1EKEA

Crystal structure of class ii ribonuclease h (rnase hii) with mes ligand
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
222
Chain Sequence
MIIIGIDEAGRGPVLGPMVVCAFAIEKEREEELKKLGVKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNSINLNDIEINAFSKVAKNLIEKLNIRDDEIEIYIDACSTNTKKFEDSFKDKIEDIIKERNLNIKIIAEHKADAKYPVVSAASIIAKAERDEIIDYYKKIYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKSKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal RNase HII: a homologue of human major RNase H
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HII
total genus 79
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1ekeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ekeA01
2YKNA 3FFIA 3L3VA 3QNNA 3P5JA 1JL1A 4FVMA 4FW1A 3RTVA 3I0RA 3M8SA 1EP4A 1I3AA 1NK4A 3TAEA 3TAFA 3SI6A 1RBVA 4CGJA 4F3OA 3IS9A 1SL2A 1L3SA 3L2UA 1S6PA 4B9MA 3VQ6A 4J2BA 4CESA 1ZBFA 4H4OA 1VSJA 4CEOA 5KRTA 1VSKA 1N6QA 5C25A 2XO7A 3BDPA 3KD5E 4EZ6A 4DU4A 3G0ZA 4NYNA 1JLGA 3ZSOA 5HRNA 3WNHA 3ISNC 3ZSVA 4CJ5A 5KRSA 1QHTA 2DY4A 1BIUA 3OVNA 2D0BA 3NGYA 2AJQA 4OKJA 3RRGA 4OJRA 1KVCA 5KI6A 4CFAA 3EY1A 3HVTA 1NJXA 1D9DA 4B3OA 2FBXA 2KW4A 1JLQA 4MQ3A 3QEVA 1NKCA 1HQEA 4CIFA 1CZ9A 4B9NA 4K8XA 4OPKA 1J53A 4HUFA 3KJVA 3L2QA 3LZJA 2KFZA 3ASMA 1WSGA 5CZ2A 4M45A 3QESA 3QEPA 3L8BA 3TI0A 2P5OA 4M3YA 4F3TA 4KREA 1BHLA 2NUBA 3AVBA 3LPUA 1UA1A 1UWBA 4CJSA 2ZQBA 3DRPA 3OYKA 1X9MA 4NYFA 1CXUA 4KAZA 3CM6A 5E41A 1ZYQA 4KHNA 4OLBA 4N56A 3ITHA 1HYZA 1S1WA 1NOZA 1SUQA 4DFKA 4CJTA 4DTRA 3K59A 4RW4A 4LSLA 3LP3A 3RWUA 2HHWA 1TVRA 3C95A 4HVJA 4DTJA 4CHYA 3CQ8A 3KK2A 1WSJA 4CJPA 1WNSA 4C8KA 1HRHA 1TV6A 1B9FA 3VQPA 1VSDA 3T3FA 1JLAA 4OKEA 3SQ1A 4H4MA 4M3TA 4ID1A 3KLFA 4KFBA 4FCYA 4FK4A 3V9XA 4CFCA 3NF9A 3ZT4A 4DLEA 3QERA 4FJNA 3C94A 3AVHA 5HP1A 4CJEA 2VWKA 3O3GA 1LWFA 4DSEA 4JRPA 3AA5X 3BGRA 2XHBA 3NAEA 1NK7A 1U49A 3DLBA 4DTUA 3V4IA 3CG7A 3DYAA 5FDLA 4DQRA 4EZ9A 4PY5A 1C1CA 4KTQA 4DS5A 1RBRA 2E4LA 4FM2A 3T19A 3JYTA 3AVIA 3LPTA 1BCMA 1KRPA 4RW7A 4CEEA 1KTQA 4OLAA 1A5VA 3RMCA 4CGGA 4OVLA 1BI4A 3AVMA 5FROA 1RTDA 1NK9A 4JLHA 2GUIA 1DLOA 4B08A 4BWJA 4CF8A 4BE0A 3SUOA 2G8IA 3AVNA 4CJRA 4FJHA 3NE6A 1D5AA 2F8SA 3DM2A 5C24A 1R0AA 1QSYA 1B92A 1LV5A 2YHBA 4AHVA 3OYAA 4FLZA 1YVUA 2HVHA 2ATQA 1L3VA 4ZHRA 4LY7A 2BANA 4DG1A 3OJSA 1RILA 4CECA 3TAMA 4CHPA 2EX3A 1DTTA 4M3UA 1W9HA 3HPHA 1IKVA 2F96A 4AHSA 2G8WA 1JXBA 2BDPA 2X74A 5HROA 3RMBA 3HYFA 5FRMA 2HHQA 4E3SA 5CYQA 3QEIA 2OPQA 1RDDA 1RBSA 2XY6A 3V6DA 4CFBA 1NJYA 3VQAA 2YNFA 4CHNA 3DMJA 4W5RA 1J54A 4E7KA 4DFMA 4O0JA 3L2WA 4Z4HA 1K6YA 1XHZA 5D3GA 1S1TA 4CF2A 4C8NA 3NDKA 4DU3A 5DK5A 3V1RA 2IDOA 4N47A 5SWMA 1NOYA 4Z4GA 5SZTA 3PX6A 1NK0A 4E19A 1NK6A 3S3OA 1HJRA 3KLEA 4O4GA 4NCBA 3ZSZA 2FC0A 1JXEA 1RDAA 3QINA 4FM1A 4KPYA 3K2PA 4DTOA 3KLGA 4CCHA 4KTWA 3MXIA 3EYZA 3TARA 4I2PA 3E01A 1A5WA 2JGUA 3MEEA 4DTMA 4FK0A 1RT5A 4E7HA 2ZD1A 2DFFA 2Y1JA 3TWHA 1GOBA 3AO3A 1VSFA 1RBTA 2RN2A 2W42A 3RMDA 4LD0A 3KK1A 2KZZA 1HMVA 3U3GA 1I39A 4N41A 3AVLA 4HUGA 1NJZA 2O4IA 2IC3A 2WOMA 2P1JA 4E0DA 4CHOA 1BGXT 4I9LA 1S9EA 3KLIA 4DQQA 4CFDA 4UQGA 3QNOA 3LANA 4BDZA 4KHSA 3DRSA 3M8RA 5J2PA 1VSHA 4AILC 4RW8A 3ZSXA 3THVA 5HRSA 3V81A 2IOCA 3OYHA 1U47A 4AHRA 3EZ5A 3DI6A 1W0HA 3HPGA 4JS5A 3NBPA 3TABA 4ID5A 3SQ0A 2OYQA 3OYGA 1MU2A 2IGIA 3SZ2A 3SYZA 3QEXA 3F73A 3HL8A 5DMRA 1UOCA 2B6AA 3DRRA 3MEGA 2HHTA 3DLKA 4MFBA 3SCXA 1QS4A 2FBVA 4AH9A 4FLWA 1L3TA 3QO9A 4OGCA 4N76A 1VRUA 3SV4A 3ZT3A 3D45A 4W5TA 4CHZA 1RDCA 1UAXA 1SKWA 4DFJA 3K5MA 3VQ8A 1U45A 4HCCA 1BIZA 1N5YA 1B9DA 4FK2A 3PY8A 2E6MA 3TR8A 4W5OA 4B9UA 3ULDA 5J2QA 1TKXA 4Z0UA 2JLEA 2O4GA 2X6NA 3VQ5A 3L2RA 3RRHA 3SV3A 4QOZB 1RT4A 2G8VA 4IDKA 4E7IA 1KLNA 2P5GA 3PUFA 4KO0A 4KB1A 1BL3A 3HVRA 4CGFA 3PX0A 3JSMA 2HHUA 1IKYA 3KD1E 4J2AA 1RT6A 4FLUA 3ALYA 2OZSA 4I7FA 1IO2A 1ZBUA 1U04A 4CJKA 3KTQA 4FLYA 3K5NA 1EX4A 4K8ZA 4F2SA 2EHGA 1X9SA 2I5JA 2B5JA 3AO1A 3SPZA 1C1BA 5HBMA 3NGZA 3LZIA 1HNVA 4Y1DA 4BWMA 2E6LA 4E1MA 1FXXA 4DQIA 1WSIA 1VSIA 2Z1JA 1GOAA 1RCHA 2VWJA 3F9KA 2Z1IA 1LWCA 4IBNA 1U48A 5HRPA 1NKBA 2G8FA 3AVJA 4PA1A 1REVA 3CFPA 4B9VA 1J9AA 3AVCA 4CEAA 3LP0A 2HNDA 4O44A 4ELTA 4CJVA 1CLQA 2VG5A 4O5BA 1KVAA 2YKMA 1Z25A 4M3WA 1LW0A 2PYJA 4AHUA 1RT7A 3LDSA 4W5NA 4GMJB 3V9WA 2D5RA 4FLVA 1T8EA 3IG1A 4O0IA 1SV5A 4FJ7A 2KZMA 1WN7A 3ZSWA 1S6QA 4YFUA 3MAQA 3SQ2A 1TK0A 3CFRA 1TAUA 2QKKA 2Q3SA 2HHVA 1S1XA 1DTQA 2G8KA 3NF6A 2BE2A 4Y1CA 4M3RA 1VSMA 3SQ4A 4IKFA 1BISA 1CZBA 1HPZA 1X1PA 4RW9A 4ELVA 3AVAA 3TAGA 2LSNA 4EP4A 3ZSRA 3VQBA 1LAVA 3DOKA 3NF8A 1X9WA 3ZSYA 1JLCA 1NK5A 1RT2A 5K14A 1XC9A 5CY4A 3C6TA 3PX4A 3SUNA 4C8OA 4F8RA 4HHTA 1EKEA 4CJQA 4BE2A 2HW3A 3KKRA 4FJGA 1ASVA 4DMNA 4I9QA 3NF7A 1TK5A 4C8LA 1WSFA 3LP2A 3MXMA 1S9GA 4IG3A 3OS2A 3M8PA 2VG6A 4C8MA 2RF2A 3NH1A 1KLMA 4PWDA 1RNHA 3C6UA 4CF0A 3OYMA 4DTXA 2IS3A 5HLFA 1XHXA 3AVGA 4ZTFA 3S3MA 2ITGA 4R5PA 3I0SA 3A2FA 3DLGA 2X6SA 4LH5A 2HHXA 2YV0X 4FLXA 1TL1A 1SL1A 3M8QA 3LWMA 4DF4A 1RTJA 3OS0A 2HVIA 1RT3A 1TGOA 4IFYA 2XY8A 1S1VA 4FW2A 3ZSQA 4H8KA 4NCAA 4AHTA 2WONA 1ASUA 3OYIA 1ZBHA 4FJLA 5I42A 2YHAA 1NJWA 4FZXC 4KHUA 1FKOA 3U6FA 1KSPA 4NCGA 4KKOA 3VQCA 5KGXA 4BDPA 4CJLA 1KFDA 4CHQA 5J2NA 3OY9A 1T03A 4CK2A 4FJIA 5J1EA 1TKZA 1Z26A 1Q8IA 1BI4B 2OPPA 3QIPA 4LH4A 4E89A 3KK3A 3HM9A 3VQ7A 1SL0A 1Q9YA 3OYJA 1BQNA 2Z1HA 3OYEA 3G10A 1SKRA 5EU7A 4DSFA 1XWLA 1QTMA 2QK9A 3IRXA 3AO2A 1SKSA 3L2VA 2QXFA 4L8RB 3OS1A 1FKPA 4FLTA 2Z1GA 3B6OA 4CIGA 3LAMA 4O55A 1IKXA 4BACA 4DSKA 1VRTA 4PQUA 4DFPA 4EP5A 4DTSA 3AVFA 2G8UA 1ZBIA 4FXDA 1RTIA 4KTZA 1YT3A 4E7LA 4Z4CA 4LSNA 4CJWA 3MEDA 4CERA 1KFSA 3V9UA 3O3HA 4I2QA 3NHGA 4RG8A 3OYFA 3TANA 4DS4A 4M42A 3VQQA 4YNQA 1C6VA 1BQMA 1NK8A 5JS1A 4ZTJA 3TAQA 1QSSA 3HP9A 3MXJA 2RPIA 5CYMA 1ITGA 4FM0A 1D9FA 1G15A 3ZT1A 4FZYA 4Z4EA 2IAJA 3CFOA 1A5XA 3P1GA 3RMAA 4B9LA 3T1AA 1TKTA 3I8DA 4FJ9A 4CE9A 4CJ3A 4DSJA 1GOCA 1LWEA 4CEQA 3NGIA 3CYMA 4FJ8A 3OYDA 1T7PA 1JLFA 3LAKA 1ASWA 2GV9A 5HRRA 4B8AB 2GBZA 3AA2A 3H08A 4IFVA 1D8YA 2HMIA 2KTQA 3VA3A 4E7JA 1T05A 3DLHA 1TL3A 5FRNA 1J5OA 3LALA 3PO4A 4B8CA 3DOLA 1L5UA 4KHWA 3OYLA 3KIOA 3S9HA 4DTNA 3RR8A 4FJMA 1IH7A 3KLHA 5T7BA 4ELUA 3AV9A 3SUPA 4CK1A 2R7YA 1WLJA 4DU1A 1YTUA 5KGWA 4M3XA 4OPJA 4F4KA 4CJUA 4KHYA 1EETA 1XI1A 1JLBA 3V1QA 2XY7A 4M41A 3K57A 1LW2A 3AO4A 3WNGA 3OYCA 3V1OA 3HP6A 4Q0BA 3WNFA 5C42A 1YTAA 4F2RA 2DFHA 1TKDA 3NH0A 3HK2A 4B9TA 1WSEA 1HQUA 3VQDA 3ZCMA 1HYSA 2OA8A 1VK0A 3HO1A 4CJFA 4TSXA 3D0PA 3IAYA 4PUOA 1TK8A 3CM5A 1TAQA 1HNIA 3P83D 4GW6A 3HJFA 2Y1IA 4RW6A 3VN5A 1WAFA 3HT3A 1RDBA 4WE1A 4CF1A 3OYBA 3K5LA 3SUQA 3ZT2A 4DSIA 2YNHA 3O4QA 4IG0A 4FYDA 1RBUA 2OPSA 2FBTA 1IG9A 3AVKA 3HSTB 2ZE2A 3QIOA 3ZT0A 4BE1A 2DFEA 4DF8A 2KQ2A 4JS4A 4QCLA 1UA0A 3PO5A 1S1UA 3V9SA 2HNZA 4DSLA 2F8TA 1C1AA 4DLGA 3DLEA 2HB5A 4CIEA 3HXMA 4B9SA 2FBYA 1EXQA 4FJXA 4FZZA 3NH2A 4E1NA 1U4BA 4DWIA 2XY5A 2BGGA 1KCFA 4Q5VA 4CEFA 3NFAA 4QAGA 3WNEA 4JRQA 3VQ4A 4J2DA 1RT1A 1C0MA 1FK9A 1RTHA 3MECA 5KTQA 4Z4IA 1VSLA 1HYVA 1QSLA 1QE1A 3U3YA 3PV8A 4J2EA 3AA3A 1Y97A 2A1SA 4CK3A 3HPOA 3LWLA 2HNYA 1JLEA 3O4NA 3QETA 4CJ4A 2PZSA 2P51A 4Z4FA 2HHSA 4HUEA 1S5JA 1KVBA 4DTPA 3QLHA 4CEBA 4CF9A 4DQPA 2X78A 3L3UA 4FJKA 3OYNA 4HCBA 4XIUA 4KV8A 4ICLA 2XRIA 2D0CA 2YNIA 3V9ZA 3B6PA 3O3FA 3SNNA 3RR7A 2OZMA 2QKBA 1F21A 2PY5A 1CXQA 2DTUA 3AO5A 2PYLA 4KI6A 4KHQA 3VQ9A 4CGIA 4G1QA 1JKHA 1LAWA 1O1WA 2ETJA 3OJUA 1VSEA 1C0UA 2VG7A 2D0AA 2A1RA 1BCOA 1NKEA 4KB0A 3SJJA 1C0TA 4GVMA 3QEWA 4BDYA 4CGHA 1QQCA 4KI4A 2G8HA 4OKKA 3S3NA 4FJ5A 4KRFA 2RKIA 3UIQA 4CEZA 5I3UA 3AA4A 4N5SA 1L3UA 5JS2A 3TAPA 4M3ZA 4DQSA 4FJJA 1JL2A 2OPRA 4W5QA 4CGDA 3NCIA 5J2MA 4HTUA 1IKWA 2YNGA 1WAJA 1ZBLA 5CZ1A 3K5OA 4AHCA 3LP1A 4OGEA 1Q9XA 2KFNA 1WSHA 3VQEA 3K58A 4CEDA 3DLRA 2B4JA 3VA0A 3KKSA 3SPYA
chains in the Genus database with same CATH superfamily
1HJOA 3EYIA 3O5BA 5AFUA 3RZOJ 4UB6C 4ILGB 3DBRB 3JR9A 3M8SA 1T08B 2JPCA 3B6CA 3RTVA 1TQPA 3ZQHA 1QQMA 5IYDJ 4CGJA 5AQNA 1K83J 4F3OA 3IS9A 3LDNA 2YU3A 2XB5A 2G0EA 2VQCA 3R60A 2IS1A 4A0YA 4B9MA 1E3OC 5GAEJ 3CCMI 2PJRB 2VQLA 3PM1A 4NC7A 4BR0A 3TTCA 1R5GA 1EH6A 2W7NA 3WXLA 2VOPA 4A5AA 3VSLA 1VSKA 2W41A 1N6QA 3ESWB 3H5RA 3O8MA 4EZ6A 1C0FA 3G0ZA 3FZLA 4FVUA 3W2WA 4PKGA 3FMRA 3F5TA 4PJLA 3VEZA 1NMNA 3ZXSA 1QBJA 1WGXA 3WNHA 4ENNA 3ISNC 5HRNA 1ZRDA 4UV9A 3EKUA 3K70C 2LKXA 4CJ5A 2DY4A 3B02A 2MGQA 1WCMJ 3NWSA 3NGYA 1S6LA 2P7VB 4BRMA 4LFUA 3RRGA 2KFDA 2E36A 1WJBA 5KI6A 3E5QA 3H3UA 2VQHA 4M73A 5HLTA 3E9LA 4NB4A 4ASNA 1JLQA 4MQ3A 1VQ9I 2QWPA 1GVJA 2OUMA 2QYOA 1HQEA 2R7SA 3EDPA 3MN9A 5FPDA 3L2QA 2PG4A 3OV8A 2KISA 1NTCA 4KIBA 1F5TA 3S93A 2PAVA 3QEPA 2P5OA 4F3TA 1ETWA 2EV6A 2KIQA 2OA4A 3IHUA 4V2FA 1BI2A 1Z1DA 3IAS2 3TDUC 2HR3A 1JXSA 4CHUA 1QZEA 1TWHJ 3ATVA 3OYKA 3RKYA 5ADXA 1YJWN 3EE9A 1CXUA 3Q0WA 2XF7A 4QSHA 3SZGA 1AU7A 1ZYQA 2VKVA 4DFKA 1BDGA 3PJRA 3I54A 3S2HJ 4CCKA 4NQWB 1OVYA 3LP3A 4LSLA 1SVLA 1JKPC 1TVRA 4D0PA 1HX1A 2ZGZA 4WCEL 2M5WA 4CHYA 3ABLH 3KLNA 3Q7BA 4FL9A 4G7HF 4U67L 1WNSA 4UHTA 5C10A 1MDMA 3LL7A 1TV6A 3L00A 2IEKA 2VE8A 3VOEA 4OKEA 5TKWA 3T3FA 1NGIA 3EO3A 2BW3A 4DJAA 4FK4A 3V9XA 1M1EB 1SD4A 2MC3A 2MYSA 2XAQA 1RR7A 3Q3SA 3RTRA 4BREA 3LSKA 1OR7C 4LG0A 3WHCA 5CVIA 3C94A 3KPHA 1VNDA 2ZFWA 3THWA 1LWFA 2DOFA 2LR8A 1QHGA 4HG2A 1SFUA 2XC7A 2A6EF 2WBMA 3IH2A 4PKHA 1U49A 3V4IA 2RREA 2VOOA 3IKMA 2HOAA 4IEJA 3O9RA 5IWAK 3THYB 4JV5K 5FDLA 2YCHA 3VF4A 1V5GA 1HCRA 2N8GA 5GPCA 5KPTA 2V1DA 2E4LA 4DS5A 1WI9A 1YFHA 1TWFJ 4FM2A 2EIJH 2IAIA 1IDZA 1XC3A 3AVIA 3RVCA 3KEQA 3HM5A 3FMSA 1G3WA 3L09A 4G9YA 2V51B 2Y0MA 4FSVA 4OVLA 1BC8C 1NBWA 3AVMA 2CQNA 4Y0WA 4JLHA 2VQGA 1RTDA 3FF5A 5K7ZA 3L1PA 4HDVA 1QZ6A 3CERA 1OJLA 3AVNA 3QBXA 1SZ2A 1D5AA 4GY2B 2G8IA 3VSKA 2QQ8A 4IX7A 5C24A 3UB5A 1B92A 1LV5A 2YHBA 1TYQA 4AHVA 3TO9A 4BRDA 5AJ3K 1L3VA 3WU1B 3A5LC 2V4JC 3OJSA 1SD7A 4M9XA 2ZMEC 4CHPA 5HLIA 4XLCA 1YIOA 3FXLA 3KZYA 4XLFA 1DTTA 1EF4A 2KIFA 1EWRA 4I6MB 2QA4I 5FD5A 5IOZA 1V55H 2O61A 2K9SA 5ILSA 5JI6A 3DF8A 3C7NA 2OPQA 2E20A 4A2AA 2I8DA 3VGKA 5J1YA 2XGXA 3L2CA 3DMJA 4QS7A 1J54A 1R9TJ 1GLLO 1XN7A 3VQAA 2DPDA 2MLKA 1O7LA 4XKBA 2OTJN 5AR0A 4RB2C 2GUPA 1XHZA 3KX2A 5D3GA 4XN0A 4DU3A 5ICGA 2IDOA 4A3MJ 2JWTA 2W1OA 4L9TA 4Z4GA 1ITYA 3KYLA 2KPMA 5FO5A 5J4VA 3DLLL 3JAMK 2PFUA 4EM1A 3CCUI 3CPEA 3BR2A 4ZDPA 1RDAA 4K42A 1U3EM 1HDPA 2P7CB 3FZMA 4M3ZA 2WC2A 1A31A 3K1MA 3EYZA 3TARA 1VQKI 1W7PD 4BRCA 1A5WA 2Y9YA 3HTUA 1S22A 1HSTA 1VZ0A 4XRFA 3SZTA 4KIGA 5J47A 4BXXJ 4H0VB 4FK0A 4U7BA 4E7HA 3GOIA 3HKZA 2O8CA 1GOBA 1R4MB 2ZMEA 2FXAA 1POGA 2DA7A 1RBTA 2H3GX 4KN4X 4HNTA 3QOEA 4CZKA 1I39A 5DV5A 4HUGA 2IC3A 2DMPA 5EZHA 3PIPF 1BGXT 1S9EA 3ECOA 2LYCA 2BEOA 2CS3A 4PFPA 5E18F 1STZA 4UQGA 4AQYK 5DYMA 1XSXA 2D2WA 2M1BA 4BVOA 3HRUA 4LJZF 2QM3A 2DO7A 3AG3H 3PO2J 2ZWHA 4JK7A 4LF9K 4IRIA 4D9JA 2K27A 3AAFA 3THVA 5HRSA 4D7MA 3W6VA 4PGGA 2V79A 3QMLA 1WWXA 1U47A 3EZ5A 1ZKGA 3MKWB 1JKQC 4ID5A 3SQ0A 4GNIA 2DMUA 5ILVA 2BUPA 3SZ2A 3F8BA 5LGUA 3GBTA 3IDHA 3OBYA 2HHTA 5F0CA 3DLKA 4MFBA 3SCXA 1QS4A 3HG9A 1QGPA 4FWQA 2Q31A 3QO9A 2F2EA 2DI3A 4H0OA 4OGCA 1VRUA 4BVPA 1ZRFA 3CCSN 5HDNA 5E3MA 5HNHA 3QOPA 4CHZA 4E6KG 3K5MA 3UKUB 1G59A 1U45A 4HCCA 3C6AA 2XSJC 4NC8A 4MEYF 1VQLI 2GWKA 4FK2A 3N4MA 1YO5C 5E1WA 3PY8A 2KRHA 4XSXF 1TKXA 4KHPK 3KFWX 4FWPA 4HA8A 3VESA 2XGDA 5BOXA 4XLNF 4A3LJ 4LIVA 3HOVJ 1ATSA 1VAZA 5AQKA 1IV6A 4QOZB 1XGSA 5AQWA 1KZHA 1BA5A 3BQYA 2FF6A 2YR2A 1ODDA 1W4MA 4KO0A 1BL3A 4KB1A 1VF9A 3H9GA 3NWTA 4UV8A 3W2VA 5C0YA 3TSQA 4FLUA 1B4AA 2GIVA 2ID6A 4EEFG 1OKRA 4BRNA 2EILH 4CJKA 4H5WA 3LFKA 4DZJA 3LDLA 4EMSA 1OCOH 4GKJK 1MIJA 3THWB 1LKXA 3BG5A 3MKZA 4CZIA 1G4DA 5E79C 1K78B 2Q97A 5B1AH 5HBMA 4M74A 2YHXA 3LSGA 4Y1DA 1P4AA 3ZX2A 3LZIA 5LL6Z 1WSIA 4JK8A 4F3QA 5ILUA 2Z1JA 2VWJA 4X65K 1VFCA 2AP1A 3IH3A 2GWRA 4AUXA 1U48A 4DIQA 2FSKA 1ENHA 2DAOA 2L4AA 1APLC 4B1UB 3CJTB 3V8JA 4EJOA 2UXCK 3N4PA 1J9AA 4BRQA 3JTGA 1WZ2A 5TKYA 1CLQA 3IC7A 1WJFA 1KVAA 4UY8O 2AA4A 5L3DA 1RT7A 2ECCA 5JICA 5BQTA 1EA3A 3DBLB 2GTDA 3GTQJ 2V1XA 4PSWA 3L7WA 3TSPA 2D5RA 1TQMA 2X1DA 3K69A 2R0QC 1FTTA 2NVXJ 3MZ8A 1DPRA 4PSXA 1LFPA 3MAQA 3ZX3A 2K3PA 3C18A 4WWCA 2QA4N 4PKIA 4EGZA 1DTQA 1TAUA 3GFLA 4M3RA 2L7FP 3SXYA 3U2RA 5E17F 3KZBA 1ZK8A 4ELVA 4J01A 4IOCF 2DDAA 2IPQX 3TAGA 3I3LA 2X6OA 3VQBA 3AGRA 2Z16A 3E1YA 2L5QA 4CGZA 1JLCA 2YHYA 4DR5K 4JI8K 2QEXI 2P0WA 2D0PA 2HBLA 5BR9A 2P6TA 2O3FA 3RYRA 3J7YP 5DM6F 3F22A 4E70A 3CQYA 5GP9A 3NCIA 4BE2A 2DA1A 4HHTA 3CLOA 1ASVA 3DWLE 3ZETA 5EYRA 3NF7A 2L0KA 2BY2A 5GTHC 1WSFA 3KP2A 3CMAI 3SYZA 3OS2A 3DWLA 4EV0A 3BR6A 1KLMA 2WAEA 2DN0A 1H9TA 1FBSA 3D5RC 5MLCQ 3H9JA 3LSIA 4ZTFA 5BMZA 4BY7J 4DBRA 1XNRK 3JAMZ 2TDXA 2UWMA 2L7MP 3DLGA 5C4XJ 1N8RO 2VLAA 1KGSA 2FJ1A 5L3GA 4LH5A 1JT6A 1FX7A 1UG2A 1MNDA 3IKTA 1TL1A 2E35A 2YV0X 1SL1A 2HHUA 5KQ8A 2JUCA 2LF8A 3M1EA 3A0HC 2UXXA 1IJWC 4IFYA 4YELA 4NCAA 4FWLA 4N9HA 4PK4A 5FKMA 3RDIA 2FBIA 3SJMA 1D8JA 2A6HF 3AG2H 4L9JA 2NVTJ 3T1BA 2L3DA 3HSCA 5I42A 4JYAK 1FKOA 4XLHA 1IG8A 2OBPA 3A02A 2M4KA 3WU0A 1AA7A 3OR1C 5LEJA 4BC2A 4BQZA 4BDPA 1R1UA 2ZXIA 3EUKL 4BBRJ 4BS9A 2IS2A 5AIQA 1KFDA 2JUGA 5CVVA 4CJLA 4G9ZA 2E1ZA 3A0IX 3QIPA 4FYDA 1SL0A 2TRTA 4MDBA 4AIHA 1W7AA 1Q9YA 3WTZA 5HLGA 4A3DJ 2UUCK 1EQYA 2Z1HA 3G1OA 3OYEA 1XUPO 3FM3A 2MD0A 4IL6C 3HRTA 5EU7A 4HAMA 4I0BA 3P4IA 1QTMA 2LSOA 3IRXA 4BR5A 1U5TB 3FHZA 3C6HA 4WFNL 3OS1A 1BR2A 4EJTA 3ZX0A 2NRTA 3I5UA 1MBJA 2ZB9A 2GXGA 2L7KA 3MN2A 5DD8A 3MZHA 4BACA 1DP7P 3IMXA 4YOWA 4B9VA 4PQUA 4KA4A 3GMEA 2G8UA 3NVMA 1ZBIA 1RTIA 3PO3J 4E7LA 2FMLA 2P5KA 3DTIA 4G94A 2WBNA 3MEDA 1YS7A 3V9UA 4AM3A 1R22A 3CUQC 3T0YA 3HIFA 2E2QA 4RG8A 3OR2C 1VQMN 5BRFA 2Q0RA 1LFBA 3J7ZO 1YRNB 2P5LC 4DW6A 2QUFA 4S0HB 3KHYA 1UELB 3WQUA 2F5FA 4RAFA 1IG7A 3HP9A 3M5RA 3TAQA 3QPTA 3O8GA 2RPIA 3AY9A 3BF1A 5IP7J 3MXJA 2UUBK 2KP6A 2ME6A 1N78A 1MNEA 2STTA 3P1GA 5BRDA 3RMAA 3T1AA 1TKTA 5DM6L 2J5PA 2OAZA 3NVKA 5ED4A 2RAEA 4CE9A 3V7SA 4DSJA 4IXAA 1BUPA 4CEQA 3A8YA 2DMQA 1BR1A 3MN6A 4FJ8A 3I56N 3G2BA 1QO0D 4HX4A 1SFXA 1ASWA 2KTQA 2M2EA 3CJCA 3H08A 4HNVA 3CETA 1ON2A 2YSRA 1ZGJA 3H1CA 5LGNA 1IUFA 1SQKA 3LALA 4N9IA 4CCJA 4IQ4A 3OYLA 1D8KA 1ZREA 5C44J 4KICA 1YHQN 3RR8A 3KLHA 5T7BA 4XRSA 2ZNZA 4M72A 2LOOA 3HHGA 3D6RA 1E3HA 1WVRA 3QPHA 2Q8KA 2R7YA 5DUKA 2MH2A 1NGDA 2P9UA 3JSPA 4KUMA 4QWQA 3SEQA 2B7EA 1B1BA 4HV5A 3V1QA 3CJ7A 2ZXWH 3AAPA 5AQIA 2YJEA 4IPAA 1XMKA 5L3CA 1KAYA 1IV8A 2GEMA 3ERED 2KKZA 4G6TB 3X2QH 5FD6A 3QFUA 4C2TA 1S3XA 4F2RA 1TKDA 3KP5A 2PEXA 4L9NA 2HOTA 1CGPA 3G73A 2CQQA 1RUOA 1ZH5A 3TMOA 1VHXA 1TK8A 3CM5A 1Z3YA 4JOMA 1HNIA 4CZLA 3CCRN 3HJFA 4RW6A 2E1OA 2LK2A 3RZDJ 3ZT2A 5CVJA 1FMWA 3O4QA 5AQUA 2GLOA 2HKOA 3GZNB 1RBUA 1N77A 3BG7A 5EZGA 2OPSA 2ZC2A 4FE7A 3H6EA 4GV3A 3HSTB 3QIOA 4P96A 1QNTA 1YAGA 3CJRB 1UA0A 3PO5A 3F72A 1S1UA 3M6GA 2HNZA 2PMHA 1KQ0A 4B9SA 4CUGA 4CIEA 2OU2A 1T38A 1MBKA 2M45A 2D1KA 2M3AA 4K0KK 4FZZA 4NB5A 2EIMH 3NH2A 1YIJN 2D0OA 1U4BA 2XY5A 2XF6A 4M6YA 1KCFA 4Q5VA 4G8XA 2HBJA 1B9NA 3E6CC 2R7XA 5AQVA 1VQ9N 4JRQA 3OOPA 2O03A 3PSFA 1L0OC 2BBYA 1BR4A 1C0MA 2OZ6A 1FPQA 1FK9A 1RTHA 2D4WA 5CVUA 2CQ7A 2DCEA 5AQXA 2B0LA 2M9HA 1W7PB 1OQYA 2ELKA 5CYVA 2ISZA 5F08A 1D3YA 2CW0F 1TWAJ 1HYVA 3CJ1A 1Z7LA 3QPSA 1S9HA 5CJ9A 4GRIA 4MTDA 1JLEA 3ZEUB 3IRQA 2P51A 3LWLA 2HHSA 3IV5A 3R1XA 4A6EA 2OQRA 1X1BA 5HOOA 2X78A 1W2BM 1IV0A 1QRYA 5CQGA 1GLFO 3DXKB 2KHOA 5AZJB 3CDLA 4KV8A 4R79A 2XRIA 3SAFA 3B6PA 1IXCA 3ABMH 3HYIA 2OZMA 3KWIA 3CCMN 4IHTA 3DTKA 1I6HJ 1TZLA 3FR0A 4X64K 2QCOA 4KHQA 2YX6A 1W1WE 4Y3OA 1JKHA 4A3IJ 4G1QA 3M7GA 5M3MJ 1H9GA 1VSEA 1TW3A 2A1RA 5E3LA 4XH5A 4DYRA 2HS5A 2MA3A 4GVMA 3O3KA 2ZM6K 4C30A 5IT3A 3I33A 3S3NA 3SMPA 4PHTX 3BY6A 2RKIA 1HA8A 2P9NB 4DV1K 3R6MA 1MBFA 3DEWA 3QYFA 1H0MA 2PJRA 2FOWA 4JI4K 1TUYA 1DGWY 4M71A 1L3UA 3WTYC 2RN7A 1GXQA 5J2MA 1BA0A 3WU2C 4ESJA 4E4HA 1WAJA 3HKZN 1ZBLA 5CZ1A 1DUXC 5M5XJ 1W5CC 5ICEA 4AHCA 2DA3A 5DS9A 3LP1A 1S72N 2K86A 2KFNA 3K58A 1JKRC 2YHWA 1X4OA 2VASA 1FYMA 2H8RA 5DCMB 4QS8A 2P9IA 2V9VA 3JREA 4A62A 4RCHA 1VQ6N 1X3ZB 4X66K 3Q9SA 2O8EB 2ASOA 3P5JA 1JL1A 3BG3A 4FW1A 3O9TA 5F27A 1LB2A 3K7AJ 1Y6IA 1I3AA 2HYJA 3TAEA 1GV2A 1FSEA 3TAFA 3SI6A 1RBVA 3VDXA 4OPAA 3FZKA 1S6PA 1VQOI 1K4SA 4EM0B 4KFCA 3MMVA 3UR3C 1UJ8A 4J2BA 2K85A 4JKEA 1BA1A 2NVUB 5KRTA 4XSZF 3FM5A 4OWRB 1S5LC 2XO7A 3BDPA 4A2BA 4DU4A 4NYNA 1MMNA 1V4RA 1JLGA 1REPC 2V1NA 3ZMTA 3BG9A 2A6TA 2CUEA 3G4SN 1SVOA 5KRSA 1QHTA 1H88C 2O4IA 1JCGA 1WH7A 2Z5UA 4ANJA 4KDPA 3OVNA 4PGHA 5HS9A 5EDNA 3VB2A 2D0BA 4BC4A 2AJQA 1W5SA 3DPLC 1J7KA 4OJRA 3O6BB 4UVAA 1LCUA 2RHKA 4QTRA 2YPRA 1PP8F 1FOKA 1E4FT 1R36A 2W00A 1FLIA 4M63C 5J6XA 4EJVA 1X58A 3PQJA 5EEHA 5IPAA 4BRPA 1NKCA 1HLVA 4B9NA 2ELJA 3E6DA 3KETA 1J53A 4CEEA 3KJVA 3PIOF 1G3SA 2CV2A 1WSGA 4UXNA 3QESA 4KREA 3L8BA 2XGCA 4CZFA 4M3YA 3LPUA 1QPMA 5J3LA 3K4NA 1X1CA 3COAC 2A07F 3AL0B 4M3GA 2ZQBA 3DRPA 1BBYA 1K4TA 3HBTA 1TT0A 2QQAA 1X9MA 1WKMA 4KHNA 2QWOA 4OLBA 4IWVA 3DV8A 4N56A 3ITHA 1HYZA 1SUQA 1GLJO 4CZGA 3CC2N 4CJTA 3E5XA 2HFHA 1K7AA 1FC3A 5KK1A 1JKOC 4HVJA 3Q9VA 3DXMB 5A2QO 3D2FB 3TDZC 3HSFA 1I6XA 1YX3A 1WSJA 4CJPA 4C8KA 3K4BA 4KH6A 3TKYA 3B73A 3QRFF 2HZTA 4CICA 1JLAA 5JMVA 3SQ1A 4OMZA 4M3TA 4M9ZA 1P90A 4KFBA 4PZJA 4LLGF 4P55A 1YJNI 4U0YA 4YHHK 2PBIA 3GTKJ 3QERA 4FJNA 2NLXA 5HP1A 1LVAA 3O3GA 2VBWA 3ABUA 2FF3B 4BKXA 1IUYA 2O8CB 2UXBK 5IT9Z 3AA5X 3BGRA 3N4QA 4M3FA 2GAUA 4YFNF 3VGLA 5AZJA 3H5NA 2V52B 4A12A 3DKYA 2WB1N 2FUG2 2HWVA 3CC4I 4BGAA 4EZ9A 3OW2M 2NOGA 4UY8I 3IFRA 1N25A 1XG1A 2OF7A 4KTQA 1T39A 4RMNA 3JYTA 4JX5A 3QICA 4LB5A 3D0SA 1A5VA 3RMCA 3G1MA 1BI4A 5FROA 1SVMA 2RDPA 2HU9A 2GWJA 1ZN2A 3AARA 3BJ6A 3C0BA 1Q86O 1E3MA 4YIFA 3SLCA 4BE0A 5HS7A 3EETA 3TL4X 3ZP5A 3WXJA 4CJRA 3SUOA 1EV7A 4HTLA 3LDQA 2EWNA 4FX0A 1QSYA 3NQOA 2BXYA 4ISEA 2QWLA 4NXMK 2F9WA 4LY7A 2BANA 2MLGA 3BR3A 4BQLA 1V5EA 3FXQA 4EATA 2DOAA 5D8LB 4HYEA 3HI0A 5JLHA 4KHWA 2EX3A 5DM7L 4IHYA 4M3UA 5LD2C 2G8WA 4AHSA 5GPAA 1JXBA 3HGGA 1BL0A 1G3YA 1WJCA 2CO5A 3R4KA 2V6EA 3HYFA 5GAHP 4XKVA 3WTTC 1RBSA 4E3SA 2PFBA 3V6DA 4CCLA 4RB3C 1JCFA 1NJYA 2YNFA 4FTHA 4CHNA 4W5RA 2VE9A 2PMZA 3K2ZA 2CYYA 2AS5F 1U78A 4ISFA 1HF0A 4BC5A 4Z4HA 4LFCK 1AHDP 4CF2A 3RQ4A 2IT0A 4HSTA 3F0CA 4CO8A 2LY2A 2OTLI 1NOYA 5FLMJ 2HQAA 3IRRA 1J6ZA 5M1PA 2QWWA 3UKRB 4BR2A 2NXNB 1NK6A 3GTLJ 1D5YA 1HJRA 1W97L 4O4GA 3E5UA 4NCBA 2FC0A 4KPYA 3QINA 4Y4RA 2JN6A 2WFBA 5B8HA 4NUBA 4HUFA 4CCHA 1IN5A 4KTWA 2KL4A 2VBYA 2D5VA 5E8IA 4I2PA 1DT9A 3KWGA 1WJ5A 1ZQ3P 1NK2P 4E7ZA 2JGUA 5M5YJ 1XTAA 1YW8A 2K02A 5KCMA 4B43A 3CCVI 3K0SA 1Q81O 1WBDA 1WRJA 3PL8A 1E17A 1JUSA 4XK4A 5GADJ 2Y1JA 3VYRB 3GXOA 2IGNA 3LM2A 3MX5A 3P38A 3RMDA 4LD0A 3MKLA 3H1VX 1XS9A 1XMAA 2BY1A 5FLXO 2ZSIB 4IZZA 1USTA 2WOMA 4CHOA 4I9LA 1ORKA 1TP4A 2EZHA 4FE4A 1RETA 3QNOA 5AQLA 3FZVA 4KHSA 4CJ7A 3CCQN 3QU6A 3DRSA 5J2PA 1VSHA 1IRGA 1T44A 3U9ZA 2WV0A 1WFXA 4L5IA 4BHPA 5JVGL 2P8TA 3V81A 1R4NB 1JCEA 1FT9A 2EFPA 1H89C 2CU7A 3HPGA 2RKHA 4JS5A 4GXOA 3U1KA 1UFMA 4I02A 3HOYJ 1A5JA 4B09A 3OYGA 3J7AO 4Q47A 1Q1VA 1LDDA 1NWKA 4NQWA 3SYTA 3QBWA 5DMRA 3H1QA 3J81O 1VQON 3T1HK 3BWGA 2MW8A 2NNNA 4BYYA 1QQOA 3J80K 5FLXZ 4IO9L 4YOXA 5KHDA 2JT1A 3OIPA 2QWMA 1HUXA 4JKCA 3DPUA 2ZJPL 3CC4N 3SV4A 4CZCA 3IUCA 3CO6C 1Z21A 3D45A 2E2NA 4W5TA 2EPFA 2CG4A 3LWFA 1BC7C 4MLEA 4DFJA 3BTJA 1V3FA 3HTVA 3VQ8A 1PP7U 2L7ZA 3ENOA 3LA2A 5L3BA 1UMQA 2E6MA 3TR8A 2QWQA 4ILHA 4RGXA 2W57A 5J2QA 3LQRA 4Z0UA 2GA2A 4A0ZA 1HW2A 4AWXB 2O4GA 2VJIA 3A01A 4P1WA 3RRHA 2W4SA 4NLBA 5FB2A 4FWMA 5E20A 3CPWM 3GW2A 4B3AA 4B48A 4YIRX 3HTSB 2DTRA 1GUUA 3BR0A 4CGFA 3JSMA 3HVRA 2BGCA 3O1WA 4C3HJ 4H5TA 2MFZA 4J2AA 1RT6A 5BPNA 2R7ZJ 2OZSA 2VC1A 4B9LA 4ZH4F 4H0PA 1N34K 2STWA 3I56I 4B3TK 4HNUA 4XRSG 3KTQA 1XX5A 3AGKA 1U9OA 2V6CA 1O3QA 1QA6A 1EX4A 2L9NA 4K8ZA 2EHGA 4ZYAA 4BQAA 1ETXA 1BM9A 1D4XA 2ELHA 3SPZA 1HNVA 2E6LA 2X4HA 1FXXA 4BGDA 2VPLA 3CP2A 1VSIA 2E1YA 2W6LA 1NKBA 2Z1IA 1LWCA 4C9YA 3K2AA 2CGKA 3RSEA 3GTMJ 2G8FA 2E34A 4DNCA 2A3ZA 2K9LA 4R1HA 4LF6K 1FIAA 1FMVA 2HNDA 4LF5K 4O44A 4RB0A 4CZZA 2NRHA 4ELTA 2VG5A 1YG2A 2ZKZA 3GUDA 2A5WA 4X6AJ 2YKMA 2DPUA 4M3WA 2COBA 3L9FA 4AHUA 4W5NA 3VYTB 2L2OA 4BQQA 4BHBA 2HMPA 3QFPA 3V9WA 3LSJA 4CCOA 1K61A 4FLVA 3IG1A 4O0IA 2E1NA 2KZMA 4QPQA 3JRCA 1OVQA 3ZSWA 1MBEA 2C6YA 3SQ2A 1TK0A 4GV9A 4ENMA 2HHVA 1D0YA 2NS7A 3SDBA 4Y1CA 1SFEA 4IKFA 1BISA 1CZBA 3HGYA 2Q2EA 3FXMA 5M5WJ 4IHVA 1HPZA 3JRHA 5C2DA 3CMMA 3FISA 3ENBA 1YRNA 2EB7A 2VT3A 2VXZA 1V54H 2DYRH 2UXNA 5DCFA 2WV1A 4CSWA 3H0GJ 2O6GE 3KK7A 2IA1A 1NK5A 2W85A 1RT2A 4UB8C 5K14A 1DGKN 4A5BA 4ZYDA 3C6TA 3PX4A 3MEXA 3FDYA 3WEEB 1OLTA 4C8OA 3DBHB 3DCFA 4DMNA 1NNEA 3R0JA 3UKRA 4WYBA 4C8LA 4A2UA 5CE3A 2XGEA 2AQFA 2NRVA 1BW6A 3WXKA 2E8AA 1BG3A 2QWNA 3NH1A 3THXA 1KD1O 4D1QA 4PWDA 1ZR4A 3C6UA 4DTXA 4EHTA 2NRAC 1I1GA 1XHXA 3BC8A 3AVGA 1LUJB 3S3MA 3EKSA 3G71N 3FKJA 1VQPI 3CD6N 4DR4K 3GG4A 4HQMA 4IQJA 1J5EK 4F91B 1YS6A 4IEIA 2NYXA 4NC6A 2HHXA 1SEUA 2G7UA 5E1XA 2KRFA 1EWQA 3LWMA 3FK7A 1KYWA 3QPLA 2MC4A 3OS0A 4LK0F 1TGOA 1LOTB 2NZTA 3ZSQA 4BQOA 3T7ZA 5HL7L 3IP4B 4AHTA 2P9SB 1ASUA 4MFEA 4CZJA 2UXDK 3O2PE 2YHAA 4YY3K 4KHUA 1A6QA 1ZTRA 3FZHA 2WTUA 4HF1A 4NCGA 3I0TA 1KSPA 1GLBG 2E5ZA 3VQCA 5LMNK 5KGXA 5J2NA 1KXPA 3OY9A 2JZYA 1T03A 4OU0A 1R1VA 2A3SA 2WAQA 4AVPA 4K43A 3ZMDA 1R5ID 3ZR8X 3HOXJ 1Q8IA 1BI4B 2PI0A 2OPPA 5KPZA 4E89A 3KK3A 1U8BA 4BR4A 4RGRA 3HM9A 3OYJA 4GCVA 4HZFA 2GX9A 1UHMA 3WQTA 5DM7F 2XROA 3MN5A 3H3VK 4FASD 4DSFA 2VGMA 4DR1K 2O8KA 2AXLA 2HGCA 1R6RA 1G6NA 2P9PA 3D7EO 3LSTA 1IW7F 3QQAA 2Z1GA 5FKLA 4CIGA 4Q48A 3F3XA 3OWTA 1FOWA 4XKCA 3GTOJ 3BF3A 4O55A 3LFUA 4BAYA 3W0LA 1DPUA 5BN8A 2J4RA 2HPIA 1U2WA 2DXIA 4ZJZA 2O8DB 4N4NB 3OSFA 3VPZA 2VCPA 1Z6TA 3AVFA 1XPXA 4WF9L 3BPVA 5GIOA 1ONVA 4BJ5C 4Z4CA 4CJWA 1KFSA 2E1MC 2CQXA 4WF2A 3ZQIA 2BYVE 2ACJA 3NHGA 3SAHA 2G8VA 1QVUA 2JA2A 3THYA 1IBLK 2XIGA 4DS4A 5M1QA 3WEEA 4MGRA 3TO7A 4YORA 4YNQA 3LSPA 1PUFB 1C6VA 2LRDA 4XLPF 1D0ZA 1BQMA 1YW7A 3BG6A 4DKWA 5K7FA 5ERIA 3A01B 1NK8A 2Q1ZB 4B4CA 1KAXA 2UYTA 3VEOA 4FM0A 2Q36A 1D9FA 1JJ6C 2IAJA 2O8FA 1SAUA 3GE1A 2ITMA 1LDKB 4YFXF 2K7LA 1FY7A 2KDZA 1PYVA 4UUVA 3TOBA 3N05A 4E1JA 1DGRM 3NGIA 1RUNA 1O13A 1T7PA 4C3IJ 3LAKA 1ETOA 4DR3K 5HRRA 2GBZA 5KAIC 4IHWA 1JHFA 4BL0B 3AA2A 5AQHA 2HVQA 1IBMK 2DFIA 3ZOBA 2RV8A 1ATRA 3DLHA 2ASPA 1HDDC 3BEXA 1VQMI 3DP7A 3PO4A 4B8CA 3JRDA 4GGGA 2M8GX 3P9IA 4H4KC 4ITVA 5E8GA 3DOLA 2MBFA 4XIDA 5F0XA 3C7NB 2BY0A 3S9HA 3K1NA 3CP8A 4GO1A 1B8IB 1VQ8I 2JTVA 3O4WA 4DHYA 4DTNA 1OR7A 4YG2F 3AV9A 2GOMA 2P9KA 3SUPA 4ELUA 2JVGA 5KGWA 1UAAA 2HTSA 4F92B 2X9DA 3K9TA 4DGWB 3SHFA 1TW2A 1EETA 1ZC6A 3FBIB 2NRZA 4KH5A 4S05A 4JNEA 1ETVA 3V4GA 3HP6A 1S3JA 4Q0BA 3LAPA 4BEHB 2OANA 2L02A 3JAMO 2A5YB 3J81Z 3TP0A 3WGGA 4BR7A 5JLWA 4H5RA 5C42A 4Q4ZF 2DFHA 3IL2A 3CIPA 3UKUA 4NO7A 5EOYA 3NH0A 5D4SA 4B9TA 3LMMA 3PFIA 3WT0A 3HK2A 2VUMJ 3VQDA 3ZETB 2OA8A 3ZGKA 3MFKA 4GYIA 4IVNA 2O8DA 4UNOA 1J9IA 2QWRA 4YIIA 4DV6K 1HKQA 1H1VA 1TAQA 2A41A 3BPXA 4KBOA 3E6MA 4B3MK 2LP0A 3CC2I 4GW6A 2HDDA 1OPCA 2NOJB 2VJ4A 3K4LA 1RDBA 1X9JA 2FSWA 3VN5A 4CF1A 2X6XA 4BG9A 4BC3A 2YNHA 4DSIA 4IRGA 1FEXA 4IG0A 1C0GA 1JJ8C 3SQNA 4XH1A 3QYBA 1IC8A 3U21A 2WB1A 2ZE2A 3AVKA 4B1WB 2NRRA 3HM8A 2CH6A 4QCLA 1YW9A 4M3DA 5BREA 3WXIA 5FKNA 1HQCA 2F8TA 3FFKB 1N36K 3ATUA 4DLGA 3DLEA 4MLOA 5J40A 4JI5K 4M7XA 1BIAA 2FBYA 1EXQA 4FJXA 2VPRA 2ESNA 4UUSB 3T69A 3TO6A 4XBFA 2L9RA 3G25A 2BGGA 4CEFA 1KU9A 5F1JA 3NFAA 2PX9A 3CMAN 3NEUA 4OO1J 3WNEA 4U87A 5L3EA 4AD9A 4DV3K 1SFOJ 3TU5A 1UB9A 1ZG5A 1QSLA 1QE1A 1J5YA 4IO9F 3U3YA 1SFKA 2HNYA 1YI2I 2O0YA 1Z3XA 3CCYA 4BXUA 2VONA 5AQSA 4CBXA 3GFJA 1BOBA 3NRVA 3I71A 3D2EA 3J7AP 3ABKH 1HXDA 2W6KA 1QQNA 2ZO4A 3A5OC 3L3UA 3T8TA 1SC7A 3ID6A 3BR1A 2D0CA 3O3FA 1NGGA 3BQZA 2XAGA 3U8XA 4IOCL 2BXZA 2MD5A 1F21A 1U2VB 2O8EA 4ETSA 2DTUA 5M1OA 3CUQB 4BR9A 1LAWA 2ETJA 1RPWA 2VG7A 1C0UA 1A04A 3Q0VA 1RRJA 2IS4A 1BCOA 1NKEA 4KB0A 2XAJA 1X19A 2OC6A 3QEWA 5C4JJ 1QQCA 3QEXA 1IXSB 2I5UA 2JRTA 2KLOA 3V42A 4OKKA 2G8HA 2KMUA 1GLEG 2LVSA 4KRFA 1F4KA 3M1FA 4NBQA 2FE3A 3MCZA 4CEZA 2QENA 3QP5A 3ZQ7A 1KAZA 1GT0C 5I3UA 4M6XA 5LMUK 1BJAA 2EIKH 3LM9A 2ADUA 2GOXB 3BJOA 1YE9A 5EGOB 2DK5A 5TRDA 1JL2A 4B1RA 2OPRA 1XCBA 3BTIA 1K6OA 3BUZB 4CGDA 4OINF 5FKOA 5GAGP 5C3EJ 2X85A 3OBWA 5CKTA 4DCHA 1YTUA 3HXLA 4A0XA 3P9CA 2LBFB 4CCNA 4OGEA 4EM2A 2DOEA 1GLCG 4KJZA 3SK3A 2DTZA 3F8MA 4JI0K 3VYSB 1ZELA 4RM3A 3SDGA 5EF6A 5E3NA 4GKKK 2BOLA 4XOPA 2EWSA 4YOUA 5F0HA 1VQKN 2K4BA 2QBYA 2EFQA 1O57A 4KITB 3VEXA 1WJEA 3MQ0A 4CZHA 2E2JJ 1EJ9A 1SL2A 2A69F 3L2UA 2Y75A 1SAXA 1FJGK 3PFYA 2NS8A 1XQSC 3VQ6A 1XSVA 5AQQA 4BBSJ 3S1RJ 3VENA 1ZBFA 3DU6A 4ZYEA 5J8CA 2A40A 4KISA 5C25A 1UHSA 2WADA 3OIOA 3ZQFA 5ICCA 1ZLKA 1MH3A 3RIRA 3Q0UA 1Z6RA 4CZMA 4A57A 2YI1A 3TSUA 3LDPA 1G99A 1NU0A 3ZSVA 1JI8A 3EEQA 2IP2A 3ZYYX 4WCGA 4B8XA 1ACIA 3VTHA 1BIUA 2QTDA 3FXOA 2E88A 2NNWA 3OTOK 1VQ7N 4DYQA 3EYYA 3HSRA 3M1CA 4NLCA 4H5NA 3EY1A 4XLEA 2CMPA 1KVCA 1NJXA 4B3OA 3M9AA 1U2VA 1PVEA 3J7ZI 2Q0UA 3QEVA 2RGVA 1B59A 3W6KB 3IWFA 4CIFA 4K8XA 3I4PA 2BY3A 4B1ZA 2WC9A 4XORA 3AAQA 3LZJA 2XHKA 3TP3A 2G7HA 3TI0A 4LK1F 1QVGM 1UA1A 1E0EA 3AVBA 3JRAA 1UWBA 3L0QA 3R0AA 4J8FA 4NYFA 4KAZA 4BUPA 4IXCA 3S15J 1YJNN 2V1UA 2E71A 4MTEA 2IBDA 2NNYA 3CCRI 1NOZA 4FWKA 1ETYA 2ZJRL 1GLDG 2G9WA 4MEXF 5AZIA 4HW0A 4FHTA 5LY3A 4TV7A 3C95A 4P9UA 2HQ5A 2HHWA 2EZIA 2Y2ZA 2LKPA 3F8CA 2IXSA 3VETA 3CQ8A 4LMYA 3RPQA 3KK2A 4OIRF 1P7JA 1X3WB 4F93B 4A93J 1B9FA 3W6JB 3T1YK 5E26A 4I99C 3VGMA 3ULQB 4ID1A 2GXAA 5M1FA 5F64A 4A3JJ 1A36A 3NF9A 4CFCA 2RNJA 3RQIA 3EN9A 2CWEA 3CUQA 2DDBA 2R5ZA 1UHWA 2R93J 2MSYA 3GF2A 2HSTA 4DSEA 2RVCA 2FF4A 3G3ZA 4JRPA 2IVPA 2XHBA 2YUSA 3FMQA 3Q5FA 4DTUA 1F36A 3DLBA 1EH8A 3HHHA 2CW7A 1YTYA 1U5TA 1KU7A 1IF1A 4DR7K 1JTYA 4ABZA 4HQEA 3OSGA 1JE8A 5HODA 2V7FA 2VWBA 2VQFK 2JSPA 3T19A 3FXKA 1BCMA 4A5NA 2JQ7A 3KP3A 3HRSA 4HSRA 1KTQA 2FSJA 2HBKA 1FZPB 4RW7A 2OTJI 4B8AB 2ZJPF 1KONA 4CGGA 2DMNA 4YOVA 1NK9A 2GUIA 4NXNK 1DLOA 4PL7A 4BWJA 1ULYA 4L5EA 1NGHA 1QZZA 4FJHA 5FFZA 3DJCA 3GO5A 4CYDA 2F8SA 3DM2A 5CVRA 3AG1H 3GDQA 3CF2A 2Y9ZA 5AFUH 1QQIA 4EGYA 1YI2N 2UU9K 4HLYA 3OYAA 2PLYA 1MW7A 1J09A 1YVUA 4CBWA 1XMQK 2IW5A 3HOZJ 2H09A 4WK8F 4DG1A 3EPZA 1RILA 3TAMA 3AL0C 1MGTA 3GLXA 1DEJA 1TNTA 5JLXA 1JGSA 1KQ8A 3HPHA 1W9HA 2A42A 1IN6A 1IKVA 2F96A 4Z6YA 5D8KB 3VTIA 5J1RA 1QHAA 2LBFA 3HUGA 4HF2A 3I59A 2K9NA 5FRMA 1X3MA 1Z91A 2P9LA 3QEIA 4X62K 1KA8A 4EQQA 3O80A 5ELZA 1O3SA 2XY6A 1P2FA 2A61A 3KYDB 1MKMA 4E7KA 3K9JA 1ZLJA 4O0JA 3KYCB 2LDUA 5FKKA 5JR3A 1VI0A 1K6YA 1OCPA 3CMEN 4RAYA 4BU2A 4LLLA 3NDKA 5JVTA 3LSHA 3V1RA 1R7JA 4AYBA 1RR8C 3GEZA 5M1KA 2O8BB 1Y8RB 2F5CA 3O1BA 2Y30A 3ZMSA 3MWTA 3CESA 3KLEA 1S72I 2HEOA 1Z0XA 3ZSZA 1JXEA 1XDSA 2CFOA 2JRMA 3CCQI 4B1VA 2E2IJ 3F8NA 3KZZA 1IGNA 1OKJA 4BG8A 5KQDA 3MXIA 1YJWI 4Y17A 1E2XA 3E01A 2X1CA 4MO7A 2FXUA 1X1AA 4WX9A 2QSGX 2XKPA 5AQPA 2ZD1A 2WAQN 3CLQA 2KIMA 1G8XA 2FOKA 3SFZA 1L3LA 2HPMA 3JXUA 1OYIA 4Y15A 1VSFA 2W42A 3TWHA 3WXMB 1W5TA 1RFQA 3FLCO 2QSHX 1HMVA 3U3GA 4N41A 3AVLA 4RLFA 4HPQA 4XOTA 3S2WA 3HL2A 2D1VA 3S1NJ 1G2HA 1HKBA 1NJZA 1K9MO 4ISGA 3SMSA 4DQQA 1R58A 5DDGA 3ENHA 4CFDA 2CRGA 4BDZA 3LANA 1D1CA 3C7JA 2ZFUA 4YFKF 1OCCH 4CA0A 4AILC 2VJ5A 4G6DA 4RW8A 2VKDA 3MKYB 2LH9A 3OYHA 1P8ZA 4JK9A 4AHRA 4CW7B 4WFAL 3S16J 3KE2A 2H8WA 2R7TA 1W0HA 3BY5A 3CHWA 2V9KA 5K1YA 1SANA 3DI6A 3GL1A 3VERA 2OYQA 2KZVA 2EBIA 4JBAA 4M7YA 2BDPA 3M8EA 4EVIA 1JT0A 1LEBA 1UOCA 2B6AA 3DRRA 3MEGA 5CQEA 1IRXA 3HUGB 2IJLA 1LE8B 4ZDLA 5M3FJ 3ONQA 5IT9K 5IP9J 4QIWN 1U6ZA 4AH9A 1OH7A 2ISYA 3C2BA 1FJLA 4BROA 5FJ8J 3DQVC 3CCEN 5K7HA 4DR2K 1GLNA 2ZF5O 2ESHA 3PIOL 4N76A 1IXRC 4E7SA 2KHMA 3HBLA 1HKSA 2IGOA 1YLFA 2VN2A 2X1EA 5LHIA 1RDCA 1UAXA 1Y64A 3ZT3A 1LNWA 3BLYA 3NARA 4A61A 1SKWA 1MSFC 1BI1A 5IT9O 1N5YA 3B6AA 1TBXA 1Z05A 4XEIA 1B9DA 4AIKA 4W5OA 2DMTA 4B1XB 2Q2RA 3LA7A 4JKGB 4B9UA 3S41A 3ZMUA 2WTEA 4LFAK 3OA9A 2X6NA 1KU2A 3L2RA 3SV3A 4AC0A 4FT8A 4PCQA 4HEA2 4U88A 4E7IA 3K4JA 2HYGD 4IDKA 4H03B 2FNAA 1KLNA 5LBQA 2KFZA 3THXB 4GDFA 1ERDA 3CCJN 2VL8A 3WODF 4C1NK 2VJJA 4AYBN 1IKYA 5BRHA 1XD7A 3ALYA 1T0FA 5LRSA 1M90O 2QW9A 1ZGAA 1IO2A 3WE2A 2R5YA 1ZBUA 3S1QJ 1X3NA 5GAHJ 3F6OA 1FIPA 2QBYB 4WQ4A 2LF7A 2F5DA 5AQOA 1NM1A 3TGNA 3M8FA 3O6WA 3TTFA 1X9SA 2I5JA 2B5JA 3AO1A 4I7HA 4IRHA 2IA0A 5AONA 1NHAA 2HQNA 3ZMZA 4Y13A 1MSEC 3M4OJ 1DU6A 3O08A 4EIAA 3L4QA 4E1MA 2BVLA 2P9SA 4AM6A 2FMYA 1WH5A 3IKVA 3J81K 1B8IA 3I4MJ 1MWKA 4IBNA 5HRPA 2FNPA 1NGEA 2O8BA 2K9MA 3AVJA 3CFPA 5HLHA 2CV1A 3QDKA 5FPEA 4CEAA 3MX2A 4BH9A 4BRAA 1ZAOA 4JYKA 2EZKA 1K8AO 3CC7N 4IO8A 3D2FA 4CJVA 4XM3A 4A3KJ 3HOWJ 4O5BA 1Z25A 2O8FB 1WQ2A 1I5ZA 2Y31A 4DBQA 3J7AY 1LW0A 4IOXA 2ZSHB 2E5NA 1IZ1A 2BVMA 1MMGA 3LDSA 1A35A 4JKAA 2V26A 3CF5L 1SD6A 1WJDA 2O5RA 3K0LA 1SV5A 1NMDA 2FD5A 4AIDA 1MNMC 1MZBA 4JI1K 4CESA 4FJ7A 3CO7C 1NGBA 4H0XB 3CFRA 2Q3SA 2QKKA 1S1XA 3M07A 4RS8A 3VPRA 3NF6A 4BRIA 4ESFA 4MHGA 1VSMA 2JMWA 2WUSA 1X1PA 3AVAA 2DA5A 2VIXA 3CMYA 2L01A 4IOAF 2LSNA 1OCZH 2OQGA 2A05A 3C65A 3ZSRA 1Y8QB 3NF8A 1X9WA 2OCEA 4UVCA 4Y33A 3O9UA 2E19A 1XC9A 4L8RB 2R7WA 1VQNI 5BPMA 1TNSA 2P5VA 4F8RA 2ID3A 4OIQF 2RE2A 4CDGA 4CJQA 3KKRA 1HR0K 3JRFA 5EX5A 3ABTA 2K40A 2Y48A 5D5UB 1ETQA 3LP2A 4IG3A 2X51A 3NAUA 3M8PA 2VG6A 2RNGA 4C8MA 2LG4A 3UKGA 2VB6A 2XPVA 3OYMA 4I6ZA 2W40A 4K41A 2IS3A 1XC5A 5J1UA 1JTXA 4IDHA 5E84A 1I27A 5HLFA 3L4IA 3U9DA 4KIFA 5GIPA 2GXBA 4R5PA 3JRIA 1GXPA 1XSDA 3A2FA 3R6SA 4I98B 1U9NA 1IRFA 1CF7B 4WQ5C 1CZAN 4G7OF 5AIPA 4FLXA 1MMDA 4PJMA 3KCCA 3D1NI 2R5ZB 3LL3A 3OIQA 1M1KO 4BRGA 4DYCA 3Q7CA 1RTJA 4WXDA 1BU6O 3ECHA 4ENJA 2QEXN 2P9KB 2R7VA 2XY8A 5AQJA 5HDKA 1U8RA 4H8KA 3NMUA 4H0EA 2WONA 3OYIA 3KEOA 1ZBHA 4MIMA 4G6QA 4FZXC 1B6AA 2HVSA 2EJRA 3U6FA 3OMYA 2JSCA 2YX4A 4X1EA 3MZYA 5KVRA 1JGGA 2CGPA 2JA8J 1BOTO 4IEEA 4CHQA 4JHDA 5LJVA 2VT2A 2IVNA 3MCAB 5AQTA 1TLHB 3WE3A 1Z26A 4JKDA 2RQPA 4O3MA 2JJ7A 3F23A 2FBKA 3KEYA 1Y56A 1Q18A 1BQNA 1YUWA 3VQ7A 2M0MA 4DUZK 2W84A 3G10A 1SKRA 4PJJA 2X6YA 3KZIC 3TBIA 1HW5A 1XWLA 4O8UA 5EG0A 2QK9A 3S14J 5GAEP 1SKSA 3L2VA 3A4CA 3H46O 3V7RA 2TCTA 3CDIA 1U5TC 4ZZLA 4MO5A 3FBNB 2DJIA 3BROA 3LAMA 1XDUA 3K6GA 3PNVA 4LOCA 4W97A 2ASMA 1SS6A 2LFBA 3DLAA 4OAYA 2IGKA 3ZQQA 1VRTA 3F8FA 3E9OA 1ZHFA 4DTSA 1YJ9I 4KTZA 4ESBA 1EH7A 3W3DA 3ISPA 2OZUA 1ON1A 1LVKA 2OCCH 2KRCA 3CJAA 4FPBA 5CR4A 5I9EB 3CQXA 1T95A 4CH7A 2Z33A 4Q5SF 4JKGA 1BOAA 3HC7A 1Z7UA 5JS1A 1ZYRF 4HF0A 4ZTJA 2Q2EB 3GWZA 3HZ6A 3ZCOA 4OOIA 5J8FA 4H0YB 1ITGA 4LF7K 2LD5A 1G15A 4FZYA 3GBGA 2B9SA 3GLLA 3HOUJ 3CFOA 4QS9A 2H94A 4P9FA 1T6CA 2I7PA 2HKXA 2DLLA 1RC9A 2HNHA 4DOZA 2F5VA 1AKHA 2I7NA 3I8DA 2RQQA 4CJ3A 1VQ8N 3TQNA 3BOQA 2CUZA 1S7OA 3KP7A 1GOCA 1LWEA 4GVEA 3RSEB 3JW4A 2I10A 3CYMA 5HDGA 2X48A 3OYDA 1B72B 2GV9A 5IYBJ 1QVTA 2HMIA 1YVNA 2YJFA 5F1XA 1T05A 5H20A 4F7ZA 5FRNA 1TL3A 1J5OA 1P4XA 3JCUC 3I59B 1O3RA 5BNGA 5IOYA 1N75A 1L5UA 1YITN 2E7XA 2E60A 5D5XB 2M7BA 1MWMA 1WUAA 3K1PA 1WPKA 1UCRA 5J4YA 4DU1A 1PUEE 4MNUA 1MBHA 5D5WB 1BWFO 5H6RA 3REOA 1JLBA 5HS8A 1LW2A 3WNGA 5C15A 2EV0A 4JI7K 3V1OA 4BY9C 1F43A 5H2FC 1OH5A 2A5XA 1GVDA 2NVYJ 1R00A 4OMYA 3WNFA 2EFNA 3QP6A 3WGIA 3EUHA 4PJ0C 5D5VB 4JP0A 4HWIA 4ON0A 1HQUA 2L9SA 1HYSA 3VF2A 3HO1A 4LC9B 4AU7A 4CJFA 4TSXA 3MWMA 4PUOA 1D8YA 3P83D 2K9QA 1TUUA 4QLCU 2VGNA 1BI3A 3HT3A 1NGCA 1WAFA 4FOEA 2VQEK 4WE1A 3K5LA 5EG0B 4DV2K 5KPRA 3FXUA 2XDVA 3PX0A 1GLAG 1AOYA 5LHHA 1W0UA 2IIRA 2FBTA 4RAGA 5FLXK 2BW3B 3I53A 1TL8A 2L4MA 2QF7A 2KQ2A 2JPBA 3V9SA 4ENKA 3E97A 3HB9A 1YHQI 2M0CA 4WXHA 1J59A 1C1AA 3HXMA 2DYSH 1Q1HA 3I55N 3E3VA 2R4GA 3IUOA 4M3EA 1D0XA 3A03A 1NK3P 4E1NA 4DWIA 1XNQK 2ZJQF 4YEJA 5EVZA 3WTUC 4C2MJ 2JVHA 3EZWA 3K10A 4FWOA 2XSDC 4JN4A 3E66A 4QAGA 2O7OA 4L3QA 4BNCA 1PUFA 4UUSA 2HI3A 3C3WA 1HNXK 3D5SC 3VQ4A 4J2DA 5H6QA 3MECA 1V4TA 4BRLA 4Z4IA 4M9SA 4XQFA 2KJCA 2HOSA 4J2EA 3VEYA 5B1BH 1Y97A 4JAXA 2H6BA 2A1SA 4A3BJ 2JWLA 3HPOA 4Z4FA 3RYPA 4B3XA 5BR8K 2PZSA 3LSMA 5EGOA 3O9QA 2XB0X 4II2A 1S5JA 2A68F 3SJHA 1Z9CA 1KVBA 3WTWC 2FEZA 4BRFA 4CEBA 5AQMA 2H1LA 3MK6A 2L9VA 3OYNA 2FX0A 2O8XA 4XIUA 1S29A 2Y0SN 1DKGD 3D2EB 4NDLA 1Q7YO 4IJAA 4C23A 4CI6A 3C1DA 2PYLA 2QI2A 4B47A 3ZPLA 3VQ9A 4CGIA 4PL8A 2G8KA 2DT5A 2IA2A 3W2AA 2JA6J 3EE8A 2ZMEB 5AQYA 2QVOA 4D5CA 3ROUA 4LG3A 3QODA 5AQGA 4V2GA 4BDYA 4CGHA 4KI4A 2IS6A 2VBZA 4FJ5A 2Z2SB 3UIQA 5JHFA 3WGHA 1RIOH 1HNZK 3CMEI 1V4SA 5KAFC 5K5OA 3TAPA 4DQSA 3BZCA 1RNLA 3RKWA 1HW1A 3CCLI 2EFWA 2W24A 1XB4A 4LG0B 2PBDA 4AM7A 2E7WA 3FX3A 5EY4A 4XH4A 1YQAA 1OISA 3ZQGA 2DU9A 1FBQA 3ZLJA 2DW4A 2MH9A 4NNJA 2Z9OA 3CCUN 1Q9XA 4B3RK 3VQEA 1VQ5I 4CEDA 2CGJA 2B4JA 4UUTA 2GELA 3KKSA 4JHDB 3SPYA 4A3CJ 2YKNA 1NH3A 3I4NJ 3FFIA 3KLOA 3AKZA 5BPDA 3L3VA 1PDNC 1IN8A 2F7TA 4FVMA 4BGBA 3QNNA 2CH5A 5FPMA 3I0RA 4WQ5A 3TTDA 1EP4A 1NK4A 4FETA 3GFIA 4KT6A 1AKHB 1RKTA 3CTAA 3MVPA 5C12A 2ZJ2A 1L3SA 4FO0A 4IOAL 1KYZA 1RDUA 1LEAA 1W0TA 4JI6K 3WG7H 1RKWA 4H4OA 1VSJA 4CEOA 3KD5E 1CF7A 2OV7A 3CJQB 3A1YA 3K4CA 4L0YB 4C1NI 3CUOA 3MAJA 3ZSOA 2UV1A 4S04A 4LIUA 5JFRA 3R3LA 4IFEA 2HYFA 2GBYA 3HEFA 3CD6I 1VQPN 5HVQC 2XVCA 2F6CA 3OOUA 3PNTA 3A5MC 4F52A 4YDUA 3UE5A 4PJNA 4A3GJ 1E3PA 1E4GT 2R7DA 1QZ5A 3KP6A 2BH1A 4CZEA 1EO1A 1U0JA 4OKJA 4RA2A 4N0BA 4W1UA 3WG9A 5B3SH 1AWCA 4JD2B 4CFAA 3HVTA 1D9DA 2HDWA 2FBXA 1ZGWA 2B63J 5LLQA 4XRMA 2FLOA 2KW4A 3H0DA 3IH4A 1TWGJ 5F1RA 1YF5L 1CZ9A 1XMXA 4A69C 2NVQJ 1WOQA 2HTJA 1RGIA 4OPKA 2H6CA 4UVBA 5EJCA 1ZARA 3PSIA 1Y1VJ 2PN6A 2R7OA 4Y7NJ 2DA6A 1RI7A 5IY5H 1LE8A 3ASMA 5CZ2A 5F6FA 5B5EC 2DA2A 2Y0SA 4M45A 4U0VA 1BHLA 2A6AA 2NUBA 2V9PA 1JJ2M 5F04A 4BJTA 4CJSA 3DEUA 4MO4A 3G1LA 1HBXG 1B72A 3CM6A 5E41A 1T98A 3RKQA 1FWZA 1S1WA 4O8KA 5DEQA 1T33A 1SAZA 4DTRA 3K59A 3HSEA 4RW4A 3RWUA 1MJ9A 2P9NA 2DK8A 4DTJA 3ZN0A 3K4KA 4OX9K 2ZGYA 4EP4A 5M1NA 5HNFA 1FOXA 1HRHA 2Z99A 2YX7A 3G6EN 3VQPA 3H3ZA 1VSDA 3ULEB 2CFXA 4DQ2A 4KH4A 4H4MA 1X2MA 3P31A 4MDAA 3KLFA 4FCYA 2L54A 3M3YJ 2FQ3A 2R7QA 1T6SA 2VKHA 4DZPA 4I2OA 1MBGA 4JKFA 3ZT4A 2EFOA 4DLEA 3K9KA 1FTZA 4JK1X 3F21A 3AVHA 2VWKA 4CJEA 3OHRA 1Y0NA 4BY1J 2DT7B 3GYHX 4P5OA 2O9LA 2QLZA 5H1SQ 3NAEA 1NK7A 1IBKK 2PMUA 4FJJA 3S17J 3VEWA 3CG7A 2EQRA 4IF4A 2HVRA 3DYAA 3HRMA 4DQRA 1MD0A 4PY5A 1C1CA 1RBRA 3BP8A 5AQRA 3SBGA 2LY1A 1R71A 1QU3A 2QXLA 3PNYA 3TW6A 5D6FA 1LQ1A 5GADP 4OLAA 2GA1A 4MLHA 4GYGA 1WBBA 4FWSA 1MDMB 4B08A 1OFCX 3U9GA 4LLNA 4CF8A 1DU0A 3K4MA 5F0FA 1J75A 2QQ9A 1ZRCA 3NE6A 3A5NC 2UZKA 3I55I 1R0AA 1B9MA 2DQRA 2E2PA 1D1AA 4FLZA 1UG0A 1K79A 2ATQA 2HVHA 4ZHRA 1BO5O 1QSSA 3EUHC 5BS6A 2Q1NA 3DAWA 4H5VA 4JEPA 4GFBA 3HZJA 4II3A 1MDUB 4A6DA 3FK6A 4XKWA 2VYPA 1BW5A 5BN9A 3PIPL 2BE5F 1HOMA 4JKBA 2X74A 1XCVA 5HROA 2HHQA 2OPTA 4MQVA 4CD1A 5CYQA 1FNNA 4DB3A 2R3SA 5D6EA 2BHZA 2XAFA 3ZRGA 1NGJA 1RDDA 1BIBA 4CFBA 4IHXA 1X1DA 3B8AX 4DFMA 5C2FA 1KQSM 3L2WA 3I8BA 4HOBA 5A2QZ 2BZTA 4J00A 1S1TA 3L6QA 4C8NA 3H36A 2QGUA 3IWZA 2GIZA 3TOAA 4KMFA 5DK5A 4N47A 5SWMA 3PV8A 2LTPA 1D5VA 5SZTA 4EAHD 1T56A 2F4IA 2H27A 3CJ9A 3PX6A 1NK0A 4WQ4C 2WY8Q 3S3OA 4L0ZB 1T8IA 1ZG1A 4E19A 1BI0A 1SD5A 2EINH 1IJJA 1TYQB 1USSA 1HNWK 3EQLF 1T0FC 4FM1A 3RSNA 4MQ9F 3K2PA 4DTOA 3KLGA 1BJZA 3BZKA 3V8LA 1OMIA 1TTYA 4CXFA 4QPOA 1ZR2A 4OIPF 1F1ZA 2W25A 3E7LA 3HOTA 2M4GA 1MJBA 1U6GA 1D1BA 1SMTA 2LNBA 4XL9A 2EH3A 1MMSA 2XPWA 1S7EA 2M30A 3FXJA 1RT5A 3SEZA 4BXFA 3MEEA 5KNLA 1W36C 4B1YB 4AF1A 1FW6A 2DFFA 3PLAA 4WXCA 3AO3A 1IRZA 3BR5A 2RN2A 1YITI 3TPQA 2KZZA 3KK1A 2BV6A 3DTEA 3FGUA 2OTLN 3WTXC 1R49A 2KKOA 4G12A 5D4RA 5L3FA 4K2EA 2P1JA 4E0DA 2CH0A 2NS0A 4HDUA 2W48A 3JSOA 2CSOA 3KLIA 1W36D 4RGSA 1TC3C 5EXWA 4A3EJ 5LRRA 3GZ6A 5ADXH 2X0LA 2NAZA 3E0JB 3M8RA 4A5MA 1Z67A 2V7YA 3P39A 2VKEA 1X3UA 2GZWA 2YS9A 3ZSXA 2DJNA 4HV6A 2FU4A 4XN3A 2IOCA 1QHHD 1FBUA 1O4XA 5JVGF 4YDUC 3F9MA 3NBPA 3TABA 5FPNA 2M87A 1IN7A 1MU2A 2IGIA 2QZ8A 3LAJA 4XMYA 3LQQA 3HL8A 5AZIB 1MMAA 3A2KA 2BTFA 2HZDA 3F73A 3RJPA 2HQRA 3CCJI 4LFBK 2FBVA 4WFBL 2EZLA 2FRHA 4FLWA 4DQ8A 4BQNA 3RPUD 4L5JA 3V7CA 1H8AC 1L3TA 2QKLB 2Y69H 1YJ9N 3CJNA 1FYLA 2CGLA 1J2XA 1T3VA 4I6MA 3E6BA 2E1CA 2ECBA 2OD5A 1HKCA 3AFHA 3RKXA 1YYVA 3CCVN 1BIZA 5IYCJ 3PUBA 4U0WA 3VEVA 3DKXA 2LC2A 2K3FA 3H3OB 2E5LK 3ULDA 2FQ4A 1OYYA 4PDKA 1HC8A 2JLEA 5CHIA 1VTNC 3VQ5A 2R5YB 3C2HA 3GZ5A 1RT4A 2PMZN 3CCEI 2IVOA 1IN4A 2P5GA 2ZJQL 1HPMA 1LFUP 2WA0A 4ZYGA 3PUFA 2WWYA 1RDWX 2XPUA 2LY9A 2XKOA 4Y52J 4FWNA 4U7DA 4Z94A 1FYKA 1R23A 2XRLA 4OPHA 3KD1E 1X2NA 4I7FA 2Q0OA 3GTPJ 1U04A 3SBTA 1O7FA 6PAXA 9ANTA 4FLYA 1W7PA 3K5NA 3MXMA 2AQEA 2FBHA 3BCAA 1DP3A 4B9QA 4DSKA 3DXMA 4F2SA 1P6RA 3HJEA 4ZYHA 1TT5B 2IVMA 4YRVA 4AVZA 2QSFX 5ICFA 3SFIA 4L18B 1C1BA 3NGZA 2XV4S 4FQGA 1LPQA 3I58A 4BWMA 1YX5A 2ZJRF 4DQIA 1FSHA 2KLAA 1GOAA 1RCHA 2GM4A 3F9KA 4EFHA 4NHJA 3N97A 4DV0K 4IZ9A 1OCRH 1R5HA 2UUZA 3FXRA 3P7NA 3WTVC 4PA1A 1REVA 5AQFA 2F4MB 4JX6A 3G71I 2AXTC 3WHBA 2HDCA 3AVCA 3QB0A 3LP0A 2ZXHA 5LEKA 1NJIO 5JLFA 2PQ8A 4LB6B 3BZ6A 4BJ6C 2IGMA 4ZDOA 4DV5K 2M8EA 2CQKA 2QM1A 2HXIA 2PYJA 3T5XA 2XRNA 4GMJB 3JRGA 2EA2A 2F5EA 3RPUA 1T8EA 2HXOA 2E2OA 4IJNA 1WN7A 5DTDA 1S6QA 4YFUA 1P92A 4XICA 1WB9A 2E2HJ 3GVAA 4KNYA 4KYWA 3M3ZA 4YOTA 1OCTC 2FSNA 1R59O 2BE2A 3SQ4A 4B3SK 1S7AA 5F2RA 5LGTA 2Z1DA 2IRFG 4RW9A 2JK3A 4RLQA 2Z3YA 2YU9J 3QAHA 1P7IA 3A0BC 1O3TA 1LAVA 1VQ4I 3DOKA 1C0WA 3ZSYA 1TWCJ 1HLUA 1Y0UA 3JTHA 2KT0A 3U1DA 3RI4A 5CY4A 4DV4K 1N32K 3SUNA 3SAGA 4DV7K 4JX4A 5EEAA 5A2QK 1NG9A 1EKEA 5TGTA 2HW3A 4F9OA 3CDHA 2VBXA 4JKHA 4I9QA 1I50J 2ME0A 4O5VA 3GX4X 1CQTA 5BPLA 1TK5A 2AHQA 3BDDA 3CJBA 1FP1D 1WJAA 1S9GA 3R8EA 4AIJA 1XGNA 2DODA 3H45C 3CF5F 2RF2A 2KIUA 3S32A 1MJAA 4I01A 1RNHA 3CZ6A 4CF0A 2R7RA 3D5LA 3TW7A 3VF6A 5LFAA 5FLVA 2BHYA 2ITGA 3ZQCA 1UZCA 4XLAA 3I0SA 3BCBA 1IAWA 1NLVA 2P9IB 3ZQLA 1ETKA 2F4OB 2X6SA 3S2DJ 1JHHA 3M8QA 5LHGA 4DF4A 4GV6A 1P4WA 3ZEUA 2HVIA 1RT3A 2P9LB 3QU3A 1S1VA 1JUPA 4FW2A 1QPIA 4RM2A 3GCMA 4FJLA 2DBBA 1NJWA 1MA9B 4JI2K 4LITA 1OH6A 4M6VA 3MWPA 3OL3A 5DCMA 1K78A 2LREA 4HX7A 4KKOA 3LDOA 2EV5A 3ZMVA 2DQLA 4CK2A 3P9KA 4FJIA 1XGOA 2JA7J 5J1EA 4A3FJ 1TKZA 4XNFA 2XF5A 5K5RA 4O5FA 5CPRB 4LH4A 4I09A 3LPTA 3O8HA 1GV5A 1KRPA 4M3BA 3HRGA 1A6IA 1P9QC 4L9VA 4JQFA 3K70D 2JA5J 2NRXA 1WI3A 3H5AA 4HLXA 1VQ7I 3FIWA 3AO2A 4OAZA 4C3JJ 4G7ZF 2KJBA 3S1MJ 2QXFA 3E9PA 1T2KA 1DDNA 1FKPA 3H35A 4KMUX 4FLTA 4BRHA 3B6OA 3DXKA 3U4LA 2P6SA 1QZYA 4N4OB 4PFOA 3VODA 4C2UA 1IKXA 1ATNA 3KP4A 3UNGC 3RCOA 2X6WA 2HF4A 2P9PB 3WUHA 1FP2A 5JHUA 4W5QA 4DFPA 5CLSA 4EP5A 2KQRA 1DQUA 5LJWA 3H9QA 1I94K 4DR6K 4I0AA 1YT3A 4FXDA 4LSNA 4CERA 3DU5A 3CC7I 1K73O 3ASNH 3O3HA 2CW8A 4I2QA 1ILYA 4EJWA 4Z2YA 3OYFA 4LGWA 5AQZA 4CECA 3CXCM 4K25A 3AG4H 3TANA 4FX4A 4M42A 4D7NA 3O9SA 3VQQA 3G4SI 5JVHL 4RGUA 4CVNE 1VQ6I 3FWEA 1ESVA 3DXJF 5GAGJ 5CYMA 3IAM2 1V5FA 2H1KA 2EK5A 4Z4EA 2J5OA 3ZT1A 4R8HA 1BN5A 1HSJA 1OH8A 3VEPA 1YOVB 1A5XA 1F9NA 5E1ZB 4DUYK 2LMDA 4FJ9A 3VMFB 3H92A 2ICWG 3LOCA 2KZGA 2FA5A 4F55A 1WSUA 2D1HA 2VC0A 2CJJA 5EEGA 4OIOF 1JLFA 1QVFM 3VFZA 4HX8A 1NGFA 2NRWA 3MD2A 5BPIA 1NG6A 2F48A 4IFVA 4E7JA 3VA3A 3ELKA 1I3QJ 5FFXA 1GDTA 3W3CA 4LD5A 2KDOA 1XGMA 3ASOH 3HOSA 3J7YJ 4HRIA 2HHHK 3MMYB 3LA3A 5DUIA 2ZXJA 3KIOA 4FJMA 1KQ9A 1IH7A 4LF4K 2ZNYA 3R61A 1YIJI 2VI6A 4CK1A 4XONA 1Y39A 1KU3A 3VYUB 4FISA 1WLJA 4M3XA 4PUSA 4RB1A 1Z77A 2RC4A 2F9TA 4OPJA 4F4KA 3JS6A 4ILJA 4KN7X 4CJUA 1VQ5N 4KHYA 1G3TA 4CYCB 2ZBKA 2XY7A 1XI1A 3DLLF 4M41A 3AO4A 4RDUA 2LKSA 3OYCA 2HBMA 3K57A 3OL4A 4O6JA 2MABA 4H0TB 2QQBA 5TISC 3LNQA 3MN7A 5E3OA 4CBUA 3V8KA 1KC8O 3M8JA 4XR6A 3J8AA 5TJJA 4BEHA 1NG7A 3ERMA 1YTAA 4HBLA 1Q82O 3LSRA 1WSEA 3FHNA 4MFDA 2D45A 4EJUA 3ZCMA 2R92J 3J80O 1IDYA 3GTGJ 1VK0A 5GINA 3D0PA 3IAYA 2COMA 3QYEA 3H3NO 1ZG3A 2OJED 3ID8A 4ZC3A 3PQKA 4CD3A 2M7AA 3MDQA 4V19S 3QWLA 2W82A 5FGMA 2CV0A 4B44A 2Y1IA 3S8PA 3OYBA 1ZBSA 3SUQA 1LDJA 2P9UB 2UUAK 3GTJJ 4BRKA 4RBOA 1NGAA 2V7ZA 2P4WA 2ZCWA 3E1SA 1IG9A 3DKWA 2PJPA 3ZT0A 3RMBA 4BE1A 2DFEA 4DF8A 3FKIJ 3ML6A 3SZPA 4JS4A 1VQLN 4RWTA 1J0RA 3G6EI 1K8KA 2XAHA 4DSLA 4FOIA 2HB5A 4CCMA 3R9PA 2LLKA 4I76A 3I64A 3TEDA 3DEEA 2P81A 4RTFD 3CQZJ 2AO9A 2XAUA 2E1MB 1HKTA 2DPNA 2WAFA 2ETHA 2R7UA 3VWBA 2HF3A 3KVGA 2XASA 4X0GA 1K8KB 5IP6A 1T6DA 2GQQA 1RT1A 4BHCA 4FWRA 1X4PA 4EHUA 2QKMB 5KTQA 3C2GA 1S8NA 2M34A 1VSLA 2R7FA 1Y1WJ 3AA3A 1VQNN 4CK3A 3QETA 3O4NA 2F4VK 4CJ4A 3DPTA 3MCPA 3I9V2 5GTIC 5DD4A 4HUEA 1FOYA 2DT6A 2K4JA 4DTPA 2K5CA 3QLHA 4CF9A 3BJAA 3BTLA 4RAZA 4IHSA 3CCLN 3EL2A 4DQPA 3J80Z 3HDDA 2WY7Q 4FJKA 3GFMA 1GHCA 4HCBA 4ICLA 3RR7A 4JD2A 2YNIA 3V9ZA 3SNNA 4CYCA 2QKBA 2CUJA 4FPAA 1TQIA 2PY5A 1CXQA 3VOVA 3AO5A 4KI6A 3BT9A 4J19A 1O1WA 3OJUA 4FJGA 1XMOK 2D0AA 2XUBA 1PJRA 4V19K 1I1SA 3ZN1A 2VODA 1C0TA 3EUAA 3SJJA 4JI3K 2CUFA 4A59A 2DA4A 3F2KA 1JUMA 1LJ9A 3DFGA 1MH4A 4LF8K 2HOEA 1YXQA 1OYWA 1WHUA 3AA4A 4YOYA 4N5SA 3WTSC 3JRBA 5JS2A 1HKGA 2JWKA 1N33K 2EA4A 4HTUA 3ULEA 1IKWA 2YNGA 1ZXOA 3T8RA 2VXDA 1RZ4A 1SMYF 5K5QA 3K5OA 1RESA 3FZFA 2MG4A 5B66C 3F6VA 1VQ4N 1WSHA 3CCSI 3CI5A 3DLRA 4DTMA 4ZZDA 4D5FA 3VA0A 1R1TA 3BTCA 3FE1A 4KT5C
chains in the Genus database with same CATH topology
2YKNA 3FFIA 3L3VA 3QNNA 3P5JA 1JL1A 4FVMA 4FW1A 3RTVA 3I0RA 3M8SA 1EP4A 1I3AA 1NK4A 3TAEA 3TAFA 3SI6A 1RBVA 4CGJA 4F3OA 3IS9A 1SL2A 1L3SA 3L2UA 1S6PA 4B9MA 3VQ6A 4J2BA 4CESA 1ZBFA 4H4OA 1VSJA 4CEOA 5KRTA 1VSKA 1N6QA 5C25A 2XO7A 3BDPA 3KD5E 4EZ6A 4DU4A 3G0ZA 4NYNA 1JLGA 3ZSOA 5HRNA 3WNHA 3ISNC 3ZSVA 4CJ5A 5KRSA 1QHTA 2DY4A