4K25A 3ZX3A 1JHFA 3SEQA 4UUSB 1VTNC 1QVUA 4XK4A 1IG9A 3ZSVA 1IRFA 4CZCA 2X78A 3TQNA 4UHTA 2R7ZJ 5LGTA 1VQ4N 3J7AP 4FT8A 1M1EB 9ANTA 3L2CA 2GV9A 2IEKA 5B8HA 4DFKA 1BR1A 3AFHA 3TDUC 2Q3SA 3PL8A 1BGXT 3BJOA 1QQCA 1HNIA 2O8BA 4XIDA 2Q2EB 3MWPA 1SL1A 1BA5A 1CZAN 5HS9A 4W5OA 1LAVA 2GQQA 1X1PA 3DBHB 1TYQA 4MQ9F 1DU6A 1XB4A 5E20A 4PQUA 4ICLA 5EGOB 1U8RA 1UOCA 3HM9A 1TWCJ 2VQHA 1RDAA 1Q86O 2IGIA 3O4QA 2NRTA 4I02A 1GOAA 3TDZC 1T05A 5D6EA 5AQXA 1F36A 1MIJA 3D2FB 3DPUA 5FGMA 4RDUA 2V7ZA 1KQ9A 2HHSA 4AHTA 3L7WA 1OCPA 2L7ZA 3W6JB 4JS5A 1KRPA 1GV5A 1IXSB 2HQAA 1WSHA 3N4PA 2WC2A 4DSJA 4DUYK 3SUPA 3AGRA 2DK8A 1YXQA 3CFOA 3ZCMA 2HWVA 6PAXA 4O44A 2IS3A 3MN9A 2KLAA 5LD2C 4F91B 2NS0A 2F5EA 1QRYA 2LYCA 3CYMA 2X0LA 4KICA 3O3GA 3DPTA 3KLOA 3ABMH 3HK2A 4U87A 2FE3A 5L3GA 3P9KA 2W6KA 4DV2K 5AJ3K 4YFKF 3L3VA 2O9LA 4GKKK 5AQPA 2ELHA 5IYDJ 1GXQA 4C8OA 1X9JA 1RT7A 4PKIA 3FLCO 1STZA 2EQRA 4M7XA 2QYOA 3SAGA 1TUYA 4KIBA 3RI4A 3PIPF 3E6DA 4GV3A 2EWSA 2X6OA 4K8XA 2COBA 4B09A 2XAHA 1JE8A 1ZGJA 1IW7F 5HNFA 4FJHA 3BZKA 3L2UA 2V1NA 3TAMA 5TISC 3MEDA 1MWMA 1IN6A 3OJSA 4W97A 1NGDA 2YV0X 3HP9A 4ETSA 2GELA 3H5NA 4AF1A 3ZSXA 1V3FA 1M90O 4CJLA 5EYRA 1QQNA 2P1JA 4CZHA 2A5YB 2EA4A 5TKYA 3LP0A 2HHXA 1USSA 4MHGA 2CUEA 3CUQB 2H27A 3G71I 3RR8A 3TTDA 2CQNA 3MMYB 4CZFA 4DZPA 2HI3A 5CHIA 4DWIA 2QSGX 3T8TA 1FT9A 1IBKK 2DYSH 5E3OA 4KB0A 1LE8A 3RSNA 4JK9A 3IC7A 2QQAA
chains in the Genus database with same CATH topology
1SUQA 4CESA 4I2PA 3WNHA 4CHZA 3RR7A 3V1QA 2KQ2A 3O4NA 3CQ8A 2HVIA 1VK0A 4CGIA 4FJ5A 1I3AA 1U48A 4FW2A 4GMJB 4CHPA 3AVIA 4M3RA 3KKSA 3MAQA 3L2RA 1TAUA 4CEBA 4FYDA 3K5NA 3S9HA 3LZJA 3D45A 3K59A 4J2AA 1U45A 2O4IA 5JS1A 4BE1A 1DTQA 3DOLA 2ITGA 3P1GA 1UA1A 4OKJA 3K5OA 3VQEA 4YNQA 1C0MA 3RMCA 2AJQA 5SWMA 4KTZA 4Z4GA 1C1BA 4LD0A