1EKEA

Crystal structure of class ii ribonuclease h (rnase hii) with mes ligand
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
222
Chain Sequence
MIIIGIDEAGRGPVLGPMVVCAFAIEKEREEELKKLGVKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNSINLNDIEINAFSKVAKNLIEKLNIRDDEIEIYIDACSTNTKKFEDSFKDKIEDIIKERNLNIKIIAEHKADAKYPVVSAASIIAKAERDEIIDYYKKIYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKSKQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
publication title Crystal structure of archaeal RNase HII: a homologue of human major RNase H
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase
total genus 79
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1ekeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ekeA01
3VQPA 4PUOA 4FJ8A 4NYFA 4DQPA 1QQCA 2YV0X 3PO4A 2DTUA 3T3FA 3OS1A 1S1UA 3ZSXA 1VSKA 4KKOA 1RTDA 1LAWA 3VN5A 2OPPA 4CEQA 2QXFA 1T03A 4N41A 1KSPA 4B9TA 1C0MA 2LSNA 1VSMA 1RDBA 3S3OA 4K8ZA 1YTUA 3HO1A 2JGUA 1LV5A 3QNNA 4ZTFA 4GVMA 1BI4A 4KPYA 4B9VA 1RT2A 1WSGA 1BI4B 4N5SA 1RBTA 2VWKA 2VG7A 4DU3A 3ZSQA 1A5VA 1WSFA 3QLHA 4AH9A 4DWIA 3VA0A 3ISNC 4W5OA 4ZTJA 1ZBHA 4PY5A 5DMRA 4KTZA 1LW2A 3OYDA 4DTXA 4CJSA 4MQ3A 4DTJA 3P83D 2E4LA 3RMDA 3RTVA 3KIOA 5E41A 1KVBA 2G8FA 4CFBA 4KO0A 4C8MA 4B9NA 1FXXA 4FZZA 2HHQA 4XIUA 4FXDA 3TARA 4CESA 4CK2A 1BQNA 3MEDA 4OPKA 3TAEA 1KFDA 2A1SA 4O0IA 2G8VA 1UOCA 1LWEA 1IH7A 5KGWA 5HRSA 4I2PA 1NK9A 1X9SA 4DSFA 1QSSA 4AHSA 4FJNA 4DSEA 1RT1A 4FJXA 2OA8A 4IBNA 4F8RA 3CM6A 1C0UA 1U04A 1NOYA 3OYCA 4LH5A 2HMIA 2X6NA 3TAMA 3V1QA 4E7JA 1X1PA 3G10A 2D0BA 4B8AB 3IAYA 3V9UA 1L3SA 1D9DA 2DFEA 4DSKA 3KD5E 3QETA 3KKRA 4PWDA 2D5RA 3HXMA 3HK2A 4H4MA 1NK7A 3SPYA 3ZSYA 3CQ8A 1JLGA 1C1CA 3NF7A 4KTWA 4L8RB 2KFZA 3SUQA 4DU1A 3KTQA 1J54A 1C6VA 1RBRA 4BE1A 1CLQA 4C8OA 5C24A 4CGDA 1VSIA 4ZHRA 2KFNA 4CF0A 1QSYA 3VQQA 1EXQA 3T19A 3AA5X 1KVAA 4GW6A 3SUOA 5I3UA 4RW6A 3TANA 1UA0A 3DI6A 3OYLA 3MAQA 4CCHA 4CGHA 4CHQA 1EP4A 3S3MA 1ASUA 1RT6A 4M3RA 2X74A 1NJYA 4QAGA 5JS1A 3NGIA 5HLFA 5J1EA 4ELUA 3VQCA 4G1QA 4W5RA 3NHGA 1VSJA 1FKPA 1NK6A 5CYQA 4F3OA 2HHWA 2FBVA 4Z0UA 2A1RA 3SYZA 4CFAA 1QE1A 1WSIA 3RMAA 1L3UA 1VSFA 1ZYQA 4DFKA 5KGXA 4HHTA 3KLIA 4KHQA 2ZD1A 3SQ2A 3ASMA 1T05A 2HHUA 1TKZA 1TK8A 3K2PA 1BCMA 3CFPA 4DF4A 3JYTA 1LWCA 2R7YA 4FJ9A 4MFBA 3O3GA 4FK4A 2GUIA 4K8XA 4B9SA 1O1WA 1JL2A 4NYNA 4HUEA 1HMVA 2ITGA 1ASVA 1HJRA 1I39A 4F4KA 5HP1A 1GOCA 3S3NA 5HROA 3AVLA 5K14A 3WNEA 3DRPA 1NK5A 2O4GA 3F9KA 4E89A 3K5MA 4DTNA 1LW0A 5CYMA 1SL2A 1N6QA 3QEWA 4E7HA 3KD1E 4CEFA 3OYBA 3ZT3A 3AA3A 3RR7A 1ZBFA 2GV9A 2HVIA 1IO2A 2X6SA 4FYDA 1KVCA 3IRXA 4PQUA 1TKXA 3NE6A 3L3UA 4OKEA 1RDCA 3DLRA 2PYLA 3CFRA 3NH0A 4FLUA 1RTIA 4QCLA 2RF2A 1RCHA 4BDPA 4CJPA 4KFBA 4FLTA 1JL1A 1VRUA 2E6MA 3K59A 4DQRA 1S1TA 1ZBLA 2XY8A 5SWMA 4DQQA 5KRTA 2YNGA 3HVTA 1HNIA 2IOCA 2W42A 3OJUA 3RMCA 1I3AA 4CJLA 1J53A 1XI1A 4DSIA 1HRHA 4ID1A 3MXJA 5J2NA 3DLKA 4N56A 4FJ7A 4W5NA 3SUNA 2Z1GA 1FKOA 2YKNA 5JS2A 4KI6A 3DYAA 2WOMA 3FFIA 4LD0A 4CFDA 2PYJA 1HYZA 1TL1A 1S1XA 4CEBA 3NCIA 1JLCA 3ZT2A 4EZ9A 3UIQA 3VQ6A 4CHZA 2KQ2A 1X9WA 4HCCA 2HHXA 1ZBUA 1RBVA 4OPJA 1JKHA 5HBMA 1WNSA 4GMJB 3HP9A 4M3TA 2VWJA 3SQ1A 1NK8A 1U4BA 1QHTA 4KREA 1GOBA 1EKEA 3AVMA 3CFOA 1HYVA 3O4QA 4R5PA 2YHBA 1NK0A 3KKSA 2HHTA 3TABA 3M8PA 4KV8A 4OVLA 3MXMA 3QEVA 1BISA 4CJUA 5HRPA 3RR8A 3M8QA 2OZSA 2HNZA 1XC9A 4CHPA 4OKKA 3SCXA 1JLBA 4DSLA 3ZSWA 3VQ4A 4HCBA 4M3WA 3NF8A 4KI4A 1BQMA 3DOLA 3A2FA 3HPHA 3DLBA 2IS3A 4N47A 4QOZB 3OJSA 5I42A 2HW3A 3V9XA 1HQEA 4FLZA 4ELTA 3RRGA 2ATQA 1RT5A 1D8YA 4F2SA 3AVIA 1RDAA 3WNGA 4E7KA 3K58A 4F2RA 4W5QA 2B4JA 4M42A 4IFVA 4KRFA 3KLHA 3V6DA 4BE2A 5EU7A 1U49A 3AO1A 3TAFA 2G8WA 2G8UA 3WNFA 3K5LA 4O44A 3LPUA 4CGJA 3ZT4A 3KLFA 4CJTA 5HRNA 4Z4EA 4FK2A 1S6PA 3LZJA 1BCOA 2RKIA 1JXBA 3SNNA 1JLAA 2IDOA 3AA2A 4AHVA 2Z1JA 3NH2A 4O0JA 2RPIA 2P51A 1L3TA 3RRHA 2RN2A 4Z4CA 4IFYA 4CEAA 3SV4A 3S9HA 4Z4HA 1U47A 4DG1A 1B92A 4E7IA 4Z4IA 1S1VA 1J9AA 1BL3A 3DLGA 3OS2A 3OYIA 4KHYA 2XO7A 2B5JA 2ZQBA 1SL0A 4IG3A 4KHSA 2ZE2A 2Y1IA 3OYFA 2XY6A 2HVHA 3CYMA 3LAMA 2EX3A 3VQAA 4FLVA 2HNDA 4FVMA 4B08A 2XY5A 4Q5VA 2B6AA 2IAJA 1MU2A 4ICLA 4HVJA 1EETA 3VQEA 4M3ZA 3AVBA 4E1MA 4J2BA 2OZMA 4CJFA 4KHUA 4LY7A 4FJHA 3AVAA 4H8KA 3NAEA 3ULDA 1U48A 4DF8A 3T1AA 3SQ4A 3QEPA 5C42A 4CIFA 4JRQA 4CGIA 4PA1A 3V9WA 3DLHA 3OVNA 2Y1JA 1Z26A 1CXUA 3LANA 4B9MA 4CF9A 4ELVA 2I5JA 3ZCMA 1F21A 1RILA 3VQ7A 4CJWA 1U45A 1NOZA 1S9EA 2BE2A 3AO5A 1Q9XA 2GBZA 4FLXA 4O55A 5D3GA 3HM9A 4CHOA 3OYKA 3LWLA 4E19A 4B9LA 4DTUA 1BIZA 4Z4GA 3I0SA 2D0CA 3DRRA 3ITHA 1NJZA 1ZBIA 1RNHA 1C0TA 2VG6A 3OY9A 4RG8A 3SPZA 3QINA 2YKMA 4RW8A 3MEEA 4AHTA 4LH4A 4DS5A 4DSJA 1XHXA 3WNHA 3OS0A 1ASWA 1LWFA 5SZTA 3LP3A 3BGRA 4OGCA 4CIGA 2F96A 1QTMA 1X9MA 4DU4A 3AVCA 3U3GA 4DMNA 3C95A 3QEIA 1WLJA 3KLGA 1NKCA 1KLMA 4EP4A 3AVFA 4E3SA 1SKSA 3BDPA 4BWJA 1RDDA 4OJRA 2FBYA 5DK5A 2Q3SA 3KLEA 2Z1HA 4DLGA 3RMBA 1NJXA 4KAZA 3VQBA 3CG7A 4DTOA 4EP5A 3K5NA 3QNOA 4B9UA 3AVNA 3DM2A 4BWMA 2PY5A 3AVHA 2HHVA 3VQDA 4DFPA 3VA3A 2FBXA 3LWMA 1XWLA 1JLFA 1WN7A 1GOAA 3EYZA 3RWUA 1BIUA 3V1OA 4WE1A 4CJKA 4M45A 3LAKA 3KK2A 5J2PA 2QKBA 3I8DA 3IG1A 1B9FA 1KLNA 4DTPA 3AV9A 4DLEA 4AHUA 4F3TA 3ZSOA 4OLBA 4RW4A 1WSJA 4AILC 3SUPA 1RT3A 1RTHA 1WSHA 3K57A 3LP0A 3SJJA 2HNYA 1DTQA 1Y97A 4BDYA 4OGEA 4CGGA 3NF9A 3O3FA 4J2EA 4RW7A 4KTQA 2IGIA 4CGFA 4W5TA 3SV3A 3QEXA 3NGYA 2G8KA 1Z25A 4IG0A 3L2WA 3E01A 3PUFA 4JRPA 4OKJA 1TV6A 3OYHA 3HJFA 1SKRA 1KCFA 1ITGA 1HPZA 3U6FA 4FCYA 1CZBA 2AJQA 3KJVA 1TK5A 4FM0A 4HTUA 2BDPA 1C1BA 3NF6A 4CIEA 4ID5A 4LSLA 3TAQA 1Q9YA 1IG9A 3PY8A 3P5JA 1VSDA 4CF8A 3OYAA 3PX4A 4LSNA 4C8KA 5FROA 4CE9A 1D5AA 3PX0A 4FJ5A 4NCBA 1S9GA 1S5JA 3AO3A 4Y1CA 1KTQA 4CHYA 4I2QA 4CHNA 2FBTA 4FM2A 2HB5A 2DFFA 2XRIA 3IS9A 3U3YA 4CK3A 3M8RA 1RT4A 4FJLA 4DQSA 2KZZA 2EHGA 4CEDA 3NGZA 4M3UA 2NUBA 2YHAA 4M41A 1UWBA 1BHLA 1TAQA 3AO2A 3SZ2A 4DQIA 4NCAA 1L3VA 3LP1A 1KRPA 4Y1DA 1CXQA 4CJQA 3OYEA 3AVGA 5FRMA 3AVJA 5T7BA 1DLOA 1JXEA 4DFJA 1EX4A 1JLQA 3HVRA 3P1GA 1A5WA 3KK1A 1NKBA 4C8NA 4CF2A 5CZ1A 3C6UA 4CJVA 3C94A 4CJRA 1S6QA 3D0PA 3LZIA 2BGGA 2O4IA 4AHRA 3L3VA 4J2AA 5FRNA 3SI6A 3HL8A 4KB0A 4FJMA 2YNIA 3VQ9A 1SL1A 3VQ8A 1SKWA 2PZSA 1TVRA 1N5YA 3QIPA 1C1AA 1TKTA 1YT3A 3HT3A 1RBSA 3CM5A 1TAUA 1TGOA 3AVKA 4DTMA 3LALA 5KI6A 2XY7A 3HSTB 3ZT1A 3LP2A 3V81A 1TKDA 1BGXT 1QSLA 2YNHA 1RT7A 3DMJA 1W0HA 1XHZA 2P5OA 2OPQA 1A5XA 4FW1A 2QK9A 1YVUA 1WAJA 4EZ6A 3HYFA 1SV5A 2JLEA 3DRSA 4FZXC 3LPTA 1CZ9A 3TAGA 3H08A 1T7PA 4DFMA 2WONA 3OYGA 1VRTA 1NJWA 3L2UA 3QERA 5CZ2A 1YTAA 4O5BA 2X78A 1IKVA 4CERA 2BANA 1HNVA 4CECA 3ZSZA 3F73A 4B8CA 1HYSA 3AO4A 4JS5A 3HPGA 4IDKA 3L2QA 3PV8A 3ALYA 2ETJA 4DTSA 4E1NA 1RBUA 4FW2A 4FLWA 1JLEA 2P1JA 3I0RA 3B6PA 3OYMA 4FM1A 3LDSA 4IKFA 2QKKA 1WSEA 2OPSA 3V1RA 3V4IA 4CJ5A 4BDZA 2G8IA 4Q0BA 4FLYA 1RTJA 4TSXA 2KTQA 3AA4A 3TWHA 1NKEA 3MXIA 3VQ5A 2DY4A 1IKXA 4OLAA 4I9LA 2F8TA 4FJGA 2VG5A 4YFUA 4Z4FA 1IKYA 3DOKA 3DLEA 3V9ZA 1TL3A 4M3YA 1G15A 3NFAA 3TI0A 1UA1A 3PO5A 3KK3A 3NH1A 4AHCA 1S1WA 2IC3A 4B3OA 3SQ0A 2KW4A 4KHWA 1REVA 3V9SA 2E6LA 5FDLA 3JSMA 3OYJA 4C8LA 4CEOA 1KFSA 2DFHA 4CFCA 3L2RA 4KB1A 2OYQA 1VSLA 3ZT0A 2XHBA 1IKWA 2Z1IA 1LAVA 3M8SA 1B9DA 2HHSA 3L8BA 1R0AA 4CEEA 4I7FA 5J2MA 5C25A 1L5UA 3QIOA 4YNQA 1UAXA 4JS4A 4DS4A 1DTTA 4FK0A 1VK0A 4CJ3A 3O4NA 3O3HA 4FJJA 4RW9A 1VSEA 4I9QA 2KZMA 3ZSVA 2G8HA 3K5OA 5KTQA 5J2QA 3QESA 2YNFA 3C6TA 5CY4A 1D9FA 4FZYA 4H4OA 4N76A 1SUQA 2F8SA 5KRSA 1T8EA 5HRRA 4E0DA 1K6YA 4FJKA 4E7LA 3MEGA 3EZ5A 2FC0A 4NCGA 3TR8A 1J5OA 4BE0A 3EY1A 4FJIA 4KHNA 3HPOA 1Q8IA 1NK4A 3NDKA 3ZSRA 4UQGA 3B6OA 4CEZA 1FK9A 4M3XA 3L2VA 4CJEA 4HUFA 4DTRA 3THVA 3QO9A 4CJ4A 1TK0A 4CK1A 2P5GA 3OYNA 1VSHA 3G0ZA 2D0AA 3NBPA 3HP6A 4JLHA 4J2DA 1W9HA 4HUGA 3D45A 1WAFA 4O4GA 3PX6A 1QS4A 3TAPA 2OPRA 3MECA 4CF1A 4BACA 1HQUA
chains in the Genus database with same CATH superfamily
3FMQA 1QQCA 1U6GA 4M71A 3BY6A 2OPPA 2PFBA 1VSMA 4PJJA 4X6AJ 2VKDA 3HOYJ 3WXLA 3I33A 2VT3A 2JT1A 2ZJPL 4WXCA 4ZTJA 2EFOA 1ZBHA 1OH8A 5EJCA 1XC3A 3LWFA 3B73A 4MGRA 4EIAA 3OIPA 3DWLA 3ERMA 5IP7J 3OTOK 5HOOA 3VSLA 1BQNA 2FD5A 1HJOA 4O0IA 1GHCA 4FJNA 3TOBA 5AZJB 4GV3A 4IBNA 4A3EJ 1IUFA 3H36A 3RTRA 2JRTA 1D9DA 4IF4A 4EFHA 2ECBA 3HK2A 5A2QZ 4WQ4C 4DU1A 4MO5A 4ZHRA 2KFNA 3M3ZA 3F8FA 4DV2K 3DI6A 5DUIA 2P9KA 1GXPA 1ASUA 4IEJA 4Z0UA 1QE1A 1OLTA 3U8XA 4UUTA 1TK8A 2R3SA 4V2FA 1E3PA 1LEBA 4JK1X 3LL7A 2FSWA 2VKHA 1E3HA 4AUXA 4HWIA 1N6QA 4E7HA 3OYBA 1E4FT 1HX1A 2ZMEA 2CGJA 3NE6A 3MZHA 1SVMA 3DLRA 1VQ9N 1YLFA 3DXJF 4KFBA 2XY8A 1HNIA 3M5RA 2Z1GA 1WJEA 1S72N 4CEBA 1D8KA 4D1QA 2DDAA 2HHTA 3KKSA 2A3SA 5F1JA 1T2KA 3SCXA 4M3WA 5LGNA 2V9KA 4RGRA 2EA4A 3C2BA 4BR7A 1KAZA 5DM6L 1G3YA 4D7MA 3SEZA 1QNTA 5B3SH 3I4MJ 3F8MA 1CZAN 3DEWA 4BE2A 4DQ2A 3KLFA 1G8XA 3R0AA 2VJJA 3DJCA 4AWXB 5LD2C 2IXSA 4CEAA 3SV4A 3KX2A 4IQJA 4E7IA 1U47A 4LK0F 3OYIA 4BJ6C 1XDSA 4JI6K 3CCRN 4HW0A 1NJIO 2HVHA 3LAMA 2E36A 2R7VA 4DV0K 2AQEA 4E1MA 4J2BA 3J7YP 2DK5A 5C42A 4JRQA 3HTUA 3E1SA 5AQNA 4CF9A 4EATA 4MLEA 4CSWA 1WH7A 3CPEA 4Z4GA 3ULEA 2YHWA 1I5ZA 2R7RA 5GAHJ 3QINA 4LH4A 2V52B 3QOEA 3KZBA 4KIBA 3ZYYX 1X9MA 1RZ4A 1KLMA 3OOPA 3QU6A 5LRRA 4WYBA 2E1CA 3HRTA 3DM2A 3SMPA 3LAPA 4DR3K 1JE8A 1BIUA 4BC3A 1SS6A 4U0WA 1NGFA 5E84A 1U9OA 2JSCA 3SJJA 3RSEB 2MH2A 4J2EA 3LSMA 3T0YA 1K4SA 5LRSA 5FLXK 2EV0A 1X9JA 1TV6A 1T38A 2UXXA 1CZBA 1ZC6A 4HTUA 5FPNA 1Q9YA 3OYAA 3ZMZA 3CMMA 4FETA 1S5JA 3AO3A 4CHNA 4PKHA 2DDBA 4M41A 5FKLA 1FYLA 4BR5A 1L3VA 3ABMH 3OYEA 5FRMA 3AVJA 3OOUA 1ZELA 2Y31A 1ZK8A 4OOIA 1NLVA 5CZ1A 4A3BJ 2BGGA 1S5LC 3BZ6A 2HOSA 2Q1ZB 2PMUA 5CLSA 3E5UA 2V79A 5IT9O 5E1XA 4BKXA 1SQKA 1Y6IA 3DBHB 4NHJA 4X62K 4H0EA 3M3YJ 3QERA 2L02A 2OJED 4K0KK 1H8AC 3CC4N 3HPGA 3ALYA 4E1NA 4IKFA 3LDSA 3THWA 5JVGL 1M1KO 2YR2A 2UUZA 3V8KA 3W3DA 5BN8A 2L4AA 2DXIA 2KW4A 2V1DA 2KMUA 5EEAA 3RYPA 4RM2A 4I7FA 1OH7A 5C25A 4RB0A 4ISFA 1L5UA 1HOMA 4XKVA 3BF3A 3RQ4A 3O4NA 2GXAA 3H9JA 4PGGA 2YNFA 1ZREA 2F8SA 2NRAC 1RRJA 2UUCK 3JRFA 1U9NA 5J4YA 1FK9A 2Q0OA 1EH8A 1UFMA 2BVMA 4NXMK 4O4GA 4BS9A 3MECA 1HQUA 1B1BA 4DQPA 3QP5A 5JI6A 1ZRCA 3DCFA 1XGSA 1NGCA 1KSPA 2X48A 3HYIA 5K1YA 3WTSC 1IW7F 2JGUA 2R7FA 3LFKA 2MSYA 2LRDA 2M4KA 2DFIA 4IX7A 2XF7A 3FZVA 3I53A 4JK8A 1YFHA 3RMDA 3RTVA 3KIOA 1IXSB 3RKWA 1USTA 2HHQA 1IG8A 2VOPA 1KFDA 4A0ZA 3ZLJA 3A5NC 2OQRA 3ZETA 2CQXA 4H0YB 3GYHX 3G4SI 3BCAA 1VQ4I 4EHTA 2ZCWA 4LH5A 3ZRGA 4E7JA 5AQVA 1ETKA 3E66A 3ZSYA 2P9UB 1JLGA 5C12A 3CCMI 2KFZA 1VQ8I 2ELKA 1IV0A 1C6VA 2ME0A 4P1WA 1DDNA 3MKWB 1XN7A 1UCRA 4EGZA 1P90A 4J19A 4DOZA 3U1DA 2W24A 4RAYA 3ZMSA 1K8AO 4M9XA 1ILYA 3TTCA 4BRQA 3M9AA 4KH5A 2QM3A 3HZJA 4XSZF 4JD2A 4B9SA 2RKHA 2P9PB 3R1XA 4F9OA 3DRPA 1NK5A 1HYSA 1WCMJ 3RR7A 3ABUA 2E2OA 3HSEA 1U3EM 3ZMUA 2DK8A 3BTJA 1UB9A 5SWMA 2MA3A 1JUMA 2OAZA 2WTEA 1D1BA 4YFXF 3SUNA 1FKOA 1FBSA 2WOMA 1QHGA 4F91B 1NHAA 2ELHA 1RBVA 4GMJB 1BC7C 1NK8A 3CXCM 5JLHA 4O8KA 3MXMA 2BE5F 5IYCJ 1WJBA 2HBKA 4H0TB 5BR9A 2IS3A 3JSOA 4OIPF 3AGRA 3CP8A 2K4JA 1R5ID 3E9OA 4Y0WA 4CICA 3AO1A 4D0PA 4DYQA 4U7DA 2F4VK 1JLAA 5GINA 2KRHA 4G6DA 4O0JA 1S29A 4NQWA 3WG9A 4Z4CA 4Z4HA 4MHGA 2KIFA 1KA8A 2JVGA 4I01A 3DLGA 1Q7YO 4IG3A 4O5VA 3O6WA 3GZ5A 1FBUA 4FVMA 5AQJA 3QODA 4MFDA 4LY7A 2V1XA 4A57A 3ULDA 4FJHA 1X3ZB 2PMHA 5D6EA 2ELJA 4ELVA 3W3CA 3KEYA 1F21A 5F08A 4O55A 4A2AA 3A5LC 2PFUA 4JI2K 2L01A 2VBYA 2OTJI 1ZH5A 5FKNA 5IY5H 4KDPA 1YW7A 3L7WA 4OJRA 4PJMA 3KLEA 5E3MA 1IDYA 2EIMH 3SZGA 5FKOA 4B9UA 2KFDA 4AM6A 2EWNA 2BZTA 4DTPA 4IL6C 4A59A 3KP4A 3LP0A 1OR7A 5B1AH 4RCHA 4JV5K 3L2WA 2EZKA 2CYYA 2D5VA 3CO6C 2P0WA 1ZG3A 1C1BA 4CIEA 2P9IA 2DOEA 1VSDA 4WCEL 3WU2C 3QAHA 1MNDA 4I2QA 2RV8A 2HB5A 2AXTC 3GFMA 4CK3A 4FJLA 2ZJQF 4L0ZB 4KFCA 3LP1A 4KUMA 2ZKZA 1VQ7N 2E5NA 5L3BA 1GV2A 3D0PA 3C94A 2X6XA 1IZ1A 1P4AA 4RM3A 4XKCA 3H3OB 5M1PA 1SAZA 1ZKGA 2A68F 2LOOA 2XY7A 5C10A 1SFUA 4RMNA 1RUNA 1W0HA 2QK9A 4EZ6A 3EUHA 1SV5A 1MMSA 2COMA 2X78A 5DM7F 3ZSZA 2D1VA 3MZYA 5JLXA 2E1MB 4FW2A 1ERDA 4DKWA 3W0LA 4OPAA 4R79A 2P4WA 2GX9A 4C3IJ 2W82A 4M3YA 1T6DA 3TI0A 2QA4N 1MBJA 4OMYA 4IPAA 4B1RA 2P8TA 4QTRA 4Z94A 1ENHA 1U2VB 1T39A 4BRHA 4EHUA 2QQ9A 3M8FA 3CUQB 1XMOK 3QESA 2O03A 3UR3C 3EY1A 1TWCJ 2V7YA 3B6OA 3M1EA 3PM1A 3L2VA 2IAIA 4RAFA 3G0ZA 5KNLA 2GXGA 2L5QA 4CZLA 2VE9A 3N4QA 4L9TA 2FEZA 3T1BA 2UYTA 4CUGA 4DNCA 5EGOB 4G9ZA 4KKOA 2JWTA 4CVNE 1V4SA 2LSNA 4A61A 1RDBA 4DHYA 3P39A 4ILJA 1RT2A 1E2XA 3QLHA 3E97A 1IV6A 1X3NA 1GVDA 3A5OC 4ZYHA 3ZMDA 3VYTB 2JUGA 4A3DJ 2WY8Q 2LSOA 4GXOA 4BXFA 3EE9A 3H46O 3MEDA 3ISPA 4YOTA 4CI6A 4I2PA 1X9SA 2HZTA 4XQFA 3QYEA 3VF2A 1MNMC 1NK7A 2MABA 3SPYA 1B8IA 5J4VA 2FA5A 4LF8K 4BR0A 1DPUA 1VSIA 3RVCA 1QSYA 2J5OA 4OAYA 3OYLA 4NC8A 1HKQA 1N8RO 1OR7C 4M3RA 4DB3A 5JS1A 3VQCA 5C44J 4W5RA 1VSJA 3WT0A 3RMAA 4RAGA 4YDUA 1NGIA 4KHQA 4JKGB 1GDTA 2XF6A 3S3NA 3WNEA 4JKBA 2NYXA 1C0GA 2LY1A 3CFRA 4BDPA 4CJPA 1W36C 4NLBA 1NG6A 5KHDA 5K5OA 3LSPA 2GAUA 1I3AA 4M6YA 2NVUB 3UIQA 1QHAA 4CHZA 4HA8A 1V5EA 3SBTA 1BUPA 3ONQA 4ZZLA 1HYVA 2YHBA 3EUHC 3M8PA 3RR8A 4DR2K 2HNZA 1WFXA 4YIFA 3VQ4A 3VYSB 5J1UA 1XG1A 3FF5A 1W7PB 4BRIA 4M42A 4DBQA 4B3AA 3TSPA 2Z3YA 4ZYEA 2RKIA 2VQFK 5JFRA 5FJ8J 1VQPN 2RREA 2P51A 3WE2A 3H3ZA 1S1VA 5B5EC 4I6ZA 3W6VA 2Y1IA 3IL2A 2X1DA 1JKQC 1F36A 1ZN2A 4EQQA 4HVJA 2HS5A 1MDMA 4JYAK 3V9WA 4HZFA 1Z26A 2R5ZB 3ZCMA 1G3SA 2BE2A 1Q9XA 4XEIA 4CHOA 4OMZA 3K69A 3ZQLA 3F2KA 3L4IA 1LUJB 3WQUA 4RW8A 4DSJA 4DS5A 3BZKA 1MA9B 1FNNA 3H1QA 1LWFA 4KN4X 1K4TA 4CW7B 4CIGA 2IGMA 4KT5C 1IRXA 3BDPA 4EP5A 2IS2A 1JLFA 1NWKA 3K9TA 3HM5A 2CU7A 3HHHA 1MWKA 2IVNA 2DA5A 4P55A 1I6XA 1YX5A 3QEXA 4CA0A 2O8XA 2QM1A 2DYSH 4OKJA 1SANA 1FSHA 3S2WA 1VQ6N 2CUFA 3CUOA 4JKDA 1QQNA 3OW2M 5BPDA 4XKWA 3PX0A 3BPXA 4Y33A 4JI5K 1VQLI 2PAVA 2HF3A 4NO7A 3H3NO 2X4HA 2VN2A 2H6BA 3QBWA 3HL8A 3GXOA 4FJMA 4LD5A 4JP0A 3CCJI 2GWJA 2CW8A 2HI3A 2EK5A 4DTMA 2EFQA 2R92J 2F4IA 3M1FA 1BGXT 1NNEA 4LIVA 2P5VA 3MQ0A 5CJ9A 4CYDA 4D9JA 4LF9K 3VEZA 5B66C 2EV5A 1EH7A 3ENOA 5GIPA 2HPIA 4EJTA 1MBFA 3V4IA 4MFEA 2QENA 4DCHA 1HF0A 1WVRA 3FWEA 2DT7B 4YFUA 1YIJN 3DLEA 4S04A 3O8GA 3IDHA 2BTFA 2E6LA 1KFSA 4CFCA 3R0JA 1Z6TA 1B4AA 1D4XA 2HHSA 4A5BA 3RDIA 4JX5A 3QIOA 3ML6A 2E2IJ 4RW9A 2E1NA 4JOMA 3JAMK 2YX7A 1P7IA 1V3FA 1YRNB 4N76A 3DU6A 2FC0A 5D8KB 4KHNA 4FWPA 2E5ZA 3H1VX 4Q4ZF 2QQAA 5CE3A 4J2DA 2O8DA 5K7FA 1LPQA 4HRIA 2MD5A 1AU7A 2WBMA 4I98B 3PO4A 3FHZA 3ZSXA 3WGGA 2DLLA 5BRHA 5HL7L 3KE2A 1YTYA 1FSEA 3BG9A 4B9VA 4UVAA 1YG2A 3ZSQA 2ZBKA 4W5OA 3DXKB 1FOYA 1WI9A 5D8LB 3ZEUA 3GFIA 3FXQA 1KVBA 4CFBA 2Z9OA 1FXXA 4BJ5C 3GZNB 4OPKA 2OC6A 1VTNC 4A0XA 3S8PA 5KGWA 2HBJA 5JVGF 2TRTA 1IN7A 1RKWA 2OA8A 3TP3A 4CZMA 1UMQA 1I94K 3TQNA 4WFBL 4BRMA 1DGWY 4ON0A 3SUQA 2GM4A 2STWA 3JW4A 2Z33A 3OR1C 3IKMA 1W1WE 4HBLA 1T3VA 4JKCA 4KJZA 2O8FA 2DCEA 4F3OA 2H27A 2DODA 2A1RA 1UAAA 4CZGA 3THXB 4YOVA 5AQIA 1L3UA 4N4OB 4MDAA 2QWOA 2BBYA 1K6OA 1LWCA 1HNXK 1DUXC 3V7CA 1N34K 4IHXA 4F4KA 4J01A 5HROA 1CF7A 2FSJA 4YHHK 1BR4A 4ILHA 1USSA 3C7NA 1XSDA 3O8MA 2RF2A 4FWQA 5E18F 3FZKA 2YJEA 4JEPA 4CGZA 3G1LA 3CMAI 4CBWA 1SVOA 2CQKA 2OTLI 4CFDA 4XH1A 1QU3A 2GTDA 3IUCA 4EZ9A 4WFNL 2DYRH 1GOBA 4EAHD 2VYPA 1S7OA 1NG7A 2VJIA 4M73A 3U9GA 1VQ5I 1RDAA 1U49A 1ZBSA 3H45C 1VHXA 3HGGA 4PJ0C 5AZJA 1OYIA 2Z1JA 4X0GA 1L3TA 3O3KA 2BVLA 4LG3A 3CF5F 1N32K 3MKZA 2DOAA 3TO9A 3G1OA 2WWYA 3C65A 2KZVA 2OZMA 1Q82O 2P7VB 4Y15A 3OVNA 3QBXA 3WGIA 3SDGA 3AO5A 3HBTA 5TKWA 2GBZA 5D3GA 3HM9A 1TQIA 1KYWA 3N05A 1IJJA 4M3GA 3HI0A 1BJAA 4EJWA 3AVCA 2VJ5A 2M30A 4CHUA 3I4PA 1Y0NA 2Z1HA 2QSFX 3V4GA 1BJZA 4DFPA 1S22A 5B8HA 5M1KA 1R1TA 5GADJ 1YE9A 1WSHA 3K57A 3T69A 2PMZA 2LKSA 2Y69H 1ACIA 2Y48A 5GAGJ 2DMNA 1BN5A 1X1BA 2CO5A 5H6RA 1ESVA 3HJFA 3P31A 2CSOA 3NWSA 3TAQA 4O5FA 2IGOA 5M1FA 4BHBA 3IS9A 4O3MA 3SFZA 4LFBK 1JXEA 4JKFA 4YOWA 4ZDLA 5IP6A 3F3XA 2CGLA 4C8NA 3VF4A 1GLJO 1HKGA 2L54A 2WBNA 2YNIA 3QPTA 1TVRA 3DAWA 4IOCF 1RBSA 2ASPA 3DBRB 3CM5A 1OCCH 1JKRC 1W0UA 2CUJA 3GE1A 3QP6A 5GAHP 1W5TA 5KPZA 2P5OA 2OPQA 1A5XA 2JLEA 5MLCQ 1YTAA 4CERA 3C2GA 3EDPA 4XOPA 5JHUA 2O8KA 4CZKA 4FM1A 3I0RA 4Q0BA 2DPUA 3AY9A 3KK7A 3B8AX 3MEXA 4R1HA 3IFRA 2VXDA 3ZT0A 4JNEA 3ATUA 4RB2C 1R0AA 4RA2A 5J2MA 1WH5A 1TWFJ 3HOUJ 2WAQA 1QGPA 4HF1A 4I9QA 3MCZA 3NEUA 2E7WA 2EFNA 1TQPA 2UXCK 3RSEA 2Z99A 1NK4A 2LNBA 2P5GA 3ASOH 1C0WA 1A36A 2Y2ZA 4FWRA 4MO7A 3DWLE 1IG7A 3E5XA 1TNTA 2Y0MA 1RTDA 1LOTB 4CYCB 3EZWA 4U0YA 3GF2A 2IP2A 1LV5A 5GPCA 4HV6A 4RLFA 2W25A 3VETA 3VWBA 4PY5A 3CJQB 2O3FA 1BA1A 3I54A 5HNHA 4A5NA 3AAPA 2DT6A 3GO5A 1FZPB 4HSRA 4FXDA 4CK2A 3ERED 4JKEA 3QPHA 1Z6RA 3BTIA 1QSSA 3L6QA 4RAZA 1Y8RB 2CH6A 1ULYA 2AXLA 3BQZA 1AA7A 5HLTA 1J54A 1P7JA 2HOEA 5F0FA 3WTYC 4EJUA 2ESNA 2IS4A 1UA0A 4BRLA 2YCHA 1U78A 3S3MA 5M1NA 4IRHA 4G1QA 2FBVA 3F6VA 4XRMA 1ZYQA 4FTHA 4XIDA 3W6JB 2KHMA 2GUIA 1I39A 5EX5A 4DTNA 4E89A 1LW0A 3FZLA 2OQGA 4BGDA 3CJTB 1KVCA 3IRXA 4PQUA 1ZHFA 4B1VA 2XB5A 1ZBLA 1ZLKA 4Z2YA 2YNGA 4QLCU 3VPZA 4W1UA 3IRRA 1SVLA 4XLAA 4N56A 4W5NA 2YKNA 5JS2A 1S1XA 1NU0A 1X1CA 4HCCA 3KP2A 4BXUA 3CFOA 5LMNK 4PKIA 1QZZA 4OVLA 3QEVA 4CJUA 3S2DJ 3M8QA 4CHPA 5HODA 3D2FB 3I56N 3NF8A 4DYRA 2R5YB 1BQMA 1MNEA 3TTFA 3OJSA 2O8EB 1Q81O 4IHTA 3K4MA 4C3JJ 1VQ6I 3WNFA 5IT3A 4AYBA 1IGNA 4E6KG 4YFNF 3FFKB 1KAYA 5LBQA 2Y9ZA 1A6QA 5D5WB 5ADXH 2RAEA 1ZR4A 1XNQK 2FF4A 2ZE2A 1O13A 2PEXA 1JGGA 4ANJA 1TW2A 2UUBK 3N4MA 4BROA 2ID6A 4IHVA 3ZN1A 5HS8A 5HS7A 4CIFA 4PA1A 1ORKA 3K2AA 1B59A 3LWLA 1VZ0A 1H9TA 1ZBIA 3OY9A 3HJEA 1U5TB 4KYWA 4E7ZA 2P9PA 2F96A 5D5UB 3LFUA 4A93J 3A01B 1WLJA 3KLGA 1OJLA 3CQXA 2QCOA 4KPYA 1NJXA 3OR2C 2ASMA 2ISZA 5IWAK 2F5EA 2FUG2 2FBXA 5CPRB 2NRVA 3AV9A 4DLEA 4BQAA 3S14J 4OLBA 5EXWA 2LG4A 4L5EA 3JS6A 4PSWA 2W84A 2ME6A 5LHIA 1DTQA 5A2QK 3EL2A 3DFGA 4BHCA 3PSIA 3V8JA 2QWNA 1S7EA 4LOCA 2OV7A 3DPUA 3H5AA 2F9TA 2ESHA 3CJBA 3NF6A 3SK3A 1Z3YA 3C3WA 4CF8A 4CE9A 4CHYA 2GA1A 2KZZA 3SZ2A 4NCAA 1Y0UA 3B6CA 1FPQA 2PBIA 1OCRH 2DMPA 1EX4A 4CF2A 3AAFA 4MTEA 1KU9A 1E0EA 3BG5A 3GTQJ 3BR5A 1R22A 3V81A 2P9SB 2ACJA 3DMJA 3GUDA 5BREA 1CZ9A 3JRDA 2FE3A 3D6RA 3QB0A 1G59A 4O5BA 3BTLA 1BM9A 3S32A 3K2ZA 2ETJA 2YX4A 4UV8A 3ATVA 4WFAL 2OPSA 2W4SA 4XN0A 4BNCA 2K85A 4BC5A 1KD1O 2DY4A 2O8CB 2CFOA 3DOKA 2LBFB 3NFAA 5IOYA 3FX3A 4A3CJ 3Q7CA 1FP1D 4KHWA 1WBDA 5FDLA 3OYJA 4NXNK 3PIOF 3CERA 5M1OA 3MKYB 1ETXA 3GG4A 4JS4A 4O6JA 1DTTA 2HTJA 4A5MA 3REOA 3GTOJ 3KPHA 4E7LA 1YIOA 4PJLA 5C0YA 4LFCK 1PDNC 3CDLA 5AQPA 4BH9A 3UKRA 1X2NA 4NNJA 4CJ7A 4C2UA 2BW3B 2A69F 3T3FA 1YVNA 5BR8K 4XH5A 1R59O 3S3OA 3PL8A 2LYCA 3QRFF 3BR6A 1R1VA 3VA0A 4H4KC 5AQFA 5BQTA 3HUGA 1UELB 3QFUA 3DPTA 3WODF 4FX0A 2NZTA 4FZZA 3O9SA 4XIUA 2QYOA 1H88C 3O9QA 2G8VA 2QWQA 4DSFA 3KLOA 2EJRA 3KP3A 4YOUA 4F8RA 2CV2A 3O1BA 4XONA 3G10A 4JI7K 3KD5E 3H5NA 2R0QC 2G7UA 2CQQA 1FX7A 1G3WA 2EBIA 3I55N 4LGWA 2GEMA 3VYRB 4GW6A 5I3UA 1WJDA 1OVQA 5ILUA 1K78A 3MAQA 1O3SA 3GL1A 4H5NA 2VIXA 1Z3XA 4JHDB 1MJ9A 1WSIA 3E6DA 1VQKN 2LY9A 3ASMA 5BPLA 2LFBA 3JYTA 1X2MA 3W2VA 3AARA 1V4TA 1HMVA 5K14A 3F9KA 1IN8A 4XL9A 3OIQA 4FYDA 2VC1A 2D0OA 1X4PA 1JL1A 3K4KA 3CTAA 3WHBA 2P7CB 2IT0A 5AQRA 5EGOA 1REPC 1T56A 2CH5A 1RDWX 1J5YA 4DSLA 1XGMA 1LKXA 3LNQA 3DLBA 4U67L 4LITA 1WHUA 1D8YA 2NRTA 1ODDA 3ZT4A 5HRNA 1NGGA 3GTKJ 3VTIA 4I76A 1VAZA 5ICFA 1YXQA 1V4RA 3WTWC 3BOQA 2HEOA 3JAMO 3RZOJ 2K02A 3VEXA 2QEXN 3ZQQA 4EJVA 4LG0B 3CCLN 2W48A 3CYMA 2XPUA 4RWTA 3IRQA 2X1EA 2HOTA 3BC8A 1P8ZA 4WQ5C 1U48A 4BEHB 4DF8A 4WCGA 4B9MA 3BTCA 1G2HA 2OZ6A 2CMPA 3OSGA 1MBHA 4FLXA 2VI6A 3TSQA 3C6AA 3BCBA 3KETA 4CCLA 1N33K 2YHYA 3WNHA 5SZTA 2MYSA 1K7AA 1BO5O 2JVHA 3CCQN 1NKCA 3FXLA 2IVPA 3CJCA 5LLQA 2R7TA 2Q3SA 5F6FA 2BY3A 3LOCA 3V1OA 5I9EB 4X64K 3KK2A 5D4RA 1J7KA 1IJWC 3CCSI 1SFXA 4AHUA 1M1EB 3RYRA 1IN5A 4IO9L 2HXOA 1RTHA 2JQ7A 1JI8A 2BYVE 3EUAA 5ELZA 2P9LB 3GDQA 4K43A 3F6OA 3OYHA 4LMYA 2RNJA 4ISEA 4HQMA 4UB6C 3LM2A 5ILSA 3E0JB 3LSKA 2YHAA 5E8GA 3AVGA 1MH4A 3CC7N 3JRCA 3DLLF 2VL8A 5HVQC 3LZIA 3H3VK 5JR3A 1S6QA 2O4IA 4J2AA 1KZHA 2HTSA 1DT9A 4AM3A 3HHGA 1JJ8C 2EQRA 3AVKA 1N75A 1GLBG 1VRTA 4B43A 2R5ZA 3KWIA 1RBUA 4FLWA 1YS6A 4ISGA 2P1JA 3PO3J 2VKEA 3MCPA 3V1RA 5F1XA 3CDHA 1W97L 4LF5K 2F8TA 3HOSA 4B4CA 1IBMK 2VASA 1S1WA 1YHQI 5TGTA 3SHFA 2CW0F 4PSXA 4G94A 3VDXA 2NXNB 3H35A 5FKKA 3NVKA 3MCAB 4NB4A 3CC2N 2W6LA 4H4OA 3J7AY 1K6YA 1YYVA 2W41A 1VI0A 3LSIA 3CD6N 2DA6A 4M3XA 3QO9A 3EUKL 5CQEA 5KAIC 1JUPA 1QPMA 2R7WA 2XGXA 5F1RA 1KC8O 5AZIB 2I10A 1C0FA 2YUSA 1LAWA 3VN5A 4B9TA 1C0MA 3L4QA 3P7NA 1HSTA 2M0MA 4RGXA 2EZLA 3VODA 4ZJZA 5AQOA 1VQON 2O7OA 2JA6J 2DA3A 4YRVA 1PUEE 4KO0A 1A6IA 2QSGX 2VKVA 4C3HJ 4ENNA 5EZHA 1GVJA 5HRSA 4JI4K 2IGKA 2R93J 3E6MA 3CCUI 1XGNA 3P9IA 2E5LK 4EJOA 4DSKA 4Q5SF 3QETA 2HWVA 3KYDB 5E3LA 1X1DA 1EV7A 2XASA 1LNWA 4C8OA 3ENBA 3T19A 3AA5X 3MDQA 4IZ9A 2P9KB 3IP4B 3SXYA 4QAGA 3K7AJ 4IXAA 1LFUP 3HG9A 5F64A 3OMYA 4DFKA 4QS9A 1O3TA 3KLIA 2HHUA 3CFPA 2R7ZJ 4JI8K 2RC4A 4FK4A 2EINH 1QA6A 2XSJC 1HUXA 5F0CA 1YRNA 2E88A 3BJOA 2E1OA 3QEWA 1I6HJ 2XVCA 1BR1A 3LA3A 3NH0A 4FLUA 1RCHA 4L8RB 2E6MA 2JA7J 3D5RC 3FZFA 5J2NA 4ID1A 4KICA 2RHKA 1DGRM 3ZT2A 3K10A 4A3FJ 1WNSA 2KRFA 1EKEA 1NK0A 3DF8A 5KQ8A 3KWGA 4OKKA 2CWEA 2XPVA 3DXKA 4FOEA 4KI4A 1ZG5A 1Z67A 3BWGA 3HM8A 4AIHA 5BRFA 1VQMI 2XRLA 3GW2A 2V51B 1S6PA 2WY7Q 2O8BB 2O0YA 2HQ5A 1JCFA 2RN2A 1SMTA 2HKOA 2XGEA 4LFUA 3S9HA 3PJRA 2E35A 1J9AA 4ZZDA 2B5JA 2HNHA 3WU1B 4M3FA 2PMZN 3M7GA 1PP7U 4FT8A 2F48A 5EDNA 2IAJA 1YJNN 5AJ3K 3F8CA 2Y1JA 1LVAA 3PFYA 1U45A 1AKHB 3H92A 2IPQX 3ULEB 3A03A 2LTPA 3EETA 1FIPA 3J7YJ 3ZGKA 2DPDA 2QWLA 2H09A 3GFJA 1VQNN 2K4BA 5FPDA 5FGMA 4DTOA 2ZC2A 4G7HF 3TTDA 1GOAA 3RWUA 1B9FA 1SAUA 3CJ1A 3IH2A 5TJJA 3EKSA 3F5TA 3IMXA 2HU9A 3LSHA 3NGYA 3GTMJ 1PP8F 1UZCA 1HPZA 1WGXA 1XNRK 2WUSA 1R23A 3VERA 3PX4A 3BLYA 2DJIA 4IVNA 1KTQA 1TBXA 5F0HA 3TEDA 4M9SA 2F9WA 3Q0WA 4DQIA 1IAWA 4BQOA 2MGQA 1Z05A 5T7BA 1JLQA 1D3YA 3HVRA 3KK1A 4DR7K 2WAQN 3L3VA 4FPAA 1JKOC 1SL1A 2PZSA 4M63C 2L3DA 2K5CA 1C1AA 2FLOA 3V7RA 2E2HJ 2UU9K 4PDKA 4FW1A 3G71N 3DRSA 2J4RA 3ROUA 2NS7A 2MC4A 4ZDPA 3BY5A 5E3OA 2VBZA 3KZZA 4GV6A 1OPCA 1XMXA 1RTJA 4N9IA 3TWHA 4BY1J 2M4GA 3A0HC 4I9LA 1SEUA 4ESJA 5GADP 3H5RA 3HRUA 2P5KA 4M72A 2DA1A 3JREA 5AQGA 3WGHA 5GAGP 2FSNA 2IEKA 3L8BA 3H9QA 3K4JA 3Q0VA 4YIIA 4DS4A 2DMUA 1VK0A 1VSEA 5KTQA 5J2QA 1R00A 3ENHA 2OA4A 5BN9A 1SUQA 2JWKA 3HPOA 2GELA 4CEZA 3HRGA 4HUFA 4X66K 5L3CA 1YITI 4FE7A 2F6CA 3PX6A 2WC2A 3VQPA 4NYFA 2E7XA 4OWRB 2W57A 1T6CA 3SZTA 3KYLA 2JA5J 4N41A 2E8AA 1Y8QB 1Q1VA 2LK2A 3C2HA 3VMFB 5DS9A 4ZTFA 3NAUA 1A5VA 4HNTA 4PUSA 2X6OA 3R3LA 1HKBA 3GVAA 2LP0A 2QVOA 5LJWA 2H94A 4I7HA 1Y1WJ 1L0OC 4XRSG 5E41A 3PFIA 1R49A 3DP7A 2A1SA 1O7LA 1IH7A 3SJMA 2NS8A 2VOOA 1JTYA 3OHRA 1QRYA 3TAMA 1ZYRF 1J9IA 3QQAA 4B3RK 3BR1A 3F9MA 5A2QO 3CMEI 3HZ6A 4H4MA 4AVZA 2M0CA 3I0TA 4GYGA 3NF7A 2F4MB 5CVIA 2VWBA 4RS8A 1QQIA 2HF4A 1CLQA 1YJ9N 1F9NA 2XAFA 2B7EA 1BU6O 1H9GA 5FO5A 4D5FA 1MD0A 1FKPA 5D4SA 1I1GA 3HEFA 2IBDA 1P9QC 1ATNA 3WG7H 4AYBN 4MFBA 3O3GA 1XMKA 4CCJA 1JL2A 4FWOA 4HX8A 5HP1A 3IC7A 3AVLA 1SL2A 2O4GA 3ULQB 2UXDK 3K59A 2DTZA 4IQ4A 3K1PA 3LDQA 3RMCA 3HSCA 5CVVA 4BRNA 1DKGD 2JJ7A 2MD0A 4CYCA 1BIAA 3TABA 3OV8A 1JLBA 4HCBA 2WADA 4N47A 1HCRA 4FLZA 3MN7A 5M5WJ 4F2SA 3K5LA 2KZGA 2FX0A 2IS6A 2HDWA 1O3QA 3R8EA 4D5CA 1WJFA 4IFYA 1SFOJ 4CZEA 4WK8F 1RNLA 1XUPO 1D1AA 4CBUA 4KHYA 2WAFA 4KHSA 2R7XA 2WA0A 3C1DA 1QBJA 1EJ9A 2XY6A 4YY3K 4KIFA 2AHQA 1A5JA 3A8YA 2AP1A 4AF1A 4FX4A 1MSFC 2ZMEC 3A0IX 3B6AA 1GV5A 1NM1A 5CR4A 2UXNA 1RNHA 5H20A 4OIQF 1KQSM 4CD3A 4KH4A 2E2JJ 4QS8A 3FXOA 4E3SA 3R61A 1R5HA 1GLNA 1ZTRA 2HXIA 3CG7A 3TO7A 1FIAA 3K5NA 2XUBA 1BG3A 1WI3A 2WTUA 2GOMA 5KPRA 1MBGA 2V26A 3IG1A 3I4NJ 1FLIA 2M1BA 3L09A 5M5XJ 2HVRA 5J40A 2OUMA 3SUPA 2CUEA 2QWPA 2QXLA 3TP0A 4XBFA 4CGGA 3OIOA 3EYIA 4ENKA 3OBWA 3I58A 3MD2A 3KZIC 3PUFA 1SKRA 3JSPA 2LREA 1OCPA 3D2FA 2R5YA 3SDBA 3CF2A 4FJ5A 2YI1A 4EM0B 2XC7A 4QWQA 3WTXC 2NUBA 4M3UA 1KRPA 4Y1DA 1CXQA 1DLOA 1MMGA 1S3JA 3KEQA 3FBNB 4AHRA 1V54H 1Q1HA 4FSVA 3HT3A 4ITVA 4DV1K 1NGHA 3LP2A 1I27A 2F5CA 1YVUA 2H8WA 1HKSA 4OPHA 2GWRA 3H08A 1VQOI 1ZRDA 2NRRA 1OYYA 4IJNA 1EWQA 2D4WA 4A3IJ 4DTSA 1BA0A 4EEFG 4FLYA 4P96A 4OLAA 3R9PA 2VG5A 1U5TA 4H03B 3CF5L 5EG0B 3KK3A 3AL0B 4V2GA 4B3OA 3A01A 3BP8A 1G99A 4B3TK 1YOVB 4IO9F 4ETSA 2QUFA 1ETYA 1IC8A 5LFAA 4FJJA 5HS9A 3M07A 3HSRA 3LDLA 4E0DA 3MEGA 1J5OA 1GUUA 3FMSA 2KKZA 4FJIA 3DTKA 4UQGA 2ZGYA 4U0VA 2XRNA 4CJ4A 1TK0A 3OYNA 2NRWA 4BYYA 4HUGA 4HTLA 3D45A 1DU0A 2M7BA 3WUHA 1IBLK 3LQQA 1RFQA 4BACA 2P6TA 5BMZA 5EEHA 2HQNA 5J1YA 1GLEG 4HX4A 4RGUA 1WRJA 3U9DA 1T03A 4GKJK 1BI4A 3AAQA 3GTLJ 1N78A 2VWKA 4CZZA 5LHHA 1ETQA 3CCEI 3SFIA 1G3TA 4IOAF 4DTXA 4UY8O 4DTJA 4G12A 3LDPA 5LJVA 2P9SA 3KYCB 3TARA 4CESA 2X85A 1RIOH 1UOCA 4BRAA 3AG2H 2M7AA 1R7JA 4H0OA 1U04A 1W4MA 1PUFA 4DJAA 2ZXJA 4ZYAA 4DUZK 3WTZA 2FOKA 3KKRA 4EGYA 4CZFA 2LD5A 2KJCA 3WTTC 1RETA 3VFZA 4FVUA 1B8IB 1ZR2A 4BE1A 1RBRA 4CF0A 3SUOA 3BEXA 4IOCL 4CCHA 3J7AO 2RQPA 5HLFA 3BDDA 3ZQ7A 3QDKA 4FWLA 1K8KB 3O2PE 1FBQA 3THYB 1XTAA 1BCMA 4Y3OA 2A6AA 2A41A 1A04A 4K8XA 4IJAA 1DP3A 3BG6A 3KHYA 3DV8A 1JT6A 5C4XJ 4LF4K 3F21A 1ZBFA 1FJLA 4D7NA 3OA9A 4HLXA 1IN4A 1XCBA 1AWCA 5AFUA 1T08B 2K7LA 4JBAA 2BW3A 5H6QA 2GQQA 5CVRA 4YFKF 2ISYA 2JN6A 1WUAA 3DXMB 1JHHA 5HDKA 1MBKA 3SAFA 3ZSWA 1T6SA 5E20A 5AR0A 2LVSA 3K4NA 3IH3A 2HW3A 2WV0A 2B4JA 2G8UA 1SD7A 4FL9A 4FK2A 4GCVA 1OCOH 1R4MB 2PLYA 1Y64A 4DG1A 3O4WA 2BXYA 3K0SA 4BU2A 3OYFA 3MVPA 1XX5A 2HNDA 4ICLA 1MU2A 2K9MA 1EETA 5K5QA 3VQEA 1P6RA 2L9SA 3R60A 3AVAA 5E26A 4LK1F 2JTVA 4BQQA 3CP2A 4A2BA 2I5JA 3I0SA 5JHFA 1YI2N 2KT0A 4HF0A 4AHTA 4OX9K 1ZXOA 3QU3A 4B3MK 2EZHA 1QTMA 3RIRA 2DQRA 4XLEA 2FBKA 4EP4A 5AQXA 1RDDA 2RN7A 4IZZA 3QNOA 4Y13A 4RGSA 2PY5A 4A5AA 3AVHA 1XWLA 4CJKA 3LAKA 4F3TA 1KLNA 1WWXA 1YF5L 4RBOA 1FTZA 3FHNA 1I3QJ 4OGEA 2DA7A 1ITGA 2GXBA 3KJVA 2PG4A 1IV8A 1XSXA 2G0EA 1FT9A 1VFCA 4C8KA 3G4SN 1D5AA 1VQ4N 4FM2A 1VQ9I 3G73A 1RT4A 4E4HA 3RZDJ 1AHDP 4ZYDA 1EH6A 2PQ8A 2V9PA 3GZ6A 3R6MA 4DFJA 3CCMN 5M5YJ 1W5CC 1S72I 3TDUC 1R71A 2KPMA 3FIWA 1FWZA 3VQ8A 3QIPA 3TO6A 3LALA 1QSLA 2A05A 2VQGA 1RT7A 1JCGA 3ZQHA 2QQ8A 4ZH4F 2Y30A 4E1JA 4PK4A 4FZXC 2XAHA 4DFMA 2OZUA 4IOXA 4BEHA 1NJWA 1T33A 2BANA 3PIPL 1LB2A 4YG2F 3F73A 2Q31A 3PV8A 3D7EO 5EOYA 2CGKA 3LSRA 2VUMJ 4BDZA 2GIZA 2A5XA 4UVBA 5LEJA 3MX5A 2YX6A 4HV5A 3A4CA 4MTDA 3TL4X 3QICA 1PJRA 3CCRI 3LM9A 4KB1A 5J8CA 5FFXA 1KXPA 5D6FA 3VESA 4WQ4A 3ABLH 1SFKA 3VOEA 1SD5A 1LQ1A 1ZGJA 1LFBA 2TDXA 3TR8A 5E1WA 2P9LA 3ZSRA 4AIDA 1GLLO 4EVIA 3O9RA 1W9HA 5J6XA 2O8DB 1NMNA 2V1UA 2XV4S 3OS1A 3VB2A 3S1NJ 3LSTA 3L9FA 5C4JJ 1RBTA 5LEKA 1WSFA 2G7HA 3DEEA 5J47A 3IKVA 2E34A 3ZQIA 3WXMB 3P83D 4OU0A 3MK6A 1J09A 1HNWK 1FEXA 4P9FA 1NK9A 4H0PA 3CO7C 3CI5A 3FMRA 4Y52J 2D0BA 2OTJN 3A5MC 3AFHA 3CETA 2D5RA 3SMSA 3BJ6A 2LKXA 2EA2A 5EVZA 4K42A 4GV9A 4BRKA 4G6TB 5HDNA 4H0VB 1UG2A 3UKGA 1JJ2M 3FK6A 2N8GA 4HOBA 4Q47A 1LCUA 1OKJA 5F2RA 2O8FB 1FOKA 3O9UA 1K73O 1MZBA 2GOXB 5KGXA 4HHTA 1WBBA 2EPFA 4DF4A 2K3FA 1UHSA 3CC4I 3S93A 1YQAA 2Q2EB 1GOCA 4HLYA 4CEFA 3ZT3A 4IWVA 1ZQ3P 1RTIA 3ZQFA 1VRUA 4H5RA 1F4KA 5KRTA 1R9TJ 5AZIA 4LIUA 4B1YB 3DYAA 3PIOL 3E6CC 4CCKA 1X9WA 2VWJA 3SQ1A 1U4BA 3HOTA 4R5PA 4HNVA 1XC9A 5DD4A 2KKOA 3J7ZO 2KQRA 1R6RA 1TLHB 2ZNYA 3P38A 3NMUA 2E2QA 3ZR8X 3V9XA 3BT9A 3LL3A 4BY9C 2ATQA 3M1CA 4S0HB 3ZXSA 2PJRB 2X0LA 4BHPA 1CQTA 4O44A 2IIRA 5E79C 1B72B 1KONA 1OKRA 4A0YA 1FOWA 4AC0A 1BOTO 2ZO4A 1SL0A 4YDUC 3JTGA 3VQAA 4FLVA 4Q5VA 2L7FP 3EEQA 5FPEA 4M3ZA 3AG3H 3HKZN 4A69C 1BI0A 5BPNA 1LEAA 1LE8B 4DQ8A 4ESFA 2BY0A 3OL4A 3VQ7A 1S9EA 4PZJA 1IXCA 2L7MP 4JI0K 3T1HK 4E19A 1XMQK 1Q86O 4PFOA 5L3GA 3WTVC 1YAGA 1EF4A 3NARA 1MIJA 2VG6A 2R7SA 3CDIA 3MFKA 5GAEP 1PYVA 3E5QA 4DU4A 3HSFA 1JJ6C 3AVFA 4KAZA 3SEQA 3O80A 4JYKA 1Z0XA 3F0CA 3VYUB 3JTHA 2UXBK 1FJGK 1RI7A 4C2MJ 4WE1A 2A42A 1JCEA 2XAJA 3BF1A 1TUUA 1WSJA 5JICA 4GRIA 3Q3SA 2P9NB 1F43A 3EN9A 1J6ZA 4DUYK 1UHMA 4P9UA 4CGFA 4W5TA 2BHYA 4G7ZF 2ZFUA 4JRPA 1JXSA 2AJQA 2L9VA 4LSLA 4B09A 4M6XA 2ZM6K 3UB5A 2X6YA 2EHGA 3NGZA 1BW6A 4DYCA 1O7FA 4JAXA 2O8BA 3CMYA 3P1GA 3GEZA 4WWCA 4I6MB 4UUSB 5KAFC 1QPIA 3CCVN 3SI6A 1HQCA 4XORA 1FP2A 1HW2A 1YT3A 5IT9Z 1TAUA 4YEJA 1X4OA 1IBKK 2VONA 4DR4K 2PBDA 4B1UB 2MH9A 4GGGA 4B48A 4F92B 3L0QA 1N25A 1T7PA 1J2XA 2GA2A 4UXNA 1MKMA 2K9LA 4JS5A 3BR2A 1TYQB 1JGSA 1AKHA 1DPRA 1TP4A 1WSEA 4CJ5A 2YPRA 2KTQA 1D0YA 1BI3A 2DMQA 1IKXA 2HZDA 3MWPA 1WB9A 4M3BA 2CFXA 4AHCA 1YO5C 3K70D 2HOAA 3SQ0A 2C6YA 2XKOA 1EQYA 3CJRB 2DFHA 1B9NA 5M3MJ 2XHBA 1LAVA 1B9DA 3RPUD 3CJNA 3JR9A 3FISA 1TTYA 2JPBA 4M7XA 3ZSVA 4LJZF 4BRPA 3C6TA 5KRSA 2ASOA 3JRHA 3BPVA 4G6QA 2QBYB 2D0AA 1J5EK 4KHPK 2Q0RA 1HLVA 2EIJH 4FHTA 5BPMA 4PHTX 5HLHA 3MWMA 5ERIA 4IRIA 1T0FA 2DTUA 5KPTA 2V6CA 4YELA 4HPQA 2A61A 4Y7NJ 3WEEB 4J8FA 1SAXA 4GVMA 1W7PD 4N5SA 1Z9CA 3Q5FA 2QKLB 2DU9A 3O9TA 3FE1A 5IP9J 1TT5B 5DMRA 2NLXA 4MQ3A 1QO0D 2HQAA 1S8NA 1TQMA 4C8MA 4B9NA 3I64A 5EY4A 2DQLA 1R4NB 3K1MA 1LWEA 2FNPA 5AQSA 1WSUA 3V1QA 1LDDA 5LY3A 3L2CA 3WQTA 1IUYA 2L9RA 2LY2A 4ABZA 1VQ7I 2HVSA 2CV0A 3DLLL 2AQFA 1K61A 3JCUC 5GPAA 1SD4A 2Q36A 3P9KA 3FM5A 4OIOF 2HHWA 3SYZA 4A3KJ 2V1NA 1KU3A 4B1XB 2ZD1A 3K2PA 5C2DA 2R7YA 3DTEA 1YX3A 4HUEA 1IXRC 2LC2A 2CQ7A 4IHYA 2BEOA 5FLVA 1NGJA 2GV9A 2KLOA 4BRDA 5CVUA 5AQYA 1YI2I 4AIKA 1OFCX 4KIGA 2QA4I 1VQLN 3M8JA 2IOCA 4DSIA 3DBLB 3MXJA 1XCVA 3X2QH 3VEPA 3M8EA 1H0MA 4XOTA 2IVOA 2HR3A 5J8FA 4M3TA 3CCJN 2QLZA 4KREA 2CG4A 2RVCA 1IF1A 5C15A 5LGUA 3HPHA 1XGOA 3FLCO 2FRHA 4V19K 4KRFA 5KK1A 5JLWA 4CGJA 2JA2A 1B9MA 4AHVA 3M4OJ 5CVJA 3VEOA 1MMNA 3S1RJ 5KQDA 3VF6A 3VEVA 3FXRA 2LKPA 4K2EA 2HDCA 2EX3A 3O8HA 3Q9SA 5D5XB 3HIFA 3LAJA 4E7SA 3Q0UA 3AVBA 5C3EJ 3NWTA 3VPRA 1RILA 3CCYA 2FOWA 1NOZA 4B9LA 1UHWA 2H3GX 1IRGA 3D1NI 3BGRA 2NRXA 1T0FC 4DMNA 5K5RA 1O57A 4CZHA 5DK5A 4W97A 4BWMA 3ESWB 1QQOA 2FF6A 4M3EA 2EFWA 2JA8J 1WN7A 5AQLA 3PQJA 2W40A 3SAHA 4M3DA 3MWTA 1UJ8A 1RT3A 3Q9VA 3O6BB 3E9LA 2HNYA 2K9QA 4BRGA 3O3FA 2IGIA 3F8BA 1YW9A 2B63J 5M1QA 3U1KA 5AIQA 3RI4A 5L3EA 4FWMA 4C30A 2I8DA 5FROA 2M5WA 3F22A 4A3MJ 4CJQA 3S1MJ 5DDGA 1NKBA 3C6UA 1E3OC 3VGKA 4KB0A 3D2EB 4H5VA 1QZYA 2DPNA 3K0LA 3HSTB 1X1AA 2DO7A 4B8XA 1A35A 4XKBA 4PGHA 2ZXHA 1KU7A 1U0JA 1XSVA 3OYGA 3A02A 3C0BA 5AQUA 1Q18A 3GCMA 5GTHC 3HRSA 3OYMA 3B6PA 1VQPI 2XKPA 4FJGA 4A3LJ 1M90O 3EKUA 2FMYA 1HW5A 2STTA 2OYQA 3CMAN 3QOPA 3I3LA 2OTLN 1IKWA 3M8SA 2ZSIB 1NK2P 1UAXA 1SZ2A 4CJ3A 3GOIA 2PN6A 4BJTA 4JK9A 1OQYA 5JVHL 2FMLA 2QKMB 2Y75A 1VSHA 1VQ5N 2E71A 2ETHA 3UKRB 1QS4A 4BXXJ 3TAPA 4CF1A 1RPWA 2K40A 2KP6A 2FNAA 2HHHK 2DAOA 3HO1A 3DKWA 4FE4A 2VQLA 2F7TA 2LH9A 1RGIA 3FM3A 4KTZA 4L0YB 2A07F 2HMPA 3O1WA 3HUGB 5DCMB 4BUPA 1NGAA 4XLHA 2G8FA 3PIPF 1R58A 1R1UA 5HDGA 5KCMA 2NVQJ 3U4LA 2JPCA 3GBTA 2A5YB 4CXFA 2W1OA 4IEIA 1X1PA 4L9JA 1L3SA 2XROA 1V5GA 4UV9A 2X6WA 2P9UA 1LFPA 4KTWA 3SQNA 3RPQA 4CGDA 2YSRA 3QPSA 4CZJA 4U87A 5EG0A 1K78B 2IA2A 2DOFA 1APLC 1HKCA 5DYMA 4BR2A 4A6DA 1HR0K 1H89C 3BUZB 4LFAK 2CS3A 5CYQA 2IA1A 3R6SA 3BQYA 5ICEA 3KVGA 4G7OF 4FJ9A 3HOZJ 4N4NB 3HB9A 1WJAA 4KBOA 4XLNF 4PWDA 5F04A 3KD1E 2ZF5O 3AA3A 2HVIA 3U2RA 3FR0A 1TKXA 5LL6Z 3K6GA 1HPMA 1YIJI 2EB7A 2QTDA 4I2OA 1S1TA 1K83J 1JKPC 3BJAA 4CBXA 2WAEA 3NQOA 4LD0A 3FFIA 1TL1A 3T8RA 2KQ2A 4BGAA 2GWKA 2HHXA 1JKHA 4HDUA 4KT6A 1CGPA 3AVMA 3AKZA 3TDZC 4U7BA 4KV8A 1MJBA 3S41A 2XHKA 5DTDA 3DOLA 2V9VA 1ZGAA 1BOAA 1NG9A 1YJWN 3GBGA 3WU0A 5BRDA 4NB5A 4Z6YA 1BC8C 3AVIA 3K58A 3V6DA 1FTTA 3H6EA 3SNNA 3H9GA 3H0GJ 3MX2A 1E3MA 4HSTA 3N4PA 2LLKA 3ZCOA 5E1ZB 2Y0SA 2ZQBA 5EEGA 1ATRA 2UWMA 3GX4X 1OMIA 2HGCA 4HYEA 5ED4A 3CPWM 1B6AA 3HTVA 4CCMA 3KP5A 1K9MO 3CCVI 4CJFA 1WPKA 3NAEA 3PNYA 2KIUA 3QEPA 5D5VB 3IH4A 1HNZK 2DJNA 2CQNA 1K8KA 5ICCA 4MDBA 4MNUA 4HX7A 2VGMA 2D0CA 3THYA 4IRGA 3SPZA 4QPOA 1V55H 1QZ5A 3MKLA 1J59A 2VQCA 5HNFA 2L4MA 3G3ZA 3KCCA 3RKYA 4NDLA 4BR9A 3EYZA 5AQMA 3K4LA 4M45A 3GLLA 2I7NA 1U6ZA 3TSUA 3S17J 1OH5A 1D1CA 3CJAA 4LB6B 4MEYF 4C1NI 1FY7A 2ZJPF 3IKTA 4BDYA 3NF9A 4JQFA 3DXMA 4GO1A 3JRBA 1W5SA 4DZJA 2E2PA 3ZQCA 2KIQA 3BG3A 4AVPA 3PY8A 4CDGA 1BOBA 4Y1CA 3KZYA 3V42A 2NRZA 2A6HF 1MMDA 3G6EN 2YU9J 3T1YK 3U3YA 2DBBA 1TAQA 2VQHA 5K7ZA 3AGKA 2ZJ2A 1D0XA 4C9YA 1T8IA 3M6GA 3AL0C 4CJRA 3MAJA 4BY7J 2GUPA 1SKWA 2QWWA 2L2OA 1TKTA 2MBFA 2B9SA 3ECOA 1TGOA 4BC4A 4M7YA 1BWFO 4XRSA 3W2AA 1XHZA 3A2KA 1I1SA 3VTHA 3LSJA 2PX9A 3GTJJ 2HFHA 4GKKK 2DT5A 3GMEA 3AO4A 4IDKA 3L2QA 2CW7A 1J75A 4H0XB 1U2WA 1Z7LA 5JMVA 2FU4A 5LGTA 4FWNA 2A3ZA 3VEYA 2NVYJ 1NTCA 3V9SA 4C8LA 4CEOA 1XD7A 4G9YA 1U2VA 3IAM2 4FK0A 4LLGF 3TU5A 2VQEK 3CUQA 2X51A 2ZNZA 1S9HA 4NCGA 4BQNA 1Q8IA 5DM6F 2D1KA 2NOJB 1ITYA 5FLMJ 4OINF 2X1CA 5F0XA 2W00A 4JLHA 1WAFA 2VC0A 1TL8A 1KQ8A 1S6LA 3K4BA 2H6CA 3OL3A 2WB1A 1QZEA 4UNOA 3QNNA 1WSGA 4AH9A 3ISNC 3OYDA 1LW2A 4DV3K 4CJSA 1MH3A 2ZXWH 2E4LA 3ZQGA 4Y4RA 1E17A 5DUKA 5K7HA 3HOWJ 4DGWB 5TISC 3A0BC 4AHSA 2IRFG 4JX4A 4IDHA 1NOYA 2HMIA 2VB6A 1MWMA 3IAYA 4B8AB 4Y17A 4ENJA 1X19A 2OU2A 2GZWA 3HXMA 2HDDA 2A6TA 3HRMA 2DA2A 4DV7K 2A5WA 5FLXZ 4PL8A 4E70A 3CQYA 2F5VA 4RW6A 1PVEA 5FD6A 3TANA 5DCFA 3VENA 2KRCA 4XR6A 5GIOA 3O5BA 4ELUA 4QSHA 1QVFM 5LMUK 2HVQA 4HG2A 4JKGA 4I0AA 1TNSA 2ZB9A 1FC3A 3KEOA 1X3MA 1O1WA 3V7SA 2E19A 3CIPA 1QVTA 1ASVA 2M34A 1HJRA 3RPUA 4QPQA 3EYYA 3BZCA 5CYMA 2CH0A 1MW7A 3OSFA 5FB2A 1IO2A 4BRFA 2YU3A 4FOIA 4QCLA 2Y9YA 1XQSC 2K27A 2M87A 4DQQA 5AQKA 3HVTA 1XI1A 4G8XA 4CJLA 3B02A 4DR1K 3I8BA 4IEEA 4QS7A 3I9V2 2PYJA 3DKYA 3HGYA 1EWRA 1P92A 2Q1NA 1EO1A 4F52A 2HKXA 3VQ6A 4AM7A 3HP9A 3PLAA 2XAUA 4BG8A 2OZSA 4PJNA 4J00A 3A2FA 4F93B 2E1MC 1ZGWA 1W7PA 1HQEA 2XGDA 3I59B 4ZDOA 1RT5A 2ADUA 2K9NA 4HQEA 3L1PA 5EU7A 2G8WA 2L7ZA 4GVEA 4AIJA 4Z4EA 2KDOA 2IDOA 1TUYA 3NH2A 3LA2A 1QHHD 4B47A 2TCTA 2BV6A 4PKGA 2RNGA 2ZJRL 1AOYA 3QFPA 3ECHA 4BG9A 3JRAA 5FLXO 4B08A 4IOAL 3GTGJ 2YJFA 1SC7A 3CUQC 2V4JC 3FK7A 1MGTA 2FXAA 4KHUA 2VBWA 2HQRA 1HA8A 4KISA 4WXHA 1OCTC 4CGIA 2NRHA 4KN7X 3HDDA 3LANA 5AQWA 2KISA 4CJWA 4U88A 2OD5A 2AS5F 3SYTA 3OYKA 1BIZA 4GFBA 1C0TA 2M45A 3KLNA 2YKMA 5DEQA 1GT0C 3LP3A 2Q2EA 4OGCA 1N36K 4BWJA 1UG0A 1GLCG 3AVNA 3FGUA 1WJ5A 2LR8A 1QVUA 4UY8I 3VA3A 3ZN0A 1X58A 3TKYA 4L9NA 2LMDA 3ZSOA 4ENMA 1VNDA 3UKUB 3ASNH 1Y97A 3HC7A 3N97A 3J7AP 4A3GJ 3PNTA 3E01A 1TK5A 4FM0A 2O61A 4NLCA 5B1BH 2YHXA 2FBTA 4XICA 2PJRA 4H5WA 3NVMA 4JK7A 2XPWA 2ZXIA 1B72A 3WE3A 3DEUA 1Z7UA 2XF5A 3MZ8A 4BBRJ 3P9CA 3C18A 3J81K 3K70C 5KI6A 2YNHA 3I56I 2P5LC 2FBIA 4OAZA 5TKYA 3TAGA 1Z1DA 3G25A 2DA4A 1LE8A 4A6EA 3L2UA 4CECA 3CHWA 2F2EA 2M9HA 1FMWA 2G8IA 1OISA 1NKEA 3MXIA 1Y56A 2M8GX 4Z4FA 1TL3A 2L7KA 4KH6A 5ICGA 4CZIA 1REVA 2GBYA 3JSMA 2E1YA 3FZHA 2QW9A 2O6GE 2ZSHB 2L9NA 2P9NA 1RR8C 1FYMA 2OPTA 4BE0A 2ZMEB 4K25A 3NDKA 4Q48A 1F1ZA 3CESA 1XS9A 3HP6A 4EMSA 4I09A 1D0ZA 1P4XA 1NGEA 2W7NA 2VODA 2YV0X 4BL0B 2DI3A 4JKAA 2QXFA 2JSPA 2PI0A 2H8RA 3WXJA 4M9ZA 4BC2A 4AU7A 2VG7A 1ZG1A 1NMDA 3MN9A 2V7FA 6PAXA 3VGMA 4I6MA 3FXUA 4UUSA 2Q0UA 3ID8A 3J80K 4B1ZA 3NRVA 5TRDA 3K9JA 4BQLA 3ZMTA 3TAEA 3BROA 4CZCA 3ABKH 4DSEA 3CM6A 1YJWI 1C0UA 2XB0X 3OYCA 5FD5A 3F8NA 2DFEA 1ETWA 1TYQA 2QWRA 3CQ8A 1RC9A 2WFBA 2OCEA 3KTQA 4A62A 3CLQA 5C24A 2M2EA 3BR0A 2B0LA 2CV1A 3ZX0A 1OH6A 2KL4A 3LDNA 4CHQA 1EP4A 3D0SA 3CCSN 5J1EA 4DV6K 3ZPLA 3THXA 4CFAA 2OF7A 1VSFA 5E17F 1T05A 1HLUA 1HC8A 3CJ9A 2WV1A 2V7ZA 3RQIA 2KHOA 4YORA 5EYRA 1Z91A 3K5MA 2Q97A 5AQQA 2MFZA 2XAQA 3TW6A 2QBYA 4B44A 5IYBJ 2ZWHA 4FLTA 1MJAA 2AO9A 4I02A 1F5TA 4RB1A 3OJUA 1NK3P 5C2FA 4KI6A 2EIKH 3WEEA 3HKZA 4N9HA 4LF7K 5FPMA 4X1EA 1BISA 5HRPA 1BA5A 1N77A 2F5DA 4IXCA 4CH7A 4R8HA 4XNFA 3FBIB 4CD1A 4E7KA 4W5QA 4IFVA 3KLHA 4CJTA 3LZJA 1RDUA 3FDYA 5IOZA 1X3WB 1JTXA 2RPIA 2D1HA 3C6HA 4Z4IA 1B92A 3QWLA 3EO3A 3G6EI 3IUOA 3ZOBA 4DR6K 4XK4A 1YHQN 1Y39A 2XY5A 4B3XA 3BG7A 2R7OA 5ADXA 4H8KA 4XLFA 4BBSJ 5BPIA 4M74A 1S3XA 4HEA2 1CXUA 3L00A 2MLKA 3THWB 3IWZA 1HDDC 2ICWG 2Z1DA 1XPXA 3DRRA 1BW5A 3E1YA 4RG8A 2JK3A 2K86A 3AG4H 3MEEA 4PFPA 3OS0A 1TC3C 1D8JA 2ECCA 1SKSA 3I55I 1LVKA 2ZGZA 4GYIA 2HHVA 3LWMA 3IHUA 2D0PA 2COBA 5J2PA 4UB8C 2O5RA 3KP7A 1R5GA 2I7PA 1VQKI 2BHZA 1FYKA 4KMFA 4IG0A 3PO2J 4ZYGA 3RCOA 2K9SA 2BDPA 4BREA 4ID5A 3P5JA 4XLCA 4F7ZA 2KDZA 3CCUN 1WQ2A 3RJPA 3LMMA 2D45A 4DQSA 3MN5A 4AD9A 3AO2A 1TWGJ 4IHSA 3J8AA 2I5UA 1H1VA 5EZGA 2BXZA 3OBYA 2FSKA 1ZARA 4CJVA 1G4DA 5HLGA 4V19S 1QVGM 3K4CA 5AIPA 2D2WA 3ZT1A 4PCQA 1XC5A 1WAJA 3ZETB 3LPTA 3DPLC 2NNNA 3U21A 5CZ2A 5BS6A 1HNVA 1KQ0A 2KIMA 1IN6A 2QKKA 3WHCA 2BH1A 2HPMA 2LF7A 1IKYA 4L3QA 1MMAA 2QEXI 1D5YA 3CCLI 2XGCA 3DQVC 2IS1A 1Y1VJ 2Z1IA 1MBEA 3J7ZI 4B9QA 1KQ9A 3MN6A 2BUPA 2KJBA 4C1NK 4YNQA 2F4OB 4JD2B 3FXKA 2KZMA 1TW3A 2ID3A 3K5OA 3E3VA 1D9FA 4FISA 4MIMA 1T8EA 5HRRA 3IAS2 1GLAG 1MSEC 1OCZH 4WF2A 1POGA 1T98A 3SLCA 1Z77A 3THVA 2HYGD 2JWLA 2NS0A 3O08A 1ZRFA 1VQMN 2A6EF 3E6BA 2DN0A 4LLNA 3CCQI 3WTUC 3CJ7A 2P81A 5DV5A 4OO1J 1ATSA 4CO8A 3FZMA 4DR5K 4H5TA 4K8ZA 1YTUA 3VGLA 2QSHX 4B3SK 1BI4B 2BOLA 5LHGA 5J3LA 4KA4A 3COAC 3ABTA 3D2EA 3DLAA 2BY2A 2XDVA 5E8IA 4C2TA 1HBXG 2E20A 3AG1H 3A1YA 2XIGA 2HBLA 2XAGA 4UHTA 2ZFWA 4FJXA 2OBPA 4NQWB 5H2FC 3TGNA 2X6NA 1PUFB 5FFZA 3RKQA 1J0RA 1ZAOA 2X9DA 3QYFA 3CC7I 1C1CA 1P2FA 1T44A 3MMYB 3W2WA 4IHWA 3HXLA 2JZYA 3K1NA 2NNYA 1EXQA 1KVAA 4CGHA 5EF6A 2QI2A 1NJYA 3PUBA 2X74A 3NGIA 3NHGA 1NK6A 1JT0A 1QQMA 4BAYA 2DTRA 3H3UA 4DW6A 2HYJA 3SQ2A 1TKZA 2P6SA 3PSFA 2EWSA 1DP7P 2K3PA 1X3UA 2VGNA 2ITGA 4LF6K 1E4GT 4WQ5A 4BRCA 4UVCA 5IT9K 1V5FA 2R4GA 2Y0SN 4BR4A 1SD6A 3L3UA 4OKEA 1RDCA 4LB5A 4DQRA 3CQZJ 3FXMA 2W42A 3S16J 1NH3A 1HRHA 1Z21A 5L3DA 4UUVA 1HDPA 3HOVJ 1HYZA 3S1QJ 3JXUA 4MLOA 1ZBUA 4NBQA 2MLGA 2GIVA 4BGBA 4EM2A 3CC2I 2CUZA 3UE5A 1P4WA 2HSTA 3WXIA 4A3JJ 4XRFA 2P9IB 4YOXA 5AQTA 2V6EA 3CD6I 1EA3A 4II3A 2O8EA 4GDFA 5I42A 1XDUA 1BDGA 3RSNA 5DCMA 4ELTA 3RRGA 4F2RA 4II2A 4M6VA 1ETVA 1BCOA 1JXBA 3AA2A 3RRHA 3R4KA 5F27A 3JAMZ 1I50J 2VT2A 2NAZA 3LQRA 2XO7A 1R36A 1FMVA 2H1LA 4OIRF 2B6AA 2EH3A 3T1AA 3SQ4A 4PL7A 3DLHA 2FQ3A 2F5FA 3FXJA 2UUAK 2R7DA 4DTUA 3I71A 3TMOA 4X65K 4ILGB 3ZX3A 3GTPJ 3Q7BA 5IYDJ 4FPBA 4XM3A 1YITN 1XHXA 2WC9A 4FWKA 3QEIA 4DLGA 3VQBA 2JMWA 3VEWA 2W6KA 2VJ4A 5CYVA 4XLPF 3VQDA 3IWFA 4NUBA 4BVPA 3EQLF 2QKBA 3I8DA 1IDZA 4FO0A 2DW4A 3SBGA 1WJCA 3H1CA 3IV5A 4RW7A 4KTQA 4B1WB 3TBIA 3SV3A 2G8KA 5CQGA 4JN4A 1KCFA 2VCPA 3U6FA 4FCYA 3QMLA 5BNGA 5FKMA 4K41A 1IG9A 1TWHJ 3E9PA 2DFFA 1G6NA 3M8RA 4F3QA 5BOXA 3ZX2A 3T7ZA 3CMEN 1KU2A 1WZ2A 2ZJRF 5AQHA 3SZPA 3T8TA 1K79A 1U8RA 4KMUX 2G9WA 5M3FJ 5FRNA 2MG4A 3VQ9A 4S05A 1N5YA 3LDOA 1YW8A 4EV0A 1NBWA 3KP6A 2BGCA 4ESBA 3W6KB 5AQZA 4L5JA 3HYFA 5J1RA 1GLFO 2E2NA 4JI1K 4CCNA 2WONA 3GLXA 2W85A 1IRZA 4B8CA 2DMTA 2ITMA 3E7LA 1HW1A 1JLEA 1U8BA 2VPLA 2WB1N 3AA4A 3EPZA 2O8CA 1A31A 2LBFA 1LJ9A 1G15A 3MN2A 3NH1A 5JVTA 4IO8A 3L2RA 1VSLA 3SAGA 1YJNI 3ELKA 1W2BM 4BVOA 3CLOA 3KFWX 3HTSB 4CEEA 5GTIC 5AONA 2LDUA 1STZA 3K9KA 5HLIA 1RESA 2OCCH 3D5SC 5L3FA 5CY4A 2QWMA 3D5LA 4FZYA 3F72A 4FJKA 1T95A 2FJ1A 4XSXF 4MQVA 3ZMVA 2XSDC 4DV5K 3J81Z 4DTRA 1GLDG 2RQQA 5ILVA 2UZKA 2NNWA 1VQNI 2EFPA 2OPRA 1FOXA 4GNIA 4PUOA 1VF9A 4FJ8A 1BI1A 4EM1A 2QF7A 3JRIA 4F55A 1S1UA 3T5XA 1VSKA 4L9VA 4CEQA 5H1SQ 3RKXA 4WX9A 3VSKA 4DU3A 1SFEA 2O9LA 1DU6A 4DWIA 5CKTA 4GY2B 3UNGC 2NVXJ 3LA7A 4NC6A 4NC7A 2IVMA 4XH4A 1LDKB 5GP9A 3I5UA 2A40A 2QQBA 4BQZA 1U5TC 2RE2A 2EILH 2VBXA 2OANA 1RT1A 2M3AA 4TV7A 3V9UA 4HDVA 1TWAJ 2NVTJ 1GXQA 1HSJA 4JI3K 3DU5A 4I99C 2AA4A 4KITB 3VQQA 1MDMB 4WXDA 1HXDA 1W0TA 4WF9L 3G2BA 1RT6A 3MMVA 3H0DA 4JHDA 3WXKA 4RTFD 4DIQA 3G71I 1KAXA 4RDUA 1KGSA 3VOVA 1XB4A 4NYNA 4LC9B 2Q2RA 4XMYA 5AFUH 1WOQA 2X6SA 1W7AA 4ZC3A 4CCOA 3J80Z 3J81O 2PYLA 2G8HA 3GFLA 4C23A 3P4IA 1J53A 2MW8A 2KLAA 3DLKA 4FJ7A 4YIRX 3NCIA 1JLCA 4MEXF 4OPJA 1WKMA 5HBMA 2VLAA 1QHTA 3O4QA 2IJLA 5DD8A 2QZ8A 4A12A 1MDUB 1BBYA 1NGBA 4QOZB 1TZLA 1TT0A 4RLQA 1W36D 3V8LA 3WNGA 2QGUA 1BI2A 3TAFA 1YS7A 4DV4K 3LPUA 1OYWA 2E1ZA 3EE8A 1DEJA 4JX6A 4FWSA 1VQ8N 2J5PA 4L5IA 3JRGA 1BL0A 4QIWN 3DTIA 1RKTA 2PJPA 2IGNA 3OS2A 1BL3A 4MLHA 2ZJQL 1ETOA 3QPLA 2Z16A 4LG0A 1ON1A 2RGVA 1YUWA 2VPRA 3FKJA 2R7UA 4I0BA 2CGPA 1HKTA 1ZLJA 3S2HJ 4KNYA 4IFEA 3OWTA 9ANTA 3TOAA 3ITHA 1NJZA 3BR3A 1FW6A 1DQUA 4LLLA 4A2UA 2VE8A 4FQGA 4DBRA 2HYFA 5DM7L 1XMAA 1ASWA 1RUOA 1DGKN 4RB3C 2EZIA 2VXZA 3U3GA 3C95A 2FBYA 4XN3A 3RMBA 3J80O 1ON2A 1YJ9I 3HOXJ 5GAEJ 2RDPA 4RW4A 4AILC 2R7QA 2JRMA 1QZ6A 3CCEN 3U9ZA 2E60A 5CHIA 5E3NA 1KYZA 3TPQA 1Z25A 3GWZA 4MQ9F 2CJJA 2FF3B 3G1MA 2EV6A 2YS9A 4LSNA 1JUSA 3PQKA 1BR2A 2MC3A 1S9GA 4NCBA 4O8UA 3I59A 2XRIA 4CEDA 3CZ6A 1UWBA 1BHLA 4DZPA 1LDJA 1A5WA 2FXUA 1S7AA 3ZEUB 1NGDA 2L0KA 3LSGA 4HF2A 3DKXA 3ID6A 1BIBA 1TKDA 1OVYA 4HAMA 1D5VA 1JHFA 2IA0A 2M8EA 4FASD 5IPAA 2H1KA 4ASNA 3C7JA 1IKVA 3ZP5A 4YOYA 1L3LA 2JUCA 3TW7A 4JKHA 2HBMA 2LF8A 2CRGA 4TSXA 2IW5A 3VQ5A 1SMYF 3SJHA 4AQYK 3V9ZA 2BY1A 1UA1A 3PO5A 1RR7A 3HBLA 2IC3A 5KVRA 2NOGA 2Z5UA 3PNVA 2Q8KA 2GLOA 3QYBA 1O4XA 4MO4A 3FKIJ 3O3HA 3HL2A 4L18B 2Z2SB 1ONVA 3UKUA 1CF7B 3EZ5A 1IRFA 4N0BA 4HNUA 2UV1A 3C7NB 4CJEA 1O3RA 4CK1A 3S15J 3NBPA 5JLFA 2FBHA 2FQ4A 3F23A 4P5OA
chains in the Genus database with same CATH topology
3VQPA 4PUOA 4FJ8A 4NYFA 4DQPA 1QQCA 2YV0X 3PO4A 2DTUA 3T3FA 3OS1A 1S1UA 3ZSXA 1VSKA 4KKOA 1RTDA 1LAWA 3VN5A 2OPPA 4CEQA 2QXFA 1T03A 4N41A 1KSPA 4B9TA 1C0MA 2LSNA 1VSMA 1RDBA 3S3OA 4K8ZA 1YTUA 3HO1A 2JGUA 1LV5A 3QNNA 4ZTFA 4GVMA 1BI4A 4KPYA 4B9VA 1RT2A 1WSGA 1BI4B 4N5SA 1RBTA 2VWKA 2VG7A 4DU3A 3ZSQA 1A5VA 1WSFA 3QLHA 4AH9A