1EKSA

Asp128ala variant of moac protein from e. coli
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
140
Chain Sequence
b'MVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYAMCKAVQKDMVIGPVRLLAKSKSGDFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
publication title Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 32
structure length 140
sequence length 142
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 1eksA00
2IDEA 4PYAA 2IIHA 3JQKA 2OHDA 4PYDA 3JQJA 2EEYA 2EKNA 3JQMA 4FDFA 1EKSA 1EKRA
chains in the Genus database with same CATH superfamily
4O3OA 1Q8KA 1NLKL 1HNVA 3QT6A 1FFWB 3Q8YA 1DQ8A 3MR3A 1LW0B 3PEHA 1NAQA 2E5IA 4R25A 2LCWA 2HLTA 1FJGF 3FCWA 3BYPA 2NQPA 5DLGA 4DEZA 2PD1A 1SC1B 2UUBF 4I6WA 2X7IA 1DTQA 4X4VA 4USUA 1GEHA 3M8ZA 1U1OA 2MLYA 1ZZFA 3ZTPA 2RF2A 4C0HA 4WWSA 1IQTA 2OP5A 2EFGA 2QJ3A 4ZDNA 4I2PB 3Q86A 2YNFA 4ETXA 3VGTA 1J5EJ 2W2OP 4N8OA 2W7AA 1BWVA 4DR3J 3OR2B 4DU8A 4I7FA 1UP1A 5DDOC 5CAAA 1NJWA 1NCLA 2RB7A 5LSLA 2H48B 3TOQA 5FDLB 2MB0B 1HWJA 4Z37A 5T14A 4RUAA 4ELVA 1RTIA 4ENOA 3I82A 1EETA 1PBAA 1RHUB 5K14B 1JLEA 1RTDB 4PXDA 3FVYA 3M8QA 1R7IA 4LR8A 2O66A 4JV5F 4USMA 2RJZA 5F8MA 5H9FJ 4C8ZA 1CBKA 2ABYA 1B64A 1FDAA 2EBGA 3DRSA 1ZA1B 3C6UB 4K7QA 1F5BA 3P45B 1TV6B 3DGPB 3DHXA 2EC0A 2Z8QA 4NLVA 2V2QA 1KTVA 1SQGA 3DXSX 5ETVA 2UU9F 1HWIA 4A48A 2UVWA 1WHXA 5THWA 2JVOA 2OEJA 4DMZA 4PEOA 2LXUA 5F8IA 3R97A 2DH9A 4JI6J 3GYXB 3AQPA 5C25A 1GT8A 5KT2A 1XMBA 3CVKA 3I87A 3A8JA 1Q8LA 3PZPA 1IR2A 2YWHA 1RTJA 2QYGA 1YRTA 3L95X 5DRKA 2CKWA 4IDKB 2UXBJ 2V9WA 4DR6J 3JQMA 3MCMA 4WFXA 4DX6A 2AZ3A 1NK4A 1R0AA 4FYWB 2CXEA 2F1FA 2MQOA 1MG7A 3SCLE 1URNA 4OJGA 3JYTB 3A3PB 3KUHA 2GVZA 4NLXA 4ZP9A 3ZZOA 3HT3A 2BYCA 1RHRB 4M5KA 2EKNA 5LMUF 1UPPA 2K3IA 3FFIB 3RR8A 1OWXA 1R6YA 3MUTP 1VQPS 3JAMY 2H4YB 2POKA 5L1IA 3RW6A 4WU2A 2ZKUA 1F9EB 2KN4A 1U4BA 1DFDA 4OYZA 4ICLB 1F5CA 5DDQC 4FF3A 1X4FA 4ECUA 1FD8A 1D3WA 3RG6A 4ECVA 4MK8A 4OZ5A 1Y10A 2XLIA 1XMQF 1L3VA 3RAMA 2OTLS 4M8LA 3RJMB 4TYBA 2K1RA 1QAIA 1S99A 3VZIA 3EX7B 2HWHA 4NLPA 4CRJA 1TMMA 2QL5B 2AV5A 5FD1A 2RRNA 2ZFHA 4KBIA 1WTBA 2HIQA 4AT1B 2OSQA 5ETSA 1VR6A 4DL4A 1UA1A 1N36F 1GXLA 2EFPA 1SKUB 2QN6B 5ETLA 4RWWA 1KD1T 1CSJA 4DPXA 2MQMA 2KFNA 1UKUA 5HLFA 1KWMA 2EFNA 4B9MA 3C6TB 2YXLA 5I3UB 3JAMU 4KH0B 4J9SA 5IS2A 4A8YA 3PW0A 1FKPA 4J9KA 4O3QA 4FPIA 4R8UA 3IC1A 2D9PA 1SH0A 1JLQB 2N3OA 1S1UA 1HPZB 4O0NA 1CLFA 1RLCL 3VGSA 4LF8J 4ZP6A 2DRBA 3ONQA 2JJ4D 3OLAA 2X1FA 4MFBB 4ZLJA 3MOJB 5KFUA 1UETA 3HHLB 2FLLA 2FHJD 1T03A 3D68A 2NCKL 1KR4A 2PA8D 3OXFA 2GGPA 4DU7A 2CWKA 4WF9Q 3IG1A 2WVFA 4C0BA 4KGZB 1RHKB 4HHUA 4RO0A 4KTQA 2PFFB 1QY7A 4RNOA 4FF4A 3CO0P 2IFXA 5D3GA 4X65J 2JH3A 4YFUA 1HR0J 3ZZYA 1RWOB 5D6GA 4Z2XA 4K0KF 2MSTA 4WJBA 2W01A 2E29A 5CCMA 3LP2B 5DETA 2FQQB 2VJUA 4YHHF 3TJ8A 1RWKB 1NK9A 5I3QA 3EPIA 2VA2A 3M9MB 4FYDA 1WUUA 4NLDA 3WC0A 3D5MA 3PYGA 2ZOMA 3DXBA 4X4QA 4TY8B 3QMQA 1D0EA 1SC6A 1ZTTA 2WCXA 2OEKA 4XDDA 2MY8A 4AYBD 1GXTA 4WXOA 2XMUA 2VQFJ 3KK2B 1WWHA 2AIRB 1FE4A 4WP8A 4ED8A 2WSFC 1P8GA 3E3XA 1VQLS 1KKHA 1JQGA 3IBCB 4G1QA 5ETKA 4JOUA 2ZHAA 1YBUA 1TKZB 2R7SA 3KG4A 3KJVA 4X4UA 1CS4A 4Q8EA 1S7IA 2LU1A 2MQPA 2FB0A 1FO1A 5J2NB 1HBOA 1TL3A 1S6PA 2Q43A 4DV3J 3ZNJ1 1P9QC 1HQUA 3GYNA 4CZCA 1XNRF 3I32A 2NSCA 1FX2A 4YS2A 3CO9A 4HI2A 3LAKA 3W65A 3KTQA 1HNXJ 2AYEA 1N5QA 1Y5NB 3G86A 3BQ2A 2ILYA 2AEJA 4J9UE 2DGUA 3T1HJ 1VFJA 3SCJE 1DURA 4ECWA 3BPDA 4X4RA 2L41A 2BBEA 1RTZA 4LUBA 2HLUA 4WXWA 3G8QA 3RB0A 1JX4A 2A6OA 3R7SB 4DFJA 3NLCA 3P3DA 4ZPWR 2R8IA 1YI2S 4RU2A 1QM9A 1LKZA 2OTJS 1KBRA 1RAHB 3CMES 1Q1KA 2UXCF 3B6BA 2F7VA 2IC3B 2BJ9A 3KJQB 4I7FB 1XR6A 1CJVB 4OI2A 2RQMA 4C6AA 1ZAVA 4M1KA 1Q7LB 3OR1A 2XMWA 4A46A 1KDNA 3MM7A 3OFFA 3M9NB 1NSAA 3CIZA 2ZVIA 4UOCA 3TZWA 4DL2A 1V6HA 2F3JA 4A8OA 3MPWA 2PN6A 3T1YF 4OYPA 2ZBRA 4W98A 4DZ6A 1VLYA 1YJ9S 1FRJA 1U1QA 2K06A 5KOXA 4IUFA 4PG5A 1M1HA 1TL1A 1NZ8A 2HHPA 4USTA 3UR0A 1O5JA 1W26A 4HI1A 1KTQA 3DRSB 3LP0A 1TAQA 3GE9A 4QZVB 4CLYA 1RSCA 5LJ3Y 5F3TA 3FBBA 1U2FA 2G2YA 3N6MA 5A8KA 3L7PA 3LAMA 3N4WA 1SV5A 5HMXA 2VG7A 1ZH5A 3HZEA 1JLFB 1X7VA 3OLBA 4Q44A 1FHTA 4IFYA 5C2GA 1IWAA 3LGMA 3PNIA 4DUYF 1RTJB 3NGTA 4URGA 1U8SA 1URRA 4HTIA 2JEFA 2OMOA 5BR8F 4IOAQ 4OHXA 4RKUC 1VC0A 3GIJA 3B78A 4HEA9 1MWYA 1T3NA 3KKFA 1KVKA 1TKTA 1U24A 4YY3F 1QAXA 4RNMA 4G1IA 2V68A 4DR5F 3JS9A 2IJFA 1S1XA 2GVZB 2WBMA 3FDSA 4DX8H 2BV3A 2OD6A 4JV5J 2HAIA 3CMQA 1WHWA 1H0HB 3WX4A 1U0SA 4F50A 5HROA 2Z2YB 1UMJA 3W8GA 1HI0P 4OMFG 4PPDA 4NA1A 2MQNA 4PPZA 2WONA 3QWPA 1X4CA 5HBMB 5CABA 3TQ1A 3FEYB 2VOPA 2CNOB 2KJWA 3GCXP 4ID5A 3ENWA 1TQLA 4J9LA 4PYAA 4K8RA 3PR5B 1HYSA 2JZ5A 3IP0A 2FVSA 4UF4A 2NPFA 4P74A 2ZJRQ 2CJKA 2XO7A 1OO0B 3KLGA 2QIFA 3M8PA 2ROGA 4OQJA 2ZH2A 2R7OA 2ZC4A 2UUTA 3AA8A 2R7WA 3AY0A 5DDRC 2B7CB 1W2BR 1TTHB 1FKAF 4URQU 4LBHA 5KG0A 2KVIA 5KG2A 2J0SD 1DTTA 1EJ7L 2ADBA 5A0YA 4N41A 4EBCA 1BC6A 2CG4A 2ZBQA 2EFOA 3GPAA 4LRDA 4ANDA 4V19X 1Q8IA 2DY1A 1Q0NA 3IMQJ 3TA2A 1S49A 3ENQA 5HP1A 3MECB 2MZRA 3BSNA 1CULB 2JX2A 4ZN3A 3W2WB 5KG4A 3QAUA 4JI0J 4JI8F 4NPOA 4TQRA 1SUQA 1NNDA 1R43A 1G7CB 1WC5A 3W61A 3ZTOA 1RWUA 3BKTA 5D4NA 3PY8A 5C7PA 3V6DA 2V94A 2XTJP 4J7CA 2YX1A 2ERRA 2ZM6F 1WJ9A 3VR1A 3TVYA 4FP9A 1RI7A 1REGX 1NPRA 3UE2A 4DV5J 3T5JA 4DN0A 2F4FA 2GGPB 2OEMA 4GVLA 2HHSA 4KIAA 3T3FA 5J1PA 1IBMF 1UA0A 5HVGA 3IG1B 3DYAA 3T5KA 1S72S 2J0WA 3DCAA 5KFBA 2J9DE 1NHUA 4DF8A 2BUNA 3W66A 3IFEA 4DFMA 2NYIA 2QYCA 2GIRA 2GS8A 5D3GB 3IR5B 1CQMA 4ILLA 3F44A 3PRBA 3K5OA 4LF1A 4WFYA 3CMAS 2HRTA 1QLNA 4EYHB 3GG0A 4C97A 4KRWA 3ILOA 3WX8A 4ZIWA 4DN9A 2DYAA 3P6YC 3E51A 2KFYA 2J0XA 4PWDB 2XZTB 1FXRA 4L3NA 2LMIA 3S6EA 2W9BB 3NMRA 3H2LA 3MEDB 5B0FA 2UZAA 4F4WA 2HGMA 3ETMA 1I5OB 1MN7A 3BDEA 4A8SA 5I42A 1NJXA 4RZRA 2BA9A 5KFMA 1D8ZA 1SC4B 3CW2C 4Z7CA 4LFCF 4K2JA 4CYUB 4S0MA 5K5MA 3NNAA 1SH2A 2VBXA 3GU0A 9ATCB 2ILZA 2IAJA 1EKRA 3EUNA 1UJ4A 4DL6A 4QWEA 3KJVB 2MLXA 2YTCA 2XULA 3D6MB 2R7QA 2EC2A 3HJFA 1TL3B 3GR0A 3ILLA 1N32J 2IM3A 2VPZB 2GO8A 1HQUB 4CH7A 1RKJA 2UUCF 1HNZJ 4Y0FA 3MWBA 4B08A 4YHHJ 2UUAJ 2OPPB 2M5YA 3FC9A 1SIZA 3W9JA 2MHEA 5A6PA 4EZ6A 4HACB 3N28A 4YB7A 3AAWB 2BRLA 3QIPA 4XIUA 3QT5A 1LWCB 2B4UA 3DDNA 1AT1B 4DLGA 4O44A 4Y2MA 3NOCA 1KEKA 5KFXA 3GFXA 1HARA 3MEEA 2D9OA 3T41A 3H0PA 3QRPA 3LGHA 4DV2J 2RRBA 2SXLA 2D3ZA 2C2RA 2MKCA 2A1BA 2BJEA 3NGKA 4UOFA 2MKSA 3CJKB 3I5CA 2BANB 1Z1ZA 2ZKTA 2UXDJ 2HEKA 2GZOA 1L3TA 4X66J 2PE8A 4XTTA 3H25A 2KXNB 1XNRJ 4EEYA 2HFOA 3QT7A 4O4GA 3DI6A 5U47A 1X5OA 1RHQB 5IV4A 5D4OA 1S76D 2OUGA 4URSA 8AT1B 1FK9A 3GG1A 3GMGA 2KFZA 4YUDA 3Q8VA 5DG7A 2WB4A 4P10A 2C2ZB 4X4OA 2L9WA 3PRVA 2FY8A 2DNNA 2EXUA 5DGBA 3LP0B 2LEPA 4KH1B 3EMTA 2ZJPQ 5E3CA 5KFCA 3AA9A 2ZWOA 5A8KB 2XMMA 4KB7A 1K44A 3H5SA 4M63A 1N0VC 2QE5A 2H54B 5T41A 4QW9A 2VG7B 5CZXA 1XNQJ 3DRPA 2UXCJ 1FRXA 5L39A 4ZK7M 4PG8A 2H3EB 5F0WA 2CUYA 3AD7C 4EU0A 1SJ4P 2W2QP 3M30A 4OYAA 4ED4A 1RT3A 1ZZNA 2R2TA 2COLA 1EARA 4KFBA 3T1YJ 1UL3A 3R7NB 5KTQA 3CT9A 1FKOA 4I64A 1KVIA 2AYBA 2DGSA 1AUSL 5H9EK 2R8KA 2M7SA 3I0RB 4M5DA 2MZQA 4A8KA 5HROB 1C4CA 2ZH8A 1T9XA 5GAGI 2WBRA 4CT9A 1VHFA 2JDJA 1NMEB 4GKKJ 4AQYF 3KHGA 4LF2A 3ICLA 3HFKA 3OFGA 2ZH4A 1HYSB 2DTJA 3HLUA 1Y4ZB 5J2MA 2BVZA 5GADU 3VVTA 1OPIA 2VL1A 1BQNB 4DPTA 2V34A 4IH6A 5BR8J 1CJKA 2QL7B 3PKYA 2V5HG 2BJ8A 2V2VA 4FBTA 4NXMF 4DR5J 1OYEA 3GFZA 1DTTB 4DS4A 3JB9k 2NS1B 5GAEU 2DHHA 2DPIA 5A0YB 1NH8A 2HHWA 4RL1A 3V4IB 1K0VA 1XIQA 3IWNC 4DL0C 5L9XA 2ZOGA 2XWYA 4U7UK 5HP1B 5AE1A 3B4DA 3RRKA 2DPJA 2OPSA 3FGVA 3K8WA 3VQTA 2UV8A 2E9RX 2DCUB 2H5EA 3TEHB 4IG3B 5F3ZA 1WD6A 1ZAXA 2WW8A 4DSLA 1CJUA 3M8WA 1SUQB 1F5AA 3A12A 4DSKA 4K4VA 1FNXH 3FQLA 2JFKA 1JNRB 5D0RA 2Y0SD 3KHHA 1N34F 2GMLA 4IQMA 1UVKA 4ES1A 2DRDA 4LFAJ 3QT8A 1RTHA 3R3TA 3IR6B 3MM6B 2J7KA 4HHJA 3FSYA 8ATCB 3TARA 3V6DB 4F3QA 2I5JA 4L73A 1XR7A 1VI7A 2GVDA 2HIYA 4CO5A 3THPA 2BMBA 1JXEA 1LV5A 3UNGC 2EI5A 3R8YA 4EMDA 3A3NB 1XEZA 4R0EA 4WZMA 3W64A 3J7A1 1WKJA 4M95A 4B9VA 2I38A 2B56A 2JEIA 5B0BA 3TJ9A 2XBPA 4DV1F 3R27A 1SQFA 2BKPA 2YNIB 4RR5A 5KFKA 4FZVA 5M2RA 1OJ4A 2FZGB 3O2IA 2YY3A 2DEJA 3NP5A 1OQ3A 4OJ1A 4JI8J 2RU9A 3H5YA 3PIOQ 3BREA 3BGOP 1YJUA 3Q0AA 1SXLA 2CQ1A 1V3ZA 3V81B 3BBCA 2B5JA 2MLZA 3VQSA 2NPIA 3PJ9A 3S01A 1FNMA 3EVOA 2DITA 1ZOTA 1HD1A 1KFSA 2JLEA 2KDOA 4KHRA 5F8HA 4G6VB 3R9LA 3ISZA 4ILMA 3MUMP 1JJCB 1TVRA 4F36A 2ATLA 2V2ZA 3GILA 3P8BB 2PGCA 1OY9A 1IBMJ 1E6YA 2IAJB 1RAFB 2GX8A 3BS9A 4LIRA 1Q5YA 5KOWA 1BGXT 4JUZA 3QNWB 2XSFA 3IWXA 2HMIA 1M5SA 1SQEA 2KKHA 5JMNA 4NXNF 3CJ5A 1TL4A 3OL8A 2P9GA 4AL7A 3BR8A 2XYPB 3AHPA 3F73A 4I6YA 2VODA 4DV4J 4DV6F 3H8YA 4OI6A 4LF6J 3FJ2A 5J2QB 1RHJB 4NOHA 1GMWD 3J81j 4DV7J 1IKVA 1UEKA 2CQCA 3CIMA 3LQVA 2Z57B 2AZ1A 1UVLA 2RKIA 1BD6A 4IFVB 2ZBIA 2UVRA 4LRBA 4QPXA 1D9DA 2W9CA 4JB8B 1VK8A 1ZPVA 2DNMA 1LNQA 3AOCA 4O44B 1NU4A 5LXRA 2FVPA 2CDRB 4C8KA 2RRAA 3MEEB 3EGVA 2KM8C 3U7JA 4B3MF 4N77A 4CI0B 3L7OA 3HSZA 2VFSA 3TR5A 4K4XA 5HJXA 3R6LB 1EZZB 4LSLA 1VRQC 5E41A 3EDRB 1RT7B 4ED7A 2DXDA 4ZS6A 4TU8A 1NHVA 4GO7X 1NJIT 2Y8WA 2YQ3A 2CZ4A 2DNPA 3W60A 3QSYB 1HBUB 1RP5A 1ICEB 2UUCJ 2X3GA 4WTOB 4KC5A 5ETQA 2MQQA 3UFCX 4N5SA 3IBWA 2V67A 3BSAA 4N7TA 3L3CA 3B8HA 3NL0A 3KXDA 3DLBA 2NXCA 2VA3A 2BACA 4H54A 1HKAA 3AXKA 2V4JB 2OPRB 2M2BA 1TFYA 4KGMA 4IH5A 4LF5J 1RT2B 2CZ9A 1X4HA 4B9NA 3V2UC 3HVTA 5DQGA 2VG6B 2V8DA 4RJVA 2R8JA 1MMLA 2HVEA 1D09B 3UWTA 3T5HA 2DRAA 3EXYA 4UT4A 4HH1A 3DRPB 4JI4F 1WOPA 3G6VA 2Y1RI 4LBIA 3AXMA 2P6SA 4UUWA 2GJ2A 2CQHA 4ZHRB 1WC6A 4NZ6A 4FKYA 2BJDA 1GNKA 4QYRA 2IHR1 3DLLQ 4X84A 2EBEA 1PSDA 4C8MA 1RT3B 4USWA 2MZTA 3KLVA 4ZKAA 4FNHA 2DXFA 5LM7E 2YQ0A 1UZDA 1FDBA 4CLZA 1UTAA 1G3OA 3MFHA 3DRXA 3B82A 2VPWB 2DGQA 4WE1B 1JLCB 2C42A 3C66A 3KDNA 3IR7B 3J81U 2YWKA 3VCDA 4CLFA 4IRCA 4UQGA 2XY7A 4LF4J 1U45A 5KFIA 3CJ0A 3JSMA 3MAQA 1R31A 3K5LA 2QV6A 1IJEB 4KSEB 3D28A 3H90A 3VHQA 1D9FA 2I0XA 4FS1A 1UWBB 4OYWA 1UAWA 3HF5A 2IA0A 4PWWA 2MMYA 5AJ3J 2LQJA 1TK0A 4X64F 3GIMA 1B0VA 4V1Ak 2IDLA 4RUBA 1N5YA 4RX6A 1NKCA 2VIHA 1QTNB 2XI3A 2AHOB 2EWHA 5D4PA 3OSPA 2F8EX 4F67A 3BN4A 4MK7A 3CCZA 2CQIA 4ZCLA 2WSEC 5EUHA 3AB2B 2B4PA 2LDIA 3WZ0A 1IKYA 1WHYA 1GMVA 1NHKL 4O3RA 1PBUA 3TP2A 5ETRA 4H4OB 4F4XA 3M05A 2HVIA 1WKLA 3G6YA 1WKKA 3SBMA 4LF7F 3RTVA 1TUGB 4RW7B 4MMOA 1U1KA 2OPSB 2B0GA 2W2MP 4YQWA 5KFDA 2QSWA 1S9FA 1JJ4A 1RT1A 5L1JA 1CJUB 3ZZZA 4CLWA 1CPZA 4X4TA 3DMJB 2VC1A 2DNKA 3OSNA 4PUOA 3OHBA 1PG5B 4WBFA 2BJ1A 1RTHB 3PIPQ 3NBPA 2NR0A 4C11B 3KG0A 1HBMA 2OFHX 1T8EA 2Y1JA 4GO5X 2KZMA 1HHSA 3W8PA 3Q24A 1MROA 2O5DA 2C2KB 4NXMJ 2U1AA 2GVDB 3NKYA 1A0OB 4CIOA 2H1YA 2V63A 1NO8A 2UV8G 1V3SA 1RT4B 1J5OA 4DQPA 1BQXA 3CSKA 3POTB 2H5JB 4I1TA 3JXOA 5A2QY 3FSIA 3FCHA 4B3SF 6AT1B 1R89A 1ROFA 3C19A 3R2CJ 2X1GA 5B0EA 1Y0HA 5CD4H 4LREA 4WKRA 1T95A 1TL5A 1AXQA 1WACA 1YK9A 4OHYA 1RAJA 2J9DA 2V8PA 4C8OA 4ZVEA 2Z4PA 1OMSA 4ECYA 1YZ6A 3PEJA 1X4EA 5K8NA 4M5NA 2KHDA 3R5CA 1HMVA 4WU3A 3CCLS 3AJ1A 3QZ7A 2F8HA 3OW2R 1RUSA 2OJ3A 2ZZTA 3FEZA 3F41A 2DKOB 7AT1B 1JKHA 1VK3A 1RAGB 3AFGA 1TVRB 2CNNB 1H2VZ 2PI5A 4P7TA 3IM8A 1Q7YT 3MR6A 4OYMA 1HNIA 2BR0A 2M3DA 2PDAA 3OFHA 1Z2ZA 2BE7D 1T11A 4KY3A 3EICA 3CJ3A 4DV1J 5F9LA 1J5EF 3BPSP 3QPIA 4DR3F 1NDCA 1U6BA 1RLDA 2HRYA 3LOUA 1N56A 1WOOA 5H9FK 3VZHA 1S1VA 1H73A 5A2QU 4KJIA 4ZPCA 4JYAJ 1LK5A 4NX9A 4ALZA 4RBUA 2E66A 5H1SV 3CD7A 3PHTA 4HLBA 3W3SA 2OFGX 5F8GA 2Z56B 2GHVC 2YWEA 2CJXB 4G1PA 1IKVB 2MZJA 2V69A 4OI4A 2LXIA 2RKIB 3US5A 3BGUA 2LYVA 2CJBA 3ISNC 5KG6A 4N56A 2CVIA 4OJHA 2W9CB 1VQ4S 1FWPA 1JLGA 2YKMB 4Y2AA 4MKVA 2YPZA 1WC1A 3AOBA 4CLSA 4MAKA 3THTA 1MW7A 2A2DA 3PCOB 1WG5A 3BO2A 2CYYA 2M8HA 3CUNA 3PACA 3O8WA 4QYZK 2Q6BA 3D6TB 5F8LA 4NLUA 4I2PA 1LWFA 4L6V3 4LSLB 2L3MA 5EGYA 1YRUA 5L8RC 2VPYB 4YDXA 4PQUB 4NXNJ 3HSJA 3GLJA 2KO1A 2AWZA 3H4DA 5HQLA 3ELHA 3NGUA 4DR6F 2DNOA 2BOPA 2XHCA 4DFPA 2GHWA 2AGOA 2E5LJ 5FDLA 1CJTB 2B43A 4DX5A 5K14A 2Y3YA 2Y8YA 5G0RB 3RB4A 1RTDA 3GJTB 2OPQA 1TUVA 4YB5A 3EGWB 2DNHA 2DCLA 3GWCA 1NSKL 4PG6A 3D6HB 3C6UA 2CPIA 3HMJG 4B3MJ 1RZMA 1TV6A 3DGPA 3PHEA 3BQ0A 2J6SA 3EXCX 3HVTB 2O1PA 4CWBA 1HHQA 5KFNA 2QA1A 1EP4A 3DFEA 3I9V9 4ECSA 1FJCA 3CDUA 1NJYA 3OVAA 1RWPB 1IBLJ 4KHMA 2F65A 3CEDA 3NCPA 1QSLA 3L4BC 2LVWA 1R0CB 1VRTA 3HHEA 1D8YA 1A6LA 2CJYB 4IDKA 5F8JA 2W24A 4M5HA 1SKRA 2D74B 1S0OA 3NXZA 2WB1D 5A8RA 1RA7A 1VBXA 1N5SA 1LWXA 1FFGB 2HVDA 3OFEA 2KM8B 1TU0B 3JYTA 1S7HA 1NSPA 1QJHA 2VKZG 2XB2D 1MWQA 1YQHA 2WVDA 2E7WA 2VDIA 4M94A 3O5TB 4F7VA 3CJRA 3G82B 2C28A 4EO8A 5LJ5Y 5ADZA 1I94J 3K8VA 3PW7A 3I4HX 1S4FA 1KNZA 1S6QB 1TR0A 3R5BA 4ICLA 5IFMA 2XSJB 3HHKA 1S1WB 2ASDA 4D3GA 4NLWA 1PO6A 4C2MA 4OI0A 3JSMB 4PAAA 1RWWB 5GVQA 3OBIA 2IMOA 3TAPA 3PTWA 3NS6A 1VQ5S 3I5AA 1XR5A 2ZC3A 3S1TA 2OSRA 2CPYA 4KKOB 1MLAA 2GHPA 4LF8F 2LQ9A 1Q95G 5DLFA 1HFEL 3ULHA 3T6BA 3MMAB 1N48A 1F9HA 4I56A 4LVNP 3CC2S 1VBYA 2V8VA 1X5SA 3G9CA 3MR2A 3MR7A 1VQNS 3D3CJ 2C2NA 2CPEA 1PYSB 1BHNA 1H72C 3FUYA 3D6FB 1Y5LB 1SIWB 1ULRA 2NUHA 3BBFA 3QJJA 1RKIA 2FJBB 3C6TA 2A10A 1T9WA 4X65F 1HR0F 5I3UA 4FF2A 2EEYA 2IBOA 1Q79A 2JWNA 2CWXA 2NZ4A 4USVA 4P2XA 1RT1B 3S7RA 1L5UA 4PQAA 1R8HA 3KFWX 4F2SA 1JLQA 1HQ2A 3K57A 1HPZA 1XK8A 4OIXA 4R5PA 4NLSA 3G2XA 2D3O1 4N76A 5AXNA 3LPYA 1U8WA 4CQ1A 2R8GA 3R5GA 1NSQA 5D0HA 2F9JA 2GMJA 3PDNA 1BQMB 1Q4RA 2VQFF 4NLTA 2YH0A 4Q0BA 2EG2A 1U26A 3RU0A 3DM2B 3K7RA 3I9ZA 4PZVA 3ETOA 1M1KT 1YHQS 4RPFA 2DIVA 4OYBA 2IVFB 2YQ1A 2HHQA 2CQPA 4P52A 1J5OB 5BYSA 1GFWB 1VIXA 3BBBA 2QMUB 2FLPA 2ZOFA 4PXEA 1X4AA 4I2QB 1PJ5A 4WFAQ 2MKHA 3CJQA 1RU1A 4XPCA 3GV7B 2RQKA 4NLYA 2VU5A 2WW4A 1KS2A 3PYDA 4DUTA 4MIWA 2DGOA 4USJC 4K50A 5L1KA 2ZBPA 2HW3A 4C7QA 1HNXF 2VPXB 1PJ7A 2D3UA 3EZOA 1TK8A 4TY8A 1KN6A 3SCKE 6FD1A 2BE2A 4DSFA 1VQ6S 4I68A 5KFYA 3MMCB 1NDLA 3H40A 5IC6B 3C15A 3CCES 3KK2A 3QWUA 2ZD1A 4DL7A 3M1VB 1Z2LA 2FVCA 2I6WA 1WC4A 2JLGA 4U7UD 2X1AA 2MPUA 4NEYA 3QQCD 2M4MA 1TKZA 1WELA 4ZOSA 2XQCA 2Z0GA 4BWMA 1IN0A 5D0GA 3M2RA 2QX0A 4AL5A 1C0TA 1BWEA 2ASLA 2HFNA 1FEEA 3I6PA 1S1VB 3LPEA 3LA0A 2AD9A 2BM1A 3UDLA 2LEAA 1SBRA 1U1MA 4CTAA 3J7YI 3J7YU 4F3OA 1UJ6A 3GFYA 2AKWB 1PAUB 1BUXA 4ILRA 3CCWA 2K7KA 1O0PA 2DNRA 3DGVA 3C46A 1PYOB 1REVB 2QRRA 3HI9A 5K20B 2EFQA 1JLGB 1SI9A 2KB2A 3PFEA 4RW8B 1KSPA 5E3PA 2QT7A 4H4KC 2MSSA 5DQIA 2U2FA 3M8YA 4MH8A 4WYLA 3TANA 4RUHA 3T9NA 1C0UA 1LWFB 5E0OA 1SB6A 2DJWA 1TKDA 2CQGA 5DG8A 2ZH3A 2Z2ZA 3BM7A 4RW6B 2IYGA 1Q8BA 2EW9A 2XYGB 2IC3A 4PXBA 2I1RA 1CJVA 3KLEA 1U48A 4OX7A 4NE9C 4P2FA 2EKYA 2MYFA 4DR2F 2NUUG 1RQ0A 3M32B 2JFDA 2OH2A 2B3TB 2DISA 1KHVA 2YKAA 3OJUA 4LR9A 4FVCA 3I4PA 2JL9A 3TI0A 5BJRA 2OPQB 4DWIA 4K5RA 3BH6B 2CPHA 3VTIA 2N3LA 2G0JA 1U1PA 2G0CA 2B9EA 2HBRB 4P6QA 1C1CA 4M5IA 2KL8A 1EP4B 1QE1B 5HMZA 3VF0B 1JLFA 2VBYA 2I8EA 4JV1A 1F60B 1VQYA 1HHTP 2GNKA 2WVCA 4RW4B 3UW1A 4B3OB 1VRTB 2BQRA 2FTRA 3ZTSA 4L72B 4LQ9A 4JV0A 3CDEA 2CPZA 1ACMB 2XC9A 4F8RA 2ZVSA 2D7SA 4QYZJ 3WDOA 3A8EA 4H4KA 4ES2A 5A8RB 2X1BA 2FUG9 1JJHA 3UCZP 3GIIA 3MGJA 2HSEB 1CG2A 2MXYA 2OHDA 3K0JA 1DQAA 3VGVA 2DR7A 2PMWA 3DLEB 1L3SA 2R2RA 4YMEA 3C3LA 3PO5A 2E1PA 4FVMA 3ZZUA 5HBMA 1K47A 2O67A 2OGUA 3HDSA 3PW2A 1F2HA 3H98A 4JI0F 2HNYA 4XK8C 1W2IA 1YG0A 4QIFA 1NH7A 2XS5A 5EWFA 4ZPTR 5K9FA 3ZC4A 4IR1A 3DKDA 4CO0A 1UPMB 1XQIA 5KFTA 1PGZA 1RBOB 2DHGA 4IOBA 4F0MA 1V5IB 3SXLA 1IWGA 1VBZA 4KO0A 1GQEA 2AGQA 2CQ0A 4DV5F 3TAMB 1TMJA 2GAGC 2GO9A 1TL7B 2HURA 1W7WA 3MUVP 2DNZA 1A9NB 1YTYA 1S79A 4BBYA 1WF2A 3PX0A 3W9HA 2IA6A 2XG8A 4IRDA 2D3OR 1ZM4A 1FDNA 2VHGA 4B9SA 3K5MA 2X3DA 4P72A 1LXJA 1GK8A 2MKKA 2HQCA 3G8TA 3LANA 5KAKA 5IV3A 2FJWA 1C1BA 3MEGA 2ZZNA 3MECA 2YVSA 1CULA 3CCRS 2JVRA 3W2WA 2C3UA 2HQ3A 5KG1A 2XO6A 1OYDA 4ZITA 2RU3A 1RISA 3DLGB 4LBPA 2FC8A 5DQHA 1S1TB 4R5PB 2W7OA 5JXSA 3V4MA 3BGFA 2W8LA 4UOGA 3NCQA 1YJRA 1HW8A 4X4PA 3D66A 1R8PA 3O1LA 5HMWA 1RWNB 3DRRB 5ETOA 4C3MA 3M7VA 5IWAJ 3CD6S 3PX6A 4Y34A 2M88A 4W4MA 4Q0BB 5I4MA 3K17A 1RAIB 1D9AA 2LU2A 5DM7Q 1RADB 2O3DA 3MCSA 1NK7A 4NZ0A 5F0UA 2V2KA 2FLNA 1Q78A 2K2PA 1BE4A 3D1HA 2MQLA 4ZVSB 3UDEA 2FHJA 2ZUAA 4JI1J 3PR4A 1N32F 3FZBA 2FHOB 3G71S 1FT8A 2VG5B 1S57A 2XYHB 1VS3A 3EGZA 1HNZF 1RYSA 4TYAA 4Q5VA 2UUAF 3SQGA 4OZJA 1X9SA 3SQOP 4DL5A 4QWCA 2FGOA 4YR3A 1M5PC 4PWDA 5C24B 2W9BA 1AROP 1OSCA 3MEDA 1JXLA 2X51A 1BY9A 2BE2B 2Z2MA 3SEOA 4ZCIA 2VICA 3PG9A 3VAFA 3ZNUA 1XERA 4P9SA 3C15B 1T0TV 1WEXA 2ZD1B 4CYUA 4DX7A 1KVJA 3J80Y 1VQKS 2BZ2A 5E3QA 2A6MA 4DV2F 1B3TA 1KRPA 2JLFA 3SV4A 2FZCB 4CLUA 1UVMA 4WFZA 3DU5A 1T05A 2UXDF 3M2RB 3FMWA 2RUSA 5KFQA 4DPWA 4OV6A 1X9WA 4X2BA 1RAAB 4DI6A 1C0TB 4YOEA 4X66F 4WKYA 4NRTA 4U7CA 1MU2B 4OZ0A 4KQZA 1TK5A 3I5BA 2OPPA 1UEVA 5KFHA 4CTAB 1VQ7S 5MLCV 1CQNA 5CZVA 3BF4A 5DM6Q 4HACA 3QBCA 3GSDA 4O3NA 5ITHA 1RGVA 3ZTQA 3RBXA 2HZAA 2W7PA 4DV0J 2KT2A 3QAEA 3ILIA 1LWCA 5KFZA 3CC4S 4ZVOB 2LA6A 2WZ1A 1WSVA 2VKRA 3IGVA 4RNFA 2WTFA 2ASYA 1UWAA 4K4WA 3W1YC 2E44A 4ZP8A 3NAHA 2QLWA 3MMBB 3UQSA 3J80U 1JLBB 3IAS9 3K59A 1RDRA 1NPPA 2L9NA 1C0UB 1YJTA 3X3UA 3I0SA 5ETNA 1JIHA 3FZ2A 3CJKA 4IR9A 2BANA 3PW5A 2EK6A 1XNQF 4M5MA 5C5JA 2E1CA 1EQ0A 3HKZD 5C42A 5AXKA 2H5IB 1HQEA 3KLEB 1ZA2B 3VAMA 2V6AA 2R4FA 3RB3A 2E7XA 3SFUA 5RUBA 1C2PA 4AXJA 1JMTA 1WF0A 4NLOA 1KOOA 4YB1P 3BGLA 4NWBA 2OIHA 4OZ2A 3D54A 1CEZA 3N6LA 5BYQA 1G4CA 2K8GA 3ZZPA 2BKOA 3OT9A 4FYXB 1SH3A 2A2CA 1QSYA 2AW0A 1PYTA 3CD5A 2G9OA 4F0KA 2XMAA 3N9UC 1N5VA 2LXFA 2KG0A 4NMXA 3TUJC 1DQ9A 1K1SA 1C1CB 4GKKF 2DD8S 2J7UA 2Y1LB 3RR7A 4R0JA 1RB0A 3NG8A 1NB7A 2RT3A 3QO9B 3J7Z5 4LT6A 5EWGA 2NLWA 3U02A 2EPIA 4DR2J 3W5XA 1X5TA 3RBZA 1Q16B 3QSIA 4NEZA 2JSXA 2KH9A 4E98A 3QRRA 3DC2A 2HQFA 2VFUA 2C3PA 1K73T 3I56S 2CPXA 3EJMA 4CLPA 4WFNQ 4BWJA 2AJ4A 2LP4A 2JEGA 4G65A 2DH7A 1M90T 3ADAC 3I0RA 4RU9A 3RGIA 3Q8RB 1GXUA 4YDDB 4MYTA 4K59A 2RSQA 1IBKF 4ELUA 2RUGA 4B9UA 5HVFA 4U95A 3D2WA 3BB5A 3BEGB 4OZ3A 1H2UX 2GC8A 5DS7A 2XMKA 5CHCB 2HNYB 2RDJA 1N88A 2D1CA 1G2EA 3UR3C 4USIA 4NA2A 1P1LA 4QR2A 4C3LA 1BQNA 2WVBA 4LFAF 2E5GA 1RE1B 4AD6A 4E8UA 2WRMA 2AYGA 2HQGA 3FMBA 3LO3A 5CA5A 2HK2A 4UOHA 5E2QA 3SI8A 4KO0B 2CPJA 3C2PA 3MM9A 4OZNA 4LF9F 4UY8T 3V4IA 2E5JA 2MGZA 3GP9A 5J1EB 4ZVRB 3HHLD 3A4TA 2XY6A 1C1BB 4FXDA 3MEGB 3FCVA 2FVRA 1IVZA 2ZH9A 4IG3A 4H4MB 4MKAA 2DB1A 4DR7J 3D1OA 4KPYA 2ROEA 2W1BA 4LFBJ 1DY3A 2MEWA 2VFVA 3OHAA 4PXCA 4LR7A 1ZM2A 3GV8B 4HDHA 1MWZA 3D0IE 3MM6A 1UCNA 2DEIA 1IXKA 3IM9A 5KFPA 2DT9A 1U1LA 4KYZA 3Q89A 4WK3A 1KHWA 3CCTA 5BYRA 1WORA 1G6BA 5GMKa 5DDPC 1R8CA 4NCBA 2EK1A 4QR0A 1DAXA 3EGNA 2W9AA 1DLOB 4CO2A 3RBEA 2DXEA 3IRXA 5L38A 3IN5A 5HL7Q 3VAIA 3GFHA 4FYVB 5IOLA 4I67A 3MD1A 1S0MA 3DU6A 2HNZB 4KHPF 2YNIA 2HNDB 1RBLA 1WEYA 1FVSA 1NK0A 3NGDA 1JJ2R 2IRUA 2QA4S 4OX8A 1S0NA 3EYZA 4DSIA 2VFTA 5FJ4A 3N01A 4ATNA 4DV4F 4IO9Q 3IGNA 1S9EA 4CH0S 2KG1A 4LF6F 2KT3A 3SQGB 5SZTA 4DV7F 5E33A 3V81A 4JP8A 2HYIB 5LT5A 3K58A 1RCXB 2HBQB 3AJDA 2PA3A 4FBUA 2VV5A 3HO1A 3M2VA 4DHVA 1KQKA 3JTPA 1M5HA 3GB0A 1WI8A 4EI2A 5LSRA 4DSEA 3LH2S 2CRLA 3JTOA 2ASJA 2C2DA 3W7BA 4DS5A 5C2CA 4CT8A 2XS2A 2N82B 1H7WA 3H20A 4P75A 1R0BG 1P6TA 5B7WA 3FKBA 3CULA 5F41A 1IUJA 1I3OB 1T05B 3Q22A 3BO4A 1Y7PA 4AXIA 4ER8A 4EBEA 2IM2A 4J9OA 3ET6A 2Y1IA 1X0FA 4OLPA 1B99A 1F0XA 5J2QA 1RWXB 2YKQA 3KOAA 1SVDA 2VQEJ 2HPUA 1FJEB 1SL0A 1FRLA 1NRKA 4QIVA 3KLIA 3KNAA 4ED0A 4IFVA 2P9EA 4F02A 4GC6A 4M5GA 1RBAA 2QGFB 2ZJQQ 1VCTA 2W4DA 2LLZA 4P71A 4LF5F 4DJBA 2HS4A 3OTOF 3U1MA 4JI7J 4PYDA 1LFPA 3OV7A 3CE8A 1JWWA 3HSGA 3FBFA 4RLEA 4D3HA 4QIGA 3BGRA 2R7TA 3HD1A 5A76A 3GTYX 5CYQB 2YKNA 2MKYA 2DR6A 1RT7A 3I0SB 1IQZA 4O23A 2IPOB 2Z2LA 4ELTA 2FC9A 3Q8PB 2GMHA 3RB6A 2CA9A 1P27B 3OTCA 5D77A 2VUGA 5C42B 1HBUA 8RUCA 1U2RA 1HQEB 4WCEQ 4Q45A 2PI4A 5KFJA 1S6UA 1GH8A 2KYXA 3KLHB 4Y00A 1Q5VA 3D3BJ 4OYXA 3SSRA 2IBKA 5M2UA 3G6XA 4F4ZA 4GVBA 4QWAA 2V4JA 2OPRA 2WHOA 3FRZA 2DR9A 3MM5A 3KHRA 5B0GA 2AMCB 3GYGA 2YNHB 5D8HB 1RT2A 4KAIA 4A8WA 4TY9A 4LSNA 3LF0A 5EN1A 3LP1B 1IM6A 2VG6A 5KFEA 4LF4F 3QATA 2RQCA 1X9MA 2GQQA 5L9NA 4C8LA 3H2VE 3C8YA 1MMDA 2AT1B 3RBDA 2E1AA 3EE3A 3I31A 7FDRA 2F63A 4GMKA 2FVQA 4BS2A 4Q7AA 1VQMS 5HO4A 2BQUA 5AJ3F 3CJ2A 2WOMB 4YR0A 1U2CA 4QR1A 4ZHRA 2A18A 2OAUA 2BW7A 2J7WA 3P5BP 2HQDA 3UI3A 2B4OA 1HL6A 1K9MT 3T1AA 1S97A 4C4WA 1M5OC 3TW0A 1IBCB 4Q2MA 3AJ2A 1SJFA 1MMNA 3D7SB 3TX0A 1NDKA 1Y11A 4ZP7A 2QFIA 2HS3A 1RT6B 4WE1A 5FLXY 1JLCA 2MKIA 5CH7B 2J8AA 4B9LA 1U0HA 1VC5A 2N7CA 2B8QA 5GAGU 3U1LA 4C9DA 4LJMA 3R5JB 3KWMA 1ELOA 4ZJLA 3CF5Q 2HKEA 2N7YA 5LOQA 4K4SA 5IXUA 1NK5A 3W5ZA 3JTNA 1RCOB 4CO4A 1UVNA 3GQCA 2PC6A 1IKWB 4UZBA 3BH7B 3A1YG 4ZLLA 2DO4A 2Q6CA 1SL1A 3QGIA 1UWBA 3MEKA 1QVFR 1FRHA 3MDFA 2DVIA 2K7JA 1E6VA 3SMZA 1B0PA 4JBCA 1VQ9S 1FX4A 1RU2A 1VGYA 2ZHOA 3D0GE 1GX5A 1CVJA 2GJIA 5KFGA 2E5HA 4W92B 3KMSA 2V4RA 3UD3P 5CYMB 3MM9B 5SUHA 2LA4A 4RUCA 1IKXB 1OIAA 1LWEA 2DGVA 3CDAA 3P5TL 2XHWA 2MGZB 4KV8B 4JI2J 4H4OA 4U67Q 1IBKJ 3R1HA 2HHUA 1NDPA 1FNOA 2QC3A 5FLXU 3HHNB 2XY5A 1FEHA 3FBCA 4RW7A 4JI3F 1WF1A 4DR4F 2HZCA 2DK2A 4NCGA 1NJZA 2F4VF 1GAOA 3O6QA 2DNQA 3DMJA 1UJ5A 3IS9B 1S9GB 4CP5A 2DR8A 3UD4P 4C11A 3GJRB 4FN5A 1GTHA 3FNNA 1SL2A 3DOMB 3C16B 2E9TA 4TVAB 2MQ8A 1LXNA 4F4YA 5EHHA 4DF4A 3QFHA 3UO0A 4LF9J 2V50A 4QBUA 4K5SA 4LVOP 1RT4A 2BABA 2AJ1A 3GV5B 2RMLA 4FYYB 1H7XA 3IRXB 3TEGA 3VV2B 2R42A 4IO1A 2KU7A 4K4ZA 1TFWA 4RNNA 3POTA 2ZEJA 1Q86T 2W2NP 5IM0A 1XBWA 1FA0A 1VHIA 3DHWC 3M2UB 1UVJA 3HT0A 1AZSA 4ZLPA 1JXVA 2W8KA 5LMNJ 2HWTA 3TZZA 4JYAF 2XNRA 5KFOA 1U1RA 5IQQA 1VRUB 1S9EB 1N6QB 2RD5C 4NCAA 3R5DA 1NPKA 3HFZB 3CC7S 2DO0A 4FKXA 1YSJA 4A8FA 2PEHA 2A3JA 3W2VB 1FE0A 3DOKA 1VBKA 4B9TA 2ZDOA 4GKJJ 3M2VB 3EZUA 3CCJS 2OKQA 2WAQD 3R5AA 3G4SS 1B70B 4J9QA 4ZCKA 4L74A 2DHXA 2IDEA 1UZHA 3H5UA 3NNHA 2DGWA 4HR2A 2GA7A 5J2PA 1HNVB 3V5RA 2PO4A 3DLJA 4KHPJ 2B9YA 3MI7X 1UFWA 2BJ3A 1WSRA 2KXFA 3T5LA 3HVWA 5IQ6A 5HANA 3IA0A 3ET6B 3OL6A 3CDWA 3CJSA 3W63A 4KR0B 2E7VA 5AE2A 2GIQA 3EDQB 3J7ZT 2P9CA 2E5LF 4PR6A 1DTQB 1BXNA 3KYLA 2V8HA 3OQ2A 2HHHJ 3KLIB 2YPYA 2RF2B 1PC4A 3DLKA 3U1NA 4QU6A 1NB2A 1ITPA 3O3LA 1FWKA 2YKMA 3OTBA 1U02A 4F2RA 1SJQA 4QW8A 1FTCA 1GMWA 2R8HA 1MNEA 2QLJB 1IJFB 2YNFB 3BGRB 3RZAA 3GJQB 2JC1A 3TUIC 2KZZA 2R7RA 5D4LA 1WDTA 2YKNB 5CQGA 2QMWA 3RRHA 2CJAA 3TA1A 1IBLF 1VJWA 3MM8A 4PQUA 1QSSA 1FI4A 2RDDA 4TLQA 2Q79A 3VALA 4U6PA 1FJGJ 1J2VA 4L3KA 2LDYA 3NY0A 4OI3A 4NZ7A 1FCAA 3H5XA 1RTIB 2UUBJ 2MHNA 1EETB 4F25A 4CLKA 1HD0A 3NGSA 1JLEB 3A8KA 1CJTA 4ED1A 3M8QB 2EVZA 4GVBB 5G0RA 3N5BA 4AFFA 1PJ6A 1TZ0A 3E8OA 3MM5B 3J81Y 2HFUA 4KGKA 4X4SA 3R1LA 4WPAA 3OTOJ 1KOHA 3BYRA 1VQSA 4ECXA 4LSNB 4DPOA 1SCJB 1X8DA 4CCHA 4TU7A 2OELA 2FLOA 1N4LA 1I94F 5HQ8A 3ZZ0A 3TUPA 4F3MA 5C25B 3H42A 4ZPDA 5HATA 4ECRA 1AFIA 2RNEA 5L1LA 5JVHQ 2H51B 4I69A 5KFWA 1R0AB 3PXGa 3FBEA 2BX6A 2JC0A 3BQ1A 3PM9A 3LWLA 4J9RA 3NWGA 3DLHA 4NI2A 2H9ZA 1S6OA 1JK9B 2Y0BB 2I9SA 1U1NA 3EM1A 4C8NA 4O4RA 3TRGA 1XJWB 1HIYA 1B4SA 3JQJA 4B3RF 1M5KC 3UDCA 3UNYA 2CDQA 3ENVA 2DH8A 4QQBA 1M5VC 1BLUA 2UU9J 5EWEA 1GMUA 3G82A 1U0HB 1AFJA 1RAEB 2F8MA 1UFKA 1Q53A 4OYOA 3J7AN 4WFBQ 1S6QA 3CWJA 3DOLA 2XSJA 3CDBA 1S1WA 3UPFA 2PMZD 3KK1A 3U27A 1P1TA 3RYLA 1R6VA 4ZVTB 1CC8A 2BE9B 4FXWA 4F04B 2K1RB 4PRFA 1NBEB 2CG8A 2FIUA 4KKOA 1XMOF 4I6AA 4MKBA 5CD4A 2IYIA 1QTMA 3TNVA 4NYPA 1E6VB 4EZ9A 1FD2A 3MMAA 3Q8QB 3EWGA 3BO3A 5G4DA 4F4KA 3I55S 1FXLA 4G3IA 4DCPB 4K2XA 2ZHBA 1YWXA 5AT1B 1F6TA 1YJ7A 5LMUJ 1YJWS 2ZITA 3KUEA 2F9DA 5A6WA 4C8YA 3C14A 4OJ3A 5HLFB 1LWEB 2G2OA 1O51A 3N0VA 2UVUA 2FJVA 2RE1A 3QGHA 1FKPB 1X60A 2NREA 4R8UB 4EBDA 3GCWP 9RUBA 1DBDA 3Q2TC 3MAAA 2B9XA 4MJKA 1T9UA 4WP3A 2VB6A 1S1UB 3CCSS 1RABB 1XMQJ 4IG0A 3TAQA 4ED6A 2AYMA 4NCGB 5KT7A 3NS5A 2CQ2A 2IY5B 1IR0A 4QIEA 1TKXA 1EKSA 1VYAA 1PIEA 1K8AT 1NM2A 5I3PA 3RRGA 1T03B 1VMBA 1H3DA 1EQMA 2ZZMA 1UFLA 3AOAA 3FEXB 1BQMA 1R3NA 1JLAA 1IM4A 1KONA 3PYFA 1N36J 3DM2A 1NKBA 1WI6A 2FGCA 4TQSA 2G1HA 3TA0A 5KT4A 5BXIA 1HWKA 4PCQA 3N5FA 2GAHC 5EDWA 3LTOA 2CNKB 4I2QA 5E3RA 5IM0B 4CNYA 3HVRA 4TXSA 4JI3J 1AZSB 4AL6A 2J6UA 2QA2A 1HBNA 4PG7A 3NRBA 2C1EB 1XTZA 4DR4J 2YX4A 2F4VJ 1RACB 2MTLA 2XZDB 1RWMB 3NNCA 4ZVQB 4FF1A 3TVZA 1KQGB 1V9OA 5J1NA 2VFRA 1HWUA 2P6TA 5KFFA 1T9YA 3FRYA 4MT1A 1KP6A 1HA1A 2DY9A 3DOKB 3MMCA 1FRIA 1S10A 1H6KX 1I6JA 3VAHA 1YZ7A 4P2SA 1H38A 3PW4A 4XDCA 3B4MA 4G1QB 3M1VA 2EFVA 2JRSA 2AJQA 3PJWA 2Q1LA 4DSJA 4PG4A 1OSDA 2BXJA 2VBZA 4BC9A 4OLOA 1CS4B 1HBOB 1SJRA 1U09A 3PKMA 4DQRA 1S6PB 3RAQA 2BQ3A 4K0KJ 5J2PB 3M6VA 2AEMA 2HGNA 3TVKA 4B3TF 2CJ9A 1NUEA 2D69A 2G13A 1XC9A 2AF6A 4ZJQA 3AB4B 3RUBL 1QUPA 4Z7YA 3PFOA 2AX0A 3NEKA 4PKDB 4WIQA 1RK8A 2NXNA 3SIPB 4OI1A 1Y00A 4NMLA 3JQKA 1ZM9A 3DLKB 3HCXA 1APSA 1REVA 1S12A 4OL8A 4RW8A 3MCNA 3HXMA 4BCAA 1TUWA 1WHVA 5DZ6A 1YDLA 2EG1A 2CAJA 1OS5A 2KJVA 3M8RA 1AYEA 3Q2SC 3MURP 4NASA 1YJNS 2HK3A 4ECTA 2LEBA 3GR1A 3EVWA 3G96A 1TP7A 4NYOA 4ZVHA 4RW6A 2M8DB 5KFVA 3MM8B 1W25A 3OR1B 2G4BA 5CYJA 3KLFA 3MM7B 3JSRA 5HAOA 3IAM9 2G0IA 4FPRA 3M32A 1ZBTA 2C3YA 1RJJA 4OFZA 2NXJA 2ADCA 1KQFB 5IT4A 3ZZTA 2YWGA 1LEOA 4MYUA 2B9WA 2MDAA 5AE3A 5AXMA 1TL1B 5IT0A 2ZUGA 4QU7A 3MPDA 2NSBA 4ANCA 2XGPA 1QD1A 4X62F 4LRFA 1JB0C 3CPWR 4LRAA 3BSCA 2HHXA 4CH1A 2QLXA 3HPOA 1SV5B 2NXEA 5CCLA 2VD3A 2R7VA 2AJ0A 1QUVA 3QLHA 1QE1A 3M6WA 4RWXA 4IFYB 5GMEA 3QFWA 3LUYA 2CQBA 1CC7A 1WNEA 4JI5F 4RW4A 2Z30B 4B3OA 5HJYA 2CQ4A 2CPDA 4DL3A 1AUDA 1VJQA 4N8NA 4BDPA 1TKTB 4HT5A 4IKAA 2J5AA 1A7GE 5DG9A 2I2YA 2OO4A 1S1XB 1S77D 4KE5A 3JSBA 1KLMA 2FJDB 2AU0A 4NI2B 1KLNA 3T19A 4ZLNA 2CPFA 4LSZB 3PRDA 2JHEA 4V19J 2W4PA 2CQDA 5ETTA 3SDEA 4AUKA 2WONB 2GCFA 3DLEA 4A4JA 4NYZA 3KJNB 2QMXA 4HYKA 1YIJS 4ID5B 5B08A 4OHVA 4ZPVR 2RIJA 5E5NA 3DOLB 1FXDA 1QVGR 3KK1B 1OQ6A 5GADI 3KLGB 3B54A 3M8PB 3HP6A 3KK3A 1FWLA 4DUYJ 2IJNA 2W25A 3VVUA 4DFKA 4E0DA 3ZO7A 2ZNYA 2XZWA 2DGXA 1PKUA 4RBTA 4J9MA 1FFSB 4UQTA 4YY3J 1GX6A 3L9ZA 2YNGA 1X5PA 2Y9HA 3WIVA 5D15A 2PFDA 1M0SA 1LQ9A 3O44A 2XLKA 3CCMS 1F3FA 4ZIVA 3TAMA 4WP9A 4NRUA 4RW9A 3TWZA 5GAEI 5KT6A 5IWAF 1TL7A 5AXLA 3UCUP 4WZQA 3QZ8A 2GV1A 3EVMA 4TNOA 1H98A 4HL9A 3HHDA 4B3RJ 2W2PP 3C14B 1JNZB 4O0IA 5M2PA 4Y6IA 3UDVA 4C0OC 2V0NA 3LWMA 1B7FA 3M6UA 4J9VA 1HI8A 3NWRA 4JI1F 4J5OA 1C4AA 3MXHP 2ZE2A 4RBVA 3D4JA 3MAAB 5IC4B 1MN9A 1HLWA 4QWDA 1FTRA 3MR5A 3W9IA 2C2OB 4QPTA 3DLGA 1O8BA 4J90A 3PJXA 4GRSA 1U7LA 2C2EA 4IG0B 1S1TA 2WVEA 3OTEA 1XMOJ 1TKXB 4DR1F 2HS0A 1S59A 2KTQA 1FF2A 1UEUA 2FZKB 1F2GA 3OD2A 3BV8A 1VDHA 3DRRA 1JLAB 3DYAB 4OX6A 3BJYA 1EIYB 1Y9OA 3HK2A 4ERDA 3OXGA 3KDOA 1Q82T 3TUZC 3IBFB 2YBVA 1X4GA 3T6JA 1YX2A 2CZVC 2E1RA 2WSCC 4ZVUB 3M6XA 1X4BA 3LW5C 3D1QA 2XLJA 2C3MA 2L48A 2ZBCA 2YKOA 1X0PA 2VJVA 4OHZA 2M70A 2PT0A 4XAKA 2VG5A 3GZ7A 3M9OB 2AX1A 3MOZA 1G1XA 3HD2A 2B51A 4I4BA 3TX8A 1SC3B 4ED5A 3MAHA 1HBNB 2B6AA 1LK7A 2RH3A 4CLTA 3ENAA 3VAGA 4ED3A 2B7BB 1N5TA 4GC7A 4EFAC 1D1UA 2OMLA 2J6TA 2VOOA 2BEFA 1ZAWA 1VOMA 2PEBA 5I42B 5C24A 1WG4A 2ZM6J 2G1DA 2DR5A 1X4DA 5KT3A 1R27B 1F9FA 4DV0F 1N33F 1NKEA 3QGGA 3EZ5A 2LECA 2HFSA 2IJRA 3OJSA 5KG5A 2R9LA 4JV2A 2RDIA 3SFGA 4L76A 1NEEA 4MKYA 1V3RA 4FS2A 1B7YB 4BHQA 1O6XA 4NLGA 2VASA 5LSOA 5HN0A 5KG7A 1X31C 1HNWF 4TN2A 2CFXA 2J8SA 4BC7A 4ZCMA 2XNQA 2Q3PA 2QLFB 4U8YA 1AB8A 1RYRA 4Q2LA 3MTJA 1YLXA 3P49B 3NMAA 3KJFB 1MU2A 1S48A 4ZMMA 4USKA 3RAXA 1DZ5A 4I0WA 2DGTA 3QIPB 3KHLA 1ZPWX 3A8IA 5DGAA 2KXHA 1Y5IB 4QOTA 5FIIA 3MPYA 4LFCJ 3P4UB 2L9DA 2QG9B 1I1GA 2VH7A 2ZH5A 4J91A 3HULA 1EB0A 1QDUB 3GIRA 1VIOA 4KPCA 2PSZA 1XWLA 1LW2A 5B0DA 2HHVA 2ACMA 3QIDA 3MD3A 3MMBA 3W5YA 1JLBA 2NZCA 2MJUA 4EGLA 4HH0A 4OHWA 5A8WA 4ZPBA 2J0QD 1U47A 3UCGA 4QJVA 4ZPAA 1R8AA 2O01C 2RVJA 2C2MB 1IR1A 3BZQA 1YBTA 3DRYA 3TZYA 1ZTWA 4B3TJ 3KLFB 3Q8SB 5KG3A 2P2CB 4O4GB 3DI6B 2XGQA 3HKWA 3UD5A 3NCRA 3FSXA 2VONA 3ZXWA 2AJFE 3PVXA 4U9RA 1FK9B 3ZTRA 1LOUA 1QAYA 2V4QA 3MHYA 2QSFA 1EHWA 2R7UA 1DHMA 2PMHA 1RAOA 2BRKA 2N4CA 4DG1A 3H7HB 4ZJOA 1KQSR 3ZZRA 1KFDA 4HT7A 1ZYQA 3CD0A 1HW9A 3GSIA 1LFWA 2JNJA 4OV1A 5KFLA 4DPYA 3A3OB 1SJ3P 2ATCB 4HKQA 3HFVA 3CCVS 1OPZA 2VF3A 3QLHB 1MSWD 4M5JA 4DCJB 3VWSA 4U8VA 1FJ7A 4KGVB 2H65B 2F5GA 3QO9A 3MTKA 3UN2A 4CO1A 2XWXA 3M30B 3IXQA 4IYQA 3TO8A 3H59A 4Y28C 2LQBA 2V9KA 4KFBB 2DBBA 2QZ8A 4CDIA 1SPBP 1FKOB 2KRBA 2MKJA 1KLMB 1EAYC 3R2DJ 2HFVA 3OVSA 4WTYA 2CVEA 2J9CA 4OX9F 4M5DB 2D41A 3WBZA 5DO2A 4LIWA 3LALA 4ANEA 1SKWA 4ED2A 2ZWPA 3N6NA 4Y2CA 4X62J 2HFZA 2QFJA 4DOZA 2J76E 3GONA 3OUYA 3ITHA 4F26A 5F9NA 4X4NA 3SDEB 4UTGA 3WHIA 4QCLA 1FRMA 3W62A 2M52A 4TU9A 2FY1A 2E9ZA 1KC8T 1I51B 5B09A 2VZ9A 1PAEX 3OXLA 2G2ZA 5CXTA 5ETPA 2QO3A 3OTDA 1YRXA 2VDHA 5KT5A 3FK4A 1RWVB 2QLBB 3M8SA 5J2MB 2KRRA 4DR7F 3KK3B 2AP6A 1HWLA 2E1MC 4A47A 4LFBF 2LFVA 3SCIE 2P5VA 4JI5J 1CJKB 4EO6A 2DNGA 2M9KA 5KFRA 5E7OB 3G87A 2ZH7A 2YNGB 4HTJA 2JOQA 3A13A 3UN5A 2NYHA 2R2SA 2HAFA 2ZDPA 4RW9B 5HQMA 6FDRA 4FDFA 1RHMB 3HZGA 5B0AA 2HVHA 1YKWA 1WEZA 4HVZA 2ALZA 4EYIB 1K1QA 3VGUA 5J1EA 3AD9C 4AQYJ 2HBZB 4YN3B 4DLEA 1Z4UA 2NXUA 2ZE2B 2ROPA 2HBYB 4BLGA 3MFIA 5H9EJ 4P2MA 4H4MA 4CNZA 2HGLA 1BMQB 5D78A 2VC0A 7FD1A 1AW0A 3SSQA 2K3KA 2RQ4A 5ETMA 3AD8C 2IM0A 4RNHA 3SZ2A 2MZSA 5T7LA 4DUZF 1RT5A 2I5JB 3DNCA 1NXIA 2CNLB 2R2UA 3RW7A 1YJVA 4ES3A 4ETZA 1OY6A 4DBQA 4A8QA 4Y2IA 2BM0A 3PYEA 1N8RT 2QA4G 4IH7A 3WIUA 4ECZA 1K0TA 3S8SA 1PCAA 2IVMA 2ACYA 1M1GA 3NGRA 5K8MA 2HZVA 1DLOA 2APOA 4EUVA 4DCOB 3CJ8A 4WIIA 4NA3A 3MMJA 3DN9A 1Q81T 1DARA 3TQEA 3CXCR 2OLWA 1UVIA 1WTFA 2HNZA 2OD4A 2XMVA 2HNDA 2UUWA 1L3UA 2AEFA 3AH6A 1XN9A 2RAQA 2IMWP 3H2UB 5K8PA 3E01A 4Q8FA 1FRKA 4CM0A 4OYIA 3UVJA 1H74A 2B8PA 1N34J 2B6AB 4Y2KA 4F0HA 2B5JB 3BDPA 3ILJA 4UW2A 1FVQA 2FJXA 2VQEF 2RHQB 2H4WB 1T94A 2FHKA 3TJAA 4DR1J 3PV8A 4ZVPB 2P8IA 3PX4A 3VAKA 2BDPA 4LMZA 3F0NA 5IT9Y 1S4EA 3K5NA 3SSSA 1YBAA 3D67A 1SJ1A 3L7UA 3HJVA 2FD2A 2HHTA 4CO3A 1OY8A 1E6YB 2DHAA 4JI7F 1FERA 3Q23A 2HWIA 3IRWP 2PIIA 2HMIB 4IQXA 2LQ5A 2UVVA 4ECQA 1HI1A 3KMQA 4WYWA 1LW0A 4DZDA 1VISA 3MPVA 1L3KA 2XS7A 3THVA 1Y3JA 2A0FB 1T3OA 5EX0A 3CTRA 4OZ1A 4ZA1A 4O3SA 3HM9A 5MAOA 4IOCQ 1NK6A 1ZM3A 2HG4A 2LKZA 4ID8A 4A8XA 2UP1A 2CIMA 3FQKA 4K4YA 3Q8UA 3I96A 2MJNA 4CM2A 3MPUB 5F8NA 1T9TA 4NLQA 1N33J 3QJLA 2JEJA 5IT9U 3V6JA 1T02A 4J9NA 1PC5A 2BW2A 1LW2B 4PWUA 5D0EA 4DXLA 4MIAA 4EWTA 4A8MP 5JJBA 5DZ7A 3OPKA 3QYYA 3OR2A 4JI6F 3QRQA 1HNWJ 5CYQA 5GMDA 1H2TZ 5A8WB 1NK8A 3KNGA 4P7VA 3E2EA 2IRXA 1S0VA 4DV6J 3H4BA 3NAIA 2UXBF 4NL5A 5K8OA 1U6FA 2WK4A 3IO1A 5E3AA 4DDFA 4XO0A 2XMTA 3CB4A 3M4XA 2GW8A 2YWWA 4MIBA 1YITS 2CQ3A 3KLHA 4TKTA 4ZVFA 4Y3CA 2HRUA 2XCPA 1TAUA 4E2FB 3AT1B 3N79A 2R7XA 2AQ4A 3WC2A 3GIKA 5HMYA 4DPUA 3AQOA 3D9BA 3MCOA 4DG1B 1F1BB 5IZHA 3ISND 2RS8A 2QTWA 2YNHA 2KHCA 2FPHX 3BN7A 3EPGA 4Q43A 1UW9A 1N0UA 3MZIA 5LXYA 3TZXA 3LP1A 3HVAA 1FESA 5HVHA 4YR2A 3KUGA 2FYXA 3WQPA 2B4VA 4KGXB 3LGNA 2IM1A 1ZS6A 1VQOS 4AE5A 1WOSA 5L46A 1N52B 1YVFA 1J27A 3PO4A 3DDKA 3QGPA 4J37A 1R8BA 2R3VA 4K4UA 1U6ZA 2BOAA 5HI7A 3K89A 5LL6d 3G8SA 2WOMA 3V6HA 3SV3A 3X1LB 3IWLA 5JUMA 1V5VA 1RXOB 2QEXS 2AJ2A 2V8GA 5HK4A 3OL7A 4J9PA 4DQQA 2HVZA 2Z58B 1PILA 1QAJA 2CJQA 3V6KA 1B0TA 1RA6A 3FFIA 3HHLC 3NS7B 2XMJA 4B02A 3K5PA 1RT6A 3OUYB 2FHMA 3ITHB 1WC3A 4JI2F 2L08A 1T9VA 1EX8A 2YKPA 1N54B 4ZVGA 2IRYA 4JI4J 3R7BB 2GFFA 4C3KA 3CCQS 4USHA 1T7PA 2XI2A 1IKWA 3Q83A 4IRKA 2DHSA 3TYTA 2F40A 1VLOA 2J9EA 4DQIA 4YEAA 3QJPA 1N5YB 2DIUA 1GTEA 2VBWA 3VAJA 3CJ4A 2YX7A 4WK1A 1TELA 4QIWD 3OVBA 2KYZA 2ZH6A 2GJFA 1P9YA 4HDGA 4HHHA 4EK2A 2YH1A 3JSYA 1ZETA 5B0CA 3GJSB 1WG1A 4O3PA 4OX9J 2AGPA 1IKYB 1Y3KA 1DJ0A 2N4DA 2XM3A 5CYMA 4DQSA 4F4AA 3SYZA 4ZN1A 1IKXA 4C98A 4QWBA 4KT0C 3T9ZA 2GQ2A 4FXVA 1U49A 1DRZA 2KI2A 2ZNZA 4KV8A 4B17A 4Y65A 3R6GB 2GIFA 3HX9A 2RHSB 5KFSA 5LMNF 1NZAA 1SKSA 2KVQE 4YB6A 4PUOB 4UUXA 3ZFVA 3NOGA 4FNIA 3CJTA 3DDIA 4MFBA 3HSDA 4X64J 3NBPB 1S5ZA 1HBMB 5HSPA 3IS9A 3HHLA 2ZH1A 1S9GA 5T7LB 2W4CA 1MROB 1RT5B 3BSOA 4LQ3A 2XEXA 4YP3A 2ALYB 3DOMA 2FJEB 3C16A 4GKJF 2CADA 2FJAB 4K4TA 3UN3A 4MTPA 3L09A 1VC6A 4NLRA 2M0GB 3BKFA 4CLLA 4L75A 5DJBA 3K2YA 2C22A 4P73A 2DNLA 4LRCA 4LF7J 3D0HE 3MF5A 3CGIA 4M5LA 1FDDA 4U96A 5GAHI 5GAHU 4DV3F 3LP2A 4W90B 2MZ1A 1WC0A 2GQCA 3M2UA 1AA1B 4MK9A 3CNQP 3E01B 3CCUS 1VRUA 2YWFA 4OZLA 3UVJB 1N6QA 2OI2A 4UZCA 3OL9A 2LQ8A 2MY7A 1HMVB 2IVYA 3T1HF 5KFAA 1YGYA 4UY85 2QL9B 2C3OA 2HHHF 4DUZJ 3P96A 1JKHB 4PABA 2BJ7A 2HQIA 3W2VA 4TLRA 4C48A 1F3VA 3BKUA 1WDDA 1HNIB 1VQ8S 2XCAA 5JVGQ 3KG1A 1UW4A 4ITSA 2IIHA 3G6ES 5J2NA 5EX3A 3AODA 3BR9A 2Q66A 3F56A 2KT5A 2BKNA 2FDNA 2RILA 4B3SJ 1U25A 4N47A 2DNYA 4XPEA 2RS2A
chains in the Genus database with same CATH topology
2IDEA 4PYAA 2IIHA 3JQKA 2OHDA 4PYDA 3JQJA 2EEYA 2EKNA 3JQMA 4FDFA 1EKSA 1EKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDE A;  4PYA A;  2IIH A;  3JQK A;  2OHD A;  4PYD A;  3JQJ A;  2EEY A;  2EKN A;  3JQM A;  4FDF A;  1EKS A;  1EKR A; 
#chains in the Genus database with same CATH topology
 4O3O A;  1Q8K A;  1NLK L;  1HNV A;  3QT6 A;  1FFW B;  3Q8Y A;  1DQ8 A;  3MR3 A;  1LW0 B;  3PEH A;  1NAQ A;  2E5I A;  4R25 A;  2LCW A;  2HLT A;  1FJG F;  3FCW A;  3BYP A;  2NQP A;  5DLG A;  4DEZ A;  2PD1 A;  1SC1 B;  2UUB F;  4I6W A;  2X7I A;  1DTQ A;  4X4V A;  4USU A;  1GEH A;  3M8Z A;  1U1O A;  2MLY A;  1ZZF A;  3ZTP A;  2RF2 A;  4C0H A;  4WWS A;  1IQT A;  2OP5 A;  2EFG A;  2QJ3 A;  4ZDN A;  4I2P B;  3Q86 A;  2YNF A;  4ETX A;  3VGT A;  1J5E J;  2W2O P;  4N8O A;  2W7A A;  1BWV A;  4DR3 J;  3OR2 B;  4DU8 A;  4I7F A;  1UP1 A;  5DDO C;  5CAA A;  1NJW A;  1NCL A;  2RB7 A;  5LSL A;  2H48 B;  3TOQ A;  5FDL B;  2MB0 B;  1HWJ A;  4Z37 A;  5T14 A;  4RUA A;  4ELV A;  1RTI A;  4ENO A;  3I82 A;  1EET A;  1PBA A;  1RHU B;  5K14 B;  1JLE A;  1RTD B;  4PXD A;  3FVY A;  3M8Q A;  1R7I A;  4LR8 A;  2O66 A;  4JV5 F;  4USM A;  2RJZ A;  5F8M A;  5H9F J;  4C8Z A;  1CBK A;  2ABY A;  1B64 A;  1FDA A;  2EBG A;  3DRS A;  1ZA1 B;  3C6U B;  4K7Q A;  1F5B A;  3P45 B;  1TV6 B;  3DGP B;  3DHX A;  2EC0 A;  2Z8Q A;  4NLV A;  2V2Q A;  1KTV A;  1SQG A;  3DXS X;  5ETV A;  2UU9 F;  1HWI A;  4A48 A;  2UVW A;  1WHX A;  5THW A;  2JVO A;  2OEJ A;  4DMZ A;  4PEO A;  2LXU A;  5F8I A;  3R97 A;  2DH9 A;  4JI6 J;  3GYX B;  3AQP A;  5C25 A;  1GT8 A;  5KT2 A;  1XMB A;  3CVK A;  3I87 A;  3A8J A;  1Q8L A;  3PZP A;  1IR2 A;  2YWH A;  1RTJ A;  2QYG A;  1YRT A;  3L95 X;  5DRK A;  2CKW A;  4IDK B;  2UXB J;  2V9W A;  4DR6 J;  3JQM A;  3MCM A;  4WFX A;  4DX6 A;  2AZ3 A;  1NK4 A;  1R0A A;  4FYW B;  2CXE A;  2F1F A;  2MQO A;  1MG7 A;  3SCL E;  1URN A;  4OJG A;  3JYT B;  3A3P B;  3KUH A;  2GVZ A;  4NLX A;  4ZP9 A;  3ZZO A;  3HT3 A;  2BYC A;  1RHR B;  4M5K A;  2EKN A;  5LMU F;  1UPP A;  2K3I A;  3FFI B;  3RR8 A;  1OWX A;  1R6Y A;  3MUT P;  1VQP S;  3JAM Y;  2H4Y B;  2POK A;  5L1I A;  3RW6 A;  4WU2 A;  2ZKU A;  1F9E B;  2KN4 A;  1U4B A;  1DFD A;  4OYZ A;  4ICL B;  1F5C A;  5DDQ C;  4FF3 A;  1X4F A;  4ECU A;  1FD8 A;  1D3W A;  3RG6 A;  4ECV A;  4MK8 A;  4OZ5 A;  1Y10 A;  2XLI A;  1XMQ F;  1L3V A;  3RAM A;  2OTL S;  4M8L A;  3RJM B;  4TYB A;  2K1R A;  1QAI A;  1S99 A;  3VZI A;  3EX7 B;  2HWH A;  4NLP A;  4CRJ A;  1TMM A;  2QL5 B;  2AV5 A;  5FD1 A;  2RRN A;  2ZFH A;  4KBI A;  1WTB A;  2HIQ A;  4AT1 B;  2OSQ A;  5ETS A;  1VR6 A;  4DL4 A;  1UA1 A;  1N36 F;  1GXL A;  2EFP A;  1SKU B;  2QN6 B;  5ETL A;  4RWW A;  1KD1 T;  1CSJ A;  4DPX A;  2MQM A;  2KFN A;  1UKU A;  5HLF A;  1KWM A;  2EFN A;  4B9M A;  3C6T B;  2YXL A;  5I3U B;  3JAM U;  4KH0 B;  4J9S A;  5IS2 A;  4A8Y A;  3PW0 A;  1FKP A;  4J9K A;  4O3Q A;  4FPI A;  4R8U A;  3IC1 A;  2D9P A;  1SH0 A;  1JLQ B;  2N3O A;  1S1U A;  1HPZ B;  4O0N A;  1CLF A;  1RLC L;  3VGS A;  4LF8 J;  4ZP6 A;  2DRB A;  3ONQ A;  2JJ4 D;  3OLA A;  2X1F A;  4MFB B;  4ZLJ A;  3MOJ B;  5KFU A;  1UET A;  3HHL B;  2FLL A;  2FHJ D;  1T03 A;  3D68 A;  2NCK L;  1KR4 A;  2PA8 D;  3OXF A;  2GGP A;  4DU7 A;  2CWK A;  4WF9 Q;  3IG1 A;  2WVF A;  4C0B A;  4KGZ B;  1RHK B;  4HHU A;  4RO0 A;  4KTQ A;  2PFF B;  1QY7 A;  4RNO A;  4FF4 A;  3CO0 P;  2IFX A;  5D3G A;  4X65 J;  2JH3 A;  4YFU A;  1HR0 J;  3ZZY A;  1RWO B;  5D6G A;  4Z2X A;  4K0K F;  2MST A;  4WJB A;  2W01 A;  2E29 A;  5CCM A;  3LP2 B;  5DET A;  2FQQ B;  2VJU A;  4YHH F;  3TJ8 A;  1RWK B;  1NK9 A;  5I3Q A;  3EPI A;  2VA2 A;  3M9M B;  4FYD A;  1WUU A;  4NLD A;  3WC0 A;  3D5M A;  3PYG A;  2ZOM A;  3DXB A;  4X4Q A;  4TY8 B;  3QMQ A;  1D0E A;  1SC6 A;  1ZTT A;  2WCX A;  2OEK A;  4XDD A;  2MY8 A;  4AYB D;  1GXT A;  4WXO A;  2XMU A;  2VQF J;  3KK2 B;  1WWH A;  2AIR B;  1FE4 A;  4WP8 A;  4ED8 A;  2WSF C;  1P8G A;  3E3X A;  1VQL S;  1KKH A;  1JQG A;  3IBC B;  4G1Q A;  5ETK A;  4JOU A;  2ZHA A;  1YBU A;  1TKZ B;  2R7S A;  3KG4 A;  3KJV A;  4X4U A;  1CS4 A;  4Q8E A;  1S7I A;  2LU1 A;  2MQP A;  2FB0 A;  1FO1 A;  5J2N B;  1HBO A;  1TL3 A;  1S6P A;  2Q43 A;  4DV3 J;  3ZNJ 1;  1P9Q C;  1HQU A;  3GYN A;  4CZC A;  1XNR F;  3I32 A;  2NSC A;  1FX2 A;  4YS2 A;  3CO9 A;  4HI2 A;  3LAK A;  3W65 A;  3KTQ A;  1HNX J;  2AYE A;  1N5Q A;  1Y5N B;  3G86 A;  3BQ2 A;  2ILY A;  2AEJ A;  4J9U E;  2DGU A;  3T1H J;  1VFJ A;  3SCJ E;  1DUR A;  4ECW A;  3BPD A;  4X4R A;  2L41 A;  2BBE A;  1RTZ A;  4LUB A;  2HLU A;  4WXW A;  3G8Q A;  3RB0 A;  1JX4 A;  2A6O A;  3R7S B;  4DFJ A;  3NLC A;  3P3D A;  4ZPW R;  2R8I A;  1YI2 S;  4RU2 A;  1QM9 A;  1LKZ A;  2OTJ S;  1KBR A;  1RAH B;  3CME S;  1Q1K A;  2UXC F;  3B6B A;  2F7V A;  2IC3 B;  2BJ9 A;  3KJQ B;  4I7F B;  1XR6 A;  1CJV B;  4OI2 A;  2RQM A;  4C6A A;  1ZAV A;  4M1K A;  1Q7L B;  3OR1 A;  2XMW A;  4A46 A;  1KDN A;  3MM7 A;  3OFF A;  3M9N B;  1NSA A;  3CIZ A;  2ZVI A;  4UOC A;  3TZW A;  4DL2 A;  1V6H A;  2F3J A;  4A8O A;  3MPW A;  2PN6 A;  3T1Y F;  4OYP A;  2ZBR A;  4W98 A;  4DZ6 A;  1VLY A;  1YJ9 S;  1FRJ A;  1U1Q A;  2K06 A;  5KOX A;  4IUF A;  4PG5 A;  1M1H A;  1TL1 A;  1NZ8 A;  2HHP A;  4UST A;  3UR0 A;  1O5J A;  1W26 A;  4HI1 A;  1KTQ A;  3DRS B;  3LP0 A;  1TAQ A;  3GE9 A;  4QZV B;  4CLY A;  1RSC A;  5LJ3 Y;  5F3T A;  3FBB A;  1U2F A;  2G2Y A;  3N6M A;  5A8K A;  3L7P A;  3LAM A;  3N4W A;  1SV5 A;  5HMX A;  2VG7 A;  1ZH5 A;  3HZE A;  1JLF B;  1X7V A;  3OLB A;  4Q44 A;  1FHT A;  4IFY A;  5C2G A;  1IWA A;  3LGM A;  3PNI A;  4DUY F;  1RTJ B;  3NGT A;  4URG A;  1U8S A;  1URR A;  4HTI A;  2JEF A;  2OMO A;  5BR8 F;  4IOA Q;  4OHX A;  4RKU C;  1VC0 A;  3GIJ A;  3B78 A;  4HEA 9;  1MWY A;  1T3N A;  3KKF A;  1KVK A;  1TKT A;  1U24 A;  4YY3 F;  1QAX A;  4RNM A;  4G1I A;  2V68 A;  4DR5 F;  3JS9 A;  2IJF A;  1S1X A;  2GVZ B;  2WBM A;  3FDS A;  4DX8 H;  2BV3 A;  2OD6 A;  4JV5 J;  2HAI A;  3CMQ A;  1WHW A;  1H0H B;  3WX4 A;  1U0S A;  4F50 A;  5HRO A;  2Z2Y B;  1UMJ A;  3W8G A;  1HI0 P;  4OMF G;  4PPD A;  4NA1 A;  2MQN A;  4PPZ A;  2WON A;  3QWP A;  1X4C A;  5HBM B;  5CAB A;  3TQ1 A;  3FEY B;  2VOP A;  2CNO B;  2KJW A;  3GCX P;  4ID5 A;  3ENW A;  1TQL A;  4J9L A;  4PYA A;  4K8R A;  3PR5 B;  1HYS A;  2JZ5 A;  3IP0 A;  2FVS A;  4UF4 A;  2NPF A;  4P74 A;  2ZJR Q;  2CJK A;  2XO7 A;  1OO0 B;  3KLG A;  2QIF A;  3M8P A;  2ROG A;  4OQJ A;  2ZH2 A;  2R7O A;  2ZC4 A;  2UUT A;  3AA8 A;  2R7W A;  3AY0 A;  5DDR C;  2B7C B;  1W2B R;  1TTH B;  1FKA F;  4URQ U;  4LBH A;  5KG0 A;  2KVI A;  5KG2 A;  2J0S D;  1DTT A;  1EJ7 L;  2ADB A;  5A0Y A;  4N41 A;  4EBC A;  1BC6 A;  2CG4 A;  2ZBQ A;  2EFO A;  3GPA A;  4LRD A;  4AND A;  4V19 X;  1Q8I A;  2DY1 A;  1Q0N A;  3IMQ J;  3TA2 A;  1S49 A;  3ENQ A;  5HP1 A;  3MEC B;  2MZR A;  3BSN A;  1CUL B;  2JX2 A;  4ZN3 A;  3W2W B;  5KG4 A;  3QAU A;  4JI0 J;  4JI8 F;  4NPO A;  4TQR A;  1SUQ A;  1NND A;  1R43 A;  1G7C B;  1WC5 A;  3W61 A;  3ZTO A;  1RWU A;  3BKT A;  5D4N A;  3PY8 A;  5C7P A;  3V6D A;  2V94 A;  2XTJ P;  4J7C A;  2YX1 A;  2ERR A;  2ZM6 F;  1WJ9 A;  3VR1 A;  3TVY A;  4FP9 A;  1RI7 A;  1REG X;  1NPR A;  3UE2 A;  4DV5 J;  3T5J A;  4DN0 A;  2F4F A;  2GGP B;  2OEM A;  4GVL A;  2HHS A;  4KIA A;  3T3F A;  5J1P A;  1IBM F;  1UA0 A;  5HVG A;  3IG1 B;  3DYA A;  3T5K A;  1S72 S;  2J0W A;  3DCA A;  5KFB A;  2J9D E;  1NHU A;  4DF8 A;  2BUN A;  3W66 A;  3IFE A;  4DFM A;  2NYI A;  2QYC A;  2GIR A;  2GS8 A;  5D3G B;  3IR5 B;  1CQM A;  4ILL A;  3F44 A;  3PRB A;  3K5O A;  4LF1 A;  4WFY A;  3CMA S;  2HRT A;  1QLN A;  4EYH B;  3GG0 A;  4C97 A;  4KRW A;  3ILO A;  3WX8 A;  4ZIW A;  4DN9 A;  2DYA A;  3P6Y C;  3E51 A;  2KFY A;  2J0X A;  4PWD B;  2XZT B;  1FXR A;  4L3N A;  2LMI A;  3S6E A;  2W9B B;  3NMR A;  3H2L A;  3MED B;  5B0F A;  2UZA A;  4F4W A;  2HGM A;  3ETM A;  1I5O B;  1MN7 A;  3BDE A;  4A8S A;  5I42 A;  1NJX A;  4RZR A;  2BA9 A;  5KFM A;  1D8Z A;  1SC4 B;  3CW2 C;  4Z7C A;  4LFC F;  4K2J A;  4CYU B;  4S0M A;  5K5M A;  3NNA A;  1SH2 A;  2VBX A;  3GU0 A;  9ATC B;  2ILZ A;  2IAJ A;  1EKR A;  3EUN A;  1UJ4 A;  4DL6 A;  4QWE A;  3KJV B;  2MLX A;  2YTC A;  2XUL A;  3D6M B;  2R7Q A;  2EC2 A;  3HJF A;  1TL3 B;  3GR0 A;  3ILL A;  1N32 J;  2IM3 A;  2VPZ B;  2GO8 A;  1HQU B;  4CH7 A;  1RKJ A;  2UUC F;  1HNZ J;  4Y0F A;  3MWB A;  4B08 A;  4YHH J;  2UUA J;  2OPP B;  2M5Y A;  3FC9 A;  1SIZ A;  3W9J A;  2MHE A;  5A6P A;  4EZ6 A;  4HAC B;  3N28 A;  4YB7 A;  3AAW B;  2BRL A;  3QIP A;  4XIU A;  3QT5 A;  1LWC B;  2B4U A;  3DDN A;  1AT1 B;  4DLG A;  4O44 A;  4Y2M A;  3NOC A;  1KEK A;  5KFX A;  3GFX A;  1HAR A;  3MEE A;  2D9O A;  3T41 A;  3H0P A;  3QRP A;  3LGH A;  4DV2 J;  2RRB A;  2SXL A;  2D3Z A;  2C2R A;  2MKC A;  2A1B A;  2BJE A;  3NGK A;  4UOF A;  2MKS A;  3CJK B;  3I5C A;  2BAN B;  1Z1Z A;  2ZKT A;  2UXD J;  2HEK A;  2GZO A;  1L3T A;  4X66 J;  2PE8 A;  4XTT A;  3H25 A;  2KXN B;  1XNR J;  4EEY A;  2HFO A;  3QT7 A;  4O4G A;  3DI6 A;  5U47 A;  1X5O A;  1RHQ B;  5IV4 A;  5D4O A;  1S76 D;  2OUG A;  4URS A;  8AT1 B;  1FK9 A;  3GG1 A;  3GMG A;  2KFZ A;  4YUD A;  3Q8V A;  5DG7 A;  2WB4 A;  4P10 A;  2C2Z B;  4X4O A;  2L9W A;  3PRV A;  2FY8 A;  2DNN A;  2EXU A;  5DGB A;  3LP0 B;  2LEP A;  4KH1 B;  3EMT A;  2ZJP Q;  5E3C A;  5KFC A;  3AA9 A;  2ZWO A;  5A8K B;  2XMM A;  4KB7 A;  1K44 A;  3H5S A;  4M63 A;  1N0V C;  2QE5 A;  2H54 B;  5T41 A;  4QW9 A;  2VG7 B;  5CZX A;  1XNQ J;  3DRP A;  2UXC J;  1FRX A;  5L39 A;  4ZK7 M;  4PG8 A;  2H3E B;  5F0W A;  2CUY A;  3AD7 C;  4EU0 A;  1SJ4 P;  2W2Q P;  3M30 A;  4OYA A;  4ED4 A;  1RT3 A;  1ZZN A;  2R2T A;  2COL A;  1EAR A;  4KFB A;  3T1Y J;  1UL3 A;  3R7N B;  5KTQ A;  3CT9 A;  1FKO A;  4I64 A;  1KVI A;  2AYB A;  2DGS A;  1AUS L;  5H9E K;  2R8K A;  2M7S A;  3I0R B;  4M5D A;  2MZQ A;  4A8K A;  5HRO B;  1C4C A;  2ZH8 A;  1T9X A;  5GAG I;  2WBR A;  4CT9 A;  1VHF A;  2JDJ A;  1NME B;  4GKK J;  4AQY F;  3KHG A;  4LF2 A;  3ICL A;  3HFK A;  3OFG A;  2ZH4 A;  1HYS B;  2DTJ A;  3HLU A;  1Y4Z B;  5J2M A;  2BVZ A;  5GAD U;  3VVT A;  1OPI A;  2VL1 A;  1BQN B;  4DPT A;  2V34 A;  4IH6 A;  5BR8 J;  1CJK A;  2QL7 B;  3PKY A;  2V5H G;  2BJ8 A;  2V2V A;  4FBT A;  4NXM F;  4DR5 J;  1OYE A;  3GFZ A;  1DTT B;  4DS4 A;  3JB9 k;  2NS1 B;  5GAE U;  2DHH A;  2DPI A;  5A0Y B;  1NH8 A;  2HHW A;  4RL1 A;  3V4I B;  1K0V A;  1XIQ A;  3IWN C;  4DL0 C;  5L9X A;  2ZOG A;  2XWY A;  4U7U K;  5HP1 B;  5AE1 A;  3B4D A;  3RRK A;  2DPJ A;  2OPS A;  3FGV A;  3K8W A;  3VQT A;  2UV8 A;  2E9R X;  2DCU B;  2H5E A;  3TEH B;  4IG3 B;  5F3Z A;  1WD6 A;  1ZAX A;  2WW8 A;  4DSL A;  1CJU A;  3M8W A;  1SUQ B;  1F5A A;  3A12 A;  4DSK A;  4K4V A;  1FNX H;  3FQL A;  2JFK A;  1JNR B;  5D0R A;  2Y0S D;  3KHH A;  1N34 F;  2GML A;  4IQM A;  1UVK A;  4ES1 A;  2DRD A;  4LFA J;  3QT8 A;  1RTH A;  3R3T A;  3IR6 B;  3MM6 B;  2J7K A;  4HHJ A;  3FSY A;  8ATC B;  3TAR A;  3V6D B;  4F3Q A;  2I5J A;  4L73 A;  1XR7 A;  1VI7 A;  2GVD A;  2HIY A;  4CO5 A;  3THP A;  2BMB A;  1JXE A;  1LV5 A;  3UNG C;  2EI5 A;  3R8Y A;  4EMD A;  3A3N B;  1XEZ A;  4R0E A;  4WZM A;  3W64 A;  3J7A 1;  1WKJ A;  4M95 A;  4B9V A;  2I38 A;  2B56 A;  2JEI A;  5B0B A;  3TJ9 A;  2XBP A;  4DV1 F;  3R27 A;  1SQF A;  2BKP A;  2YNI B;  4RR5 A;  5KFK A;  4FZV A;  5M2R A;  1OJ4 A;  2FZG B;  3O2I A;  2YY3 A;  2DEJ A;  3NP5 A;  1OQ3 A;  4OJ1 A;  4JI8 J;  2RU9 A;  3H5Y A;  3PIO Q;  3BRE A;  3BGO P;  1YJU A;  3Q0A A;  1SXL A;  2CQ1 A;  1V3Z A;  3V81 B;  3BBC A;  2B5J A;  2MLZ A;  3VQS A;  2NPI A;  3PJ9 A;  3S01 A;  1FNM A;  3EVO A;  2DIT A;  1ZOT A;  1HD1 A;  1KFS A;  2JLE A;  2KDO A;  4KHR A;  5F8H A;  4G6V B;  3R9L A;  3ISZ A;  4ILM A;  3MUM P;  1JJC B;  1TVR A;  4F36 A;  2ATL A;  2V2Z A;  3GIL A;  3P8B B;  2PGC A;  1OY9 A;  1IBM J;  1E6Y A;  2IAJ B;  1RAF B;  2GX8 A;  3BS9 A;  4LIR A;  1Q5Y A;  5KOW A;  1BGX T;  4JUZ A;  3QNW B;  2XSF A;  3IWX A;  2HMI A;  1M5S A;  1SQE A;  2KKH A;  5JMN A;  4NXN F;  3CJ5 A;  1TL4 A;  3OL8 A;  2P9G A;  4AL7 A;  3BR8 A;  2XYP B;  3AHP A;  3F73 A;  4I6Y A;  2VOD A;  4DV4 J;  4DV6 F;  3H8Y A;  4OI6 A;  4LF6 J;  3FJ2 A;  5J2Q B;  1RHJ B;  4NOH A;  1GMW D;  3J81 j;  4DV7 J;  1IKV A;  1UEK A;  2CQC A;  3CIM A;  3LQV A;  2Z57 B;  2AZ1 A;  1UVL A;  2RKI A;  1BD6 A;  4IFV B;  2ZBI A;  2UVR A;  4LRB A;  4QPX A;  1D9D A;  2W9C A;  4JB8 B;  1VK8 A;  1ZPV A;  2DNM A;  1LNQ A;  3AOC A;  4O44 B;  1NU4 A;  5LXR A;  2FVP A;  2CDR B;  4C8K A;  2RRA A;  3MEE B;  3EGV A;  2KM8 C;  3U7J A;  4B3M F;  4N77 A;  4CI0 B;  3L7O A;  3HSZ A;  2VFS A;  3TR5 A;  4K4X A;  5HJX A;  3R6L B;  1EZZ B;  4LSL A;  1VRQ C;  5E41 A;  3EDR B;  1RT7 B;  4ED7 A;  2DXD A;  4ZS6 A;  4TU8 A;  1NHV A;  4GO7 X;  1NJI T;  2Y8W A;  2YQ3 A;  2CZ4 A;  2DNP A;  3W60 A;  3QSY B;  1HBU B;  1RP5 A;  1ICE B;  2UUC J;  2X3G A;  4WTO B;  4KC5 A;  5ETQ A;  2MQQ A;  3UFC X;  4N5S A;  3IBW A;  2V67 A;  3BSA A;  4N7T A;  3L3C A;  3B8H A;  3NL0 A;  3KXD A;  3DLB A;  2NXC A;  2VA3 A;  2BAC A;  4H54 A;  1HKA A;  3AXK A;  2V4J B;  2OPR B;  2M2B A;  1TFY A;  4KGM A;  4IH5 A;  4LF5 J;  1RT2 B;  2CZ9 A;  1X4H A;  4B9N A;  3V2U C;  3HVT A;  5DQG A;  2VG6 B;  2V8D A;  4RJV A;  2R8J A;  1MML A;  2HVE A;  1D09 B;  3UWT A;  3T5H A;  2DRA A;  3EXY A;  4UT4 A;  4HH1 A;  3DRP B;  4JI4 F;  1WOP A;  3G6V A;  2Y1R I;  4LBI A;  3AXM A;  2P6S A;  4UUW A;  2GJ2 A;  2CQH A;  4ZHR B;  1WC6 A;  4NZ6 A;  4FKY A;  2BJD A;  1GNK A;  4QYR A;  2IHR 1;  3DLL Q;  4X84 A;  2EBE A;  1PSD A;  4C8M A;  1RT3 B;  4USW A;  2MZT A;  3KLV A;  4ZKA A;  4FNH A;  2DXF A;  5LM7 E;  2YQ0 A;  1UZD A;  1FDB A;  4CLZ A;  1UTA A;  1G3O A;  3MFH A;  3DRX A;  3B82 A;  2VPW B;  2DGQ A;  4WE1 B;  1JLC B;  2C42 A;  3C66 A;  3KDN A;  3IR7 B;  3J81 U;  2YWK A;  3VCD A;  4CLF A;  4IRC A;  4UQG A;  2XY7 A;  4LF4 J;  1U45 A;  5KFI A;  3CJ0 A;  3JSM A;  3MAQ A;  1R31 A;  3K5L A;  2QV6 A;  1IJE B;  4KSE B;  3D28 A;  3H90 A;  3VHQ A;  1D9F A;  2I0X A;  4FS1 A;  1UWB B;  4OYW A;  1UAW A;  3HF5 A;  2IA0 A;  4PWW A;  2MMY A;  5AJ3 J;  2LQJ A;  1TK0 A;  4X64 F;  3GIM A;  1B0V A;  4V1A k;  2IDL A;  4RUB A;  1N5Y A;  4RX6 A;  1NKC A;  2VIH A;  1QTN B;  2XI3 A;  2AHO B;  2EWH A;  5D4P A;  3OSP A;  2F8E X;  4F67 A;  3BN4 A;  4MK7 A;  3CCZ A;  2CQI A;  4ZCL A;  2WSE C;  5EUH A;  3AB2 B;  2B4P A;  2LDI A;  3WZ0 A;  1IKY A;  1WHY A;  1GMV A;  1NHK L;  4O3R A;  1PBU A;  3TP2 A;  5ETR A;  4H4O B;  4F4X A;  3M05 A;  2HVI A;  1WKL A;  3G6Y A;  1WKK A;  3SBM A;  4LF7 F;  3RTV A;  1TUG B;  4RW7 B;  4MMO A;  1U1K A;  2OPS B;  2B0G A;  2W2M P;  4YQW A;  5KFD A;  2QSW A;  1S9F A;  1JJ4 A;  1RT1 A;  5L1J A;  1CJU B;  3ZZZ A;  4CLW A;  1CPZ A;  4X4T A;  3DMJ B;  2VC1 A;  2DNK A;  3OSN A;  4PUO A;  3OHB A;  1PG5 B;  4WBF A;  2BJ1 A;  1RTH B;  3PIP Q;  3NBP A;  2NR0 A;  4C11 B;  3KG0 A;  1HBM A;  2OFH X;  1T8E A;  2Y1J A;  4GO5 X;  2KZM A;  1HHS A;  3W8P A;  3Q24 A;  1MRO A;  2O5D A;  2C2K B;  4NXM J;  2U1A A;  2GVD B;  3NKY A;  1A0O B;  4CIO A;  2H1Y A;  2V63 A;  1NO8 A;  2UV8 G;  1V3S A;  1RT4 B;  1J5O A;  4DQP A;  1BQX A;  3CSK A;  3POT B;  2H5J B;  4I1T A;  3JXO A;  5A2Q Y;  3FSI A;  3FCH A;  4B3S F;  6AT1 B;  1R89 A;  1ROF A;  3C19 A;  3R2C J;  2X1G A;  5B0E A;  1Y0H A;  5CD4 H;  4LRE A;  4WKR A;  1T95 A;  1TL5 A;  1AXQ A;  1WAC A;  1YK9 A;  4OHY A;  1RAJ A;  2J9D A;  2V8P A;  4C8O A;  4ZVE A;  2Z4P A;  1OMS A;  4ECY A;  1YZ6 A;  3PEJ A;  1X4E A;  5K8N A;  4M5N A;  2KHD A;  3R5C A;  1HMV A;  4WU3 A;  3CCL S;  3AJ1 A;  3QZ7 A;  2F8H A;  3OW2 R;  1RUS A;  2OJ3 A;  2ZZT A;  3FEZ A;  3F41 A;  2DKO B;  7AT1 B;  1JKH A;  1VK3 A;  1RAG B;  3AFG A;  1TVR B;  2CNN B;  1H2V Z;  2PI5 A;  4P7T A;  3IM8 A;  1Q7Y T;  3MR6 A;  4OYM A;  1HNI A;  2BR0 A;  2M3D A;  2PDA A;  3OFH A;  1Z2Z A;  2BE7 D;  1T11 A;  4KY3 A;  3EIC A;  3CJ3 A;  4DV1 J;  5F9L A;  1J5E F;  3BPS P;  3QPI A;  4DR3 F;  1NDC A;  1U6B A;  1RLD A;  2HRY A;  3LOU A;  1N56 A;  1WOO A;  5H9F K;  3VZH A;  1S1V A;  1H73 A;  5A2Q U;  4KJI A;  4ZPC A;  4JYA J;  1LK5 A;  4NX9 A;  4ALZ A;  4RBU A;  2E66 A;  5H1S V;  3CD7 A;  3PHT A;  4HLB A;  3W3S A;  2OFG X;  5F8G A;  2Z56 B;  2GHV C;  2YWE A;  2CJX B;  4G1P A;  1IKV B;  2MZJ A;  2V69 A;  4OI4 A;  2LXI A;  2RKI B;  3US5 A;  3BGU A;  2LYV A;  2CJB A;  3ISN C;  5KG6 A;  4N56 A;  2CVI A;  4OJH A;  2W9C B;  1VQ4 S;  1FWP A;  1JLG A;  2YKM B;  4Y2A A;  4MKV A;  2YPZ A;  1WC1 A;  3AOB A;  4CLS A;  4MAK A;  3THT A;  1MW7 A;  2A2D A;  3PCO B;  1WG5 A;  3BO2 A;  2CYY A;  2M8H A;  3CUN A;  3PAC A;  3O8W A;  4QYZ K;  2Q6B A;  3D6T B;  5F8L A;  4NLU A;  4I2P A;  1LWF A;  4L6V 3;  4LSL B;  2L3M A;  5EGY A;  1YRU A;  5L8R C;  2VPY B;  4YDX A;  4PQU B;  4NXN J;  3HSJ A;  3GLJ A;  2KO1 A;  2AWZ A;  3H4D A;  5HQL A;  3ELH A;  3NGU A;  4DR6 F;  2DNO A;  2BOP A;  2XHC A;  4DFP A;  2GHW A;  2AGO A;  2E5L J;  5FDL A;  1CJT B;  2B43 A;  4DX5 A;  5K14 A;  2Y3Y A;  2Y8Y A;  5G0R B;  3RB4 A;  1RTD A;  3GJT B;  2OPQ A;  1TUV A;  4YB5 A;  3EGW B;  2DNH A;  2DCL A;  3GWC A;  1NSK L;  4PG6 A;  3D6H B;  3C6U A;  2CPI A;  3HMJ G;  4B3M J;  1RZM A;  1TV6 A;  3DGP A;  3PHE A;  3BQ0 A;  2J6S A;  3EXC X;  3HVT B;  2O1P A;  4CWB A;  1HHQ A;  5KFN A;  2QA1 A;  1EP4 A;  3DFE A;  3I9V 9;  4ECS A;  1FJC A;  3CDU A;  1NJY A;  3OVA A;  1RWP B;  1IBL J;  4KHM A;  2F65 A;  3CED A;  3NCP A;  1QSL A;  3L4B C;  2LVW A;  1R0C B;  1VRT A;  3HHE A;  1D8Y A;  1A6L A;  2CJY B;  4IDK A;  5F8J A;  2W24 A;  4M5H A;  1SKR A;  2D74 B;  1S0O A;  3NXZ A;  2WB1 D;  5A8R A;  1RA7 A;  1VBX A;  1N5S A;  1LWX A;  1FFG B;  2HVD A;  3OFE A;  2KM8 B;  1TU0 B;  3JYT A;  1S7H A;  1NSP A;  1QJH A;  2VKZ G;  2XB2 D;  1MWQ A;  1YQH A;  2WVD A;  2E7W A;  2VDI A;  4M94 A;  3O5T B;  4F7V A;  3CJR A;  3G82 B;  2C28 A;  4EO8 A;  5LJ5 Y;  5ADZ A;  1I94 J;  3K8V A;  3PW7 A;  3I4H X;  1S4F A;  1KNZ A;  1S6Q B;  1TR0 A;  3R5B A;  4ICL A;  5IFM A;  2XSJ B;  3HHK A;  1S1W B;  2ASD A;  4D3G A;  4NLW A;  1PO6 A;  4C2M A;  4OI0 A;  3JSM B;  4PAA A;  1RWW B;  5GVQ A;  3OBI A;  2IMO A;  3TAP A;  3PTW A;  3NS6 A;  1VQ5 S;  3I5A A;  1XR5 A;  2ZC3 A;  3S1T A;  2OSR A;  2CPY A;  4KKO B;  1MLA A;  2GHP A;  4LF8 F;  2LQ9 A;  1Q95 G;  5DLF A;  1HFE L;  3ULH A;  3T6B A;  3MMA B;  1N48 A;  1F9H A;  4I56 A;  4LVN P;  3CC2 S;  1VBY A;  2V8V A;  1X5S A;  3G9C A;  3MR2 A;  3MR7 A;  1VQN S;  3D3C J;  2C2N A;  2CPE A;  1PYS B;  1BHN A;  1H72 C;  3FUY A;  3D6F B;  1Y5L B;  1SIW B;  1ULR A;  2NUH A;  3BBF A;  3QJJ A;  1RKI A;  2FJB B;  3C6T A;  2A10 A;  1T9W A;  4X65 F;  1HR0 F;  5I3U A;  4FF2 A;  2EEY A;  2IBO A;  1Q79 A;  2JWN A;  2CWX A;  2NZ4 A;  4USV A;  4P2X A;  1RT1 B;  3S7R A;  1L5U A;  4PQA A;  1R8H A;  3KFW X;  4F2S A;  1JLQ A;  1HQ2 A;  3K57 A;  1HPZ A;  1XK8 A;  4OIX A;  4R5P A;  4NLS A;  3G2X A;  2D3O 1;  4N76 A;  5AXN A;  3LPY A;  1U8W A;  4CQ1 A;  2R8G A;  3R5G A;  1NSQ A;  5D0H A;  2F9J A;  2GMJ A;  3PDN A;  1BQM B;  1Q4R A;  2VQF F;  4NLT A;  2YH0 A;  4Q0B A;  2EG2 A;  1U26 A;  3RU0 A;  3DM2 B;  3K7R A;  3I9Z A;  4PZV A;  3ETO A;  1M1K T;  1YHQ S;  4RPF A;  2DIV A;  4OYB A;  2IVF B;  2YQ1 A;  2HHQ A;  2CQP A;  4P52 A;  1J5O B;  5BYS A;  1GFW B;  1VIX A;  3BBB A;  2QMU B;  2FLP A;  2ZOF A;  4PXE A;  1X4A A;  4I2Q B;  1PJ5 A;  4WFA Q;  2MKH A;  3CJQ A;  1RU1 A;  4XPC A;  3GV7 B;  2RQK A;  4NLY A;  2VU5 A;  2WW4 A;  1KS2 A;  3PYD A;  4DUT A;  4MIW A;  2DGO A;  4USJ C;  4K50 A;  5L1K A;  2ZBP A;  2HW3 A;  4C7Q A;  1HNX F;  2VPX B;  1PJ7 A;  2D3U A;  3EZO A;  1TK8 A;  4TY8 A;  1KN6 A;  3SCK E;  6FD1 A;  2BE2 A;  4DSF A;  1VQ6 S;  4I68 A;  5KFY A;  3MMC B;  1NDL A;  3H40 A;  5IC6 B;  3C15 A;  3CCE S;  3KK2 A;  3QWU A;  2ZD1 A;  4DL7 A;  3M1V B;  1Z2L A;  2FVC A;  2I6W A;  1WC4 A;  2JLG A;  4U7U D;  2X1A A;  2MPU A;  4NEY A;  3QQC D;  2M4M A;  1TKZ A;  1WEL A;  4ZOS A;  2XQC A;  2Z0G A;  4BWM A;  1IN0 A;  5D0G A;  3M2R A;  2QX0 A;  4AL5 A;  1C0T A;  1BWE A;  2ASL A;  2HFN A;  1FEE A;  3I6P A;  1S1V B;  3LPE A;  3LA0 A;  2AD9 A;  2BM1 A;  3UDL A;  2LEA A;  1SBR A;  1U1M A;  4CTA A;  3J7Y I;  3J7Y U;  4F3O A;  1UJ6 A;  3GFY A;  2AKW B;  1PAU B;  1BUX A;  4ILR A;  3CCW A;  2K7K A;  1O0P A;  2DNR A;  3DGV A;  3C46 A;  1PYO B;  1REV B;  2QRR A;  3HI9 A;  5K20 B;  2EFQ A;  1JLG B;  1SI9 A;  2KB2 A;  3PFE A;  4RW8 B;  1KSP A;  5E3P A;  2QT7 A;  4H4K C;  2MSS A;  5DQI A;  2U2F A;  3M8Y A;  4MH8 A;  4WYL A;  3TAN A;  4RUH A;  3T9N A;  1C0U A;  1LWF B;  5E0O A;  1SB6 A;  2DJW A;  1TKD A;  2CQG A;  5DG8 A;  2ZH3 A;  2Z2Z A;  3BM7 A;  4RW6 B;  2IYG A;  1Q8B A;  2EW9 A;  2XYG B;  2IC3 A;  4PXB A;  2I1R A;  1CJV A;  3KLE A;  1U48 A;  4OX7 A;  4NE9 C;  4P2F A;  2EKY A;  2MYF A;  4DR2 F;  2NUU G;  1RQ0 A;  3M32 B;  2JFD A;  2OH2 A;  2B3T B;  2DIS A;  1KHV A;  2YKA A;  3OJU A;  4LR9 A;  4FVC A;  3I4P A;  2JL9 A;  3TI0 A;  5BJR A;  2OPQ B;  4DWI A;  4K5R A;  3BH6 B;  2CPH A;  3VTI A;  2N3L A;  2G0J A;  1U1P A;  2G0C A;  2B9E A;  2HBR B;  4P6Q A;  1C1C A;  4M5I A;  2KL8 A;  1EP4 B;  1QE1 B;  5HMZ A;  3VF0 B;  1JLF A;  2VBY A;  2I8E A;  4JV1 A;  1F60 B;  1VQY A;  1HHT P;  2GNK A;  2WVC A;  4RW4 B;  3UW1 A;  4B3O B;  1VRT B;  2BQR A;  2FTR A;  3ZTS A;  4L72 B;  4LQ9 A;  4JV0 A;  3CDE A;  2CPZ A;  1ACM B;  2XC9 A;  4F8R A;  2ZVS A;  2D7S A;  4QYZ J;  3WDO A;  3A8E A;  4H4K A;  4ES2 A;  5A8R B;  2X1B A;  2FUG 9;  1JJH A;  3UCZ P;  3GII A;  3MGJ A;  2HSE B;  1CG2 A;  2MXY A;  2OHD A;  3K0J A;  1DQA A;  3VGV A;  2DR7 A;  2PMW A;  3DLE B;  1L3S A;  2R2R A;  4YME A;  3C3L A;  3PO5 A;  2E1P A;  4FVM A;  3ZZU A;  5HBM A;  1K47 A;  2O67 A;  2OGU A;  3HDS A;  3PW2 A;  1F2H A;  3H98 A;  4JI0 F;  2HNY A;  4XK8 C;  1W2I A;  1YG0 A;  4QIF A;  1NH7 A;  2XS5 A;  5EWF A;  4ZPT R;  5K9F A;  3ZC4 A;  4IR1 A;  3DKD A;  4CO0 A;  1UPM B;  1XQI A;  5KFT A;  1PGZ A;  1RBO B;  2DHG A;  4IOB A;  4F0M A;  1V5I B;  3SXL A;  1IWG A;  1VBZ A;  4KO0 A;  1GQE A;  2AGQ A;  2CQ0 A;  4DV5 F;  3TAM B;  1TMJ A;  2GAG C;  2GO9 A;  1TL7 B;  2HUR A;  1W7W A;  3MUV P;  2DNZ A;  1A9N B;  1YTY A;  1S79 A;  4BBY A;  1WF2 A;  3PX0 A;  3W9H A;  2IA6 A;  2XG8 A;  4IRD A;  2D3O R;  1ZM4 A;  1FDN A;  2VHG A;  4B9S A;  3K5M A;  2X3D A;  4P72 A;  1LXJ A;  1GK8 A;  2MKK A;  2HQC A;  3G8T A;  3LAN A;  5KAK A;  5IV3 A;  2FJW A;  1C1B A;  3MEG A;  2ZZN A;  3MEC A;  2YVS A;  1CUL A;  3CCR S;  2JVR A;  3W2W A;  2C3U A;  2HQ3 A;  5KG1 A;  2XO6 A;  1OYD A;  4ZIT A;  2RU3 A;  1RIS A;  3DLG B;  4LBP A;  2FC8 A;  5DQH A;  1S1T B;  4R5P B;  2W7O A;  5JXS A;  3V4M A;  3BGF A;  2W8L A;  4UOG A;  3NCQ A;  1YJR A;  1HW8 A;  4X4P A;  3D66 A;  1R8P A;  3O1L A;  5HMW A;  1RWN B;  3DRR B;  5ETO A;  4C3M A;  3M7V A;  5IWA J;  3CD6 S;  3PX6 A;  4Y34 A;  2M88 A;  4W4M A;  4Q0B B;  5I4M A;  3K17 A;  1RAI B;  1D9A A;  2LU2 A;  5DM7 Q;  1RAD B;  2O3D A;  3MCS A;  1NK7 A;  4NZ0 A;  5F0U A;  2V2K A;  2FLN A;  1Q78 A;  2K2P A;  1BE4 A;  3D1H A;  2MQL A;  4ZVS B;  3UDE A;  2FHJ A;  2ZUA A;  4JI1 J;  3PR4 A;  1N32 F;  3FZB A;  2FHO B;  3G71 S;  1FT8 A;  2VG5 B;  1S57 A;  2XYH B;  1VS3 A;  3EGZ A;  1HNZ F;  1RYS A;  4TYA A;  4Q5V A;  2UUA F;  3SQG A;  4OZJ A;  1X9S A;  3SQO P;  4DL5 A;  4QWC A;  2FGO A;  4YR3 A;  1M5P C;  4PWD A;  5C24 B;  2W9B A;  1ARO P;  1OSC A;  3MED A;  1JXL A;  2X51 A;  1BY9 A;  2BE2 B;  2Z2M A;  3SEO A;  4ZCI A;  2VIC A;  3PG9 A;  3VAF A;  3ZNU A;  1XER A;  4P9S A;  3C15 B;  1T0T V;  1WEX A;  2ZD1 B;  4CYU A;  4DX7 A;  1KVJ A;  3J80 Y;  1VQK S;  2BZ2 A;  5E3Q A;  2A6M A;  4DV2 F;  1B3T A;  1KRP A;  2JLF A;  3SV4 A;  2FZC B;  4CLU A;  1UVM A;  4WFZ A;  3DU5 A;  1T05 A;  2UXD F;  3M2R B;  3FMW A;  2RUS A;  5KFQ A;  4DPW A;  4OV6 A;  1X9W A;  4X2B A;  1RAA B;  4DI6 A;  1C0T B;  4YOE A;  4X66 F;  4WKY A;  4NRT A;  4U7C A;  1MU2 B;  4OZ0 A;  4KQZ A;  1TK5 A;  3I5B A;  2OPP A;  1UEV A;  5KFH A;  4CTA B;  1VQ7 S;  5MLC V;  1CQN A;  5CZV A;  3BF4 A;  5DM6 Q;  4HAC A;  3QBC A;  3GSD A;  4O3N A;  5ITH A;  1RGV A;  3ZTQ A;  3RBX A;  2HZA A;  2W7P A;  4DV0 J;  2KT2 A;  3QAE A;  3ILI A;  1LWC A;  5KFZ A;  3CC4 S;  4ZVO B;  2LA6 A;  2WZ1 A;  1WSV A;  2VKR A;  3IGV A;  4RNF A;  2WTF A;  2ASY A;  1UWA A;  4K4W A;  3W1Y C;  2E44 A;  4ZP8 A;  3NAH A;  2QLW A;  3MMB B;  3UQS A;  3J80 U;  1JLB B;  3IAS 9;  3K59 A;  1RDR A;  1NPP A;  2L9N A;  1C0U B;  1YJT A;  3X3U A;  3I0S A;  5ETN A;  1JIH A;  3FZ2 A;  3CJK A;  4IR9 A;  2BAN A;  3PW5 A;  2EK6 A;  1XNQ F;  4M5M A;  5C5J A;  2E1C A;  1EQ0 A;  3HKZ D;  5C42 A;  5AXK A;  2H5I B;  1HQE A;  3KLE B;  1ZA2 B;  3VAM A;  2V6A A;  2R4F A;  3RB3 A;  2E7X A;  3SFU A;  5RUB A;  1C2P A;  4AXJ A;  1JMT A;  1WF0 A;  4NLO A;  1KOO A;  4YB1 P;  3BGL A;  4NWB A;  2OIH A;  4OZ2 A;  3D54 A;  1CEZ A;  3N6L A;  5BYQ A;  1G4C A;  2K8G A;  3ZZP A;  2BKO A;  3OT9 A;  4FYX B;  1SH3 A;  2A2C A;  1QSY A;  2AW0 A;  1PYT A;  3CD5 A;  2G9O A;  4F0K A;  2XMA A;  3N9U C;  1N5V A;  2LXF A;  2KG0 A;  4NMX A;  3TUJ C;  1DQ9 A;  1K1S A;  1C1C B;  4GKK F;  2DD8 S;  2J7U A;  2Y1L B;  3RR7 A;  4R0J A;  1RB0 A;  3NG8 A;  1NB7 A;  2RT3 A;  3QO9 B;  3J7Z 5;  4LT6 A;  5EWG A;  2NLW A;  3U02 A;  2EPI A;  4DR2 J;  3W5X A;  1X5T A;  3RBZ A;  1Q16 B;  3QSI A;  4NEZ A;  2JSX A;  2KH9 A;  4E98 A;  3QRR A;  3DC2 A;  2HQF A;  2VFU A;  2C3P A;  1K73 T;  3I56 S;  2CPX A;  3EJM A;  4CLP A;  4WFN Q;  4BWJ A;  2AJ4 A;  2LP4 A;  2JEG A;  4G65 A;  2DH7 A;  1M90 T;  3ADA C;  3I0R A;  4RU9 A;  3RGI A;  3Q8R B;  1GXU A;  4YDD B;  4MYT A;  4K59 A;  2RSQ A;  1IBK F;  4ELU A;  2RUG A;  4B9U A;  5HVF A;  4U95 A;  3D2W A;  3BB5 A;  3BEG B;  4OZ3 A;  1H2U X;  2GC8 A;  5DS7 A;  2XMK A;  5CHC B;  2HNY B;  2RDJ A;  1N88 A;  2D1C A;  1G2E A;  3UR3 C;  4USI A;  4NA2 A;  1P1L A;  4QR2 A;  4C3L A;  1BQN A;  2WVB A;  4LFA F;  2E5G A;  1RE1 B;  4AD6 A;  4E8U A;  2WRM A;  2AYG A;  2HQG A;  3FMB A;  3LO3 A;  5CA5 A;  2HK2 A;  4UOH A;  5E2Q A;  3SI8 A;  4KO0 B;  2CPJ A;  3C2P A;  3MM9 A;  4OZN A;  4LF9 F;  4UY8 T;  3V4I A;  2E5J A;  2MGZ A;  3GP9 A;  5J1E B;  4ZVR B;  3HHL D;  3A4T A;  2XY6 A;  1C1B B;  4FXD A;  3MEG B;  3FCV A;  2FVR A;  1IVZ A;  2ZH9 A;  4IG3 A;  4H4M B;  4MKA A;  2DB1 A;  4DR7 J;  3D1O A;  4KPY A;  2ROE A;  2W1B A;  4LFB J;  1DY3 A;  2MEW A;  2VFV A;  3OHA A;  4PXC A;  4LR7 A;  1ZM2 A;  3GV8 B;  4HDH A;  1MWZ A;  3D0I E;  3MM6 A;  1UCN A;  2DEI A;  1IXK A;  3IM9 A;  5KFP A;  2DT9 A;  1U1L A;  4KYZ A;  3Q89 A;  4WK3 A;  1KHW A;  3CCT A;  5BYR A;  1WOR A;  1G6B A;  5GMK a;  5DDP C;  1R8C A;  4NCB A;  2EK1 A;  4QR0 A;  1DAX A;  3EGN A;  2W9A A;  1DLO B;  4CO2 A;  3RBE A;  2DXE A;  3IRX A;  5L38 A;  3IN5 A;  5HL7 Q;  3VAI A;  3GFH A;  4FYV B;  5IOL A;  4I67 A;  3MD1 A;  1S0M A;  3DU6 A;  2HNZ B;  4KHP F;  2YNI A;  2HND B;  1RBL A;  1WEY A;  1FVS A;  1NK0 A;  3NGD A;  1JJ2 R;  2IRU A;  2QA4 S;  4OX8 A;  1S0N A;  3EYZ A;  4DSI A;  2VFT A;  5FJ4 A;  3N01 A;  4ATN A;  4DV4 F;  4IO9 Q;  3IGN A;  1S9E A;  4CH0 S;  2KG1 A;  4LF6 F;  2KT3 A;  3SQG B;  5SZT A;  4DV7 F;  5E33 A;  3V81 A;  4JP8 A;  2HYI B;  5LT5 A;  3K58 A;  1RCX B;  2HBQ B;  3AJD A;  2PA3 A;  4FBU A;  2VV5 A;  3HO1 A;  3M2V A;  4DHV A;  1KQK A;  3JTP A;  1M5H A;  3GB0 A;  1WI8 A;  4EI2 A;  5LSR A;  4DSE A;  3LH2 S;  2CRL A;  3JTO A;  2ASJ A;  2C2D A;  3W7B A;  4DS5 A;  5C2C A;  4CT8 A;  2XS2 A;  2N82 B;  1H7W A;  3H20 A;  4P75 A;  1R0B G;  1P6T A;  5B7W A;  3FKB A;  3CUL A;  5F41 A;  1IUJ A;  1I3O B;  1T05 B;  3Q22 A;  3BO4 A;  1Y7P A;  4AXI A;  4ER8 A;  4EBE A;  2IM2 A;  4J9O A;  3ET6 A;  2Y1I A;  1X0F A;  4OLP A;  1B99 A;  1F0X A;  5J2Q A;  1RWX B;  2YKQ A;  3KOA A;  1SVD A;  2VQE J;  2HPU A;  1FJE B;  1SL0 A;  1FRL A;  1NRK A;  4QIV A;  3KLI A;  3KNA A;  4ED0 A;  4IFV A;  2P9E A;  4F02 A;  4GC6 A;  4M5G A;  1RBA A;  2QGF B;  2ZJQ Q;  1VCT A;  2W4D A;  2LLZ A;  4P71 A;  4LF5 F;  4DJB A;  2HS4 A;  3OTO F;  3U1M A;  4JI7 J;  4PYD A;  1LFP A;  3OV7 A;  3CE8 A;  1JWW A;  3HSG A;  3FBF A;  4RLE A;  4D3H A;  4QIG A;  3BGR A;  2R7T A;  3HD1 A;  5A76 A;  3GTY X;  5CYQ B;  2YKN A;  2MKY A;  2DR6 A;  1RT7 A;  3I0S B;  1IQZ A;  4O23 A;  2IPO B;  2Z2L A;  4ELT A;  2FC9 A;  3Q8P B;  2GMH A;  3RB6 A;  2CA9 A;  1P27 B;  3OTC A;  5D77 A;  2VUG A;  5C42 B;  1HBU A;  8RUC A;  1U2R A;  1HQE B;  4WCE Q;  4Q45 A;  2PI4 A;  5KFJ A;  1S6U A;  1GH8 A;  2KYX A;  3KLH B;  4Y00 A;  1Q5V A;  3D3B J;  4OYX A;  3SSR A;  2IBK A;  5M2U A;  3G6X A;  4F4Z A;  4GVB A;  4QWA A;  2V4J A;  2OPR A;  2WHO A;  3FRZ A;  2DR9 A;  3MM5 A;  3KHR A;  5B0G A;  2AMC B;  3GYG A;  2YNH B;  5D8H B;  1RT2 A;  4KAI A;  4A8W A;  4TY9 A;  4LSN A;  3LF0 A;  5EN1 A;  3LP1 B;  1IM6 A;  2VG6 A;  5KFE A;  4LF4 F;  3QAT A;  2RQC A;  1X9M A;  2GQQ A;  5L9N A;  4C8L A;  3H2V E;  3C8Y A;  1MMD A;  2AT1 B;  3RBD A;  2E1A A;  3EE3 A;  3I31 A;  7FDR A;  2F63 A;  4GMK A;  2FVQ A;  4BS2 A;  4Q7A A;  1VQM S;  5HO4 A;  2BQU A;  5AJ3 F;  3CJ2 A;  2WOM B;  4YR0 A;  1U2C A;  4QR1 A;  4ZHR A;  2A18 A;  2OAU A;  2BW7 A;  2J7W A;  3P5B P;  2HQD A;  3UI3 A;  2B4O A;  1HL6 A;  1K9M T;  3T1A A;  1S97 A;  4C4W A;  1M5O C;  3TW0 A;  1IBC B;  4Q2M A;  3AJ2 A;  1SJF A;  1MMN A;  3D7S B;  3TX0 A;  1NDK A;  1Y11 A;  4ZP7 A;  2QFI A;  2HS3 A;  1RT6 B;  4WE1 A;  5FLX Y;  1JLC A;  2MKI A;  5CH7 B;  2J8A A;  4B9L A;  1U0H A;  1VC5 A;  2N7C A;  2B8Q A;  5GAG U;  3U1L A;  4C9D A;  4LJM A;  3R5J B;  3KWM A;  1ELO A;  4ZJL A;  3CF5 Q;  2HKE A;  2N7Y A;  5LOQ A;  4K4S A;  5IXU A;  1NK5 A;  3W5Z A;  3JTN A;  1RCO B;  4CO4 A;  1UVN A;  3GQC A;  2PC6 A;  1IKW B;  4UZB A;  3BH7 B;  3A1Y G;  4ZLL A;  2DO4 A;  2Q6C A;  1SL1 A;  3QGI A;  1UWB A;  3MEK A;  1QVF R;  1FRH A;  3MDF A;  2DVI A;  2K7J A;  1E6V A;  3SMZ A;  1B0P A;  4JBC A;  1VQ9 S;  1FX4 A;  1RU2 A;  1VGY A;  2ZHO A;  3D0G E;  1GX5 A;  1CVJ A;  2GJI A;  5KFG A;  2E5H A;  4W92 B;  3KMS A;  2V4R A;  3UD3 P;  5CYM B;  3MM9 B;  5SUH A;  2LA4 A;  4RUC A;  1IKX B;  1OIA A;  1LWE A;  2DGV A;  3CDA A;  3P5T L;  2XHW A;  2MGZ B;  4KV8 B;  4JI2 J;  4H4O A;  4U67 Q;  1IBK J;  3R1H A;  2HHU A;  1NDP A;  1FNO A;  2QC3 A;  5FLX U;  3HHN B;  2XY5 A;  1FEH A;  3FBC A;  4RW7 A;  4JI3 F;  1WF1 A;  4DR4 F;  2HZC A;  2DK2 A;  4NCG A;  1NJZ A;  2F4V F;  1GAO A;  3O6Q A;  2DNQ A;  3DMJ A;  1UJ5 A;  3IS9 B;  1S9G B;  4CP5 A;  2DR8 A;  3UD4 P;  4C11 A;  3GJR B;  4FN5 A;  1GTH A;  3FNN A;  1SL2 A;  3DOM B;  3C16 B;  2E9T A;  4TVA B;  2MQ8 A;  1LXN A;  4F4Y A;  5EHH A;  4DF4 A;  3QFH A;  3UO0 A;  4LF9 J;  2V50 A;  4QBU A;  4K5S A;  4LVO P;  1RT4 A;  2BAB A;  2AJ1 A;  3GV5 B;  2RML A;  4FYY B;  1H7X A;  3IRX B;  3TEG A;  3VV2 B;  2R42 A;  4IO1 A;  2KU7 A;  4K4Z A;  1TFW A;  4RNN A;  3POT A;  2ZEJ A;  1Q86 T;  2W2N P;  5IM0 A;  1XBW A;  1FA0 A;  1VHI A;  3DHW C;  3M2U B;  1UVJ A;  3HT0 A;  1AZS A;  4ZLP A;  1JXV A;  2W8K A;  5LMN J;  2HWT A;  3TZZ A;  4JYA F;  2XNR A;  5KFO A;  1U1R A;  5IQQ A;  1VRU B;  1S9E B;  1N6Q B;  2RD5 C;  4NCA A;  3R5D A;  1NPK A;  3HFZ B;  3CC7 S;  2DO0 A;  4FKX A;  1YSJ A;  4A8F A;  2PEH A;  2A3J A;  3W2V B;  1FE0 A;  3DOK A;  1VBK A;  4B9T A;  2ZDO A;  4GKJ J;  3M2V B;  3EZU A;  3CCJ S;  2OKQ A;  2WAQ D;  3R5A A;  3G4S S;  1B70 B;  4J9Q A;  4ZCK A;  4L74 A;  2DHX A;  2IDE A;  1UZH A;  3H5U A;  3NNH A;  2DGW A;  4HR2 A;  2GA7 A;  5J2P A;  1HNV B;  3V5R A;  2PO4 A;  3DLJ A;  4KHP J;  2B9Y A;  3MI7 X;  1UFW A;  2BJ3 A;  1WSR A;  2KXF A;  3T5L A;  3HVW A;  5IQ6 A;  5HAN A;  3IA0 A;  3ET6 B;  3OL6 A;  3CDW A;  3CJS A;  3W63 A;  4KR0 B;  2E7V A;  5AE2 A;  2GIQ A;  3EDQ B;  3J7Z T;  2P9C A;  2E5L F;  4PR6 A;  1DTQ B;  1BXN A;  3KYL A;  2V8H A;  3OQ2 A;  2HHH J;  3KLI B;  2YPY A;  2RF2 B;  1PC4 A;  3DLK A;  3U1N A;  4QU6 A;  1NB2 A;  1ITP A;  3O3L A;  1FWK A;  2YKM A;  3OTB A;  1U02 A;  4F2R A;  1SJQ A;  4QW8 A;  1FTC A;  1GMW A;  2R8H A;  1MNE A;  2QLJ B;  1IJF B;  2YNF B;  3BGR B;  3RZA A;  3GJQ B;  2JC1 A;  3TUI C;  2KZZ A;  2R7R A;  5D4L A;  1WDT A;  2YKN B;  5CQG A;  2QMW A;  3RRH A;  2CJA A;  3TA1 A;  1IBL F;  1VJW A;  3MM8 A;  4PQU A;  1QSS A;  1FI4 A;  2RDD A;  4TLQ A;  2Q79 A;  3VAL A;  4U6P A;  1FJG J;  1J2V A;  4L3K A;  2LDY A;  3NY0 A;  4OI3 A;  4NZ7 A;  1FCA A;  3H5X A;  1RTI B;  2UUB J;  2MHN A;  1EET B;  4F25 A;  4CLK A;  1HD0 A;  3NGS A;  1JLE B;  3A8K A;  1CJT A;  4ED1 A;  3M8Q B;  2EVZ A;  4GVB B;  5G0R A;  3N5B A;  4AFF A;  1PJ6 A;  1TZ0 A;  3E8O A;  3MM5 B;  3J81 Y;  2HFU A;  4KGK A;  4X4S A;  3R1L A;  4WPA A;  3OTO J;  1KOH A;  3BYR A;  1VQS A;  4ECX A;  4LSN B;  4DPO A;  1SCJ B;  1X8D A;  4CCH A;  4TU7 A;  2OEL A;  2FLO A;  1N4L A;  1I94 F;  5HQ8 A;  3ZZ0 A;  3TUP A;  4F3M A;  5C25 B;  3H42 A;  4ZPD A;  5HAT A;  4ECR A;  1AFI A;  2RNE A;  5L1L A;  5JVH Q;  2H51 B;  4I69 A;  5KFW A;  1R0A B;  3PXG a;  3FBE A;  2BX6 A;  2JC0 A;  3BQ1 A;  3PM9 A;  3LWL A;  4J9R A;  3NWG A;  3DLH A;  4NI2 A;  2H9Z A;  1S6O A;  1JK9 B;  2Y0B B;  2I9S A;  1U1N A;  3EM1 A;  4C8N A;  4O4R A;  3TRG A;  1XJW B;  1HIY A;  1B4S A;  3JQJ A;  4B3R F;  1M5K C;  3UDC A;  3UNY A;  2CDQ A;  3ENV A;  2DH8 A;  4QQB A;  1M5V C;  1BLU A;  2UU9 J;  5EWE A;  1GMU A;  3G82 A;  1U0H B;  1AFJ A;  1RAE B;  2F8M A;  1UFK A;  1Q53 A;  4OYO A;  3J7A N;  4WFB Q;  1S6Q A;  3CWJ A;  3DOL A;  2XSJ A;  3CDB A;  1S1W A;  3UPF A;  2PMZ D;  3KK1 A;  3U27 A;  1P1T A;  3RYL A;  1R6V A;  4ZVT B;  1CC8 A;  2BE9 B;  4FXW A;  4F04 B;  2K1R B;  4PRF A;  1NBE B;  2CG8 A;  2FIU A;  4KKO A;  1XMO F;  4I6A A;  4MKB A;  5CD4 A;  2IYI A;  1QTM A;  3TNV A;  4NYP A;  1E6V B;  4EZ9 A;  1FD2 A;  3MMA A;  3Q8Q B;  3EWG A;  3BO3 A;  5G4D A;  4F4K A;  3I55 S;  1FXL A;  4G3I A;  4DCP B;  4K2X A;  2ZHB A;  1YWX A;  5AT1 B;  1F6T A;  1YJ7 A;  5LMU J;  1YJW S;  2ZIT A;  3KUE A;  2F9D A;  5A6W A;  4C8Y A;  3C14 A;  4OJ3 A;  5HLF B;  1LWE B;  2G2O A;  1O51 A;  3N0V A;  2UVU A;  2FJV A;  2RE1 A;  3QGH A;  1FKP B;  1X60 A;  2NRE A;  4R8U B;  4EBD A;  3GCW P;  9RUB A;  1DBD A;  3Q2T C;  3MAA A;  2B9X A;  4MJK A;  1T9U A;  4WP3 A;  2VB6 A;  1S1U B;  3CCS S;  1RAB B;  1XMQ J;  4IG0 A;  3TAQ A;  4ED6 A;  2AYM A;  4NCG B;  5KT7 A;  3NS5 A;  2CQ2 A;  2IY5 B;  1IR0 A;  4QIE A;  1TKX A;  1EKS A;  1VYA A;  1PIE A;  1K8A T;  1NM2 A;  5I3P A;  3RRG A;  1T03 B;  1VMB A;  1H3D A;  1EQM A;  2ZZM A;  1UFL A;  3AOA A;  3FEX B;  1BQM A;  1R3N A;  1JLA A;  1IM4 A;  1KON A;  3PYF A;  1N36 J;  3DM2 A;  1NKB A;  1WI6 A;  2FGC A;  4TQS A;  2G1H A;  3TA0 A;  5KT4 A;  5BXI A;  1HWK A;  4PCQ A;  3N5F A;  2GAH C;  5EDW A;  3LTO A;  2CNK B;  4I2Q A;  5E3R A;  5IM0 B;  4CNY A;  3HVR A;  4TXS A;  4JI3 J;  1AZS B;  4AL6 A;  2J6U A;  2QA2 A;  1HBN A;  4PG7 A;  3NRB A;  2C1E B;  1XTZ A;  4DR4 J;  2YX4 A;  2F4V J;  1RAC B;  2MTL A;  2XZD B;  1RWM B;  3NNC A;  4ZVQ B;  4FF1 A;  3TVZ A;  1KQG B;  1V9O A;  5J1N A;  2VFR A;  1HWU A;  2P6T A;  5KFF A;  1T9Y A;  3FRY A;  4MT1 A;  1KP6 A;  1HA1 A;  2DY9 A;  3DOK B;  3MMC A;  1FRI A;  1S10 A;  1H6K X;  1I6J A;  3VAH A;  1YZ7 A;  4P2S A;  1H38 A;  3PW4 A;  4XDC A;  3B4M A;  4G1Q B;  3M1V A;  2EFV A;  2JRS A;  2AJQ A;  3PJW A;  2Q1L A;  4DSJ A;  4PG4 A;  1OSD A;  2BXJ A;  2VBZ A;  4BC9 A;  4OLO A;  1CS4 B;  1HBO B;  1SJR A;  1U09 A;  3PKM A;  4DQR A;  1S6P B;  3RAQ A;  2BQ3 A;  4K0K J;  5J2P B;  3M6V A;  2AEM A;  2HGN A;  3TVK A;  4B3T F;  2CJ9 A;  1NUE A;  2D69 A;  2G13 A;  1XC9 A;  2AF6 A;  4ZJQ A;  3AB4 B;  3RUB L;  1QUP A;  4Z7Y A;  3PFO A;  2AX0 A;  3NEK A;  4PKD B;  4WIQ A;  1RK8 A;  2NXN A;  3SIP B;  4OI1 A;  1Y00 A;  4NML A;  3JQK A;  1ZM9 A;  3DLK B;  3HCX A;  1APS A;  1REV A;  1S12 A;  4OL8 A;  4RW8 A;  3MCN A;  3HXM A;  4BCA A;  1TUW A;  1WHV A;  5DZ6 A;  1YDL A;  2EG1 A;  2CAJ A;  1OS5 A;  2KJV A;  3M8R A;  1AYE A;  3Q2S C;  3MUR P;  4NAS A;  1YJN S;  2HK3 A;  4ECT A;  2LEB A;  3GR1 A;  3EVW A;  3G96 A;  1TP7 A;  4NYO A;  4ZVH A;  4RW6 A;  2M8D B;  5KFV A;  3MM8 B;  1W25 A;  3OR1 B;  2G4B A;  5CYJ A;  3KLF A;  3MM7 B;  3JSR A;  5HAO A;  3IAM 9;  2G0I A;  4FPR A;  3M32 A;  1ZBT A;  2C3Y A;  1RJJ A;  4OFZ A;  2NXJ A;  2ADC A;  1KQF B;  5IT4 A;  3ZZT A;  2YWG A;  1LEO A;  4MYU A;  2B9W A;  2MDA A;  5AE3 A;  5AXM A;  1TL1 B;  5IT0 A;  2ZUG A;  4QU7 A;  3MPD A;  2NSB A;  4ANC A;  2XGP A;  1QD1 A;  4X62 F;  4LRF A;  1JB0 C;  3CPW R;  4LRA A;  3BSC A;  2HHX A;  4CH1 A;  2QLX A;  3HPO A;  1SV5 B;  2NXE A;  5CCL A;  2VD3 A;  2R7V A;  2AJ0 A;  1QUV A;  3QLH A;  1QE1 A;  3M6W A;  4RWX A;  4IFY B;  5GME A;  3QFW A;  3LUY A;  2CQB A;  1CC7 A;  1WNE A;  4JI5 F;  4RW4 A;  2Z30 B;  4B3O A;  5HJY A;  2CQ4 A;  2CPD A;  4DL3 A;  1AUD A;  1VJQ A;  4N8N A;  4BDP A;  1TKT B;  4HT5 A;  4IKA A;  2J5A A;  1A7G E;  5DG9 A;  2I2Y A;  2OO4 A;  1S1X B;  1S77 D;  4KE5 A;  3JSB A;  1KLM A;  2FJD B;  2AU0 A;  4NI2 B;  1KLN A;  3T19 A;  4ZLN A;  2CPF A;  4LSZ B;  3PRD A;  2JHE A;  4V19 J;  2W4P A;  2CQD A;  5ETT A;  3SDE A;  4AUK A;  2WON B;  2GCF A;  3DLE A;  4A4J A;  4NYZ A;  3KJN B;  2QMX A;  4HYK A;  1YIJ S;  4ID5 B;  5B08 A;  4OHV A;  4ZPV R;  2RIJ A;  5E5N A;  3DOL B;  1FXD A;  1QVG R;  3KK1 B;  1OQ6 A;  5GAD I;  3KLG B;  3B54 A;  3M8P B;  3HP6 A;  3KK3 A;  1FWL A;  4DUY J;  2IJN A;  2W25 A;  3VVU A;  4DFK A;  4E0D A;  3ZO7 A;  2ZNY A;  2XZW A;  2DGX A;  1PKU A;  4RBT A;  4J9M A;  1FFS B;  4UQT A;  4YY3 J;  1GX6 A;  3L9Z A;  2YNG A;  1X5P A;  2Y9H A;  3WIV A;  5D15 A;  2PFD A;  1M0S A;  1LQ9 A;  3O44 A;  2XLK A;  3CCM S;  1F3F A;  4ZIV A;  3TAM A;  4WP9 A;  4NRU A;  4RW9 A;  3TWZ A;  5GAE I;  5KT6 A;  5IWA F;  1TL7 A;  5AXL A;  3UCU P;  4WZQ A;  3QZ8 A;  2GV1 A;  3EVM A;  4TNO A;  1H98 A;  4HL9 A;  3HHD A;  4B3R J;  2W2P P;  3C14 B;  1JNZ B;  4O0I A;  5M2P A;  4Y6I A;  3UDV A;  4C0O C;  2V0N A;  3LWM A;  1B7F A;  3M6U A;  4J9V A;  1HI8 A;  3NWR A;  4JI1 F;  4J5O A;  1C4A A;  3MXH P;  2ZE2 A;  4RBV A;  3D4J A;  3MAA B;  5IC4 B;  1MN9 A;  1HLW A;  4QWD A;  1FTR A;  3MR5 A;  3W9I A;  2C2O B;  4QPT A;  3DLG A;  1O8B A;  4J90 A;  3PJX A;  4GRS A;  1U7L A;  2C2E A;  4IG0 B;  1S1T A;  2WVE A;  3OTE A;  1XMO J;  1TKX B;  4DR1 F;  2HS0 A;  1S59 A;  2KTQ A;  1FF2 A;  1UEU A;  2FZK B;  1F2G A;  3OD2 A;  3BV8 A;  1VDH A;  3DRR A;  1JLA B;  3DYA B;  4OX6 A;  3BJY A;  1EIY B;  1Y9O A;  3HK2 A;  4ERD A;  3OXG A;  3KDO A;  1Q82 T;  3TUZ C;  3IBF B;  2YBV A;  1X4G A;  3T6J A;  1YX2 A;  2CZV C;  2E1R A;  2WSC C;  4ZVU B;  3M6X A;  1X4B A;  3LW5 C;  3D1Q A;  2XLJ A;  2C3M A;  2L48 A;  2ZBC A;  2YKO A;  1X0P A;  2VJV A;  4OHZ A;  2M70 A;  2PT0 A;  4XAK A;  2VG5 A;  3GZ7 A;  3M9O B;  2AX1 A;  3MOZ A;  1G1X A;  3HD2 A;  2B51 A;  4I4B A;  3TX8 A;  1SC3 B;  4ED5 A;  3MAH A;  1HBN B;  2B6A A;  1LK7 A;  2RH3 A;  4CLT A;  3ENA A;  3VAG A;  4ED3 A;  2B7B B;  1N5T A;  4GC7 A;  4EFA C;  1D1U A;  2OML A;  2J6T A;  2VOO A;  2BEF A;  1ZAW A;  1VOM A;  2PEB A;  5I42 B;  5C24 A;  1WG4 A;  2ZM6 J;  2G1D A;  2DR5 A;  1X4D A;  5KT3 A;  1R27 B;  1F9F A;  4DV0 F;  1N33 F;  1NKE A;  3QGG A;  3EZ5 A;  2LEC A;  2HFS A;  2IJR A;  3OJS A;  5KG5 A;  2R9L A;  4JV2 A;  2RDI A;  3SFG A;  4L76 A;  1NEE A;  4MKY A;  1V3R A;  4FS2 A;  1B7Y B;  4BHQ A;  1O6X A;  4NLG A;  2VAS A;  5LSO A;  5HN0 A;  5KG7 A;  1X31 C;  1HNW F;  4TN2 A;  2CFX A;  2J8S A;  4BC7 A;  4ZCM A;  2XNQ A;  2Q3P A;  2QLF B;  4U8Y A;  1AB8 A;  1RYR A;  4Q2L A;  3MTJ A;  1YLX A;  3P49 B;  3NMA A;  3KJF B;  1MU2 A;  1S48 A;  4ZMM A;  4USK A;  3RAX A;  1DZ5 A;  4I0W A;  2DGT A;  3QIP B;  3KHL A;  1ZPW X;  3A8I A;  5DGA A;  2KXH A;  1Y5I B;  4QOT A;  5FII A;  3MPY A;  4LFC J;  3P4U B;  2L9D A;  2QG9 B;  1I1G A;  2VH7 A;  2ZH5 A;  4J91 A;  3HUL A;  1EB0 A;  1QDU B;  3GIR A;  1VIO A;  4KPC A;  2PSZ A;  1XWL A;  1LW2 A;  5B0D A;  2HHV A;  2ACM A;  3QID A;  3MD3 A;  3MMB A;  3W5Y A;  1JLB A;  2NZC A;  2MJU A;  4EGL A;  4HH0 A;  4OHW A;  5A8W A;  4ZPB A;  2J0Q D;  1U47 A;  3UCG A;  4QJV A;  4ZPA A;  1R8A A;  2O01 C;  2RVJ A;  2C2M B;  1IR1 A;  3BZQ A;  1YBT A;  3DRY A;  3TZY A;  1ZTW A;  4B3T J;  3KLF B;  3Q8S B;  5KG3 A;  2P2C B;  4O4G B;  3DI6 B;  2XGQ A;  3HKW A;  3UD5 A;  3NCR A;  3FSX A;  2VON A;  3ZXW A;  2AJF E;  3PVX A;  4U9R A;  1FK9 B;  3ZTR A;  1LOU A;  1QAY A;  2V4Q A;  3MHY A;  2QSF A;  1EHW A;  2R7U A;  1DHM A;  2PMH A;  1RAO A;  2BRK A;  2N4C A;  4DG1 A;  3H7H B;  4ZJO A;  1KQS R;  3ZZR A;  1KFD A;  4HT7 A;  1ZYQ A;  3CD0 A;  1HW9 A;  3GSI A;  1LFW A;  2JNJ A;  4OV1 A;  5KFL A;  4DPY A;  3A3O B;  1SJ3 P;  2ATC B;  4HKQ A;  3HFV A;  3CCV S;  1OPZ A;  2VF3 A;  3QLH B;  1MSW D;  4M5J A;  4DCJ B;  3VWS A;  4U8V A;  1FJ7 A;  4KGV B;  2H65 B;  2F5G A;  3QO9 A;  3MTK A;  3UN2 A;  4CO1 A;  2XWX A;  3M30 B;  3IXQ A;  4IYQ A;  3TO8 A;  3H59 A;  4Y28 C;  2LQB A;  2V9K A;  4KFB B;  2DBB A;  2QZ8 A;  4CDI A;  1SPB P;  1FKO B;  2KRB A;  2MKJ A;  1KLM B;  1EAY C;  3R2D J;  2HFV A;  3OVS A;  4WTY A;  2CVE A;  2J9C A;  4OX9 F;  4M5D B;  2D41 A;  3WBZ A;  5DO2 A;  4LIW A;  3LAL A;  4ANE A;  1SKW A;  4ED2 A;  2ZWP A;  3N6N A;  4Y2C A;  4X62 J;  2HFZ A;  2QFJ A;  4DOZ A;  2J76 E;  3GON A;  3OUY A;  3ITH A;  4F26 A;  5F9N A;  4X4N A;  3SDE B;  4UTG A;  3WHI A;  4QCL A;  1FRM A;  3W62 A;  2M52 A;  4TU9 A;  2FY1 A;  2E9Z A;  1KC8 T;  1I51 B;  5B09 A;  2VZ9 A;  1PAE X;  3OXL A;  2G2Z A;  5CXT A;  5ETP A;  2QO3 A;  3OTD A;  1YRX A;  2VDH A;  5KT5 A;  3FK4 A;  1RWV B;  2QLB B;  3M8S A;  5J2M B;  2KRR A;  4DR7 F;  3KK3 B;  2AP6 A;  1HWL A;  2E1M C;  4A47 A;  4LFB F;  2LFV A;  3SCI E;  2P5V A;  4JI5 J;  1CJK B;  4EO6 A;  2DNG A;  2M9K A;  5KFR A;  5E7O B;  3G87 A;  2ZH7 A;  2YNG B;  4HTJ A;  2JOQ A;  3A13 A;  3UN5 A;  2NYH A;  2R2S A;  2HAF A;  2ZDP A;  4RW9 B;  5HQM A;  6FDR A;  4FDF A;  1RHM B;  3HZG A;  5B0A A;  2HVH A;  1YKW A;  1WEZ A;  4HVZ A;  2ALZ A;  4EYI B;  1K1Q A;  3VGU A;  5J1E A;  3AD9 C;  4AQY J;  2HBZ B;  4YN3 B;  4DLE A;  1Z4U A;  2NXU A;  2ZE2 B;  2ROP A;  2HBY B;  4BLG A;  3MFI A;  5H9E J;  4P2M A;  4H4M A;  4CNZ A;  2HGL A;  1BMQ B;  5D78 A;  2VC0 A;  7FD1 A;  1AW0 A;  3SSQ A;  2K3K A;  2RQ4 A;  5ETM A;  3AD8 C;  2IM0 A;  4RNH A;  3SZ2 A;  2MZS A;  5T7L A;  4DUZ F;  1RT5 A;  2I5J B;  3DNC A;  1NXI A;  2CNL B;  2R2U A;  3RW7 A;  1YJV A;  4ES3 A;  4ETZ A;  1OY6 A;  4DBQ A;  4A8Q A;  4Y2I A;  2BM0 A;  3PYE A;  1N8R T;  2QA4 G;  4IH7 A;  3WIU A;  4ECZ A;  1K0T A;  3S8S A;  1PCA A;  2IVM A;  2ACY A;  1M1G A;  3NGR A;  5K8M A;  2HZV A;  1DLO A;  2APO A;  4EUV A;  4DCO B;  3CJ8 A;  4WII A;  4NA3 A;  3MMJ A;  3DN9 A;  1Q81 T;  1DAR A;  3TQE A;  3CXC R;  2OLW A;  1UVI A;  1WTF A;  2HNZ A;  2OD4 A;  2XMV A;  2HND A;  2UUW A;  1L3U A;  2AEF A;  3AH6 A;  1XN9 A;  2RAQ A;  2IMW P;  3H2U B;  5K8P A;  3E01 A;  4Q8F A;  1FRK A;  4CM0 A;  4OYI A;  3UVJ A;  1H74 A;  2B8P A;  1N34 J;  2B6A B;  4Y2K A;  4F0H A;  2B5J B;  3BDP A;  3ILJ A;  4UW2 A;  1FVQ A;  2FJX A;  2VQE F;  2RHQ B;  2H4W B;  1T94 A;  2FHK A;  3TJA A;  4DR1 J;  3PV8 A;  4ZVP B;  2P8I A;  3PX4 A;  3VAK A;  2BDP A;  4LMZ A;  3F0N A;  5IT9 Y;  1S4E A;  3K5N A;  3SSS A;  1YBA A;  3D67 A;  1SJ1 A;  3L7U A;  3HJV A;  2FD2 A;  2HHT A;  4CO3 A;  1OY8 A;  1E6Y B;  2DHA A;  4JI7 F;  1FER A;  3Q23 A;  2HWI A;  3IRW P;  2PII A;  2HMI B;  4IQX A;  2LQ5 A;  2UVV A;  4ECQ A;  1HI1 A;  3KMQ A;  4WYW A;  1LW0 A;  4DZD A;  1VIS A;  3MPV A;  1L3K A;  2XS7 A;  3THV A;  1Y3J A;  2A0F B;  1T3O A;  5EX0 A;  3CTR A;  4OZ1 A;  4ZA1 A;  4O3S A;  3HM9 A;  5MAO A;  4IOC Q;  1NK6 A;  1ZM3 A;  2HG4 A;  2LKZ A;  4ID8 A;  4A8X A;  2UP1 A;  2CIM A;  3FQK A;  4K4Y A;  3Q8U A;  3I96 A;  2MJN A;  4CM2 A;  3MPU B;  5F8N A;  1T9T A;  4NLQ A;  1N33 J;  3QJL A;  2JEJ A;  5IT9 U;  3V6J A;  1T02 A;  4J9N A;  1PC5 A;  2BW2 A;  1LW2 B;  4PWU A;  5D0E A;  4DXL A;  4MIA A;  4EWT A;  4A8M P;  5JJB A;  5DZ7 A;  3OPK A;  3QYY A;  3OR2 A;  4JI6 F;  3QRQ A;  1HNW J;  5CYQ A;  5GMD A;  1H2T Z;  5A8W B;  1NK8 A;  3KNG A;  4P7V A;  3E2E A;  2IRX A;  1S0V A;  4DV6 J;  3H4B A;  3NAI A;  2UXB F;  4NL5 A;  5K8O A;  1U6F A;  2WK4 A;  3IO1 A;  5E3A A;  4DDF A;  4XO0 A;  2XMT A;  3CB4 A;  3M4X A;  2GW8 A;  2YWW A;  4MIB A;  1YIT S;  2CQ3 A;  3KLH A;  4TKT A;  4ZVF A;  4Y3C A;  2HRU A;  2XCP A;  1TAU A;  4E2F B;  3AT1 B;  3N79 A;  2R7X A;  2AQ4 A;  3WC2 A;  3GIK A;  5HMY A;  4DPU A;  3AQO A;  3D9B A;  3MCO A;  4DG1 B;  1F1B B;  5IZH A;  3ISN D;  2RS8 A;  2QTW A;  2YNH A;  2KHC A;  2FPH X;  3BN7 A;  3EPG A;  4Q43 A;  1UW9 A;  1N0U A;  3MZI A;  5LXY A;  3TZX A;  3LP1 A;  3HVA A;  1FES A;  5HVH A;  4YR2 A;  3KUG A;  2FYX A;  3WQP A;  2B4V A;  4KGX B;  3LGN A;  2IM1 A;  1ZS6 A;  1VQO S;  4AE5 A;  1WOS A;  5L46 A;  1N52 B;  1YVF A;  1J27 A;  3PO4 A;  3DDK A;  3QGP A;  4J37 A;  1R8B A;  2R3V A;  4K4U A;  1U6Z A;  2BOA A;  5HI7 A;  3K89 A;  5LL6 d;  3G8S A;  2WOM A;  3V6H A;  3SV3 A;  3X1L B;  3IWL A;  5JUM A;  1V5V A;  1RXO B;  2QEX S;  2AJ2 A;  2V8G A;  5HK4 A;  3OL7 A;  4J9P A;  4DQQ A;  2HVZ A;  2Z58 B;  1PIL A;  1QAJ A;  2CJQ A;  3V6K A;  1B0T A;  1RA6 A;  3FFI A;  3HHL C;  3NS7 B;  2XMJ A;  4B02 A;  3K5P A;  1RT6 A;  3OUY B;  2FHM A;  3ITH B;  1WC3 A;  4JI2 F;  2L08 A;  1T9V A;  1EX8 A;  2YKP A;  1N54 B;  4ZVG A;  2IRY A;  4JI4 J;  3R7B B;  2GFF A;  4C3K A;  3CCQ S;  4USH A;  1T7P A;  2XI2 A;  1IKW A;  3Q83 A;  4IRK A;  2DHS A;  3TYT A;  2F40 A;  1VLO A;  2J9E A;  4DQI A;  4YEA A;  3QJP A;  1N5Y B;  2DIU A;  1GTE A;  2VBW A;  3VAJ A;  3CJ4 A;  2YX7 A;  4WK1 A;  1TEL A;  4QIW D;  3OVB A;  2KYZ A;  2ZH6 A;  2GJF A;  1P9Y A;  4HDG A;  4HHH A;  4EK2 A;  2YH1 A;  3JSY A;  1ZET A;  5B0C A;  3GJS B;  1WG1 A;  4O3P A;  4OX9 J;  2AGP A;  1IKY B;  1Y3K A;  1DJ0 A;  2N4D A;  2XM3 A;  5CYM A;  4DQS A;  4F4A A;  3SYZ A;  4ZN1 A;  1IKX A;  4C98 A;  4QWB A;  4KT0 C;  3T9Z A;  2GQ2 A;  4FXV A;  1U49 A;  1DRZ A;  2KI2 A;  2ZNZ A;  4KV8 A;  4B17 A;  4Y65 A;  3R6G B;  2GIF A;  3HX9 A;  2RHS B;  5KFS A;  5LMN F;  1NZA A;  1SKS A;  2KVQ E;  4YB6 A;  4PUO B;  4UUX A;  3ZFV A;  3NOG A;  4FNI A;  3CJT A;  3DDI A;  4MFB A;  3HSD A;  4X64 J;  3NBP B;  1S5Z A;  1HBM B;  5HSP A;  3IS9 A;  3HHL A;  2ZH1 A;  1S9G A;  5T7L B;  2W4C A;  1MRO B;  1RT5 B;  3BSO A;  4LQ3 A;  2XEX A;  4YP3 A;  2ALY B;  3DOM A;  2FJE B;  3C16 A;  4GKJ F;  2CAD A;  2FJA B;  4K4T A;  3UN3 A;  4MTP A;  3L09 A;  1VC6 A;  4NLR A;  2M0G B;  3BKF A;  4CLL A;  4L75 A;  5DJB A;  3K2Y A;  2C22 A;  4P73 A;  2DNL A;  4LRC A;  4LF7 J;  3D0H E;  3MF5 A;  3CGI A;  4M5L A;  1FDD A;  4U96 A;  5GAH I;  5GAH U;  4DV3 F;  3LP2 A;  4W90 B;  2MZ1 A;  1WC0 A;  2GQC A;  3M2U A;  1AA1 B;  4MK9 A;  3CNQ P;  3E01 B;  3CCU S;  1VRU A;  2YWF A;  4OZL A;  3UVJ B;  1N6Q A;  2OI2 A;  4UZC A;  3OL9 A;  2LQ8 A;  2MY7 A;  1HMV B;  2IVY A;  3T1H F;  5KFA A;  1YGY A;  4UY8 5;  2QL9 B;  2C3O A;  2HHH F;  4DUZ J;  3P96 A;  1JKH B;  4PAB A;  2BJ7 A;  2HQI A;  3W2V A;  4TLR A;  4C48 A;  1F3V A;  3BKU A;  1WDD A;  1HNI B;  1VQ8 S;  2XCA A;  5JVG Q;  3KG1 A;  1UW4 A;  4ITS A;  2IIH A;  3G6E S;  5J2N A;  5EX3 A;  3AOD A;  3BR9 A;  2Q66 A;  3F56 A;  2KT5 A;  2BKN A;  2FDN A;  2RIL A;  4B3S J;  1U25 A;  4N47 A;  2DNY A;  4XPE A;  2RS2 A; 
#chains in the Genus database with same CATH homology
 2IDE A;  4PYA A;  2IIH A;  3JQK A;  2OHD A;  4PYD A;  3JQJ A;  2EEY A;  2EKN A;  3JQM A;  4FDF A;  1EKS A;  1EKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...