1EKOA

Pig aldose reductase complexed with idd384 inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
SHLVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKREDLFIVSKLWCTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVETWEAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNRNWRVCALMSCASHKDYPFHEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title The structure of human aldose reductase bound to the inhibitor IDD384.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 105
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ekoA00
4RPQA 4AUBA 2PZNA 4PUWA 4WDXA 2INEA 2PD5A 4FALA 1EXBA 4LBRA 2ACRA 4Q7BA 3LENA 1IHIA 4JTAA 2C91A 1X98A 4WRHA 1AH3A 2PDLA 2ISFA 5JH2A 4DBSA 4XZHA 1XJBA 1T40A 3RX2A 4ICCX 4WDWA 3FX4A 1S1PA 4G5DA 3CMFA 1SM9A 5LIXX 4LAUA 1S2AA 2P5NA 2BP1A 3CASA 2IQDA 2HE8A 4YS1A 2HV5A 4DBWA 3V36A 3WCZA 3BV7A 4JIHA 4FAMA 4QBXA 3GUGA 2PF8A 4LAZA 4ZFCA 3ERPA 5LIUX 3MC5A 4JTQA 2PDKA 4HBKA 2PDQA 3FJNA 3LUTA 3ONBA 3C3UA 3N2TA 2HEJA 4IJCA 4XK2A 2IKJA 3LQGA 3R58A 1ZSXA 4XO7A 1EF3A 1MI3A 1OG6A 3H4GA 3M4HA 4EXBA 2QXWA 4GQ0A 4JQ1A 3EB3A 2PDHA 3CAQA 3V35A 5C7HA 3Q67A 1Z89A 4PR4A 2IS7A 3LEPA 2PEVA 1GVEA 3O3RA 5LIYX 2PDGA 4PRRA 2J8TA 3R94A 1MZRA 3U2CA 4GIEA 4PRTA 1Z3NA 5HNUA 1RY8A 4XO6A 3R6IA 4QX4A 1LWIA 2HVOA 4JIIX 4LB4A 3MB9A 4JQ3A 3CAVA 3N6QA 1AH4A 3CV6A 2F38A 3WBWA 3F7JA 1PWLA 4IJRA 3EB4A 2R9RA 4F40A 2IKGA 3GHSA 4XZMX 4GCAA 1ZUAX 2PDYA 5LIWX 3P2VA 1YNPA 3G1RA 2VDGA 2HVNA 1XF0A 4R9OA 1T41A 4MHBA 2PDJA 2NVDA 3UZWA 2IKIA 3R8HA 5AZ0A 3R8GA 1Q13A 1MRQA 3VXGA 1AFSA 3R7MA 2PDUA 3H7RA 1HQTA 2BGSA 1VBJA 2PDCA 3V0UA 2DUZA 3LN3A 4WEVX 4H8NA 1PZ1A 1PWMA 3EAUA 5JH1A 3WG6A 4L1XA 1M9HA 5HA7A 1ZGDA 4PUUA 2AGTA 4HMNA 3NTYA 4GACA 5KETA 2PDWA 4XZLX 3UZXA 4GQGA 2PDBA 1YNQA 2FGBA 3Q65A 5M2FX 1QWKA 1VP5A 1X97A 2BGQA 4QXIA 3WBXA 3BUVA 4I5XA 3M0IA 4DBUA 4LBSA 4JQ4A 3UP8A 2FZDA 1YE6A 2F2KA 3GHTA 4YU1A 4LB3A 4FA3A 4YVPA 2IPWA 3LNMA 1X96A 2DUXA 3KRBA 2FZ9A 2IPJA 2PDFA 2CLPA 2WZMA 4H7CA 1RY0A 4WDUA 3DOPA 4L1WA 1FRBA 2IKHA 4JQ2A 3V0SA 4XVDA 1Z9AA 1J96A 3RX4A 3O0KA 5DANA 1PYFA 1RALA 2A79A 2FVLA 1JEZA 1US0A 1S1RA 2ACSA 2FZBA 3R43A 5LIKX 3WBYA 2PDPA 2FZ8A 5AZ1A 1Q5MA 4JTDA 4GABA 1K8CA 1R38A 3T42A 4XVEA 2PDXA 1AZ2A 4Q3MA 3S3GA 3G5EA 2WZTA 3V0TA 4DZ5A 1YE4A 1HW6A 1IEIA 4YVXA 3DN5A 3B3DA 3CV7A 4JIRA 2NVCA 1ZQ5A 3M64A 2PDIA 1XGDA 2R24A 2ACUA 3LZ3A 3LBOA 3UZYA 4XZIA 3LD5A 4PMJA 4EXAA 3UZZA 2PFHA 3BCJA 2INZA 4YVVA 3QKZA 4OTKA 3UGRA 3LQLA 4FZIA 3D3FA 3UG8A 1C9WA 3H7UA 1LQAA 3GHRA 2IPFA 5HNTA 4JQAA 2DV0A 1QRQA 3BURA 4NKCA 1PZ0A 1EKOA 4GA8A 1Z8AA 3UFYA 4WDTA 2HE5A 2ALRA 4JTCA 3RX3A 3COTA 4IGSA 1UR3M 2IPGA 2I17A 3UYIA 1AZ1A 3ONCA 4WGHA 1A80A 4XAPA 2PDNA 2I16A 2PDMA 4QR6A 1EL3A 1AH0A 3LZ5A 1S2CA 2HDJA 1ADSA 4XZNX 3UWEA 3GHUA 2ACQA 4ASTA 4JTRA 2IQ0A 2PD9A
chains in the Genus database with same CATH superfamily
2YOCA 4AUBA 4G1NA 1XI3A 3WQFA 3WKZA 4PUWA 5I02A 2QYGA 3GO2A 3IIXA 3S5SA 1MSSA 3D5HA 2OKTA 4XAYA 2NVAA 3PZVA 5D8ZA 3SDOA 1IHIA 4JTAA 3T44A 1ICPA 4KRTA 4OKDA 2WKJA 1IT0A 3W1XA 1E5JA 4PCFA 1T5AA 3IVUA 4NU7A 3NXLA 1SM9A 2YA2A 2PB1A 3H2AA 3JS3A 4FOKA 1KM3A 1UKOA 1J8VA 1E9ZB 3E96A 4GJ1A 2ZUTA 5BWAA 4PBEA 3TWBA 4PA8A 3CWOX 3WDPP 4AIEA 4U33A 3FJLA 2ZZ2A 5E6ZA 1KBBA 1TCMA 4B5TA 3STCA 4F0LA 4J3XA 2VZSA 3GUGA 2J88A 2FLIA 3QGKC 1W3NA 4DJDD 3W84A 1UR8A 4B5VA 3DGBA 5EBAA 4JTQA 4B9ZA 3EA2A 1CEOA 2C1IA 1P48A 3QPEA 3CH9A 3UW6A 2R94A 4EOUA 4GVIA 2O0TA 3PWIA 2V0TA 1GKPA 1VEMA 1US2A 1EC7A 1XLBA 3PANA 3H54A 4ZOBA 2QW5A 1DBTA 1MI3A 1PKMA 1SUXA 1TV8A 3GH4A 4MADA 1T6MA 3PAJA 3QMTA 4O8AA 4HK7A 1JD9A 1A5KC 1G1YA 1JNEA 4GIRA 1UZHA 4OT7A 3VDCA 2DZBA 4AC1X 2JFEX 4RDYA 1O7AA 3ECQA 3LV5A 5FI8A 1W54A 2RKXA 4XX6A 5CLTA 5HATA 1IWAA 4PRTA 3KS6A 4JFTA 4F4RA 1RJRA 4B3KA 1KFLA 4QITA 3WSUA 3VGGA 4POCA 1RCOB 2QMKA 3TSBA 1GOMA 3W9ZA 3WENA 1ISXA 1LWIA 1UR4A 1TIMA 1LT7A 2PWFA 2REQB 1LRQA 3WQ4A 1RQBA 5EA9A 2PE4A 5A6KA 1QI2A 5E93A 4WXZA 4I8YA 4E4UA 1EJUC 2ZUSA 3CXOA 2E0PA 5CZSA 4ZODA 1U5VA 4WVXA 4HB7A 2C18A 1XDJA 1IE7C 5M03A 4L4MA 5F4XA 2YBTA 1HJSA 1YXDA 3CM4A 5AHEA 3N14A 5AY7A 4G2DA 3WQ8A 4AH7A 2V82A 3VXGA 3GNRA 4J28A 3MUCA 3R4IA 4HKPA 2BXVA 3UXDA 4NJJA 1FCUA 3B8SA 1H7OA 4JN6A 3TZFA 5T9BG 3EKLA 4GRSA 4WEVX 3QXBA 1UD8A 3HF3A 3RO6A 1MEHA 4AD5A 3FLUA 2HQAA 5AHNA 1XYCA 3PUDA 3L0KA 3GXPA 3P14A 1ISVA 1U1JA 2VWSA 4H6KA 1H5VA 2QDDA 1VFOA 1V0NA 4UQAA 4XISA 1FHDA 5I24A 1YPFA 1Q8AA 2JQXA 5FJRA 5J8LA 2VTFA 2YCJA 2GYIA 1XL9A 4QLKA 4LBSA 1JPIA 2WSYA 1FCVA 2BZNA 1EJRC 1XFCA 1NFGA 4DJDC 4JEJA 5BXSA 4AY8A 2WZMA 5BMXA 4EWJA 1FY6A 3G3DA 3PTDA 1ZP4A 3LHYA 3NJ3A 1J01A 7ODCA 1KXHA 1XC4A 3MCOA 1DKWA 3OVQA 5A8MA 4DF0A 1B3XA 2PP1A 3R43A 5T8GA 9RUBA 4WUIA 3MANA 2ZXDA 1W1VA 2RDUA 2OJPA 3SGUA 1PZ2A 4Q3MA 1QO2A 3MV11 1PHQA 3N1AA 4DZ5A 1POJA 3SJNA 4DYJA 2V3FA 3ZS4A 1JQXA 4ZQNA 3L4XA 3LLXA 2XWEA 1X7FA 3PZGA 1DQUA 5AHFA 3SURA 2NSOA 1K3UA 3L7RA 2NVCA 3ATYA 3TDFA 3VDBA 3VIOA 3TN5A 1V6VA 2VCAA 3MV01 4QIUA 4CQCA 3MMDA 4CVUA 1OB0A 3M5ZA 2C0HA 1O4UA 1MMFA 2E6DA 2I9UA 4MPKA 1XXXA 4JTEA 2J47A 4JTJA 3PSWA 3ZWSA 1IYXA 1JRBA 3R25A 4L5ZA 1FXQA 5LNRA 2DP3A 2DJXA 3T7VA 3W7DA 2GUBA 2DVUA 1D8WA 1CX9A 4AZHA 1PZ3A 2WMJA 4PYSA 2PGFA 4D72A 5EU9A 2TSYA 3S9ZA 5FL0A 5CBBA 3HMCA 1QHOA 3OQEA 3BURA 2OELA 1JNDA 2PPGA 3W2MA 5ABTA 2W9MA 2VEGA 3B8UA 3U48A 4GPNA 2BOEX 4M51A 2G4FA 2WVSA 4MDOA 4W89A 1SFJA 1DJIA 2V30A 3WL0A 3WLJA 3F2BA 4QDMA 2ZC8A 1E6NA 3H7VA 4O54A 1O12A 4Q8NA 4PTNA 4RR4A 3F5JA 5I07A 2YBVA 3KX6A 1E9YB 2B7PA 4RL3A 1UP3A 4XIMA 3EDEA 3N4AA 1OX6A 3NSXA 5I3FA 5AYXA 1A3XA 2FH8A 3F4NA 1U83A 1BQCA 1SJCA 1K9FA 4RV3A 3WF3A 5HJXA 3OZPA 2CLOA 4MAVA 4HNLA 4JHOA 7CGTA 1A5LC 1QCWA 4DWSB 1E6RA 4AVFA 4HZ6A 3W7RA 1M68A 1W8GA 2CLKA 1YIXA 2A1YA 3VE9A 3RCYA 3GG8A 3S5NA 4FOJA 4O0QA 4ICCX 3W7PA 1TWZA 3BLOA 3E0WA 4W8AA 2E9MA 4LAUA 2OLAA 1Q6RA 4UTLA 1RCXB 4YHGA 1B0IA 4XD3A 3T1GA 2A7NA 1LRTA 4W9TA 3EDFA 3URAA 1MO0A 4L56A 2X7WA 1V0LA 3OLEA 4U3AA 4HN8A 1MQPA 4H8VA 2WANA 4ZZ9A 1SVDA 4IQEA 1VBHA 4QBXA 5I3GA 4HVXA 2F6XA 5LIUX 3ARSA 1WX0A 3LYEA 2PDKA 1G9HA 2E68A 3CTLA 4PZVA 3JZEA 4IH3A 1AUSL 4MB4A 2QUVA 2NXGA 4OU1A 1XINA 4K1GA 4C6OA 4PE8A 4DWSA 1YX1A 3H4GA 5K9CA 3BJSA 1FQ0A 2PGRA 1B54A 2A2IA 3M0LA 1UB3A 1W3TA 1OM0A 4MY8A 4OJYA 3P81A 4I7UA 4BEQA 4MVAA 1CWYA 2QV4A 4U3CA 3SUTA 1W3KA 4L9YA 5C0QA 1Y65A 2ZRVA 4RZ4A 3IRDA 1E0VA 4Z2KA 5FOOA 3W72A 2HVOA 2OGYA 2F61A 3W75A 4IIBA 4YCOA 3MB9A 1GTHA 1UJQA 3CL8A 3AHTA 4O1CA 2OEMA 2QGYA 4MY1A 1KKOA 4X9YA 4UTTA 1SU5A 1SJDA 3EB4A 2QAPA 4KS0A 2WM1A 3IVSA 3N04A 4ZENA 3TJXA 4AZIA 1R86A 1G67A 3TYBA 2YBUA 5M3WA 4O8RA 3LCLA 4GCAA 2O4MA 3ZXWA 1YNPA 2YL6A 4HHPA 4F0SA 1ML1A 2E8ZA 3NOYA 4BFAA 1KM2A 4AU0A 2X30A 3UZWA 3F4CA 4JCMA 3TR2A 1H41A 3R8HA 3MHFA 3S2CA 3UQNA 1GPWA 1MRQA 1ZRQA 3I3DA 1J6OA 3BV4A 1R0MA 2E28A 2WZHA 4GH3A 4WOZA 4NHVA 1LCOA 4JPGA 2BGSA 4YWIA 4GO9A 3IJLA 3QTGA 3FDGA 4P7OA 3WQWA 4CGTA 4YTQA 5FEPA 4HK6A 3HMJG 3TYCA 5BWFA 2Y2WA 1C92A 5LA1A 3SCQA 1T8XA 4HD5A 1W9UA 4MLJA 3MKCA 1VFHA 2HK1A 3TQKA 4IGNA 3BG3A 1FKWA 2AGTA 3VK5A 4GACA 5KETA 2XIOA 4PB4A 2W92A 1W5PA 1P0BA 1ZHAA 3LGDA 5FJPA 2PDBA 1YNQA 4QLLA 3E2VA 4Y9AA 3AZTA 3CEUA 1BSIA 1A5NC 2ZRWA 3HPAA 3CPGA 1I75A 2OWXA 3NPUA 5BXTA 2Z00A 4NASA 4YVPA 3WQCA 4RDZA 5I06A 1VF8A 1OX4B 3CBWA 1H09A 3C2EA 3PZIA 3W71A 1F4HA 3GU9A 2EPHA 4F0MA 2V2CA 3WD4A 4X61A 5A6JA 4ENLA 4GUHA 1J96A 3CNYA 1KGWA 4E2OA 4XZWA 1W3LA 2A79A 1PE1A 4JTHA 3ZVIA 2H6RA 3G2GA 1VFLA 2Y6ZA 3G3MA 4CD7A 2CERA 4KPLA 4BS0A 1WDQA 1BYCA 1QW7A 3ELFA 3SQLA 3C61A 2Y7EA 2J7HA 3MWCA 3QV6A 1TTIA 3DN5A 3KUMA 5DLCA 2D3LA 1ZFJA 1GJUA 1TFVA 3NZPA 4UCGA 3AXIA 4TIMA 1AW1A 2F6KA 1VPXA 3IAQA 4C90A 1SR0A 1GW1A 3C2FA 1ME9A 2OO0A 3MT1A 1QK2A 3KBVA 3PPFA 4ZB0A 4D9PA 3RF9A 2V5BA 2VX6A 4QG6A 1XUZA 3DIPA 1SPQA 2EG8A 5DRCA 4NJKA 3ZYZA 3A21A 3W6LA 2D24A 4FS9A 3C8NA 3SEPA 4WXYA 3BXWA 3FDKA 1IIHA 1OK4A 3AMLA 4ZQMA 1LQAA 4Q8TA 2H3BA 1MDLA 5E70A 1W31A 3P62A 3IVTA 2BG5A 4LAKA 1KRCC 3K1DA 2PC4A 4S39A 4GK8A 4MFDA 4A6GA 4K38A 3POHA 3W00A 1F4AA 3B9AA 1SW3A 2WLYA 3FAXA 4AWSA 1P5BA 4H9ZA 4W86A 1GJPA 2Y5SA 3EWBX 3KLKA 4S3JA 2EBNA 3INPA 1QOPA 3EX6A 4AZ6A 2XGBA 4Z1AA 1H4PA 3QJAA 4M1RA 3FOKA 1Q6LA 1J6PA 2ZUWA 4NQ1A 1ADSA 3WH8A 2V5KA 4K3ZA 4QP0A 4GY1A 3T0BA 4CNTA 2CEQA 1ADOA 1NWSA 4J5NA 4X9SA 2NX9A 4WY0B 4Y9MA 1JPKA 2PD5A 1EXBA 5CSRA 2OEKA 3LENA 2KX9A 2QNEA 1OC5A 1R9ZA 5A6LA 1VB9A 1VEOA 4NZJA 4CQBA 4DBSA 3CIXA 4O1EA 3VAVA 3LU2A 1UH3A 4CU8A 2JEPA 3GW3A 3AYVA 1JF5A 2UWFA 3F2CA 2P0OA 5DF0A 1RA0A 4JDBA 1X38A 4RDVA 4RXFA 1R3TA 3O1NA 2UZ9A 5KINA 1JZ6A 3GKAA 3VX0A 2I5QA 4O1DA 4UQCA 4NAEB 5CJNA 4XWUA 1OX5A 5CPOA 2V5JA 4CD4A 1JDCA 3M5YA 3AHVA 4ZFCA 1UA3A 1HKWA 1EPVA 2PWEA 3C0QA 2ZFAA 1GTEA 3MC5A 4K7YA 3BAJA 4ECLA 1KTNA 3S9YA 1J0IA 2E1WA 1XH1A 1NWRA 4B3LA 2D2JA 2DZSA 3QC0A 1J12A 2FFIA 4LRTA 4WJ8A 4RK8A 3VD5A 4WY0A 3QZEA 5U4NA 2WPGA 1TWDA 2XZ9A 4E3VA 1I2PA 3M4HA 3VCNA 3PJXA 2YB4A 3SSJA 1EDTA 1QK0A 2G96A 2TODA 1KM0A 1Y8BA 3QR3A 4MUZA 3FK4A 5JIPA 1HZYA 1EIXA 4A2SA 1KM1A 3ICJA 1XPGA 2V8ZA 1HJUA 4JDYA 1NH6A 3ANUA 2V69A 4EANA 1H7RA 4QEHA 1VHCA 3GVGA 3BAKA 3CB3A 2Y24A 3KVKA 3MKVA 4NAEA 1YMYA 1XV8A 3S42A 3ZZ1A 3N13A 2OSWA 4AVOA 3MMWA 3R6IA 4Q33A 4YYFA 1ZBWA 4AVNA 1YRRA 4E4FA 4UNLA 1UMLA 4PCNA 3M07A 2AQWA 4UXDA 3AXKA 5H1WA 2QULA 2XM1A 4IFRA 4N9DA 3UT0A 1NY1A 3IV8A 3P5ZA 2XH4A 2Q3RA 1P43A 3GVVA 5K3VA 4FHAA 4DQWA 5CXPA 1WZKA 3L2IA 1EYEA 2O7QA 2VX7A 1XBVA 2R1MA 4L1GA 3PNZA 4IMCA 3URBA 3MO7A 3EOOA 3G6MA 4PMUA 1TE1A 4O19A 1QI0A 2IKIA 5AZ0A 1PV8A 4Q4OA 3VU2A 3F03K 3SUSA 1E70M 3W74A 2F7FA 2RDWA 4GI8A 2BVWA 2WMGA 2DZWA 3DFOA 4NT0A 2QKFA 2VI0A 1PWMA 1EXPA 3BSHA 4UTWC 1S3TC 3FA5A 3W07A 2I1OA 3S8HA 3EWWA 2YIHA 2QF7A 4NYYA 1XIIA 3WK0A 3TC3A 3UZXA 5G4HC 3WF1A 3NQAA 3VNMA 1X97A 2HCVA 3SCTA 3N6HA 5DT7A 1HTIA 4S3GA 2PTYA 5D9PA 3T6CA 3DHUA 2Z7GA 2WSKA 3PFMA 3S9IA 1EGVA 1CT5A 1X96A 4QQ3A 4G7FA 3UZ5A 2W66A 1H2JA 3ARWA 1VIWA 3M7SA 1X1OA 2PDFA 5DBTA 4DUVA 4CLMA 4I9JA 3H22A 4L1WA 5TAOA 2Q02A 5EL1A 2XIQA 3W81A 3ARUA 2IMRA 1EX1A 3CMJA 5J5DA 1A4MA 3UESA 2AAMA 4Q8QA 4UTJA 5MHBA 1R5YA 1TX0A 4IL2A 3GG7A 3H2MA 1JDEA 2PUZA 3GAYA 1KLZA 3W88A 3W1RA 2DDXA 4ATWA 5K9XA 3PTQA 4AX7A 3LHZA 1S39A 2FQIA 4UMAA 1QNOA 3CC1A 4JTDA 3FYYA 5A2CA 1R38A 2QPXA 3T42A 2AOSA 3R12A 5AC6A 4EXQA 3H55A 3WBAA 1K1DA 2VXNA 5E5CA 4M80A 2D20A 1HN1A 1UYQA 2DZXA 4DJEA 3S2JA 2O9TA 2ZXBA 3APGA 4LVBA 3S1GA 5U7SA 4DJFD 1GUVA 3AMCA 4AEOA 3TA6A 1EO5A 1LBFA 3TONA 1ZBCA 4R53A 3FSUA 8XIAA 4IQDA 3G22A 1W1ZA 2OZ0A 1ZJAA 5DO8A 4B92A 4IZGA 4HU8A 2GVLA 3KS5A 2JGQA 5CGQA 5D2WA 3CPUA 2V6AA 3SM0A 3H2OA 4AD1A 1A0CA 3ABXA 3T0CA 3V75A 4EP8C 4A35A 1ITQA 2QS8A 4G1KA 2VDHA 5C8BB 4CUCA 2QCCA 1XDLA 2QJMA 3CGTA 2Z2AA 4JQAA 4R5EA 4U5IA 1IXOA 4C6CA 3RYSA 2GDQA 2GVGA 3NPXA 4Q7IA 4C6PA 4HNTA 1PDYA 2X1IA 4KETA 3KFTA 1E6ZA 3N9RA 4E0CA 1O68A 2Y0FA 3LSCA 4XAPA 2J8FA 4LUJA 1TYGA 3BGGA 4N02A 2ZZ4A 1N8IA 1W3IA 2QCFA 3FY1A 4NJGA 1ZPTA 1QW9A 5DBUA 3ZMRA 2EF9A 2AQVA 4E3TA 5BZAA 2CLIA 3M5XA 4LEFA 4LUYA 5EMLA 2PTWA 1A0EA 1AH0A 1AW5A 1TQXA 1DXIA 3SFKA 3UWEA 4Z1CA 2OLSA 3RMJA 1JDFA 5EMUA 3CU2A 5BXRA 5ABGA 1H7PA 1M41A 3AZRA 2GSHA 2C19A 2YLAA 1CGWA 1B57A 2ZA2A 4UR9A 3VINA 4AX6A 2WHMA 3AJXA 4MKSA 3MHGA 2HS6A 3CZKA 4CQ9A 4AD4A 4AEFA 1CW2A 4QCEA 4QGCA 3PJWA 4GIYA 3KTSA 3VVGA 3E2QA 1TQJA 3APTA 1AODA 4UMBA 2HJPA 4UNKA 2WCAA 3GB6A 5FF3A 3KCOA 5I3HA 4IQLA 2R14A 2R1PA 3PZTA 2YFOA 3BVJA 4QE1A 3FA3A 3I7SA 4WLCA 2DGAA 3S2LA 1FWBC 1BG4A 4DJFC 4UTIA 4W4QA 2WC7A 1W91A 1M7PA 3WQ5A 1XHGA 3ONBA 3PBGA 2BTMA 3PBMA 2Q8XA 2WC4A 1T7LA 3E9AA 2HEJA 1UC4A 1EHNA 2IKJA 1EDQA 1KV5A 1TUFA 2CBUA 4GFSA 1EGZA 3BTNA 4BJHA 4KCVA 4MZYA 3WLHA 1TMLA 4WKHA 3NZRA 4JTLA 5CZJA 3C5QA 4Y8EA 2YDRA 2V68A 1WE5A 3NZ1A 4AWEA 2DZTA 2D3NA 2PEVA 1K8YA 4M5PA 1OC6A 3C6CA 4PULA 5LIYX 3A23A 3A12A 4PRRA 4ZB2A 1UC5A 3BICA 4GQQA 3RIKA 2YDQA 3FVMA 1P0DA 1F74A 1QJWA 3VOCA 2DT3A 1LLWA 3AQUA 3VIPA 3T9PA 2PLMA 3FXYA 1K9EA 1GWJA 1HNYA 2A7PA 1OD8A 1HP4A 1AH4A 2VEPA 4H9XA 3C52A 1VYRA 2VZUA 4PMXA 4DF2A 4YLWA 4GJJA 4NF7A 1VJSA 1B9BA 3K8LA 4LY8A 2EJAA 1UBPC 2I56A 3TIMA 5LIWX 4IP7A 3P2VA 4WD0A 5AC7A 2FVMA 4MWAD 3C0SA 2G0WA 3VIGA 3AS2A 2FH6A 5AHMA 2NVDA 3U8GA 3USBA 1R3WA 4W8BA 1CENA 3SCRA 1WAUA 4U4MA 2YB1A 1B2YA 3IACA 1OIMA 3DXIA 3DEQA 1XLFA 2EPKX 1I8JA 4HK5A 4UFJA 3M0YA 4GWEA 3GTIA 3GDKA 1W3JA 4DVOA 4H8NA 3TH6A 2Z7KA 2YGYA 5CC7A 3WF2A 3KW3A 4GYJA 3P0WA 5JH1A 4AMAA 5LXEA 2OOFA 4AC7C 1DIEA 4PUUA 1WKEA 1BRLB 2ZX6A 4G56A 3REQA 2XPKA 4UFKA 5M5DA 5ABFB 2QCMA 1KWKA 3N25A 2DZVA 2E67A 1L2UA 5M2FX 1XISA 5I03A 4ZTXA 4YXGA 4DZIA 5D04C 2FZDA 3G1FA 1PCKA 5AB3A 1GQLA 4FA3A 2IPWA 1SZEA 1Q63A 3FHQA 3LHVA 3Q4DA 3T4CA 2CLPA 4S3KA 4PN2A 1PIGA 4IIEA 3GD6A 4H01A 1FKXA 3WH6A 4RJEA 1QNQA 1ONEA 5FIPA 3N11A 3CK5A 3EDJA 4HNUA 5C2XA 1J18A 3UVAA 2P3EA 2FVLA 1US0A 5F1UA 5LIKX 4HA0A 4OQVA 4UFMA 4IMGA 1FCBA 1XKYA 4L64A 5FA5A 2GVEA 1GVRA 1YKWA 1ZENA 1Q2RA 1UWUA 3L4ZA 3FGCB 3U6WA 4FNSA 1B4KA 1FWTA 3CL7A 1GORA 3LSBA 4LS1A 6XIAA 1BRLA 3UWVA 1K8ZA 2VFEA 5ABFA 1UOZA 1ONXA 1OZMA 5F7UA 2C71A 5I79A 2VFGA 3LCGA 1SZFA 5CEWA 4WSJA 1JCYA 1OINA 2I57A 5I77A 1VBUA 2VEMA 3WLMA 1TWWA 4O1FA 4FEZA 5FAGA 1LDCA 2BODX 2X05A 1RP8A 1BYAA 3GR4A 3U9IA 2ANUA 1TX2A 1ZB5A 2DQXA 3QKZA 4H1ZA 4M82A 1V6WA 4IISA 3D3FA 1V7AA 3K4WA 3IIVA 1WUEA 4MM1A 1OFOA 3F4DA 3UG8A 4DO7A 3CLWA 4MWAC 1YDNA 2H8XA 3DI0A 5CZ0A 1G01A 2J74A 3CHCA 3TTEA 4BWLC 4TO8A 4MJ4A 3S6TA 2OT0A 3FGCA 3RJXA 1CXFA 4GUGA 3N6JA 3BAYA 4IFOA 4K39A 4MB3A 1PZ0A 1M04A 1O5XA 4IMDA 4GNVA 4KEMA 4ZO9A 4IPJA 2VO5A 2TMDA 1Q6FA 4I90A 1EBHA 1LBMA 3COTA 2O4QA 4J7RA 4LYQA 5HXMA 3WLRA 3VUSA 4JTKA 2O92A 4O10A 4Z1YA 3AJ7A 1KFCA 3D3AA 4F2BA 1XG4A 2Z2BA 3BW2A 3GFXA 5TF0A 2JKPA 1VFUA 4KW2A 3R0DA 1TPDA 3ARYA 3WDJA 4CVWA 2OO6A 3U4FA 1UUMA 2BHYA 1TPWA 3OPSA 1P1XA 3M0KA 5E6YA 3LI1A 3O6CA 4OECA 1A47A 3O6AA 4P7QA 3VKJA 1XWYA 2IQ0A 4BHYA 1FOBA 1UH2A 4RPQA 4LX4A 1QBBA 1JPMA 3QLLA 4IL0A 1GZJA 2X2GA 1E15A 4M3PA 1GCYA 1NDZA 1HJXA 1W1YA 3AU2A 3HFYA 1XJBA 4JIPA 5IM51 4TOQA 3B8WA 5BOEA 3G1YA 4JFVA 4ZTYA 1NF0A 3MCNA 3WQEA 4RNJA 4WX2A 5EB8A 1I4NA 3THAA 5HOSA 4Q4RA 3WJWA 1SJAA 4M24A 4XSLA 4W7WA 1RK6A 1GG0A 3NDZA 4RZ5A 1LWJA 3FSTA 3GM8A 3RLVA 4B2DA 3WUFA 4GX9A 1X6UA 4ROPA 5C5YA 5A3HA 3W02A 2E6YA 4FX7A 1LBLA 3LHWA 1EPXA 5D9OA 5IBXA 1S5VA 4CN6A 4KEZA 2AL1A 4UTKA 4E8GA 3GC5A 1G7UA 2A3LA 1JUKA 3ZJ8A 3N2TA 3PBWA 4Z2LA 2VGBA 1E1CB 4A8IA 4IX0A 3VIIA 1EF3A 1NAL1 1TA3B 4HSOA 4KEVA 4KWVA 4Y2WA 5LNVA 2WQPA 3EB3A 3KTCA 4S3EA 3BG5A 5D2VA 5K7JA 3H8AA 1E40A 1PDZA 4OHQA 1ZS2A 3KXQA 3FYOA 4PR4A 1X8CA 5EKYA 1S5NA 4NAFB 1THFD 4AHOA 4DEFA 1PTDA 3IIZA 4HSNA 3UR2A 2PDGA 4J27A 1TJRA 3W7LA 2WSRA 3CV2A 3TC7A 1MFVA 3BGAA 3IGUA 1VYSX 3ZSSA 4DF1A 2DIEA 4US5D 2XHYA 4MNJA 4C91A 1IZKA 3AYSA 4XO6A 4LBUA 3W7QA 4W8LA 1VCGA 1C91A 3AZSA 1IXNA 2CHOA 3DFSA 1F8IA 3S1XA 4KWWA 1PWLA 4CCZA 4NSBA 1YDVA 2G97A 4HP5A 4GYPA 3BG9A 1ME7A 4O1BA 2IKGA 1XLJA 4H8UA 1E1CA 3NYZA 3GDBA 2FPTA 1TA3A 5BMWA 1DIKA 3NO3A 3AICA 1JL8A 3AYRA 3T07A 4DXKA 4AG0A 3BLPX 1R47A 7ENLA 1KR0A 2G95A 2ZUMA 2GUUA 3DC0A 1MNSA 4NAFA 4TUFA 3LPFA 3UWWA 4PL2A 4D6DA 3GXIA 3WF0A 3PTKA 2G41A 1GQJA 3NXFA 3TN4A 1KR1A 2G8ZA 1QR7A 1KBIA 4D6JA 1QASA 4L1XA 4YTSA 1JAEA 3R13A 4H19A 3V1PA 4RE0A 1M7XA 2E8YA 4KT2A 1QPQA 1KC7A 3KE0A 3B0PA 4IF2A 5DX7A 1B90A 3AFBA 5CZTA 3OBEA 3RCMA 3GE7A 4IIFA 4B9YA 4M6VA 1VEPA 2QCNA 2RAGA 4O15A 4DB7A 4A21A 3CIWA 3NQVA 5T9CE 1RUSA 1C7SA 3SCPA 3VD4A 1IZJA 4TV5A 4I9TA 1XLHA 4MB1A 3CUZA 1H1YA 1BVZA 1UD6A 2A21A 4P8VA 3R8RA 1W1TA 4OV9A 3PZNA 4WDUA 1F61A 3HG5A 1H62A 4GZIA 1J93A 4LV9A 3A9IA 1HKMA 3LX9A 5GNXA 3OA3A 3RX4A 5FD0A 3FNDA 1NDWA 2G3MA 2ZRYA 3W7HA 1OG0A 1JEZA 1UA7A 2X2YA 4OOZA 2FZBA 3KEHA 3PC0A 1AL7A 2PDPA 4WJXA 3CAKA 3MSDA 5AZ1A 1Q6QA 3UYCA 3DZ1A 3PNUA 2AKZA 4F0RA 1AZ2A 2R8WA 1B3OA 1KTBA 1CBGA 4NZ1A 3GR7A 5LYRA 5I23A 2XUCA 1GKQA 1AA1B 4J3WA 5CAHA 3W3OA 1UBSA 4ADSA 3CV7A 3LS9A 1V03A 1XYBA 2I5IA 1M53A 1JYVA 3K30A 2ZUVA 1ZTVA 1FWFC 1VR6A 2POZA 1AD1A 1D2KA 3UZZA 2AMGA 1XRFA 2FTYA 1VRXA 1VZWA 1HJWA 1BLIA 3VKCA 1WKYA 4FLQA 3UPMA 3L4WA 2XISA 3MUIA 2Y63A 2P3ZA 2Z28A 1W5NA 3UR7A 2OZ3A 3BAIA 4O4VA 3KOWA 3G1HA 2I9EA 1SZNA 2P53A 3VM5A 1QBAA 2Y85A 1GVSA 2CBVA 2DV0A 1R9YA 2WJFA 1UCWA 3N19B 1C8XA 1Y7VA 4OGZA 1QI5A 1Y5VA 2CIPA 3OGSA 5D02A 4FNRA 3WJXA 2HE5A 5IXEA 1NQ6A 5EY5A 3PF3A 1OF6A 3GS6A 2B4GA 2X09A 3UD6A 4IGSA 4UMCA 3W82A 4O53A 3UYIA 4O14A 2C1HA 3EPMA 4J40A 1Z42A 5EFFA 5IDIA 3SUUA 3MP4A 4DNHA 4UFHA 3M0ZA 1SW7A 2ZZ6A 1BKHA 1ZJHA 1IZCA 3O7UA 4ACZB 3M43A 2HNEA 1SO5A 2GSJA 4LVFA 3DBPA 1WAWA 1KCLA 1B1YA 3QH2A 3LGEA 4CD6A 1VCVA 1DOSA 3HIJA 4A3UA 1DJXA 2J9YA 6REQB 2ACQA 4EVZA 2ZX7A 1EIBA 2KZHA 1PXGA 1HF6A 3TA9A 4Z08A 3GDMA 3RCNA 4GNJA 2E6AA 2BVDA 8TIMA 1JUEA 3BZGA 3ARXA 1RVKA 2Q01A 3T2PA 2ZA1A 2VJXA 3DHFA 1WDPA 3GXDA 4NX5A 2ALDA 2OX1A 1J0ZA 1E6QM 4I8DA 1GZGA 2CLLA 4H41A 5T26A 5BU6A 4G5DA 3W2LA 1NOFA 4YN5A 5K9DA 1C7TA 1TTJA 4D8LA 1H0IA 4I3GA 3ARPA 1ZL1A 4L9XA 1AJ2A 5FKYA 3BV7A 4NRSA 1FCQA 4W7VA 3EOLA 3OLGA 2J62A 1VH7A 2WWCA 2PF8A 4ACZA 5HR6A 1Q6OA 3VUPA 1S2WA 3ERPA 5C7VA 1VLWA 3UG5A 4FIQA 3QSTA 1OCBA 3POCA 1EC9A 3SRDA 3LUTA 6REQA 1UHVA 3RAOA 3HO8A 1BYBA 2OYLA 3G0UA 4RE3A 2Q8LA 1TVPA 3AAMA 1HVXA 2J7GA 2VFFA 3LQGA 3SECA 4Y8FA 2E9BA 5A8NA 1N8WA 4ZCWA 1GONA 3I4EA 1BXNA 4GQ0A 3TROA 4LFYA 1YTKA 4LRSA 4MAZA 4NZ3A 5IRPA 4Z17A 2WHKA 1H1NA 4HPXA 2DSWA 3QOMA 1J5TA 5MF5A 1V8EA 2ZXQA 3BO9A 1EOKA 1ECEA 1V0MA 1OFPA 4DZAA 5A69A 3WDHA 1VKFA 2GFTA 3W7NA 3IGSA 3M41A 5KEZA 1A49A 2HNHA 4Q8VA 5D30A 1HXJA 2WMKA 4QX4A 4INFA 4HTYA 3B40A 2EJ1A 3BOFA 4MIMA 4JQ3A 3BLIA 1QI3A 3C86A 3WBWA 3CQHA 4M7TA 4ZR8A 2HBVA 1RBOB 3WLPA 3WLQA 3TLLA 5BRQA 4XZMX 4KWSA 3O06A 1JFHA 3I7QA 2PDYA 1ECQA 1JF6A 1D8CA 1PX4A 4PEKA 1XLDA 2FHBA 3RU6A 1FWSA 1FA2A 2PDJA 2BVYA 4JX6A 1VHNA 1LUCB 2P8CA 2BNJA 3AMKA 3SCVA 3JR2A 3W27A 3HZ3A 1A0DA 3DHPA 3H7RA 3WLKX 4GI9A 3WDIA 5C70A 5ECUA 3FCPA 1KWGA 5LGXA 3BSMA 3ARVA 1RLCL 2DUZA 4PTMA 4IGHA 4GOAA 4LU0A 2DUAA 4UQDA 1PZ1A 3IGXA 3BCFA 5EPDA 4QJ4B 2E5BA 2VP8A 2HROA 5D8WA 4I9MA 1TJPA 4CEUC 1OCQA 1XCFA 2RHGA 3GH5A 4HN4A 5DFAA 2OB3A 4Z42C 3W38A 2GGJA 2XM2A 4GQGA 1R3YA 5TQLA 2DIKA 5JU6A 1LOQA 5LNUA 3R11A 4UTFA 4YTUA 3ITYA 4ZSTA 5LGZA 2CPUA 5FJUA 1CGVA 3CT7A 1P6BA 3RPDA 3DFPA 3WO8A 1ISZA 4DZHA 3NPVA 3EWUA 2VDIA 4PC8A 1REQB 3H2NA 3I6TA 3QHMA 1LUCA 3B8IA 3T05A 2VQUA 1Z69A 3SI9A 2XDFA 1HL8A 4O1AA 4XVDA 1Z9AA 1SZRA 4TV6A 4A05A 4LC6A 4AIUA 3NGFA 3AIEA 2QEZA 3WBYA 3NOEA 1CECA 2E1DA 1Z6KA 3EPNA 3FFSA 5FJTA 4UQEA 2PLKA 1NJJA 5AHLA 2WZTA 5KTLA 3FEMA 2V81A 5C2CA 3VOIA 4JYDA 3MCMA 4JL1A 1IWBA 3C4UA 4AD3A 2XFWA 3FAWA 4MFEA 1K9TA 2R24A 2XH2A 1U5JA 2WMIB 5G4WA 1UP2A 3LD5A 3O63A 2JKEA 1XYAA 2OFJA 3HTWA 5EMMA 1JPHA 1REQA 4JTTA 5C71A 3Q37A 4HJWA 4L65A 2PFHA 3SW6A 3TR9A 3P3BA 3R0UA 4K36A 3RRXA 4C7DA 5DXYA 4RCXA 4O16A 1Q8JA 4LVGA 1P4CA 2NX1A 1SMAA 3DERA 4GY0A 3M44A 3UWUA 1MQQA 3PUGA 4HNNA 3B9OA 4JYFA 4DNMA 4DBEA 2GJNA 4XZ9A 4ORMA 1FWRA 4RNHA 1H5YA 2XVPA 3EEZA 2QPSA 3S46A 4H6EA 3TSMA 5AVNA 1HGYA 1OT1A 3OTRA 5F4WA 2I17A 4TVCA 3G77A 3QY7A 1LWHA 4TX8A 4HCLA 3D47A 3ABZA 4HNOA 1DXEA 2VD8A 3ES7A 2DT1A 4OBTA 2QJJA 3MJMA 1ZU8A 3EPOA 4ORIA 2YLLA 2WZEA 3GXNA 4XUYA 3NO1A 5DEZA 2ONEA 3MI6A 1BGGA 2Z1XA 3LXCA 2QJNA 4D6CA 1QTWA 1L8NA 1KRAC 3AWOA 3H70A 2VZTA 4A2RA 3N2CA 3PR2A 2QCLA 4LBRA 3GAKA 3QW4B 2BHUA 3RO8A 2OR2A 2ZCGA 3BZJA 4OWGA 2Q8ZA 3VGFA 2PDLA 1FTXA 3HB9A 2XZ7A 4IG2B 3VDGA 3S2MA 1MXDA 1KXVA 3IK2A 1F6KA 1RR2A 4L4OA 3QV7A 3UY8A 3GXMA 5CAKA 4FF5A 3ZVHB 1BXCA 4ALDA 4K37A 1XIEA 4HQVA 5FF7A 4Z1BA 4XG1A 1AVAA 2Y4SA 3M0JA 3GIYA 1I6NA 4XQ6A 4AZCA 2QDEA 2GZXA 2BFGA 2ZXAA 3PK7A 4FAMA 4YCPA 3NURA 2OODA 2JKAA 3AIRA 1VIZA 3TW6A 1JZ2A 3TMQA 3EMQA 5AYYA 4PCPA 3TTOA 2E09A 4AZBA 3KWSA 3TE9A 2V3DA 2CZVA 4EIVA 1WZLA 3BJFA 4XK2A 1E9LA 4XO7A 4O57A 4C6MA 4LH8A 1XCWA 3VCRA 2Y7DA 3NQFA 3QZAA 1LQ2A 2OTDA 3CUIA 2DY3A 1RQEA 1EOMA 2YCKX 5C7HA 1GHRA 4LUTB 4IG2A 3W28A 4JTFA 2UY2A 2WB5A 1W2PA 2POTA 3GU2A 4H04A 3OO2A 2DW6A 3ITTA 3ZJ6A 1AQHA 3U5UA 5A6TC 3ZVHA 3DFTA 4TQTA 1IEWA 5CKSA 3A9BA 1ZAIA 3WUGA 5E0CA 4NUWA 2G4JA 1MEIA 1S2VA 1OY0A 1CGUA 4LNYA 3VPLA 3K13A 1VLIA 2HXUA 4WQ6A 2DSKA 4DJDA 3W7CA 3PTMA 3EWZA 4L61A 1SJBA 4H6RA 4ONVA 3CV6A 2HBXA 3NSNA 3W26A 1GJWA 2NT0A 1SFSA 3E2SA 4W93A 1KXTA 1XQKA 3LLFA 3M1ZA 1V5XA 4GC4A 2CZDA 4LJ3A 2CLEA 3IWPA 5AYIA 3HN3A 5BYWA 2ISWA 2D2OA 1Z7AA 4M0XA 4FNTA 1F76A 1RAKA 3VDHA 2W4XA 3WH5A 3BH4A 1TV5A 2IW0A 1Q7MA 4LUTA 1EA9C 4N4QA 3BLLA 1N8FA 2HWGA 2Q09A 1YBQB 2X42A 3HPXA 1I0DA 3VABA 1TPFA 1FWJC 5FF0A 3WH7A 3GNXA 3RRAA 2GK1A 3GBDA 1MUMA 5H8MA 4HJFA 3LMZA 4IICA 4NNCA 3PN8A 2UBPC 5HDRA 3DU0A 3WEZA 1J11A 1ITCA 2PDWA 1TZ7A 1YEYA 3WF4A 3NUKA 5EGRA 3CUFA 4I7VA 5DY2A 4E38A 5E9AA 1QWKA 2BGQA 4BQ5A 1TV7A 3UXLA 3FJ6A 1RP9A 1QAPA 2VGFA 3WUEA 3T8QA 1NFBA 4N6FA 3KOXA 4MYAA 3Q94A 1FX6A 1ZNNA 3ITGA 1XG3A 2VEKA 2ZX8A 1DHPA 4X22A 2X1SA 3ARZA 1SSGA 2I5GA 1KB3A 4DRSA 3BMWA 1FWIC 4BKNA 3QV9A 2J7FA 1V02A 3LRMA 1FUYA 2D2HA 4GZEA 3W7JA 3W85A 4MG4A 2WNNA 3GTNA 4OUEA 1YBQA 2JF7A 2B31A 2PCEA 3P8JA 1OGGA 4DHGA 2CU0A 4FNQA 2ZADA 3NQ8A 3TW9A 1YYAA 4XVEA 4KGJA 4B16A 3MYOA 1KM4A 1R85A 2ISVA 1XSJA 2GSEA 5BRBA 4AFYA 3O8AA 1IEIA 5GQBA 5I3IA 2ADAA 1IV8A 3GZ3A 3H2CA 4HPNA 2DT2A 1N55A 2PDIA 3P74A 1K4HA 2ACUA 1XUUA 4TTGA 1RPKA 3TYZA 1BF6A 5BOOA 3PAOA 3VD7A 2J6XA 2BVTA 3GIQA 3KM8A 1EF2A 1RHCA 3Q58A 1F3EA 4RZBA 1O5RA 4JNYA 4ZOEA 3W73A 4FZIA 1UWSA 2R6OA 2DH3A 3UJFA 3NPWA 3OVGA 3T08A 1OYCA 3OJGA 3KBNA 3PBYA 4XAGA 4M29A 1ELSA 2TYSA 1AK5A 3ZLHA 3N29A 3BANA 4OBSA 2PBOA 1PBGA 4C6LA 3V1HA 1CB7B 4O11A 4C1NB 1UP0A 5A6BD 3GWQA 1EFZA 2J13A 5GJNA 4IJBA 4XAFA 5CZKA 2PTXA 1O6IA 3EA1A 7XIMA 3MMTA 2YYUA 5F2LA 3DUGA 4FB7A 1DYSA 1EWDA 1JZ8A 2Z1WA 2PURA 4AXKA 1ZCCA 3JZUA 5LNSA 4PUNA 4QSFA 3AWNA 2YCIX 3U5YA 3A47A 4L6DA 3I6RA 4DXXA 5BW6A 2J9XA 3NDOA 2FZMA 1R2SA 1RD6A 4GINA 4QR6A 2CYGA 1E4IA 2C1GA 3FYPA 4HCHA 3CUGA 1S3HA 3I4KA 4PBGA 1EZWA 2YXGA 5FJOA 2ZRZA 4IUOA 4ZQCA 3VGBA 2PZNA 3HA1A 3MY9A 2C14A 3PSVA 3SO7A 3NQ7A 3MYPA 3N34A 2CLFA 3LBCA 1OZQA 1FWDC 4NIRA 3EX2A 3TXVA 2C91A 1P7TB 4Q22A 4IOTA 4MY9A 3PM6A 4PSRA 5JH2A 4C1NA 5J04A 1LROA 3MVIA 4FXRA 5D37A 2VD9A 3HGSA 3TNBA 1HGWA 4GVHA 1V02E 3BLEA 3PWAA 1UH4A 1TJ1A 1UD4A 1S2AA 2CHRA 4B4FA 4OIFA 4KFPA 4V15A 4G6CA 1YW1A 3A6OA 5CJ5A 3QPZA 4F9DA 1AD4A 1F05A 4LT9A 3IGHX 2YCLB 2XJ7A 2OG9A 3TVAA 1TCDA 1QUMA 3OVRA 1US3A 1J4EA 2QQ6A 5DY3A 3WD0A 5XIAA 3PS7A 4HSHA 5HMSA 1DV7A 5I0DA 3W1LA 4WJEA 2VYOA 1D3CA 3PB0A 5C9WA 3NQDA 1OD0A 2J27A 4ZXLA 4WOQA 4KEUA 1IQ8A 3VKAA 3W86A 4B4HA 4ERAA 3SY8A 2Z26A 5CSYA 3TFXA 4LQ1A 2HVMA 3E0FA 2REQA 3I65A 4IXHA 1F07A 1H7NA 1GKRA 3SY5A 4PL1A 2GJXB 3NAVA 4F2UA 3THCA 3R2GA 1EA0A 3VCCA 1FDJA 4BZYA 3O6DA 4H7ZA 1I2OA 1DJNA 4J9JA 5H2ZA 2EEXA 1UROA 1UZDA 4WCJA 5C6MA 3IV3A 1CLXA 2YCLA 4QROA 5I7GA 3AIUA 2XIBA 3W7IA 9CGTA 1KNWA 4L6HA 2GDUA 3HGOA 2R1LA 2QJIA 5C9UA 3ZLFA 1ZP3A 4IP5A 1SR9A 4KGLA 4JX4A 4C1LA 2FZNA 2PWDA 3HG2A 1MZHA 3VMNA 3NNTA 4ML9A 1LL6A 4DAIA 1UIOA 3HG3A 4Y9NA 2Y5EA 3QOKA 4IMFA 3SBFA 3WFLA 4F40A 1CIUA 2Z0IA 3GC4A 3UCQA 8XIMA 3U4AA 3BOXA 1UMYA 2ESCA 3B8DA 4KH2A 1UKSA 3CWHA 2EHHA 2Z6JA 4MB5A 1VS1A 5LHFA 2YKKA 4NNAA 4CNUA 2PWHA 4CN1A 3TYAA 5CJMA 4EWND 4OOUA 3W2NA 2GJXA 3NL2A 3IANA 2RJGA 1ALDA 1HQTA 3DH7A 5CSUA 4Q4QA 2FHFA 4H9UA 1EQPA 1D9EA 4FR6A 2SFPA 4FLOA 4KWUA 2VR5A 2J75A 4RPPA 2R1NA 3SRKA 2NQZA 4BI7A 3EMZA 3VOFA 2VC5A 2ZVRA 3LTSA 2GJPA 5EMKA 5HNRA 3ITVA 1RLDA 4NXSA 1ODUA 4YJ5A 3G0XA 2YA1A 3ITXA 1H63A 3UETA 5L6UA 3VD9A 3XIMA 3K4AA 1V77A 2PRLA 1YDYA 2GGEA 2XN0A 1Q7QA 5IDZA 3AIBA 4K68A 3RM4A 4LSBA 2Q71A 3CZEA 2NXIA 3VM7A 5MKGB 5A8GA 1V0KA 4LNCA 1HL9A 2GQAA 5D05A 4E2VA 3LNMA 4S23A 1LJYA 4V28A 1XBYA 2RJHA 1G4EA 2ISSA 3U57A 2QUTA 3AHYA 4UFLA 3V5FA 4XBKA 4DO6A 4YYCA 1HKKA 3LPGA 1NSJA 2W27A 3EYPA 2NV9A 4BR1A 2VC6A 4ZBCA 3ZM8A 4LEQA 1A5SA 2W62A 1LF1A 1GEQA 3IUHA 3LTYA 2Z1VA 4BI5A 4D2JA 2XH0A 1J0KA 4F66A 1GGOA 3SB0A 4LY4A 3WIJA 1L6GA 1PO9A 3HGJA 3AXXA 3VNLA 4E2BA 4UC5A 2PWVA 4UOJA 1JCMP 2Y88A 3F5KA 4NNBA 2W79A 2PDXA 1WP6A 2IXVA 3DESA 1HL2A 3V0TA 3HQOA 1MYRA 3U0HA 4YVXA 4CN4A 3S1VA 3AUOA 1JZ3A 5GPRA 2NW0A 2BASA 4N9CA 2HXTA 5I09A 4BEUA 2NV1A 4GYKA 5MKGA 1ISWA 3FIGA 3VD3A 3NEHA 2CXGA 3C0JA 1ZBVA 4C6DA 2F2HA 1SFLA 1V3KA 1B4EA 5FJJA 2INZA 2VCCA 2NQLA 1GPFA 3MHUA 1UD5A 4A22A 4OFCA 3WYZA 4IPLA 3KL5A 1IXQA 4HPHA 5HMFA 2UY5A 3H7UA 5AC5A 4QS6A 3AS1A 3W1QA 2WKLA 5CSSA 7A3HA 3B9EA 4XIAA 2WOQA 1R7OA 5HQEA 2W91A 1TV2A 5F2MA 3QBUA 1UWQA 5JIWA 3DI1A 4C65A 2E3ZA 1LL7A 5A2AA 1Z8AA 1KCKA 1A5CA 2XFRA 3M47A 1RK5A 1J9YA 1E0UA 5HUPA 1VFMA 3EMCA 3L4VA 4GMEA 4Q8MA 2BY1A 3B4UA 1LOSA 3K1GA 2QDHA 3SRHA 3LZ5A 3VNKA 1S2CA 4LF1A 1FWAC 1S5WA 3RG6A 1HP5A 4FX6M 4TVDA 4DLMA 4A8RA 3GSMA 5D4YA 3KRUA 1DJHA 1HT6A 4MYXA 3KP1A 3NVTA 2YDSA 3BJTA 3B0XA 1AL8A 4MTVA 2Q3OA 3T40A 5CC5A 1JYNA 2HTMA 4ZVJA 3SQSA 1H11A 1MUCA 1O1ZA 4A4AA 4HA3A 1P1MA 1NM9A 1OFDA 4NG3A 3FX4A 3QMRA 1QO5A 3NM1A 3GDRA 3FS2A 4AXNA 1I9CB 6TIMA 3MUXA 3O0FA 3G8EA 3WDRA 5C9XA 2OVLA 3ARQA 4EAMA 3UVIA 2PP0A 4JZ5A 3ZR6A 5DN1A 3VA8A 5HJYA 3MDWA 2ATSA 3BAXA 5HPCA 1XP3A 2QMJA 4DLFA 4IPIA 1M3UA 4UIOA 4UTMA 2EKCA 1EP1A 4GY7A 3WZ0E 4KWOA 1M01A 4LF2A 3OP2A 5DQPA 2V63A 3LLDA 1DEDA 1AQFA 1ENUA 4Q4PA 2VCBA 3KP0A 2QUMA 5HMDA 4ZO6A 1QU4A 2YPIA 1OT2A 2AMXA 2G3FA 4LXFA 3BCDA 4AWTA 3HPZA 1H60A 3I68A 4RX0A 2QXWA 4UTWA 4JQ1A 4W5UA 3VKKA 3CAQA 2CWNA 3DFQA 3V35A 3TTYA 4OBRA 3RPTA 3LEPA 1EB3A 1JGMA 1GVEA 1VFSA 1MNZA 3OZOA 1K7XA 3M0XA 1E4MM 2J8TA 3RR1A 4S2CA 3ABQA 1K6AA 2D2GA 1WKDA 2C0AA 3H2FA 3KOFA 2VC7A 2BWGA 3SCOA 3IS4A 1E71M 1JPDX 3KZPA 4DUOA 1E1EA 2WMHA 4EPDC 1Z41A 4LTSA 1N7KA 4P5UA 3UR5A 2RH9A 4XSMA 1OGSA 3OG2A 5CPSA 4R7JA 4IP4A 5FEZA 2OT1A 4IPNB 1HIZA 4CCEA 3O2LA 4HIBA 4B5SA 4F48A 1IIGA 4R85A 3TCSA 2Z4GA 1W9XA 3KCLA 3BMVA 4AEEA 1KM6A 3W0KA 1UR0A 4BY3A 4ATLA 8RUCA 4M81A 2BOFX 4GC3A 4HU4A 4DUWA 1RH9A 1VBJA 2J6VA 3TC6A 1KCZA 4D6HA 3EGJA 1OX4A 4RNFA 2NWRA 1AJZA 2PCQA 4GJIA 3MMUA 3SRFA 3EAUA 3GY1A 4Z2GA 5AYBA 1NTHA 3CUXA 1HKVA 3KLLA 3CZGA 1SZGA 1Z48A 5H6HA 3UA4A 1MXSA 2EQDA 4HNCA 4HMNA 3N4EA 5HJLA 3RITA 1EUNA 4K6AA 3LV6A 2QF8A 2FPVA 3H4WA 2OPJA 4FXSA 4C6QA 6TAAA 1TREA 3T2QA 4D1JA 4DN1A 1E73M 4OZOA 3WBXA 4I5XA 5CPNA 1VGAA 4PMQA 3T0TA 4H3DA 1R6WA 1SQ7A 4LB3A 2GVYA 1RA5A 3G24A 2GQ3A 3H6OA 2X16A 4LV4A 2C6QA 2GQ8A 2NX3A 3HQPA 3QPYA 4DO5A 1TMQA 1X8FA 2IKHA 3E1F1 2V5LA 1EJWC 1Z44A 2Y5JA 4UR7A 1WOAA 1HO4A 3R89A 3O0KA 2ZDRA 1NVMA 2AL2B 4L80A 5A6MA 3GH7A 3GVWA 1BTMA 1UQYA 4RE4A 3IUDA 5LA2A 1PHWA 4ERIA 3A4WA 3MKKA 5XIMA 3VYLA 1EJ7L 2A3AA 5A1AA 4KMQA 2PP3A 4IIDA 2WSQA 3A5VA 2ZTKA 3F5LA 1DTNA 3UCCA 3YPIA 4B15A 2WSPA 3GKFA 3B3DA 3BMXA 1EJXC 3L5MA 4JIRA 1JGIA 4QDWA 4AQLA 4MGGA 4GXWA 2DSUA 2IQTA 2JIWA 4O17A 1XYLA 2VKZG 1WBJA 3TP4A 3NM3A 2Y8VA 3UZYA 4AY7A 1W32A 4ZXOA 3CZLA 1FFRA 4ROQA 1BQGA 1KFEA 2F9RA 3QHNA 2TRSA 4WGXA 3ZO9A 5AKQA 3UA3A 3DFNA 1DJYA 2ON3A 4BQ4A 4YVVA 3TYDA 5CQ1A 2WV8A 4C7GA 4JKKA 1RPXA 1KW1A 4H83A 4WKAA 6A3HA 1I45A 3LMYA 4N4PA 4FLRA 4NYUA 4D8AA 4AY1A 5LKYA 1PYMA 2AL2A 3QVQA 5CLWA 2QCHA 2FMOA 2G37A 2XWDA 2GGIA 3E5BA 1GOWA 3R1ZA 4X60A 3XISA 2DIJA 4HA4A 1R8LA 1TIWA 3RLHA 5FJIA 4RV8A 4WDTA 4JX5A 2ALRA 2J7EA 1GEHA 2JIEA 4DJFA 2E25A 3ONCA 5E09A 3BPWA 1A80A 1PL9A 4JIEA 2QGHA 2Y8UA 1YDOA 3T0DA 1Q6GA 1YXCA 5KSWA 1VENA 1RVGA 3A3XA 3WD2A 4DPPA 2VRQA 5CCZA 3OGRA 3P0XA 1DWIM 3BE7A 4PUMA 1E6PA 2PLJA 4P7NA 2A7RA 4K8EA 4NILA 1NWTA 2YSWA 3CPRA 1MUWA 1VQTA 3NZQA 1E72M 4Z2JA 5G2HA 2J24A 2ACRA 4Q7BA 1XIJA 3KHJA 3TWAA 4O13A 1DWJM 1QATA 4UQ9A 4JKLA 2QDGA 2GGGA 3L0GA 2JF6A 2ZZ5A 3SY1A 3C3NA 2FDMA 4CD5A 1IGSA 1Y0EA 3KAOA 2ZTJA 1UASA 2ZWYA 3GXTA 2X41A 4WR3A 3CO4A 5C55A 3TQ0A 4A3HA 1TZ9A 1OC7A 4YMZA 5KZEA 4Y96A 4AZ7A 1DQWA 3GK0A 1H61A 1EJTC 1JAKA 3ATZA 4NY2A 3PZUA 2QJHA 1DTUA 2ZUNA 4DO4A 3IJ6A 3HQNA 1MW2A 3IARA 4ZO8A 1QOQA 3W1NA 3FJNA 1NDVA 5H91A 4DUXA 1JULA 1IEVA 4LUSB 3EA3A 3SFWA 1UJPA 1U2YA 2A6NA 4QLJA 2GQ9A 2EKGA 3UGVA 4JL2A 3VTRA 2XU2A 4P8WA 4TU1A 4JY9A 5CGMA 5CGTA 3CB8A 3ZT7A 2BX7A 1TE6A 3BGJA 1LM1A 3CQIA 4GQBA 3ZQ9A 3FEQA 2XN1A 3CLMA 1UUQA 3EX4A 3II1A 1OFRA 4ZL1A 1OFQA 2YDAA 3CQ0A 3WLOA 4FSAA 2Z2UA 3GG0A 2WJEA 3B4YA 1VBGA 3V5CA 2CETA 4GVFA 3JVAA 1OFBA 3TN6A 3NA8A 3W37A 2QZRA 4LW7A 2ZE0A 1B3ZA 1UKTA 3PULA 1QPRA 3PVFA 3L2MA 2Y7GA 3QN3A 3CAVA 3LGGA 2WYSA 4Q32A 3W83A 3SCNA 3F7JA 1KD0A 3L21A 1RJQA 4Q8UA 1TVNA 1GVQA 3KVJA 1VJZA 5J5RA 1F3WA 4ZEPA 3KDNA 4LUSA 1OVDA 4AB4A 4MWAB 3QFWA 4GGHA 1V51A 5A95A 1XLAA 2VDGA 1UD2A 3AXMA 4FXJA 1IF2A 1DXFA 4KF1A 1E1FA 3ZT6A 2V9DA 4A3RA 2EG6A 4J3SA 1QNSA 1VRDA 4W84A 1OIFA 3MSYA 1A5MC 2VHLA 4JIQA 2BY3A 4MZ8A 1E5NA 3LN3A 4HMEA 4QEEA 1WB0A 4GBUA 1G4TA 1XYZA 1YNYA 5REQB 4HU3A 4YWSA 3N18A 1GYMA 4C6IA 4L4LA 3CEPA 1VJIA 3EWXA 3UPWA 2YW4A 2D0GA 4D1IA 2NQJA 1DORA 4C7FA 5KMYA 3SZ8A 1GK8A 1NIUA 2CESA 1PB0A 5AHIA 4W87A 4JEQA 3OQ8A 4QFUA 4F8XA 1KV8A 3S1UA 5JQ9A 3N15A 1VC4A 4V2XA 1N2VA 4JQ4A 4JCLA 5F2GA 1IR2A 2FDSA 4IT1A 4M19A 3GHTA 4RLIA 3N17A 1ZAJA 2OX4A 4MWAA 4QS5A 5HUOA 4HPJA 4DELA 2FZ9A 4O18A 2IPJA 3CJPA 1JQVA 1XC6A 2NWSA 3AALA 1JCJA 2DQWA 4BWLA 1O5KA 2A3CA 2W5FA 2YXXA 3BLKA 2OQHA 1R2TA 2P10A 4I7WA 3LRKA 1DIOA 4ADTA 2E5DA 4HPGA 5FEWA 1JCNA 1KTCA 1PIIA 4IPPA 5DANA 1ZJIA 3RR4A 2QCDB 1VD6A 5B80A 5BRPA 1WDRA 3PPGA 2OXNA 3IEBA 4U31A 2D1ZA 1WYIA 3TSDA 1JD7A 2WJZA 1O5QA 5REQA 3DKLA 3O05A 2Z29A 4WIWA 3MI2A 3FVDA 1WDSA 3W70A 1QT1A 4I5RA 4GZ7A 3I3BA 4D6EA 4QJ3B 3G5EA 2X40A 4AYSA 3T0AA 1HW6A 5BCAA 5XINA 3OLDA 1E3ZA 3KRZA 1J0YA 1KFJA 5K4ZA 1XH2A 4BK9A 1WZAA 2OGJA 1DVJA 2Z1KA 3IRSA 2VWTA 1XIGA 4LC8A 4P7LA 2QLYA 4S1FA 2UY4A 3LZ3A 4KESA 3VFLA 5G5IA 2CCRA 3DYMA 1JCTA 1TPB1 1W8SA 4PMJA 1MDRA 2BV9A 4F79A 2QIIA 4ZGYA 1HG3A 2WHJA 3CZJA 1LL4A 4P61A 3URNA 1P0EA 5A5WA 4HOWA 3TK7A 1J2BA 3LQLA 5DRIA 4DWDA 1XIHA 4MUPA 3GVRA 4PUDA 4IMAA 2YJQA 5I78A 2QCDA 3U2EA 4WHBA 1AJ0A 1G69A 2WBGA 4M6QA 4CKQA 2G3JA 2CNCA 1V3LA 2PGWA 2CHNA 4KFOA 3AROA 4PTXA 3UJSA 1KQYA 1WXJA 2KAUC 4BA0A 2NV2A 4REQB 1B30A 3O07A 1XLKA 4GA8A 1B9ZA 2VEFA 1WZMA 4DY1A 3A3HA 3M9YA 1A4LA 4JTCA 1F8MA 5G1YA 2GJLA 4WGHA 3P84A 2RFGA 1LYXA 1KGXA 4QNEA 3UNTA 2P1FA 4GD0A 3MZNA 1PVNA 2GLKA 2YA0A 1BGAA 5HAOA 3A24A 4NXKA 1JFXA 4C6BA 2PDMA 3WFZA 4PB5A 3VZYA 3QKEA 2OZTA 4XBSA 1A5AA 1C29A 2XFFA 5HWJA 4JNZA 1O60A 3J7HA 1AQ0A 4HA1A 3PG8A 4ML4A 1I60A 3GDLA 3ALGA 4WDXA 1Y5WA 3CAWA 1A3WA 4OE7A 2UY3A 2INEA 4MWAE 4U10A 4WZHA 2C79A 2CWXA 3W76A 2YZRA 1AH3A 4AZ5A 2ZYFA 3WMSA 4R88A 3RX2A 1D7FA 2VOMA 2XIJA 4REQA 1QOXA 3EX3A 4QISA 3H21A 3KVMA 3EXTA 3VGHA 4J3VA 4JTSA 3OVPA 1W56A 4GUFA 3HV9A 2Y8KA 3NEVA 1UR9A 5IOBA 5GNYA 5AFDA 1S46A 1T99A 3GXFA 2YL9A 1WA3A 1O95A 3MPGA 2I7GA 3L68A 5IFTA 1D7KA 3EOSA 4IQJA 3STFA 4XD6A 5A94A 4RZ6A 4DI8A 3NQGA 3TKFA 5G1MA 3N2XA 3SR7A 3G1SA 4HBKA 2J9ZA 3MQTA 4S2BA 4UZSA 3TAOA 1CXEA 5HR7A 1KRMA 3I3EA 3U2OA 3VX1A 4BQ2A 1OJXA 2A85A 4BI6A 5CPQA 2QHAA 3O9NA 2Z24A 2WHLA 3N4FA 4NZ5A 1X6NA 3FXGA 4HYVA 4IMEA 3MDUA 4QJ5B 1DE5A 3LY0A 3STEA 2WK2A 2OSXA 3R94A 3U2CA 1IEXA 2ISDA 2A4AA 1HKJA 4XD5A 3VIJA 4C1KA 2D69A 3CYVA 2PTZA 4KERA 5FF4A 3PG9A 3S0CA 1GYLA 2XVLA 1C8QA 1OFAA 1E9IA 1WXZA 5E0FA 1B3YA 1V7YA 3THQA 4JBRA 1MW3A 4LCQA 3W23A 1GOKA 2CKRA 2XSXA 1QNRA 1GQNA 3GTFA 3W1AA 1FH8A 1FP9A 1XYFA 5I00A 3GTHA 2GJRA 4UOQA 1V6UA 1DWFM 2VX4A 2GOKA 1BWLA 2QJGA 1A5BA 1QHZA 3ALFA 1Z32X 2YW3A 3S4TA 2J78A 2Z1BA 1JG9A 1F3XA 2X0YA 1PAMA 3B03A 4EF8A 5JMUA 3SADA 1NQKA 2QT3A 2VRKA 4UR8A 2HVNA 2WLZA 3HFTA 4NZCA 3TJLA 4WKFA 1QHPA 1MW0A 2X0HA 4KCTA 1UD3A 2H90A 2X1RA 4HMCA 1WKFA 5ABEA 1Y5XA 5HULA 3OLIA 4J4KA 1SO4A 5D09A 1QPNA 2VC9A 4US5A 1EC8A 2CW6A 3CWNA 1FWGC 3GX9A 3W25A 1W5QA 1UWAA 4D6FA 1UUOA 1U1HA 1K6WA 1PTGA 3TQVA 3ISIX 3UXKA 2EPMX 4XZLX 1X7IA 1H50A 4H2HA 3S1WA 1WQ5A 5K4XA 3K8KA 1XBZA 3P61A 2QIWA 3WJSA 2CLHA 3NQEA 4G9PA 3BUVA 4RW3A 1E0WA 4AIBA 5LNWA 2BSLA 4B3ZA 4I6KA 4MKVA 2XSAA 3PZMA 4UTUA 1AG1O 2BXZA 1KFWA 4H7CA 4RXGA 1RY0A 2P76A 1XLGA 3KBJA 1DJQA 4M6UA 1ESWA 2VFHA 4DPQA 2VR4A 4ZQOA 3UCDA 1RALA 2ABBA 3THDA 5JUVA 3PPHA 3QYQA 4FNUA 2Z25A 1QWGA 3OIHA 4N6EA 1J79A 3MSRA 3MTWA 3GUWA 2JGYA 4P8XA 2O9RA 3P5YA 5LSMA 1WOBA 5I5RA 5D33A 3VIKA 3GLCA 2VRJA 3AC0A 4CNSA 2AGKA 3QHOA 4B90A 2D0HA 3HPFA 5DMYA 3KRSA 3SUVA 4AD0A 1KBKA 3OZMA 3EKGA 4D71A 3TTQA 3G0SA 4R33A 4XZIA 2V5CA 4Y7EA 5H8UA 1LTDA 2D23A 4GFIA 3B9NA 3WK1A 1JI1A 3WD1A 3W7EA 3CT2A 3QR1A 2C3ZA 3PJTA 2XIMA 4O52A 4TTUA 2VT0A 3OEXA 1B5TA 4AHQA 1R3RA 2VUNA 2A6LA 4O0KA 2EG7A 3AYTA 3DCPA 3PP7A 3WX7A 1XD1A 1W9DM 4U28A 3T81A 3KL0A 1YQ2A 2XIIA 3MO4A 3BQ6A 5IHRA 1XGEA 3Q2DA 3TZNA 2XTKA 4J3TA 4S3CA 1CPUA 1XDMA 1QRQA 1MRAA 4LCSA 3PUOA 1LG2A 3T09A 3IAPA 4IWWA 3ZIZA 5GJPA 1ZBKA 5C2GA 5BOFA 3CHEA 3QMSA 3RX3A 4F3HA 3CZ8A 1U1UA 3VNJA 4MNLA 2PLCA 1BEUA 1PKNA 1W6TA 3G18A 1UR1A 2ZVIA 4JR5A 5LHEA 3LB0A 4KIRA 3DC8A 3W4RA 3W87A 2E77A 4GIAA 5HWMA 3LHTA 2PDNA 4TR9A 4YNGA 2YXOA 2DSZA 3G1XA 2RDXA 3WQ6A 3N9SA 5A8OA 1M7OA 3O15A 3NQ6A 4M1BA 2BLEA 4XZBA 4ASTA 2WJDA 1ZCOA 3GW0A 1R46A 3P82A 1KRBC 5CC6A 1X39A 4BCEA 2WZIA 4GNKB 1JDAA 2DORA 3B9DA 1Q45A 4E8CA 4GE8A 4LAOA 4DWSD 5BNKA 2ZUUA 2ISFA 1KKRA 2QPUA 4XZHA 2FJUB 3ITOA 2WNZA 2PMQA 1HFBA 3BW3A 3OW1A 3UERA 4R27A 1KFBA 5CPMA 3R79A 1BSLA 5HQLA 1F5ZA 3CMFA 4GXPA 1I1XA 3WQVA 1QVBA 4FF7A 1NFPA 1BAGA 3M0MA 3AIQA 4JN7A 3B8VA 2PSNA 4K8GA 4K1WA 2IQDA 3AU6A 3UJEA 2OLHA 1OEPA 1SW0A 4YS1A 3DYOA 5GVJA 1DWHM 3SIMA 3V36A 3TOYA 1CXKA 3G8RA 2J7DA 1AW2A 1EWEA 1MWOA 1WV2A 2YL5A 3ZWTA 3DX5A 3NQCA 3W29A 4WK9A 2CZEA 1G94A 2BS9A 4AD2A 4PUEA 1M65A 3GDTA 3ABRA 4C6EA 4URIA 3LI0A 4H00A 4O28A 2H8ZA 3STPA 3TMLA 3EBVA 3ABSA 1BYDA 3M7WA 4PRWA 2ZZ1A 3RDKA 4D6IA 2NT1A 1OG6A 1O94A 4GI6A 1LRNA 4Z1DA 2FHCA 5CC3A 4Q8PA 1IXPA 4KCWA 2X1UA 3IJ9A 2G50A 3TYUA 4KCUA 1EO7A 3VC5A 2VR2A 1S5TA 4HHHA 3F2DA 3I6EA 3MW7A 1F7BA 1QI4A 2QCGA 3LCHA 3K2GA 1OYAA 1CZ1A 1OQFA 5BROA 4XBJA 4W7UA 1PJ9A 3MBFA 1JZ4A 1E6XM 2DSVA 3B06A 2VZOA 4PFMA 3RM9A 1FHLA 3NSMA 4P8UA 4JN8A 1MEWA 5G2IA 3UWQA 3CQJA 4LYRA 2OZ8A 5AVHA 1CLVA 4V1XA 3UNDA 3C8FA 3GG1A 3S5OA 2J7BA 1ZLPA 3AHXA 1M1BA 4J2MA 3BLFA 2Y89A 3W1TA 2C15A 3GU1A 4W88A 4EX4A 4ERGA 1SSDA 3OBAA 3WNPA 4E4PA 3PBUA 4L7ZA 1YTEA 4PBFA 2ZA3A 1SMDA 4LYKA 1TR1A 3WJZA 2UV8G 4QNWA 3VKBA 3TLQA 2HISA 2ZOXA 3A4AA 1ISYA 3NDYA 1K70A 3K8MA 3HBLA 5TIMA 3IIPA 1TV4A 3UG4A 3L4UA 3V16A 1WPCA 4DWSC 3FJ4A 4XKMA 1GOXA 2VX5A 3FW6A 1NARA 1JXJA 1CXIA 4BF9A 5GJMA 4MZ1A 1YHTA 4N0RA 3LG3A 3HM7A 4JICA 3W53A 1CGYA 2VEIA 5IHSA 1TRIA 2W0UA 5FCZA 3NTYA 5DCDA 1HO1A 1PKYA 4DX3A 1IR1A 3F4WA 3VFCA 2HZGA 1W9BM 2FGBA 1E3XA 4Y9OA 4YTTA 3K5XA 5JVLA 4BQ3A 5DCBA 1JZ5A 4DBUA 4X2PA 3DKJA 4JS3A 3BSGA 4ATDA 4BF5A 2NUXA 2VENA 1D3GA 2X0SA 1YE6A 1YPIA 1V3HA 1H51A 4G8TA 3DG7A 3OGVA 3WLSA 2V3GA 4U5KA 4QAIA 2JEQA 2MNRA 1EZ2A 3S5ZA 2DU2A 4YTRA 7PTDA 1EDGA 4UTTC 3LNPA 3LRLA 2O56A 3F1QA 5L9FA 1LG1A 4X3ZA 4GGBA 4KIEA 4O0ZA 2QUUA 2HS8A 4GUIA 5FESA 4C6NA 1XLLA 2QVNA 2AQOA 4M8UA 1PX3A 1J0JA 1X1NA 3GBEA 3QQ0A 2VZVA 5D2XA 2B7QA 1CI1A 3IIOA 3VZZA 4FPSA 1XIMA 3LM3A 1QFEA 2EPNA 4PCSA 5DT5A 3VOJA 3V18A 3A64A 4WSHA 1ZQ5A 3MI3A 1YPXA 4K2SA 1W0MA 1KCXA 3OZYA 3JW7A 1EGMA 1MW1A 1CDGA 2Y7FA 4QJ1A 3BWWA 4MJMA 2ZE3A 4B5NA 4D8ZA 1DJGA 1V4YA 2ABAA 3W01A 4EKJA 3SCSA 2ZRXA 1EHAA 1MVYA 4MNKA 1U5HA 3VNDA 3CHDA 3B97A 3VKDA 1VYPX 5A6SA 1H3GA 4NJHA 1WUFA 5F4SA 5A2BA 1LORA 1ONRA 1TG7A 2G5WA 1XBXA 1C9WA 3HU7A 2IPFA 4LS0A 1IT7A 1UWIA 1TELA 3NYDA 4XUGA 4C5YA 3DFYA 3WLLA 3WLTA 4DXVA 1F2JA 5BU9A 4NKCA 4GO8A 3SN0A 1GHSA 1K77A 2YZ5A 1E55A 2YR1A 3T2OA 3WLNA 2DT0A 1L0PA 3UFYA 2FGZA 2YFNA 3V5OA 3SGGA 3T78A 1V3IA 3OHMB 3WQPA 5C9ZA 3CYJA 1UR3M 4DIAA 2OMAA 1W1PA 5AC4A 4IHCA 3EB2A 2E6FA 4DAFA 5JBFA 2OYKA 2XH7A 4LPCA 4KKXA 1XSIA 4MSSA 3SIZA 3ZR4A 1M6JA 4Q8OA 4H8HA 4MMWA 2VURA 1DWGM 2PU0A 4PMNA 1NF7A 2HDJA 4XZNX 1XGZA 1AMKA 3LBMA 5I6SA 3KDOA 3NG3A 3URQA 4JKMA 1UQZA 3PJUA 3TX9A 5I3JA 7TIMA 1PPIA 4FALA 2H9AB 2EO7A 4GCXA 2WVVB 1X98A 3QRHA 4QDPA 1OFEA 2P88A 3WH9A 1YXYA 3RK8A 3WQOA 4JTUA 1POKA 3VMPA 1GVFA 4HYWA 3B8TA 3XINA 4WSKA 4WDWA 3LCXA 4XTIA 2V2HA 4JHMA 1WNOA 3T4WA 5LIXX 2H3DA 4A8NA 1OBAA 2BP1A 4K8HA 2FGLA 3KWXA 2FFCA 2R91A 3PB2A 3S6OA 4DM2A 1F73A 3AIVA 1JXKA 3WCZA 3QQ1A 1VFTA 3P67A 1D3HA 1CNVA 3MUAA 2IXUA 3VILA 3NGJA 2FB2A 1NOWA 1Q4WA 2Z27A 3C2VA 4FP1A 5F1VA 1S38A 4YIWA 4PMOA 3A4XA 1XYMA 3PZQA 4W85A 2WNQA 1UKQA 1ZY9A 2C13A 4HTBA 1PTAA 1RV8A 3LTPA 3LM7A 2WWDA 1WDWA 3QGAC 4J2PA 2H9AA 4GKTA 1V6YA 4F9JA 2WVVA 3L5LA 1T96A 3LERA 2Y62A 5BXPA 5K2ZA 5PTDA 1E56A 1QW8A 3RPMA 1H0GA 2IS7A 1FXPA 2FIQA 2VGIA 3CQKA 2W6RA 3N3MA 4JYEA 3SJ3A 3EXRA 1F3TA 2NUYA 3K4DA 3WQDA 5IFPA 1G7VA 1XLCA 3BK0A 3HJZA 1RY8A 3IJ7A 3T55A 1TR9A 4R34A 4UNIA 1FHUA 1OCNA 4S3AA 3CV1A 3GR8A 1L9WA 2QV5A 5LXXA 4GVGA 2O55A 4JIIX 3ORWA 5DELA 3AMDA 1VCFA 1NDYA 1FH9A 1GW9A 2EAWA 5B7YA 4PMRA 4MKNA 1VAHA 5CBIA 1XM3A 4W5ZA 3GHSA 5A8PA 2JALA 3ZSTA 2HK0A 1QMLA 2GWNA 3H2EA 3GC2A 1XF0A 3PHAA 3SAZA 3R8GA 1Q13A 3W6MA 2R1KA 3N2MA 1LLZA 3NO5A 1M5WA 2Y70A 3WEOA 1GOIA 2X1TA 2F6UA 4HZ7A 2FB3A 3TQPA 4LVAA 1EYWA 2PS2A 1F6PA 2GOUA 3TXZA 1Q66A 4GUJA 3LDVA 1TO3A 4NP7A 1TPUA 4QCFA 3VOHA 4PFHA 2D0FA 1RQHA 5CG7A 4I6VA 3THUA 5H8PA 4QE4A 3VGEA 3BOLA 1A3HA 3MA8A 2EGZA 1ONWA 1JZ7A 3RGTA 2XYLA 1A53A 5M1TA 3B04A 4H9TA 4Q7NA 3VI2A 4FK9A 1VP5A 4S38A 1RSCA 4TMCA 1OSEA 1XD0A 3M0IA 1K4GA 1UIPA 4IXXA 3RNDA 5LA0A 5DMLA 5A8QA 4TMBA 4DJED 2DUXA 1P0KA 4EE9A 1QNVA 1TKKA 3EOEA 3EXSA 3LCIA 4AF0B 1JVNA 2AAAA 3OA5A 4CEXC 3TU9A 3DOPA 1FWWA 4H9VA 5FACA 1FRBA 4JQ2A 3V0SA 3ZR5A 3NL5A 4HYRA 1KQZA 1T8QA 1EJVC 3GNOA 2O9OA 3FKRA 2WMIA 3VZXA 1J0HA 4L4PA 3REQB 3TNOA 3D46A 1UKPA 4UZUA 3D6NA 1S1RA 2ACSA 1FH7A 1JR1A 7TAAA 5KZMA 1QXLA 3NQMA 1Q5MA 1TSIA 3KBMA 3KVLA 1UZ1A 1W9VA 3VIFA 5DMNA 3S3GA 1OADA 2PRMA 5D9MA 3GNPA 2Y61A 4F0KA 3OU8A 1R3SA 3U7BA 4JD4A 1E6SM 2B0MA 3W7MA 4CQ8A 1UW9A 1OGBA 2MANA 2VVNA 3NL6A 2NZLA 4US6A 1Q85A 3LBOA 2V5DA 4YHEA 3PY2A 2EPLX 3L12A 4X2RA 3QTPA 3RILA 1OYBA 4AF0A 3OYXA 3C56A 1VFFA 4V1YA 4FMVA 4OTKA 2J25A 2FTPA 3FKKA 4HHLA 4XTDA 3IK4A 2CITA 3E74A 1I1WA 3ARTA 4IIHA 2G3NA 5ECVA 1RBLA 1UWRA 1BD0A 3L4TA 2E4TA 2VOTA 3CIVA 5HNTA 3GNDA 2DH2A 4D6GA 2FPYA 4H4IA 3SN4A 3ARRA 1J10A 3TW7A 1W5MA 2X7VA 2OKOA 1GYNA 5FSDC 3G1DA 4RDWA 3KTXA 4ADUA 4ES4A 3HPSA 2CLMA 1GVOA 4IFKB 4ZSUA 1AZ1A 1PEZA 1RZMA 3UBPC 3ZFHA 1XR2A 4MPQA 4YL2A 3DECA 4PEEA 3NR0A 1GOQA 1EH9A 1ICQA 3P8IA 1L6YA 1FWCC 4PSPA 3LCWA 1PUDA 4H6QA 2BBFA 4A8LA 1MFUA 2NXHA 1F9CA 4NVTA 1TPEA 4DJEC 3LCFA 4JTRA 3VOGA 1KGUA 1K8XA 3CS2A 3MZ2A 1G4SA 2I14A 1OF8A 2B7OA 4GQRA 5A6BA 1TJ2A 4WRHA 3AO0A 1BWVA 4M7SA 3WUBA 1I0BA 1GZ1A 2C16A 3O16A 3E5PA 3UU0A 3DG3A 4LVDA 2BOGX 1F6YA 4FXFA 4WF7A 1M7JA 2L5HA 2XFYA 1EP3A 4Q6JA 1EEPA 4HOZA 2O7SA 3IUIA 1WO2A 4LOCA 4AMCA 3CASA 4IFKA 1HJQA 3D0CA 1JIBA 1DE6A 2OQLA 1G5AA 2HV5A 3TYEA 2HPIA 2W61A 3QY8A 4S3BA 1KO0A 4JIHA 1KM5A 2VNCA 3LOTA 3H24A 4I9AA 4Q6XA 3RHGA 3VGDA 2OEJA 3VE7A 3EKZA 1ITXA 1LT8A 3A5FA 2VFDA 4MJ2A 1RXOB 3UR8A 3KOYA 3RXZA 2WC3A 4UWMA 2PWGA 3UPBA 3R58A 4JXCA 5RUBA 3SSZA 4FNPA 3R0KA 4QAWA 3EEGA 3CUHA 3TFCA 3PBVA 5CPTA 1I2QA 4PMZA 3Q67A 3KZSA 4L9ZA 2J8GA 4QE5A 5JBDA 3DYPA 3W6YA 3OYZA 1L8PA 2FTWA 2F84A 1S5MA 1TUXA 1U22A 4J1OA 3VDAA 2PF0A 1TVLA 4GIEA 4TX9A 4NZ4A 3E0VA 1Z3NA 3UJRA 5HNUA 1ICSA 3OB8A 5TD4A 4IM4A 3L4YA 3GYCA 1HUVA 3TAKA 2ATMA 4JTIA 2MUCA 4I5UA 1L6SA 4KBXA 2DEPA 1C3FA 1DQXA 3N3TA 4OUIA 3EWDA 4M6PA 3W7KA 2F38A 4DI9A 3B05A 2BGNE 1RBAA 3RM8A 1TWSA 2NQ9A 2R9RA 3SUWA 1ZUAX 3WK2A 1B3WA 2TPSA 4N42A 4EPEC 1BF2A 3W1PA 2XN2A 3P7YA 1EUAA 4N9EA 3M46A 1Q65A 1QDSA 4DYEA 4R7OA 1K7EA 2J79A 4TVUA 1L2QA 5I3DA 5CH9A 1T41A 4MHBA 3BDKA 1XRVA 3GFZA 3IJDA 3L23A 2P50A 5HNNA 4X0VA 1AFSA 1LZOA 3AHZA 3USZA 4L6OA 2PDUA 4JOMA 3WLIA 2AKMA 3HOJA 1XH0A 4RW5A 4C6KA 1XX1A 3VMOA 3UG3A 4XV0A 4AZGA 3L9CA 3AS0A 2BXYA 4ZA0A 3PWGA 2V38A 2WO5A 1M9HA 3RN6A 4LUIA 1CCWB 4JHZA 2CC0A 2A0NA 5AOUA 2PGEA 3NCOA 3HURA 3Q65A 1TTQA 4XD4A 4LGXA 1C8YA 4U2YA 2A3HA 4QXIA 3A13A 7REQB 3QZ6A 4R3UA 1BVWA 1H7XA 1XQLA 4KFNA 4UFIA 1JUBA 4QM1A 2XSBA 1W1B1 4HU0A 2F2KA 4FI4A 2JE8A 1GT8A 2ZWZA 4AYGA 1I2RA 2ASHA 3NFUA 4KQNA 2OSYA 2PI6A 1DJZA 3I10A 2RGMA 1MQRA 4PB3A 1EP2A 1EJSC 5TNVA 2HPMA 2PRHA 3QW3A 1XPYA 4OVXA 3VIHA 2WBKA 1IEQA 1O1HA 3M5VA 3EWCA 1HX0A 1ADDA 2GL5A 3H26A 1VPYA 1PYFA 1JRCA 2ZC1A 1BVNP 1X6LA 3JUGA 1TMHA 5I2UA 1U33A 2BY2A 2VMFA 3MUZ1 5HWNA 3HG4A 3HV8A 1FBAA 1KBLA 2PU1A 3AS3A 2W63A 3EDKA 2WMFA 3MU7A 1V3JA 3ANYA 3IJIA 3E38A 3V4BA 1W1IE 3OG3A 1E0XA 4ZB5A 3RMEA 2ZX5A 2QR6A 3MVTA 2TAAA 3DDMA 7REQA 3C2RA 1RCQA 4Z0JA 1L6FA 1E4NA 3SN1A 3C0LA 5HINA 1UOKA 1SO6A 1TRDA 5D38A 2GDVA 3FV9A 3UEQA 2JK2A 5E0KA 2VQTA 3IPWA 5D32A 2ZDSA 3W1UA 3UGRA 4HZ8A 1TZZA 2WQDA 3L2LA 1DP0A 3V3WA 3LXAA 3DFHA 1B3VA 3A4JA 3GHRA 2DVXA 4NI8A 1H7WA 3HGRA 1LLOA 4ZOCA 3LXBA 4UBPC 3CL6A 2DVTA 1EKOA 2XG9A 3WL1A 4QQUA 4B5XA 4NI3A 5F2IA 3UF9A 4P7RA 3WY1A 1P7TA 3MUY1 2IPGA 4R7WA 2WVUA 2O9PA 3ZJ7A 5D2YA 1HVQA 3W1MA 4HHMA 1BPLB 1KA9F 3L5AA 5D9NA 8A3HA 2J77A 3VNYA 2I16A 1FHVA 2BY0A 4B2DD 3NWRA 1Q7ZA 4UB9A 1NP0A 1LP6A 1EL3A 1GQIA 4FIRA 1MXGA 4HOXA 3O6YX 1AMYA 2HSAA 1SYTA 2W3ZA 3MP5A 2J4GA 4JAWA 4Y9PA 5EMYA 4LANA 1YADA 2XGIA 1ODZA 1KBJA 3QV8A 3AISA 3S2NA 4JNMA 4FR1A 3NQ2A 4IX2A 4QHRA 3LHUA 4GYFA 4GISA 4F0HA