1EKEA

Crystal structure of class ii ribonuclease h (rnase hii) with mes ligand
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
222
Chain Sequence
b'MIIIGIDEAGRGPVLGPMVVCAFAIEKEREEELKKLGVKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNSINLNDIEINAFSKVAKNLIEKLNIRDDEIEIYIDACSTNTKKFEDSFKDKIEDIIKERNLNIKIIAEHKADAKYPVVSAASIIAKAERDEIIDYYKKIYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKSKQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HII
molecule tags Hydrolase
source organism Methanocaldococcus jannaschii
publication title Crystal structure of archaeal RNase HII: a homologue of human major RNase H
pubmed doi rcsb
total genus 79
structure length 222
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 1ekeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ekeA01
2F8TA 5DK5A 1Z26A 3K57A 3V81A 4Z4IA 4PY5A 3B6OA 4AHVA 2OZSA 4DQIA 3AA4A 2XRIA 3LPTA 1CZ9A 4FJ5A 2DY4A 2OZMA 3DRPA 4CEZA 4N41A 3HO1A 4RW8A 5KI6A 1C1BA 3NDKA 3IAYA 3MEDA 2Y1JA 4CJSA 1U4BA 1NJWA 3NBPA 4CF1A 3RMBA 2VWJA 3DRRA 3OS0A 1TL1A 2IDOA 4W5QA 1Z25A 4FW2A 3G0ZA 4CEQA 4DFMA 3P5JA 3S3OA 4NYFA 5HRRA 3QEPA 4CK3A 1XI1A 4KV8A 1S9GA 3CM6A 3TAPA 1L5UA 2KZZA 4L8RB 1RT6A 3MXMA 1RBUA 4KRFA 3SV3A 4OGEA 3AV9A 4CCHA 1B9FA 3OYNA 4FJLA 4PUOA 5C24A 1RTDA 3TI0A 4F4KA 1YTAA 1N6QA 3ZSYA 3HPOA 3RRHA 1CZBA 1BL3A 1HJRA 3QEWA 2VG6A 4ZHRA 1VSMA 4ZTFA 2RPIA 1GOCA 4EP4A 3VQAA 3SV4A 3ZSXA 3PO5A 3LAKA 3UIQA 3HP6A 4F2SA 4I9LA 2F8SA 4KB1A 4Z0UA 4O5BA 3OY9A 1EP4A 1JL1A 2XO7A 4B9SA 2RKIA 1J53A 3AO1A 4CESA 4AHCA 4FJMA 1RT4A 3SUNA 1RTJA 3TARA 1JXEA 1Q8IA 3CG7A 3D0PA 4ID1A 4BWJA 3L3UA 1REVA 3KLGA 4B9NA 1NKBA 3VQDA 1NOZA 3SYZA 4Y1DA 5HRPA 1LW2A 2EHGA 4R5PA 4JS5A 1J9AA 3SQ0A 4OLAA 4FCYA 1A5WA 1TAQA 2YNFA 1U47A 2X6SA 4CECA 4DTXA 3OS1A 4LY7A 3I0SA 3V9SA 3V9XA 1XHZA 2HNZA 1X9WA 3VQ9A 2GV9A 3T1AA 1NK0A 1QTMA 4DSKA 3AO5A 2W42A 2Z1IA 3V1OA 5I42A 3DLGA 1Q9YA 3K59A 3DRSA 4QOZB 1NJYA 3L2RA 3KLFA 4HUGA 2DFFA 4M3WA 4FLVA 2BE2A 1S1TA 2D0AA 3TAQA 5J1EA 1NK7A 1VSDA 1RDBA 4EZ6A 3ISNC 1KFSA 4RW7A 4MQ3A 1T8EA 4CF8A 2XY7A 2G8FA 4FJXA 4CEEA 5I3UA 3OYIA 1IO2A 4E1MA 2VG5A 3TANA 4F3OA 3K5OA 5FDLA 1HNVA 1HQEA 3ULDA 2HMIA 3DMJA 3SUOA 1J5OA 1UOCA 3LP2A 3JSMA 4DSFA 4EP5A 4DTNA 2PZSA 3VQEA 1VK0A 3HL8A 3OJSA 4JRPA 3QNNA 1W9HA 5J2PA 3KD5E 4KB0A 1VSHA 4DFPA 1RTIA 4W5TA 4AHSA 4MFBA 4CFDA 4CJRA 4ELUA 2HHSA 1L3VA 4J2DA 4DS4A 3OVNA 3NE6A 1D9DA 1TKZA 4F3TA 1JLFA 3C6UA 4O55A 1HYSA 1ASUA 2KZMA 2KFZA 3HVRA 3O4QA 1EX4A 4W5RA 4KPYA 3AO4A 4LH5A 2R7YA 2YNGA 4DQPA 3AVCA 4GVMA 4JLHA 1S1XA 2XY5A 2KTQA 3NH1A 3OYEA 4ICLA 3WNHA 4N5SA 4BE2A 5CYMA 3LZIA 4DTOA 4KHNA 5T7BA 4ELVA 2HHXA 2YHBA 3DOLA 2XY6A 4Q5VA 1S6PA 3ZSOA 2D0BA 1VRUA 1X1PA 3SQ1A 1Y97A 1TV6A 2O4GA 3O4NA 3HJFA 3LAMA 3CYMA 1XWLA 3HSTB 3P83D 5CZ2A 1IKYA 1YVUA 4M41A 3QINA 3NF8A 1NK9A 1BCOA 1TGOA 3VQCA 3ZCMA 1WSHA 3LPUA 1JLAA 4GW6A 3WNEA 2G8WA 3F9KA 4CEOA 4B3OA 3QERA 2OA8A 2ZQBA 4FXDA 2A1RA 1FK9A 2RF2A 3FFIA 2EX3A 3KTQA 3AVBA 4M3XA 3AA2A 5C42A 3O3HA 1RT1A 2P5OA 4KHYA 1WSEA 3ZT4A 2G8UA 4CJVA 3OYAA 1DTTA 1BQMA 4E1NA 4CF0A 4Z4FA 3AVHA 1C0MA 2KW4A 1DLOA 4DLGA 4LH4A 4CF9A 3AO3A 3V9ZA 1JLCA 4Q0BA 4O44A 2E6MA 3U3YA 3ZSQA 2BGGA 4CJ3A 3VQPA 4IBNA 1BISA 2HW3A 4I2PA 4FJ8A 4CGDA 4KKOA 4CJUA 4TSXA 1QSSA 1K6YA 1W0HA 1GOAA 3MXJA 4CJLA 3L3VA 4IFVA 3B6PA 1RTHA 1TAUA 3KLEA 4DTPA 1Q9XA 3KIOA 4PWDA 4DTRA 2ETJA 4H4MA 4KI6A 3RWUA 3IG1A 1EXQA 1HRHA 1C1CA 2Z1GA 3DI6A 1NJZA 4OKEA 1RT2A 3NHGA 4DTSA 4HHTA 3VQQA 3ZSVA 4CJTA 1KLNA 1NK4A 5EU7A 4HCCA 3QETA 4BWMA 1NOYA 3V9UA 1T7PA 4KTQA 3SI6A 2RN2A 3AA5X 1CLQA 4B8CA 4H4OA 1LV5A 1RT3A 3MEGA 1T05A 3RR8A 4M3TA 2DFEA 4YFUA 2IC3A 3QLHA 5HBMA 1IG9A 4WE1A 4CJFA 4IKFA 2HB5A 2Q3SA 4FLYA 1R0AA 1RILA 3OYGA 4FM0A 1I39A 4DSEA 1NK5A 3KLIA 3VQ8A 4NCAA 2PYLA 1L3UA 4FM1A 3HVTA 1S1WA 3KKSA 2OPQA 3LALA 4KAZA 4FM2A 3AVGA 3DLBA 4XIUA 4E7JA 4IFYA 3T3FA 4E0DA 4KFBA 2Z1JA 3AA3A 1KCFA 5FRMA 3VQ6A 1ASVA 4M3YA 4ZTJA 4CEAA 2YKNA 3RTVA 2Z1HA 3QIPA 2OPSA 5E41A 4AILC 3PUFA 5CZ1A 4FJJA 3HT3A 2JLEA 3AVIA 3LP0A 3BGRA 3QIOA 2HVHA 4FLTA 4CJ5A 4C8NA 2DTUA 3I8DA 1SKWA 1HPZA 1YT3A 3M8SA 3EYZA 1IKXA 4LSLA 4CIEA 4CHYA 5FRNA 4FK2A 1RBVA 3QNOA 1UA1A 1U45A 2PYJA 4DU1A 3C94A 3AO2A 2HHQA 2B6AA 1XHXA 4E7KA 1HNIA 3K5MA 3HPHA 4OKJA 3TAMA 1C1AA 4CJQA 3RMAA 4RW6A 2B4JA 3BDPA 2D5RA 3SQ2A 1RDAA 4CJ4A 3CFPA 4DS5A 3M8PA 3O3GA 1B9DA 2HNDA 2ZD1A 2XY8A 3VQ7A 3PO4A 2VWKA 3KKRA 4CF2A 1TKXA 4FLZA 5K14A 2VG7A 2YV0X 3V4IA 2QKKA 4QAGA 4BDYA 3V6DA 4CJKA 3IRXA 5JS1A 3TAGA 1QQCA 2D0CA 3LANA 4E89A 4I7FA 2WONA 4CHOA 4OPKA 1U49A 1ZBUA 3S3NA 1LWCA 3JYTA 2E6LA 4CGIA 1EETA 3EZ5A 4FK4A 4CFBA 1TL3A 1F21A 2AJQA 3V1QA 2P51A 4M45A 2FBYA 4CHZA 5KRTA 2IS3A 1KTQA 1SL0A 3DM2A 3VN5A 4OVLA 1BCMA 3NGYA 3OYCA 4DSLA 4I9QA 4J2BA 1B92A 3LWLA 1ZBFA 1JKHA 4DLEA 1WSIA 2IGIA 3O3FA 3U6FA 2BANA 5HLFA 3M8QA 4NCGA 4CGFA 3VQ5A 4F2RA 1VSLA 1VRTA 3K2PA 3D45A 1CXUA 1FKPA 3KLHA 3L2WA 3HK2A 3CM5A 4RW4A 1XC9A 3M8RA 1C0UA 4Y1CA 3K5LA 4FZYA 3TR8A 1RCHA 3OYBA 1RBTA 3CFRA 1QSLA 2O4IA 5HP1A 1ZBIA 2A1SA 1EKEA 1KVAA 2LSNA 2FBXA 1SKRA 1DTQA 4FJKA 4CK2A 4OLBA 1A5XA 1QS4A 4Z4GA 2GUIA 1WSJA 3ZT2A 4YNQA 2KQ2A 4Z4EA 4H8KA 1KSPA 3K58A 1HMVA 3C6TA 3WNGA 4CHNA 1D8YA 4DTUA 4DU3A 4BDZA 2P5GA 4CK1A 2FC0A 4FLXA 5J2NA 1WSGA 2F96A 1JLQA 3NF6A 4W5OA 4IG0A 3VA0A 3HYFA 5KGXA 4CGHA 3ZSZA 1TKTA 1ZYQA 1WLJA 4CERA 3CQ8A 1JXBA 1LWFA 1UWBA 4FJGA 1WSFA 3SQ4A 4HCBA 2HHTA 4OGCA 3SUQA 3HM9A 3LP3A 3SJJA 4B8AB 1MU2A 3MEEA 1N5YA 4FZZA 4NYNA 3KJVA 1O1WA 1C0TA 4CEFA 3OYLA 2G8KA 1BHLA 2ITGA 3DLHA 4E7IA 4B9UA 1TVRA 4N56A 5HROA 5JS2A 1JLBA 3HPGA 3OYMA 4PA1A 5FROA 4BDPA 2FBVA 2P1JA 3SUPA 3VA3A 2QK9A 3OJUA 4W5NA 3LP1A 4FJIA 3LZJA 4DSJA 4HUEA 3KD1E 1KLMA 2YKMA 3E01A 1VSFA 3NH2A 1YTUA 4E3SA 5KTQA 4ID5A 1S1VA 5CYQA 4BE0A 4LSNA 1TK5A 1KVBA 3ZSRA 5CY4A 3NAEA 3L8BA 4DG1A 4DQQA 1X9MA 3KK1A 4HVJA 1C6VA 1U04A 4FW1A 3DLRA 4LD0A 3OYDA 4E7HA 4CE9A 3DOKA 1D5AA 2BDPA 2IOCA 4AHTA 4FVMA 3MXIA 3L2VA 1SL2A 1BI4A 4QCLA 4M42A 1GOBA 1G15A 3MAQA 4FYDA 1RBRA 3AVAA 4DTJA 3S9HA 1S1UA 2KFNA 4N47A 1RT5A 2YNHA 4BE1A 4DQRA 1LAVA 3SCXA 4J2AA 5D3GA 4CEDA 4FJHA 1NKEA 3THVA 3SNNA 2X74A 4C8LA 1ITGA 2IAJA 4CJEA 2I5JA 1LWEA 3ZT0A 5C25A 2G8HA 4DWIA 4FK0A 4OJRA 1LW0A 1LAWA 3DLKA 4B9LA 4RW9A 4O0JA 3ZSWA 2PY5A 1QHTA 3DLEA 2XHBA 5J2MA 3PX0A 2E4LA 3PV8A 4PQUA 4KO0A 4IG3A 3AVJA 3OS2A 1QSYA 3AVKA 4F8RA 2DFHA 3A2FA 4KHSA 3QESA 1BI4B 3V1RA 5HRSA 3WNFA 4AHRA 4CGGA 3L2QA 2JGUA 4Z4CA 1QE1A 4CFAA 3ZT3A 4IDKA 4KTWA 3P1GA 1RDCA 4NCBA 1BIZA 4B9TA 4KHUA 3L2UA 3RMCA 1J54A 2OPPA 1NK6A 1S6QA 1RBSA 4I2QA 4DF4A 1JLGA 5SWMA 4FJ7A 4B9MA 3V9WA 1IKVA 1A5VA 1SV5A 3QO9A 1L3TA 4Z4HA 1CXQA 1WN7A 3TAFA 1FXXA 3HXMA 1KFDA 3IS9A 4CFCA 4JRQA 4EZ9A 1NK8A 4O0IA 4KHWA 4CHPA 4FZXC 3SPZA 1BIUA 3TWHA 4FLUA 4M3UA 1VSIA 4FLWA 1RDDA 3OYJA 1HYZA 2X6NA 3RMDA 4O4GA 3KK2A 2GBZA 3G10A 1RT7A 4GMJB 1KVCA 4HTUA 4KREA 4CJWA 2HHUA 1WNSA 4E19A 2WOMA 1UA0A 3K5NA 4C8KA 2FBTA 3ASMA 3PX4A 3TABA 4RG8A 1ZBLA 4K8XA 4UQGA 3NF7A 4KTZA 2HNYA 1S5JA 1BGXT 1NKCA 1T03A 4OPJA 4C8OA 4KHQA 3SPYA 4M3ZA 3QEIA 3LWMA 3AVLA 4AHUA 4CEBA 3PX6A 1X9SA 1D9FA 2ZE2A 3RR7A 3AVNA 1SKSA 5DMRA 4M3RA 2QKBA 1RNHA 3NF9A 2X78A 1VSKA 3QEXA 1JL2A 3NCIA 1SUQA 1TKDA 3TAEA 1TK8A 3RRGA 2G8IA 3QEVA 1TK0A 3NGZA 4G1QA 3LDSA 1I3AA 4B08A 1BQNA 4CHQA 4OKKA 3KK3A 3DYAA 4ELTA 4N76A 4J2EA 3ZT1A 5HRNA 1VSJA 1S9EA 2OPRA 3AVMA 1ZBHA 3NFAA 1ASWA 3SZ2A 2HHWA 3EY1A 1WAJA 2YNIA 3F73A 4FJ9A 4FJNA 1U48A 2HVIA 3OYKA 3ALYA 2G8VA 1VSEA 2YHAA 4E7LA 4DQSA 1HQUA 1HYVA 5J2QA 3CFOA 1SL1A 3AVFA 4CIFA 5SZTA 2OYQA 4DSIA 1KRPA 2B5JA 5KRSA 4CIGA 1IH7A 4DFKA 3T19A 4JS4A 5KGWA 3OYFA 3S3MA 4C8MA 3C95A 4BACA 3I0RA 3VQBA 3NH0A 4K8ZA 4KI4A 4DTMA 4DU4A 1FKOA 1L3SA 1UAXA 3PY8A 3H08A 4DFJA 4B9VA 1IKWA 3U3GA 3VQ4A 1WAFA 4CGJA 3NGIA 4HUFA 1NJXA 2HHVA 3OYHA 3ITHA 3MECA 4AH9A 2NUBA 1JLEA 2ATQA 4DF8A 2Y1IA 4DMNA 3HP9A 2QXFA 4CJPA
chains in the Genus database with same CATH superfamily
1U8BA 5GADP 2IJLA 4V2FA 2I5UA 2VOPA 2XRIA 1GLAG 3LPTA 4JNEA 5AR0A 2VKHA 1TUYA 4FJ5A 4CBWA 3BZKA 1G3TA 1C1BA 1XQSC 3IAYA 4NLBA 3H6EA 2ZFWA 5ELZA 1TL1A 4FOEA 4W5QA 3OR2C 5JVHL 3DLAA 3H5RA 3WGGA 1CQTA 2R7UA 4BG8A 4DFMA 4G94A 3W0LA 2LP0A 3BR5A 4KH4A 1L5UA 3CM6A 2EV5A 4L8RB 4O6JA 2KLAA 1FJGK 3DQVC 3VWBA 3MXMA 2H09A 4KRFA 2GOMA 3OW2M 4XH1A 3NWTA 3EE9A 4G8XA 2R7OA 5FGMA 1LCUA 4B3SK 2FU4A 1WB9A 2RQQA 2X1DA 3F8NA 3WEEB 5AQLA 2OV7A 4MO4A 4BNCA 3QEWA 4L9NA 5BRHA 2VG6A 3MKYB 1H9TA 3SMSA 4UUSA 3I56I 1AHDP 1N25A 1R5GA 2ZO4A 2GM4A 5ERIA 1GOCA 2FSNA 3VQAA 2IGOA 2ASOA 3LAKA 3CZ6A 4I9LA 1I5ZA 3S14J 5CVVA 5GINA 2F8SA 3TOBA 3O80A 3C7JA 4RB2C 3QPTA 4OIRF 2FF4A 2LTPA 2DXIA 4DB3A 5LJVA 1EP4A 3PUBA 2LDUA 1WCMJ 2ZBKA 2VGMA 5IWAK 1SVOA 1Z9CA 3RVCA 2K85A 2YX7A 5CKTA 1LE8B 1J53A 3AO1A 2XO7A 4AVPA 1T08B 4A3BJ 3CCVI 1RT4A 2BBYA 4DKWA 2DA5A 4GV3A 3CG7A 2VL8A 1P7IA 3D0PA 5F6FA 4BWJA 2LKXA 4B9NA 3KYLA 1NKBA 3BJAA 1KC8O 2P9NB 2KHMA 2A42A 3H5AA 1WUAA 3LM2A 4R5PA 1BI0A 1U47A 3H35A 1MWMA 2YHWA 3JRDA 2DDBA 4LY7A 4DV1K 1XHZA 2KIMA 4JYKA 5L3DA 2CQXA 1LE8A 4IOXA 1S29A 4EJVA 4S04A 4JKAA 2Z5UA 4WFNL 1R5HA 3ZETA 2ZXJA 1X9WA 1QTMA 2W42A 1WWXA 2GUPA 4JI5K 5HS9A 3FXQA 3K59A 1NJYA 4CZLA 4JK9A 4LLLA 2DFFA 2XF6A 4BJ5C 1YIJI 3TAQA 2DO7A 3A0IX 5J1EA 2ZSIB 1B6AA 1SFXA 3K4NA 1KFSA 4RW7A 4MQ3A 1QVUA 2BY0A 2PG4A 5D4RA 1BIBA 1UHWA 4X1EA 1VQPN 1QO0D 2VE8A 4QLCU 4HDUA 1EQYA 1P90A 4K43A 3VF2A 4A61A 4KA4A 1IO2A 2PFUA 4CEEA 4FASD 2P8TA 4GFBA 3HTVA 5FPDA 3TANA 2LBFB 1Z3XA 2JZYA 3GXOA 2EINH 3HJEA 4EGZA 1I1SA 2IGMA 1UOCA 5GIPA 3JSMA 2QBYA 2EWNA 4U0YA 3BJOA 3J80K 4DSFA 1VK0A 3OJSA 4DTNA 1Q82O 2CW7A 4MTDA 3DAWA 1E0EA 1ON1A 1GLFO 2R7FA 4AUXA 4W5TA 4AHSA 3HZJA 4CFDA 5JVGF 4CJRA 3KHYA 5AQPA 2HHSA 4DS4A 5E8IA 3R61A 2FRHA 1JLFA 4O55A 4FETA 1BR2A 2M0CA 4FISA 1XCVA 3OSFA 2EZLA 2BOLA 4B09A 5J4VA 2OTJN 1EX4A 1E3PA 1R23A 2YCHA 1W2BM 3CDLA 2NRTA 2R7YA 1BIAA 2F5DA 1S3XA 4DQPA 3AVCA 3F6VA 2GWJA 4GVMA 2XY5A 2BHZA 4BE2A 4ICLA 2HHXA 5A2QZ 4ELVA 2B0LA 1X2NA 2FA5A 2EV6A 4BC2A 2WY8Q 2XY6A 1S6PA 3NQOA 1ON2A 3WG9A 2R7XA 3CCMI 2D0BA 4BJ6C 1X1PA 2HYJA 2O3FA 4LF9K 3RI4A 4HQMA 3GTOJ 2CQKA 2IEKA 4ABZA 1RNLA 3ZN1A 5FJ8J 3CO7C 2DU9A 1YVUA 3LAMA 1FY7A 4FWSA 3ECHA 1B1BA 2PEXA 1FJLA 3GCMA 1VQ7I 4LFBK 1P2FA 3QINA 1ETOA 5FPNA 3K2ZA 3O1BA 1NK9A 2V1NA 4DR1K 1TGOA 3VQCA 3SBTA 5KVRA 5KHDA 5F27A 4YIRX 3OTOK 1H1VA 3WNEA 3A1YA 3OA9A 3O3KA 4CEOA 1XMQK 1SD7A 1OPCA 5KK1A 3MWMA 2V6CA 5E17F 3QERA 2L7ZA 2ZQBA 4FXDA 2A1RA 1FK9A 3BG7A 5B8HA 2GELA 4AYBN 3AA2A 2P5OA 3W2AA 4G9ZA 4XOTA 4RGRA 3H1CA 3EUHA 3HOVJ 5CVJA 2HXIA 2HHHK 1BQMA 1W4MA 2QEXI 2A6TA 4BY1J 1DGKN 1C0MA 3S1QJ 2W6LA 3AVHA 1DLOA 3K9TA 2P9SA 2W25A 3OMYA 1RZ4A 1XTAA 3U2RA 3JRGA 3AO3A 4O44A 4CF9A 3V9ZA 2BGGA 1R36A 2JA2A 2KFDA 3FXLA 1X1BA 1B8IA 1O3QA 2M7AA 5CPRB 2HI3A 3P9CA 2X85A 4KKOA 1HF0A 4CJUA 1YLFA 5A2QK 5AQUA 5CE3A 3MXJA 5TISC 4A3JJ 3L3VA 1WRJA 4RMNA 4IFVA 2VJIA 4KMUX 2LR8A 3H0DA 2V1UA 5FKOA 2FF3B 3O08A 2UXXA 3CCRI 2ETJA 4DTRA 4FWKA 5FKKA 3O2PE 4IHWA 3AG3H 3B6CA 3KP7A 4AIKA 1D0ZA 3K69A 3GVAA 2V1DA 4PJ0C 2UV1A 2R5ZB 1JKPC 3VQQA 1A5JA 3ZSVA 4HHTA 3SAFA 3QBWA 1KLNA 3ZETB 2CRGA 1RUOA 1T7PA 1WVRA 3SI6A 1ETYA 4KTQA 2OU2A 2KIQA 4AIDA 5DD4A 2DJNA 1RT3A 4KIFA 3Q0UA 5TRDA 1VQ5N 2XF7A 1TWGJ 1VQ4I 3D7EO 5J8CA 5F2RA 3BR1A 3GZ5A 4KBOA 1JKRC 1V55H 2L9RA 4OAZA 5JFRA 3JREA 3G1OA 4XSXF 3GTKJ 3GTPJ 1NGGA 1TYQB 4DSEA 3KLIA 3WTWC 1OYYA 1YF5L 3PIOL 1V54H 2PYLA 4DGWB 4IOAF 1P4WA 2M2EA 4UB6C 2WAQN 2WV0A 3QWLA 3U9ZA 3H0GJ 3I4MJ 4E7JA 2MLKA 3G1MA 4GNIA 4A3GJ 4G12A 5C2FA 3ESWB 4BR0A 4KITB 4EM0B 1VI0A 2R7QA 3IWZA 1U0JA 3W2WA 1BG3A 4ZTJA 4CEAA 3CCVN 2X6WA 5HS8A 2Z1HA 3O6WA 2OPSA 4CD1A 2KRCA 4AILC 4J8FA 3HZ6A 1S72N 5CZ1A 3F3XA 1P6RA 1HQCA 3OIPA 5JVTA 3L6QA 3LP0A 3HT3A 3FKJA 4LFAK 2HVHA 4FLTA 1BL0A 2JPCA 4CJ5A 1A6IA 2GOXB 4IPAA 3F23A 3I8DA 1SKWA 2G9WA 1KAYA 2ECCA 3M8SA 3IV5A 3HIFA 2VE9A 1ZG3A 4FK2A 1RBVA 2WY7Q 3QNOA 1F1ZA 2NS7A 1ETWA 2H27A 3CCQI 3FR0A 5BN9A 1U45A 1DP3A 4NUBA 2PYJA 3IFRA 3C94A 2ZCWA 4QS8A 3OIQA 3OIOA 4CZIA 1FBUA 3MKWB 3HSCA 1BJZA 2HHQA 2RV8A 1REPC 2CJJA 1XHXA 3WU0A 4FTHA 3HOZJ 1CF7A 1NBWA 3JSPA 5I9EB 4RW6A 3VYTB 3WTUC 1TQMA 3BTLA 4HNUA 5GAEP 3WEEA 2OJED 1YIJN 3MN5A 3O3GA 2VWBA 4BGAA 2VWKA 1EO1A 3J81O 1IUFA 3GTJJ 1P9QC 2F5VA 1D0XA 1OCTC 3OHRA 2NYXA 4LGWA 3EUHC 1JJ6C 4A3LJ 1ATSA 2VG7A 3V4IA 1HW1A 3V6DA 3MKZA 2QKKA 3KP2A 4CZZA 5JLWA 2TDXA 3TL4X 1QQCA 1YXQA 3F8CA 1B72A 3LANA 3K9JA 2VQGA 1R58A 3U4LA 2ZFUA 4S0HB 5E3OA 1ZBUA 1FW6A 3IL2A 1LDJA 1L0OC 2V4JC 3QU6A 1BI2A 4DJAA 3CC2I 4BRIA 4M3FA 4PJNA 1S3JA 3IDHA 5LL6Z 2EFNA 2KJBA 4V2GA 2CFXA 2FSJA 1FT9A 1GLJO 1TL3A 3I59A 2JRTA 2FBYA 3IUCA 5KRTA 1YVNA 2E88A 1IW7F 4OVLA 2HDWA 2PBIA 3NGYA 3VN5A 2B63J 4V19K 1KD1O 2FSKA 5J47A 1ZBFA 5CQEA 2Q2EA 3O3FA 1Y1WJ 1X4OA 5L3BA 3O4WA 3U6FA 4NCGA 3VQ5A 2RVCA 3K2PA 3WE2A 3W6VA 1IRFA 4I0BA 2OTLI 4JKDA 1FKPA 3HHHA 1N78A 1XC9A 4DV2K 2XPUA 3K5LA 1E2XA 2Z99A 3VYUB 1J6ZA 4Y1CA 5CYVA 4FZYA 3FISA 2B7EA 5AIPA 5EG0B 3K10A 5IYCJ 4CD3A 5AIQA 2LSNA 3CJRB 3ZQQA 3EYYA 3G6EI 2FBXA 4JAXA 3BTJA 2VQCA 3C65A 4ZYEA 4IEJA 1ETKA 1A5XA 1QS4A 4XRMA 3E5UA 3CJCA 3SLCA 3FF5A 4JKHA 3I0TA 4YNQA 1HMVA 3WNGA 2FLOA 2A69F 2JT1A 2A07F 2Q2RA 4H5NA 4PGGA 3VPZA 5M1FA 3EZWA 4CK1A 1T6SA 1TL8A 1WSGA 2F96A 3RCOA 4BRLA 4WFBL 2E2OA 4CZGA 4WCEL 3NF6A 3K0LA 2QW9A 1MH3A 4LG0B 3JRBA 2QGUA 2A41A 3VGKA 1TKTA 2HQAA 4B8XA 2ELJA 4CERA 3KP3A 5JLHA 2BXZA 1T44A 2F2EA 2OANA 4JI3K 4A5BA 5HDNA 2E1CA 1WSFA 2E8AA 5AJ3K 3QYBA 3SQ4A 5K7HA 4OGCA 2XV4S 1KAXA 4B8AB 3K2AA 3H1VX 3MEEA 1N5YA 4MO7A 3PNYA 3SHFA 2G8KA 3VTHA 4FWQA 4XLHA 3DV8A 4E7IA 1TVRA 1TW3A 2ACJA 4PL8A 3CCSN 3HPGA 5DUIA 3CJ9A 3VA3A 3RKQA 2QK9A 4B4CA 4ZH4F 3VDXA 2DPUA 1YX3A 2KDZA 3LZJA 3H45C 4HUEA 5FO5A 3L9FA 1D4XA 1AKHA 2D1VA 1QBJA 4HTLA 2P6SA 1A04A 2YKMA 3E01A 1YTUA 4E3SA 4G9YA 3PL8A 1S1VA 4BE0A 4ID5A 1TK5A 3FX3A 1ZXOA 1HX1A 3HRSA 3NAEA 2COBA 3JRHA 5BR8K 1S5LC 5DM7F 3L8BA 1POGA 1WPKA 4CZCA 4Z94A 1U04A 5EY4A 3PQKA 2E20A 3DLRA 4CZHA 3ABTA 3VPRA 1FZPB 1RUNA 1HCRA 2ZJQF 2VODA 4JKGA 2IOCA 1SL2A 1UCRA 1M90O 2STTA 1Z21A 2YU3A 3IKTA 3I64A 1C0GA 4BR5A 5J1RA 1GOBA 1G15A 3G71N 1RBRA 2E2PA 1L3LA 4DTJA 3P9IA 3S9HA 3UB5A 5D3GA 1LAVA 3CLOA 3NRVA 3ID6A 3SQNA 3O5BA 4FOIA 1NKEA 3S1MJ 3GMEA 1RPWA 4ENMA 2KHOA 4JD2B 4JI2K 1MH4A 2I5JA 4RB1A 3I5UA 3VEYA 5FKLA 1HLUA 5C25A 2ETHA 1LW0A 1LAWA 2DMUA 4OAYA 3A01B 1O3TA 3LDQA 4RW9A 1IJJA 4XRFA 4AVZA 2CSOA 3DLEA 1HKQA 5GPAA 1WH5A 3SFIA 2MYSA 1GLEG 4PQUA 1X3WB 3ULEB 3D1NI 4ISEA 2CH0A 3AAPA 4MEXF 2P9KB 3OS2A 4IG3A 4KO0A 1VAZA 4IFEA 4H0XB 2O8BB 3TDZC 2QF7A 5HRSA 3L1PA 4Z4CA 3ZT3A 3HYIA 5HLTA 4PKGA 3TTCA 2FMLA 1GXQA 4NCBA 2F4OB 3QOPA 3UKUA 1ZKGA 3TEDA 3CHWA 1NK6A 5AQQA 3DTKA 4HCCA 2XRNA 4B9MA 1OISA 3SYTA 3GTMJ 3ZQ7A 4W97A 2KLOA 4XR6A 4RLQA 3CCQN 2LMDA 3TAFA 3TTFA 3RPQA 1KFDA 2QWPA 1OJLA 2VB6A 5D8LB 1U78A 2ZF5O 3ZMSA 5HL7L 4BROA 1YS7A 2PMUA 4O0IA 2O8BA 4DUYK 1LVKA 3HRUA 4HEA2 4B44A 4CHPA 4IO9L 3F9MA 4KDPA 1VSIA 5DV5A 2Q0OA 2D4WA 3QPHA 3CCMN 3W3CA 2OC6A 1QRYA 4I98B 1W0TA 3WQUA 1WBDA 2O8EB 1XGOA 1WJEA 3R1XA 3IAM2 4OU0A 1HJOA 5LMUK 4KREA 2VXZA 4KT5C 3G25A 4IHYA 3DPTA 4G7OF 3ASMA 2XGCA 3TDUC 2Y0SN 1OKJA 4NO7A 3QP6A 4F92B 2EK5A 2LVSA 1FLIA 4BRQA 4DV7K 3LNQA 2HVQA 3BP8A 1IN7A 2CV1A 1T03A 4KHQA 2BEOA 2MH9A 3LWMA 2QEXN 3ZOBA 3Q3SA 4CEBA 2M5WA 5EVZA 2ZE2A 4PJMA 1X9SA 5M5WJ 2OF7A 3LAJA 4YOTA 1RNHA 3NF9A 2X78A 1JUSA 3QEXA 3I71A 1TWHJ 5H6RA 5F1RA 4JKEA 1JKOC 3S2HJ 1SD6A 1GLNA 1FYLA 3TAEA 1TK8A 1R1TA 2KT0A 4JX5A 3LDSA 5JICA 1I3AA 3C18A 3HGGA 3BPXA 3I59B 2JA6J 4WXDA 4XLEA 3OOPA 1H89C 4B08A 2E71A 2FD5A 2EZIA 4OKKA 5H2FC 3QFUA 1MMNA 1U6GA 4J2EA 5BNGA 1BU6O 1MW7A 1S9EA 1ZBHA 2DLLA 3RSNA 1NM1A 3EY1A 2RQPA 2ELKA 3LWFA 1WAJA 1D5YA 4A0XA 2MG4A 1G3SA 4PSWA 1W7PA 2YU9J 4FJNA 5TKYA 2HVIA 2V79A 2ID6A 4CUGA 1UHMA 4I76A 2VONA 1VSEA 2YHAA 3PIPL 4DQSA 2G8VA 2NNYA 3GDQA 3PLAA 4HX7A 2CV0A 2W1OA 2K40A 4M72A 1G2HA 4UY8O 3J8AA 1IV8A 5ILUA 5SZTA 3GUDA 4CIGA 1IH7A 4OX9K 5KGWA 3JTGA 2DOAA 3THXB 3G3ZA 4E6KG 1JHHA 3BTCA 1R1UA 3WQTA 5AZJA 2AHQA 4BACA 2X6YA 2Q36A 3BF3A 2XAFA 2GZWA 3H08A 4AU7A 4CGJA 3HSEA 1NG9A 3W3DA 1UMQA 1W36D 1ZQ3P 4PKHA 1LEAA 3HP9A 2F8TA 4FPBA 4U0VA 1Z26A 2FJ1A 4JD2A 3V81A 4A5MA 5B66C 3KWGA 2P9UB 2QKLB 1OFCX 5J4YA 3HO1A 5KI6A 2W00A 1NJWA 1U4BA 1H88C 1HNZK 2WA0A 3CP8A 5EEAA 2IDOA 5J8FA 1RESA 3GL1A 1YUWA 2MW8A 2V26A 4RAGA 3G0ZA 3BG3A 3S3OA 4B1WB 4BXXJ 4DV6K 1K4SA 3W2VA 1B9MA 3GTLJ 1VQKI 2P7VB 4JYAK 4KV8A 3TAPA 2EIKH 2KZZA 1RT6A 2ZJRL 4KYWA 4XKWA 1RBUA 3THWB 1MGTA 4KICA 4EM1A 3I4PA 3WG7H 3AV9A 4GYIA 4OGEA 4CCHA 1B9FA 3OYNA 5BN8A 1FOKA 3TI0A 4MLEA 5C10A 1YTAA 2ESHA 1BOAA 2FX0A 2L7FP 2IS4A 2P7CB 3LA3A 1SMTA 3BLYA 5F04A 4ZHRA 2K02A 3GEZA 2Z3YA 2Z16A 1KGSA 2E1NA 4A0YA 3JAMK 3A5NC 5GAHJ 1ENHA 3HP6A 3ZCOA 4F2SA 3VFZA 3E9LA 4HNVA 2F4MB 1VQKN 4A5AA 1KA8A 4H4KC 2QTDA 4BUPA 2GLOA 4O5BA 4Z0UA 4LFCK 3G71I 3R9PA 3BT9A 3HOXJ 3ABMH 3CDIA 3QAHA 3SEZA 1ZR2A 4C1NK 1VZ0A 4B9SA 2RKIA 4CESA 3KD5E 1HC8A 4FJMA 4OINF 5LFAA 3A2KA 3KX2A 1UG0A 1RTJA 4BR4A 3TARA 1Q8IA 2HR3A 2X48A 3DCFA 2KQRA 2DT5A 1C0FA 3JRAA 1IAWA 2I8DA 1EJ9A 1REVA 4JK8A 3R3LA 4H0PA 2YJEA 3VF4A 2A61A 2PX9A 2K4BA 4BJTA 5KQDA 5BOXA 2HF4A 3HEFA 2EHGA 2VGNA 4JS5A 4XQFA 1J9AA 2A6EF 3SQ0A 2YNFA 5ADXA 5AQNA 3OS1A 4JP0A 4XBFA 3ULEA 2UXBK 2J4RA 2MFZA 2HNZA 4JN4A 2DK5A 3V8LA 1NGJA 1TYQA 2VN2A 4CH7A 3AO5A 3QB0A 3E6DA 2XB0X 2FXUA 3DLGA 5AQIA 2W4SA 4D5FA 4HUGA 2R5YA 1IBKK 2BE2A 5EZHA 4WCGA 2NNWA 3C2BA 4IRGA 5FLXZ 1Y39A 2D0AA 4FSVA 1NK7A 2MD0A 1H0MA 2VT3A 5JMVA 3ISNC 4IJNA 4E7SA 4YFKF 2P0WA 4L9TA 5LHGA 2XY7A 3HG9A 3KVGA 4AM7A 1F9NA 4E1MA 4LLNA 2CH5A 3O9RA 3EKSA 4JKGB 5AQSA 3K5OA 1S9HA 4LK1F 2HMIA 3DMJA 3KZZA 3SUOA 2E7WA 1FWZA 5LEKA 3E5QA 3HL8A 4JRPA 2WTEA 1NWKA 1BI1A 4KB0A 4B3RK 2O8DB 1Z77A 4DFPA 1M1KO 1MBGA 4MFBA 3DF8A 1YO5C 3U9DA 4EAHD 4HF2A 1IXCA 1UZCA 3BG9A 3UNGC 1L3VA 1NG7A 1I50J 1R49A 3OVNA 1TKZA 3REOA 4Y3OA 1EV7A 4ZZLA 1HYSA 4BEHA 3UKRB 1CZAN 2DA6A 2A05A 1FYMA 1Z6RA 5DYMA 3MN9A 2FOKA 3I58A 3CF5L 4IVNA 3LSPA 3RTRA 1QHAA 3AO4A 4IRHA 3LSTA 4EM2A 4LH5A 3L2CA 2AXLA 2YNGA 2GEMA 5GAGP 1B4AA 1ULYA 3CCSI 3BY5A 3OYEA 1MKMA 4DTOA 5CYMA 1GLLO 2L2OA 3DLLF 4IX7A 3B8AX 3QYFA 1T33A 4M9ZA 4KNYA 1KYZA 1FC3A 1VTNC 2DA1A 4DYCA 2PJRB 1XCBA 2O8FB 3SQ1A 3L4QA 2A3SA 2H94A 2ASPA 2O4GA 4IXCA 2NRWA 3HJFA 2FMYA 5CZ2A 3WODF 4ZC3A 3U1KA 4XIDA 3RZDJ 2BY2A 1A31A 1RFQA 4FHTA 4KFCA 1XWLA 4XLCA 2JA7J 3FLCO 2IA2A 3ENOA 4DV3K 1MD0A 1OH6A 3M9AA 1ZELA 2WBMA 3ZQFA 3F0CA 4BQOA 3TU5A 1BCOA 3HM8A 3ZMVA 1J7KA 4GV6A 1FSEA 2DQLA 3CJQB 2OCCH 3HGYA 3HRMA 4YORA 2E2HJ 2D1KA 2G8WA 4DCHA 2OA8A 4L5EA 2IVPA 1Y64A 4IOAL 2EX3A 3FWEA 1IV6A 4ON0A 3S8PA 2DODA 1R9TJ 5E1XA 3ZT4A 2R7TA 2R7SA 2A6HF 2CWEA 2ICWG 2RNJA 3CO6C 1FEXA 3KZBA 5K1YA 4NC7A 2YUSA 3FZHA 3IH4A 4HX8A 2WV1A 3LOCA 1LNWA 1BR1A 1X4PA 2E6MA 3U3YA 4CBUA 1MBEA 1OR7C 4CJ3A 3VQPA 1P7JA 1Z1DA 4YG2F 2HDDA 4IBNA 4CYCA 1DGWY 2B9SA 2KKOA 1BISA 1YJWI 2WWYA 4GVEA 4H03B 4I2PA 2HW3A 4HNTA 3ISPA 2M3AA 2HKOA 2LF8A 4IEIA 4CJLA 3B6PA 4FWLA 4BVOA 4CBXA 1J09A 2ME0A 3WUHA 4CCOA 4FWMA 2CH6A 4UVCA 4X6AJ 3QICA 1APLC 5BRFA 4BR7A 2RDPA 3D2EA 1ORKA 3OL3A 2WFBA 2ZJQL 1Q9XA 3J7AP 1NG6A 5BPDA 3WE3A 1YRNA 1HRHA 1NJZA 2H6CA 2K5CA 1Q18A 3MFKA 2W40A 3NHGA 3HOYJ 2Z9OA 1KZHA 4CJTA 1B59A 2DPNA 1Q1VA 2E5NA 2DQRA 3F8MA 4WQ5A 4BWMA 4U87A 2VC1A 1VQON 2RN2A 4NBQA 4O3MA 1HPMA 4WF2A 1KQ0A 3M6GA 2K86A 3DEUA 3BROA 3F6OA 1DUXC 4H4OA 3UKGA 1LV5A 2E7XA 1T05A 4M3TA 2DFEA 3RQ4A 4M9XA 4RLFA 5IT9Z 2IC3A 3HOSA 3QLHA 4Y0WA 3K4BA 2E1OA 3OL4A 4OWRB 1USSA 3LAPA 2HB5A 2Q3SA 3QODA 3OYGA 2IGKA 1I39A 1R0AA 2Z1DA 5BPMA 3VQ8A 3KEOA 4F93B 4NCAA 3DBRB 4A5NA 1L3UA 1S1WA 3E66A 3KKSA 2OPQA 2P5VA 4KAZA 4C3IJ 4XOPA 3FMSA 1Z05A 4C2MJ 1I6HJ 3AVGA 3K9KA 4RCHA 3DLLL 3T3FA 3DLBA 3H5NA 3MAJA 1ITYA 4M3DA 4E0DA 1G3WA 4O5FA 3ERED 4QPQA 4CCLA 1IRZA 5ICEA 3VQ6A 1TT0A 3SEQA 4M3YA 3HOWJ 5M1NA 3GF2A 3Q9VA 4BC3A 3VSKA 3AL0C 3QIPA 3RTVA 5CVIA 1U2WA 5E41A 1VQMN 4OLAA 2DA4A 1ZTRA 1AA7A 4WQ5C 2IA0A 2W48A 3CLQA 1Z91A 1YJ9I 4C8NA 1XNQK 4DW6A 4UUSB 3B73A 3FKIJ 1OCZH 3HRTA 4R1HA 2HF3A 2GXAA 2VQEK 1IKXA 4CIEA 4BS9A 4E4HA 5FRNA 2LK2A 1JCGA 2E34A 1NTCA 4CHYA 2XF5A 1UA1A 3GFJA 2L7KA 4ZYHA 4DU1A 2NVXJ 4BRCA 2KPMA 2EZKA 1D0YA 4LIVA 1K6OA 1FOXA 1VFCA 2UWMA 2B6AA 3F2KA 4JV5K 3B02A 3TAMA 1C1AA 3SK3A 4WF9L 3RSEA 3ZMUA 3EL2A 3ABLH 2B4JA 2MH2A 2PJRA 3BDPA 3GLLA 4C3HJ 4M3GA 3FHZA 4CJ4A 4DS5A 4BRGA 2MBFA 1B9DA 4CICA 4LK0F 2XY8A 2ZD1A 5LHIA 1NK2P 4AF1A 4L9JA 2QSFX 2NRHA 4RAYA 2LC2A 1ZARA 5CR4A 2LLKA 4FLZA 1VQLN 2MGQA 5K14A 2CUZA 4H5TA 2LF7A 3ERMA 2YV0X 4P96A 4JI8K 4CJKA 1Y6IA 2KL4A 1UFMA 4BGDA 2D0CA 3TAGA 4E89A 2P9PB 1ZGJA 4OPKA 1IDYA 3ASOH 5E3MA 2I7NA 5AQVA 1TQPA 1NJIO 1LWCA 3HBTA 3JRIA 2E2QA 1EETA 3O9UA 1T56A 1WJCA 2EA2A 2MSYA 3E0JB 3K4JA 3SDBA 1RDWX 1V4SA 4CFBA 2E5LK 3MZHA 2P51A 4GY2B 2QI2A 1KONA 1EF4A 1GVJA 3PSFA 4A6EA 4YIFA 2WB1A 4C2TA 3MWTA 3UKUB 2VC0A 4PDKA 4U7DA 1F5TA 4CHUA 2M0MA 4L0ZB 1VQLI 1WSIA 4C8KA 3ONQA 4L3QA 4NB5A 2EB7A 2JUGA 2YHYA 2JVHA 5FFXA 3M8QA 3EETA 4MIMA 1EH6A 3CUQA 1VSLA 3D45A 1R59O 1JE8A 4IRIA 3FM3A 4F7ZA 3L2WA 2D0OA 3HK2A 1YE9A 4RW4A 3M8RA 1C0UA 3KYCB 3CMAI 2OUMA 1XX5A 1GXPA 3EPZA 2EFQA 2KIUA 1RBTA 1QSLA 4EQQA 3J80Z 5CVRA 4LF5K 2A1SA 5BQTA 2O5RA 3NEUA 2LD5A 4CK2A 1RKTA 4NC8A 4CO8A 1WSJA 4MDAA 2EPFA 4H8KA 3K58A 2P9UA 2EFWA 1K4TA 1MNMC 3BR0A 3VEZA 5BR9A 4CHNA 4BDZA 2YX4A 4II3A 2KP6A 1KYWA 4EJWA 4FLXA 2ZSHB 1JLQA 5CQGA 3C1DA 3VA0A 2WC9A 5KGXA 1B72B 3ZSZA 3CMAN 4EV0A 1W7AA 2M8EA 1WI9A 2FNAA 5ILSA 1WLJA 1LWFA 1UWBA 3JW4A 2VJJA 3CCUN 4BXFA 2MD5A 1E17A 3RIRA 3R6SA 5ICGA 3TO9A 1JJ2M 3SUQA 1V5FA 3HM9A 2O8XA 3LP3A 4GV9A 1MU2A 4FZZA 1T0FC 1JUMA 4RGSA 1HUXA 2IVMA 1C0TA 2NVUB 1BHLA 1W7PD 1BA0A 3O9QA 3CUOA 2OCEA 3CP2A 5D5WB 3THYA 2RE2A 3RYPA 4H0TB 1YJWN 3VETA 5FROA 4BDPA 2P1JA 2ADUA 3WXLA 1OCCH 1GLCG 3FE1A 3KCCA 1W5SA 2NS8A 3OJUA 3TO6A 4EEFG 1TT5B 4NC6A 3JCUC 2G7UA 4UUTA 2M34A 1QZ5A 4OIOF 2LKPA 4FWPA 4CZFA 1QGPA 4JI4K 1NLVA 4PK4A 3IRQA 1BM9A 5CYQA 2WB1N 4LSNA 1KVBA 1KQ9A 3QMLA 5CY4A 2D5VA 2HDCA 3CJAA 2YI1A 4OMYA 4DQQA 1X9MA 5IY5H 3K7AJ 1BBYA 3LA2A 2HZTA 4MEYF 2L5QA 3MN6A 5TKWA 2OTJI 1VQ9I 2GAUA 4E7HA 1JTXA 4CE9A 1D5AA 2QSHX 3HSRA 2CQ7A 4AHTA 3MXIA 3DXKA 3L2VA 2BDPA 2IAIA 4C9YA 2IVOA 3H3ZA 2NXNB 3DPLC 3MAQA 4FYDA 3M8JA 4DV4K 1OH7A 1OYWA 2H3GX 1RT5A 5AQMA 4DQRA 3T8RA 4NHJA 2X6OA 2PBDA 2IXSA 2XAGA 5EEGA 3FZKA 5AZIA 3THVA 2QWWA 4GRIA 4C2UA 1GV5A 1RR8C 2G8HA 3AFHA 1QVTA 3MMYB 2KRHA 1A36A 2J5PA 4O0JA 1IN4A 2P9PA 2IGNA 4EJOA 3ZSWA 5F1XA 2PY5A 2DN0A 1QHTA 2HS5A 2Y9YA 4JK7A 2XHBA 1LUJB 1ZG5A 2E4LA 2I7PA 5FPEA 1OCRH 2VT2A 3C6HA 2P6TA 4M63C 1PUEE 4KMFA 1H9GA 4B1XB 4F8RA 4WXCA 2DFHA 2H8RA 3IWFA 3I4NJ 3QESA 3FBNB 1BI4B 1RETA 2BZTA 4UXNA 5J3LA 3V1RA 1U49A 4I01A 2VIXA 2XHKA 4MLHA 5C3EJ 3HXLA 1R5ID 1R71A 2CQQA 3RMCA 1J54A 3M1EA 2ZGZA 1SD4A 1Y0UA 2Q1ZB 3MQ0A 4J19A 1MMAA 1RBSA 3JR9A 3ZYYX 3J80O 1XNRK 2XPWA 2UZKA 3T1BA 4MDBA 5B3SH 1SV5A 3QO9A 1OLTA 3N4QA 3CF5F 3HXMA 2JUCA 2M9HA 2Q0RA 4JRQA 1N32K 1R4MB 2X51A 1ZRCA 5L3GA 2CGJA 1TTYA 1Z3YA 2ESNA 2PJPA 3A8YA 4FZXC 3S1RJ 3SDGA 5L3EA 3SPZA 2O8EA 1BIUA 3R6MA 4UUVA 4HSRA 2L54A 4ZJZA 4U67L 3RKYA 4FLWA 1XG1A 4XONA 4YRVA 1RDDA 1I3QJ 3DEEA 4PUSA 2HSTA 3ZP5A 4O8UA 4O4GA 1U5TA 4CJ7A 5EJCA 3KK2A 2EFOA 3RMDA 2X4HA 1D1CA 3IH3A 4DNCA 4HTUA 4Q48A 4I02A 2R5ZA 4DYQA 1VNDA 2JWLA 2CS3A 4QIWN 4E19A 5DM6F 2P9LB 3K5NA 3CCRN 3TABA 3CPEA 4ZYAA 3HTSB 2HU9A 1FTZA 3NF7A 3TP3A 1S5JA 1F4KA 1DDNA 3VEOA 2QA4N 3PNVA 2EH3A 1WJDA 3HUGB 4RA2A 5DDGA 5GTIC 3CERA 3QEIA 4NQWB 4GXOA 1EWQA 2FF6A 3AVNA 2V51B 2YSRA 5HLIA 4M3RA 1VQ5I 1WSUA 2W7NA 1VQ4N 2P81A 2Q8KA 1BC8C 1ZG1A 4XKCA 3TO7A 2WAFA 3Q0WA 1HA8A 1OVYA 1TKDA 1FTTA 2G8IA 2Q0UA 1R4NB 4HAMA 2YPRA 4L5JA 3GZ6A 1OVQA 5AQFA 4YOVA 1XMOK 3V8JA 2UUCK 1LB2A 1MBFA 4BRPA 3WXKA 2HQNA 3KK3A 5ILVA 4IWVA 3DKYA 3DBHB 1GHCA 4HRIA 1S8NA 2OPRA 4BRFA 5KPZA 4HV5A 1ASWA 2ZWHA 3V7RA 3V4GA 2YNIA 2A68F 2JK3A 3CJ7A 4YIIA 5BPNA 2HQ5A 4CDGA 3ATVA 4UNOA 3ALYA 1V3FA 3DTIA 4E7LA 2XRLA 4QSHA 3L09A 2ZNYA 1YOVB 1R1VA 5LGTA 1SVLA 2LRDA 3KZYA 1W97L 3AVFA 4CIFA 2OYQA 2B5JA 3WT0A 4IHVA 1XGNA 3T19A 3TTDA 3FZMA 2DA3A 3ZX2A 4JS4A 3BDDA 3S3MA 1KU2A 4ZDLA 1J2XA 1IV0A 4L5IA 3Q7CA 3NVKA 1JTYA 3DWLA 4W1UA 1ZREA 4C1NI 3I0RA 3VQBA 2VLAA 3NH0A 4KI4A 4DTMA 3KPHA 4DU4A 3C2GA 1FKOA 3PY8A 5K7FA 1JGGA 4U88A 1AWCA 3H9GA 4B9VA 3U3GA 4XRSG 4IHSA 3P7NA 4CA0A 1AU7A 3C0BA 4TV7A 3MECA 3KE2A 1D8KA 1XN7A 3ROUA 4GDFA 1XGMA 3I8BA 5E26A 5KAIC 4DF8A 2Y1IA 2E1MC 2QXFA 5DK5A 2OQRA 4DZPA 2STWA 4PY5A 1BW6A 1D8JA 1MWKA 3AA4A 1IBMK 2OZSA 1CZ9A 2DY4A 2OZMA 4CEZA 4DZJA 2MLGA 3ATUA 1U5TC 5M5YJ 3MEDA 3VEWA 4CF0A 2Y1JA 3NBPA 4CF1A 3CCJN 2VWJA 3LSKA 3CCLN 3WHBA 1Z25A 4D7NA 2CFOA 4FW2A 4F91B 4G7HF 3G1LA 2VQLA 5DUKA 2GTDA 4NYFA 4XNFA 1ETVA 1MBJA 2BGCA 1OCPA 2XGEA 4FQGA 5FKNA 1SZ2A 5HRRA 5FPMA 4CK3A 3QEPA 2L9SA 2FEZA 2LSOA 2XIGA 1VQMI 2NRAC 3RDIA 1X3UA 3I33A 4H0YB 4LOCA 4K0KK 2LNBA 3ZQGA 9ANTA 2GQQA 3QQAA 2EA4A 3C3WA 1SAZA 4PUOA 1NGFA 5CJ9A 5EF6A 3BPVA 3M8FA 1GT0C 1HDDC 1N6QA 4JI1K 3HPOA 2P5KA 4BR9A 4B47A 1GLDG 3I55N 4JKFA 5IT9O 2MC4A 2JSPA 1BL3A 5HLGA 3CCJI 5FLXK 2BY1A 2NOJB 2E19A 3CCLI 2A40A 3WGIA 1JUPA 2Y2ZA 5C4JJ 1Q1HA 3PO5A 4BBSJ 3UIQA 3LL3A 1QQMA 3LSIA 5E18F 1QQNA 4IQ4A 4WX9A 1QVFM 4BQLA 2XAHA 4KB1A 4I99C 1T6CA 1IN6A 3UR3C 5AQJA 2HTSA 2RKHA 2IS2A 3HKZN 1TLHB 2DJIA 5DCMA 1OCOH 2JRMA 2Z33A 1WJ5A 2XGXA 2JWKA 3EO3A 1SFUA 4ITVA 3D2EB 1WJFA 3G6EN 3KWIA 4DSKA 3J7AO 3T8TA 1IG7A 2L4MA 1H8AC 4XICA 4ENJA 3HRGA 3PQJA 1LPQA 2VBWA 1G59A 3TP0A 1JCEA 1IXRC 1W36C 1FMVA 1NOZA 2GIVA 4XH5A 1BI3A 3SYZA 4BC5A 1E3MA 2M87A 3CESA 3KEQA 2Y0MA 3FDYA 4ILJA 1MSEC 2HGCA 4MO5A 1FBSA 1HSJA 2L01A 4FCYA 3CQZJ 2F4VK 4CECA 4DTXA 5LRRA 3CF2A 1BA5A 5AQXA 3I0SA 2CUFA 4MHGA 2F4IA 2OPTA 2W84A 2VJ4A 2IRFG 1NGAA 1BDGA 4RGUA 3K6GA 3T1AA 1WJBA 3W6JB 1NK0A 2Z1IA 3V1OA 3K4KA 1F36A 3L2RA 2PFBA 4II2A 1ZAOA 4HX4A 3AAQA 5AQRA 4BRMA 3KLFA 4FLVA 2UUAK 2EBIA 1XB4A 3Q9SA 4N9HA 2XAJA 2CQNA 4WXHA 1JT0A 2HBKA 3HHGA 1BWFO 1ATRA 1RDBA 3HL2A 1MDMB 3L7WA 4LIUA 4IHXA 1FMWA 4CF8A 1T8EA 1E4GT 3DP7A 3O8HA 4CW7B 4FJXA 3KLNA 3TOAA 5GPCA 2R7VA 3A5OC 5TGTA 3OYIA 5J1UA 5M1OA 4BBRJ 2VG5A 4MQVA 3HKZA 2KZGA 1HQEA 2ID3A 3ULDA 2EIJH 2N8GA 2VJ5A 2ZJPF 1S7AA 2NVQJ 3IKMA 1I6XA 1HKTA 1HNXK 3VSLA 3A5LC 2ZM6K 2PZSA 3VQEA 3MKLA 3QYEA 3QNNA 1T98A 1W9HA 3WU1B 5J2PA 4DHYA 4P9UA 1VSHA 1FIPA 3H3UA 3CMEN 5ADXH 3ZLJA 5JI6A 4K41A 4QPOA 5AQOA 4XKVA 3SMPA 2VBYA 4GCVA 4HLYA 2M7BA 1QPIA 1NGCA 4LG0A 4E1JA 4ELUA 3T5XA 3AKZA 4J2DA 2HYFA 2NLXA 3NE6A 1ZLKA 3JTHA 5IYDJ 2KFZA 1QZEA 3HVRA 1S7EA 2L9NA 3CCEN 5EXWA 5C2DA 3CC7N 5M1KA 2EILH 1NMNA 1NGBA 4JLHA 1HW5A 1S1XA 2A5WA 5FLXO 2KTQA 1TNTA 4KHNA 3WNHA 5E1WA 5T7BA 4S05A 2GXGA 3MVPA 1KAZA 2NRVA 2YHBA 4EMSA 3E1YA 3ZSOA 1XC5A 2FQ4A 4Q5VA 2V52B 4N0BA 4FWNA 4B3TK 1FP2A 1Y0NA 1HXDA 1TV6A 3O4NA 2EV0A 1NGHA 2DYRH 1SC7A 1DT9A 3ZX0A 1IKYA 3WTZA 4XSZF 3H92A 3BY6A 3M1CA 3F72A 4YDUA 4BR2A 2ECBA 3U9GA 3LSRA 2GX9A 3S16J 1SQKA 2H8WA 3NF8A 3TMOA 4XH4A 2F6CA 2DA7A 3ZCMA 4BKXA 1WSHA 4XM3A 1JLAA 3EDPA 3BF1A 1G8XA 3NWSA 2HYGD 3LPUA 4GW6A 1WBBA 4KUMA 1W7PB 2XROA 2OD5A 4HW0A 4PZJA 2RF2A 1I94K 3KTQA 1LVAA 1J5YA 4HOBA 2JQ7A 1QA6A 1D3YA 4Z6YA 4GO1A 2NVTJ 2O9LA 5IT9K 1RT1A 4ILHA 1PJRA 1RI7A 5C42A 1J75A 3J7ZO 4MLOA 5KQ8A 4CJVA 4CI6A 1VQ9N 1DTTA 2P5LC 1RIOH 3F8BA 3BEXA 3C7NA 4E1NA 1KQSM 3I9V2 1FSHA 4D7MA 1HNWK 4U0WA 2IP2A 3ZSQA 2RNGA 4HBLA 4FWRA 5LRSA 4JI6K 2LY2A 2W6KA 5HS7A 3FM5A 3BR3A 1UAAA 2DYSH 5L3CA 4ETSA 1HLVA 4CGDA 4DOZA 2OZUA 4F52A 1VQOI 1QSSA 1QZZA 1GOAA 2WAQA 1YTYA 2E35A 4BYYA 5E84A 2DMNA 2RC4A 4CYCB 1YHQI 3GWZA 3PM1A 1VF9A 1RTHA 1ATNA 4PL7A 3K70C 4PGHA 1KU7A 1MDUB 2QBYB 4DTPA 3C7NB 3EYIA 3DJCA 4KI6A 1XDSA 4DBQA 3K70D 3C6AA 3IG1A 2QWLA 1IZ1A 3CMMA 1EXQA 1C1CA 5J6XA 3DI6A 3GG4A 4OKEA 1IG8A 5FD6A 1K83J 2Y9ZA 2AS5F 3ZQLA 5AQYA 1NOYA 4DV0K 4JEPA 4BHCA 5KNLA 3AA5X 3QBXA 3LFUA 3ZN0A 1SFOJ 3SZPA 4P1WA 3CC4I 2ZJ2A 1NGDA 3CMYA 4FE7A 3F21A 4YFUA 2ZJRF 5HBMA 4WE1A 4CJFA 4M6XA 4FLYA 4X0GA 2Y30A 1RILA 3GTQJ 1BW5A 3ZGKA 3QRFF 1P8ZA 1HBXG 3S41A 4A3FJ 1NK5A 2QXLA 5LLQA 3HVTA 3H3NO 2R4GA 4ASNA 3EUAA 5K5RA 4FM1A 5FD5A 3KZIC 1XMAA 4XIUA 2JVGA 2K27A 3ML6A 3WU2C 2FQ3A 3S1NJ 3J7YJ 2KRFA 4KFBA 4LMYA 1K61A 3AA3A 5FRMA 4AD9A 3FMRA 2CUEA 1HKGA 2H6BA 2YKNA 2M30A 2QYOA 4HWIA 3PUFA 3O8GA 2XSDC 1EWRA 2JLEA 2BY3A 3AVIA 4FJJA 2YHXA 1IC8A 3QIOA 3TSUA 4A2AA 2DTUA 3KETA 2CUJA 2DDAA 1YT3A 4Q5SF 1JXSA 5E8GA 1E3HA 3VGMA 2CO5A 1O7LA 1WGXA 5AQHA 2P4WA 2EQRA 4NNJA 4RGXA 1XDUA 4BU2A 3FGUA 3U8XA 1WHUA 1MMSA 5F08A 1R00A 5EG0A 2F48A 3AO2A 2G7HA 1S7OA 3E7LA 4RB3C 1HNIA 3HPHA 4M7YA 4CJQA 1J0RA 5EYRA 4KHPK 2JTVA 3IHUA 5C4XJ 4UB8C 3VERA 3SQ2A 1RDAA 3IKVA 1O3RA 1YAGA 5BMZA 4Y33A 3PIPF 1BA1A 3PO4A 5IYBJ 2HNDA 3VQ7A 4FT8A 3VOVA 4BVPA 4I7HA 1TKXA 4YELA 1HDPA 2QWOA 2BW3A 2DFIA 2P9KA 2R3SA 3K1PA 4QAGA 1U8RA 3LA7A 1N75A 3IRXA 3LFKA 2VPRA 3N4PA 5EOYA 5JS1A 3HTUA 3N97A 2WONA 3A01A 3MZYA 5H20A 2R93J 3S3NA 2MC3A 4PKIA 4CGIA 3SJMA 3JYTA 4RS8A 3HOTA 1ZLJA 3EZ5A 1LJ9A 2V1XA 1KXPA 4G6TB 1U6ZA 1MMGA 2FBIA 2ZJPL 2Y31A 2QUFA 4AIJA 5LBQA 4CHZA 2HMPA 1KTQA 3DM2A 2CMPA 1FOYA 1BCMA 3OYCA 4WFAL 1ZK8A 4L9VA 2LY9A 2XB5A 2BANA 3MMVA 5HLFA 3I56N 1DPRA 4BHBA 6PAXA 2H1KA 5LY3A 4F2RA 3HDDA 4LITA 1K7AA 1X1AA 2F9TA 3HUGA 3KLHA 3FXOA 2BYVE 4XMYA 4LB6B 1MDMA 3TR8A 3OYBA 3CUQB 2AXTC 3FXKA 3LQQA 4U7BA 3RZOJ 1ZC6A 3P31A 4EIAA 2O4IA 1EKEA 1KVAA 3WXJA 3KFWX 5LHHA 4HA8A 1U9NA 3ZMDA 4AIHA 1SKRA 4FJKA 4OLBA 1YW9A 1Y1VJ 3IRRA 2GUIA 3ZT2A 2UU9K 2LKSA 5AQZA 1KSPA 4X62K 2F5CA 2EZHA 3ABUA 2L02A 4KH5A 3BR2A 4DU3A 2H1LA 4H5RA 4DR2K 2FC0A 5J2NA 1BJAA 2O8CB 3DKWA 3NAUA 3OSGA 4W5OA 5DTDA 3BOQA 3W6KB 3HYFA 2O61A 3DBLB 4CGHA 1ZYQA 3LSMA 2CU7A 4BH9A 4J01A 4L18B 2YJFA 4JI7K 2M4KA 3V42A 3I55I 2XKOA 1M1EB 4HDVA 3LDPA 3MDQA 3ECOA 4A57A 3DU5A 3O1WA 3SJJA 4NYNA 4LF4K 4ESJA 2CGKA 3JAMZ 1T39A 4OOIA 1TWAJ 1O1WA 5AQKA 1P4XA 2ITGA 4XRSA 4CEFA 2JA5J 2HPMA 4H0VB 2VQFK 3CCYA 3DLHA 4GYGA 4DYRA 2V6EA 4J00A 4B9UA 5HROA 5JS2A 1Z0XA 2BXYA 3OYMA 1JLBA 2QQ9A 4PA1A 5EGOB 2FBVA 2F9WA 2WADA 1IRXA 4M6YA 4YY3K 3EUKL 4Y13A 1KU3A 1UG2A 1Q81O 3LP1A 2OTLN 1LDKB 3EN9A 2JPBA 5DM7L 3CETA 3VODA 4DSJA 3KD1E 2PLYA 2IBDA 2ZXWH 2V9PA 2PI0A 4RWTA 3T7ZA 3CD6N 1KLMA 3OV8A 2IVNA 3NH2A 3J7ZI 4H0OA 4MFDA 4NLCA 1YX5A 1XD7A 1BR4A 3F8FA 3V8KA 4H5VA 4A2BA 2XAUA 3K4MA 5C0YA 4KN4X 1W0UA 4FW1A 1KU9A 4F9OA 1WOQA 3OYDA 4ILGB 3I53A 4LD0A 2W24A 2XDVA 2XGDA 4IXAA 3ENHA 1VQ6I 4LF6K 2JA8J 2X9DA 3AVAA 2M8GX 4KH6A 2DOFA 2AQFA 1O57A 4EVIA 5D6FA 2KFNA 4LD5A 4N47A 3DWLE 2P9SB 4IOCF 4HF0A 3CD6I 3SCXA 4J2AA 4LF8K 1ZH5A 4CEDA 4FJHA 2CG4A 5E20A 3SNNA 2X74A 3A5MC 5HLHA 1ITGA 2E2IJ 3PSIA 2R7DA 4PJLA 2CGPA 4Y15A 3S93A 2IAJA 3ZT0A 4FK0A 3Q7BA 4M6VA 4B9LA 2WBNA 2F5FA 5IP9J 5CHIA 3MCPA 2O6GE 1X58A 2HOEA 2TRTA 3KEYA 5AZIB 4BGBA 3JSOA 1SFKA 5J2MA 3PX0A 5E3LA 1ODDA 1QSYA 4CVNE 2Y69H 1N8RO 4OMZA 5DEQA 3A2FA 1SS6A 2LYCA 2YS9A 2DTZA 5BPIA 2QSGX 1MBHA 3CCEI 1STZA 4Y7NJ 4OIQF 1WJAA 2JGUA 2QWQA 4IDKA 4AHRA 4CFAA 4CZEA 2IPQX 1RDCA 2X6XA 4B9TA 2R7RA 2KDOA 3L2UA 2GWKA 3ENBA 3K4LA 1Z67A 1NGIA 2OPPA 1N33K 3FXJA 3THWA 4I2QA 2E60A 4FJ7A 2HTJA 5D5VB 3ULQB 1PUFA 2ZXIA 3JXUA 5IP6A 2RN7A 2HNHA 4HLXA 2GIZA 2ME6A 4ANJA 3WTVC 3G4SI 4A3CJ 4FPAA 2KKZA 2LBFA 3SZTA 1ZN2A 3DXMA 3O9TA 4I6MB 2JWTA 1EH7A 1T95A 1GDTA 4CFCA 5BREA 1D1AA 3PFYA 2ZNZA 3KLOA 4N4OB 4M71A 5ICFA 1TP4A 4A3DJ 4DR7K 2IA1A 1OR7A 1Y8QB 1RKWA 2IW5A 5DD8A 3F22A 5TJJA 3FBIB 2J5OA 2KMUA 1YJNI 1HW2A 4A93J 3FZLA 5JVGL 4D5CA 2M1BA 1NMDA 1IG9A 1HYZA 5M5XJ 3J7AY 4XLAA 3TBIA 5EZGA 2GBZA 3G10A 3EKUA 1SFEA 1KVCA 2DT6A 4JBAA 1J5EK 3OOUA 2HHUA 3N05A 3QPLA 1G6NA 1WNSA 1UA0A 2XPVA 4YOYA 2F5EA 4QTRA 2FBTA 4YDUC 4RG8A 5AQTA 2L7MP 4CYDA 3PX4A 1ZBLA 2HXOA 4KTZA 4NQWA 2BH1A 3VEVA 1NKCA 2V7FA 3H9JA 3MCAB 5HNHA 1S22A 3SPYA 4M3ZA 4KIGA 3D5RC 3ZXSA 3WTSC 2XC7A 3AVLA 5A2QO 3RR7A 1ONVA 1YJNN 1SKSA 4PFPA 4O8KA 5HOOA 3ZMZA 5FB2A 1JL2A 3J81Z 3AARA 4FVUA 2G0EA 3MCZA 3PFIA 1SUQA 1JJ8C 3D6RA 2LG4A 3RRGA 2UXCK 1X3ZB 1TK0A 4P5OA 3NGZA 4G1QA 4CZJA 1E4FT 3FMQA 1XPXA 4CZMA 3K1MA 1BQNA 1UELB 4CHQA 1N34K 1YHQN 4ELTA 3HC7A 5DCFA 3UE5A 3ZT1A 4N76A 2I10A 3WTXC 4XN0A 1VSJA 2BVLA 4LLGF 5HRNA 5AONA 2QM1A 3ABKH 3NFAA 3LM9A 3SZ2A 5CVUA 2O8CA 1U5TB 4N4NB 3J7YP 2D2WA 3QDKA 3B6AA 3OYKA 1QVGM 1NNEA 4FWOA 3VYRB 5GP9A 5D5XB 3TKYA 4QS7A 3ASNH 4JX4A 3CFOA 3G2BA 4Q47A 1AOYA 2XUBA 2NRZA 4IO9F 5B1AH 4C23A 1YW7A 4DV5K 1Y56A 4B3MK 3NVMA 3FIWA 1BUPA 2QVOA 1MBKA 2QZ8A 2OA4A 2W57A 1VHXA 4C8MA 4LG3A 3T69A 3IMXA 4JOMA 3V7CA 4K8ZA 4EFHA 5D6EA 3SBGA 1L3SA 2E5ZA 2R0QC 1MNDA 1F43A 3VYSB 1UAXA 2TCTA 1V5EA 3VQ4A 2RREA 4B1RA 3NGIA 1NJXA 3AY9A 1IUYA 4AH9A 1SANA 3IUOA 1D5VA 1JLEA 3JS6A 2K3FA 4DR4K 4B1ZA 5DS9A 1G4DA 1HOMA 3K57A 4Z4IA 3KYDB 1W5TA 3B6OA 4AHVA 4DUZK 4DQIA 4B3AA 2GBYA 5J1YA 1GVDA 3IP4B 4HPQA 4D0PA 3PO3J 1NK3P 5IT3A 1DKGD 3DRPA 2OAZA 4N41A 4ENNA 3IC7A 4OPAA 4ESFA 1V4TA 2HVSA 4RW8A 5M1PA 4CJSA 1ZR4A 2R5YB 1YYVA 4BC4A 3NDKA 3RMBA 2OQGA 1HSTA 3OS0A 2DCEA 2DK8A 3DRRA 4P55A 1HR0K 1TWCJ 2E1YA 1X2MA 4CEQA 3P5JA 5LGNA 2BV6A 5GAHP 1XI1A 5KPTA 1S9GA 3S32A 1IN8A 1FNNA 5GIOA 4EHTA 2DMQA 2MABA 2V9KA 3OBYA 1K79A 1MSFC 3SV3A 2DI3A 1FOWA 2HFHA 4HF1A 3CC2N 4LF7K 3GZNB 4FJLA 3GTGJ 2NOGA 2PMHA 5C24A 2QWRA 1RTDA 3VEPA 2NRRA 5F0XA 4F4KA 3ZSYA 2RHKA 4WQ4A 1WH7A 2GWRA 1CZBA 1HJRA 3RRHA 3QPSA 4K42A 2K4JA 2QLZA 5CLSA 4G7ZF 2JN6A 4ZTFA 1YW8A 2KJCA 1VSMA 2RPIA 2VCPA 4ISGA 4EP4A 1MNEA 3SV4A 4HYEA 3ZSXA 3BZ6A 3MX2A 1VQ7N 3SAHA 2K9NA 1D9FA 2DOEA 3E6CC 3R4KA 3SXYA 4JHDA 4B1VA 3R0AA 3CQXA 3OY9A 4RB0A 1JL1A 2HBLA 3LDNA 1JGSA 4UV9A 3N4MA 2O0YA 4M9SA 2IS6A 2Y0SA 4KT6A 5D4SA 4AHCA 4YFNF 3SZGA 3CJBA 5AFUH 4YOWA 3SUNA 1XC3A 1JXEA 3T1YK 5AZJB 1T8IA 1RDUA 3FFKB 5FFZA 3L3UA 4ID1A 1PP7U 3KLGA 4LFUA 3VQDA 1QHHD 5AFUA 4IOCL 2ISZA 2QWNA 4Y1DA 1UHSA 5HRPA 1PDNC 2HWVA 4GKKK 3RPUD 1JT6A 1LW2A 2FBHA 2VASA 1Z7UA 1A5WA 3JRFA 4B48A 1CF7B 3Q0VA 1TAQA 2X6SA 4H0EA 3V9SA 3V9XA 2K9QA 4EJUA 1DQUA 4M3EA 2X1CA 3VQ9A 4F3QA 2O7OA 2ZXHA 2GV9A 1MMDA 3CJTB 2ZMEC 3GFIA 3CCUI 2E2NA 3VESA 5KPRA 1V5GA 1XS9A 1TQIA 1LQ1A 1P92A 5I42A 1ETXA 2Q97A 3DRSA 1K78A 1T2KA 1Q9YA 4QOZB 3QP5A 4M3WA 3CMEI 5JR3A 1FYKA 1S1TA 3D5SC 4EZ6A 1YITI 1VSDA 4XEIA 3WXIA 1USTA 2DTRA 3ZMTA 2ZGYA 1T0FA 4BL0B 3T0YA 2JMWA 5F64A 4AQYK 2G8FA 1R7JA 1LFBA 2VPLA 2UUZA 4I0AA 3ZRGA 3S2WA 3CDHA 4B3XA 5I3UA 1X1DA 1YS6A 3GW2A 1JCFA 1MZBA 4R8HA 2PAVA 3KP6A 1HNVA 5FDLA 4HSTA 4F3OA 5HNFA 4EHUA 5GAGJ 3LP2A 1J5OA 2X0LA 1O13A 4EP5A 3M07A 3WGHA 1B9NA 1J59A 3BUZB 4NXNK 4WWCA 2UUBK 3E9OA 2ZB9A 1RTIA 1FX7A 3VF6A 4B1UB 4A3IJ 2VI6A 3MZ8A 2R7WA 3O9SA 4AM6A 4HG2A 1X3NA 3FZFA 3A0BC 4BREA 3ZEUA 2FBKA 2HQRA 2VQHA 4HZFA 2V7YA 1D9DA 1AKHB 3C6UA 1VQPI 4F3TA 4CXFA 1ASUA 2VKVA 3MK6A 5ED4A 1EA3A 2KZMA 1Q86O 2RAEA 2HPIA 1MJBA 3JRCA 1OMIA 1TBXA 3O4QA 4W5RA 3L00A 4G6QA 4XLFA 5FKMA 2XKPA 4EJTA 3CIPA 3DTEA 1NH3A 2HOSA 2WAEA 5K5OA 1DU6A 4E7ZA 1K8KA 1Q7YO 2AA4A 3NH1A 4N5SA 3PNTA 4AC0A 3LDOA 3LZIA 1X19A 4BY7J 4ZDPA 3BC8A 2XASA 2R92J 2QQ8A 1LEBA 5BS6A 3DOLA 5LMNK 4BY9C 1XMKA 4BRNA 2WUSA 4QWQA 3A4CA 1VRUA 3RSEB 1PUFB 1Y97A 2DW4A 1PYVA 2M4GA 1OH8A 3CYMA 3F5TA 3HSTB 1RGIA 3P83D 3BTIA 5DM6L 3CUQC 3M3YJ 5EDNA 5EX5A 1UJ8A 2NVYJ 2OZ6A 2XSJC 3D2FA 3OR1C 1LFPA 4M41A 3CPWM 3K1NA 1RR7A 3DXJF 4KN7X 1YFHA 3HOUJ 1K8KB 3CI5A 1FPQA 4MQ9F 3OWTA 3R0JA 2X1EA 3A02A 2GXBA 2XVCA 3F9KA 1O4XA 4B3OA 2Y75A 1TWFJ 2VOOA 2IS1A 4UHTA 3FFIA 1XUPO 3AVBA 3E6MA 2VKEA 4M3XA 3FK7A 3O3HA 4KHYA 1WSEA 2G8UA 1FP1D 3OYAA 3LSGA 3DKXA 2LREA 4A3KJ 4Z4FA 1TC3C 4Z2YA 4CCNA 2KW4A 3VENA 4JI0K 4P9FA 4PJJA 3DPUA 3GFMA 1G99A 4RBOA 3H46O 4LH4A 4X66K 1JLCA 4DLGA 1C0WA 4Q0BA 1CLQA 1SVMA 4WK8F 3AGKA 3GYHX 3U1DA 4UVBA 4FJ8A 5BPLA 4EGYA 4UY8I 1ZRDA 1LDDA 3P4IA 4TSXA 1K6YA 1EH8A 1W0HA 4K25A 1ZGAA 4XORA 1RC9A 1HKSA 5LD2C 5F0HA 3GLXA 1ESVA 2K9LA 5AQGA 1TAUA 2FNPA 3KLEA 4N9IA 3NMUA 2W82A 3RKWA 3HSFA 3HM5A 1GUUA 3KIOA 5C12A 4IJAA 3AG2H 1DEJA 1IN5A 4H4MA 3RWUA 4PWDA 2VUMJ 1K8AO 2Z1GA 4JK1X 2CGLA 2KZVA 3KP4A 1RT2A 1IXSB 2CYYA 1YI2N 2LH9A 1NK4A 3WHCA 4JHDB 1HKBA 5EU7A 4YHHK 3QETA 3V9UA 3SJHA 4ENKA 2A5YB 3VOEA 5EGOA 1JKQC 3S17J 2V7ZA 2HOTA 4B8CA 3LSHA 4JX6A 3LQRA 2A6AA 3MEGA 4DR3K 1MA9B 3RR8A 3GOIA 4BQAA 4WQ4C 1W5CC 3H1QA 4V19S 4I6ZA 3IAS2 4IKFA 3G4SN 2HBMA 2C6YA 4FM0A 4QS9A 2P9NA 4M3BA 3LSJA 4GGGA 1OKRA 3L0QA 2GA2A 3KP5A 1ZYRF 1QPMA 3QFPA 3LALA 4FM2A 1HKCA 2EJRA 1VQ6N 4IFYA 1VQ8I 1GLBG 2Z1JA 3CC7I 4BRDA 1KCFA 2HVRA 2DAOA 2E36A 3CJNA 4D1QA 2D45A 4IHTA 2P9LA 3ID8A 1IF1A 4I2OA 1QNTA 4IL6C 4F55A 3TW6A 1A6QA 1ASVA 2QWMA 3TW7A 4A12A 3CXCM 4A0ZA 3A0HC 2ZMEB 3GO5A 4E70A 1QU3A 2K3PA 2L0KA 3E3VA 3BGRA 1XSXA 4BQNA 3E5XA 1IGNA 1HPZA 3BQZA 4AYBA 3GE1A 2L3DA 2QM3A 1VQNI 3DXMB 2UYTA 4RM2A 4IO8A 5IPAA 4LSLA 1X1CA 4A62A 4PHTX 3DFGA 3EYZA 3LDLA 2FSWA 4NXMK 2FXAA 5JLXA 5JHUA 4BAYA 3ELKA 2QQAA 4HV6A 3M4OJ 4CCJA 4BRHA 1G3YA 1VQ8N 1WZ2A 4ZYDA 3S15J 3MX5A 3RYRA 2KISA 4E7KA 1K73O 3CTAA 4IF4A 4OKJA 5GADJ 3K5MA 3RMAA 4MGRA 4EATA 4XLPF 4UV8A 2O8FA 3AAFA 4O5VA 4C30A 2D5RA 2GA1A 1XGSA 1NHAA 4L0YB 3CFPA 1NGEA 3M8PA 1D1BA 2WC2A 1KQ8A 3KKRA 3FK6A 4CSWA 3QU3A 4FX0A 1B8IB 2AP1A 4CF2A 1TNSA 2L9VA 4D9JA 3ZQIA 2FOWA 1ZRFA 3H36A 3TGNA 3MWPA 5H6QA 4BDYA 1QQOA 2IIRA 2HEOA 2OBPA 1BC7C 4A6DA 4I7FA 1IDZA 4CHOA 2JJ7A 4H5WA 1RRJA 3K0SA 5IOYA 3K4CA 2CW0F 3E97A 2W41A 4IEEA 3TSQA 2E6LA 1YRNB 3VGLA 3ZEUB 4YOXA 1LFUP 2EFPA 4X64K 4FK4A 3ZX3A 1F21A 2P9IA 4DTSA 2AJQA 3V1QA 4BQQA 4M45A 4BHPA 1SL0A 2IS3A 4DSLA 5JHFA 4I9QA 4XN3A 3WTYC 2CV2A 4J2BA 1B92A 4M74A 3LWLA 3DXKB 1YJ9N 1DPUA 1JKHA 4DLEA 5JLFA 2IGIA 3THXA 5F0CA 1YQAA 3WTTC 1IRGA 1WKMA 4CGFA 3U21A 1ETQA 1BN5A 2PMZA 1VRTA 1U2VB 3FXMA 1CXUA 4A59A 2DPDA 2K7LA 1K9MO 4XL9A 3CM5A 2DT7B 2AO9A 2ELHA 5M3FJ 1RCHA 1BOBA 3NARA 3VMFB 3CFRA 3CJ1A 1SEUA 4ESBA 5HP1A 1ZBIA 1U9OA 5DCMB 4A2UA 1K78B 3ZQHA 4KPYA 5L3FA 1OYIA 1PVEA 1S6LA 1DTQA 4IZZA 4Z4GA 4RTFD 2HOAA 1ILYA 2LFBA 4FO0A 2ZC2A 3JAMO 2KQ2A 4Z4EA 3C6TA 1OH5A 4OO1J 2D0PA 2VYPA 1O7FA 1FBQA 3SFZA 4DTUA 1D8YA 4HQEA 4ZZDA 1X3MA 2BW3B 2YR2A 2VXDA 5HODA 2O8KA 4IDHA 3THYB 2P5GA 3IH2A 3ZPLA 2A5XA 3M1FA 3D5LA 3FXUA 4I09A 4IG0A 4KIBA 2ASMA 2M45A 4BXUA 2E1ZA 4PCQA 4LC9B 2HKXA 3HBLA 3S2DJ 2NZTA 4KJZA 3BCAA 4MTEA 3AGRA 1JXBA 3CQ8A 5KAFC 4FJGA 4M73A 2PQ8A 4YEJA 2COMA 4R79A 1MJAA 1PP8F 2XAQA 5M3MJ 4HCBA 2HHTA 3ZR8X 4PFOA 2K9MA 5GTHC 5M1QA 1BOTO 4MFEA 1ZBSA 3KJVA 3EEQA 2BVMA 3OYLA 3H3OB 2AQEA 4N56A 1N36K 2BHYA 5D5UB 4AM3A 5EEHA 2LOOA 3SUPA 5KCMA 5D8KB 4JKCA 2ZMEA 4RAZA 5K5QA 4W5NA 1SAXA 2IT0A 4FJIA 2NRXA 5B5EC 4CGZA 2QENA 2NNNA 3TSPA 1VSFA 4PSXA 2Z2SB 3FHNA 3P39A 5KTQA 3X2QH 1ZGWA 3M5RA 3ZSRA 5F0FA 4DG1A 4RAFA 2DMTA 3KK1A 4HVJA 1YI2I 1A35A 1C6VA 1YITN 3HB9A 2Q31A 5BRDA 3TQNA 1WI3A 1FIAA 2YX6A 3DOKA 3KK7A 4BQZA 4FVMA 2VKDA 2DBBA 2LY1A 1BI4A 3CQYA 4QCLA 4M42A 3C2HA 4ZYGA 4BG9A 1MJ9A 4DIQA 5ICCA 3ZQCA 1S1UA 4BE1A 2YNHA 3LL7A 4A3MJ 1E3OC 1QZ6A 3WXMB 1P4AA 4LB5A 4C8LA 3P9KA 2ITMA 4CJEA 1BO5O 5E1ZB 3DEWA 1LWEA 4DWIA 1U3EM 1O3SA 2BTFA 2E1MB 3AL0B 2QA4I 2FE3A 3DLKA 4OJRA 1IBLK 5HDKA 4MNUA 4GKJK 4OIPF 4IZ9A 4BRAA 3O6BB 2FUG2 2EIMH 3PV8A 3VEXA 2A3ZA 4Y4RA 3AVJA 2DMPA 5IOZA 2WTUA 3AVKA 4KHSA 1SD5A 2NS0A 5B1BH 2O03A 2RGVA 1T3VA 1QZYA 3TPQA 3WNFA 3H9QA 3BZCA 3L2QA 4CGGA 3GBGA 1QE1A 1UB9A 4KTWA 1DGRM 4YFXF 1W1WE 2VBXA 3P1GA 4BRKA 2UXDK 1DU0A 3HI0A 3J81K 1BIZA 4KHUA 1J9IA 3I3LA 3RQIA 1NU0A 1S6QA 1VQNN 2O8DA 4DF4A 1JLGA 4IQJA 4Q4ZF 3H3VK 5SWMA 3FXRA 3V9WA 1IKVA 1A5VA 1XSDA 1L3TA 3V7SA 1CXQA 4Z4HA 1T6DA 1WN7A 1FXXA 1WFXA 2BE5F 2Q1NA 3IS9A 4EZ9A 1DP7P 3BG6A 5H1SQ 3T1HK 1SAUA 1NK8A 3GBTA 4NDLA 1Z6TA 1ERDA 4KHWA 2JSCA 5C44J 2BUPA 4OPHA 1MIJA 2R7ZJ 3TWHA 1Y8RB 1QHGA 3RJPA 4FLUA 4M3UA 4DQ8A 3OYJA 3P38A 2X6NA 4A69C 3R8EA 3E9PA 2QQBA 3BQYA 3M7GA 3MEXA 1YIOA 2Y48A 4GMJB 1RT7A 3QOEA 5LJWA 4BEHB 3L4IA 1V4RA 1R6RA 3UKRA 4CJWA 3RPUA 5K7ZA 4DQ2A 1ACIA 5E79C 3GX4X 3LMMA 3MN2A 4AWXB 2F7TA 2WOMA 4K8XA 1GV2A 5FLVA 4DBRA 3O8MA 4UQGA 2HNYA 4G6DA 4CZKA 2VBZA 5LEJA 1BGXT 4DR5K 5E3NA 3EE8A 1YG2A 2PN6A 4UVAA 4WYBA 2NAZA 4OPJA 3PJRA 4RM3A 4C8OA 3AG4H 1U2VA 1S72I 2PMZN 3PX6A 2ISYA 1I1GA 4XKBA 1QQIA 2L4AA 4B43A 4JKBA 4AHUA 3GFLA 5F1JA 4NB4A 1R22A 5DMRA 1XSVA 3E1SA 3D2FB 2Q2EB 3CC4N 3VTIA 2MA3A 1VSKA 2QKBA 2K9SA 2EWSA 1ZHFA 3AG1H 3NCIA 3BG5A 4Y52J 2QCOA 3FZVA 1IJWC 3BR6A 4FL9A 3SAGA 3QEVA 1X9JA 4X65K 1Z7LA 2V9VA 2P9IB 3RKXA 3COAC 1N77A 4ISFA 2D1HA 3MD2A 1LOTB 5AQWA 3DYAA 1OQYA 1I27A 1SMYF 3E6BA 4FX4A 5GAEJ 2KIFA 3AVMA 4B1YB 2HHWA 1JI8A 4Y17A 3F73A 4I6MA 3A03A 4FJ9A 1LKXA 5LGUA 3Q5FA 2HZDA 4JQFA 1CGPA 3MN7A 4YOUA 3D0SA 4K2EA 1U48A 4ZDOA 3M3ZA 5HVQC 1HQUA 2E2JJ 2DA2A 4XLNF 1HYVA 4B9QA 5MLCQ 5J2QA 4DR6K 2CW8A 2W85A 4A3EJ 5IP7J 4FE4A 1TUUA 1SL1A 4C3JJ 5HDGA 4DSIA 1KRPA 4XK4A 3PIOF 3M8EA 3G73A 1TW2A 3OBWA 3I54A 5KRSA 4KISA 4LJZF 4DFKA 3PO2J 3OYFA 2HBJA 3R60A 2ZKZA 3BJ6A 2UXNA 3BCBA 5FLMJ 3C95A 3BWGA 2QKMB 3EQLF 4DFJA 1IKWA 4HUFA 4CCMA 4CCKA 1WAFA 2HHVA 1T38A 1WQ2A 3DU6A 3OYHA 3ITHA 5J40A 4M7XA 1JHFA 2NUBA 1XMXA 2ATQA 1TZLA 5C15A 3VB2A 4DMNA 4RDUA 4CJPA
chains in the Genus database with same CATH topology
2F8TA 5DK5A 1Z26A 3K57A 3V81A 4Z4IA 4PY5A 3B6OA 4AHVA 2OZSA 4DQIA 3AA4A 2XRIA 3LPTA 1CZ9A 4FJ5A 2DY4A 2OZMA 3DRPA 4CEZA 4N41A 3HO1A 4RW8A 5KI6A 1C1BA 3NDKA 3IAYA 3MEDA 2Y1JA 4CJSA 1U4BA 1NJWA 3NBPA 4CF1A 3RMBA 2VWJA 3DRRA 3OS0A 1TL1A 2IDOA 4W5QA 1Z25A 4FW2A 3G0ZA 4CEQA 4DFMA 3P5JA 3S3OA 4NYFA 5HRRA 3QEPA 4CK3A 1XI1A 4KV8A