1EKOA

Pig aldose reductase complexed with idd384 inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
SHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCALMSCASHKDYPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of human aldose reductase bound to the inhibitor IDD384.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 105
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ekoA00
4GACA 4Q3MA 2IKIA 1C9WA 5HNUA 1ZQ5A 3GHUA 3LZ5A 2HV5A 2NVDA 3MB9A 2PDNA 3BV7A 3M64A 5HA7A 3S3GA 2PDMA 4PRTA 4ZFCA 4XK2A 1PWLA 2FVLA 4PUWA 1S1RA 4LAUA 3WCZA 1YNQA 1AH0A 3COTA 2IKGA 2J8TA 1IEIA 3G5EA 3ERPA 4Q7BA 4GCAA 1ZUAX 5LIYX 3UZZA 5JH1A 3CASA 3EB3A 2PDIA 4YU1A 2P5NA 3CV7A 1YNPA 4L1XA 2F38A 4WGHA 1QWKA 1X98A 2PDYA 4QR6A 3RX4A 4ICCX 2VDGA 1Q13A 3NTYA 4F40A 1HW6A 3T42A 2PDHA 4XZNX 5DANA 4EXBA 3R94A 3RX2A 1PZ1A 3N6QA 1Z9AA 3UZWA 3O3RA 2PEVA 1MZRA 5C7HA 4FAMA 3KRBA 1JEZA 2ACSA 4QX4A 4EXAA 4JTAA 4GQGA 4DBSA 3DN5A 1S1PA 3R43A 3UP8A 3V36A 4DBUA 4LAZA 1Z89A 2IQ0A 2WZTA 4LBSA 2INZA 3BURA 2ACUA 1K8CA 4JIRA 4JTRA 1AZ2A 2BGSA 3RX3A 3VXGA 2ACRA 1T41A 3Q65A 2F2KA 4WDWA 1OG6A 2BP1A 2PF8A 1S2AA 3GHSA 1XJBA 2ACQA 4XZIA 1UR3M 2FGBA 3V0UA 4JIHA 4RPQA 2PDBA 5HNTA 2HEJA 1EXBA 3Q67A 2PDFA 3O0KA 3WBXA 2PDUA 1PYFA 4LB4A 4WDUA 1ZGDA 2FZ9A 4ASTA 3B3DA 3LQGA 1T40A 3LD5A 2IKHA 4XZHA 4H7CA 2IPFA 3MC5A 2C91A 2ALRA 1AH3A 3UYIA 2FZDA 3UZYA 4FALA 3V0SA 5KETA 3ONBA 3V0TA 2IPWA 5LIXX 5JH2A 4JQAA 3V35A 1RY8A 3G1RA 3M0IA 2FZ8A 3R6IA 3LENA 3WBYA 1Q5MA 4IGSA 1MI3A 3CV6A 5LIUX 1M9HA 3WG6A 4WRHA 2FZBA 1SM9A 2IPJA 5LIWX 4MHBA 5AZ1A 3EAUA 4GA8A 2PDXA 3GUGA 3DOPA 1IHIA 4AUBA 3QKZA 1AZ1A 2DV0A 2PDLA 1LWIA 4LBRA 3LN3A 5AZ0A 3P2VA 3CAQA 1X96A 4XZMX 1YE4A 2R24A 2QXWA 4NKCA 3CMFA 2I17A 3D3FA 3H7UA 2HVOA 1MRQA 3UZXA 3R8GA 4LB3A 3FX4A 4FA3A 4JQ1A 4PUUA 3LQLA 2IPGA 3C3UA 2A79A 1X97A 3U2CA 2HDJA 2IS7A 2PDWA 4IJCA 4QBXA 4GQ0A 1VP5A 4YVVA 2R9RA 3LNMA 2ISFA 2NVCA 4JIIX 3F7JA 3LUTA 2AGTA 4I5XA 4JQ2A 3UFYA 2PDPA 4PR4A 3H4GA 2PDKA 3N2TA 1AH4A 1YE6A 1XF0A 1ZSXA 1RY0A 2IKJA 4G5DA 4JTCA 3R7MA 3M4HA 3EB4A 1S2CA 3BCJA 3ONCA 4JQ4A 4HMNA 4IJRA 2HVNA 4FZIA 3GHTA 4YS1A 3CAVA 2WZMA 4WEVX 4PRRA 2PDJA 3UG8A 4OTKA 1LQAA 1AFSA 2PD9A 4DBWA 4WDTA 1J96A 3UWEA 4XZLX 1GVEA 4DZ5A 1VBJA 1R38A 3FJNA 1XGDA 4QXIA 3GHRA 4H8NA 3BUVA 3LEPA 2HE5A 3WBWA 2PD5A 4GABA 2BGQA 4XVEA 3H7RA 2DUZA 5M2FX 4YVPA 5LIKX 1HQTA 4PMJA 4XAPA 4JTDA 4WDXA 2PZNA 3LZ3A 2PDCA 1PWMA 4XVDA 2HE8A 4YVXA 4XO6A 1US0A 1EKOA 1FRBA 2CLPA 4GIEA 4JQ3A 1A80A 3LBOA 2DUXA 2PFHA 1EF3A 3R8HA 1RALA 1Z3NA 3R58A 4JTQA 3UGRA 2INEA 4L1WA 2PDQA 1PZ0A 4R9OA 1Z8AA 1QRQA 4XO7A 2PDGA 1ADSA 2I16A 4HBKA 1EL3A 2IQDA
chains in the Genus database with same CATH superfamily
2G3MA 4UTJA 1R3SA 2YL6A 3LZ5A 1J01A 3ALFA 3MKVA 4Y8EA 2YDRA 4PMOA 3PM6A 4QQUA 5HDRA 1T5AA 3G6MA 5D8WA 2XM2A 5BMWA 3L2IA 4TVCA 3GDLA 3DC0A 1YNQA 4PMXA 1LCOA 4JKMA 2XFYA 4MF4A 1BYBA 1XDJA 2DZUA 3C61A 1I45A 4BKNA 1JZ5A 4LUSB 1O5QA 3ERPA 4CNSA 1UD8A 4CEXC 5D03A 1UZHA 5IRPA 1QWKA 5D9OA 4H2CA 4IPPA 1JPIA 1KCZA 3ZMRA 4H01A 4GIYA 2JF7A 1KC7A 4ADSA 4A4AA 4CVUA 4I7WA 4L4OA 4B9YA 3GBDA 2JQXA 3NA8A 2OKTA 5BZAA 4ZODA 1Z9AA 1V3JA 2G5WA 3ZVHB 4MWAC 3HFYA 2WHLA 5REQB 4ZMGA 1NIUA 1JI1A 3P6LA 5CGMA 2EG6A 5F7UA 4GQGA 2Q8XA 3ALGA 4OT7A 1XSJA 1H4PA 1WDSA 3CAKA 1IXOA 3O6AA 4GGBA 4IOTA 4M7TA 4FMVA 5AY7A 1PKNA 3P62A 4BHYA 4QTGA 2XSBA 3CUJA 4ATLA 1GOQA 2FTYA 1KR1A 3VXGA 4P8XA 1FA2A 5E0KA 1HKKA 4MB1A 4XAZA 4PMUA 1S2WA 2BDQA 4DHGA 1BXCA 3GDBA 3AMGA 2PSNA 4AD5A 2PWVA 3WNMA 2V2HA 1XISA 3QM3A 3V5FA 1X6UA 4AB4A 4AIBA 5HUOA 2WNZA 2PDBA 3NM1A 5A6JA 4G7EA 1GVIA 4F2TA 4M6PA 3V5OA 3MHUA 3W22A 3WNLA 4O53A 3DG3A 4LOCA 4IISA 4WDUA 1S5WA 2ZICA 1H62A 1TTPA 5LGZA 3FKRA 3SQMA 3KUMA 1MW2A 3WBEA 1Q8AA 1WUEA 2WO5A 2J78A 4JFVA 4O1EA 1CGTA 3WD4A 1XLKA 5C8BB 4MADA 4GUGA 1EEPA 1AG1O 1C8QA 4KRTA 3MANA 5JMUA 1U2YA 1V0MA 1O68A 1V8EA 1X6LA 1WKDA 4Y7EA 1T7LA 1V7AA 1NDVA 4NAFA 3SCTA 5M03A 4G7FA 3NQGA 2Y7FA 3THAA 4B15A 2R1NA 2J47A 4H83A 4HA0A 4C5ZA 1SO6A 1JDAA 1JDCA 3LHZA 1MUMA 3G1DA 4XBJA 3WQWA 1MYRA 1CECA 3P5ZA 4GYJA 3ME3A 2AKMA 2QCGA 5HWMA 1XYCA 1QNOA 2VYOA 5CBIA 3W76A 2D22A 4DO6A 2J7FA 4OFCA 3GUGA 1PDYA 4P8WA 1Q6RA 4QLKA 3WQEA 3CAWA 1M68A 4LX4A 4F0LA 2DZWA 4RL3A 4O13A 1P7TA 1KB3A 3GXPA 3ABRA 4JNMA 1XM3A 1J2BA 2NVAA 2VZUA 3O1NA 1FWGC 3BLLA 1V6WA 4AMAA 2E9MA 4JQ1A 2ANUA 4DUWA 3VKKA 3AUJA 4JAWA 1VIWA 3CPGA 3GIYA 3E5PA 4Q4PA 1UKPA 1GORA 3Q94A 4FX7A 1RVKA 3GIQA 1I2NA 4Z2HA 2GL5A 5GPRA 3O6DA 5EGRA 4UFIA 1PEZA 4BEUA 2X7VA 4MNMA 3FYPA 1UQZA 4AG0A 2E6DA 1M7JA 4AZIA 2GZXA 1L2QA 1XCWA 3IUHA 3WLOA 1ADDA 2GSHA 4CEUC 5A8GA 1D2KA 1EQPA 4GNJA 3W7LA 2AL2B 1NQ6A 1SZGA 2D2GA 4OECA 3U2ZA 4FR1A 5FKYA 1ZALA 4QG6A 2CC0A 3CJPA 1WA3A 1W9UA 5CG7A 4PB4A 3LDVA 1AFSA 4MWAD 4GH1A 3TSBA 1J96A 1R7AA 1LWJA 2F6UA 4H8VA 3RNDA 3E5BA 3FK4A 3TFCA 4GI4A 2CBIA 3SCRA 2YLLA 1FWDC 4J4KA 2E68A 4NP7A 3HOJA 3NQMA 2UY3A 4U5IA 2V67A 8XIMA 4KMQA 5E9AA 3MU7A 3V7PA 3N4AA 4LS2A 3H7RA 3N2XA 2GQ3A 4HNCA 1AL8A 1HFBA 3LSCA 3A47A 1XRTA 3PZNA 4JNYA 1HJXA 3CS2A 4JCMA 4UUIA 1KFWA 3CZEA 3TK7A 4KBXA 3P84A 4U28A 3TE9A 3PANA 5F4WA 4D1IA 2O9OA 4CD7A 3L4WA 1XBZA 5C2GA 4IP4A 1AJ2A 3M43A 1U22A 1P7TB 1UCWA 3FKKA 3UPMA 4PFMA 3LBOA 5CEWA 1GQNA 3ECQA 3M0LA 4L1WA 1B1YA 4OV9A 2DT2A 5AHEA 4CNNA 1W5QA 4IQLA 1JI2A 1T6MA 1Q6GA 1FX6A 4PTDA 3K46A 3HPXA 2NX1A 1KFLA 3KOZA 1XBVA 2BG5A 4CD8A 1HJVA 3VABA 4AWUA 3BWWA 1Y5VA 3ARSA 3S5ZA 4PMNA 3H22A 3C0JA 4PBEA 3M64A 3MJMA 3LTYA 5HPCA 3EMQA 3MHGA 1NU5A 4IIEA 3CXOA 2WHJA 1XFBA 4LAUA 4EPKA 1K8ZA 5FL0A 3QC0A 2D2JA 1VJIA 3SDOA 2XUCA 1UC4A 2Z1WA 1T8QA 4HMCA 4GCAA 2A5HA 2P3EA 1AQHA 4EAMA 1ESWA 4HCLA 2E4TA 3R8RA 3AS3A 3GSMA 4BEQA 5LNSA 2JF6A 1X98A 1Q13A 2VR2A 1VRDA 3WL0A 2CBUA 4AFYA 2O7SA 2DJLA 1PJ9A 4WY0A 1TYGA 4ATWA 3HV9A 3H12A 4UNLA 3A3WA 4HZ7A 4CD5A 3TONA 3O3RA 4JS3A 2PEVA 4DJFD 1MZRA 1I2QA 2PC4A 4JTSA 2DVUA 3GVWA 2FPVA 2YCJA 1HP5A 1XWYA 3YPIA 1Q6EA 1XQLA 2ZVRA 3AIWA 1FWBC 2E8YA 1M1BA 1GKRA 4WQ6A 4H41A 1FWAC 3S5NA 3O06A 4YHEA 4TTGA 4PUKA 1MFUA 1H1YA 3NO3A 4AHQA 2C8NA 2QJIA 4Z1YA 3I6EA 5HJLA 4A3HA 4W5ZA 1Z7AA 4JX4A 3WF2A 3KTSA 3UJRA 3WF1A 5FEPA 1CNVA 3GTIA 4LEQA 5XINA 1W1B1 5T9CE 4LSBA 2P0IA 2QVHA 1EPXA 3LY0A 4E8CA 2EBNA 4AD0A 4DWSD 5DBUA 3CO4A 4GI6A 5D09A 4GY1A 3OOQA 5ABFB 4O54A 2HEJA 1EXBA 3O0KA 2E8ZA 3WBXA 4ZQNA 5ABHA 1U83A 3B3DA 2BOFX 3S1WA 2VELA 1F05A 1W3HA 4TVDA 2ZUMA 3UZJA 1DJNA 1S2VA 3W7QA 3EDJA 1WBHA 1O95A 2WCAA 1US2A 5IBXA 5G4HC 4UTKA 1W17A 3OZPA 1PKYA 5LIXX 4NILA 1FWJC 1RY8A 3ZR6A 2E40A 1H5YA 2Y89A 2TMDA 2INFA 1JCYA 3KVLA 4JFWA 1K02A 3MUY1 3QMSA 3SQSA 1KM0A 1PB0A 5I6SA 4WKAA 5BROA 5AZ1A 3R11A 2WPBA 1SYTA 2YYTA 3E2SA 1KWKA 4AZGA 1OZQA 4UQ9A 4F48A 4JBRA 3GAKA 3GNPA 3W7KA 4HHPA 1UUQA 1JFXA 2CNCA 2J9YA 2GUYA 2PUZA 1ELSA 1QNVA 4ICNA 1IXNA 1EJSC 1BGGA 3U6WA 1DP0A 3TJIA 3OZMA 1EEXA 4R34A 1F7BA 1EUAA 3VDGA 4R88A 3DECA 1TA3A 4EAYA 3HQOA 1E5NA 4PUJA 1A53A 3VFLA 3WQOA 2GVYA 3CO8A 3CHCA 3UZXA 4LB3A 4U10A 1YIXA 3R2GA 3H55A 3T6CA 2V3FA 2BY1A 3MI6A 1J0IA 3DGRA 3C2FA 4DAFA 3W6LA 3AYSA 1LOLA 1TV8A 2ZZ7A 2FJKA 3UEQA 4AXKA 3PSWA 4FK9A 4UCFA 1BLIA 1W9BM 5BNKA 1QI5A 3P74A 3E2QA 3QOMA 2DDXA 2PURA 1RCXB 2R1KA 4F9JA 3WQPA 2GGHA 2W9MA 3PWGA 4OJYA 1GVSA 2DIKA 1WYIA 2YXOA 4P8UA 3AIVA 3GR8A 1JUEA 4C1NA 1UIOA 1L9WA 4GWEA 1CXIA 3W6YA 4JICA 3W1TA 2YL8A 1TPUA 1GEQA 4JTCA 1MUCA 1DIDA 1SZNA 4H9MA 1UP3A 1SSDA 3KWXA 1GK8A 1E1CB 1QT1A 2ZIDA 3FY1A 4LUIA 4B3KA 2A7PA 1ONXA 4JKLA 3ZWSA 3W1RA 2F6XA 4PTXA 4XZLX 4UNKA 1VBJA 2AQVA 4LYKA 1Y5WA 1ONRA 3PBUA 2W6RA 4NU7A 3SRKA 3NSMA 4P7NA 4KGLA 2ZZ3A 2WKLA 5I3IA 3LCFA 4ACYA 5T26A 3C6CA 2OSWA 3N6JA 4PMJA 4JTDA 1FDZA 3K2GA 1VHCA 5BW6A 3GNNA 4AYSA 1GZ1A 4UTIA 7ENLA 1FQ0A 3ZJ8A 1MQRA 1ZP3A 3M0JA 3M6DA 5IFPA 4AEOA 2ZRUA 3QW3A 1XL9A 1WZAA 1DJYA 3CQKA 1W31A 1W9PA 1ZU8A 4MDOA 3LHUA 2ZRZA 2FIQA 2CBVA 1UMYA 3CGTA 3TXVA 1JYNA 2Y62A 3W1LA 3PNUA 4WLCA 1S5TA 3K4AA 4Q8PA 1C92A 4FOKA 3RGTA 1AVAA 3VZYA 3GR4A 3VNKA 4OOUA 1JCJA 2DJXA 3VKJA 4AWEA 2TPSA 3QRHA 3RLUA 1OIFA 4OV4A 1FHUA 2PDGA 2EPNA 4PZVA 4AHPA 2G3NA 3MI3A 1OEPA 5EBUA 4EWJA 4A8LA 4AZBA 3UCQA 2XN2A 1RD6A 1ZBWA 3EXTA 1Z32X 1LLZA 2EPHA 3M7SA 2JBMA 2C16A 4ZFCA 2RGLA 1OIMA 2ATMA 3T81A 1WDQA 3DBPA 4O1DA 1WNOA 2PZ0A 3SCNA 3FHQA 4J1OA 2D0HA 1V02A 3ANUA 1E15A 4QSHA 3RILA 3WNKA 2VGIA 3GS6A 1YNPA 3Q4DA 2WSKA 1Z48A 3ABZA 3A4AA 1W5OA 3GTNA 1ECQA 3OZYA 3TROA 2W4XA 2H9AA 3BQ5A 1KRMA 2YSWA 4DJFA 1IR1A 1V6YA 1PV8A 4HHLA 1BVNP 1EXPA 1EOMA 5A6MA 2QUUA 3OQEA 3IGHX 4H00A 3N4FA 5AYYA 1B0IA 4AY7A 4JEQA 1YYAA 4LBUA 3QV7A 1W8GA 3ZYZA 2E1WA 3VKAA 4E8DA 2X1RA 2VFFA 4KH2A 4C6IA 1PDZA 2V63A 4NNCA 2XGIA 1DTUA 3KX6A 3LI1A 3RLHA 5KITA 4QQ3A 1GVYA 4PMZA 1IQ8A 3VD7A 3PC0A 5AFDA 4K39A 3TR9A 5A2CA 1OY0A 1XS2A 2ICSA 3QZEA 8TIMA 3NO5A 4JIRA 1UOZA 3EEZA 1LTDA 4R27A 4OQVA 4AF0B 5HK4A 3HN3A 1RH9A 3LRLA 3NVTA 2EPLX 2BWGA 5ENLA 2C14A 1T41A 3URNA 1H41A 5LYRA 2ZUUA 2GDVA 4HK6A 3AZSA 3CT7A 3G3DA 2E67A 2NV1A 4IP5A 4D8AA 3WKZA 1H7RA 1NOUA 3LXBA 2OQYA 2X0HA 2YIHA 1HJQA 3VZXA 1Z42A 1LRNA 5D9MA 3THDA 3PZGA 3PJWA 1GVQA 5HWNA 3JRKA 1GJPA 4RXGA 5DY3A 1WZKA 2NZLA 4ASTA 1XLBA 3UR2A 4DO4A 5CC3A 4LVBA 2QCMA 3KTCA 5EFFA 3WSUA 1FFRA 3UJFA 5AHLA 2A85A 2C91A 2WQDA 5BU9A 4MDPA 3DFSA 3QXBA 2JIWA 1AODA 1HL2A 3ONBA 2PP0A 3N13A 4Y90A 3HGRA 3EWUA 1M01A 4MJZA 3P5YA 1WZLA 3M0IA 3ZSTA 2C18A 3D3AA 3UXLA 3W27A 4NUWA 1SFJA 3BAYA 3MSRA 4LALA 3WK2A 2P0OA 4WSJA 3G1SA 5LIUX 5HULA 3UGVA 3ZZ1A 1XIBA 3B0XA 4KEUA 2JALA 4PRWA 3UY7A 3WLRA 1IHIA 2AOSA 1GQLA 1BHGA 2C1IA 4Z2LA 4C6DA 1J10A 1W2VA 4XD3A 5CZSA 2OX4A 3OHIA 3EOOA 1Y65A 1Z69A 2E25A 4J3XA 3FCPA 1EO7A 2QPXA 3BQ6A 3DGBA 4IL2A 3UF9A 1ZJHA 4GMEA 4DYJA 3CZ8A 3CEPA 1V3KA 3B4UA 1ME7A 5AOUA 4HN8A 3NPVA 1VFMA 1MNSA 3GB6A 3C8NA 1IYXA 1GJWA 1E0VA 1J6PA 1U30A 3OG3A 1TJPA 5GQBA 1SW7A 3QOKA 1V0LA 1V6UA 3VD3A 4XD6A 4PCPA 4IJCA 1MFVA 4XTIA 2VFDA 4LCSA 1UKSA 3KVKA 5CH9A 1JZ2A 4PMDA 4S38A 3Q2DA 2WSQA 5JIPA 3LK6A 1XSIA 5C2XA 1E1EA 4JOMA 5LHEA 2PWFA 4ZENA 5C70A 1YE6A 3SIZA 3IV8A 4GNVA 1OABA 3DYOA 1DHKA 1W3IA 3IVSA 3CB3A 5K3VA 3NQCA 3O16A 1KLZA 1LLWA 1O12A 3S1GA 4YS1A 3CAVA 1FCUA 4DBWA 3SCVA 2ZRXA 1MQPA 3UWEA 4ZVJA 4WOZA 3CQIA 1FCBA 1QK2A 1DXEA 1RV8A 3I4EA 1RQHA 3AS2A 2PGRA 3WF3A 3TDFA 2Q09A 3DFQA 2YFOA 4F2BA 3AHTA 1A4MA 3ES7A 3LGGA 2DUZA 2Z24A 1POKA 3NQBA 5LXXA 1KRBC 4BZYA 4MKVA 2UWFA 4CNPA 3BAXA 4YVXA 1A0DA 2CLIA 4J9JA 3APGA 5C7VA 4IPIA 3OHMB 1TJ1A 3O0FA 4JTFA 4FP1A 4GIRA 4HOXA 3HIJA 3W28A 3OJGA 3C4UA 5EMKA 1R9XA 5EYWA 5TBOA 4K38A 3W71A 4PMQA 4JD4A 2ABAA 1B90A 1R9YA 4LANA 3U2OA 3L65A 4QLJA 2J79A 3TYCA 1TA3B 2INEA 3S5SA 2CYGA 5BXPA 2ZZ6A 2QUTA 3S1VA 1MMFA 4I7VA 2VGGA 3AROA 4R7WA 1WX0A 1HNYA 3W7PA 2QDEA 3WEOA 3N9RA 1RK5A 5AYBA 1ITQA 1TMLA 4JTHA 1GOWA 1ZJAA 3TTYA 4BK9A 1MZHA 1BD0A 1YDVA 1H5VA 3H2MA 3OLDA 2Y88A 1XPYA 4JEJA 2IW0A 4PUWA 3RCNA 3L66A 3MQTA 2Z7KA 1CGYA 5I7GA 4HIBA 1VD6A 3ZWTA 3QGVA 2ZUVA 1E9ZB 3NR0A 1XLMA 1IEIA 2WB5A 1RQEA 3WQDA 5JH1A 4J7RA 4NY2A 3CASA 2ZX8A 2ZXQA 3WIJA 4IX2A 3SI9A 1R3RA 3QYSA 2VDGA 1Q7QA 3VE7A 2J25A 1FOBA 3AWOA 2CESA 4EK7A 2E28A 1U5JA 1EB3A 3G6LA 3EX1A 3N6QA 1OG0A 2FMOA 3PJUA 1UP0A 3SN4A 4F9DA 3CIWA 2Z29A 5A8OA 5A95A 3IARA 1XYBA 2VD8A 3OTRA 3T9PA 5AHIA 3W9ZA 4GLEA 3BO9A 2NW0A 2DIJA 4JTKA 4LAZA 4JIQA 3CH0A 1X8FA 2A3CA 5FEZA 3AALA 1P6WA 1VFOA 2XG9A 3C52A 1A5MC 3AS0A 1OX5A 3HGOA 3ITTA 1VB9A 1SFTA 1LZOA 4UMBA 5A8PA 5CCZA 1AZ2A 1LL4A 3WY1A 3CBWA 4MY9A 2PGEA 1E6RA 3ARZA 3WJYA 3TCSA 3C2YA 4PSPA 3O6YX 3B9EA 4FF5A 4OHQA 2GPTA 3T4CA 1VENA 1H09A 3LGDA 4CU6A 2QCCA 4PL1A 1IIHA 4A2RA 1OG6A 2BP1A 3CPUA 2PF8A 3G1HA 4A2SA 3CUGA 3VU2A 2GOKA 3PJXA 2BB0A 3O8AA 2I57A 2GVGA 1P4CA 1EYEA 1OFEA 4OBSA 3SUSA 3RO6A 4H9UA 4JN8A 3TXZA 1HTIA 3QSRA 2Z2AA 4YNGA 4K68A 3T78A 5HMFA 3ZS4A 2XVKA 2IPFA 2GFTA 1FP9A 1C8XA 1B3VA 3QLLA 1NEYA 2ON3A 3B0VC 2AMXA 3T08A 4JTTA 1JULA 3NNTA 5DBTA 5KINA 1P5BA 2Z2BA 4I6KA 2A7RA 4C6LA 1H63A 2J4GA 1O60A 1NP2A 2VWTA 2JEPA 1XLIA 2QEZA 2Y61A 3QLDA 2HS6A 1L8NA 4IGSA 1F5ZA 3EYPA 4C91A 3CV6A 4N42A 5TIMA 4IJBA 4UTFA 2W3ZA 1OK6A 6PTDA 1FFQA 1XIDA 4IFKA 4UTTC 3F4CA 2NV2A 3KLLA 1YBQA 2NUWA 1XRFA 3T09A 1EYWA 4U2YA 5FF4A 3UZ5A 2X2YA 1HVXA 1VCGA 4NZ4A 2NSXA 3CAQA 4NRRA 3QR0A 3M0YA 1NF7A 1TIMA 1F61A 4UTLA 2TSYA 3EWDA 5HQLA 2W5FA 4HHMA 3R8GA 3RPTA 5CZ0A 3WENA 2Y63A 2OELA 4DWSB 5HUPA 4KW2A 3CHVA 4TR9A 4QS6A 2AAMA 3KRUA 3VKBA 2IS7A 5EPDA 1CXKA 1L6YA 4MAVA 3KBNA 5CZTA 1DJXA 4HU4A 3LHVA 4GPNA 4TV5A 1HJWA 1F3TA 2Z6JA 3FA4A 3TAKA 3UXIA 3UESA 4I5UA 5E5CA 3G0UA 4LEFA 4AY1A 1O5XA 1H49A 4JIIX 2PU0A 4HPXA 4HPHA 2AGTA 3PP7A 4NYYA 4W84A 1L8PA 2PDPA 2Q02A 3BC9A 2WAGA 5LKYA 4P7LA 4TX6A 3GUWA 2XGBA 4E2OA 1ZSXA 2IKJA 3BVJA 1R8LA 2FB2A 1OYAA 5LNWA 3BCJA 3S2JA 2J6VA 3IVTA 1VYRA 3N2CA 4IJRA 3OZOA 3HA1A 3HURA 3SECA 4FX8A 2NQZA 3MTWA 5F1UA 5AVNA 4EF9A 3UG8A 8XIAA 2PF0A 4PSRA 5CXPA 2XZ7A 4RNIA 1WUFA 3KBJA 4AY8A 4WJ8A 1F73A 4AX6A 3D5HA 3EA3A 3RLGA 2PWGA 1LWHA 3POHA 3CYJA 2PBGA 5LIKX 2WHKA 4MJ4A 1HQTA 2VQUA 4NJKA 4WDXA 4YL2A 3UG5A 5IBXC 4RDYA 5FJUA 2W27A 4XVDA 2V0TA 3LCGA 3BLDA 3TQ0A 1IZKA 4XO6A 1W1PA 5KTLA 1IZCA 2OJPA 4YYCA 5EA9A 3H70A 3W4RA 1QW8A 4GXMA 3DUGA 4RPPA 5L9FA 4G7EB 4JX6A 1NF0A 2FPYA 1QNPA 4DO5A 5HQMA 2A3EA 2A3LA 4FNSA 4YHGA 3ARPA 1TWSA 3S1UA 1TE1A 4UTUA 4CN4A 2FQIA 4UR8A 3NOEA 4AD4A 1EGZA 3B05A 3E12A 1PZ0A 1VPXA 1GOMA 4REQA 1QW7A 2EXOA 4OE7A 2XM1A 3QY6A 1XLFA 2ISVA 1L6WA 1SFSA 2EKGA 3WDIA 3V1PA 3ZSSA 3SCUA 2IKIA 4FXRA 3G0XA 3E74A 3PB0A 1S3HA 3LBCA 2NVDA 4XG1A 1J18A 3WLSA 1E6NA 5DCBA 3H4XA 2DVXA 4PC8A 3VIIA 3M16A 3W85A 1JGMA 4C6QA 2XIMA 3EWYA 4LJ3A 4D72A 4JYFA 3W88A 3LBMA 1PWLA 1LOQA 4ZSUA 1XLHA 4YJ5A 4Z0JA 4M3PA 1TPC1 2YYUA 1UH4A 3VD4A 4Q6JA 5I79A 1R2SA 1E0UA 3DENA 2DQWA 3VIKA 3TLQA 4GI8A 4JYEA 4N4QA 2O92A 1C7SA 4K1GA 1ISYA 4NJIA 3UA4A 4DNHA 3IJ9A 1G69A 4IH3A 4O15A 3W2LA 3B97A 1ZENA 1PZ2A 1E73M 3NTYA 9XIMA 4HD5A 2VX5A 2EG7A 2ALDA 4BQ2A 3EKGA 3B9AA 3PVFA 1O5KA 2HTMA 3HB9A 1B3WA 4DUVA 1XYZA 5T8GA 3VILA 1YTDA 3MSGA 5ABGA 3S2NA 5BWFA 4L61A 4LTSA 3WH9A 4GYKA 9XIAA 4CVWA 3JZEA 1X1NA 1NOWA 3TU9A 1QI2A 4AZHA 3BMWA 3SO7A 4IG2A 4DBUA 1QW9A 3WNOA 2INZA 4MYAA 2J7DA 5MKGA 1BVWA 1V51A 3LLXA 1XD0A 1TMQA 3RMJA 4Q32A 3OA5A 2G37A 1CZ1A 4GY7A 2R1LA 1PUDA 4K37A 3A24A 4OWGA 1SFLA 3WBAA 4M1BA 3V4BA 2OX1A 3U48A 3MMWA 4OKDA 3WDQA 1JNDA 5BOFA 1MEHA 1K9TA 1KM5A 3RR4A 4TQTA 4HMEA 4ZQRA 1EJXC 2I9EA 2PAJA 1WDRA 3BSGA 2OLSA 3APYA 3U4AA 1D7KA 2WOQA 3M44A 2Z28A 3BJSA 1I6NA 2DSUA 2Q01A 1WBJA 1OCBA 3NSNA 4BF5A 4QCEA 3PWIA 1YMYA 1C8YA 1VBGA 2VX7A 2O4MA 3R79A 3MJYA 4DN1A 1D3CA 3DHUA 2XN1A 3WO8A 5FCZA 3NZQA 5FI8A 2ZX9A 3FNDA 2OCZA 1EP2A 1KCLA 1OX4B 1EC7A 1BXNA 3VVGA 4X9YA 2JKPA 3WD1A 2FPTA 3STPA 2QCHA 1NJJA 3SCQA 3PF3A 1BYCA 4L9ZA 7REQB 2KAUC 2PA6A 3GDRA 3EBVA 3OIXA 1M9HA 3SB0A 4N2YA 5HMDA 2FZBA 1X6NA 4ZO7A 3SSZA 3GWQA 3AUOA 1J5SA 1XBXA 3TA9A 4HNTA 3SY8A 3R5EA 1SVDA 2CWXA 5BRBA 3VD5A 3REQB 1EZWA 4MUPA 4AIEA 2DW6A 3DDMA 1JZ6A 3L4YA 4Q8WA 1I4NA 1VF8A 4DELA 2ZTJA 3E2RA 5AYZA 2X41A 2B0MA 3PTDA 4ZQMA 2TODA 2QXWA 4QITA 2R8WA 1H7OA 3W73A 4HA4A 2OZ8A 1BAGA 3MP4A 3HM7A 4GGHA 3OBAA 4K7YA 3UCCA 3QV8A 5AB3A 3BTNA 3CWNA 1P0NA 3T0BA 3RJXA 2V8ZA 1AMYA 3MO4A 1X97A 4L56A 2X1IA 5J8LA 3LERA 2V30A 1Q6DA 1B30A 4ZO6A 2XFFA 1VP5A 1TX2A 1XLAA 3SSJA 3SFWA 1JJKA 3ABSA 2FFCA 4LS1A 5XIAA 4L9YA 1JD7A 2VGFA 4XQ6A 5IFTA 4TIMA 2J66A 6REQA 3S9ZA 1A4LA 4BJHA 3OVGA 4M51A 3H2AA 5JBFA 1QK0A 3H4GA 1RP9A 4MUZA 4AIOA 5G4WA 1GEHA 4HHHA 4DJDD 3W37A 4Z0SA 5FF2A 3A3XA 4URIA 1J79A 1ZB5A 3CH9A 5IHRA 4ROQA 1OX6A 3NUKA 3GVGA 1P0BA 3XINA 4GX8A 4HK7A 5HR6A 3L0NA 1PS9A 4NSBA 4UC5A 4QXIA 3KZPA 2FZMA 4H8NA 1WDWA 3BUVA 4ZTYA 5DRCA 2BXVA 3L5LA 1H7XA 4J3WA 2CITA 5CKSA 4O11A 4LAOA 4WXYA 1QNQA 4TU1A 3N2OA 3OP2A 2BGQA 2J74A 5C9XA 1FDYA 2CKRA 2HK1A 3WL1A 3LPOA 4UNIA 3WMCA 4AVNA 1KFEA 2YW3A 4JHOA 3USZA 2ZDRA 3QFEA 5LHFA 4JPGA 2X7WA 1TJRA 4NAEB 4DYKA 3EB2A 2CLLA 2GK1B 1C91A 5I78A 3E0VA 2EQDA 2VXNA 3M5YA 5JU6A 4JTGA 3IUIA 3G22A 3A23A 4EXQA 3GRIA 3GU9A 5MF5A 3THUA 4J40A 2QCNA 4GZ7A 3PPHA 4R9XA 1EC9A 4V28A 1G4TA 3KCOA 5I0DA 5DEZA 1G4SA 3W2MA 1SW3A 4R9OA 3KRZA 4G6CA 4M6UA 1RVGA 2GJPA 1JCMP 4LVGA 4N9CA 4R3UA 1HKIA 3H23A 4ALDA 1XLLA 1D7FA 4G2DA 3HBLA 4H6EA 2J6XA 4PGLA 4M1RA 3OLGA 4KPLA 1PO9A 4Q7NA 1U5HA 2WM1A 3TN4A 4CQDA 3BXWA 4XK2A 4Z1BA 1JYXA 1ZJBA 1GVRA 1NDYA 5BCAA 2VZSA 3T1GA 5G2WA 3ZQ9A 3QHNA 4HVXA 3LS9A 1PX8A 3EKLA 1SPQA 3LA4A 1OWQA 5RUBA 3A4WA 2XZ9A 3TJLA 1KR0A 1ZUAX 2Y8KA 2V82A 2D23A 4YU1A 4QDPA 4B5UA 4O57A 3E1F1 5EFDA 2QQ6A 1VFSA 2GWNA 2H3DA 2DZBA 1LT7A 4PULA 3UWVA 5HINA 5BXSA 5AVHA 1A5LC 1ZZMA 4AQLA 3NZRA 1LOSA 1DL3A 3L0GA 5CPNA 1THFD 3NIYA 3NSXA 3UXAA 1CXHA 3OGSA 4S3EA 4FXFA 4GVFA 1W0MA 2EF9A 1ZLPA 4ZOAA 2PTWA 4FAMA 4KFPA 4EXAA 4RNFA 1KD0A 1OC7A 1VBUA 4ZO9A 3KL5A 3M1ZA 4GD0A 3WDHA 1P0DA 1OADA 2WLZA 1K8CA 1U5VA 5GNYA 2D0GA 4IIGA 2XJ7A 2RJGA 1R3TA 3DI0A 4IWWA 4ATDA 5DCEA 4GYPA 3PUDA 3G1YA 4QEEA 4A22A 5I03A 3ARYA 5C2CA 4XB3A 4Y2WA 2GQ8A 1KKRA 1UZ1A 5A8QA 2EJAA 1U1HA 2GLKA 2NSOA 3GFYA 1MEWA 2XH2A 3VM7A 2PDFA 5HPOA 1NWSA 2ZWZA 3GVQA 2FHFA 1JYWA 3I3EA 2QNEA 2VR4A 2WW5A 3LG3A 4Z08A 4JGDA 4YTRA 3UXDA 1I2OA 3OYZA 1CWYA 1VFFA 3TUUA 1DHPA 3SM0A 1EFZA 1LG1A 1VJSA 3L5MA 3EMCA 3W1QA 1B9ZA 3O63A 3NZ1A 3DIPA 4F2UA 3KWSA 4PCTA 1OCJA 2NWRA 1JFHA 4XBSA 3WUBA 3KOWA 4A21A 1SM9A 2QIIA 3UW6A 2F84A 4UTWC 3GO2A 1TTQA 4LYPA 4R53A 4WJXA 4D8ZA 2A6LA 4AUBA 1XRVA 3U9IA 3GNDA 4MNJA 2W0UA 1OJXA 2ZBTA 1L6GA 5AZ0A 3DFNA 2Z4GA 3QZ6A 1PIFA 1K3UA 1XLDA 5EU9A 2YLAA 5I77A 1OINA 2NT0A 1UH3A 1S5VA 4OUIA 3FX4A 1JQVA 3MW7A 4X3ZA 4C90A 4G56A 1J8VA 3VX1A 3PZQA 4LS0A 2NQJA 3RLVA 3LB0A 4JX5A 2P53A 1LL7A 1VYSX 5ECUA 4US5A 2J8GA 3HQNA 2WC4A 3N9KA 3F4WA 1D8WA 1TPH1 3SCSA 1CT5A 1QUMA 2OFJA 1UR0A 5AHMA 1EP1A 1Q4WA 1OGSA 3PS7A 3PZOA 4U3CA 1LDCA 2BZNA 1YKWA 2PMQA 2OODA 4JQ2A 2ZA3A 4FOUA 4HNUA 3ABQA 3S2MA 3N2TA 1WKYA 4H9TA 1J6OA 4RDZA 3PZTA 3ITYA 4H7VA 1VEPA 2R14A 5G1MA 5I3FA 1L0PA 4YTQA 4RZ5A 1TRIA 5GJMA 4RV8A 2QMJA 4XWUA 4FI4A 2VJXA 3IACA 2YPIA 4F0MA 5I3KA 3VC6A 5E9XA 3AISA 2QJMA 1R38A 1RBAA 3BMVA 3I10A 3H2CA 5BOEA 1A3WA 1B4EA 4ZA0A 1J0YA 3CIVA 1N2VA 4X22A 2PD5A 1KGWA 4GABA 2DZSA 3QH2A 5EMJA 3VDCA 1N8IA 2O4QA 3CB8A 4HSNA 3AHZA 1VEMA 5I5RA 1JZ3A 3TVAA 2P8BA 1U1UA 1LRTA 1ZHAA 2YXXA 2ZXAA 4E2BA 3BE7A 1YLVA 5FL1A 1V3MA 2PTZA 4PCFA 1NAL1 3BAIA 4QFUA 3SY1A 1SJDA 3AIUA 1GOKA 2A7NA 2QLYA 2VFHA 3OVRA 8CGTA 1ME9A 3GNXA 4PUNA 1UASA 3FXYA 3IPWA 3P61A 1EX5A 3ZR4A 2VQTA 4ZOBA 3R58A 5HWJA 2O56A 3HMJG 4MG4A 4POCA 3QF0A 4MNLA 4YTTA 3RF9A 1JF6A 2P50A 3LCLA 4Z42C 4CNOA 1RJPA 1QO5A 3CUIA 3AXKA 2HSAA 2VFIA 1EDTA 4K6AA 1AJ0A 7A3HA 4GK8A 3B9NA 2F7FA 4H7ZA 4YCPA 2D24A 3SN0A 2PDMA 4F8XA 1U1JA 3KDOA 2ZZ5A 3IV3A 5GVJA 2JK2A 1HO1A 1DEDA 3RU8X 2VZOA 4N9BA 1AW2A 5LXEA 2WZIA 4F0KA 3T7VA 4XAGA 3WUEA 4EX4A 3PG9A 3HFTA 3LMZA 3G3MA 3RRAA 2XGZA 2Y5JA 4PBFA 2XN0A 4ZB5A 3KVMA 3G5EA 4I7UA 1HX0A 3B9DA 2QJHA 2YDQA 1ZAJA 4WGHA 3GXTA 4F4RA 4W9TA 5DX7A 4KWSA 4KS0A 3WLNA 4MMWA 1XIHA 3L7RA 4DF0A 4MLJA 3SCOA 4HKPA 1SR0A 2V5LA 4KKXA 3RX2A 1P48A 3IJLA 1AD1A 3VIOA 2NWSA 1V4YA 4CU7A 1XIJA 4J35A 5D38A 3LV5A 1PXGA 4Z1AA 1UHVA 3WX7A 3TV8A 3BMXA 4QS5A 3UBPC 3ZT7A 1OT1A 4NX5A 4QX4A 4UBPC 4JTLA 3AI0A 5HJXA 1RAKA 1BWVA 1ZCCA 5LZLA 3KCLA 1FWIC 3W74A 2HNEA 3MKKA 2WZTA 2ZX6A 4U3AA 2QPSA 3EWXA 4QNWA 5D33A 4Z2IA 3G1AA 1OFQA 1K70A 3K4DA 2F6KA 2ZUSA 4MKNA 3WF0A 3IRDA 3GD6A 4J5NA 1FH9A 1VZWA 1J4EA 2WNWA 1K8XA 2VL4A 3QSTA 5J04A 5J5RA 2E5DA 4GZJA 3GH4A 4ERAA 5EMYA 1TFVA 1K03A 4S1FA 2I9UA 2VC9A 3C5QA 3VYLA 1TV4A 1ML1A 1P6CA 4WOQA 3K30A 3QR1A 5A8MA 3UR5A 3GU1A 4GG9A 3LHYA 1ISXA 2VUNA 1TWZA 4LVAA 1QR7A 1FWWA 2RAGA 3NQVA 2OEJA 3MMTA 2PDUA 4LB4A 2VWSA 4KWOA 4GC4A 5IHSA 3LQGA 3TFXA 3DH7A 1T40A 3KBWA 5A69A 1M5WA 5MHBA 4H7CA 2VEMA 5AC7A 1NSJA 2VRQA 1IIGA 3MS8A 4FNTA 4CUCA 4Y9NA 4NJHA 4LRSA 5KMYA 1CB2A 3PWAA 2OZTA 3OGRA 1TG7A 4CQAA 2JGQA 1V7YA 5C71A 5JH2A 1PTDA 2Y5EA 3AIQA 4QG8A 2ZRWA 4ZO8A 3TOPA 1DV7A 5DFAA 5I09A 2GOUA 3EXSA 2VGBA 1F8MA 1QI0A 4WRHA 1NWRA 2G96A 4B5XA 4UFMA 4A3RA 3REQA 1QATA 2V38A 1YDYA 1B2YA 1FWHC 1UR4A 2V5JA 1EWEA 2YB1A 2OLAA 3AXMA 2VMFA 1EF2A 4GUJA 4KERA 4RJEA 3QV9A 4GXPA 3W38A 4TOQA 2CCRA 1RQBA 3FDKA 1EJRC 3LN3A 4TV6A 2G3IA 1X96A 1OT2A 5K9CA 3F4VA 4GH3A 4RR4A 3G2GA 2V2CA 1CDGA 3BPWA 4I3GA 3T2OA 2WMFA 1YHTA 3OLIA 4LUTB 1LQ0A 4GRSA 3L4UA 3RK8A 3O7UA 4NG3A 3BZGA 1PBGA 4R5EA 5TD4A 1J0JA 4O8RA 2OU4A 4MLRA 3NQAA 3IEBA 3QPZA 5DLCA 2BXYA 3GY1A 1IEQA 1SZEA 3HG3A 4NJGA 5DCDA 3PUEA 4P61A 1NWUA 4PUEA 2J13A 4L4MA 5H8UA 3CL7A 1JF5A 1G6CA 1IE7C 2DT0A 7PTDA 1I75A 1XXXA 2DSVA 2EKCA 4NIRA 3SCWA 4Y6GA 2D0FA 3QZAA 4I5XA 3GG7A 3GYEA 1TO3A 1CLVA 3RFAA 5FF3A 2BGNE 1XCXA 4QM1A 3PBMA 3NQFA 2QJGA 3N9SA 3IIPA 2ZXDA 4YIWA 3J7HA 3S6OA 3DFOA 2XPKA 4JZ5A 4KQNA 1VCFA 3WD3A 4FZIA 3GFXA 4NXKA 4RLIA 2DZXA 2WZMA 3R1ZA 1K9FA 2WMKA 2Q8LA 1QAPA 4KETA 4DJEA 4ADTA 3C0LA 3TYBA 4KWWA 6REQB 2VD9A 4WY0F 2CZFA 2MNRA 1OCQA 1A0CA 4MFDA 1O6IA 3QVQA 1XR2A 1B9BA 3KDNA 3CEUA 3MCNA 3V1HA 3H21A 4AEEA 4ERGA 1EDQA 3N19B 3FYOA 5M2FX 1Z6KA 4GKLA 4JN7A 4GJ1A 2PPGA 3HGSA 4UTMA 1VGAA 1U33A 3GH5A 1XGZA 2XINA 1EKOA 2ZUWA 1W3JA 3AQUA 3TMQA 3IIVA 1W1ZA 1OVDA 4LYQA 4HZ6A 4X2RA 4KF1A 3RPMA 1XV8A 2BHUA 1E70M 4HYWA 4UOZA 2FKPA 4IPLA 3II1A 2DPEA 2FDSA 5H91A 3VC5A 2HBXA 3K5XA 3BSMA 2DFAA 2H8ZA 4BQ4A 4UXDA 1R3WA 1X39A 4UFLA 2YA2A 1GYMA 1JUBA 4LVFA 4FS9A 4LU0A 4TMCA 3M0XA 4ACZB 2WJZA 2WWCA 2A3BA 5I3JA 3WQGA 3ZO9A 4PTMA 1I2PA 4NAFB 3CUHA 1ZCOA 4L6DA 1E6QM 3QY7A 2DZVA 4LYRA 3VNYA 1LM1A 3GC2A 3ORWA 1A5NC 2J7GA 3U8GA 1UPPA 3KM8A 1JPDX 3CZJA 4BS0A 2P5NA 5JVLA 1G5AA 3PPCA 1XH2A 1XD1A 4MWAB 3OVQA 2BTMA 3WFLA 1JRCA 1BQGA 1G0CA 3DFHA 1KM1A 4HMDA 1G9HA 3PTMA 3EX3A 3M0ZA 4HU3A 4LV4A 3VI2A 3OIHA 3UYCA 1JCTA 1OFAA 4Z17A 3D46A 2WBGA 4K3ZA 4K1WA 2XU2A 1JEZA 1DJHA 1REQA 5K4XA 3D0CA 2CHOA 3W87A 2OT1A 4WIWA 4GO8A 4UR9A 3VGDA 3UJSA 2BX7A 1QJWA 3W2KA 1T99A 1LYXA 4ZQOA 1WOBA 2V3EA 3IIXA 3WH7A 4PEKA 3LCXA 1JGIA 5KEZA 4MZ1A 2XVLA 4V1YA 4QAWA 1D8CA 2LLEA 1TR1A 3ITLA 2UY4A 3USBA 2BGSA 4FLSA 1ICSA 3WD0A 5JBDA 1UP2A 4GY0A 4JL1A 1F6KA 1R3VA 4IIDA 1OFPA 3HG2A 1MWOA 2DSKA 3IUDA 2CETA 3W6MA 3WK1A 1XG3A 1J5TA 5CJMA 1UR3M 1UKTA 1TJ2A 2FGBA 3V0UA 2Z1BA 4DJED 5BWAA 1ADOA 4WK9A 3AHXA 4IHCA 1H51A 4GQQA 5DY2A 4M24A 2R1PA 4DIAA 5LA2A 3VNJA 2VCBA 3PTQA 3RM4A 3AXIA 4EE9A 4BI5A 3GNOA 2GVLA 4GINA 3TP4A 3W7DA 4C60A 9RUBA 3HMCA 3URBA 1C3FA 5JIWA 4YXGA 3W25A 3LLFA 2E7FA 3V0TA 1XFCA 2Y7DA 3T2PA 1FH8A 1G94A 4Q7IA 4OUEA 3W26A 1ZL1A 2VRKA 2OEKA 3UNDA 1EGVA 4PFHA 2J7EA 4H6RA 1JVNA 3NEVA 5A6TC 3EEGA 2VZTA 2PLMA 2VOMA 4IM4A 5AC4A 1F3EA 4DZHA 4P7OA 3VOJA 2EAWA 3UG3A 1CPUA 2GYIA 5DMNA 2G0WA 5E1QA 1JCXA 5EMLA 1T96A 3EAUA 2PDXA 1OQFA 3I68A 4QE1A 4MY8A 4ZBCA 2DZTA 3ZT6A 3MWCA 2YA1A 1UWTA 4AF0A 1AZ1A 3ABOA 2REQB 2OYLA 3WFAA 5FEWA 3W70A 4IX0A 3DHDA 2A0NA 3WZ0E 4FOJA 1KXHA 2PCEA 1B57A 1JD9A 4KEVA 2HXUA 1RCQA 2WPGA 2WJEA 4PYSA 4IQDA 1DWGM 1Y0EA 3GDKA 3N2MA 5REQA 1G4EA 3WH5A 2DUAA 2RFGA 3MMDA 3LQLA 1E6PA 5F4SA 1F6YA 1WE5A 3RHGA 5K2ZA 5D9PA 4EPEC 2BODX 2PODA 4GC3A 2YW4A 4N7QA 1A0EA 1VFTA 3N3TA 5FSEC 4XISA 1XICA 1S38A 1EGMA 4Q6XA 1GHRA 3H4WA 4GQ0A 1UZDA 4PBGA 3SZ8A 5DN1A 3ZIZA 4PTWA 4S3DA 2NVCA 4UQEA 1FHDA 4LUTA 2I5QA 1LF1A 3E0IA 4GQRA 1WQ5A 3F7JA 4DAIA 1BF6A 1XDMA 3N18A 3FS2A 1TPB1 2XIOA 2FGLA 3EWCA 2PDKA 3U3HA 3QMRA 3UXKA 4G5DA 3R7MA 3MCMA 2CHRA 2V9DA 3QHMA 2Y85A 3KBSA 2VENA 3HQPA 4BWLC 2GJRA 3FHAA 3FVDA 4PTNA 3TYAA 1GCYA 1LQAA 1TVNA 5D04C 3MT1A 1P43A 1H50A 4DZ5A 3B0YA 3PAOA 1XGDA 3TYEA 4GXWA 1EX1A 5LA1A 3NYDA 1MEIA 1N7KA 3W7OA 1MSSA 3E9AA 4DEFA 2RJHA 4NAEA 1UQYA 5TAOA 1V3LA 3ARRA 1K77A 2CHNA 1PTAA 1AQMA 4H8HA 2OWXA 1C7TA 2JGYA 2ZZ4A 4ORMA 1PWMA 1YEYA 4EPDC 3VK5A 2GJXB 1IT0A 4LW7A 3N3MA 4DWDA 1OGBA 5A2BA 4H9VA 1GHSA 1UA3A 1MDLA 1Q6OA 2Q3RA 2E5CA 1FKWA 2VRJA 4JQ3A 4NI8A 1GTHA 3PZ9A 4X9SA 3VKDA 4C6FA 2G8ZA 4JIPA 2XVGA 1BTCA 3OBKA 3VAVA 3B0UX 3IJQA 2HPIA 2XVNA 3F5JA 3W82A 5LNRA 1V6VA 4UQBA 3UGRA 4AX7A 1EUNA 2OO6A 3UR7A 4LFYA 4P7RA 5FSDC 3PG8A 3ZXWA 2XHYA 4MKSA 3GNRA 4D6EA 3L4XA 1XDLA 3T0DA 4A8IA 2X2GA 1I8JA 2PBOA 5KSWA 1UROA 4IGMA 1HKMA 1TPVA 2Z6IA 3LOTA 4HU8A 1E1CA 3IGUA 2VEIA 1ITCA 2YBTA 2ZRYA 4HA1A 4A6GA 2F9RA 1S1RA 4RZBA 4DX3A 2WVSA 3GZ3A 3BH4A 4YCOA 5B80A 2HMCA 1PCWA 1K9EA 2IKGA 4U4MA 2J8TA 4AC7C 1B4KA 3BLIA 3URAA 4X63A 5HMEA 3K1DA 4GUFA 1K6WA 4M7SA 3MHFA 1KBLA 1ZPTA 3EX2A 3H2FA 1E6XM 3GTFA 4HSHA 3PR2A 4IMGA 3WN6A 1OC5A 3NZGA 1UR2A 4YN5A 4AAJA 4MNKA 4WY0B 2BHYA 3VDAA 1W1VA 3BICA 3WQCA 4RZ6A 5DANA 1J12A 1LQ2A 4TUFA 4AHOA 2XH4A 4WSKA 3UWWA 1CGXA 3M0KA 3WLMA 2G3JA 1UUOA 3NYZA 3R89A 1ME8A 2CWNA 3M5ZA 1XYFA 2W91A 4XIMA 5CQ1A 2Z1XA 5PTDA 3TZFA 3N15A 3UP8A 1QNSA 4CQ9A 4L5ZA 5DXYA 3TEVA 1BPLB 4HOZA 1K7FA 4ROPA 3ITCA 4UTWA 2QULA 4Y9MA 1HGYA 3T05A 5I3DA 1DKWA 1DORA 2V3DA 4YYFA 3Q58A 4PCNA 4L4LA 1Q7ZA 4NYUA 4O10A 4V33A 1PVNA 5U7SA 1PX3A 2QZRA 2PTXA 1VLWA 1JAEA 2TYSA 4ZE4A 3KLKA 3MBDA 5DXXA 3BOLA 3WD2A 7REQA 4DI9A 4WUIA 3I6TA 1JCNA 3WMSA 4RKAA 2NV9A 2AMGA 3WUGA 4IMAA 5CPMA 2CFFA 4UMCA 3IJ8A 2VURA 5A2AA 4MZYA 1QWGA 4M8UA 3RYSA 3H2NA 2WWDA 3P80A 3PSVA 2VVSA 2Q8ZA 3L23A 4W7VA 3QW4B 4YPJA 1O5RA 4Y9PA 2Z1KA 5MKGB 1XJBA 3UNTA 1SZFA 3E02A 3KS5A 2QJNA 5JBEA 4MPKA 3ARXA 3BJTA 3OA3A 4RPQA 1P1MA 4XAFA 3ITXA 1B5TA 4MYXA 4DNMA 5AHNA 4V27A 1H2JA 5CPQA 5XIMA 2A3AA 4NASA 3JUGA 3PTKA 3TQVA 4S3AA 4S2CA 3BOXA 1ALDA 4XZBA 2I5GA 4K8HA 4DF1A 3VINA 4AVOA 2NX9A 3MC5A 3R10A 3WUFA 3BGGA 1TR9A 1PTGA 4CQ8A 3SAZA 7TIMA 2WSYA 2HRWA 3L2LA 3NQDA 4H19A 2B31A 4FALA 1PCKA 3TR2A 2X16A 4QP0A 2R82A 1LL6A 1DIOA 5FJJA 3WNNA 4MWAE 3GH7A 3IVUA 1DTNA 3QHOA 4G8TA 2FZ8A 1X7IA 3UA3A 4QE5A 3RPDA 1SMDA 1BXBA 2XH7A 4NZ1A 1F76A 4PN2A 5B7YA 1N82A 1IEXA 5DELA 5A5WA 3MDUA 4OZOA 1ODUA 2VP8A 3FIGA 3B8IA 4KCUA 4UR7A 1XIMA 3A21A 2J75A 1H1ZA 5CZJA 3N1AA 2OYMA 2TRSA 1ZAIA 4IT1A 3LU2A 3R0KA 1LWIA 3W1UA 5CPSA 1TPFA 1P6BA 1UWUA 4QJ1A 1YPFA 3W02A 4BQ3A 3HGJA 3QJAA 1R30A 2ZTKA 4XZMX 3EA2A 1JL8A 2BY2A 1HIZA 5D9NA 5A3HA 3W7RA 3NDZA 4C6PA 2QF8A 3L21A 3NGFA 1R5YA 1QHZA 4WXZA 1CGUA 4O28A 1NP0A 3CLMA 2XDFA 1GJUA 3C3UA 2A79A 3G8RA 4O1FA 2QCLA 1W6TA 3WYZA 3F4NA 3LTSA 2PDWA 4QBXA 4RDWA 1W1TA 3K8LA 4HOWA 3OBEA 5A94A 3W1NA 2JIEA 4ZXLA 3GG8A 3AHVA 2GJXA 3DESA 4S2BA 5CPOA 2Z1SA 2HZGA 4CLMA 2I5IA 3M0MA 4Y96A 1FUYA 2OGYA 2J88A 4CD6A 2QVNA 4P7QA 1EHNA 1UWQA 5D2VA 2YZ5A 5AC8A 1Q3NA 4A3QA 3QGKC 3WEMA 2EEXA 4UWMA 3TTEA 4MOZA 1CXFA 5I00A 4JN6A 4BF9A 3PY2A 5C55A 1F3XA 2WVVA 4RE4A 3T0TA 2BY0A 2NXIA 1FDJA 2PDJA 4LAKA 4WDTA 4REQB 1GVEA 3QTPA 4K2SA 1KGXA 5A6LA 3L5AA 1PSCA 1X1ZA 3LNPA 2EPOA 3A9IA 1TWWA 1QOXA 3IGXA 4L65A 2BOEX 1HL8A 1DJQA 3W7GA 1ZP4A 5I2UA 2ZX5A 2OQHA 3I6RA 3UERA 3SADA 1M53A 4HNVA 1WO2A 4M80A 4DJFC 5E0FA 4GBUA 2GUUA 4B5NA 1E9YB 1TTJA 1X7FA 4LC8A 4AZ5A 4DJEC 2VC5A 3C86A 1K4HA 3ZLFA 4W86A 4GO9A 4JFSA 4WVXA 4AIUA 3CHDA 2VCCA 2YCLB 3A3HA 2YFNA 5KZDA 3ID7A 1KBJA 3BLEA 3VCCA 3W7CA 2C1GA 1E1FA 1I2RA 4OIFA 1H0GA 2WMIA 3TQPA 1ZBKA 4O50A 3VFCA 1EO5A 4GCXA 4CN1A 5A1AA 3MYOA 1KBIA 1G7VA 4I9AA 1NARA 3GHUA 4UOQA 2G97A 3WMBA 3LI0A 3DZ1A 3QY8A 3I7QA 4HP5A 2GWGA 1WAUA 1E9LA 4QSFA 1NDZA 1BQCA 3U5YA 4L64A 1D3HA 4D6HA 1HO4A 1YXDA 2Y24A 4ZB2A 3B8UA 1EA0A 4PB3A 1XHGA 5TQLA 4B2DA 4G9PA 2D2HA 1A5BA 4FHAA 3G77A 5I06A 6ENLA 1OZMA 1KM6A 2HROA 3AU2A 4HPNA 5LIYX 3B40A 3OEXA 1DQUA 2XSAA 3EB3A 4W93A 3RXZA 3PFMA 3NCOA 1MRAA 1EJWC 5HANA 4U31A 4W8LA 4LUYA 5CZKA 4HPJA 3R4IA 2H8XA 4I9MA 1YXCA 4K8GA 5D30A 6XIMA 5H2ZA 4F40A 3TW7A 2P3ZA 3NL6A 4FNPA 4NZCA 2PDHA 2BVDA 2X05A 1LBFA 2XH0A 1SJBA 3Q45A 4DRSA 1PE1A 1UBSA 1F4AA 1TV3A 2YKKA 1E3XA 4ICMA 3ZLHA 3A5FA 2ZCGA 1BWLA 2I14A 3GXIA 1QVBA 3M07A 3DKLA 3R43A 2QKFA 1KQZA 3S6TA 2WKJA 2J7HA 5E93A 1ZAHA 1F3WA 3W86A 2RDUA 3ATYA 2POZA 4L7ZA 1CGWA 4ACZA 4JTJA 3VIGA 3MYPA 4IMCA 1CLXA 4EANA 1E4LA 3BCDA 5AECA 3KP1A 2I1OA 4FXJA 1FWEC 1ZBVA 3AJ7A 5EKYA 1VQTA 1TX0A 4M6VA 3UPBA 1ISVA 4NL1A 4IL0A 2Y0FA 2GSJA 3IJDA 1KFBA 3TYDA 2GK1A 4H9XA 3VO0A 1KNWA 1BF2A 5G2HA 3W1MA 1MUWA 4JIHA 3EZ4A 2VTFA 3MMUA 4J2PA 3CWHA 1M65A 3ITOA 4JY8A 2ZRVA 1CLKA 1R6WA 3AIBA 1VFLA 4DLFA 4N6FA 3DG6A 2IKHA 1RD5A 3S42A 4LNYA 1EJVC 3GR7A 3M6YA 5C0QA 4C65A 4GYFA 2HBVA 3VTRA 3HO8A 3RITA 3I3BA 1RLDA 1OFBA 1C93A 3MO7A 2PWHA 3T44A 3FAXA 2X40A 5KETA 1HJUA 2XIJA 2IXVA 3CT2A 2IPWA 1TPDA 1TWDA 4DXKA 1HKWA 2QS8A 2UZ9A 2Y7GA 4F66A 5C54A 1MO0A 3BGJA 4UZSA 2FYMA 4H6QA 1W8SA 2QMKA 2VT0A 1JPKA 4MB4A 3U2EA 2A1YA 4HJWA 1KA9F 4BA0A 1HT6A 3WMLA 4P5UA 3CQJA 2HVMA 3UVIA 1KFJA 3B8TA 1W5NA 3MVIA 2WBKA 1YADA 5LGXA 3ISIX 5IOBA 1PL9A 4Q8MA 1O66A 2J24A 2PDLA 3NAVA 1FWFC 4YWSA 4MVAA 3P2VA 2X09A 2XFRA 2QGYA 1PYMA 4QHRA 2BHZA 1MRQA 3TH6A 4FEZA 4Q4MA 4QNEA 4FA3A 1R2RA 1PAMA 6XIAA 3UU0A 1TSIA 3ATZA 2DY3A 3AC0A 3U2CA 1LUCB 5D2XA 2A2IA 2Y70A 1RBLA 4V15A 1M03A 2QPUA 2CLOA 1EBHA 4QIUA 2FGZA 4FO4A 3C8FA 3GW0A 2VEGA 4Q4RA 3C0QA 4KGJA 3UT0A 4EP8C 1K8YA 2QW5A 2PGWA 2V3GA 1KRCC 4QGCA 3A4JA 3XIMA 3NWRA 2FJUB 1AW1A 4MGGA 4J3SA 2OVLA 1LORA 5M17A 4PR4A 2VC7A 2E77A 5FEXA 4AC1X 3S5OA 4BI6A 2O9TA 4KCWA 5EBAA 3WJSA 1NQKA 3N11A 3M4HA 1KCXA 3RR1A 4WF7A 1ICPA 4HK5A 3BG3A 3OYXA 3EX4A 5CBBA 2HVNA 2FDMA 2PE4A 5CC5A 2X0YA 1XG4A 3DFYA 3GHTA 1ZRQA 4DYEA 4I8YA 2WMIB 3VD9A 1JRBA 2BSLA 2D3LA 2CZDA 1DE5A 5DT5A 3DBNA 1MQQA 4O14A 3FJNA 3U0HA 3K1GA 5K7JA 1FWNA 2H3BA 2P88A 4FB7A 3LEPA 1EDGA 3ABXA 4KIRA 3CYVA 2X0SA 2B4GA 4PUDA 4TX8A 3S4TA 3GIPA 3QC3A 1QCWA 2H9AB 3HG4A 4Z2GA 3WQ8A 4MM1A 3C2VA 3VMPA 1KW1A 1OD0A 1O94A 3U4FA 2VHLA 4UFJA 3MUAA 1SR9A 4HB7A 2RDWA 2BMBA 3W72A 1VFUA 4TMBA 2BVTA 4CCCA 1QASA 3N04A 2R94A 3THQA 2VEKA 3QEZA 1EOKA 5BYWA 2DZPA 1FP8A 4S3JA 3XISA 3P8IA 4IICA 4O16A 5AYXA 1QPRA 7XIMA 5ECVA 2HWGA 4F79A 3B0PA 3SRFA 4B3LA 4C6KA 1SU5A 5CPTA 1Z8AA 2GVEA 3ZVIA 4XO7A 3DXIA 3VDHA 4ZZ9A 5GJNA 3W23A 1WOAA 3ZR5A 3S8HA 2C13A 3TWBA 2BY3A 4X60A 3AYVA 4GX9A 2CXEA 3MP3A 3TYUA 1NVMA 3NL3A 1RJQA 1VJZA 2AQOA 2CPUA 3S5YA 1K4GA 5JQ9A 1PHQA 3KE0A 2UBPC 3GQYA 3IJIA 1W5PA 3ELFA 1KXVA 1BSIA 1ONEA 3PZIA 1E0WA 1EZ2A 2NXGA 1XYMA 3NDOA 1UR9A 1PZ3A 5FACA 3CMGA 1FWTA 3EPMA 1US3A 3SUUA 1KFKA 2P1FA 4INFA 3UZZA 5A6BD 4XKYA 3BAKA 2WZEA 3VGEA 2OO0A 4FPSA 3IIZA 4RK8A 1RA5A 3IWPA 4GUIA 4DLMA 3I4KA 1RSCA 3RM9A 4ZXOA 4ES4A 2NQHA 3QMTA 3RRXA 4L80A 4XZ9A 3T42A 2OR2A 3PB2A 1LT8A 2V5KA 3U7VA 3TN5A 4LC6A 1CIUA 4A3YA 1FXPA 4GUHA 2J7CA 1A49A 1JZ4A 3UD6A 2C3ZA 3AOFA 3IRSA 1WDDA 1TCMA 4D6CA 1R86A 1Q8JA 3VMNA 4LCQA 1AQFA 1S1PA 2Z26A 3UJ2A 1I0DA 1EH9A 4I90A 1Z89A 1H7WA 4IMEA 2PWDA 4HTYA 4P2VA 4E0CA 4Z2JA 3SUVA 2EPKX 3VUPA 2PTYA 3WLPA 4AU0A 3LXAA 3ZJ7A 2VEFA 1FCQA 2OGJA 3W2UA 2DH3A 1RPKA 4RW3A 3HPAA 3APTA 1CTNA 4AZCA 3EDDA 2ASHA 1H7NA 3GVRA 3OW1A 3M46A 1DJWA 2DGAA 3VKCA 2AKZA 3PZUA 1Q63A 4S3FA 3S9IA 1UG6A 2QF7A 5F2IA 3S47A 2SFPA 2Z7GA 3T2QA 3BARA 4KFNA 3OODA 4S39A 1PYFA 2FZ9A 3BCFA 3KVJA 1GOXA 4S3BA 1AK5A 1C29A 1S2UA 4KRZA 1T8XA 2WMJA 4EIVA 3U5UA 3W2JA 2AQWA 1A3HA 4NZ3A 4DUOA 2MANA 2IQTA 1Q7MA 1ZS2A 1UC5A 3P3BA 3P0WA 3V0SA 3W7MA 3TMLA 4Q8UA 1SUXA 4C6MA 2C0AA 4RE2A 4FNQA 3RDKA 2YDSA 4JQAA 3VGGA 1M7XA 1P0EA 3AFBA 1KTBA 1QPOA 1NDWA 4MB3A 4FNUA 3W83A 3OLEA 2DH2A 3CC1A 1V5XA 4HPGA 6ALDA 2IPJA 1RA0A 1E40A 2YA0A 3TOYA 3DOPA 3W00A 1P0KA 1UBPC 2E6AA 4JNZA 4XD5A 1A47A 3OVPA 2PS2A 1CW2A 4KT2A 3KBVA 3EA1A 4EKJA 1N55A 4LCRA 3A12A 2Z0IA 3T8LA 5I24A 3GXDA 4QJ4B 1R3QA 4KEMA 3MDWA 3FJLA 3S1XA 1XI3A 1R9ZA 3EXRA 2Y6ZA 2HDJA 1XLJA 1UR1A 2UV8G 1GT8A 1QPNA 1QBBA 1LRQA 4Q8VA 5TNVA 3KOFA 4ZB0A 1OB0A 4B90A 2BS9A 1ISZA 2ISFA 1HKJA 4BFAA 3NXFA 1UKQA 4TTUA 5AYIA 3AIEA 4C6JA 1UWRA 6A3HA 3DYPA 3JW7A 1AH4A 4LGXA 5M5DA 1VIZA 2DW7A 3FJ6A 4A8NA 5M1TA 3MV01 1W1A1 4E4UA 2Q6ZA 3EB4A 2QR6A 3ONCA 1EIXA 3A4XA 5CC7A 2JKAA 4AZ7A 4Z2KA 2VM8A 3HV8A 4B92A 4NX0A 1E6ZA 3LHWA 4QEHA 2PD9A 4GJJA 3A6OA 4IG2B 4ONVA 4JHZA 1WCGA 4QJ5B 3WEZA 1W1YA 3AXHA 1GYLA 1OFOA 4CNUA 2V5BA 5D8ZA 4QDWA 4OU1A 4FNRA 2V5DA 2O55A 3E6EA 1UWSA 4AD2A 2XVPA 4XVEA 2QV4A 3LPPA 2J9XA 1UWIA 2J62A 2QDDA 1BKSA 2VFGA 1GQJA 4H6KA 3OO2A 2AGKA 2JEQA 3P82A 4IXXA 2Z00A 5FD0A 3SCPA 4OGZA 1TV5A 4XKMA 1QI4A 1X38A 3VOGA 4XKYB 3LMYA 2B81A 2Z25A 2OOGA 2BNJA 5JXQA 3NO1A 4NT0A 4AD1A 2V2DA 2WJDA 4XV0A 3IK4A 3TSMA 3CUFA 3R8HA 1Z3NA 3DERA 1RCOB 1NELA 4HSOA 3F2DA 1FHVA 5EB8A 2VDIA 5A6KA 3AHYA 4HBKA 1UD6A 1KFCA 3KAOA 3AXXA 4B3ZA 2ZFAA 4Q3MA 1D3GA 1D9EA 3M0HA 1RBOB 3EPNA 2CERA 3FDGA 4GE8A 1DBTA 5HNUA 2GGEA 4NZFA 3VNMA 4N0RA 3V3WA 2XTKA 2E09A 5D02A 4D6GA 3FGCB 4Q8TA 1LG2A 3CL6A 1W2PA 2ZUNA 3LGEA 5HA7A 4Y9AA 1TCDA 2G41A 2WVVB 1ZNNA 4PMYA 1VPQA 4CQCA 3TN3A 4JR5A 1YTEA 4RV3A 1L6FA 4LY8A 1LLOA 2GQAA 3AWNA 3VX0A 5D4YA 4CCEA 3QPYA 2WMHA 3NJ3A 4DB7A 3UY8A 3CV7A 4FLRA 4L1XA 3RN6A 1HZYA 4ECLA 2H6RA 3MUCA 1WKEA 3BDKA 4YTSA 1W3KA 3WJZA 1XUUA 3VIJA 1XLCA 1GW1A 2BFGA 5FESA 3LXCA 2YXGA 3NOYA 3W07A 1CX9A 3GYCA 2IXUA 1V08A 1H60A 2PU1A 3QPEA 3AZRA 4ORIA 4B5SA 1JXKA 1BRLB 4IPJA 4O0ZA 3GDMA 1KM2A 2QUNA 1TRDA 3O9NA 4O1CA 1M7PA 1W3TA 1IWBA 2OZ0A 3K8MA 3DHPA 2O0TA 2VC6A 3ENLA 3NVDA 4KCTA 1UD4A 4JY9A 2YCEA 3ANYA 3A22A 2WCSA 2ONEA 1EJTC 1VS1A 2ACUA 3Q37A 4M0XA 2RHGA 3DX5A 3FA3A 3TW6A 1GPFA 4J3ZA 4IZGA 3SJNA 2FLIA 1F9CA 3GFZA 1GQIA 1RPXA 2F2KA 1HL9A 3L67A 1IXQA 4WDWA 3EDKA 5FAGA 3C2EA 4X2PA 4MJ2A 4F0RA 1RP8A 2FVMA 7ODCA 1XRSA 3SEPA 2WV8A 1GZJA 3GHSA 3SIMA 3I3DA 2ACQA 1UB3A 1XH1A 1G01A 3VIHA 3ITGA 3MI2A 1BTMA 2JFEX 1XGEA 2PRHA 2QCEA 1A50A 5FOOA 4E6MA 2CZEA 1UWAA 4C6EA 2QCDA 1TJ0A 1VPYA 4DBDA 2NLYA 1BRLA 4GVIA 4KIEA 4DBEA 1FVPA 3G1FA 1YNYA 1PKMA 3URQA 3LD5A 1NTHA 3ZFHA 2OWCA 8RUCA 1XIGA 3LSBA 3NQ8A 2ALRA 2C0HA 1BVZA 3UYIA 3PPFA 3WDRA 2CLMA 1JNEA 4N9DA 2W92A 2GJNA 3L0KA 1VBHA 1J0HA 1G1YA 2VUYA 3LRKA 4PH6A 2RKXA 2VO5A 1A5OC 4HU0A 3MBFA 2XIBA 4C1KA 3CQHA 5IDIA 3CTTA 3W29A 3V35A 4UQAA 3G1RA 2D1ZA 2YDAA 2O7QA 1V79A 1UIPA 4HZMA 3AAMA 4M6QA 5B7ZA 1BSLA 1E5JA 4EVZA 3WDPP 1PPIA 1JXJA 3WG6A 5CG0A 4D8LA 5K9DA 3E96A 3L4ZA 4O18A 2QYGA 4NF7A 2I7GA 4UTHA 2YJQA 1XIEA 2ZZ1A 4OBTA 1FTXA 5F1VA 4IIFA 6TIMA 1K7XA 4NNBA 2DV0A 1TPEA 5C9RA 4FSAA 4W87A 1CEOA 4D6IA 1IEVA 4XTDA 1UH2A 3PBVA 4IFOA 2YL9A 1XP3A 4E38A 3INPA 3TNOA 3TJXA 2P76A 3GBEA 2E6FA 3CMFA 3CTLA 2I17A 1QBAA 1HGWA 1SQ7A 1DYSA 1VKFA 5C9UA 4I9TA 5T91A 5I23A 1J11A 3H7VA 3BW4A 1H61A 1WKFA 4D2JA 5HMSA 5U4NA 2KZHA 1Q66A 3ARUA 3LCIA 2HPMA 3T40A 2BV9A 2A4AA 1SO5A 3MSYA 1PKLA 5DRIA 2XIIA 3N34A 4DVOA 4E5TA 4L6HA 4NNAA 4BY3A 4ML4A 3RAOA 1KBBA 2CKSA 1E56A 3JU2A 1LROA 2D69A 2B7QA 3PULA 3NQ6A 1EQCA 4QAIA 1VR6A 3EGJA 1V02E 1JZ7A 3S0CA 3W7IA 1TUXA 4PA8A 1NOFA 1QFEA 4S3CA 2RDXA 2GVJA 4OBRA 3FEMA 2R91A 4GZIA 2FHCA 4QG9A 3KFTA 2Y4SA 1DVJA 4HGXA 2BVWA 2OXNA 3GTXA 1IT8A 1K6AA 4FIRA 4AEFA 4Z1DA 5G1TA 4TVUA 3BLPX 5JUVA 3ITVA 1V0NA 1GVFA 2ZWYA 3LPGA 3H54A 2VOTA 2Y8VA 3WBWA 3MUXA 1F74A 1TUFA 3VE9A 1PHWA 3TIMA 3E0LA 3GXMA 1AJZA 3VGBA 2PZNA 4KEZA 3KL0A 4W4QA 1IT7A 4LF1A 4BR1A 3B4YA 4EPBC 4LWWA 4TX9A 3EWWA 3GXFA 1XC4A 4B91A 3TC7A 1A80A 2QAPA 1Q6QA 4M29A 3WF4A 1UUMA 1RALA 1OYCA 3M7WA 3BG5A 2REQA 3V5CA 1KGUA 5BRQA 4K36A 1VC4A 4KWVA 3TSDA 1BKHA 2GGJA 3RM8A 3JVAA 1V3HA 3GW3A 3KBMA 3NZPA 1DIEA 4O0KA 2DQXA 1M6JA 3ARVA 1IGSA 2V6AA 3ZJKA 1JAKA 5HOSA 1ITUA 4X0NA 4LNCA 1QDSA 1GZGA 3LM7A 1R46A 3R13A 2FTWA 1DJZA 2NLIA 3AMDA 3WLKX 3S3GA 1F07A 1XC6A 5GNXA 2QUVA 1FCVA 3C2RA 3IAPA 3ZJ6A 4V2XA 2Y7EA 3T0CA 2FVLA 3CUZA 5A6BA 3BLOA 3RJYA 1TIWA 2NXHA 2E3ZA 5FJIA 5DQPA 5C6MA 4D6DA 3GX9A 4M5PA 2BASA 1S3TC 4Y9OA 4KCVA 2VZVA 1LP6A 4D1JA 3QTGA 4Q7BA 4H9ZA 3H8AA 4Q4SA 1YTKA 4S3GA 3E0FA 1DJGA 5D2TA 4E4PA 3GAYA 1UZ4A 4N4PA 3VM5A 2QDHA 5ABEA 4O4VA 3CQ0A 3WLHA 1ZJIA 1WPCA 1UOKA 1R87A 5GJPA 3TW9A 1KXQA 1EPVA 1TKKA 1W9VA 2OKOA 1CXLA 4WR3A 3MY9A 1B54A 2Q71A 1YPXA 5BXTA 4YMZA 5C7HA 5CSSA 3STGA 3IANA 5I07A 2UY5A 2YGYA 1P1XA 1RZMA 1NFBA 3R12A 3FA5A 3IGSA 4R7OA 1R0MA 4QROA 3VOIA 4UOJA 3NXLA 1TELA 1EC8A 4XBKA 4S23A 3CZKA 3VOCA 5DMMA 1WXYA 3BK0A 3EMZA 4E4FA 2F61A 4A29A 1XIIA 4JTRA 3T55A 2XYLA 2PLJA 3TC3A 3FLUA 3STCA 1T0OA 4JFUA 1TV2A 1TPWA 3OU8A 3L4VA 3Q65A 4QISA 2WHMA 3GC4A 2A21A 4DZAA 3CV1A 2EJ1A 5LNUA 3MUIA 1WDPA 1Y7VA 1LJYA 3AYTA 4LV9A 3OG2A 1R3YA 1W91A 1OM0A 1GKPA 4GVHA 2OYKA 3CNYA 2GSEA 4O1AA 3NFUA 2ZA1A 4GI9A 3KHDA 3MPGA 3ZVHA 3RUBL 4IIBA 1VCVA 3C3NA 1QTWA 1OK4A 1EBGA 3E49A 2NQ9A 4XZHA 4O4WA 3S2CA 3OPSA 2QGHA 1Y5XA 4DJDC 2D73A 2EG8A 4H1ZA 3FFSA 3IJ7A 1AH3A 1S2TA 2PTDA 3TJ4A 3TYZA 3STEA 3W01A 4WKHA 3NPXA 6CGTA 4P8VA 2RGMA 1KBKA 1ITXA 4UQCA 4LAMA 2FZNA 3LENA 2W61A 4JXCA 3RU6A 1G4PA 5CPLA 1UD3A 2B7OA 5LNVA 5C5YA 1LBMA 1J2WA 1IZJA 5H8PA 4HNOA 2ZYFA 1Q85A 2YCIX 3WJXA 1ZBCA 2ISDA 5LIWX 1TWIA 3WLIA 1O1ZA 2HCVA 3CL8A 1AMKA 3PN8A 4ZR8A 3EOSA 3NGJA 1DWAM 4QRNA 4WHBA 3L2MA 5G2IA 2EPMX 4DPPA 3GVVA 3FAWA 2AL1A 4E3VA 4ML9A 3QBUA 3G18A 1S5MA 2FVKA 1KCKA 4W7WA 5BRPA 1V93A 3LLDA 3PBYA 2HJPA 1IWAA 5CAKA 1F4HA 3EOUA 4PUUA 3CHEA 2ZKMX 4O0QA 5KZEA 4LY4A 3P60A 3UWQA 4ZCWA 1NY1A 1CB7B 2E9LA 3MWAA 5ABFA 1E55A 4O8AA 4UFKA 1H7PA 4B5WA 2E6YA 3HJEA 3VCRA 4A05A 4R33A 2NQLA 2RUSA 1PIIA 4DO7A 2YL5A 3T8QA 2QCFA 5E70A 2YX0A 3LX9A 2RH9A 3LNMA 4JIEA 3M9YA 2D2OA 1UJQA 3MVTA 4DM1A 2C7FA 4WCJA 3QV6A 3LUTA 2VX4A 1C90A 3UFYA 2PP3A 4Q4QA 1FXQA 2C79A 4GJIA 1UD2A 4H3DA 4KFOA 4HNLA 3SJ3A 3VUSA 1JCLA 1R85A 1XCFA 4NZJA 2MUCA 1FKXA 3FN9A 2BVYA 5A6SA 1NWTA 1I9CB 3FW6A 1V0KA 3B03A 4JYDA 1Z44A 2Z27A 1VH7A 4WEVX 3GTHA 2ATSA 5D37A 4MB5A 3WQVA 5AC6A 4E3TA 3BW3A 4PEEA 4WZHA 1A3XA 2XWDA 4E8GA 2DSWA 3VDBA 5FA5A 3GHRA 1B3XA 1AL7A 1XH0A 3AYRA 3S6DA 4U33A 4C5YA 4OVXA 1VBRA 3WLQA 5FF0A 1GONA 1Q4NX 3O2LA 2X42A 2QIWA 5CLTA 4AH7A 2DEPA 3LZ3A 3MV11 3LHTA 4BCEA 1KV5A 3N4EA 5K9XA 4LH8A 3HZ3A 2Y5SA 3GE7A 2HE8A 4JDYA 4WD0A 1E0TA 2F2HA 4JDBA 4PMVA 4PB5A 5HQEA 1Q45A 4GIEA 2ZOXA 4Q8OA 4GHRA 3ANVA 4IIHA 2PI6A 4LRTA 4HN4A 3BG9A 2XISA 3PAJA 3FJ4A 3E0WA 3E38A 1F2JA 1DJIA 4GISA 2B7NA 1E4NA 3R0UA 3VOHA 3GXNA 3O07A 2L5HA 4PODA 3SQLA 1GKQA 1TTIA 3MA8A 4FR6A 4YWIA 4B4HA 3BAWA 1ZTVA 3KCJA 5F2GA 5D2WA 4HYRA 1QMLA 3ZOAA 5CGTA 2IQDA 2F8QA 2ABBA 2DU2A 2Y1HA 5BU6A 1M41A 3MB9A 4HQVA 1YDOA 4L9XA 4ZE5A 1REQB 2WNQA 3UWZA 3F2BA 4DXVA 4B5VA 1JZ8A 3SGZA 4GZEA 4G1NA 3CPRA 5C9WA 3K4WA 3OB8A 3AIRA 2W63A 4ZOCA 3W81A 2AAAA 4RXFA 5BMXA 1DQWA 4WGXA 3EOEA 5E09A 4AMCA 4H8UA 2OSXA 2PDIA 1VEOA 3G8EA 5T9BG 2J9ZA 5M3WA 3FVMA 4TXEA 4QR6A 3OQ8A 4ICCX 2OOFA 3KS6A 2Z1VA 2BBFA 4MWAA 3DFPA 5SWUA 3AS1A 4US5D 4YTUA 1OGGA 4PCSA 2WZHA 3VIMA 1SMAA 3QQ0A 4PMRA 1SZRA 2WC7A 1MXSA 1SSGA 3V75A 2WXDM 3A9BA 3GC5A 2DORA 4D9PA 3RCYA 4HCHA 1GVOA 2OB3A 1EJUC 3TTOA 1ONWA 1B31A 4LF2A 4ADUA 4DF2A 5F2MA 4H2HA 4JFTA 1W9XA 4KRUA 1GWJA 2WC3A 3V36A 1DWJM 3FOKA 4LBSA 4O52A 1UA7A 4X61A 4UB9A 4Q33A 2OZ3A 4GFSA 3AZTA 3FV9A 1H1NA 3KHJA 2Q3OA 4FLOA 1KM3A 4LQ1A 4IP7A 4ZL1A 3P14A 1E9IA 3H26A 4MFEA 1GG0A 3WQ4A 2ACRA 3VIFA 1JDEA 3WELA 3H2EA 2QHAA 3WJWA 2C19A 4M56A 3TAOA 4DZIA 2PLKA 2WNNA 2OT0A 5HXMA 1XIFA 3EWZA 2O9RA 1IXPA 3BJFA 4PL2A 3WK3A 5L6UA 2X1TA 1R47A 3SUWA 3EDFA 1VYPX 3TTSA 5LSMA 3PJTA 1S46A 2DSZA 3LM3A 3WQFA 1GQKA 1MW0A 3UG4A 3TWAA 2V69A 1ZGDA 1RUSA 4LVDA 3UJEA 2Z2UA 3OGVA 1DXFA 1JYVA 1DPMA 1Q2RA 1RXOB 3WFZA 3KL3A 1F8IA 3A5VA 2ZADA 3BANA 4E2DA 3NQ7A 5DT7A 1MVYA 2BLEA 1XLEA 1ICQA 2DT3A 3GG1A 4I6VA 1YX1A 2FTPA 5GNZA 3UZYA 4AYGA 4CKQA 4EOUA 1B3ZA 4J3VA 1QHOA 1YXYA 1OHLA 4D6JA 4QE4A 3B8VA 1GGOA 3F1QA 1RR2A 3BAJA 3R6IA 4XSMA 1XQKA 3WBYA 3P7YA 3GLCA 1OF8A 1TREA 3NPUA 4LT9A 1EP3A 2AL2A 3BZJA 4RX0A 4F3HA 1RLCL 5H6HA 1G67A 3G1VA 3W3OA 1K1DA 2QUMA 1BFNA 1O4UA 4IQEA 1DE6A 3QFWA 4GA8A 1DXIA 3EX6A 1ODZA 2VKZG 1FH7A 3CWOX 3W84A 1HF6A 4JTUA 1JIBA 3M41A 3B04A 3JR2A 2CW6A 4HNNA 3O15A 1A5CA 1YQ2A 4Q8QA 4HA3A 4NKCA 3PZVA 1QOPA 2ZX7A 4EACA 1TV7A 2GDQA 5HAOA 2A6NA 4N6EA 3FSTA 1FY6A 3AO0A 4B2DD 4C1NB 1POJA 2OQLA 2IPGA 5CSUA 2YB4A 3L4TA 2ESCA 1K7EA 1IF2A 1C8VA 4O12A 4K7VA 3TLLA 3C0SA 4WSHA 1MW3A 2WM0A 2CEQA 1XPGA 1AA1B 2ZUTA 4L4PA 4HTBA 2R9RA 3W0KA 4IGNA 1V03A 3G0SA 2NUYA 3CLWA 2O9PA 2NQ5A 3SN1A 1KTNA 3WDJA 4GBDA 1GG1A 3PUGA 1SW0A 2YCKX 3SBFA 1RY0A 4HT3A 1W3NA 2W62A 1OD8A 1V6XA 3N6HA 4KWUA 4ZQCA 3AU6A 1XX1A 5AHFA 4HMNA 5K4ZA 2J7BA 3SY5A 3CM4A 3VA8A 3NURA 1KKOA 4UMAA 2WLYA 3E3HA 1RHCA 4O17A 1E51A 1ENUA 3W53A 1MXGA 4J28A 1K9DA 2ZE0A 1QO2A 2FH8A 2YZRA 3ZM8A 3CV2A 1QPQA 1FWRA 3IJ6A 4V1XA 1TVLA 4W85A 3O6CA 1TVPA 2EGZA 2XIQA 5DF0A 3G1XA 4O19A 1SO4A 2PC8A 1SJAA 2P8CA 4X0VA 2DZAA 4YVPA 3T07A 2C15A 1R2TA 3VOFA 3WLLA 4IFRA 5A8NA 2ZC8A 2CLKA 4B16A 2PRMA 5IDZA 4FLQA 1BEUA 1YDNA 2QDGA 1QU4A 4LXFA 3DKJA 4NRSA 1OBAA 1EA9C 3D6NA 4AWTA 4DWSA 4H4IA 1L2UA 2CLPA 3O05A 4WX2A 4IF2A 2OSYA 3EPOA 1R7OA 4MTVA 4E2VA 3UQNA 1XYLA 1YPIA 1VLIA 1XYAA 5CGQA 2XWEA 5HNRA 3KTXA 1E3ZA 3CHFA 2BOGX 3VZZA 2G50A 5G4EA 1V77A 1E72M 4B4FA 1CXEA 2WQPA 3SRHA 4GYPC 4UTTA 2EHHA 2NUXA 1I1XA 1VAHA 3L9CA 4I8DA 2FFIA 4RW5A 4AZCB 3V16A 2WMGA 3GKFA 4MJMA 4ZTXA 2WYSA 2X8RA 1C9WA 4UCGA 1Y8BA 1ZQ5A 1DIKA 4PE8A 4NVTA 5CBJA 4CCDA 3PZMA 1XSKA 4C6NA 4ZOEA 2E0PA 3WLTA 5I02A 2VVNA 4PRTA 1H11A 1UPMB 3M47A 2V81A 5EL1A 4GKTA 3WK0A 2VFEA 2WSRA 3UVAA 4RE3A 3MZNA 5H1WA 1GYNA 5I3HA 3NM3A 1I0BA 1NM9A 2IUZA 1QNRA 2Y2WA 4W89A 3UCDA 4N9EA 3W1XA 4OOZA 3NDYA 3RCMA 3AMKA 2F38A