1EKSA

Asp128ala variant of moac protein from e. coli
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
140
Chain Sequence
MVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYAMCKAVQKDMVIGPVRLLAKSKSGDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
total genus 32
structure length 140
sequence length 142
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 1eksA00
4FDFA 2IIHA 3JQJA 3JQMA 2EKNA 2OHDA 4PYDA 2EEYA 4PYAA 3JQKA 1EKSA 2IDEA 1EKRA
chains in the Genus database with same CATH superfamily
2CPEA 5I42A 1AT1B 1Q53A 4DSLA 3T5HA 2FHMA 1HQUA 1S0NA 3NRBA 3G6ES 1GK8A 2GW8A 1FJCA 4I4BA 2CQ3A 2HS3A 4DJBA 1PAEX 1I6JA 2YX7A 1HKAA 2FQQB 1RADB 5KFNA 2WVBA 3VZHA 4CLWA 2DHAA 3OHAA 2B4VA 3BREA 5C7PA 3DLKA 5ETQA 3N6NA 3ZZUA 4USMA 3HHKA 1U6ZA 4N47A 2C2ZB 3R1HA 2XZTB 5D3GB 2RB7A 1ZM9A 1HLWA 4O23A 3SZ2A 2MSSA 3TQ1A 1R6YA 1WSVA 1ZAXA 2DCUB 2RMLA 3DYAB 3SMZA 5D6GA 4GKKF 1FJGF 1NJZA 3DI6B 3DDNA 2EI5A 2HLTA 3TZWA 4ICLA 1HNZJ 3PKYA 1NH8A 2LDYA 4F0MA 2VIHA 1Y11A 1EB0A 1YJUA 3LPYA 3U1MA 5F8IA 2FHKA 1NK5A 1TUVA 4DL4A 1LFWA 2FTRA 2YVSA 1WJ9A 4E8UA 5D4NA 4FF2A 1X7VA 3L7OA 3OTEA 4M5NA 1ZH5A 3NNAA 3ETMA 1MMLA 4FYWB 1RAJA 1VC5A 2BYCA 1KKHA 4CLZA 4Y2MA 4ZIWA 4ED8A 2XMUA 3C2PA 5HBMB 5ETVA 1T03A 1D3WA 2VBWA 3LANA 3TP2A 4DZ6A 1KLNA 1B64A 3GSIA 4DL2A 1S1UA 1IKWB 4GRSA 3HF5A 2KYZA 2VPWB 1Y5NB 2APOA 2DNYA 3NEKA 1VMBA 1PAUB 1Q0NA 1S7HA 1EQ0A 4ICLB 2NZCA 2H4WB 2YX4A 4L6V3 4TU9A 2PMWA 2H1YA 4QIWD 2ZZNA 1S6PA 4R25A 4XAKA 1HWLA 4AL6A 3V6HA 1CC8A 2FLPA 4RBUA 5LJ5Y 3CJSA 4WYLA 5FDLA 5EGYA 4CLUA 3KMQA 1YWXA 2OP5A 5D15A 4RW9A 4LF5F 5F8JA 2ILYA 5H9EK 1QE1A 3DLJA 1Z4UA 1RAAB 3G87A 3DRSB 2LEBA 2VPXB 2J7KA 3BF4A 4LFAF 3M6XA 3HFKA 2MB0B 2MZTA 3MURP 2UU9J 4QWAA 2BXJA 2WBRA 1FFGB 5E5NA 1B7FA 3AT1B 3OVAA 2IDEA 3WBZA 2EFNA 2K1RA 4B02A 5HROA 4QWBA 2CPDA 3NBPA 1U49A 1M0SA 4DR1F 2BW7A 3TAMB 1T95A 1E6YB 5DDRC 1IR0A 3UCGA 3Q2SC 1FEEA 5LMUJ 1WHWA 3GG0A 4QZVB 3PW2A 1DJ0A 2QV6A 3NAHA 5ETOA 3KKFA 4NLSA 4OZLA 1QUVA 2XMAA 4X4UA 3UD4P 4PWDA 4P7TA 2XY6A 2OO4A 3B4MA 4NPOA 5DS7A 5HP1B 3KK1B 3SDEB 1JQGA 2NCKL 2J0WA 4LREA 4LFBF 2BRKA 5E7OB 2OI2A 2MDAA 3EPGA 2ZH4A 1TL7B 1T9VA 4RW7B 5L1LA 2MKJA 4OX9F 2RDJA 1VQPS 4QQBA 4I2QB 1SVDA 4TY9A 2HZVA 3GB0A 4UOCA 2XLKA 5IT4A 2IJRA 2BOAA 2YNFB 2Y1LB 1NO8A 1TFWA 2KM8C 1VJQA 3O5TB 5HK4A 2C2OB 1HIYA 3M8YA 2FVSA 3VVUA 3FQLA 1YITS 5DETA 3IR6B 4PWWA 3IWLA 1TL4A 2F5GA 3EMTA 5AXKA 4DPXA 1S97A 3FK4A 4NLPA 1LWCB 4OV1A 5BYRA 4IOAQ 2HHSA 1N88A 2BANB 5F3ZA 3QRQA 1FK9B 3D1HA 4Q7AA 1RWUA 2CPJA 5F3TA 2ZH7A 3VAHA 1WC6A 1JX4A 2FLLA 4WIQA 2HVHA 3RRKA 3FUYA 5DG8A 4DCOB 2RRNA 1JK9B 3BBCA 4OFZA 4B9TA 4HLBA 1SKRA 1J5EF 3RBZA 1IQTA 4R8UB 1AYEA 1QAYA 4DFKA 3RU0A 2WONA 5KG5A 2XM3A 2J9DA 4JOUA 1FDDA 1Z2LA 2W2OP 2UUAJ 5KFEA 1F2HA 2MLZA 4GMKA 4Q0BA 4PG4A 1RT4A 2KL8A 2FVQA 5CXTA 2DPJA 4DUZF 1WI8A 4FDFA 4JP8A 2IVMA 5F8HA 1DQAA 5J2QB 2GGPA 1UWAA 3AAWB 1S76D 2NS1B 5HMXA 3S7RA 4CNYA 1C0UA 2VV5A 2R7QA 4ILRA 3T41A 2WW8A 2BANA 3R5BA 5E0OA 4Z2XA 4IG3A 5HMWA 5L9NA 1ZETA 1RWKB 2Q43A 4UQGA 1U0HA 5EWFA 4ZLPA 1H98A 1NJWA 2DGSA 5BYSA 1HI8A 4OHXA 1XNQF 2OFGX 4LR9A 2O5DA 3T19A 4C8KA 2BJ1A 2NLWA 2V8GA 3KUHA 3JSBA 2J0SD 1EETA 1ZBTA 1N34J 1VQYA 1KQGB 3OXGA 4I0WA 4OJ3A 2OD6A 2EW9A 2XMJA 3FQKA 1RGVA 3LGMA 4MTPA 4LIWA 1AFIA 4OHVA 5KFTA 3UDVA 2CG8A 2DNQA 3EE3A 2K2PA 1YKWA 3CMAS 2Z0GA 2IJFA 3T5LA 3JYTB 1PYSB 4PXBA 4JYAF 5CZXA 3QLHA 4OZ5A 2V6AA 4DR7F 4W90B 4LF6J 3OVBA 1LOUA 3MMAB 5IOLA 3T3FA 3R9LA 2KRBA 3E01B 2EFOA 2E9RX 2EFPA 1SV5A 5LJ3Y 3EGNA 1YJVA 4JI1F 2DXFA 2G0IA 1CBKA 2CPIA 4HACA 4PR6A 1WG5A 1OPIA 4YMEA 2P2CB 1HR0J 2BRLA 4MIAA 3A4TA 2V2VA 1Q81T 2DR7A 1URNA 2R3VA 2AGPA 2LKZA 1ZTWA 4KIAA 4LBHA 2OH2A 2K8GA 3R1LA 4JI7J 4URGA 3HVTA 5MAOA 3LPEA 5GADU 1CLFA 4C9DA 1FWKA 2NYIA 2P6TA 1RT1A 3C66A 3M6VA 4ED7A 4CLPA 2LP4A 1VHFA 2E7WA 3KLIB 3MPVA 3US5A 5DG9A 4O44B 1RCOB 2UUAF 1J2VA 5IWAF 2FJEB 1XERA 2AZ1A 3DHXA 4DR2F 2UUTA 3BN4A 3DLGA 4YB7A 2J9EA 3L4BC 5F9LA 1J5EJ 1UW4A 3KNAA 1Q1KA 2OTJS 1KC8T 1TTHB 4DX5A 1HNIA 2DGVA 5L1IA 1MW7A 1WEYA 4O3RA 1SBRA 4A8XA 2HS0A 3LGNA 4G65A 3CO0P 4EZ6A 2JEIA 3QAUA 2AHOB 3TARA 2KVIA 1FD8A 5F41A 4CH1A 2MTLA 3H5YA 1HBMB 2JC1A 1V3ZA 3P96A 3T9NA 1YI2S 3NS6A 3BJYA 4ZVTB 1N54B 3CEDA 1VBXA 2DGUA 5G0RA 1X4CA 2QA1A 2AIRB 1XEZA 1BQXA 2EKYA 3KUEA 1RWXB 1FE4A 2ACMA 3IXQA 5HSPA 5FLXU 2IIHA 5KAKA 2PFDA 4P73A 5CH7B 2E66A 1WNEA 3K17A 2MJUA 4UTGA 2ZJRQ 2ASLA 4OI4A 2E7VA 2Z2YB 4JI2F 4ES3A 5DQGA 1NDKA 2V8PA 2YPYA 2ZITA 3MMBB 1FK9A 4QWDA 4RU9A 1M5KC 2W2MP 3VHQA 3OJSA 1V3RA 4FXWA 2CQIA 2FB0A 2JDJA 4JB8B 1HMVB 2CVIA 3OR2B 2Y3YA 1T8EA 5E33A 3ZZTA 2W8LA 4C7QA 5ETSA 2CQCA 4DV5F 4YR0A 3ISZA 4ID5A 1HD0A 1QAXA 2WVCA 2L3MA 3PFOA 4DSKA 3MEEB 2GAGC 2HRTA 5B0FA 4Q5VA 3UW1A 1YIJS 2R7UA 5B0CA 1KRPA 1JWWA 1HBOA 2YWFA 2LQ8A 1U1MA 2ZC4A 5H1SV 2OEJA 3S1TA 5L1JA 3BDPA 2KXNB 2Q3PA 1JJ4A 2UUCF 2W7AA 1LWFA 3HSGA 3JSRA 1UZDA 3BH6B 4HHJA 1BXNA 4RW6B 4C6AA 4FYYB 3D4JA 4A8SA 1BWEA 3DRPA 1N5YA 4F67A 2PEHA 2IM3A 2W4PA 3CPWR 5H9EJ 1JJ2R 4FVCA 2LQJA 3GV5B 1X4FA 2Y1IA 1Q8IA 2RQKA 3MM7A 4WXWA 5T14A 4NYPA 3SI8A 2HS4A 4NYZA 2XG8A 4F2RA 2YPZA 2BJ3A 3H40A 3FBCA 4DFJA 1VISA 4DDFA 1NMEB 4KGMA 5JMNA 3CE8A 4IFVA 2UXCF 2AZ3A 3VR1A 2R7XA 4ZVRB 2VQEJ 2GHVC 1U45A 2KFNA 3HZEA 4RU2A 4NLDA 2R2SA 4KQZA 3N6LA 3PACA 2DNNA 1QVGR 4PZVA 1JLFB 1JLQB 1S7IA 2V2ZA 3FBEA 1WHXA 2FY8A 2IBOA 1R27B 1JLGB 3D6HB 3FJ2A 5DLGA 4X65J 4X65F 3VAKA 5HMYA 2N7YA 2Y8YA 1HPZB 5J2NA 4DL5A 2POKA 2D3UA 3MPDA 3MM7B 1DAXA 3D28A 4M5LA 1R8PA 3U7JA 4F4AA 4ER8A 1N32J 5HL7Q 3OVSA 2XZWA 1K1QA 4H4MA 1GMWA 4WXOA 2X3DA 4HDHA 5HMZA 1YBTA 4EEYA 4MYUA 1NAQA 4BWMA 5DJBA 4F3QA 2IJNA 4WK3A 4LQ3A 1ELOA 4FBUA 1SJFA 1SJ3P 3BSAA 4IR1A 2RRAA 2IDLA 1TL5A 1S9GA 2W2NP 1N8RT 3DOMB 4WP9A 4F04B 1S6PB 1LXNA 2KJWA 3LA0A 1T02A 2V0NA 1UP1A 2WSFC 3OL9A 3M8RA 4WPAA 1WC0A 5IC4B 3FMBA 4O4GB 3FEXB 3HHLA 3W66A 3TJ8A 4DR3F 3RB6A 1FD2A 2LA6A 1RISA 3GWCA 3TVKA 4E0DA 4DL6A 4ZP8A 4C0BA 5KT4A 4IO9Q 2BOPA 1FKOB 3IFEA 4O4RA 4TY8A 1RAGB 2BEFA 2DNMA 2M4MA 3LAMA 1AZSB 2PD1A 3SBMA 3PRBA 3VAGA 2SXLA 5E3QA 2D3O1 7FD1A 5HQMA 1FDAA 2GJFA 1QSLA 4EK2A 2RT3A 4PPZA 3W2VA 2GS8A 2EG1A 1YJRA 5DG7A 1NCLA 5CAAA 5D4PA 3CCTA 3GZ7A 4CM0A 2DK2A 1RTIA 4Y2IA 2H5EA 5AT1B 5CA5A 2YXLA 5EDWA 3G96A 4DV1F 2JEGA 5GMDA 4JV5J 2E5LJ 2V63A 4G3IA 3S8SA 5F9NA 3Q24A 1XMOF 1UJ5A 2MZQA 3CJKB 1B3TA 3KHRA 4X2BA 4UUXA 1C4AA 5ETRA 4M5IA 2GQQA 2EC2A 2W2QP 3R97A 4NI2B 4TQSA 5KG4A 3CJRA 3VTIA 3ZTQA 1F5AA 1N5QA 3I87A 4K0KJ 2WZ1A 3H5SA 4QU6A 1NK0A 1P27B 4PUOA 3THPA 4WJBA 1VQ6S 3W9JA 4LF6F 3PJWA 2DIUA 1S5ZA 1W2IA 2K7JA 1Q7LB 1UEVA 1EJ7L 2VG5A 3HD2A 3PG9A 3NMAA 2HIQA 2XI2A 1QD1A 2NYHA 4Y34A 2FJDB 5IV4A 1IBLF 2G1DA 3W9IA 1XTZA 3CJQA 1RHUB 3AOAA 3LP1B 4C11B 1TKTB 4J9LA 5K20B 3MM5A 1RQ0A 4OYOA 4P72A 2W7PA 3JQKA 4CT9A 3B82A 3GTYX 5FDLB 3CCRS 2V4JA 4WP8A 3R5DA 4ECYA 1AW0A 3K89A 3Q8SB 2VQFF 1KTVA 1P1LA 2XGQA 5MLCV 4JI7F 1JLBB 4JV2A 1CEZA 3LTOA 2DEIA 3KG0A 4J5OA 3KNGA 5D0EA 1MU2B 2D1CA 5C42B 3PIOQ 3EZ5A 2B4PA 1WF1A 2YWHA 3SFGA 3MECB 1RAOA 4ED4A 1B0TA 1T03B 5K8OA 1QSSA 5KFZA 3MM9A 2E44A 1XMQJ 1HBNB 1TELA 2XTJP 4QIEA 1S9FA 1L3TA 3TA2A 3T5KA 3EDQB 4TNOA 3QJPA 5ADZA 2YY3A 4JI8F 2QZ8A 3I0SB 3ITHB 2MZRA 3J81j 4B3SF 1KEKA 3CWJA 3ZTRA 2M8DB 3NNHA 3RAMA 4JBCA 4Q0BB 2OPRA 3MFIA 5LXYA 3DXBA 3RGIA 1TQLA 3KJNB 2AQ4A 4ERDA 1LNQA 4TU7A 2UXBF 3R5CA 1SC4B 4Y65A 2JOQA 4TU8A 5J2QA 5KFAA 4QR2A 2DTJA 2IA0A 4CI0B 1SKUB 1C1CA 1CJVA 1RXOB 1EETB 2R7OA 3AA9A 1WKLA 3DMJA 1BD6A 3IBFB 4YB5A 1LFPA 3RG6A 2CJYB 1RHQB 4Y00A 3OT9A 1FFWB 4X4TA 3OFFA 2LU1A 2DO4A 3I55S 2WVFA 4ATNA 2CZ9A 2DD8S 5C2CA 3QPIA 4FYVB 2CIMA 3W65A 1S6QA 3C6TB 4Y0FA 1N5SA 3MDFA 4F8RA 3DYAA 1SXLA 3M4XA 4DN0A 1VQ4S 1KLMB 3KLHA 2PC6A 2C1EB 3GP9A 2JEJA 3CUNA 2FZCB 4RPFA 5IM0B 1WF0A 3FBBA 3BQ0A 3ZNJ1 1X4AA 3FSXA 3A8KA 2ZDPA 1FERA 4IKAA 3CIMA 3UO0A 2LXFA 2ZBQA 4O3SA 4J9SA 1N5YB 1S77D 4OI2A 2F4VF 3MPWA 2VH7A 3MCSA 1NEEA 1M1HA 2C3PA 1TL7A 4RW7A 4ZS6A 1SV5B 2E9ZA 1FEHA 4MH8A 1RTDB 4DR6J 3HVTB 1IKVA 2HWIA 3NGTA 4ZLLA 1IWAA 3CMQA 3T1HF 1RWWB 3EWGA 1IBMF 1IBMJ 1HHTP 1JXVA 2P9GA 1RU2A 4P2XA 2HFZA 1SIZA 4DG1A 1Q8KA 1P9YA 1R8CA 2HBRB 2XYGB 4I6YA 5HVFA 1VHIA 3ENVA 5I3UA 3E3XA 2M8HA 2EK1A 4NLGA 2EC0A 2Q66A 4DR2J 4ZCIA 2EKNA 3GJTB 4C0HA 2JHEA 2N3LA 3PY8A 5D0GA 4F0HA 3JXOA 4ZP7A 3Q86A 4NLRA 1PGZA 4WZQA 3O6QA 2DBBA 4N8NA 2XWXA 5KG1A 1RTDA 1M5SA 1W25A 2C3YA 4KHMA 4RW9B 1OQ6A 3FCHA 1YZ6A 2ADCA 3TW0A 4OYZA 1P8GA 3H2LA 3J7Z5 4DR5F 1B4SA 4ZPTR 1UWBB 3VAIA 3NMRA 2C2NA 1OY9A 4XDCA 2B6AB 7AT1B 2XMKA 4RBVA 5H9FK 4QR1A 1UKUA 2DNRA 3M1VA 4CP5A 1RJJA 2O1PA 3L9ZA 4JI1J 2PSZA 1VDHA 3C14A 5DZ7A 1U1KA 4B9VA 4U7UD 5FIIA 2JRSA 4HH1A 5BJRA 3KLVA 1Q78A 1NXIA 4FNHA 3MMBA 5IQQA 1PBAA 1EKRA 3OQ2A 1PJ6A 2NSCA 3D1QA 4ECVA 4O3PA 4LF9J 2IC3B 3NCPA 2YKQA 2ZBRA 4CZCA 3HLUA 4CO5A 2JX2A 4P2FA 3G8TA 2LEAA 3QT8A 4X4SA 1N6QA 3MCMA 2XNRA 1F5CA 2Z2ZA 2CQGA 2GVZA 3O3LA 4P9SA 4NLWA 4ZA1A 1RKIA 2AJ1A 1N5VA 2AX0A 2N3OA 4ZPDA 2AKWB 4J90A 4PQUB 2D74B 1G3OA 2GQ2A 3PX0A 3VAMA 1TK5A 1JJHA 3KJVA 3L95X 1X8DA 4OZ2A 4X4QA 1K73T 3OBIA 1U8SA 2X51A 4N8OA 2J5AA 1DLOB 1RBAA 2PI5A 4IFYB 4XDDA 5A2QU 2BA9A 4DR5J 1N33J 1CJKB 1IJFB 1O0PA 2FJWA 3GONA 2GIQA 2MKSA 1ZZNA 1VCTA 3V81B 4FPIA 5HLFB 2HHWA 2OELA 3OD2A 4NASA 4DU7A 1LWCA 3A12A 3UDEA 2VASA 3OXFA 2LQ5A 2I5JB 2KU7A 4DCPB 2O3DA 1WTBA 1UVNA 2HPUA 4DV0J 3J7A1 2O01C 1NDLA 3G2XA 1HBUA 3AD9C 1RA6A 1F2GA 5E41A 1P9QC 3MM8A 2UUBF 2GO9A 1TP7A 1Y3KA 2M70A 3M8PA 2W1BA 4WU3A 5J1NA 2VG5B 3JS9A 3PEJA 1NKEA 3C16B 2ZNYA 4ZJQA 5AXMA 4KBIA 1XIQA 4QBUA 2ZHOA 5IM0A 4PXDA 3KG4A 2DPIA 1HQEB 3IP0A 5F0UA 3LP1A 1RSCA 5EX0A 3OV7A 2HHQA 1D9AA 2HFSA 3AA8A 2MQOA 3WC0A 2X1FA 2BM1A 5IV3A 3DLEA 1BMQB 1URRA 2XMMA 1U02A 2QTWA 3P8BB 4OJGA 2V50A 1GT8A 3FZBA 4C48A 3MEGB 3CXCR 5DLFA 4B17A 1S48A 2YKNB 3HD1A 2M9KA 1MSWD 2GJIA 3DN9A 2Z56B 3P45B 3LP2B 1QSYA 2AGQA 2WOMA 2Z2MA 2CPHA 1U2CA 1T94A 3DHWC 3IGNA 4CTAA 5HQ8A 1G7CB 2B5JB 1F0XA 4RJVA 4B3RJ 3N0VA 2PN6A 1PJ7A 1WKKA 1WEXA 1CQNA 4IG0A 4NWBA 4Q44A 2R8KA 2HVZA 1F1BB 4U8VA 5D78A 2B0GA 2PEBA 3AFGA 3CJ0A 2MKIA 2N7CA 5KFRA 3CCES 2KT3A 1U48A 3WHIA 2RUGA 2DGTA 2OLWA 5L39A 3QRRA 2UZAA 3AOCA 3KK3B 4AUKA 2MMYA 3G86A 4JI6F 2NXUA 2ZKUA 2BJ7A 1K0TA 5ETKA 2ROPA 3MR3A 1SL0A 3PW0A 3OR2A 3DRRA 3PW5A 3DOKB 4BDPA 2DKOB 1H3DA 2CZVC 4YY3F 1VYAA 1HL6A 4GKJF 1WACA 1X5PA 2FJAB 2I8EA 4J9VA 5GAGU 3MUTP 5CYMB 4J9KA 5HBMA 5C25A 3KHHA 4C8ZA 1C1CB 2B4UA 4X64F 1OQ3A 3C6UA 3RB4A 5C2GA 2FZKB 2ADBA 2V9WA 3OTDA 4GVBB 3ZZYA 2XO6A 4LR7A 2C22A 1GMWD 3IM8A 1NSAA 2ATLA 3QJJA 2ZUGA 3EXYA 2OD4A 3C14B 3M2VB 5E3RA 2NUHA 3BGLA 2G0CA 4X66F 3X1LB 3QWPA 3CD0A 3KK3A 5B08A 2UUBJ 4DV4J 3RBDA 3LQVA 3QAEA 3CJTA 4K5SA 3N28A 5U47A 4DFMA 1N48A 3N5BA 2IM0A 4BS2A 1OSDA 3FFIA 4LFAJ 2M0GB 5SZTA 1TL1A 4EBDA 1CJTB 2QEXS 2F7VA 2ROGA 3IR7B 3JTOA 4JUZA 3HZGA 5RUBA 4DSFA 3B78A 2ZM6F 1PIEA 5AXNA 3MEDA 4ES1A 1NPPA 1YGYA 2DHXA 2JSXA 1Y0HA 2OHDA 3V4IB 1WC5A 3CD5A 2UVVA 2DGOA 2OPPB 4WP3A 3TUJC 3UN5A 4OYPA 3QGGA 5GAEI 4ZLJA 4V1Ak 4UOHA 4N77A 3BO2A 2HVIA 4P10A 1WDTA 4M5GA 4CCHA 2HZCA 4ES2A 1ZA2B 2VJUA 4ECXA 2FHJD 3RR7A 4DV6J 4ZVEA 1CULA 1GXTA 5I4MA 1JKHB 4EWTA 3DM2B 1HWJA 4CO3A 4DG1B 6FDRA 3VAFA 5GADI 3PX4A 3TA0A 2E1PA 1B70B 3SSRA 1KS2A 2FD2A 3Q23A 2ZH3A 4LF7J 3PW4A 3RZAA 1LWXA 1NKCA 1RAFB 2AEFA 4NLXA 2PO4A 4RR5A 1XNRJ 4NRTA 1RLDA 3D5MA 5JXSA 1HW8A 5K14A 3SDEA 2F63A 4MIBA 4BBYA 2W8KA 2PI4A 3H59A 2KZMA 3H4BA 3UR0A 5J2PB 2XEXA 1TKZB 5KFLA 1ZTTA 3Q2TC 2X1AA 2Q79A 4J9RA 4J9PA 2UXDF 1SQEA 1D9DA 3WQPA 5JVGQ 2KDOA 4W98A 1VS3A 2QLFB 2R8GA 1JJCB 3DM2A 2Y1JA 3NNCA 4E98A 3HVRA 4HL9A 2G2YA 4PAAA 2EWHA 4C8OA 2B56A 2QMUB 4M5HA 3R7NB 4ZN1A 6FD1A 4XPCA 3THVA 3CCSS 3F56A 3DDKA 1Q8LA 2YQ3A 4NYOA 1GAOA 2FC8A 3NOGA 2VG7B 1FKOA 5KOWA 3PVXA 1VQ5S 2NREA 3UI3A 2GA7A 3MAQA 3DRPB 4LF8F 2OPRB 4IO1A 4ZVHA 4X4PA 3CDBA 4I6WA 5DZ6A 2HFUA 2X1BA 3GSDA 2P9CA 5HVGA 4N56A 3GPAA 4OI3A 5B0EA 4LUBA 1RABB 4QR0A 2L9WA 3QT7A 4R8UA 2W9CB 3OXLA 3MM6B 1S6QB 3C6TA 1FVQA 2W9AA 2ZHAA 3PR4A 4KH1B 4DS4A 3BO4A 4UT4A 1XNRF 4UOFA 2HQCA 2HEKA 2JVOA 1GX5A 3NP5A 3JAMU 1SJ4P 2G13A 2QLWA 1RZMA 2Z8QA 1RT2B 3G82A 4WFBQ 2CQ1A 2UVRA 4NCGB 4EBEA 2DRDA 2NPFA 4KTQA 2XMWA 2RE1A 2AT1B 5I3PA 3TAPA 4K2XA 2RF2A 1H2UX 1DRZA 2QLJB 1RB0A 3AXMA 1NHUA 2J7UA 2E5GA 2MLXA 3UD3P 2VPYB 3UQSA 1IBKF 3KXDA 3NOCA 1OS5A 2DNOA 4L3KA 4AD6A 4MKAA 4UUWA 1J27A 3IWXA 3BB5A 2YQ0A 1T9TA 4IDKB 4M5DB 3OR1A 2QMXA 3WIUA 1TAUA 2QJ3A 2ZJPQ 2ZZTA 1U7LA 2V34A 2D7SA 3OSNA 1FWPA 3MHYA 4C11A 4FKYA 2HKEA 4FS2A 2VA2A 3PV8A 3CJ8A 5DM7Q 1VRQC 1VLYA 3C16A 1FNOA 4AQYJ 2DJWA 3J81Y 3NG8A 2G0JA 5I3UB 4CNZA 4I64A 4Z37A 4PPDA 3DI6A 2HQGA 1UW9A 4DFPA 1JLBA 4Z7CA 3WX8A 2AEMA 3CGIA 2OSQA 3FMWA 4M5KA 2IMWP 1RU1A 2IPOB 3D6MB 4WFAQ 2DNZA 2RQ4A 3ILIA 3MEDB 3L3CA 2PMHA 4PWDB 4WF9Q 3DLEB 3MR6A 3CCJS 4OJHA 1NSKL 4MIWA 3VGSA 1UA0A 2V5HG 3Q8YA 2OKQA 3E51A 1YQHA 4DEZA 2QE5A 2UU9F 4ZITA 4LVNP 3R27A 1REVB 1G1XA 4ZHRB 1FRHA 4ITSA 1KOHA 1EAYC 2GJ2A 3T6JA 5J1PA 2B8PA 4LIRA 4USTA 3AY0A 5M2PA 2P9EA 1NHVA 4C8MA 1VBZA 2XSJB 1L3KA 1R3NA 3RB0A 3LGHA 2QIFA 4OX6A 2BUNA 1MN9A 3CJKA 1YSJA 3WIVA 1NPRA 4DSEA 1PSDA 2XY7A 1Z2ZA 3OTOJ 3N5FA 3M2UA 2V2KA 4PQUA 1N56A 3N01A 1XN9A 3C19A 4CQ1A 3CCQS 2I6WA 4CYUA 1VLOA 2CQBA 2M5YA 3DOKA 1NK9A 5HVHA 2RAQA 2D3ZA 4WIIA 3QFWA 4YP3A 2J6TA 3MCOA 3IG1B 4DR4J 3QNWB 1FCAA 2PDAA 2QA4G 3CULA 1ZPVA 1ICEB 2WONB 1HYSB 2RNEA 3MD1A 3QMQA 1JLCA 3TANA 2D41A 4YEAA 3H0PA 2GV1A 3B4DA 4DOZA 3CDEA 2D3OR 1L3UA 3Q8UA 3UWTA 3AJDA 1HA1A 1S12A 1XMBA 4LSZB 1U0SA 2CPZA 4TLQA 5ETTA 3SV3A 3E2EA 3W2WA 2HNYA 3GG1A 4CH0S 4QU7A 4LF4F 4OL8A 5B7WA 1IKXB 4NXMJ 2LA4A 1TL3B 2AJ0A 3IS9B 5CHCB 3EPIA 2AGOA 3Q89A 1NSPA 3KFWX 1RTHB 4L73A 4XTTA 2RJZA 4F36A 3KK1A 1X4HA 1VQLS 1AA1B 2DYAA 1G6BA 3J81U 4U95A 1PILA 1YLXA 2RDDA 2XMTA 2ILZA 3MR5A 3D2WA 1VQOS 1GQEA 2VICA 4UZBA 1U1PA 1S0OA 1TMJA 1JLAA 2CWXA 3M2RB 3NAIA 1SIWB 2I1RA 4FXVA 2IMOA 4JI5F 4DXLA 2F8MA 3EVOA 3IC1A 3E01A 2OAUA 4PYAA 2IY5B 1XR5A 3W5YA 1SI9A 4ANDA 1FT8A 1R6VA 1BUXA 4CLYA 4C97A 1X5TA 4ZPWR 1SH2A 1MMDA 2QYCA 3I96A 1RACB 3MOZA 5KFIA 1UWBA 5K8NA 1UFLA 3M9NB 2DRBA 1BE4A 3AQOA 3TWZA 2DR5A 1T9XA 2YNHB 3D66A 2L48A 1Q5YA 7FDRA 2J9CA 2VC1A 1HWUA 2FHOB 3ZZPA 3ENAA 3GFHA 4RO0A 2HG4A 1L3SA 3BKUA 2EK6A 1H72C 2RHQB 4DQQA 5HLFA 4IRKA 1NU4A 3GMGA 3W8PA 3A3NB 3I5AA 2HSEB 3BR9A 5EN1A 1T9UA 4MK7A 3BN7A 2FPHX 2I5JA 4IH6A 4K4VA 1BQMB 4ANEA 4FXDA 1FDBA 4OYAA 2O67A 4OYXA 5KG0A 1D1UA 2MQLA 3BSCA 1DARA 2CZ4A 2DGXA 3D54A 3ISNC 3HCXA 3JQMA 2BV3A 4ZPVR 4E2FB 3NGDA 4LSLB 5D0RA 4KAIA 4LT6A 5DDOC 2L41A 5KT6A 1JIHA 3QGHA 2MKHA 4ID5B 4EMDA 1TKXB 3DGPA 1NNDA 3SQOP 3VAJA 2A10A 3C15B 4MT1A 3G6VA 3C6UB 3FRZA 2CA9A 3PHEA 3HHLB 3KMSA 4DV2J 3UNGC 4DV2F 4A8FA 1F9FA 1WG1A 2BQRA 2LXIA 1SL1A 1SUQB 4OQJA 1ZOTA 3WX4A 1WC1A 2HAIA 4WK1A 5GMEA 1BQMA 2W9BB 2X7IA 1UAWA 5E2QA 2I38A 2QA2A 2ZM6J 2LQ9A 3M2UB 3D3BJ 4B3TF 4OI1A 1S0VA 4YHHJ 2YKPA 1YG0A 4Q45A 1PYOB 1RWMB 4L76A 4OMFG 3D7SB 4S0MA 1F6TA 2HK3A 4JI0F 3RW7A 3MTKA 5B0BA 1TFYA 4CTAB 4HR2A 1TKXA 3DGPB 1OJ4A 1FTRA 3ELHA 1GX6A 1BC6A 1ZYQA 4TLRA 4V19X 2V8DA 3TYTA 1VIXA 2JLFA 4RW8B 3KK2B 1VQ7S 1JLCB 1FE0A 3LWLA 2AJQA 3FEYB 4TXSA 2CDQA 4DX8H 1VK3A 3EGWB 5SUHA 2GFFA 4R0EA 5A8RB 1UVIA 1CQMA 3LUYA 1FDNA 4Q8FA 1DY3A 2MLYA 4NE9C 1RYRA 1MROA 2RQCA 3OW2R 2BX6A 3N9UC 2BMBA 5KG3A 1FNMA 3T1AA 2XMVA 3LO3A 4DV3F 2CJ9A 2ZVSA 3I5CA 3AB2B 2M7SA 5HATA 5J2MB 3CJ5A 3JSMB 2R7SA 4MK9A 3KDNA 1FKAF 4DF8A 2E5JA 1LKZA 3LP2A 1YJWS 2OUGA 3IAS9 2HHHF 4DSJA 4IUFA 2W24A 3F44A 2IYGA 1UPMB 3H20A 1BQNB 4RNOA 2NXEA 2HHUA 2HFVA 3LF0A 2ZVIA 4USWA 4KPCA 5KFPA 4ZJOA 4A48A 5KT3A 4QYRA 1U1QA 4PEOA 2GGPB 2FY1A 3CMES 2K1RB 1VBYA 4W4MA 1QY7A 2QL5B 3BBFA 3ZTPA 4RZRA 1DZ5A 2BKOA 1ZZFA 4KGXB 3SV4A 4EUVA 1J5OB 2DR9A 4UF4A 3HHEA 3TZYA 2HQFA 1R8BA 3BDEA 1HNWJ 2ZZMA 3OFGA 4CDIA 2GVDB 3QSYB 4RUAA 4LRBA 4K2JA 5T7LB 3ZFVA 3RTVA 1EP4B 1FXLA 1TK0A 2DNKA 4H54A 1R7IA 3HSZA 1YTYA 1EKSA 1VQMS 1NK7A 3KDOA 2CAJA 1D9FA 2P5VA 3NGRA 4J9OA 1RT6B 3PFEA 4OI6A 2F3JA 3CJ3A 4NLOA 1JLEA 3M8WA 3PYDA 4GKJJ 2CJQA 3ZZRA 1RHJB 2LECA 1NB2A 2E5HA 1NM2A 1PCAA 1T9YA 2HNDA 2QT7A 3OFEA 5CYQB 2B3TB 2ZBPA 5LT5A 4RX6A 1HYSA 2VFUA 4R5PA 1H74A 4M95A 1IXKA 1ZAWA 4ZP6A 1APSA 1YRXA 3PJ9A 4QIVA 5JUMA 2N82B 2A3JA 3R8YA 3BSOA 4KV8B 5BR8F 3M9OB 1U24A 3D6TB 1UVJA 2AEJA 3AQPA 4WKRA 1RAEB 1U25A 2K7KA 2VDHA 3WDOA 2UP1A 3M8ZA 3A8JA 2A0FB 1TUWA 5HI7A 5KFWA 3OHBA 3R5AA 1WF2A 2F40A 1AZSA 3GCXP 4KRWA 2CPFA 4DV7F 2QC3A 3AJ1A 3MMCA 1Y9OA 4LSLA 2XSFA 2YBVA 3M6UA 4OIXA 3R3TA 1TV6B 4NZ0A 2PA3A 1YZ7A 4ETZA 4NEZA 5EX3A 1H7WA 3IR5B 3CCMS 1XQIA 1K9MT 4X4VA 2HMIB 3NWRA 4DX6A 1JLGA 1RHRB 2D9OA 1AUDA 2EFGA 3TJ9A 2MEWA 2VOOA 4KJIA 2W2PP 4TKTA 5IS2A 4NXMF 3F0NA 4XK8C 2KG1A 3EX7B 4EZ9A 2I9SA 4O3QA 4ZCKA 2OMLA 4JI3F 2N4CA 1RAIB 1W26A 4QJVA 5AE3A 3MM5B 1HNIB 4KGZB 4X62F 2R2RA 3TI0A 5KOXA 2L9DA 3S01A 3AH6A 1R31A 2XHCA 2MQ8A 3DCAA 4I6AA 1IJEB 1XR6A 4I7FA 4NLYA 1R0AB 3KOAA 1RDRA 2B8QA 2BE2B 3I31A 3PM9A 1G4CA 1RWOB 2FYXA 1NSQA 2R8HA 2UUCJ 3HSJA 2OSRA 4ED0A 3B8HA 3QJLA 4TVAB 5A6PA 4DQPA 3GIKA 4CLLA 4QPTA 2ALZA 3BR8A 4LF7F 2CPYA 3PRVA 3MWBA 1VOMA 3G8QA 4WWSA 5CD4A 1WUUA 2M52A 2QN6B 3EDRB 4C0OC 3PKMA 4P52A 1U2RA 3BQ2A 2DIVA 4USUA 2HQIA 2GO8A 5JJBA 5A2QY 1S10A 4DL0C 3H42A 3HPOA 3FGVA 3OTOF 2VQEF 4X84A 3WC2A 2A2CA 2HLUA 2PA8D 2ZD1A 3HSDA 4OLPA 3RJMB 2ZNZA 1FRLA 1E6YA 1GMUA 2B9EA 1R0AA 1UVMA 2BACA 3R6LB 3TUIC 2G9OA 3W2VB 1VRTA 4A8OA 3SSQA 2ZH8A 5B0DA 3UCZP 2GMLA 4L75A 3P6YC 4TY8B 1QAJA 4ECWA 4H4OB 1WD6A 2M2BA 2PE8A 3JB9k 2IFXA 1HBOB 2GMJA 2FDNA 1MG7A 2GIFA 3POTB 3PYGA 2GHWA 3M8QA 2J6UA 1LW2B 2HWTA 2IM1A 3M05A 1N0VC 1QVFR 3C15A 4NCGA 1D0EA 5KG6A 4LRCA 2DY1A 2FGOA 5KFOA 2PGCA 3R7SB 4DZDA 1GEHA 2VC0A 2EPIA 3MI7X 4I2PA 5LMNJ 2CQ0A 3O2IA 3PO4A 1X60A 2VD3A 4IQMA 3NGSA 1VGYA 1ZPWX 2WK4A 3I5BA 4DN9A 3OL6A 2AX1A 2H54B 2GVZB 1N36J 1PBUA 1HWIA 3I9V9 3KJFB 1NK4A 1HNVA 1IM6A 3GYNA 3Q8VA 5A8WB 3R7BB 2VHGA 4ECUA 4PCQA 2UVUA 3K0JA 3TZZA 2AV5A 2MQQA 2L08A 2ZH6A 1SJQA 3PJXA 4RNMA 3C46A 3ENWA 4D3GA 2BR0A 4QIFA 2QGFB 2HWHA 3PR5B 2H9ZA 5KFBA 2XULA 1QM9A 4ELTA 2C2MB 3M32B 2Z2LA 3M6WA 5CZVA 4Y2AA 2JH3A 5DRKA 5KFXA 1YDLA 3NS5A 4AL7A 3TJAA 1M1GA 3FC9A 4KKOA 1S1XB 3QGIA 3SCKE 5CD4H 1F3VA 1ZM2A 4C3KA 1F60B 3GYXB 2F1FA 1TKTA 1MU2A 2HRUA 2XQCA 4J9QA 4KGKA 4OHYA 3MPUB 2MSTA 1GTHA 3MM9B 1K0VA 4KE5A 2V4JB 4NCBA 1NZ8A 2UV8A 3GIJA 4ZCMA 3PCOB 4U6PA 3KHGA 1WELA 3ITHA 4EYHB 1REVA 5KFFA 3V6KA 1VC0A 3U1NA 1EQMA 4UZCA 2A18A 3OPKA 4HHHA 3UNYA 1X5OA 3M32A 3RRGA 1OPZA 3TNVA 3ET6B 3O44A 3D0HE 3I0RB 4USIA 4ZVSB 3Q8QB 3K8VA 1F9HA 4OYBA 3SQGA 2D69A 1SQGA 1VK8A 4CT8A 3HM9A 5A0YB 4B9UA 1UJ4A 2NPIA 1UVLA 4KYZA 3LP0A 1HI1A 1B0PA 2G4BA 4K4UA 1V9OA 2OEMA 4GO5X 1ZM4A 1Q86T 4M94A 1AFJA 4HDGA 4DS5A 2WRMA 3DU5A 1R8HA 1HR0F 4L3NA 2WW4A 3FVYA 1N6QB 4K50A 2HNZA 2CNLB 1S57A 2MHNA 3TA1A 3TR5A 2QFJA 5LSRA 2VBZA 3HKWA 4EU0A 2HHVA 3U1LA 5IT9Y 4KGVB 3PYFA 1DTTB 1EX8A 3QATA 4FBTA 4NXNJ 2YTCA 2YKAA 4ZK7M 1LQ9A 2FC9A 2LCWA 1QAIA 3MR2A 1QDUB 1TVRB 2DH9A 2QLXA 4LF2A 2ZEJA 1FI4A 2KJVA 2WVEA 3P3DA 5GAHU 1K47A 1X4EA 2CNKB 3BGRA 1B99A 4ZDNA 2B51A 2XYHB 3WZ0A 3I4PA 2AYEA 2XCPA 1KSPA 2J0XA 2C3UA 3W2WB 4OZ0A 1WOSA 3DRRB 2D9PA 5J1EB 1YK9A 4LJMA 1T11A 2F9DA 2VG6A 4QW9A 4B3MF 5EWEA 1T05B 4JI4F 2LEPA 1KP6A 3RR8A 5IQ6A 2XB2D 5KFGA 1K44A 2MZ1A 2E1AA 4XIUA 4YY3J 2BJ8A 2DNPA 3V6DB 2IA6A 2OJ3A 3GR0A 3VQSA 4GVBA 3J7AN 1EZZB 4KR0B 2UV8G 4DUTA 3CDUA 4A8YA 1YJ7A 1S9GB 2IAJB 1DBDA 3DDIA 1TU0B 1LW2A 1C4CA 1OWXA 3ENQA 1S1TA 3F41A 3IRXB 4DPWA 4EO8A 4CIOA 2JLGA 4NEYA 4J9NA 2XHWA 1G2EA 2KB2A 4QIGA 4ILMA 4KHRA 1UEKA 1WDDA 2HVDA 3HT0A 2JLEA 1NJIT 1BLUA 4ZVGA 4IRCA 1R43A 2DB1A 2KKHA 5HP1A 2GX8A 2EFVA 2MQMA 2Z30B 2HW3A 2KO1A 3T1YJ 3H4DA 1U26A 4MKBA 2GZOA 2H65B 3AD8C 1YVFA 2A1BA 2AJ4A 2YKNA 2OEKA 3GR1A 1XR7A 2A6OA 2FJXA 2VFSA 3DKDA 4DR6F 3PYEA 2DXEA 2DNHA 1RT1B 3VGTA 4DI6A 3TRGA 3ETOA 2DH8A 1BQNA 2O66A 5HANA 5GAHI 3S6EA 3LOUA 2J6SA 2GCFA 2AMCB 4L74A 4LR8A 4DUYF 4OV6A 1BHNA 4WE1B 4M1KA 3M9MB 1Y5IB 2CQPA 1YJNS 1HNWF 2HGNA 1D09B 2HVEA 4CO2A 1QTMA 1T0TV 2OPQA 4LRDA 2HIYA 3OUYB 4CM2A 4LFCJ 2C2DA 2CADA 3R5JB 2HNYB 1S1WB 3J7YI 4CO4A 2YNGA 4UQTA 4DV3J 3QRPA 3SXLA 3GFZA 3LW5C 4I69A 4ZPCA 2EFQA 2VONA 2ZKTA 3EZOA 4DR4F 4WZMA 2E29A 2QMWA 4NZ7A 1O8BA 1M90T 3NL0A 4B3RF 4IFYA 1AB8A 1JXEA 1Q4RA 1SCJB 2M88A 1MN7A 1CJKA 2HBZB 3D68A 3H98A 3CDWA 9RUBA 2UUWA 1RWVB 4FPRA 2XS7A 1IVZA 4DR7J 3F73A 3KJVB 5DDQC 2WHOA 3C8YA 5T41A 2G1HA 3EGVA 3M2VA 2ASJA 1FXDA 2NR0A 1KTQA 2PIIA 3G6YA 4LMZA 1PJ5A 2HNDB 5CYQA 5LSOA 2B9WA 4IG3B 3G4SS 3DFEA 4QYZK 3BEGB 3PX6A 5ETPA 3HVWA 4RUHA 3TO8A 3UN2A 3J80Y 4JI4J 2JZ5A 2NQPA 4B3SJ 1TAQA 3HJVA 2VOPA 3MUVP 3EVWA 4PG7A 4WFNQ 2RDIA 3DLKB 1XK8A 4KHPJ 1KNZA 5C25B 2ZOFA 3D9BA 3QZ7A 5F8NA 4YQWA 3MM6A 3UVJB 2MY7A 1Y3JA 2RHSB 2BW2A 8AT1B 2XWYA 2KVQE 3VQTA 1I94J 4LF9F 3MR7A 2COLA 3I0SA 3CCZA 3UDCA 3UDLA 2VQFJ 1UMJA 1OYDA 1TR0A 4YHHF 4AL5A 2NZ4A 2H3EB 3PEHA 4MFBA 2WBMA 3UPFA 4U96A 2ZWPA 3O1LA 2H5JB 1SQFA 3K59A 1RK8A 1Y10A 1T3NA 3CCWA 4N7TA 4P2SA 1C0TA 1HHQA 1UVKA 3FZ2A 3VF0B 1XMQF 1SKSA 4FF4A 1HQEA 2JL9A 4A8QA 4Y2KA 3PHTA 4HACB 2BJEA 5T7LA 3ZNUA 2B5JA 4NZ6A 2WSEC 4I56A 4WKYA 2YWEA 3VV2B 3GE9A 4EI2A 2C2KB 2R2TA 3CCLS 4IG0B 2B6AA 3MEGA 2GAHC 3A3PB 3RW6A 4Y6IA 4A8MP 3IM9A 1S9EB 1UCNA 3BGFA 3DRXA 4LBIA 4M8LA 2A2DA 4RUCA 2WOMB 2OIHA 4EO6A 3QIDA 1BGXT 5GAGI 3QGPA 1JKHA 3TEHB 3KLIA 1FJGJ 4GKKJ 2VKRA 1TUGB 2HRYA 4HT7A 4ELVA 1X4GA 1W7WA 1ZA1B 4WFZA 2K3IA 1C0TB 2BE7D 4P74A 2IHR1 5C24A 5KFJA 2W7OA 3K5NA 4GC6A 2AYBA 3I9ZA 3PRDA 4YR2A 3CB4A 2E9TA 2H5IB 3H2UB 2E1CA 3W8GA 2CG4A 3GJRB 3O8WA 1VJWA 3P5TL 2XCAA 1TZ0A 2OMOA 2VU5A 4QYZJ 1NPKA 2LQBA 1X4BA 4DHVA 2ZH5A 3DLHA 4AQYF 1TV6A 1RT3A 2ZBIA 5LM7E 3L09A 3K5PA 2MGZA 4JV0A 4LQ9A 3UR3C 3QFHA 4QWCA 2W9CA 5KFMA 1QE1B 3NBPB 4MKYA 5KG7A 2VFVA 1PC5A 4PXEA 3W7BA 2ZH9A 2IVYA 2EBGA 2HBYB 2UXCJ 1F9EB 4BC7A 4D3HA 3V81A 1UPPA 2YKOA 4DR1J 2LFVA 3AODA 1JXLA 4DUYJ 3RUBL 2ZDOA 1MROB 4KY3A 5BXIA 3A8EA 3IO1A 4HEA9 2QRRA 3JSYA 3G71S 4ED2A 1YHQS 1Q7YT 4DLEA 3BGRB 2I0XA 1PYTA 4FS1A 3X3UA 3MMAA 4YDXA 4DPTA 2HYIB 4P2MA 3GYGA 4XPEA 2W4CA 2ZUAA 1CVJA 3QT6A 2VG6B 5E3AA 1VRUB 4I2QA 3K2YA 4UY8T 2CQ4A 2Y0SD 4U7CA 3G8SA 3K58A 4ELUA 1WORA 3OJUA 4RUBA 1S49A 1KHWA 4YDDB 3MXHP 2UXBJ 3OTCA 1LWEB 5G4DA 5KT2A 1KVJA 3EYZA 3H25A 2E1MC 4JI0J 4FYXB 1DTQB 4AYBD 4DU8A 4LF4J 3H8YA 4KO0B 4WFYA 3HMJG 2J0QD 4KT0C 2RSQA 4HHUA 1NDCA 1SH3A 4KB7A 2Q6BA 2CQHA 2RU9A 5HJXA 5K14B 5KFHA 4QCLA 2DEJA 4C8LA 1V5VA 1XNQJ 3VWSA 2WTFA 4URQU 3DLGB 2JWNA 4F4WA 3RBEA 5ETMA 4DL7A 1VRUA 3AB4B 2HHHJ 3UFCX 1I94F 1T7PA 4CRJA 1EP4A 2RS8A 4ZN3A 1KFDA 1KWMA 4YUDA 1FX4A 5D8HB 1IKYA 2V67A 1K1SA 1TMMA 3FDSA 3TVYA 1M5HA 5KFQA 5CABA 1NJYA 2V9KA 3IBCB 3QWUA 2FVRA 3OL7A 4DPOA 3DXSX 1N0UA 1JLEB 1BWVA 2K06A 3NXZA 4WFXA 4DCJB 5AE2A 4WU2A 5M2UA 1IWGA 2C2EA 4JI3J 1JLQA 1JLFA 1WHYA 4UY85 3W63A 1N5TA 2ABYA 5A0YA 4PRFA 3TAMA 3W3SA 3MAAB 1MMNA 4BLGA 4F4KA 2CJXB 4FN5A 1S6OA 3PNIA 4IYQA 1QTNB 4CLSA 4JV5F 4ALZA 4B08A 3ZXWA 4FNIA 3U27A 4EGLA 3BH7B 3A1YG 4F2SA 4K4ZA 4LSNB 1U1LA 4Q2MA 5F0WA 1CPZA 1MWZA 2MJNA 4B9SA 1S72S 4ZVQB 4K4SA 2MPUA 4YS2A 2BVZA 2RU3A 4I67A 1HBUB 2A6MA 3V5RA 2H51B 3CCUS 2Z4PA 2VFRA 1C1BA 1U1NA 1YBUA 2F9JA 2MXYA 4J9UE 1H7XA 4F4XA 4ECZA 4LFCF 2KFZA 2CNNB 3IWNC 2DNLA 4TYAA 5FLXY 1WOOA 3FFIB 3K5OA 4QOTA 2ZE2B 2OGUA 4ZLNA 5C24B 4X4OA 1GFWB 3OLAA 3KLFA 2ZHBA 1H0HB 1H2TZ 1LWFB 1RUSA 2XZDB 5LL6d 5E3CA 4CLKA 3Q22A 2V8VA 1KOOA 4FYDA 4LFBJ 1A6LA 1XBWA 2E5IA 1FFSB 3FKBA 3QYYA 5ETNA 4C3MA 1HNXF 1FJ7A 5LSLA 1E6VB 3ICLA 1VI7A 4LF1A 4RBTA 4QW8A 3W1YC 3ZC4A 4IDKA 1OSCA 4M5DA 1RHMB 4IOCQ 5BR8J 1SKWA 3HHLD 3MD3A 3PXGa 1WC3A 4ETXA 4ZVUB 2PT0A 3IG1A 2AYGA 4JI2J 1HW9A 1S1TB 1GXLA 3D67A 2Q1LA 3KJQB 5D77A 3V6JA 1KVKA 4W92B 1IR1A 4LRAA 1EHWA 4O44A 4Q43A 1KQSR 4G1PA 3M1VB 5IZHA 1DURA 4KKOB 3GIIA 1NK8A 4C3LA 2HURA 1IM4A 1C0UB 3TX0A 5IWAJ 2GQCA 2AU0A 3T6BA 4Q2LA 3MOJB 4RNHA 4N76A 4Q8EA 2Z58B 2CQ2A 4LRFA 3TUZC 2BE9B 4RNFA 1LK5A 2ASYA 2CPXA 4IOBA 4NA2A 3UD5A 4LF5J 3HK2A 3UN3A 5CCMA 1OMSA 3ILJA 4BWJA 3I82A 5FJ4A 2N4DA 4ZHRA 1M5OC 5CYMA 4CO0A 1HQ2A 2ZBCA 4HI1A 2V2QA 1WKJA 4KC5A 3GFYA 5I3QA 1ULRA 2F4VJ 5G0RB 2YH1A 2XSJA 3CCVS 1DTTA 3QBCA 3I0RA 1X5SA 2UVWA 1Q8BA 4K5RA 1K8AT 1VC6A 3BS9A 2C28A 3SQGB 4AE5A 2VG7A 2R7VA 5LMUF 1JLAB 2B4OA 2ROEA 3H2VE 3M2RA 5L38A 1REGX 1CJUB 3EICA 4G1QA 4OX7A 3RBXA 3CDAA 3SIPB 5KT5A 3JSMA 2ZC3A 3PW7A 2BQ3A 1LK7A 2BKNA 4U8YA 2HQDA 3ZZ0A 2DT9A 3KTQA 8RUCA 4P71A 2BQUA 1DHMA 2DHHA 5C42A 3TUPA 4X4RA 4HTJA 3VVTA 4B3OB 1HFEL 2OPQB 1GMVA 5ITHA 4ECRA 4DQSA 4N41A 3T5JA 2ZOGA 1RE1B 3L7PA 4M63A 1HNZF 1SC1B 4JI8J 3CJ4A 2VJVA 3IA0A 2XO7A 2CVEA 3R5GA 2UXDJ 1WEZA 1IQZA 2IAJA 2CDRB 4NLUA 2X3GA 1R0BG 2EXUA 3MM8B 2LYVA 2ALYB 2WB1D 5KFDA 3MEEA 3KLEA 1H38A 1FTCA 2CQDA 2IVFB 4DWIA 4MJKA 4R0JA 3QSIA 2DGWA 3J7YU 1NHKL 2F4FA 2QLBB 2RF2B 3DGVA 1RBOB 2IC3A 2VB6A 2Y1RI 4UW2A 3AJ2A 3NY0A 2CYYA 5DO2A 5IFMA 4ECTA 1Y4ZB 2YX1A 4MAKA 1Y5LB 4AFFA 2WB4A 4NLQA 4DV7J 3NGKA 3PO5A 1CJVB 3DMJB 1RI7A 3UVJA 1RTHA 2XI3A 2FLNA 2BABA 4DV6F 1VFJA 3HFVA 1S59A 5BYQA 5A8KA 3VZIA 1VQNS 5L9XA 4C4WA 4HH0A 1IKXA 2KRRA 4ZOSA 3AXKA 3EJMA 2IBKA 1UJ6A 3HVAA 5A76A 2LDIA 1AUSL 1V5IB 1AROP 3IAM9 4NL5A 4R5PB 3QO9B 3SEOA 1FWLA 3TQEA 3LAKA 4DUZJ 4J91A 1HPZA 2LVWA 1RT4B 4FKXA 5J2NB 3KLGB 1X9WA 4KV8A 4LVOP 3BGOP 4OZ1A 4PABA 1NUEA 1D8YA 2AWZA 4HT5A 5THWA 1LXJA 2KN4A 1DTQA 3BZQA 5EUHA 5B09A 4X64J 4NRUA 1FJEB 4OZNA 1HARA 1SH0A 1OYEA 2G2OA 1FRXA 3PIPQ 4K4TA 3LP0B 1P1TA 1F5BA 2BZ2A 3ILOA 2FJVA 1U0HB 2QYGA 2CWKA 3D1OA 4X66J 4TN2A 1VIOA 4K7QA 4EFAC 4K4WA 2J7WA 4RLEA 2WVDA 2GNKA 4K4XA 1XMOJ 4RNNA 3R2CJ 3DNCA 1R89A 3H7HB 4OLOA 4PKDB 5HJYA 2PMZD 2E7XA 2VL1A 3DU6A 3W60A 2HNZB 4BCAA 2V4RA 5D3GA 1UTAA 3EVMA 3QO9A 4IQXA 2VDIA 3BKTA 3GQCA 3D3CJ 4CLFA 2NXNA 2VBXA 3W64A 2YNHA 5GAEU 4WE1A 1N4LA 1MWYA 1TVRA 2CUYA 3IBWA 3NLCA 4RW6A 4RWWA 2OPSA 4MK8A 1TKDA 2MZJA 1GXUA 2R7RA 2KXHA 5K9FA 5KFCA 3OTBA 5DQHA 4F4YA 4I7FB 2QL7B 1S1WA 2BJ9A 2BE2A 4G6VB 2DH7A 2QSFA 4YR3A 1IN0A 2RQMA 2RKIA 4H4KA 1RTJB 3FEZA 3C3LA 1RWPB 4C8YA 1NH7A 4LSNA 5D4OA 2DVIA 1XWLA 2DR8A 2JJ4D 1S6UA 1SPBP 3Q83A 4YB6A 2QL9B 2RUSA 4P7VA 1FHTA 3QIPB 5K8PA 4USKA 3CTRA 2VA3A 2IYIA 3TAQA 2B7CB 2MKYA 4GO7X 4K4YA 4U7UK 5CCLA 2OPSB 3BV8A 3IRXA 5HO4A 2RILA 2HZAA 1RTIB 4ID8A 3FCVA 2RIJA 1ZAVA 2U1AA 3HP6A 2VPZB 4J9MA 1JNZB 3K8WA 2ZJQQ 4A8WA 2DITA 1L3VA 2WAQD 2KHCA 1KLMA 3KLHB 5L8RC 5KT7A 1B7YB 1NRKA 2DO0A 4QWEA 1HNXJ 1X4DA 4IRDA 1A7GE 1PG5B 3CVKA 4O0IA 2R2UA 2QA4S 4OJ1A 2VZ9A 1RT5A 3OFHA 1RA7A 2C3MA 3VGVA 3W5XA 1PO6A 4URSA 1E6VA 2MY8A 4ENOA 1BY9A 2B9XA 4FVMA 5K5MA 3MMJA 2XLIA 4ED1A 3MMCB 3HFZB 4LF8J 5A8RA 1AXQA 1S9EA 4NLTA 5B0AA 2VFTA 3GJQB 3V4MA 1QUPA 2HAFA 2DR6A 3I56S 1N33F 2ATCB 1U2FA 1HBMA 3EUNA 1DLOA 3GCWP 3MF5A 2BM0A 4KO0A 4YFUA 2HMIA 1DQ9A 2IRUA 3BYRA 4DPUA 4A4JA 4RW8A 1RAHB 3E8OA 3KK2A 4I1TA 3VALA 2DRAA 1CS4A 3MEKA 1LWEA 3DLBA 3KG1A 1Q16B 1CG2A 4ANCA 4EBCA 1LW0B 1UA1A 2KHDA 1U1OA 3CC7S 5HQLA 1NJXA 3PZPA 3OLBA 2YKMA 3JTNA 4K59A 2M3DA 3KUGA 2W25A 4F50A 5A8WA 2HHTA 2H48B 3FSYA 3VCDA 1H2VZ 1FRIA 5GVQA 3ZO7A 5A8KB 3FRYA 3H5UA 1S0MA 2RVJA 1RT3B 2QFIA 3BBBA 4WBFA 2X1GA 3HJFA 1FESA 2EG2A 2YNFA 4EYIB 5DGAA 1KDNA 3CC4S 4B3TJ 4K0KF 3TX8A 2R7WA 4ECQA 1S99A 3MAAA 3ONQA 1IKWA 4AXJA 4TQRA 1HBNA 1IR2A 3SFUA 3PTWA 1U4BA 1S4EA 2ZFHA 1KD1T 1NDPA 2J9DE 1O6XA 1M5PC 4KH0B 3AD7C 2WSCC 4ZJLA 1FVSA 2YNIA 4CLTA 2BJDA 3H90A 1L5UA 3FCWA 4OYMA 1RBLA 2VBYA 1OO0B 3CF5Q 2JVRA 3HULA 2KFYA 3CD7A 4NI2A 3HXMA 1RYSA 3BPDA 4I68A 1J5OA 4IH7A 3DOLB 2E5LF 4DV1J 5J2PA 4B9LA 1XJWB 1Q82T 2AP6A 3A13A 1FRMA 4ZKAA 5AJ3F 1HI0P 2R8JA 4OHZA 3FSIA 5K8MA 3IRWP 4PUOB 3CT9A 1MNEA 4HVZA 4JI5J 2QO3A 2KT5A 1Y7PA 3SCLE 2GIRA 2LMIA 1SJ1A 3Q8PB 2KTQA 1NK6A 4DQIA 1YX2A 4OHWA 4OYIA 2W01A 4IFVB 1H73A 2IRXA 1WG4A 1VQSA 2U2FA 3CIZA 2FLOA 3ET6A 3OR1B 4DBQA 4DV4F 1C2PA 1JB0C 3IMQJ 4LBPA 4F02A 2FVPA 1WC4A 4DSIA 4KHPF 4U9RA 4ED5A 3KHLA 4OI0A 4G1IA 4DQRA 4WTYA 2Y8WA 1WOPA 3W9HA 4F25A 3RRHA 1EIYB 2FUG9 2RH3A 2B9YA 2CJAA 3IN5A 5E3PA 2DHSA 2AJFE 5KFUA 2V4QA 2HQ3A 2KYXA 2RKIB 1KN6A 1HQUB 3DC2A 2J8AA 1YJ9S 1EARA 5D4LA 1XC9A 4HI2A 3TEGA 4GC7A 4C2MA 3DLLQ 3V2UC 3T1HJ 5EHHA 3GFXA 4HYKA 1MWQA 3EM1A 1YRUA 2AF6A 2HK2A 1SB6A 1RT7B 2IRYA 2YWGA 1WSRA 1SC3B 1RWNB 3N6MA 5HAOA 1FRKA 1RT2A 3G82B 3CW2C 3SSSA 2YQ1A 4BC9A 3D0GE 1FO1A 4B9MA 3NGUA 4I2PB 4FP9A 4CO1A 5DQIA 1FXRA 5J1EA 2KM8B 1KONA 1CJTA 2F65A 2GHPA 1T05A 5HN0A 1P6TA 2MHEA 1FRJA 4PWUA 4RKUC 3MECA 3OSPA 3RAXA 1IKYB 2ZOMA 3BO3A 1X0PA 3I32A 4RW4B 2DXDA 3J7ZT 5CQGA 4DR3J 3U02A 1X0FA 4FZVA 4CYUB 2Y0BB 1N52B 3CSKA 1RT7A 1ZS6A 4NLVA 2KZZA 4OZJA 4M5MA 2MGZB 1DFDA 2RD5C 1A0OB 1YJTA 1N34F 3AOBA 4ZIVA 5KFSA 1GNKA 2HFNA 4ED3A 2E1RA 2F8EX 5F8GA 4RL1A 2GMHA 1D8ZA 3M8SA 2ZE2A 3KLFB 3ZTSA 3ADAC 4ZVPB 4ZCLA 2MQNA 4P6QA 1KQFB 1UEUA 3BQ1A 2PFFB 1OY6A 3HDSA 4H4KC 4YN3B 2MKKA 2MQPA 2OFHX 1CJUA 4G1QB 1VR6A 1W2BR 4F3MA 2L9NA 1FKPA 3T9ZA 1IUJA 2MYFA 2NXCA 3MZIA 4Y28C 2HGMA 3G9CA 1IKVB 4DV5J 3M30B 1HD1A 3P5BP 2JEFA 3KWMA 3GILA 3B54A 5L1KA 4F4ZA 3CC2S 1PC4A 5F8MA 3DRSA 4HKQA 1RKJA 1IBLJ 3D6FB 1U6BA 3A3OB 4ED6A 1KFSA 2AJ2A 3QIPA 1Z1ZA 3MTJA 2YH0A 3L7UA 4Z7YA 5LXRA 3FBFA 5CYJA 5DGBA 2YNIB 5I42B 5KFYA 3GV7B 1RP5A 2FGCA 2FHJA 1WTFA 3AHPA 4L72B 3RAQA 2CJKA 1WWHA 1OY8A 3QLHB 2XC9A 1T9WA 2XS5A 4USHA 1V6HA 2B7BB 1HNVB 4Y2CA 4ZVOB 4FF3A 2VODA 5H9FJ 4O3NA 4B9NA 5AXLA 3QQCD 3DOLA 4F0KA 5IXUA 1HMVA 4RWXA 4OX8A 1FKPB 2CFXA 2DGQA 5B0GA 2NXJA 4QPXA 5F8LA 4N5SA 1FA0A 3RB3A 1U8WA 3M30A 3TZXA 3QT5A 1VBKA 3DRYA 3EZUA 2XBPA 3NKYA 4KSEB 4PG5A 1S1VB 2QG9B 5JVHQ 5L46A 6AT1B 1OIAA 2J76E 4NA3A 9ATCB 4IR9A 1JMTA 1Q5VA 1S1XA 3K57A 1MLAA 1WI6A 2HFOA 2CNOB 2C42A 2HBQB 1VQ8S 2V94A 3R6GB 4F26A 4KFBA 4J37A 4YB1P 1CSJA 3HHLC 2IM2A 4DMZA 1LEOA 1UETA 3A8IA 3ISND 4ZVFA 3TVZA 2CKWA 1PKUA 4IH5A 4DF4A 1NKBA 1R0CB 2NSBA 5LOQA 4NMXA 2ZH1A 4DLGA 3CJ2A 4USVA 4O3OA 1F3FA 1O5JA 2DCLA 2DHGA 1GTEA 3UE2A 3KLGA 1ROFA 3B6BA 1LW0A 2V8HA 4O0NA 5LMNF 1X9SA 1ITPA 1ZM3A 1S79A 2YKMB 3BYPA 3GLJA 3LH2S 1SC6A 2EVZA 4PG6A 5DM6Q 5EWGA 2EEYA 2XS2A 2BDPA 2KT2A 3ZTOA 1S1VA 3Q0AA 4A8KA 2WCXA 2JNJA 2RS2A 1S1UB 2G2ZA 4WYWA 1B0VA 5KG2A 2ACYA 3BSNA 1U09A 1RT6A 1RTZA 2MKCA 3GIRA 4Y3CA 3ZZZA 2XY5A 4PYDA 2DY9A 4AXIA 2R7TA 4MYTA 1C1BB 4KFBB 3R2DJ 3I6PA 3GV8B 2KH9A 3KLEB 4BHQA 1YBAA 5KFKA 3Q8RB 2ZD1B 3EXCX 3HKZD 3IGVA 3JAMY 3MFHA 4NCAA 3TOQA 2KI2A 1SL2A 4OX9J 1Q79A 3D0IE 4ZMMA 1VRTB 5IT0A 1X9MA 3SCJE 1M5VC 1FF2A 4YOEA 3SYZA 2R4FA 1RTJA 2OTLS 1NBEB 3LWMA 2Y9HA 3EGZA 1NB7A 1ACMB 3CD6S 2XLJA 4DPYA 4B3OA 4H4OA 4DL3A 2Z57B 3KYLA 1T3OA 4CH7A 3HO1A 2KXFA 1NZAA 4DV0F 4M5JA 5D0HA 2KG0A 3GU0A 3MAHA 4MKVA 3M8QB 5AJ3J 1UFWA 2AW0A 3FNNA 5IT9U 2V68A 3JYTA 2NUUG 5C5JA 4C8NA 2V69A 2FVCA 4DX7A 3JTPA 1N36F 2LU2A 4ZP9A 3RYLA 5ETLA 2VF3A 1TL1B 2CRLA 1WHVA 2RRBA 3BM7A 3ZZOA 1M1KT 1RHKB 2MZSA 5KTQA 4PG8A 2W4DA 3BGUA 1R8AA 1YRTA 3V4IA 3W5ZA 4X62J 3OUYA 1HWKA 4B3MJ 3K5MA 2BKPA 1U6FA 5J2MA 4V19J 2ZH2A 2BBEA 2OPPA 1SJRA 3JQJA 4GVLA 3I4HX 3NCQA 4JYAJ 1H6KX 2YWKA 4AT1B 4U67Q 1VQ9S 2R9LA 1JNRB 1TK8A 3V6DA 1I51B 2JFDA 3ULHA 4JV1A 4NXNF 2ERRA 1UZHA 4HTIA 3W61A 1SUQA 2HGLA 3LALA 8ATCB 1S4FA 4ECSA 4F7VA 1KR4A 4J7CA 1QJHA 2FJBB 3OL8A 3VGUA 2W9BA 4A47A 1LV5A 4MFBB 2JC0A 3CNQP 4WCEQ 3HI9A 3HT3A 1KVIA 4ZPAA 3J80U 5IC6B 3HHNB 2FIUA 1A9NB 1FX2A 4OZ3A 2JFKA 3K5LA 1CS4B 2LLZA 3NS7B 1U1RA 4P75A 1KBRA 3CO9A 4ILLA 2GVDA 3GIMA 1GH8A 1TL3A 3IS9A 4H4MB 4FF1A 2DISA 3G6XA 2XYPB 1I1GA 4NMLA 4UOGA 4PXCA 5AE1A 2DNGA 2Q6CA 4JI6J 3M7VA 3MPYA 2XGPA 4X4NA 1HHSA 1I5OB 2CXEA 2R42A 3MUMP 4RW4A 4CWBA 3ILLA 1U47A 2C2RA 2EBEA 3POTA 4NOHA 1TKZA 1NLKL 1I3OB 5DDPC 4F3OA 5A6WA 3H5XA 2ZWOA 2H4YB 3DOMA 1KQKA 2QSWA 2FZGB 2VKZG 1IBCB 2ASDA 2P8IA 5M2RA 2P6SA 2CJBA 4KPYA 3MGJA 2HHPA 3HX9A 4NX9A 4O4GA 1RCXB 1UL3A 3UCUP 4A46A 1V3SA 2XNQA 3BPSP 4WTOB 3QZ8A 1KHVA 3N4WA 4MMOA 5FD1A 1UFKA 2AD9A 3BKFA 1IBKJ 1N32F 1RT5B 4OYWA 2K3KA 2AYMA 5KFVA 5HROB 3K7RA 1VQKS 2HHXA 2J8SA 1Q95G 2VUGA 2LXUA 1RLCL 1FNXH 2QX0A 3P4UB 4ZPBA 3SCIE 2YNGB 3HHDA 1O51A 3N79A 1CC7A 4K8RA 4XO0A 3P49B 1Y00A 3GJSB 4PQAA 4USJC 3THTA 4C98A 3T1YF 2I2YA 1QLNA 1CULB 2GC8A 4NA1A 2C3OA 1X31C 5GMKa 3M8PB 3W62A 2R8IA 2F8HA 2YWWA 3MCNA 2B43A 1DQ8A 3NWGA 4TYBA 3PDNA 3NCRA
chains in the Genus database with same CATH topology
4FDFA 2IIHA 3JQJA 3JQMA 2EKNA 2OHDA 4PYDA 2EEYA 4PYAA 3JQKA 1EKSA 2IDEA 1EKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FDF A;  2IIH A;  3JQJ A;  3JQM A;  2EKN A;  2OHD A;  4PYD A;  2EEY A;  4PYA A;  3JQK A;  1EKS A;  2IDE A;  1EKR A; 
#chains in the Genus database with same CATH topology
 2CPE A;  5I42 A;  1AT1 B;  1Q53 A;  4DSL A;  3T5H A;  2FHM A;  1HQU A;  1S0N A;  3NRB A;  3G6E S;  1GK8 A;  2GW8 A;  1FJC A;  4I4B A;  2CQ3 A;  2HS3 A;  4DJB A;  1PAE X;  1I6J A;  2YX7 A;  1HKA A;  2FQQ B;  1RAD B;  5KFN A;  2WVB A;  3VZH A;  4CLW A;  2DHA A;  3OHA A;  2B4V A;  3BRE A;  5C7P A;  3DLK A;  5ETQ A;  3N6N A;  3ZZU A;  4USM A;  3HHK A;  1U6Z A;  4N47 A;  2C2Z B;  3R1H A;  2XZT B;  5D3G B;  2RB7 A;  1ZM9 A;  1HLW A;  4O23 A;  3SZ2 A;  2MSS A;  3TQ1 A;  1R6Y A;  1WSV A;  1ZAX A;  2DCU B;  2RML A;  3DYA B;  3SMZ A;  5D6G A;  4GKK F;  1FJG F;  1NJZ A;  3DI6 B;  3DDN A;  2EI5 A;  2HLT A;  3TZW A;  4ICL A;  1HNZ J;  3PKY A;  1NH8 A;  2LDY A;  4F0M A;  2VIH A;  1Y11 A;  1EB0 A;  1YJU A;  3LPY A;  3U1M A;  5F8I A;  2FHK A;  1NK5 A;  1TUV A;  4DL4 A;  1LFW A;  2FTR A;  2YVS A;  1WJ9 A;  4E8U A;  5D4N A;  4FF2 A;  1X7V A;  3L7O A;  3OTE A;  4M5N A;  1ZH5 A;  3NNA A;  3ETM A;  1MML A;  4FYW B;  1RAJ A;  1VC5 A;  2BYC A;  1KKH A;  4CLZ A;  4Y2M A;  4ZIW A;  4ED8 A;  2XMU A;  3C2P A;  5HBM B;  5ETV A;  1T03 A;  1D3W A;  2VBW A;  3LAN A;  3TP2 A;  4DZ6 A;  1KLN A;  1B64 A;  3GSI A;  4DL2 A;  1S1U A;  1IKW B;  4GRS A;  3HF5 A;  2KYZ A;  2VPW B;  1Y5N B;  2APO A;  2DNY A;  3NEK A;  1VMB A;  1PAU B;  1Q0N A;  1S7H A;  1EQ0 A;  4ICL B;  2NZC A;  2H4W B;  2YX4 A;  4L6V 3;  4TU9 A;  2PMW A;  2H1Y A;  4QIW D;  2ZZN A;  1S6P A;  4R25 A;  4XAK A;  1HWL A;  4AL6 A;  3V6H A;  1CC8 A;  2FLP A;  4RBU A;  5LJ5 Y;  3CJS A;  4WYL A;  5FDL A;  5EGY A;  4CLU A;  3KMQ A;  1YWX A;  2OP5 A;  5D15 A;  4RW9 A;  4LF5 F;  5F8J A;  2ILY A;  5H9E K;  1QE1 A;  3DLJ A;  1Z4U A;  1RAA B;  3G87 A;  3DRS B;  2LEB A;  2VPX B;  2J7K A;  3BF4 A;  4LFA F;  3M6X A;  3HFK A;  2MB0 B;  2MZT A;  3MUR P;  2UU9 J;  4QWA A;  2BXJ A;  2WBR A;  1FFG B;  5E5N A;  1B7F A;  3AT1 B;  3OVA A;  2IDE A;  3WBZ A;  2EFN A;  2K1R A;  4B02 A;  5HRO A;  4QWB A;  2CPD A;  3NBP A;  1U49 A;  1M0S A;  4DR1 F;  2BW7 A;  3TAM B;  1T95 A;  1E6Y B;  5DDR C;  1IR0 A;  3UCG A;  3Q2S C;  1FEE A;  5LMU J;  1WHW A;  3GG0 A;  4QZV B;  3PW2 A;  1DJ0 A;  2QV6 A;  3NAH A;  5ETO A;  3KKF A;  4NLS A;  4OZL A;  1QUV A;  2XMA A;  4X4U A;  3UD4 P;  4PWD A;  4P7T A;  2XY6 A;  2OO4 A;  3B4M A;  4NPO A;  5DS7 A;  5HP1 B;  3KK1 B;  3SDE B;  1JQG A;  2NCK L;  2J0W A;  4LRE A;  4LFB F;  2BRK A;  5E7O B;  2OI2 A;  2MDA A;  3EPG A;  2ZH4 A;  1TL7 B;  1T9V A;  4RW7 B;  5L1L A;  2MKJ A;  4OX9 F;  2RDJ A;  1VQP S;  4QQB A;  4I2Q B;  1SVD A;  4TY9 A;  2HZV A;  3GB0 A;  4UOC A;  2XLK A;  5IT4 A;  2IJR A;  2BOA A;  2YNF B;  2Y1L B;  1NO8 A;  1TFW A;  2KM8 C;  1VJQ A;  3O5T B;  5HK4 A;  2C2O B;  1HIY A;  3M8Y A;  2FVS A;  3VVU A;  3FQL A;  1YIT S;  5DET A;  3IR6 B;  4PWW A;  3IWL A;  1TL4 A;  2F5G A;  3EMT A;  5AXK A;  4DPX A;  1S97 A;  3FK4 A;  4NLP A;  1LWC B;  4OV1 A;  5BYR A;  4IOA Q;  2HHS A;  1N88 A;  2BAN B;  5F3Z A;  3QRQ A;  1FK9 B;  3D1H A;  4Q7A A;  1RWU A;  2CPJ A;  5F3T A;  2ZH7 A;  3VAH A;  1WC6 A;  1JX4 A;  2FLL A;  4WIQ A;  2HVH A;  3RRK A;  3FUY A;  5DG8 A;  4DCO B;  2RRN A;  1JK9 B;  3BBC A;  4OFZ A;  4B9T A;  4HLB A;  1SKR A;  1J5E F;  3RBZ A;  1IQT A;  4R8U B;  1AYE A;  1QAY A;  4DFK A;  3RU0 A;  2WON A;  5KG5 A;  2XM3 A;  2J9D A;  4JOU A;  1FDD A;  1Z2L A;  2W2O P;  2UUA J;  5KFE A;  1F2H A;  2MLZ A;  4GMK A;  4Q0B A;  4PG4 A;  1RT4 A;  2KL8 A;  2FVQ A;  5CXT A;  2DPJ A;  4DUZ F;  1WI8 A;  4FDF A;  4JP8 A;  2IVM A;  5F8H A;  1DQA A;  5J2Q B;  2GGP A;  1UWA A;  3AAW B;  1S76 D;  2NS1 B;  5HMX A;  3S7R A;  4CNY A;  1C0U A;  2VV5 A;  2R7Q A;  4ILR A;  3T41 A;  2WW8 A;  2BAN A;  3R5B A;  5E0O A;  4Z2X A;  4IG3 A;  5HMW A;  5L9N A;  1ZET A;  1RWK B;  2Q43 A;  4UQG A;  1U0H A;  5EWF A;  4ZLP A;  1H98 A;  1NJW A;  2DGS A;  5BYS A;  1HI8 A;  4OHX A;  1XNQ F;  2OFG X;  4LR9 A;  2O5D A;  3T19 A;  4C8K A;  2BJ1 A;  2NLW A;  2V8G A;  3KUH A;  3JSB A;  2J0S D;  1EET A;  1ZBT A;  1N34 J;  1VQY A;  1KQG B;  3OXG A;  4I0W A;  4OJ3 A;  2OD6 A;  2EW9 A;  2XMJ A;  3FQK A;  1RGV A;  3LGM A;  4MTP A;  4LIW A;  1AFI A;  4OHV A;  5KFT A;  3UDV A;  2CG8 A;  2DNQ A;  3EE3 A;  2K2P A;  1YKW A;  3CMA S;  2Z0G A;  2IJF A;  3T5L A;  3JYT B;  1PYS B;  4PXB A;  4JYA F;  5CZX A;  3QLH A;  4OZ5 A;  2V6A A;  4DR7 F;  4W90 B;  4LF6 J;  3OVB A;  1LOU A;  3MMA B;  5IOL A;  3T3F A;  3R9L A;  2KRB A;  3E01 B;  2EFO A;  2E9R X;  2EFP A;  1SV5 A;  5LJ3 Y;  3EGN A;  1YJV A;  4JI1 F;  2DXF A;  2G0I A;  1CBK A;  2CPI A;  4HAC A;  4PR6 A;  1WG5 A;  1OPI A;  4YME A;  2P2C B;  1HR0 J;  2BRL A;  4MIA A;  3A4T A;  2V2V A;  1Q81 T;  2DR7 A;  1URN A;  2R3V A;  2AGP A;  2LKZ A;  1ZTW A;  4KIA A;  4LBH A;  2OH2 A;  2K8G A;  3R1L A;  4JI7 J;  4URG A;  3HVT A;  5MAO A;  3LPE A;  5GAD U;  1CLF A;  4C9D A;  1FWK A;  2NYI A;  2P6T A;  1RT1 A;  3C66 A;  3M6V A;  4ED7 A;  4CLP A;  2LP4 A;  1VHF A;  2E7W A;  3KLI B;  3MPV A;  3US5 A;  5DG9 A;  4O44 B;  1RCO B;  2UUA F;  1J2V A;  5IWA F;  2FJE B;  1XER A;  2AZ1 A;  3DHX A;  4DR2 F;  2UUT A;  3BN4 A;  3DLG A;  4YB7 A;  2J9E A;  3L4B C;  5F9L A;  1J5E J;  1UW4 A;  3KNA A;  1Q1K A;  2OTJ S;  1KC8 T;  1TTH B;  4DX5 A;  1HNI A;  2DGV A;  5L1I A;  1MW7 A;  1WEY A;  4O3R A;  1SBR A;  4A8X A;  2HS0 A;  3LGN A;  4G65 A;  3CO0 P;  4EZ6 A;  2JEI A;  3QAU A;  2AHO B;  3TAR A;  2KVI A;  1FD8 A;  5F41 A;  4CH1 A;  2MTL A;  3H5Y A;  1HBM B;  2JC1 A;  1V3Z A;  3P96 A;  3T9N A;  1YI2 S;  3NS6 A;  3BJY A;  4ZVT B;  1N54 B;  3CED A;  1VBX A;  2DGU A;  5G0R A;  1X4C A;  2QA1 A;  2AIR B;  1XEZ A;  1BQX A;  2EKY A;  3KUE A;  1RWX B;  1FE4 A;  2ACM A;  3IXQ A;  5HSP A;  5FLX U;  2IIH A;  5KAK A;  2PFD A;  4P73 A;  5CH7 B;  2E66 A;  1WNE A;  3K17 A;  2MJU A;  4UTG A;  2ZJR Q;  2ASL A;  4OI4 A;  2E7V A;  2Z2Y B;  4JI2 F;  4ES3 A;  5DQG A;  1NDK A;  2V8P A;  2YPY A;  2ZIT A;  3MMB B;  1FK9 A;  4QWD A;  4RU9 A;  1M5K C;  2W2M P;  3VHQ A;  3OJS A;  1V3R A;  4FXW A;  2CQI A;  2FB0 A;  2JDJ A;  4JB8 B;  1HMV B;  2CVI A;  3OR2 B;  2Y3Y A;  1T8E A;  5E33 A;  3ZZT A;  2W8L A;  4C7Q A;  5ETS A;  2CQC A;  4DV5 F;  4YR0 A;  3ISZ A;  4ID5 A;  1HD0 A;  1QAX A;  2WVC A;  2L3M A;  3PFO A;  4DSK A;  3MEE B;  2GAG C;  2HRT A;  5B0F A;  4Q5V A;  3UW1 A;  1YIJ S;  2R7U A;  5B0C A;  1KRP A;  1JWW A;  1HBO A;  2YWF A;  2LQ8 A;  1U1M A;  2ZC4 A;  5H1S V;  2OEJ A;  3S1T A;  5L1J A;  3BDP A;  2KXN B;  2Q3P A;  1JJ4 A;  2UUC F;  2W7A A;  1LWF A;  3HSG A;  3JSR A;  1UZD A;  3BH6 B;  4HHJ A;  1BXN A;  4RW6 B;  4C6A A;  4FYY B;  3D4J A;  4A8S A;  1BWE A;  3DRP A;  1N5Y A;  4F67 A;  2PEH A;  2IM3 A;  2W4P A;  3CPW R;  5H9E J;  1JJ2 R;  4FVC A;  2LQJ A;  3GV5 B;  1X4F A;  2Y1I A;  1Q8I A;  2RQK A;  3MM7 A;  4WXW A;  5T14 A;  4NYP A;  3SI8 A;  2HS4 A;  4NYZ A;  2XG8 A;  4F2R A;  2YPZ A;  2BJ3 A;  3H40 A;  3FBC A;  4DFJ A;  1VIS A;  4DDF A;  1NME B;  4KGM A;  5JMN A;  3CE8 A;  4IFV A;  2UXC F;  2AZ3 A;  3VR1 A;  2R7X A;  4ZVR B;  2VQE J;  2GHV C;  1U45 A;  2KFN A;  3HZE A;  4RU2 A;  4NLD A;  2R2S A;  4KQZ A;  3N6L A;  3PAC A;  2DNN A;  1QVG R;  4PZV A;  1JLF B;  1JLQ B;  1S7I A;  2V2Z A;  3FBE A;  1WHX A;  2FY8 A;  2IBO A;  1R27 B;  1JLG B;  3D6H B;  3FJ2 A;  5DLG A;  4X65 J;  4X65 F;  3VAK A;  5HMY A;  2N7Y A;  2Y8Y A;  1HPZ B;  5J2N A;  4DL5 A;  2POK A;  2D3U A;  3MPD A;  3MM7 B;  1DAX A;  3D28 A;  4M5L A;  1R8P A;  3U7J A;  4F4A A;  4ER8 A;  1N32 J;  5HL7 Q;  3OVS A;  2XZW A;  1K1Q A;  4H4M A;  1GMW A;  4WXO A;  2X3D A;  4HDH A;  5HMZ A;  1YBT A;  4EEY A;  4MYU A;  1NAQ A;  4BWM A;  5DJB A;  4F3Q A;  2IJN A;  4WK3 A;  4LQ3 A;  1ELO A;  4FBU A;  1SJF A;  1SJ3 P;  3BSA A;  4IR1 A;  2RRA A;  2IDL A;  1TL5 A;  1S9G A;  2W2N P;  1N8R T;  3DOM B;  4WP9 A;  4F04 B;  1S6P B;  1LXN A;  2KJW A;  3LA0 A;  1T02 A;  2V0N A;  1UP1 A;  2WSF C;  3OL9 A;  3M8R A;  4WPA A;  1WC0 A;  5IC4 B;  3FMB A;  4O4G B;  3FEX B;  3HHL A;  3W66 A;  3TJ8 A;  4DR3 F;  3RB6 A;  1FD2 A;  2LA6 A;  1RIS A;  3GWC A;  3TVK A;  4E0D A;  4DL6 A;  4ZP8 A;  4C0B A;  5KT4 A;  4IO9 Q;  2BOP A;  1FKO B;  3IFE A;  4O4R A;  4TY8 A;  1RAG B;  2BEF A;  2DNM A;  2M4M A;  3LAM A;  1AZS B;  2PD1 A;  3SBM A;  3PRB A;  3VAG A;  2SXL A;  5E3Q A;  2D3O 1;  7FD1 A;  5HQM A;  1FDA A;  2GJF A;  1QSL A;  4EK2 A;  2RT3 A;  4PPZ A;  3W2V A;  2GS8 A;  2EG1 A;  1YJR A;  5DG7 A;  1NCL A;  5CAA A;  5D4P A;  3CCT A;  3GZ7 A;  4CM0 A;  2DK2 A;  1RTI A;  4Y2I A;  2H5E A;  5AT1 B;  5CA5 A;  2YXL A;  5EDW A;  3G96 A;  4DV1 F;  2JEG A;  5GMD A;  4JV5 J;  2E5L J;  2V63 A;  4G3I A;  3S8S A;  5F9N A;  3Q24 A;  1XMO F;  1UJ5 A;  2MZQ A;  3CJK B;  1B3T A;  3KHR A;  4X2B A;  4UUX A;  1C4A A;  5ETR A;  4M5I A;  2GQQ A;  2EC2 A;  2W2Q P;  3R97 A;  4NI2 B;  4TQS A;  5KG4 A;  3CJR A;  3VTI A;  3ZTQ A;  1F5A A;  1N5Q A;  3I87 A;  4K0K J;  2WZ1 A;  3H5S A;  4QU6 A;  1NK0 A;  1P27 B;  4PUO A;  3THP A;  4WJB A;  1VQ6 S;  3W9J A;  4LF6 F;  3PJW A;  2DIU A;  1S5Z A;  1W2I A;  2K7J A;  1Q7L B;  1UEV A;  1EJ7 L;  2VG5 A;  3HD2 A;  3PG9 A;  3NMA A;  2HIQ A;  2XI2 A;  1QD1 A;  2NYH A;  4Y34 A;  2FJD B;  5IV4 A;  1IBL F;  2G1D A;  3W9I A;  1XTZ A;  3CJQ A;  1RHU B;  3AOA A;  3LP1 B;  4C11 B;  1TKT B;  4J9L A;  5K20 B;  3MM5 A;  1RQ0 A;  4OYO A;  4P72 A;  2W7P A;  3JQK A;  4CT9 A;  3B82 A;  3GTY X;  5FDL B;  3CCR S;  2V4J A;  4WP8 A;  3R5D A;  4ECY A;  1AW0 A;  3K89 A;  3Q8S B;  2VQF F;  1KTV A;  1P1L A;  2XGQ A;  5MLC V;  4JI7 F;  1JLB B;  4JV2 A;  1CEZ A;  3LTO A;  2DEI A;  3KG0 A;  4J5O A;  3KNG A;  5D0E A;  1MU2 B;  2D1C A;  5C42 B;  3PIO Q;  3EZ5 A;  2B4P A;  1WF1 A;  2YWH A;  3SFG A;  3MEC B;  1RAO A;  4ED4 A;  1B0T A;  1T03 B;  5K8O A;  1QSS A;  5KFZ A;  3MM9 A;  2E44 A;  1XMQ J;  1HBN B;  1TEL A;  2XTJ P;  4QIE A;  1S9F A;  1L3T A;  3TA2 A;  3T5K A;  3EDQ B;  4TNO A;  3QJP A;  5ADZ A;  2YY3 A;  4JI8 F;  2QZ8 A;  3I0S B;  3ITH B;  2MZR A;  3J81 j;  4B3S F;  1KEK A;  3CWJ A;  3ZTR A;  2M8D B;  3NNH A;  3RAM A;  4JBC A;  4Q0B B;  2OPR A;  3MFI A;  5LXY A;  3DXB A;  3RGI A;  1TQL A;  3KJN B;  2AQ4 A;  4ERD A;  1LNQ A;  4TU7 A;  2UXB F;  3R5C A;  1SC4 B;  4Y65 A;  2JOQ A;  4TU8 A;  5J2Q A;  5KFA A;  4QR2 A;  2DTJ A;  2IA0 A;  4CI0 B;  1SKU B;  1C1C A;  1CJV A;  1RXO B;  1EET B;  2R7O A;  3AA9 A;  1WKL A;  3DMJ A;  1BD6 A;  3IBF B;  4YB5 A;  1LFP A;  3RG6 A;  2CJY B;  1RHQ B;  4Y00 A;  3OT9 A;  1FFW B;  4X4T A;  3OFF A;  2LU1 A;  2DO4 A;  3I55 S;  2WVF A;  4ATN A;  2CZ9 A;  2DD8 S;  5C2C A;  3QPI A;  4FYV B;  2CIM A;  3W65 A;  1S6Q A;  3C6T B;  4Y0F A;  1N5S A;  3MDF A;  4F8R A;  3DYA A;  1SXL A;  3M4X A;  4DN0 A;  1VQ4 S;  1KLM B;  3KLH A;  2PC6 A;  2C1E B;  3GP9 A;  2JEJ A;  3CUN A;  2FZC B;  4RPF A;  5IM0 B;  1WF0 A;  3FBB A;  3BQ0 A;  3ZNJ 1;  1X4A A;  3FSX A;  3A8K A;  2ZDP A;  1FER A;  4IKA A;  3CIM A;  3UO0 A;  2LXF A;  2ZBQ A;  4O3S A;  4J9S A;  1N5Y B;  1S77 D;  4OI2 A;  2F4V F;  3MPW A;  2VH7 A;  3MCS A;  1NEE A;  1M1H A;  2C3P A;  1TL7 A;  4RW7 A;  4ZS6 A;  1SV5 B;  2E9Z A;  1FEH A;  4MH8 A;  1RTD B;  4DR6 J;  3HVT B;  1IKV A;  2HWI A;  3NGT A;  4ZLL A;  1IWA A;  3CMQ A;  3T1H F;  1RWW B;  3EWG A;  1IBM F;  1IBM J;  1HHT P;  1JXV A;  2P9G A;  1RU2 A;  4P2X A;  2HFZ A;  1SIZ A;  4DG1 A;  1Q8K A;  1P9Y A;  1R8C A;  2HBR B;  2XYG B;  4I6Y A;  5HVF A;  1VHI A;  3ENV A;  5I3U A;  3E3X A;  2M8H A;  2EK1 A;  4NLG A;  2EC0 A;  2Q66 A;  4DR2 J;  4ZCI A;  2EKN A;  3GJT B;  4C0H A;  2JHE A;  2N3L A;  3PY8 A;  5D0G A;  4F0H A;  3JXO A;  4ZP7 A;  3Q86 A;  4NLR A;  1PGZ A;  4WZQ A;  3O6Q A;  2DBB A;  4N8N A;  2XWX A;  5KG1 A;  1RTD A;  1M5S A;  1W25 A;  2C3Y A;  4KHM A;  4RW9 B;  1OQ6 A;  3FCH A;  1YZ6 A;  2ADC A;  3TW0 A;  4OYZ A;  1P8G A;  3H2L A;  3J7Z 5;  4DR5 F;  1B4S A;  4ZPT R;  1UWB B;  3VAI A;  3NMR A;  2C2N A;  1OY9 A;  4XDC A;  2B6A B;  7AT1 B;  2XMK A;  4RBV A;  5H9F K;  4QR1 A;  1UKU A;  2DNR A;  3M1V A;  4CP5 A;  1RJJ A;  2O1P A;  3L9Z A;  4JI1 J;  2PSZ A;  1VDH A;  3C14 A;  5DZ7 A;  1U1K A;  4B9V A;  4U7U D;  5FII A;  2JRS A;  4HH1 A;  5BJR A;  3KLV A;  1Q78 A;  1NXI A;  4FNH A;  3MMB A;  5IQQ A;  1PBA A;  1EKR A;  3OQ2 A;  1PJ6 A;  2NSC A;  3D1Q A;  4ECV A;  4O3P A;  4LF9 J;  2IC3 B;  3NCP A;  2YKQ A;  2ZBR A;  4CZC A;  3HLU A;  4CO5 A;  2JX2 A;  4P2F A;  3G8T A;  2LEA A;  3QT8 A;  4X4S A;  1N6Q A;  3MCM A;  2XNR A;  1F5C A;  2Z2Z A;  2CQG A;  2GVZ A;  3O3L A;  4P9S A;  4NLW A;  4ZA1 A;  1RKI A;  2AJ1 A;  1N5V A;  2AX0 A;  2N3O A;  4ZPD A;  2AKW B;  4J90 A;  4PQU B;  2D74 B;  1G3O A;  2GQ2 A;  3PX0 A;  3VAM A;  1TK5 A;  1JJH A;  3KJV A;  3L95 X;  1X8D A;  4OZ2 A;  4X4Q A;  1K73 T;  3OBI A;  1U8S A;  2X51 A;  4N8O A;  2J5A A;  1DLO B;  1RBA A;  2PI5 A;  4IFY B;  4XDD A;  5A2Q U;  2BA9 A;  4DR5 J;  1N33 J;  1CJK B;  1IJF B;  1O0P A;  2FJW A;  3GON A;  2GIQ A;  2MKS A;  1ZZN A;  1VCT A;  3V81 B;  4FPI A;  5HLF B;  2HHW A;  2OEL A;  3OD2 A;  4NAS A;  4DU7 A;  1LWC A;  3A12 A;  3UDE A;  2VAS A;  3OXF A;  2LQ5 A;  2I5J B;  2KU7 A;  4DCP B;  2O3D A;  1WTB A;  1UVN A;  2HPU A;  4DV0 J;  3J7A 1;  2O01 C;  1NDL A;  3G2X A;  1HBU A;  3AD9 C;  1RA6 A;  1F2G A;  5E41 A;  1P9Q C;  3MM8 A;  2UUB F;  2GO9 A;  1TP7 A;  1Y3K A;  2M70 A;  3M8P A;  2W1B A;  4WU3 A;  5J1N A;  2VG5 B;  3JS9 A;  3PEJ A;  1NKE A;  3C16 B;  2ZNY A;  4ZJQ A;  5AXM A;  4KBI A;  1XIQ A;  4QBU A;  2ZHO A;  5IM0 A;  4PXD A;  3KG4 A;  2DPI A;  1HQE B;  3IP0 A;  5F0U A;  3LP1 A;  1RSC A;  5EX0 A;  3OV7 A;  2HHQ A;  1D9A A;  2HFS A;  3AA8 A;  2MQO A;  3WC0 A;  2X1F A;  2BM1 A;  5IV3 A;  3DLE A;  1BMQ B;  1URR A;  2XMM A;  1U02 A;  2QTW A;  3P8B B;  4OJG A;  2V50 A;  1GT8 A;  3FZB A;  4C48 A;  3MEG B;  3CXC R;  5DLF A;  4B17 A;  1S48 A;  2YKN B;  3HD1 A;  2M9K A;  1MSW D;  2GJI A;  3DN9 A;  2Z56 B;  3P45 B;  3LP2 B;  1QSY A;  2AGQ A;  2WOM A;  2Z2M A;  2CPH A;  1U2C A;  1T94 A;  3DHW C;  3IGN A;  4CTA A;  5HQ8 A;  1G7C B;  2B5J B;  1F0X A;  4RJV A;  4B3R J;  3N0V A;  2PN6 A;  1PJ7 A;  1WKK A;  1WEX A;  1CQN A;  4IG0 A;  4NWB A;  4Q44 A;  2R8K A;  2HVZ A;  1F1B B;  4U8V A;  5D78 A;  2B0G A;  2PEB A;  3AFG A;  3CJ0 A;  2MKI A;  2N7C A;  5KFR A;  3CCE S;  2KT3 A;  1U48 A;  3WHI A;  2RUG A;  2DGT A;  2OLW A;  5L39 A;  3QRR A;  2UZA A;  3AOC A;  3KK3 B;  4AUK A;  2MMY A;  3G86 A;  4JI6 F;  2NXU A;  2ZKU A;  2BJ7 A;  1K0T A;  5ETK A;  2ROP A;  3MR3 A;  1SL0 A;  3PW0 A;  3OR2 A;  3DRR A;  3PW5 A;  3DOK B;  4BDP A;  2DKO B;  1H3D A;  2CZV C;  4YY3 F;  1VYA A;  1HL6 A;  4GKJ F;  1WAC A;  1X5P A;  2FJA B;  2I8E A;  4J9V A;  5GAG U;  3MUT P;  5CYM B;  4J9K A;  5HBM A;  5C25 A;  3KHH A;  4C8Z A;  1C1C B;  2B4U A;  4X64 F;  1OQ3 A;  3C6U A;  3RB4 A;  5C2G A;  2FZK B;  2ADB A;  2V9W A;  3OTD A;  4GVB B;  3ZZY A;  2XO6 A;  4LR7 A;  2C22 A;  1GMW D;  3IM8 A;  1NSA A;  2ATL A;  3QJJ A;  2ZUG A;  3EXY A;  2OD4 A;  3C14 B;  3M2V B;  5E3R A;  2NUH A;  3BGL A;  2G0C A;  4X66 F;  3X1L B;  3QWP A;  3CD0 A;  3KK3 A;  5B08 A;  2UUB J;  4DV4 J;  3RBD A;  3LQV A;  3QAE A;  3CJT A;  4K5S A;  3N28 A;  5U47 A;  4DFM A;  1N48 A;  3N5B A;  2IM0 A;  4BS2 A;  1OSD A;  3FFI A;  4LFA J;  2M0G B;  5SZT A;  1TL1 A;  4EBD A;  1CJT B;  2QEX S;  2F7V A;  2ROG A;  3IR7 B;  3JTO A;  4JUZ A;  3HZG A;  5RUB A;  4DSF A;  3B78 A;  2ZM6 F;  1PIE A;  5AXN A;  3MED A;  4ES1 A;  1NPP A;  1YGY A;  2DHX A;  2JSX A;  1Y0H A;  2OHD A;  3V4I B;  1WC5 A;  3CD5 A;  2UVV A;  2DGO A;  2OPP B;  4WP3 A;  3TUJ C;  3UN5 A;  4OYP A;  3QGG A;  5GAE I;  4ZLJ A;  4V1A k;  4UOH A;  4N77 A;  3BO2 A;  2HVI A;  4P10 A;  1WDT A;  4M5G A;  4CCH A;  2HZC A;  4ES2 A;  1ZA2 B;  2VJU A;  4ECX A;  2FHJ D;  3RR7 A;  4DV6 J;  4ZVE A;  1CUL A;  1GXT A;  5I4M A;  1JKH B;  4EWT A;  3DM2 B;  1HWJ A;  4CO3 A;  4DG1 B;  6FDR A;  3VAF A;  5GAD I;  3PX4 A;  3TA0 A;  2E1P A;  1B70 B;  3SSR A;  1KS2 A;  2FD2 A;  3Q23 A;  2ZH3 A;  4LF7 J;  3PW4 A;  3RZA A;  1LWX A;  1NKC A;  1RAF B;  2AEF A;  4NLX A;  2PO4 A;  4RR5 A;  1XNR J;  4NRT A;  1RLD A;  3D5M A;  5JXS A;  1HW8 A;  5K14 A;  3SDE A;  2F63 A;  4MIB A;  4BBY A;  2W8K A;  2PI4 A;  3H59 A;  2KZM A;  3H4B A;  3UR0 A;  5J2P B;  2XEX A;  1TKZ B;  5KFL A;  1ZTT A;  3Q2T C;  2X1A A;  2Q79 A;  4J9R A;  4J9P A;  2UXD F;  1SQE A;  1D9D A;  3WQP A;  5JVG Q;  2KDO A;  4W98 A;  1VS3 A;  2QLF B;  2R8G A;  1JJC B;  3DM2 A;  2Y1J A;  3NNC A;  4E98 A;  3HVR A;  4HL9 A;  2G2Y A;  4PAA A;  2EWH A;  4C8O A;  2B56 A;  2QMU B;  4M5H A;  3R7N B;  4ZN1 A;  6FD1 A;  4XPC A;  3THV A;  3CCS S;  3F56 A;  3DDK A;  1Q8L A;  2YQ3 A;  4NYO A;  1GAO A;  2FC8 A;  3NOG A;  2VG7 B;  1FKO A;  5KOW A;  3PVX A;  1VQ5 S;  2NRE A;  3UI3 A;  2GA7 A;  3MAQ A;  3DRP B;  4LF8 F;  2OPR B;  4IO1 A;  4ZVH A;  4X4P A;  3CDB A;  4I6W A;  5DZ6 A;  2HFU A;  2X1B A;  3GSD A;  2P9C A;  5HVG A;  4N56 A;  3GPA A;  4OI3 A;  5B0E A;  4LUB A;  1RAB B;  4QR0 A;  2L9W A;  3QT7 A;  4R8U A;  2W9C B;  3OXL A;  3MM6 B;  1S6Q B;  3C6T A;  1FVQ A;  2W9A A;  2ZHA A;  3PR4 A;  4KH1 B;  4DS4 A;  3BO4 A;  4UT4 A;  1XNR F;  4UOF A;  2HQC A;  2HEK A;  2JVO A;  1GX5 A;  3NP5 A;  3JAM U;  1SJ4 P;  2G13 A;  2QLW A;  1RZM A;  2Z8Q A;  1RT2 B;  3G82 A;  4WFB Q;  2CQ1 A;  2UVR A;  4NCG B;  4EBE A;  2DRD A;  2NPF A;  4KTQ A;  2XMW A;  2RE1 A;  2AT1 B;  5I3P A;  3TAP A;  4K2X A;  2RF2 A;  1H2U X;  1DRZ A;  2QLJ B;  1RB0 A;  3AXM A;  1NHU A;  2J7U A;  2E5G A;  2MLX A;  3UD3 P;  2VPY B;  3UQS A;  1IBK F;  3KXD A;  3NOC A;  1OS5 A;  2DNO A;  4L3K A;  4AD6 A;  4MKA A;  4UUW A;  1J27 A;  3IWX A;  3BB5 A;  2YQ0 A;  1T9T A;  4IDK B;  4M5D B;  3OR1 A;  2QMX A;  3WIU A;  1TAU A;  2QJ3 A;  2ZJP Q;  2ZZT A;  1U7L A;  2V34 A;  2D7S A;  3OSN A;  1FWP A;  3MHY A;  4C11 A;  4FKY A;  2HKE A;  4FS2 A;  2VA2 A;  3PV8 A;  3CJ8 A;  5DM7 Q;  1VRQ C;  1VLY A;  3C16 A;  1FNO A;  4AQY J;  2DJW A;  3J81 Y;  3NG8 A;  2G0J A;  5I3U B;  4CNZ A;  4I64 A;  4Z37 A;  4PPD A;  3DI6 A;  2HQG A;  1UW9 A;  4DFP A;  1JLB A;  4Z7C A;  3WX8 A;  2AEM A;  3CGI A;  2OSQ A;  3FMW A;  4M5K A;  2IMW P;  1RU1 A;  2IPO B;  3D6M B;  4WFA Q;  2DNZ A;  2RQ4 A;  3ILI A;  3MED B;  3L3C A;  2PMH A;  4PWD B;  4WF9 Q;  3DLE B;  3MR6 A;  3CCJ S;  4OJH A;  1NSK L;  4MIW A;  3VGS A;  1UA0 A;  2V5H G;  3Q8Y A;  2OKQ A;  3E51 A;  1YQH A;  4DEZ A;  2QE5 A;  2UU9 F;  4ZIT A;  4LVN P;  3R27 A;  1REV B;  1G1X A;  4ZHR B;  1FRH A;  4ITS A;  1KOH A;  1EAY C;  2GJ2 A;  3T6J A;  5J1P A;  2B8P A;  4LIR A;  4UST A;  3AY0 A;  5M2P A;  2P9E A;  1NHV A;  4C8M A;  1VBZ A;  2XSJ B;  1L3K A;  1R3N A;  3RB0 A;  3LGH A;  2QIF A;  4OX6 A;  2BUN A;  1MN9 A;  3CJK A;  1YSJ A;  3WIV A;  1NPR A;  4DSE A;  1PSD A;  2XY7 A;  1Z2Z A;  3OTO J;  3N5F A;  3M2U A;  2V2K A;  4PQU A;  1N56 A;  3N01 A;  1XN9 A;  3C19 A;  4CQ1 A;  3CCQ S;  2I6W A;  4CYU A;  1VLO A;  2CQB A;  2M5Y A;  3DOK A;  1NK9 A;  5HVH A;  2RAQ A;  2D3Z A;  4WII A;  3QFW A;  4YP3 A;  2J6T A;  3MCO A;  3IG1 B;  4DR4 J;  3QNW B;  1FCA A;  2PDA A;  2QA4 G;  3CUL A;  1ZPV A;  1ICE B;  2WON B;  1HYS B;  2RNE A;  3MD1 A;  3QMQ A;  1JLC A;  3TAN A;  2D41 A;  4YEA A;  3H0P A;  2GV1 A;  3B4D A;  4DOZ A;  3CDE A;  2D3O R;  1L3U A;  3Q8U A;  3UWT A;  3AJD A;  1HA1 A;  1S12 A;  1XMB A;  4LSZ B;  1U0S A;  2CPZ A;  4TLQ A;  5ETT A;  3SV3 A;  3E2E A;  3W2W A;  2HNY A;  3GG1 A;  4CH0 S;  4QU7 A;  4LF4 F;  4OL8 A;  5B7W A;  1IKX B;  4NXM J;  2LA4 A;  1TL3 B;  2AJ0 A;  3IS9 B;  5CHC B;  3EPI A;  2AGO A;  3Q89 A;  1NSP A;  3KFW X;  1RTH B;  4L73 A;  4XTT A;  2RJZ A;  4F36 A;  3KK1 A;  1X4H A;  1VQL S;  1AA1 B;  2DYA A;  1G6B A;  3J81 U;  4U95 A;  1PIL A;  1YLX A;  2RDD A;  2XMT A;  2ILZ A;  3MR5 A;  3D2W A;  1VQO S;  1GQE A;  2VIC A;  4UZB A;  1U1P A;  1S0O A;  1TMJ A;  1JLA A;  2CWX A;  3M2R B;  3NAI A;  1SIW B;  2I1R A;  4FXV A;  2IMO A;  4JI5 F;  4DXL A;  2F8M A;  3EVO A;  3IC1 A;  3E01 A;  2OAU A;  4PYA A;  2IY5 B;  1XR5 A;  3W5Y A;  1SI9 A;  4AND A;  1FT8 A;  1R6V A;  1BUX A;  4CLY A;  4C97 A;  1X5T A;  4ZPW R;  1SH2 A;  1MMD A;  2QYC A;  3I96 A;  1RAC B;  3MOZ A;  5KFI A;  1UWB A;  5K8N A;  1UFL A;  3M9N B;  2DRB A;  1BE4 A;  3AQO A;  3TWZ A;  2DR5 A;  1T9X A;  2YNH B;  3D66 A;  2L48 A;  1Q5Y A;  7FDR A;  2J9C A;  2VC1 A;  1HWU A;  2FHO B;  3ZZP A;  3ENA A;  3GFH A;  4RO0 A;  2HG4 A;  1L3S A;  3BKU A;  2EK6 A;  1H72 C;  2RHQ B;  4DQQ A;  5HLF A;  4IRK A;  1NU4 A;  3GMG A;  3W8P A;  3A3N B;  3I5A A;  2HSE B;  3BR9 A;  5EN1 A;  1T9U A;  4MK7 A;  3BN7 A;  2FPH X;  2I5J A;  4IH6 A;  4K4V A;  1BQM B;  4ANE A;  4FXD A;  1FDB A;  4OYA A;  2O67 A;  4OYX A;  5KG0 A;  1D1U A;  2MQL A;  3BSC A;  1DAR A;  2CZ4 A;  2DGX A;  3D54 A;  3ISN C;  3HCX A;  3JQM A;  2BV3 A;  4ZPV R;  4E2F B;  3NGD A;  4LSL B;  5D0R A;  4KAI A;  4LT6 A;  5DDO C;  2L41 A;  5KT6 A;  1JIH A;  3QGH A;  2MKH A;  4ID5 B;  4EMD A;  1TKX B;  3DGP A;  1NND A;  3SQO P;  3VAJ A;  2A10 A;  3C15 B;  4MT1 A;  3G6V A;  3C6U B;  3FRZ A;  2CA9 A;  3PHE A;  3HHL B;  3KMS A;  4DV2 J;  3UNG C;  4DV2 F;  4A8F A;  1F9F A;  1WG1 A;  2BQR A;  2LXI A;  1SL1 A;  1SUQ B;  4OQJ A;  1ZOT A;  3WX4 A;  1WC1 A;  2HAI A;  4WK1 A;  5GME A;  1BQM A;  2W9B B;  2X7I A;  1UAW A;  5E2Q A;  2I38 A;  2QA2 A;  2ZM6 J;  2LQ9 A;  3M2U B;  3D3B J;  4B3T F;  4OI1 A;  1S0V A;  4YHH J;  2YKP A;  1YG0 A;  4Q45 A;  1PYO B;  1RWM B;  4L76 A;  4OMF G;  3D7S B;  4S0M A;  1F6T A;  2HK3 A;  4JI0 F;  3RW7 A;  3MTK A;  5B0B A;  1TFY A;  4CTA B;  4HR2 A;  1TKX A;  3DGP B;  1OJ4 A;  1FTR A;  3ELH A;  1GX6 A;  1BC6 A;  1ZYQ A;  4TLR A;  4V19 X;  2V8D A;  3TYT A;  1VIX A;  2JLF A;  4RW8 B;  3KK2 B;  1VQ7 S;  1JLC B;  1FE0 A;  3LWL A;  2AJQ A;  3FEY B;  4TXS A;  2CDQ A;  4DX8 H;  1VK3 A;  3EGW B;  5SUH A;  2GFF A;  4R0E A;  5A8R B;  1UVI A;  1CQM A;  3LUY A;  1FDN A;  4Q8F A;  1DY3 A;  2MLY A;  4NE9 C;  1RYR A;  1MRO A;  2RQC A;  3OW2 R;  2BX6 A;  3N9U C;  2BMB A;  5KG3 A;  1FNM A;  3T1A A;  2XMV A;  3LO3 A;  4DV3 F;  2CJ9 A;  2ZVS A;  3I5C A;  3AB2 B;  2M7S A;  5HAT A;  5J2M B;  3CJ5 A;  3JSM B;  2R7S A;  4MK9 A;  3KDN A;  1FKA F;  4DF8 A;  2E5J A;  1LKZ A;  3LP2 A;  1YJW S;  2OUG A;  3IAS 9;  2HHH F;  4DSJ A;  4IUF A;  2W24 A;  3F44 A;  2IYG A;  1UPM B;  3H20 A;  1BQN B;  4RNO A;  2NXE A;  2HHU A;  2HFV A;  3LF0 A;  2ZVI A;  4USW A;  4KPC A;  5KFP A;  4ZJO A;  4A48 A;  5KT3 A;  4QYR A;  1U1Q A;  4PEO A;  2GGP B;  2FY1 A;  3CME S;  2K1R B;  1VBY A;  4W4M A;  1QY7 A;  2QL5 B;  3BBF A;  3ZTP A;  4RZR A;  1DZ5 A;  2BKO A;  1ZZF A;  4KGX B;  3SV4 A;  4EUV A;  1J5O B;  2DR9 A;  4UF4 A;  3HHE A;  3TZY A;  2HQF A;  1R8B A;  3BDE A;  1HNW J;  2ZZM A;  3OFG A;  4CDI A;  2GVD B;  3QSY B;  4RUA A;  4LRB A;  4K2J A;  5T7L B;  3ZFV A;  3RTV A;  1EP4 B;  1FXL A;  1TK0 A;  2DNK A;  4H54 A;  1R7I A;  3HSZ A;  1YTY A;  1EKS A;  1VQM S;  1NK7 A;  3KDO A;  2CAJ A;  1D9F A;  2P5V A;  3NGR A;  4J9O A;  1RT6 B;  3PFE A;  4OI6 A;  2F3J A;  3CJ3 A;  4NLO A;  1JLE A;  3M8W A;  3PYD A;  4GKJ J;  2CJQ A;  3ZZR A;  1RHJ B;  2LEC A;  1NB2 A;  2E5H A;  1NM2 A;  1PCA A;  1T9Y A;  2HND A;  2QT7 A;  3OFE A;  5CYQ B;  2B3T B;  2ZBP A;  5LT5 A;  4RX6 A;  1HYS A;  2VFU A;  4R5P A;  1H74 A;  4M95 A;  1IXK A;  1ZAW A;  4ZP6 A;  1APS A;  1YRX A;  3PJ9 A;  4QIV A;  5JUM A;  2N82 B;  2A3J A;  3R8Y A;  3BSO A;  4KV8 B;  5BR8 F;  3M9O B;  1U24 A;  3D6T B;  1UVJ A;  2AEJ A;  3AQP A;  4WKR A;  1RAE B;  1U25 A;  2K7K A;  2VDH A;  3WDO A;  2UP1 A;  3M8Z A;  3A8J A;  2A0F B;  1TUW A;  5HI7 A;  5KFW A;  3OHB A;  3R5A A;  1WF2 A;  2F40 A;  1AZS A;  3GCX P;  4KRW A;  2CPF A;  4DV7 F;  2QC3 A;  3AJ1 A;  3MMC A;  1Y9O A;  4LSL A;  2XSF A;  2YBV A;  3M6U A;  4OIX A;  3R3T A;  1TV6 B;  4NZ0 A;  2PA3 A;  1YZ7 A;  4ETZ A;  4NEZ A;  5EX3 A;  1H7W A;  3IR5 B;  3CCM S;  1XQI A;  1K9M T;  4X4V A;  2HMI B;  3NWR A;  4DX6 A;  1JLG A;  1RHR B;  2D9O A;  1AUD A;  2EFG A;  3TJ9 A;  2MEW A;  2VOO A;  4KJI A;  2W2P P;  4TKT A;  5IS2 A;  4NXM F;  3F0N A;  4XK8 C;  2KG1 A;  3EX7 B;  4EZ9 A;  2I9S A;  4O3Q A;  4ZCK A;  2OML A;  4JI3 F;  2N4C A;  1RAI B;  1W26 A;  4QJV A;  5AE3 A;  3MM5 B;  1HNI B;  4KGZ B;  4X62 F;  2R2R A;  3TI0 A;  5KOX A;  2L9D A;  3S01 A;  3AH6 A;  1R31 A;  2XHC A;  2MQ8 A;  3DCA A;  4I6A A;  1IJE B;  1XR6 A;  4I7F A;  4NLY A;  1R0A B;  3KOA A;  1RDR A;  2B8Q A;  2BE2 B;  3I31 A;  3PM9 A;  1G4C A;  1RWO B;  2FYX A;  1NSQ A;  2R8H A;  2UUC J;  3HSJ A;  2OSR A;  4ED0 A;  3B8H A;  3QJL A;  4TVA B;  5A6P A;  4DQP A;  3GIK A;  4CLL A;  4QPT A;  2ALZ A;  3BR8 A;  4LF7 F;  2CPY A;  3PRV A;  3MWB A;  1VOM A;  3G8Q A;  4WWS A;  5CD4 A;  1WUU A;  2M52 A;  2QN6 B;  3EDR B;  4C0O C;  3PKM A;  4P52 A;  1U2R A;  3BQ2 A;  2DIV A;  4USU A;  2HQI A;  2GO8 A;  5JJB A;  5A2Q Y;  1S10 A;  4DL0 C;  3H42 A;  3HPO A;  3FGV A;  3OTO F;  2VQE F;  4X84 A;  3WC2 A;  2A2C A;  2HLU A;  2PA8 D;  2ZD1 A;  3HSD A;  4OLP A;  3RJM B;  2ZNZ A;  1FRL A;  1E6Y A;  1GMU A;  2B9E A;  1R0A A;  1UVM A;  2BAC A;  3R6L B;  3TUI C;  2G9O A;  3W2V B;  1VRT A;  4A8O A;  3SSQ A;  2ZH8 A;  5B0D A;  3UCZ P;  2GML A;  4L75 A;  3P6Y C;  4TY8 B;  1QAJ A;  4ECW A;  4H4O B;  1WD6 A;  2M2B A;  2PE8 A;  3JB9 k;  2IFX A;  1HBO B;  2GMJ A;  2FDN A;  1MG7 A;  2GIF A;  3POT B;  3PYG A;  2GHW A;  3M8Q A;  2J6U A;  1LW2 B;  2HWT A;  2IM1 A;  3M05 A;  1N0V C;  1QVF R;  3C15 A;  4NCG A;  1D0E A;  5KG6 A;  4LRC A;  2DY1 A;  2FGO A;  5KFO A;  2PGC A;  3R7S B;  4DZD A;  1GEH A;  2VC0 A;  2EPI A;  3MI7 X;  4I2P A;  5LMN J;  2CQ0 A;  3O2I A;  3PO4 A;  1X60 A;  2VD3 A;  4IQM A;  3NGS A;  1VGY A;  1ZPW X;  2WK4 A;  3I5B A;  4DN9 A;  3OL6 A;  2AX1 A;  2H54 B;  2GVZ B;  1N36 J;  1PBU A;  1HWI A;  3I9V 9;  3KJF B;  1NK4 A;  1HNV A;  1IM6 A;  3GYN A;  3Q8V A;  5A8W B;  3R7B B;  2VHG A;  4ECU A;  4PCQ A;  2UVU A;  3K0J A;  3TZZ A;  2AV5 A;  2MQQ A;  2L08 A;  2ZH6 A;  1SJQ A;  3PJX A;  4RNM A;  3C46 A;  3ENW A;  4D3G A;  2BR0 A;  4QIF A;  2QGF B;  2HWH A;  3PR5 B;  2H9Z A;  5KFB A;  2XUL A;  1QM9 A;  4ELT A;  2C2M B;  3M32 B;  2Z2L A;  3M6W A;  5CZV A;  4Y2A A;  2JH3 A;  5DRK A;  5KFX A;  1YDL A;  3NS5 A;  4AL7 A;  3TJA A;  1M1G A;  3FC9 A;  4KKO A;  1S1X B;  3QGI A;  3SCK E;  5CD4 H;  1F3V A;  1ZM2 A;  4C3K A;  1F60 B;  3GYX B;  2F1F A;  1TKT A;  1MU2 A;  2HRU A;  2XQC A;  4J9Q A;  4KGK A;  4OHY A;  3MPU B;  2MST A;  1GTH A;  3MM9 B;  1K0V A;  4KE5 A;  2V4J B;  4NCB A;  1NZ8 A;  2UV8 A;  3GIJ A;  4ZCM A;  3PCO B;  4U6P A;  3KHG A;  1WEL A;  3ITH A;  4EYH B;  1REV A;  5KFF A;  3V6K A;  1VC0 A;  3U1N A;  1EQM A;  4UZC A;  2A18 A;  3OPK A;  4HHH A;  3UNY A;  1X5O A;  3M32 A;  3RRG A;  1OPZ A;  3TNV A;  3ET6 B;  3O44 A;  3D0H E;  3I0R B;  4USI A;  4ZVS B;  3Q8Q B;  3K8V A;  1F9H A;  4OYB A;  3SQG A;  2D69 A;  1SQG A;  1VK8 A;  4CT8 A;  3HM9 A;  5A0Y B;  4B9U A;  1UJ4 A;  2NPI A;  1UVL A;  4KYZ A;  3LP0 A;  1HI1 A;  1B0P A;  2G4B A;  4K4U A;  1V9O A;  2OEM A;  4GO5 X;  1ZM4 A;  1Q86 T;  4M94 A;  1AFJ A;  4HDG A;  4DS5 A;  2WRM A;  3DU5 A;  1R8H A;  1HR0 F;  4L3N A;  2WW4 A;  3FVY A;  1N6Q B;  4K50 A;  2HNZ A;  2CNL B;  1S57 A;  2MHN A;  3TA1 A;  3TR5 A;  2QFJ A;  5LSR A;  2VBZ A;  3HKW A;  4EU0 A;  2HHV A;  3U1L A;  5IT9 Y;  4KGV B;  3PYF A;  1DTT B;  1EX8 A;  3QAT A;  4FBT A;  4NXN J;  2YTC A;  2YKA A;  4ZK7 M;  1LQ9 A;  2FC9 A;  2LCW A;  1QAI A;  3MR2 A;  1QDU B;  1TVR B;  2DH9 A;  2QLX A;  4LF2 A;  2ZEJ A;  1FI4 A;  2KJV A;  2WVE A;  3P3D A;  5GAH U;  1K47 A;  1X4E A;  2CNK B;  3BGR A;  1B99 A;  4ZDN A;  2B51 A;  2XYH B;  3WZ0 A;  3I4P A;  2AYE A;  2XCP A;  1KSP A;  2J0X A;  2C3U A;  3W2W B;  4OZ0 A;  1WOS A;  3DRR B;  2D9P A;  5J1E B;  1YK9 A;  4LJM A;  1T11 A;  2F9D A;  2VG6 A;  4QW9 A;  4B3M F;  5EWE A;  1T05 B;  4JI4 F;  2LEP A;  1KP6 A;  3RR8 A;  5IQ6 A;  2XB2 D;  5KFG A;  1K44 A;  2MZ1 A;  2E1A A;  4XIU A;  4YY3 J;  2BJ8 A;  2DNP A;  3V6D B;  2IA6 A;  2OJ3 A;  3GR0 A;  3VQS A;  4GVB A;  3J7A N;  1EZZ B;  4KR0 B;  2UV8 G;  4DUT A;  3CDU A;  4A8Y A;  1YJ7 A;  1S9G B;  2IAJ B;  1DBD A;  3DDI A;  1TU0 B;  1LW2 A;  1C4C A;  1OWX A;  3ENQ A;  1S1T A;  3F41 A;  3IRX B;  4DPW A;  4EO8 A;  4CIO A;  2JLG A;  4NEY A;  4J9N A;  2XHW A;  1G2E A;  2KB2 A;  4QIG A;  4ILM A;  4KHR A;  1UEK A;  1WDD A;  2HVD A;  3HT0 A;  2JLE A;  1NJI T;  1BLU A;  4ZVG A;  4IRC A;  1R43 A;  2DB1 A;  2KKH A;  5HP1 A;  2GX8 A;  2EFV A;  2MQM A;  2Z30 B;  2HW3 A;  2KO1 A;  3T1Y J;  3H4D A;  1U26 A;  4MKB A;  2GZO A;  2H65 B;  3AD8 C;  1YVF A;  2A1B A;  2AJ4 A;  2YKN A;  2OEK A;  3GR1 A;  1XR7 A;  2A6O A;  2FJX A;  2VFS A;  3DKD A;  4DR6 F;  3PYE A;  2DXE A;  2DNH A;  1RT1 B;  3VGT A;  4DI6 A;  3TRG A;  3ETO A;  2DH8 A;  1BQN A;  2O66 A;  5HAN A;  5GAH I;  3S6E A;  3LOU A;  2J6S A;  2GCF A;  2AMC B;  4L74 A;  4LR8 A;  4DUY F;  4OV6 A;  1BHN A;  4WE1 B;  4M1K A;  3M9M B;  1Y5I B;  2CQP A;  1YJN S;  1HNW F;  2HGN A;  1D09 B;  2HVE A;  4CO2 A;  1QTM A;  1T0T V;  2OPQ A;  4LRD A;  2HIY A;  3OUY B;  4CM2 A;  4LFC J;  2C2D A;  2CAD A;  3R5J B;  2HNY B;  1S1W B;  3J7Y I;  4CO4 A;  2YNG A;  4UQT A;  4DV3 J;  3QRP A;  3SXL A;  3GFZ A;  3LW5 C;  4I69 A;  4ZPC A;  2EFQ A;  2VON A;  2ZKT A;  3EZO A;  4DR4 F;  4WZM A;  2E29 A;  2QMW A;  4NZ7 A;  1O8B A;  1M90 T;  3NL0 A;  4B3R F;  4IFY A;  1AB8 A;  1JXE A;  1Q4R A;  1SCJ B;  2M88 A;  1MN7 A;  1CJK A;  2HBZ B;  3D68 A;  3H98 A;  3CDW A;  9RUB A;  2UUW A;  1RWV B;  4FPR A;  2XS7 A;  1IVZ A;  4DR7 J;  3F73 A;  3KJV B;  5DDQ C;  2WHO A;  3C8Y A;  5T41 A;  2G1H A;  3EGV A;  3M2V A;  2ASJ A;  1FXD A;  2NR0 A;  1KTQ A;  2PII A;  3G6Y A;  4LMZ A;  1PJ5 A;  2HND B;  5CYQ A;  5LSO A;  2B9W A;  4IG3 B;  3G4S S;  3DFE A;  4QYZ K;  3BEG B;  3PX6 A;  5ETP A;  3HVW A;  4RUH A;  3TO8 A;  3UN2 A;  3J80 Y;  4JI4 J;  2JZ5 A;  2NQP A;  4B3S J;  1TAQ A;  3HJV A;  2VOP A;  3MUV P;  3EVW A;  4PG7 A;  4WFN Q;  2RDI A;  3DLK B;  1XK8 A;  4KHP J;  1KNZ A;  5C25 B;  2ZOF A;  3D9B A;  3QZ7 A;  5F8N A;  4YQW A;  3MM6 A;  3UVJ B;  2MY7 A;  1Y3J A;  2RHS B;  2BW2 A;  8AT1 B;  2XWY A;  2KVQ E;  3VQT A;  1I94 J;  4LF9 F;  3MR7 A;  2COL A;  3I0S A;  3CCZ A;  3UDC A;  3UDL A;  2VQF J;  1UMJ A;  1OYD A;  1TR0 A;  4YHH F;  4AL5 A;  2NZ4 A;  2H3E B;  3PEH A;  4MFB A;  2WBM A;  3UPF A;  4U96 A;  2ZWP A;  3O1L A;  2H5J B;  1SQF A;  3K59 A;  1RK8 A;  1Y10 A;  1T3N A;  3CCW A;  4N7T A;  4P2S A;  1C0T A;  1HHQ A;  1UVK A;  3FZ2 A;  3VF0 B;  1XMQ F;  1SKS A;  4FF4 A;  1HQE A;  2JL9 A;  4A8Q A;  4Y2K A;  3PHT A;  4HAC B;  2BJE A;  5T7L A;  3ZNU A;  2B5J A;  4NZ6 A;  2WSE C;  4I56 A;  4WKY A;  2YWE A;  3VV2 B;  3GE9 A;  4EI2 A;  2C2K B;  2R2T A;  3CCL S;  4IG0 B;  2B6A A;  3MEG A;  2GAH C;  3A3P B;  3RW6 A;  4Y6I A;  4A8M P;  3IM9 A;  1S9E B;  1UCN A;  3BGF A;  3DRX A;  4LBI A;  4M8L A;  2A2D A;  4RUC A;  2WOM B;  2OIH A;  4EO6 A;  3QID A;  1BGX T;  5GAG I;  3QGP A;  1JKH A;  3TEH B;  3KLI A;  1FJG J;  4GKK J;  2VKR A;  1TUG B;  2HRY A;  4HT7 A;  4ELV A;  1X4G A;  1W7W A;  1ZA1 B;  4WFZ A;  2K3I A;  1C0T B;  2BE7 D;  4P74 A;  2IHR 1;  5C24 A;  5KFJ A;  2W7O A;  3K5N A;  4GC6 A;  2AYB A;  3I9Z A;  3PRD A;  4YR2 A;  3CB4 A;  2E9T A;  2H5I B;  3H2U B;  2E1C A;  3W8G A;  2CG4 A;  3GJR B;  3O8W A;  1VJW A;  3P5T L;  2XCA A;  1TZ0 A;  2OMO A;  2VU5 A;  4QYZ J;  1NPK A;  2LQB A;  1X4B A;  4DHV A;  2ZH5 A;  3DLH A;  4AQY F;  1TV6 A;  1RT3 A;  2ZBI A;  5LM7 E;  3L09 A;  3K5P A;  2MGZ A;  4JV0 A;  4LQ9 A;  3UR3 C;  3QFH A;  4QWC A;  2W9C A;  5KFM A;  1QE1 B;  3NBP B;  4MKY A;  5KG7 A;  2VFV A;  1PC5 A;  4PXE A;  3W7B A;  2ZH9 A;  2IVY A;  2EBG A;  2HBY B;  2UXC J;  1F9E B;  4BC7 A;  4D3H A;  3V81 A;  1UPP A;  2YKO A;  4DR1 J;  2LFV A;  3AOD A;  1JXL A;  4DUY J;  3RUB L;  2ZDO A;  1MRO B;  4KY3 A;  5BXI A;  3A8E A;  3IO1 A;  4HEA 9;  2QRR A;  3JSY A;  3G71 S;  4ED2 A;  1YHQ S;  1Q7Y T;  4DLE A;  3BGR B;  2I0X A;  1PYT A;  4FS1 A;  3X3U A;  3MMA A;  4YDX A;  4DPT A;  2HYI B;  4P2M A;  3GYG A;  4XPE A;  2W4C A;  2ZUA A;  1CVJ A;  3QT6 A;  2VG6 B;  5E3A A;  1VRU B;  4I2Q A;  3K2Y A;  4UY8 T;  2CQ4 A;  2Y0S D;  4U7C A;  3G8S A;  3K58 A;  4ELU A;  1WOR A;  3OJU A;  4RUB A;  1S49 A;  1KHW A;  4YDD B;  3MXH P;  2UXB J;  3OTC A;  1LWE B;  5G4D A;  5KT2 A;  1KVJ A;  3EYZ A;  3H25 A;  2E1M C;  4JI0 J;  4FYX B;  1DTQ B;  4AYB D;  4DU8 A;  4LF4 J;  3H8Y A;  4KO0 B;  4WFY A;  3HMJ G;  2J0Q D;  4KT0 C;  2RSQ A;  4HHU A;  1NDC A;  1SH3 A;  4KB7 A;  2Q6B A;  2CQH A;  2RU9 A;  5HJX A;  5K14 B;  5KFH A;  4QCL A;  2DEJ A;  4C8L A;  1V5V A;  1XNQ J;  3VWS A;  2WTF A;  4URQ U;  3DLG B;  2JWN A;  4F4W A;  3RBE A;  5ETM A;  4DL7 A;  1VRU A;  3AB4 B;  2HHH J;  3UFC X;  1I94 F;  1T7P A;  4CRJ A;  1EP4 A;  2RS8 A;  4ZN3 A;  1KFD A;  1KWM A;  4YUD A;  1FX4 A;  5D8H B;  1IKY A;  2V67 A;  1K1S A;  1TMM A;  3FDS A;  3TVY A;  1M5H A;  5KFQ A;  5CAB A;  1NJY A;  2V9K A;  3IBC B;  3QWU A;  2FVR A;  3OL7 A;  4DPO A;  3DXS X;  1N0U A;  1JLE B;  1BWV A;  2K06 A;  3NXZ A;  4WFX A;  4DCJ B;  5AE2 A;  4WU2 A;  5M2U A;  1IWG A;  2C2E A;  4JI3 J;  1JLQ A;  1JLF A;  1WHY A;  4UY8 5;  3W63 A;  1N5T A;  2ABY A;  5A0Y A;  4PRF A;  3TAM A;  3W3S A;  3MAA B;  1MMN A;  4BLG A;  4F4K A;  2CJX B;  4FN5 A;  1S6O A;  3PNI A;  4IYQ A;  1QTN B;  4CLS A;  4JV5 F;  4ALZ A;  4B08 A;  3ZXW A;  4FNI A;  3U27 A;  4EGL A;  3BH7 B;  3A1Y G;  4F2S A;  4K4Z A;  4LSN B;  1U1L A;  4Q2M A;  5F0W A;  1CPZ A;  1MWZ A;  2MJN A;  4B9S A;  1S72 S;  4ZVQ B;  4K4S A;  2MPU A;  4YS2 A;  2BVZ A;  2RU3 A;  4I67 A;  1HBU B;  2A6M A;  3V5R A;  2H51 B;  3CCU S;  2Z4P A;  2VFR A;  1C1B A;  1U1N A;  1YBU A;  2F9J A;  2MXY A;  4J9U E;  1H7X A;  4F4X A;  4ECZ A;  4LFC F;  2KFZ A;  2CNN B;  3IWN C;  2DNL A;  4TYA A;  5FLX Y;  1WOO A;  3FFI B;  3K5O A;  4QOT A;  2ZE2 B;  2OGU A;  4ZLN A;  5C24 B;  4X4O A;  1GFW B;  3OLA A;  3KLF A;  2ZHB A;  1H0H B;  1H2T Z;  1LWF B;  1RUS A;  2XZD B;  5LL6 d;  5E3C A;  4CLK A;  3Q22 A;  2V8V A;  1KOO A;  4FYD A;  4LFB J;  1A6L A;  1XBW A;  2E5I A;  1FFS B;  3FKB A;  3QYY A;  5ETN A;  4C3M A;  1HNX F;  1FJ7 A;  5LSL A;  1E6V B;  3ICL A;  1VI7 A;  4LF1 A;  4RBT A;  4QW8 A;  3W1Y C;  3ZC4 A;  4IDK A;  1OSC A;  4M5D A;  1RHM B;  4IOC Q;  5BR8 J;  1SKW A;  3HHL D;  3MD3 A;  3PXG a;  1WC3 A;  4ETX A;  4ZVU B;  2PT0 A;  3IG1 A;  2AYG A;  4JI2 J;  1HW9 A;  1S1T B;  1GXL A;  3D67 A;  2Q1L A;  3KJQ B;  5D77 A;  3V6J A;  1KVK A;  4W92 B;  1IR1 A;  4LRA A;  1EHW A;  4O44 A;  4Q43 A;  1KQS R;  4G1P A;  3M1V B;  5IZH A;  1DUR A;  4KKO B;  3GII A;  1NK8 A;  4C3L A;  2HUR A;  1IM4 A;  1C0U B;  3TX0 A;  5IWA J;  2GQC A;  2AU0 A;  3T6B A;  4Q2L A;  3MOJ B;  4RNH A;  4N76 A;  4Q8E A;  2Z58 B;  2CQ2 A;  4LRF A;  3TUZ C;  2BE9 B;  4RNF A;  1LK5 A;  2ASY A;  2CPX A;  4IOB A;  4NA2 A;  3UD5 A;  4LF5 J;  3HK2 A;  3UN3 A;  5CCM A;  1OMS A;  3ILJ A;  4BWJ A;  3I82 A;  5FJ4 A;  2N4D A;  4ZHR A;  1M5O C;  5CYM A;  4CO0 A;  1HQ2 A;  2ZBC A;  4HI1 A;  2V2Q A;  1WKJ A;  4KC5 A;  3GFY A;  5I3Q A;  1ULR A;  2F4V J;  5G0R B;  2YH1 A;  2XSJ A;  3CCV S;  1DTT A;  3QBC A;  3I0R A;  1X5S A;  2UVW A;  1Q8B A;  4K5R A;  1K8A T;  1VC6 A;  3BS9 A;  2C28 A;  3SQG B;  4AE5 A;  2VG7 A;  2R7V A;  5LMU F;  1JLA B;  2B4O A;  2ROE A;  3H2V E;  3M2R A;  5L38 A;  1REG X;  1CJU B;  3EIC A;  4G1Q A;  4OX7 A;  3RBX A;  3CDA A;  3SIP B;  5KT5 A;  3JSM A;  2ZC3 A;  3PW7 A;  2BQ3 A;  1LK7 A;  2BKN A;  4U8Y A;  2HQD A;  3ZZ0 A;  2DT9 A;  3KTQ A;  8RUC A;  4P71 A;  2BQU A;  1DHM A;  2DHH A;  5C42 A;  3TUP A;  4X4R A;  4HTJ A;  3VVT A;  4B3O B;  1HFE L;  2OPQ B;  1GMV A;  5ITH A;  4ECR A;  4DQS A;  4N41 A;  3T5J A;  2ZOG A;  1RE1 B;  3L7P A;  4M63 A;  1HNZ F;  1SC1 B;  4JI8 J;  3CJ4 A;  2VJV A;  3IA0 A;  2XO7 A;  2CVE A;  3R5G A;  2UXD J;  1WEZ A;  1IQZ A;  2IAJ A;  2CDR B;  4NLU A;  2X3G A;  1R0B G;  2EXU A;  3MM8 B;  2LYV A;  2ALY B;  2WB1 D;  5KFD A;  3MEE A;  3KLE A;  1H38 A;  1FTC A;  2CQD A;  2IVF B;  4DWI A;  4MJK A;  4R0J A;  3QSI A;  2DGW A;  3J7Y U;  1NHK L;  2F4F A;  2QLB B;  2RF2 B;  3DGV A;  1RBO B;  2IC3 A;  2VB6 A;  2Y1R I;  4UW2 A;  3AJ2 A;  3NY0 A;  2CYY A;  5DO2 A;  5IFM A;  4ECT A;  1Y4Z B;  2YX1 A;  4MAK A;  1Y5L B;  4AFF A;  2WB4 A;  4NLQ A;  4DV7 J;  3NGK A;  3PO5 A;  1CJV B;  3DMJ B;  1RI7 A;  3UVJ A;  1RTH A;  2XI3 A;  2FLN A;  2BAB A;  4DV6 F;  1VFJ A;  3HFV A;  1S59 A;  5BYQ A;  5A8K A;  3VZI A;  1VQN S;  5L9X A;  4C4W A;  4HH0 A;  1IKX A;  2KRR A;  4ZOS A;  3AXK A;  3EJM A;  2IBK A;  1UJ6 A;  3HVA A;  5A76 A;  2LDI A;  1AUS L;  1V5I B;  1ARO P;  3IAM 9;  4NL5 A;  4R5P B;  3QO9 B;  3SEO A;  1FWL A;  3TQE A;  3LAK A;  4DUZ J;  4J91 A;  1HPZ A;  2LVW A;  1RT4 B;  4FKX A;  5J2N B;  3KLG B;  1X9W A;  4KV8 A;  4LVO P;  3BGO P;  4OZ1 A;  4PAB A;  1NUE A;  1D8Y A;  2AWZ A;  4HT5 A;  5THW A;  1LXJ A;  2KN4 A;  1DTQ A;  3BZQ A;  5EUH A;  5B09 A;  4X64 J;  4NRU A;  1FJE B;  4OZN A;  1HAR A;  1SH0 A;  1OYE A;  2G2O A;  1FRX A;  3PIP Q;  4K4T A;  3LP0 B;  1P1T A;  1F5B A;  2BZ2 A;  3ILO A;  2FJV A;  1U0H B;  2QYG A;  2CWK A;  3D1O A;  4X66 J;  4TN2 A;  1VIO A;  4K7Q A;  4EFA C;  4K4W A;  2J7W A;  4RLE A;  2WVD A;  2GNK A;  4K4X A;  1XMO J;  4RNN A;  3R2C J;  3DNC A;  1R89 A;  3H7H B;  4OLO A;  4PKD B;  5HJY A;  2PMZ D;  2E7X A;  2VL1 A;  3DU6 A;  3W60 A;  2HNZ B;  4BCA A;  2V4R A;  5D3G A;  1UTA A;  3EVM A;  3QO9 A;  4IQX A;  2VDI A;  3BKT A;  3GQC A;  3D3C J;  4CLF A;  2NXN A;  2VBX A;  3W64 A;  2YNH A;  5GAE U;  4WE1 A;  1N4L A;  1MWY A;  1TVR A;  2CUY A;  3IBW A;  3NLC A;  4RW6 A;  4RWW A;  2OPS A;  4MK8 A;  1TKD A;  2MZJ A;  1GXU A;  2R7R A;  2KXH A;  5K9F A;  5KFC A;  3OTB A;  5DQH A;  4F4Y A;  4I7F B;  2QL7 B;  1S1W A;  2BJ9 A;  2BE2 A;  4G6V B;  2DH7 A;  2QSF A;  4YR3 A;  1IN0 A;  2RQM A;  2RKI A;  4H4K A;  1RTJ B;  3FEZ A;  3C3L A;  1RWP B;  4C8Y A;  1NH7 A;  4LSN A;  5D4O A;  2DVI A;  1XWL A;  2DR8 A;  2JJ4 D;  1S6U A;  1SPB P;  3Q83 A;  4YB6 A;  2QL9 B;  2RUS A;  4P7V A;  1FHT A;  3QIP B;  5K8P A;  4USK A;  3CTR A;  2VA3 A;  2IYI A;  3TAQ A;  2B7C B;  2MKY A;  4GO7 X;  4K4Y A;  4U7U K;  5CCL A;  2OPS B;  3BV8 A;  3IRX A;  5HO4 A;  2RIL A;  2HZA A;  1RTI B;  4ID8 A;  3FCV A;  2RIJ A;  1ZAV A;  2U1A A;  3HP6 A;  2VPZ B;  4J9M A;  1JNZ B;  3K8W A;  2ZJQ Q;  4A8W A;  2DIT A;  1L3V A;  2WAQ D;  2KHC A;  1KLM A;  3KLH B;  5L8R C;  5KT7 A;  1B7Y B;  1NRK A;  2DO0 A;  4QWE A;  1HNX J;  1X4D A;  4IRD A;  1A7G E;  1PG5 B;  3CVK A;  4O0I A;  2R2U A;  2QA4 S;  4OJ1 A;  2VZ9 A;  1RT5 A;  3OFH A;  1RA7 A;  2C3M A;  3VGV A;  3W5X A;  1PO6 A;  4URS A;  1E6V A;  2MY8 A;  4ENO A;  1BY9 A;  2B9X A;  4FVM A;  5K5M A;  3MMJ A;  2XLI A;  4ED1 A;  3MMC B;  3HFZ B;  4LF8 J;  5A8R A;  1AXQ A;  1S9E A;  4NLT A;  5B0A A;  2VFT A;  3GJQ B;  3V4M A;  1QUP A;  2HAF A;  2DR6 A;  3I56 S;  1N33 F;  2ATC B;  1U2F A;  1HBM A;  3EUN A;  1DLO A;  3GCW P;  3MF5 A;  2BM0 A;  4KO0 A;  4YFU A;  2HMI A;  1DQ9 A;  2IRU A;  3BYR A;  4DPU A;  4A4J A;  4RW8 A;  1RAH B;  3E8O A;  3KK2 A;  4I1T A;  3VAL A;  2DRA A;  1CS4 A;  3MEK A;  1LWE A;  3DLB A;  3KG1 A;  1Q16 B;  1CG2 A;  4ANC A;  4EBC A;  1LW0 B;  1UA1 A;  2KHD A;  1U1O A;  3CC7 S;  5HQL A;  1NJX A;  3PZP A;  3OLB A;  2YKM A;  3JTN A;  4K59 A;  2M3D A;  3KUG A;  2W25 A;  4F50 A;  5A8W A;  2HHT A;  2H48 B;  3FSY A;  3VCD A;  1H2V Z;  1FRI A;  5GVQ A;  3ZO7 A;  5A8K B;  3FRY A;  3H5U A;  1S0M A;  2RVJ A;  1RT3 B;  2QFI A;  3BBB A;  4WBF A;  2X1G A;  3HJF A;  1FES A;  2EG2 A;  2YNF A;  4EYI B;  5DGA A;  1KDN A;  3CC4 S;  4B3T J;  4K0K F;  3TX8 A;  2R7W A;  4ECQ A;  1S99 A;  3MAA A;  3ONQ A;  1IKW A;  4AXJ A;  4TQR A;  1HBN A;  1IR2 A;  3SFU A;  3PTW A;  1U4B A;  1S4E A;  2ZFH A;  1KD1 T;  1NDP A;  2J9D E;  1O6X A;  1M5P C;  4KH0 B;  3AD7 C;  2WSC C;  4ZJL A;  1FVS A;  2YNI A;  4CLT A;  2BJD A;  3H90 A;  1L5U A;  3FCW A;  4OYM A;  1RBL A;  2VBY A;  1OO0 B;  3CF5 Q;  2JVR A;  3HUL A;  2KFY A;  3CD7 A;  4NI2 A;  3HXM A;  1RYS A;  3BPD A;  4I68 A;  1J5O A;  4IH7 A;  3DOL B;  2E5L F;  4DV1 J;  5J2P A;  4B9L A;  1XJW B;  1Q82 T;  2AP6 A;  3A13 A;  1FRM A;  4ZKA A;  5AJ3 F;  1HI0 P;  2R8J A;  4OHZ A;  3FSI A;  5K8M A;  3IRW P;  4PUO B;  3CT9 A;  1MNE A;  4HVZ A;  4JI5 J;  2QO3 A;  2KT5 A;  1Y7P A;  3SCL E;  2GIR A;  2LMI A;  1SJ1 A;  3Q8P B;  2KTQ A;  1NK6 A;  4DQI A;  1YX2 A;  4OHW A;  4OYI A;  2W01 A;  4IFV B;  1H73 A;  2IRX A;  1WG4 A;  1VQS A;  2U2F A;  3CIZ A;  2FLO A;  3ET6 A;  3OR1 B;  4DBQ A;  4DV4 F;  1C2P A;  1JB0 C;  3IMQ J;  4LBP A;  4F02 A;  2FVP A;  1WC4 A;  4DSI A;  4KHP F;  4U9R A;  4ED5 A;  3KHL A;  4OI0 A;  4G1I A;  4DQR A;  4WTY A;  2Y8W A;  1WOP A;  3W9H A;  4F25 A;  3RRH A;  1EIY B;  2FUG 9;  2RH3 A;  2B9Y A;  2CJA A;  3IN5 A;  5E3P A;  2DHS A;  2AJF E;  5KFU A;  2V4Q A;  2HQ3 A;  2KYX A;  2RKI B;  1KN6 A;  1HQU B;  3DC2 A;  2J8A A;  1YJ9 S;  1EAR A;  5D4L A;  1XC9 A;  4HI2 A;  3TEG A;  4GC7 A;  4C2M A;  3DLL Q;  3V2U C;  3T1H J;  5EHH A;  3GFX A;  4HYK A;  1MWQ A;  3EM1 A;  1YRU A;  2AF6 A;  2HK2 A;  1SB6 A;  1RT7 B;  2IRY A;  2YWG A;  1WSR A;  1SC3 B;  1RWN B;  3N6M A;  5HAO A;  1FRK A;  1RT2 A;  3G82 B;  3CW2 C;  3SSS A;  2YQ1 A;  4BC9 A;  3D0G E;  1FO1 A;  4B9M A;  3NGU A;  4I2P B;  4FP9 A;  4CO1 A;  5DQI A;  1FXR A;  5J1E A;  2KM8 B;  1KON A;  1CJT A;  2F65 A;  2GHP A;  1T05 A;  5HN0 A;  1P6T A;  2MHE A;  1FRJ A;  4PWU A;  4RKU C;  3MEC A;  3OSP A;  3RAX A;  1IKY B;  2ZOM A;  3BO3 A;  1X0P A;  3I32 A;  4RW4 B;  2DXD A;  3J7Z T;  5CQG A;  4DR3 J;  3U02 A;  1X0F A;  4FZV A;  4CYU B;  2Y0B B;  1N52 B;  3CSK A;  1RT7 A;  1ZS6 A;  4NLV A;  2KZZ A;  4OZJ A;  4M5M A;  2MGZ B;  1DFD A;  2RD5 C;  1A0O B;  1YJT A;  1N34 F;  3AOB A;  4ZIV A;  5KFS A;  1GNK A;  2HFN A;  4ED3 A;  2E1R A;  2F8E X;  5F8G A;  4RL1 A;  2GMH A;  1D8Z A;  3M8S A;  2ZE2 A;  3KLF B;  3ZTS A;  3ADA C;  4ZVP B;  4ZCL A;  2MQN A;  4P6Q A;  1KQF B;  1UEU A;  3BQ1 A;  2PFF B;  1OY6 A;  3HDS A;  4H4K C;  4YN3 B;  2MKK A;  2MQP A;  2OFH X;  1CJU A;  4G1Q B;  1VR6 A;  1W2B R;  4F3M A;  2L9N A;  1FKP A;  3T9Z A;  1IUJ A;  2MYF A;  2NXC A;  3MZI A;  4Y28 C;  2HGM A;  3G9C A;  1IKV B;  4DV5 J;  3M30 B;  1HD1 A;  3P5B P;  2JEF A;  3KWM A;  3GIL A;  3B54 A;  5L1K A;  4F4Z A;  3CC2 S;  1PC4 A;  5F8M A;  3DRS A;  4HKQ A;  1RKJ A;  1IBL J;  3D6F B;  1U6B A;  3A3O B;  4ED6 A;  1KFS A;  2AJ2 A;  3QIP A;  1Z1Z A;  3MTJ A;  2YH0 A;  3L7U A;  4Z7Y A;  5LXR A;  3FBF A;  5CYJ A;  5DGB A;  2YNI B;  5I42 B;  5KFY A;  3GV7 B;  1RP5 A;  2FGC A;  2FHJ A;  1WTF A;  3AHP A;  4L72 B;  3RAQ A;  2CJK A;  1WWH A;  1OY8 A;  3QLH B;  2XC9 A;  1T9W A;  2XS5 A;  4USH A;  1V6H A;  2B7B B;  1HNV B;  4Y2C A;  4ZVO B;  4FF3 A;  2VOD A;  5H9F J;  4O3N A;  4B9N A;  5AXL A;  3QQC D;  3DOL A;  4F0K A;  5IXU A;  1HMV A;  4RWX A;  4OX8 A;  1FKP B;  2CFX A;  2DGQ A;  5B0G A;  2NXJ A;  4QPX A;  5F8L A;  4N5S A;  1FA0 A;  3RB3 A;  1U8W A;  3M30 A;  3TZX A;  3QT5 A;  1VBK A;  3DRY A;  3EZU A;  2XBP A;  3NKY A;  4KSE B;  4PG5 A;  1S1V B;  2QG9 B;  5JVH Q;  5L46 A;  6AT1 B;  1OIA A;  2J76 E;  4NA3 A;  9ATC B;  4IR9 A;  1JMT A;  1Q5V A;  1S1X A;  3K57 A;  1MLA A;  1WI6 A;  2HFO A;  2CNO B;  2C42 A;  2HBQ B;  1VQ8 S;  2V94 A;  3R6G B;  4F26 A;  4KFB A;  4J37 A;  4YB1 P;  1CSJ A;  3HHL C;  2IM2 A;  4DMZ A;  1LEO A;  1UET A;  3A8I A;  3ISN D;  4ZVF A;  3TVZ A;  2CKW A;  1PKU A;  4IH5 A;  4DF4 A;  1NKB A;  1R0C B;  2NSB A;  5LOQ A;  4NMX A;  2ZH1 A;  4DLG A;  3CJ2 A;  4USV A;  4O3O A;  1F3F A;  1O5J A;  2DCL A;  2DHG A;  1GTE A;  3UE2 A;  3KLG A;  1ROF A;  3B6B A;  1LW0 A;  2V8H A;  4O0N A;  5LMN F;  1X9S A;  1ITP A;  1ZM3 A;  1S79 A;  2YKM B;  3BYP A;  3GLJ A;  3LH2 S;  1SC6 A;  2EVZ A;  4PG6 A;  5DM6 Q;  5EWG A;  2EEY A;  2XS2 A;  2BDP A;  2KT2 A;  3ZTO A;  1S1V A;  3Q0A A;  4A8K A;  2WCX A;  2JNJ A;  2RS2 A;  1S1U B;  2G2Z A;  4WYW A;  1B0V A;  5KG2 A;  2ACY A;  3BSN A;  1U09 A;  1RT6 A;  1RTZ A;  2MKC A;  3GIR A;  4Y3C A;  3ZZZ A;  2XY5 A;  4PYD A;  2DY9 A;  4AXI A;  2R7T A;  4MYT A;  1C1B B;  4KFB B;  3R2D J;  3I6P A;  3GV8 B;  2KH9 A;  3KLE B;  4BHQ A;  1YBA A;  5KFK A;  3Q8R B;  2ZD1 B;  3EXC X;  3HKZ D;  3IGV A;  3JAM Y;  3MFH A;  4NCA A;  3TOQ A;  2KI2 A;  1SL2 A;  4OX9 J;  1Q79 A;  3D0I E;  4ZMM A;  1VRT B;  5IT0 A;  1X9M A;  3SCJ E;  1M5V C;  1FF2 A;  4YOE A;  3SYZ A;  2R4F A;  1RTJ A;  2OTL S;  1NBE B;  3LWM A;  2Y9H A;  3EGZ A;  1NB7 A;  1ACM B;  3CD6 S;  2XLJ A;  4DPY A;  4B3O A;  4H4O A;  4DL3 A;  2Z57 B;  3KYL A;  1T3O A;  4CH7 A;  3HO1 A;  2KXF A;  1NZA A;  4DV0 F;  4M5J A;  5D0H A;  2KG0 A;  3GU0 A;  3MAH A;  4MKV A;  3M8Q B;  5AJ3 J;  1UFW A;  2AW0 A;  3FNN A;  5IT9 U;  2V68 A;  3JYT A;  2NUU G;  5C5J A;  4C8N A;  2V69 A;  2FVC A;  4DX7 A;  3JTP A;  1N36 F;  2LU2 A;  4ZP9 A;  3RYL A;  5ETL A;  2VF3 A;  1TL1 B;  2CRL A;  1WHV A;  2RRB A;  3BM7 A;  3ZZO A;  1M1K T;  1RHK B;  2MZS A;  5KTQ A;  4PG8 A;  2W4D A;  3BGU A;  1R8A A;  1YRT A;  3V4I A;  3W5Z A;  4X62 J;  3OUY A;  1HWK A;  4B3M J;  3K5M A;  2BKP A;  1U6F A;  5J2M A;  4V19 J;  2ZH2 A;  2BBE A;  2OPP A;  1SJR A;  3JQJ A;  4GVL A;  3I4H X;  3NCQ A;  4JYA J;  1H6K X;  2YWK A;  4AT1 B;  4U67 Q;  1VQ9 S;  2R9L A;  1JNR B;  1TK8 A;  3V6D A;  1I51 B;  2JFD A;  3ULH A;  4JV1 A;  4NXN F;  2ERR A;  1UZH A;  4HTI A;  3W61 A;  1SUQ A;  2HGL A;  3LAL A;  8ATC B;  1S4F A;  4ECS A;  4F7V A;  1KR4 A;  4J7C A;  1QJH A;  2FJB B;  3OL8 A;  3VGU A;  2W9B A;  4A47 A;  1LV5 A;  4MFB B;  2JC0 A;  3CNQ P;  4WCE Q;  3HI9 A;  3HT3 A;  1KVI A;  4ZPA A;  3J80 U;  5IC6 B;  3HHN B;  2FIU A;  1A9N B;  1FX2 A;  4OZ3 A;  2JFK A;  3K5L A;  1CS4 B;  2LLZ A;  3NS7 B;  1U1R A;  4P75 A;  1KBR A;  3CO9 A;  4ILL A;  2GVD A;  3GIM A;  1GH8 A;  1TL3 A;  3IS9 A;  4H4M B;  4FF1 A;  2DIS A;  3G6X A;  2XYP B;  1I1G A;  4NML A;  4UOG A;  4PXC A;  5AE1 A;  2DNG A;  2Q6C A;  4JI6 J;  3M7V A;  3MPY A;  2XGP A;  4X4N A;  1HHS A;  1I5O B;  2CXE A;  2R42 A;  3MUM P;  4RW4 A;  4CWB A;  3ILL A;  1U47 A;  2C2R A;  2EBE A;  3POT A;  4NOH A;  1TKZ A;  1NLK L;  1I3O B;  5DDP C;  4F3O A;  5A6W A;  3H5X A;  2ZWO A;  2H4Y B;  3DOM A;  1KQK A;  2QSW A;  2FZG B;  2VKZ G;  1IBC B;  2ASD A;  2P8I A;  5M2R A;  2P6S A;  2CJB A;  4KPY A;  3MGJ A;  2HHP A;  3HX9 A;  4NX9 A;  4O4G A;  1RCX B;  1UL3 A;  3UCU P;  4A46 A;  1V3S A;  2XNQ A;  3BPS P;  4WTO B;  3QZ8 A;  1KHV A;  3N4W A;  4MMO A;  5FD1 A;  1UFK A;  2AD9 A;  3BKF A;  1IBK J;  1N32 F;  1RT5 B;  4OYW A;  2K3K A;  2AYM A;  5KFV A;  5HRO B;  3K7R A;  1VQK S;  2HHX A;  2J8S A;  1Q95 G;  2VUG A;  2LXU A;  1RLC L;  1FNX H;  2QX0 A;  3P4U B;  4ZPB A;  3SCI E;  2YNG B;  3HHD A;  1O51 A;  3N79 A;  1CC7 A;  4K8R A;  4XO0 A;  3P49 B;  1Y00 A;  3GJS B;  4PQA A;  4USJ C;  3THT A;  4C98 A;  3T1Y F;  2I2Y A;  1QLN A;  1CUL B;  2GC8 A;  4NA1 A;  2C3O A;  1X31 C;  5GMK a;  3M8P B;  3W62 A;  2R8I A;  2F8H A;  2YWW A;  3MCN A;  2B43 A;  1DQ8 A;  3NWG A;  4TYB A;  3PDN A;  3NCR A; 
#chains in the Genus database with same CATH homology
 4FDF A;  2IIH A;  3JQJ A;  3JQM A;  2EKN A;  2OHD A;  4PYD A;  2EEY A;  4PYA A;  3JQK A;  1EKS A;  2IDE A;  1EKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...