1EL0A

Solution structure of the human cc chemokine, i-309
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
b'SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords I-309
publication title Human CC chemokine I-309, structural consequences of the additional disulfide bond.
pubmed doi rcsb
molecule tags Immune system
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1el0A00
1EIHA 5CMDA 1C8CA 1B50A 1PFNA 1F9RA 1S4ZA 3I8ZA 5D65A 5E4XA 1O7YA 2HCCA 2XIWA 1HA6A 5CBEE 3DEPA 2K03A 2H1EA 1HFGA 3DM1A 1B4OA 5COYA 4ZKBB 2B2VC 1U4LA 2NWGA 1B2TA 4RA8A 1XX8A 1MI2A 4DN4M 2L12A 4XT3B 2B2YA 1F9PA 1IKLA 1U4MA 4IUVA 5AFWA 4R8IA 4X3UA 1WD0A 5EQ0A 3Q6SA 1AZPA 2K28A 4IUPA 1B53A 2VXWA 4IUQA 2KEDA 1HRJA 2RSNA 1NR4A 4CJ0B 2B2WC 4MHEA 2K01A 1MGSA 1DOMA 2B2UC 3QO2A 4MN3A 1Q3LA 2X6LA 5EPKA 2MJ8A 3GV3A 3GV6A 3TZDA 1O80A 1EIGA 3H91A 2EPBA 4OIJA 1AZQA 2X6GA 1DZ1A 1BF4A 2CVRA 2MGSA 1G2SA 1ML0D 3KBXA 1TVXA 1ICWA 4IURA 1DONA 1ZXTA 1CM9A 1DOKA 2J7ZA 4R9WA 2R3ZA 2KECA 1VMPA 5EJWA 1MSHA 2FMMA 3UI2A 4ZLTF 1KNEA 1MSGA 1B3AA 1ESRA 2FJ2A 2FHTA 2NYZD 4ZAIA 1WTVA 3KUPA 2NZ1D 2JP1A 5EKIA 1PFMA 3LWEA 4RWSC 3FPUB 1X3PA 2KOLA 1HHVA 2DY7A 1LV9A 1U4PA 3R93A 3MWYW 4HSVA 2B2YC 1G91A 3I91A 4X3KA 2RSOA 2D9UA 1AP0A 2RVLA 4CJ1B 1CA5A 1WTRA 1IKMA 2K05A 2DY8A 1F9QA 2BDNA 4UAIA 1WTXA 4ZKCB 4HCSA 3ONAB 1HUNA 3SVMA 2SDFA 4HAEA 4QUCA 4QUFA 1BNZA 2HCIA 3IL8A 2L9HA 2KVMA 4LMQD 1PFBA 2K04A 2KEEA 5EPJA 2HDLA 1JE4A 1HUMA 1XYIA 1VMCA 1PLFA 4ZK9B 5JJZA 2B2TA 2MP1A 4HEDA 4NW2A 1WTOA 1WTPA 1SAPA 2L11A 1HFNA 1JICA 1RJTA 1SSOA 1BBXC 3FDTA 4X3SA 4IUUA 5DNFA 1G2TA 1EL0A 2MPMA 1J8IA 2N55A 1KNAA 3DEOA 1WTWA 3TN2A 4XT1B 1F9SA 1EQTA 2Q8TA 1U4RA 2KUMA 1J9OA 4XDXA 1IL8A 1QNKA 4OIKA 3D6WA 2FINB 3I90A 4IUTA 5E4WC 1CA6A 3G7LA 1ILQA 3HP3A 2L1BA 1DOLA 1RTNA 5CBAE 1F2LA 3IFDA 1A15A 1X3QA 4CJ2C 2B2VA 1BO0A 1GUWA 4RAUC 1RODA 2HUGA 1PDQA 2FFKB 2IL8A 2Q8RE 3F2UA 3I3CA 1WTQA 1EOTA 4X3TA 5D14A 5EPLA 2JYOA 1RTOA 1ILPA 1X32A 2L4NA 1SDFA 1G6ZA 4O42A 2M2LA 2N88A 2X69A 2EOTA 1NCVA 1O7ZA 3N52A 2B2TC 1NAPA 2B2WA 2B2UA 1WVLA 1M8AA 1QG7A 2K1BA 5T1IA 2HDMA 1RHPA 3P7JA 1NR2A 2EE1A 2RA4A 5CORA 1WD1A 3MTSA 4U68A 1E0BA 5T1GA 1QE6A
chains in the Genus database with same CATH superfamily
5GAEC 3QR8A 3BVZA 3F2DA 3KLSA 2UU9L 3T56B 5FLXL 2H1EA 1L1OA 1GM5A 2F03A 1SROA 4RA8A 4PQXA 3GTGH 4DKAC 3M3YB 1VQCA 2F0HA 2F52A 3MA2B 1OTCA 1E3PA 3MEFA 1KTKA 2P5ZX 3BG3A 1LLRD 4A3CH 2LFNA 1TT2A 1Q3LA 4CGYB 1SR3A 4A3IB 1IBKL 2F0SA 2RCFA 2VL6A 3S15H 1WOCA 1GOZA 2CW0D 3JAME 4RKBA 3AFPA 4FXKC 2DNEA 3GTQH 5FLXc 3F2BA 1SRUA 4RKLA 3K8AA 5ELEA 2K5QA 4TKOB 1RF2D 2KOLA 1PTOC 2VQEQ 3GTOB 2CKZB 4A3DG 1ONLA 1KDBA 2B2YC 2D0PA 1N8RC 5M5WB 3BVMA 4YCUA 1Y69U 3C46A 1VQKA 1PYSB 4JI4L 2C9OA 4WORA 3RN2A 4P71A 5M3FH 2OT2A 1HZ9A 1XWEA 2QF7A 1EOVA 3Q0AA 1A2TA 1SNPA 1YI2A 2IT1A 4Y52H 1R9TB 3MXNA 4JI3Q 1STHA 1GKHA 3PUXA 3VR6A 2SNMA 4A93H 5GAGC 3A55A 1EUJA 4JBWA 3CCJA 4U673 2K52A 4GN4B 5C0XH 4IUTA 5E4WC 4Q5VA 4DU9A 3HP3A 1QUQA 1S5DD 1TS5A 4JV5L 4HTHA 2MNAA 2VNUD 2B2VA 3UE0A 2PQAB 3DWAA 3F2UA 3PUVA 3UE1A 1S5FD 4YCVA 4H44C 1RTOA 3JC66 1KDCA 4HMJA 1G6ZA 5EBCA 4C3HG 2M2LA 3SHLA 1JWUD 2B2WA 4XQQA 4DR5Q 3D3RA 1II3A 1A3VA 3EJIA 2JA8H 2NVTH 3CPWA 1QVGA 3KK7A 1GO3E 1E2WA 1VQBA 5C4ZA 4U68A 3TMEA 1VQMA 2RDGA 1QE6A 3A8KE 4DV0Q 4L63B 4HCEA 3CQZB 2SOBA 4B3SQ 4GKJL 4DAYA 2Z0SA 1EY6A 1SMYC 2NVXH 1TWFH 1B4OA 4A3MB 2R93B 1U4LA 3SK4A 1PV4A 1EU3A 1F9PA 3CU7A 3S17H 2BH2A 1STBA 1Z47A 3TBIB 4LFAL 2A6EC 4IPDA 2JJQA 4DV2L 2UXBQ 3SE0A 1DYQA 3SK8A 4A4IA 2B2UC 4PG3A 4IOAA 5D3IB 2JA5B 4R8NA 1SXTA 3I4MH 2YTYA 4DV4L 3OIQA 2WAQB 1DOKA 2R3ZA 2AWOA 4LF5Q 1PZJD 3KYHC 3W1BA 1MSGA 3D4DA 2CWPA 2QDLA 3NBHB 3STBD 1RCVD 4KN4C 5IGBA 1P8LA 4BA2I 2IX3A 2D9UA 4JI6L 1Q90A 1CA5A 4UAIA 2EJGC 2G5DA 2JA9A 1I50B 2NN6I 5BR8Q 3S1RB 1VQGA 4LMQD 3CCSA 3KF6B 1H95A 3CRLC 3FMCA 1H9SB 4KY7A 4A76A 1SEBD 2L5TA 5FJ8H 1PLFA 4PV1C 4I7AA 2MP1A 5G3LD 1KD1C 4NW2A 4WFN3 4LFBL 1SAPA 4DV6Q 4OO1I 1JICA 3MXPA 3FDTA 2KENA 1C4QA 1SNOA 2LS01 1KQSA 4A3LH 3PUWA 2IHFA 2A69D 1DXMA 2JA7B 3H3VI 4JYAQ 3J80c 4NP5A 1OXXK 3H09A 3U58A 2FINB 4EGVA 1TXYA 1JOKA 3S14H 3OYYA 3HOUB 1N9WA 1BO0A 1NJIC 5JEAH 3J7ZC 4OL7A 1KRTA 3T53B 3UDGA 1SNQA 1SLJA 1VQDA 3A7LA 1XNRL 4IOCA 1Q8IA 3BYYB 1YIJA 1NCVA 4B3TL 4FF4A 1X3FA 3H0GG 3HOWH 1YEZA 2ICIA 3IRBA 4JBKA 2GA4B 2XWJB 2E8GA 4GLAC 5CMDA 2N8NA 1B50A 4PZ7A 4DA2A 2B39A 3I70A 2CCZA 1UNSA 2K03A 4EQPA 4X65Q 5I6WA 1VF7A 3A5UA 4XT3B 2KHJA 3RMHA 4C3JB 1H9KA 3J81i 2Q2TA 4A3MG 3L3OC 4IUQA 3J7AF 1J5EQ 2PW5A 5BN3A 2RDFA 4J6HA 4P2CB 1G6PA 3G48A 4JVZA 2TSSA 4X62L 1HNWQ 1Q1EA 2MJ8A 2D0OA 1EYGA 5G3LF 2EYPA 4BY1B 3VA5A 1O78A 3OWFA 1ICWA 3ZYYX 2JA5G 5EJWA 3RN5A 2KCTA 4C2MB 2A6HC 1E22A 3S1QB 4X66Q 2NUCA 1VF5C 2QEJC 2MO1A 4LAAA 1YNXA 2WAQG 1EQRA 1X3PA 1HHVA 1E1TA 2PCFB 1K9MC 3A7AB 3I91A 2M9VA 3OW2A 1WTRA 1JMCA 1B8AA 1PMRA 3RR5A 4ZKCB 3ONAB 1PH9A 1SMYD 4EVOA 3DWQA 2KVMA 2ZTDA 4OWTB 3HOZB 3I4NH 3VR4A 2L11A 4FF1A 1HFNA 1SSOA 4IUUA 1QNUA 1AE3A 4O1NA 2GVAA 5FO9B 3C1EA 4GZYC 4IO9A 1Q1BA 4XDXA 2Y0SE 3J7AV 1F2YA 4OX9L 1R4PB 1DOLA 2QEXA 3B6YA 4ME5A 4P72A 1J6QA 2F4IA 1PYBA 4X3TA 2KCCA 4HJ7A 3HOUG 4IFDI 1FD7D 1X32A 2J4XA 1TWGH 1EQQA 2NTTA 2X69A 4C56C 5KNDA 1LT3D 1O7ZA 2B2TC 1OXSC 1LO5D 3HG9A 4K6LA 2MFIA 4ODGA 4A3GB 1N36L 1B7YB 3OMGA 2B63H 2A1AA 2LY7A 4LF6L 2Z1CA 1O7YA 1Y1VB 1G8ZD 2HHHL 4A3DH 1HFGA 1MIUA 3DUZA 2VB3X 1HNXL 2DJGC 5IY0A 1VQEA 3NK9A 2JA6B 5C4HA 5M5YH 4QB4A 3FVQA 5CGKA 5M3FG 4C1NI 4OONA 1EYCA 2O5IC 4IFDJ 4C3JG 3O13A 4MHEA 1V1OA 3K5LA 4A3JB 1I6HB 1S5BD 2AKWB 2X6GA 2EXDA 3EIVA 4A93G 2E76C 1OXVA 2R61A 1VMPA 2SNSA 1MSHA 4BY1G 4Y7NH 5IT9E 4K8IA 2PQEA 1WTVA 1O7IA 1Q8KA 1IBKQ 3R93A 2LMCB 3M7GA 3RZOB 3A54A 5CV8A 2PYKA 3MAQA 4C3HH 1ENFA 1I4PA 3VYSA 5EAYA 4V190 3F8TA 3OIPA 3Q23A 1SE4A 4KHVA 2JQOA 3QB3A 2JA8G 1WTPA 2ZTEA 1IYVA 5M5XB 2IW3A 3D4RA 3HOZG 1VQPA 4JI4Q 2K50A 4RFBA 1KNAA 2E2JB 2I46A 1YJWA 1BBWA 3PO3B 1UUPA 1U4RA 4DR1Q 1QCBD 1JE5A 1BCPD 5JAVA 5K36H 2DGYA 3HOXB 4LNQA 2PNHA 3S9WA 3CCUA 5DLQE 1A15A 1GUWA 1RODA 3HKSA 1IHZA 1SNCA 4A3EB 4ZUJA 3T16A 3M3YH 5JJIA 5C4JB 4KJOA 1CT1D 2XWBB 3WDNA 4JV5Q 3E9HA 1SNMA 5M3MB 3PIPA 2K7VA 2E2IB 4KKUA 1D8LA 1WVLA 1IYUA 3KBGA 3J7YW 3URYA 2R7ZB 1FVIA 3SGIA 2UXDL 2R7DA 1I6VC 4A3GG 1GUTA 2RKSA 1VQIA 2XIWA 3HEJA 4DK6C 5KYLA 5LMNL 2EY6A 1EWCA 4DUZL 5IYCG 1VQOA 1Y1VG 5J39A 3GTOH 1LT6D 2C35B 5IP9G 1Q7YC 3RLNA 5M5WH 1TU2B 4GKJQ 4XQNA 3UDIA 3VR3A 4IUPA 1B53A 3K57A 1A2UA 2Y0SB 3T1HL 3U9SA 1Y1WB 2YU9H 2RQXA 1A62A 3QO2A 1NMGA 1TS4A 4YHHQ 2HIVA 1A3UA 3GV3A 3LWUA 1F77A 3K81C 2Q8IB 1HH2P 2XSCA 3M4PA 2MGSA 2Z8LA 2F0VA 4LFAQ 5KRUA 1R9TH 4PZ8A 1K8AC 4C3IB 2A5HA 4MTNA 4DV2Q 3CCLA 1JWSD 1ET9A 1V1PB 2R7FA 3CAMA 3NSWA 4ZQ3A 2NZ1D 1BCPF 1YNNC 4K14A 1L1OC 4KI0A 3KJOA 1HR0W 2PZTA 1TY2A 1JQYD 4GOPA 5DM63 1EWHA 4DV4Q 3V2TA 1JT8A 4JI2L 1AW7A 1EU4A 4YIJA 1HTPA 3EROA 3IL8A 1KIXA 3RNUA 3GTLB 3Q8DA 4JI6Q 3BZKA 3R2TA 1UEBA 1K3BC 2PI2A 1EY9A 3LX0A 2LSSA 4RG1A 5GROA 2B29A 1CKNA 4KKTA 4KY6A 1K28A 3CQZH 4KLKA 3J81E 2Z4IA 3D6WA 1KLGD 3NTIA 4LFBQ 3M4YA 3MC0B 3OMCA 5HY6A 3IFDA 4LUZA 3U4VA 3HOXG 4J8QA 4A3MH 2E5LL 3QWNA 2K32A 5I9OA 2R93H 2A19A 1U9RA 4BY7B 3C3LA 1ZYRC 3PIOA 3ERSX 1EYAA 1HA5A 1B3QA 3EQLC 4A3EG 2ZXPA 1GUNA 4HIKA 2JA5H 4JI5L 2AQ1B 5M9OA 5I4DA 1YHAA 4XQJA 1XNRQ 1YZ6A 2R7ZG 2HCCA 4CDCC 4B3TQ 1S72A 3VR2A 4DK0A 3J80i 5H1SE 2C5CA 1K0RA 2B2VC 4DNTB 5HGQA 3M4OB 4BBSB 2H4OA 2H5XA 3KFUA 1WD0A 3Q24A 4PMBA 1AZPA 4UP7A 3D0FA 5DEHA 4BA1I 5FO7B 4HJ8A 3KDFB 4CJ0B 3S1RH 2B2WC 1BOSA 3BDCA 2K5HA 1D2BA 2LXKA 1PRTC 2IX0A 2Y0SG 4OIJA 3AYHB 1Y1WG 1TVXA 5C44B 2PMZE 5FOBB 4NB3A 2FJ2A 4X62Q 4C3IG 1L1OB 2JP1A 5EKIA 2NB0A 4NMZA 1K3RA 5A2QL 3T4AC 3VA7A 4HIOA 4X3KA 1AP0A 3HOUH 1HTLD 3NTKA 1LTID 4MNOA 4RMFA 4HAEA 4GNXA 1CI3M 4TQUS 1A63A 4JI0Q 3VYRA 4LF9L 1QVFA 2HDLA 1JE4A 2B63G 5ELDA 4R4QA 5JJZA 4RGNA 3S2HH 4FXGC 4DR4Q 1KAWA 1RJTA 4H13C 4K5XA 4X3SA 4DXGA 1CQFA 2D5DA 1IW7D 3TS0A 1TS2A 3N6RA 4KTAA 4XT1B 3TRZA 1ENCA 1SJHD 1TR5A 1IBLL 4NXNL 2KQ3A 2ASBA 1Q46A 1QOHA 3S1NB 3H3VC 3LNNA 1HNZL 5CBAE 1E2VA 3PSIA 2JE6I 4CHTB 1Q81C 2R92B 2CQOA 2F0FA 4ME3A 2L0CA 4C3JH 4DR6L 2F4VL 3D6CA 2IY5B 4B3RL 1ASYA 3MFYA 1PH2A 4BY7G 2VZAA 1SJED 1Q86C 1N34L 5C6AA 3CP0A 3ERQA 1CK1A 2HDMA 3P7JA 2A68C 4G57A 4DFAA 1PH1A 5JJLA 3CHBD 4BY1H 1BQQT 5IE8A 4A3FB 3MVVA 4C2MH 2QCPX 4FXDA 1QUQB 3S1QH 2MUYA 1N36Q 2K6AA 3QOJA 2PNRC 1JB3A 1XMOL 2F0GA 3DXJC 1MI2A 4FF3A 4GN3B 4F87A 4X3UA 4A3KB 5KNCA 4LF6Q 5EQ0A 4PNYA 5L37A 3W1GA 4BBSG 2HHHQ 2KA7A 2UXCL 3S1MH 1X56A 1HNXQ 1PYWD 1UE7A 1G291 2HIXA 2PQAA 1PRTB 1BDOA 1RDPD 3HOZH 2TMPA 1KDAA 3AQQA 3M85A 1ZYRD 5FLXE 1ZEQX 1ML0D 4ALPA 4V0BA 2F0NA 1ZXTA 2F0UA 3G4SA 4QIWE 1S40A 4DAYB 2FMMA 5K36G 4YY3L 1CFMA 2WB1B 3TDQA 4O0AA 1CHQD 3MXGA 4M1UB 3X3MA 3H94A 4KHPL 4CDDC 1CKMA 2YTXA 3QJYA 5C4XB 4TSSA 2PO4A 1LYLA 2F0OA 3HOVB 4QUCA 4QUFA 1X9NA 1I4RA 4IZ8A 3CKIB 4JOIA 4DK3C 1F2MA 3P75A 3CC2A 4G7OC 4A3IG 2WACA 4NDXA 1I3QB 4A3GH 1EEFD 3J81j 5DNFA 3VYUA 3MFGA 2B3GA 1R4QB 1WI5A 1ET6A 4NKLA 1V9PA 1IYJB 1PTOB 3I4LA 1WCMB 2F0MA 1HQRD 3BZCA 3ND8A 3J80L 2Q8TA 4L5QA 1UWVA 2BE5C 1CA6A 5IYCH 1Y1VH 3GDEA 2L1BA 1YBYA 5IP9H 1HZCA 2F0LA 1TWHB 4RAUC 2PMZB 3KF8A 2Q2UA 4DNIA 1ILPA 4ABNA 2JA6H 2L4NA 5BN4A 2WFWA 2R92G 1PH3A 3NENA 2N88A 2DJFC 4FO2A 2VW9A 5C5MA 4B3ML 1STYA 3M7NA 3CCVA 5JVG3 3K80C 5T1IA 1VQJA 1RHPA 4EQ5A 1ENAA 1NE3A 1CZWA 3UDXA 1WD1A 4ZUIA 3FKIB 1H9SA 5KIXA 5LMUQ 4APVA 3EN2A 2XRQD 4JI1L 4A3FG 3TP5A 2XTIA 3MHBA 4N8FA 4DN4M 1T5EA 2UXDQ 1PTOD 5ELOA 1U4MA 2VY3A 3ULLA 3RZOH 3Q6SA 1E2ZA 4GKKL 5LMNQ 3DMUA 4DUZQ 5IWAQ 2EJFC 3TZDA 1DM0B 1SYFA 2OF1A 3PQIA 5IGCA 1YITA 1VDZA 1NMFA 4YWLA 4X64L 5BN5A 1GUSA 3T1HQ 4QJFA 2E2JH 4BS9A 1BXTA 1PFMA 1DJRD 5DM73 2J0TD 3LGJA 4RWSC 2BA1A 1K8OA 3HOXH 3ULPA 2R93G 1B9NA 3FEWX 1I4XA 1E0BA 3MWYW 4HSVA 2N78A 3AMUA 1F9QA 2HD3A 5C3EB 5CR3A 2WKCA 1VQ4A 2F0WA 4A3EH 3IKJA 3TSSA 5C4XG 5C4JH 3CMEA 2L9HA 3KLWA 1PFBA 3L9AX 4K8JA 1XNQL 1XYIA 5M3MH 1WTOA 2OTJA 4JI2Q 5JOBA 4KD3A 2EYMA 5IODA 2WINB 3J80E 2R7ZH 1VQLA 2Z4HA 4XIGS 1C9OA 1JJ2A 5HGTA 2KJXA 4OO1G 4POGA 2BOSA 3W2DA 1PVOA 3IFTA 1SE2A 1WCMG 2QKIC 2NTSA 3OOCA 2O2LD 2I07B 4GS3A 1W2BA 4S3SA 1X3QA 2BH8A 4CJ2C 3M9BA 4FP5D 4M8AA 4QIWB 3K5OA 1GD7A 4LJZC 2F0PA 3ULJA 2N3SA 4DV5L 2A6ED 3SEBA 1Y1WH 2E5LQ 3E0EA 1T9HA 1SE3A 3Q22A 5C0XI 5GADC 1XJVA 3H15A 2NVTB 2IHEA 2QGQA 2DUDA 2JA7G 4TVAB 4AH6A 3F1ZA 3V05A 3I8ZA 4C3IH 4LUVA 1TWAB 4N9PA 1Y8OB 3AU7A 3FKIG 3ICEA 4WJWA 2F3IA 1B2TA 1LM0A 5ELBA 1EY0A 4IQZA 1EFID 4JI5Q 1B44D 3ITPA 4HIMA 3TP8A 2K28A 3BVGA 2KEDA 2O4XA 5EKLA 1WYDA 3P1HA 3CC7A 3PO2B 1K83B 1KAAA 2F0KA 3GTLH 1K0SA 1FJGL 1TIID 4DV1L 2ALYB 2NBFA 1S5CD 2N49A 4YWMA 5A35A 3D8GA 1U5KA 2J7ZA 1EY4A 4K5WA 4RCOA 5C0XJ 3OTOL 1KNEA 1ESRA 4EQNA 3GTKH 1AFPA 2RBMA 4OWWB 1YJNA 2ENBA 2L55A 1I4HA 2RCNA 2CWAA 1JOQA 2ZM6L 3CC4A 2UU9Q 2E2DC 3PGZA 2PI2E 2IWHA 1EY8A 2B8FA 2MHVA 3I72A 1V43A 1PZID 4RH6A 4LFCL 3CPFA 2Z6KA 1BNZA 5KEEA 4BY7H 4YWKA 2VUMB 5C3EG 4BBRB 3S16H 3PIP3 3A74A 5IGGA 2I0QA 5IGDA 4DV0L 2K5NA 1LT5D 2QW7A 4B3SL 3A8IE 3CCEA 4KMUC 4NXML 2O5JC 1WTWA 1F9SA 1RD9D 4AYBE 5ELCA 2JEAI 1JR0D 4LF9Q 3GTJB 1L0YB 3NBIA 4P74A 3FHWA 2BDOA 1H9MA 3I90A 3HKZE 5K5PA 5DAUA 4GOPC 1ILQA 1X65A 3CCMA 3AFQA 4RHRA 4DGZA 3DM3A 3S14B 1ZKOA 2MO0A 2NVQB 3KJPA 2DNCA 3SDZA 3M4OH 4BBSH 2KCMA 4UPAA 3WOEA 1GUGA 2F3WA 1SFOB 4NXNQ 1KLUD 1KXLA 1SN8A 2F0TA 3DWPA 1HNZQ 2E2HH 4O2DA 4Q0FA 4JI7L 2OTLA 3BDLA 2K4KA 2K5DA 4IFDG 4LF5L 3K59A 2EE1A 3VYTA 4HR7B 1BBUA 4DR6Q 3K7AB 3PCOB 2F4VQ 2KBNA 3W3AA 1A0IA 4IPCA 4LK1C 3CXCA 2A6HD 2YYZA 3T51B 1N34Q 4ZKBB 4UY8C 2NWGA 5KNBA 1JB7A 1G51A 3I55A 4JI8L 3U4ZA 4CKCA 1BUVT 2K33A 4DV6L 3NHHA 4HMIA 4B9XA 1M1KC 4A3IH 2KHIA 4MN3A 2ATWA 3A5ZB 2X6LA 3K7UC 4UP8A 3V96A 5IYBG 1GJXA 2VB2X 1JC7A 1YJ9A 3OW7A 3TEHB 3KBXA 1VQHA 3PO2G 3NXWA 3UI2A 4K0KL 1VQNA 3SXHA 2FHTA 3X3NA 1TY0A 4AQYL 3LWEA 1O7LA 1YNJC 1N32L 1LV9A 4L8JA 2A74C 3S1NH 1HUNA 4UDUC 2JA6G 2F0JA 4YY3Q 2R92H 4ID6A 3J81c 2EIFA 3PIO3 5IYDG 3FRPB 2OCEA 1XTCD 1IBML 1JCKB 2I5MX 5EPJA 2K04A 2KEEA 1HUMA 3NE5B 3NELA 2K5WA 5KGUA 4A3JG 4ZK9B 4LF8L 2CW0C 4BBRG 3PUZA 2MPMA 1J8IA 5JPMC 1EY7A 2N55A 4FNFA 5LL6S 3UDFA 4BXXG 5FLMG 3RZDB 1IXRA 3C1FA 4FVMA 1PXUA 1LTGD 5LL6X 4A3FH 3K5MA 1LACA 4K2LA 1XMQL 1QNKA 3R3OA 4GOPB 4IPHA 4OGQC 2CHBD 1EEID 5CV5A 2RDHA 5FKAC 1PDQA 1J5EL 3NPPA 3U50C 1C7YA 5ISRA 5KYIA 4GNXC 1E7ZA 5JVH3 1C48A 4RCNA 3L7ZC 1FR3A 4O42A 3FPPA 2WP8J 3F2CA 1E24A 3N52A 4K5VA 1FL0A 5CV9A 4I7ZC 3EVQA 2IJ0A 5AJ3L 5CORA 1CKNB 4A3BB 1BF4A 3PO3G 2EYLA 1C8CA 1JWMD 3GD7A 3SR1A 4DPGA 4B3MQ 1VQ8A 1OO9B 3GTMB 4BWGB 3JAML 3AEVA 1ESFA 2EXZA 5JPNC 1HCZA 1HPCA 1RIPA 4IJHA 5GQOA 2UUBL 2AQ2B 2A8VA 2EQSA 5C4XH 2WB1E 3RUZA 4AYBB 3GO5A 5M5YB 4JI1Q 2UUAL 1HRJA 3HKZB 5M3MG 2F0QA 1FNUA 2L15A 3D4WA 3GV6A 2NN6H 2EYOA 2CVRA 1UEAB 3TQYA 4DUYL 4DR7L 2B8GA 1I3QH 3QG1A 4IURA 3HOYB 1S3OA 4GKKQ 2KECA 2I5LX 3TREA 1Z9FA 2Q2HA 3C2PA 4OO1H 4R4TA 3JAMc 1PTOH 1WCMH 3SK5A 4OEMB 1CQVA 2FXQA 1QZGA 4C1NK 1HQMC 2DY7A 3H3VH 3G6EA 5EKKA 4JCVE 1I50H 1TWHH 2K14A 3L0OA 1YHQA 4H0LC 2HCIA 3FP9A 3A0JA 4DR3L 3S2DB 2EYHA 1LT4D 1HR0L 1BR9A 3MXUA 1AH9A 1PFSA 2NVYB 1Y8NB 4G7ZC 1SYDA 2JA7H 3KDFA 4Z9CB 3QOLA 1W6KA 3DEOA 2G9HD 1SBBB 3STBC 2LKVA 3E5SA 3ZJYC 2PZWA 4DNRB 1J9OA 3FKIH 1T5XD 4CDFC 1XNQQ 3E9IA 3QIAA 1TWCB 4K2KA 3OHXC 4UHVA 1RTNA 3AB9A 2V4DA 4DF7A 2HQLA 4J1MA 4HJ9A 2PZUA 2Q8RE 1WTQA 4GNXB 3PF5A 2EY5A 5C3XA 1EIYB 1D7QA 1YNJD 4JOIC 3K58A 3PF4A 3EFXD 4H02A 3VR5A 5GAHC 3BYTB 2A69C 3GP7A 4CBVA 1SE8A 3R2IA 4ULLA 4DV5Q 2ID0A 1D1IA 1X3EA 4R1JA 1HA6A 5CBEE 4A3BG 1NBWA 4KN7C 4KJNA 3IAYA 1YNND 4NPSA 2R6GA 5I9PA 4PMWA 3TZUA 1PH8A 4QL5A 3G71A 2AWNA 4OX9Q 3MXNB 4MZ9A 5C3EH 3GTPB 3CF5A 2JXMB 1FYCA 4KY5A 2ZTCA 1D5ZC 1GHKA 1KL9A 1NR4A 2K01A 2E75C 3R8BA 5F2DA 4AYBG 1A3TA 4FYDA 3KOJA 2YU9B 2VQFL 3HKZG 4IUNA 4DV7L 4DR1L 3T1YL 2XVSA 2NZHA 4HN7A 4B9WA 2IPKD 1SYBA 3HOYG 2F0IA 2VS1A 3FPUB 3NEMA 1FJGQ 4K6DA 1A8VA 4DV1Q 5IIFA 1N33L 5IOCA 1GVPA 2RVLA 2K05A 3OTOQ 2RF4A 3HZXA 4HCSA 2EDGA 4IN3A 4DAVA 2PW7A 2ZXOA 4DR2L 4R4OA 2ZM6Q 4IFDH 2ZJPA 2Q2IA 3H0GB 4LF7L 4LFCQ 5A2QE 5C44G 3K5NA 1VQ9A 3KLRA 4OELB 1TWAH 3RD4A 3ER0A 2CH4W 3TP6A 4NXMQ 2D2CC 2M00A 1CKOA 4IJLA 1EOTA 5D14A 3NP8A 4XYOA 4MTKA 4XYQA 2YV5A 4YHHL 1D1KA 3M4QA 3EBEA 5IYBH 2V1CC 4JC0A 5HURA 1QG7A 1C0AA 3PUYA 1VS0A 1K83H 1PH5A 3PO2H 2FMCA 1PRTD 5I2XA 4OWXB 1F9RA 1S4ZA 3A8JE 5E4XA 4JI7Q 1I5FA 3TS2A 3DM1A 1EQVA 4B08A 3NBHA 1H9JA 2EZVA 2B2YA 3KF8B 4HSPA 4R8IA 1OXUA 5IYDH 1P16A 3NQTA 1JORA 4CKBA 1OXTA 4LF4L 4LWCA 2RSNA 4A3JH 1I6HH 4KHZA 1L0XB 2VUMH 1MD2D 1S5ED 1CHPD 3E0JA 5EPKA 3KF6A 4BBRH 1O80A 3TP7A 1AZQA 4BXXH 2XRSD 5FLMH 4JI8Q 1B9MA 2QILA 4J15A 1XTDA 1DD2A 1B1ZA 5CV6A 2RHSB 3MZ5A 1STAA 4RHSA 2NYZD 2JN4A 3E3XA 3GTJH 1W6JA 1B70B 3GTGB 1G91A 2UUCL 1M4VA 1I94L 4WJ3M 1IKMA 2EY2A 2DY8A 4A3KG 2JSOA 1UAPA 4K0KQ 2NVQH 4AQYQ 3OSOA 4N8X1 1SFOH 1WJJA 2RHQB 1N32Q 1SYEA 2NZOA 5M5XH 4N9TA 2EY1A 1VMCA 2OWOA 1EZ6A 1UE6A 3S15B 4GLVB 5E1FA 1VCIA 3PO3H 1PRTF 3S2HB 1MBYA 3GTQB 3I73A 1SNDA 1YVCA 1PA6A 5IP7G 3TN2A 2A68D 3J7A5 1IBMQ 1GXDC 1EQTA 3K7AH 4DAMA 2KUMA 3WWVA 2JEBI 4LF8Q 2WB1G 2IX1A 1PH4A 1Y14B 2IL8A 4JW0A 5LHY1 2OQ0A 1V8QA 5EPLA 1TKWB 2Z6KC 4DV3L 5M3FB 1LTBD 3HOVG 1XMQQ 4G4KA 1FNVA 2KCNA 2E2IH 3G6JB 2NN6G 1NAPA 2B2UA 1M8AA 4XXEA 1MKHA 3KLSX 2K75A 4A93B 4P73A 4R4CA 2BA0A 3RLFA 3KUPA 1BCPC 1UE1A 2ZT9C 1HZBA 2XN9C 2PPBC 3DEPA 1D6EC 1PTOF 1STGA 4XTCS 5C5LA 1AE2A 2A73B 2OXPA 4G7HC 4ZRZA 2ZJRA 3ND9A 5IGFA 4ZCKA 5AJ3Q 2L12A 1KC8C 1IKLA 5IT9L 4IUVA 3S24A 4JI0L 3U9OA 1EY5A 1RKNA 1KHIA 3I2ZA 3P20A 4DR4L 1LTRD 4PZ6A 4X6AH 2AUKA 1MGSA 1DOMA 1QJOA 1LTSD 2OEOA 5EBDA 3S1MB 2JA8B 3H91A 2UUBQ 1DZ1A 2VQEL 4OXPA 2F0EA 1I4QA 3PV0A 2K5VA 5ELFA 2UUAQ 4ZLTF 2NVXB 1TWFB 1MHWC 4RGMA 1GUOA 4ZAIA 3RZDH 1MJCA 2ICEC 1EIFA 4CKEA 5ELNA 5IT9c 2DN8A 2BE5D 4DUYQ 4DR7Q 5I2YA 3S17B 1H9RA 2RSOA 1NTGA 1Q12A 2G9DA 4HJAA 4JI3L 4CDEC 4POFA 2WKDA 1LUZA 1AEXA 2SDFA 4R4IA 4ZYSA 1FGUA 4F8MA 4QGUA 4FF2A 2ES2A 4A3CG 3I4MB 4HEDA 4IPGA 1BBXC 1EL0A 4EX5A 1XPRA 4DR3Q 4QCLA 4HIDA 2QA4A 4A3BH 4YCWA 3NUCA 1HR0Q 4OIKA 1X55A 3JAMi 1F2LA 3GTMH 4FDBA 1EFWA 4DR5L 1RL2A 1DGSA 2JYOA 3NTHA 3NWTA 4F7XA 2LXJA 1E1OA 3D31A 1SDFA 4DK1A 3EA6A 2MQHA 4GN5A 1W3SA 1HJPA 2Z9HA 4OHJA 2EJMA 5LMNW 1M90C 1IL2A 3T13A 1X3GA 4LW1A 2AQ3B 1XXGA 5CV7A 2RA4A 1LTAD 1BVSA 1BCPB 1EIHA 3HOYH 1PH7A 1PFNA 1KABA 3CD6A 4QMGA 4QQBX 3I56A 3CMAA 2UXBL 2F1MA 2ZJQA 1NSNS 5C0XG 5D3DA 1K73C 1JJGA 1IBLQ 1NNXA 1JJCB 1XX8A 1K8GA 4ILWA 1HZAA 2VXWA 5J1ZA 2ZXRA 4JG2A 3HFZB 4JBJA 3HOWB 3S2DH 1EIGA 4B3RQ 5C44H 3K0XA 3DHQA 4GLXA 3NWSA 1STNA 1G2SA 1EYDA 2NVYH 1STEA 4DXFA 3CW2C 1SMXA 3W5OA 4R9WA 1VQ5A 4L6TB 1EZ8A 4E6IA 5BR8L 2VQFQ 1K8MA 3SK6A 4JPBW 4DV7Q 1U4PA 1TWCH 3T1YQ 3NQIA 4CJ1B 2AMCB 3H6MA 4KD4A 2F3VA 2SEBD 2OQKA 3J81L 1CSPA 1FGBD 2YTVA 4WRDA 1XMOQ 2EYJA 1Z6HA 2AHOB 1N33Q 4JYAL 4QF4A 4HJ5A 2B2TA 2UXCQ 3HRZC 1CSQA 4MIUA 3BZDB 5LMUL 3I4MG 3CRKC 1Q82C 4KV6A 1FNWA 5JEAJ 4DR2Q 2QDBA 1GHJA 2KHSA 5C3WA 3G7LA 3DLLA 4LF7Q 5CC4A 1ASZA 3BJUA 5FK9C 2D62A 2FFKB 3I3CA 1NUCA 5IWAL 5CYUA 4KHPQ 1QVCA 4I65A 2VUMG 3I4NB 4P75A 3GTPH 4UP9A 3BDOA 1QB5D 4RGOS 5J22A 3E6ZX 1LABA 1IW7C 4QY7A 5FJ8G 2K1BA 1BKBA 4X65L 1CTMA 1TS3A 3MTSA 5T1GA 4L5SA 1Y8PB 1F2ZA 4A3LG 4WJ4A 2EYFA 5D65A 3CCQA 1D5XC 1HXYD 1V1PA 2CQAA 3L2PA 5COYA 2BCOA 2CH4A 1PHJA 1ICFB 3HS0C 1HNWL 4A3KH 5JJKA 1JOOA 1LTLA 2JK8A 5E3FA 5AFWA 2HT1A 1L0WA 1TWGB 3WOFA 5JEAG 2E74C 1VQ6A 5NUCA 4JK1C 4PMCA 2Z6BA 4X66L 4H7BA 1G2TA 4TRDA 1U0LA 4KKSA 1CUKA 1X54A 4L5RC 1IZ6A 2B63B 3K6OA 2EPBA 1PZKD 3BS1A 4IALA 3H0GH 1WFQA 5IP7H 3HOWG 1DONA 1QWYA 1CM9A 2AUJD 3RLOA 4LF4Q 1PH6A 2F0DA 1B3AA 5TSSA 4A3DB 1AN8A 1VQAA 3CCRA 3GTKB 1NY4A 1CZGA 1A6XA 4AIMA 4DAPA 3VDYA 1XPUA 1VQFA 2BDNA 3HOVH 1WTXA 1WTHA 3MEHA 3SVMA 1VQ7A 4LUOA 1DCZA 1XPOA 2GN5A 2WV6D 1LTTD 5I6YA 1QZHA 5FO8B 1TQOA 2UUCQ 1YHBA 1I94Q 1I4GA 3S16B 2I5HA 1SYGA 2XNAC 3HGBA 5J3BA 4EQOA 1MJEA 2CFMA 4Y7NB 1SYCA 5CV4A 2HQEA 4KK7A 2EVBA 4X64Q 1IL8A 4L5TA 5E7NA 1L2FA 3I4OA 2GVBA 1UE5A 2WIIB 1EWIA 1Z7TA 5IGEA 2HUGA 1V1QA 3OWEB 4C3HB 3GQBA 2WAQE 3A56A 4A75A 1D5MC 4F88A 4RGTA 3OPOA 5EGTA 1KRSA 2XGTA 3PMFA 2EOTA 4JBMA 3I4NG 1X6OA 3BU2A 2E2HB 3K0YA 1NR2A 4DV3Q 3I7FA 1QILA
chains in the Genus database with same CATH topology
3BVZA 3KLSA 3T56B 5FLXL 2H1EA 2F03A 4RA8A 4PQXA 3M3YB 2F0HA 3MA2B 1KTKA 3BG3A 1LLRD 2LFNA 1TT2A 1Q3LA 4CGYB 4A3IB 2F0SA 2CW0D 1GOZA 3JAME 4RKBA 4FXKC 2DNEA 4RKLA 5ELEA 2K5QA 4TKOB 1RF2D 2KOLA 1PTOC 3GTOB 1ONLA 1KDBA 2B2YC 5M5WB 3BVMA 1Y69U 3C46A 2C9OA 4WORA 2OT2A 1XWEA 2QF7A 3Q0AA 1A2TA 1SNPA 2IT1A 1R9TB 3MXNA 1STHA 3PUXA 3VR6A 2SNMA 3A55A 4JBWA 4U673 5C0XH 4IUTA 5E4WC 4Q5VA 4DU9A 3HP3A 1S5DD 1TS5A 4HTHA 2VNUD 2B2VA 3DWAA 3F2UA 3PUVA 1S5FD 4H44C 1RTOA 1KDCA 4HMJA 1G6ZA 5EBCA 4C3HG 2M2LA 3SHLA 1JWUD 2B2WA 4XQQA 3D3RA 1II3A 1A3VA 3EJIA 3KK7A 1E2WA 5C4ZA 4U68A 3TMEA 2RDGA 1QE6A 3A8KE 4L63B 4HCEA 3CQZB 2SOBA 4DAYA 1EY6A 1SMYC 1B4OA 4A3MB 2R93B 1U4LA 3SK4A 1EU3A 1F9PA 3CU7A 1STBA 1Z47A 3TBIB 2A6EC 3SE0A 1DYQA 3SK8A 2B2UC 5D3IB 2JA5B 4R8NA 1SXTA 3OIQA 2WAQB 1DOKA 2R3ZA 2AWOA 1PZJD 1MSGA 3D4DA 5IGBA 1RCVD 4KN4C 4BA2I 2IX3A 2D9UA 1Q90A 1CA5A 4UAIA 2EJGC 1I50B 2NN6I 3S1RB 4LMQD 3CRLC 3FMCA 1H9SB 4KY7A 1SEBD 2L5TA 1PLFA 4PV1C 5G3LD 2MP1A 4NW2A 4WFN3 1SAPA 4OO1I 1JICA 3MXPA 3FDTA 1C4QA 1SNOA 2LS01 3PUWA 2A69D 1DXMA 2JA7B 4NP5A 1OXXK 3H09A 2FINB 4EGVA 1JOKA 3HOUB 1BO0A 5JEAH 4OL7A 3T53B 1SNQA 3A7LA 1Q8IA 3BYYB 1NCVA 4FF4A 2ICIA 2GA4B 2XWJB 5CMDA 1B50A 4DA2A 2B39A 3I70A 1UNSA 2K03A 4EQPA 5I6WA 1VF7A 4XT3B 3RMHA 4C3JB 1H9KA 3L3OC 4IUQA 3J7AF 2PW5A 5BN3A 2RDFA 4J6HA 4P2CB 2TSSA 1Q1EA 2MJ8A 5G3LF 2EYPA 4BY1B 3VA5A 1O78A 3OWFA 1ICWA 3ZYYX 5EJWA 4C2MB 2A6HC 3S1QB 2NUCA 1VF5C 2QEJC 4LAAA 1X3PA 1HHVA 2PCFB 3A7AB 3I91A 2M9VA 1WTRA 1PMRA 4ZKCB 3ONAB 1SMYD 4EVOA 3DWQA 2KVMA 3HOZB 3VR4A 2L11A 4FF1A 1HFNA 1SSOA 4IUUA 1QNUA 4O1NA 5FO9B 3C1EA 4GZYC 1Q1BA 4XDXA 3J7AV 1F2YA 1R4PB 1DOLA 4ME5A 2F4IA 4X3TA 2KCCA 4IFDI 1FD7D 1X32A 2J4XA 2NTTA 2X69A 4C56C 5KNDA 1LT3D 1O7ZA 2B2TC 1OXSC 1LO5D 3HG9A 4K6LA 4ODGA 4A3GB 3OMGA 2LY7A 2Z1CA 1O7YA 1Y1VB 1G8ZD 1HFGA 3DUZA 2VB3X 3NK9A 2JA6B 5C4HA 4QB4A 3FVQA 5CGKA 4C1NI 1EYCA 2O5IC 4IFDJ 4C3JG 3O13A 4MHEA 1V1OA 3K5LA 4A3JB 1I6HB 1S5BD 2X6GA 2E76C 1OXVA 2R61A 1VMPA 2SNSA 1MSHA 5IT9E 4K8IA 2PQEA 1WTVA 3R93A 2LMCB 3M7GA 3RZOB 3A54A 5CV8A 2PYKA 3MAQA 1ENFA 1I4PA 3VYSA 4V190 3OIPA 3Q23A 1SE4A 4KHVA 3QB3A 1WTPA 1IYVA 5M5XB 2IW3A 3D4RA 4RFBA 1KNAA 2E2JB 2I46A 3PO3B 1UUPA 1U4RA 1QCBD 1BCPD 5JAVA 5K36H 3HOXB 3S9WA 1A15A 1GUWA 1RODA 1IHZA 1SNCA 4A3EB 4ZUJA 3T16A 5C4JB 4KJOA 1CT1D 2XWBB 3WDNA 1SNMA 5M3MB 2E2IB 2K7VA 4KKUA 1WVLA 1IYUA 3KBGA 3J7YW 3URYA 2R7ZB 1I6VC 1GUTA 2RKSA 2XIWA 3HEJA 5KYLA 2EY6A 1EWCA 5J39A 1LT6D 1TU2B 4XQNA 3VR3A 4IUPA 1B53A 3K57A 1A2UA 2Y0SB 3U9SA 1Y1WB 2RQXA 3QO2A 1TS4A 3GV3A 1A3UA 3LWUA 1F77A 2Q8IB 2XSCA 2Z8LA 2MGSA 2F0VA 5KRUA 4C3IB 2A5HA 1JWSD 1ET9A 1V1PB 4ZQ3A 3NSWA 2NZ1D 1BCPF 1YNNC 4K14A 4KI0A 2PZTA 1TY2A 1JQYD 5DM63 1EWHA 3V2TA 1AW7A 1EU4A 4YIJA 1HTPA 3EROA 3IL8A 3GTLB 3R2TA 1EY9A 3LX0A 4KKTA 4KY6A 3J81E 2Z4IA 3D6WA 1KLGD 3NTIA 3M4YA 3MC0B 3OMCA 3IFDA 4J8QA 3QWNA 2K32A 5I9OA 1U9RA 4BY7B 3C3LA 1ZYRC 1EYAA 1HA5A 3EQLC 2ZXPA 1GUNA 2AQ1B 5M9OA 5I4DA 4XQJA 2HCCA 3VR2A 4DK0A 2C5CA 2B2VC 4DNTB 3M4OB 4BBSB 2H4OA 1WD0A 3Q24A 4PMBA 1AZPA 5DEHA 4BA1I 5FO7B 4CJ0B 2B2WC 1BOSA 3BDCA 1D2BA 1PRTC 2IX0A 4OIJA 1TVXA 5C44B 5FOBB 2FJ2A 4C3IG 2JP1A 5EKIA 2NB0A 4NMZA 5A2QL 3T4AC 3VA7A 4X3KA 1AP0A 1HTLD 3NTKA 1LTID 4HAEA 1CI3M 4TQUS 3VYRA 2HDLA 1JE4A 5ELDA 5JJZA 4RGNA 4FXGC 4K5XA 1RJTA 4H13C 4X3SA 4DXGA 1CQFA 2D5DA 1IW7D 1TS2A 3N6RA 4KTAA 4XT1B 1ENCA 1SJHD 1TR5A 2KQ3A 1QOHA 3S1NB 3H3VC 3LNNA 5CBAE 1E2VA 2JE6I 4CHTB 2R92B 2F0FA 2L0CA 3D6CA 3MFYA 1SJED 5C6AA 3ERQA 1CK1A 2HDMA 3P7JA 2A68C 4G57A 4DFAA 3CHBD 1BQQT 4A3FB 3MVVA 2QCPX 4FXDA 2MUYA 2K6AA 3QOJA 2PNRC 1JB3A 2F0GA 3DXJC 1MI2A 4FF3A 4F87A 4X3UA 4A3KB 5KNCA 5EQ0A 4PNYA 2KA7A 1PYWD 1G291 1PRTB 1BDOA 1RDPD 2TMPA 1KDAA 3M85A 1ZYRD 5FLXE 1ZEQX 1ML0D 4V0BA 2F0NA 1ZXTA 2F0UA 2FMMA 5K36G 1CFMA 2WB1B 3TDQA 1CHQD 3MXGA 4M1UB 3X3MA 3H94A 3QJYA 5C4XB 4TSSA 2PO4A 2F0OA 3HOVB 4QUCA 4QUFA 1I4RA 4IZ8A 3CKIB 1F2MA 3P75A 4G7OC 2WACA 4NDXA 1I3QB 1EEFD 5DNFA 3VYUA 3MFGA 1R4QB 1ET6A 4NKLA 1PTOB 3I4LA 1WCMB 2F0MA 1HQRD 3ND8A 3J80L 2Q8TA 2BE5C 1CA6A 2L1BA 2F0LA 1TWHB 4RAUC 2PMZB 3KF8A 1ILPA 4ABNA 2L4NA 5BN4A 2N88A 4FO2A 5C5MA 1STYA 3M7NA 5JVG3 5T1IA 1RHPA 1ENAA 1CZWA 1WD1A 4ZUIA 3FKIB 1H9SA 5KIXA 2XRQD 3TP5A 3MHBA 4DN4M 1T5EA 1PTOD 1U4MA 3Q6SA 1E2ZA 3DMUA 3TZDA 2EJFC 1DM0B 1SYFA 2OF1A 5IGCA 1VDZA 5BN5A 1GUSA 4BS9A 1BXTA 1PFMA 1DJRD 5DM73 2J0TD 4RWSC 2BA1A 1K8OA 1B9NA 3FEWX 1I4XA 3MWYW 4HSVA 3AMUA 1F9QA 5C3EB 5CR3A 2WKCA 2F0WA 3IKJA 3TSSA 2L9HA 1PFBA 3L9AX 4K8JA 1XYIA 1WTOA 5JOBA 4KD3A 2EYMA 5IODA 2WINB 3J80E 2Z4HA 4XIGS 5HGTA 2KJXA 4OO1G 2BOSA 3W2DA 1SE2A 3IFTA 2QKIC 2NTSA 3OOCA 2O2LD 2I07B 4S3SA 1X3QA 4CJ2C 4FP5D 4M8AA 4QIWB 3K5OA 4LJZC 2F0PA 2A6ED 3SEBA 1SE3A 3Q22A 5C0XI 2NVTB 3V05A 3I8ZA 1TWAB 4N9PA 1Y8OB 3AU7A 4WJWA 1B2TA 5ELBA 1EY0A 4IQZA 1EFID 1B44D 3ITPA 3TP8A 2K28A 3BVGA 2KEDA 2O4XA 5EKLA 3P1HA 3PO2B 1K83B 1KAAA 2F0KA 1TIID 2NBFA 1S5CD 5A35A 3D8GA 2J7ZA 1EY4A 4K5WA 4RCOA 5C0XJ 1KNEA 1ESRA 4EQNA 1AFPA 2RBMA 2ENBA 2L55A 1I4HA 1JOQA 2E2DC 2IWHA 1EY8A 2B8FA 2MHVA 3I72A 1V43A 1PZID 4RH6A 1BNZA 5KEEA 2VUMB 4BBRB 3PIP3 5IGGA 5IGDA 1LT5D 3A8IE 4KMUC 2O5JC 1WTWA 1F9SA 1RD9D 2JEAI 5ELCA 1JR0D 3GTJB 1L0YB 3NBIA 2BDOA 1H9MA 3I90A 5K5PA 5DAUA 1ILQA 4RHRA 4DGZA 3S14B 1ZKOA 2NVQB 2DNCA 3SDZA 3WOEA 1GUGA 2F3WA 1SFOB 1KLUD 2F0TA 3DWPA 4Q0FA 3BDLA 2K5DA 4IFDG 3K59A 2EE1A 3VYTA 4HR7B 3K7AB 3W3AA 4LK1C 2A6HD 2YYZA 3T51B 4ZKBB 2NWGA 5KNBA 4CKCA 1BUVT 2K33A 3NHHA 4HMIA 4B9XA 4MN3A 2X6LA 3V96A 1GJXA 2VB2X 1JC7A 3OW7A 3KBXA 3NXWA 3UI2A 3SXHA 2FHTA 3X3NA 1TY0A 3LWEA 1O7LA 1YNJC 1LV9A 4L8JA 2A74C 1HUNA 4UDUC 2F0JA 4ID6A 3PIO3 3FRPB 1XTCD 1JCKB 5EPJA 2K04A 2KEEA 1HUMA 3NE5B 2K5WA 5KGUA 4ZK9B 2CW0C 3PUZA 2MPMA 1J8IA 5JPMC 1EY7A 2N55A 4FNFA 5LL6S 3RZDB 3C1FA 4FVMA 1PXUA 1LTGD 5LL6X 3K5MA 1LACA 4K2LA 1QNKA 3R3OA 4OGQC 2CHBD 1EEID 5CV5A 2RDHA 5FKAC 1PDQA 3NPPA 5ISRA 5KYIA 5JVH3 1C48A 4RCNA 3L7ZC 1FR3A 4O42A 3FPPA 2WP8J 3N52A 4K5VA 5CV9A 4I7ZC 3EVQA 2IJ0A 5CORA 4A3BB 1BF4A 2EYLA 1C8CA 1JWMD 3GD7A 3SR1A 1OO9B 3GTMB 4BWGB 3JAML 1ESFA 2EXZA 5JPNC 1HCZA 1HPCA 2AQ2B 3RUZA 4AYBB 3GO5A 5M5YB 1HRJA 3HKZB 2F0QA 1FNUA 3D4WA 3GV6A 2NN6H 2EYOA 2CVRA 1UEAB 2B8GA 3QG1A 4IURA 3HOYB 2KECA 3C2PA 4OO1H 1PTOH 3SK5A 1CQVA 4C1NK 1HQMC 2DY7A 5EKKA 4H0LC 2HCIA 3S2DB 2EYHA 1LT4D 1BR9A 3MXUA 2NVYB 1Y8NB 4G7ZC 1SYDA 4Z9CB 3QOLA 1W6KA 3DEOA 2G9HD 1SBBB 2LKVA 3E5SA 2PZWA 4DNRB 1J9OA 1T5XD 3QIAA 1TWCB 4K2KA 3OHXC 1RTNA 3AB9A 2V4DA 4DF7A 4J1MA 2PZUA 2Q8RE 1WTQA 2EY5A 5C3XA 1YNJD 3K58A 3EFXD 3VR5A 3BYTB 2A69C 3GP7A 4CBVA 3R2IA 4ULLA 2ID0A 1D1IA 1HA6A 5CBEE 4KN7C 4KJNA 3IAYA 1YNND 2R6GA 5I9PA 4PMWA 3TZUA 2AWNA 3GTPB 2JXMB 1FYCA 4KY5A 1D5ZC 1GHKA 1NR4A 2K01A 2E75C 3R8BA 5F2DA 4FYDA 1A3TA 2YU9B 4IUNA 2XVSA 4HN7A 4B9WA 2IPKD 1SYBA 2F0IA 3FPUB 4K6DA 5IIFA 5IOCA 2RVLA 2K05A 3HZXA 4HCSA 2EDGA 4IN3A 4DAVA 2PW7A 2ZXOA 4IFDH 3H0GB 5A2QE 3K5NA 3KLRA 3RD4A 3TP6A 2D2CC 2M00A 1EOTA 5D14A 3NP8A 4XYOA 4XYQA 1D1KA 5HURA 1QG7A 3PUYA 2FMCA 1PRTD 5I2XA 1F9RA 1S4ZA 3A8JE 5E4XA 3DM1A 1EQVA 4B08A 3NBHA 1H9JA 2EZVA 2B2YA 4HSPA 4R8IA 1OXUA 3NQTA 1JORA 4CKBA 1OXTA 2RSNA 4KHZA 1L0XB 1MD2D 1S5ED 1CHPD 3E0JA 5EPKA 1O80A 3TP7A 1AZQA 2XRSD 1B9MA 2QILA 1DD2A 1B1ZA 5CV6A 3MZ5A 1STAA 4RHSA 2NYZD 1W6JA 3GTGB 1G91A 1M4VA 1IKMA 2EY2A 2DY8A 2JSOA 1UAPA 3OSOA 1SYEA 4N9TA 2EY1A 1VMCA 1EZ6A 3S15B 5E1FA 1VCIA 3S2HB 1PRTF 1MBYA 3GTQB 3I73A 1SNDA 3TN2A 2A68D 1GXDC 1EQTA 2KUMA 2JEBI 2IX1A 2IL8A 5LHY1 1V8QA 5EPLA 1TKWB 5M3FB 1LTBD 4G4KA 1FNVA 2KCNA 3G6JB 2NN6G 1NAPA 2B2UA 1M8AA 4XXEA 3KLSX 4A93B 2BA0A 3RLFA 3KUPA 1BCPC 2ZT9C 2XN9C 2PPBC 3DEPA 1D6EC 1PTOF 1STGA 4XTCS 5C5LA 2A73B 2OXPA 4G7HC 4ZRZA 3ND9A 5IGFA 2L12A 1IKLA 5IT9L 4IUVA 3U9OA 1EY5A 1RKNA 3P20A 1LTRD 2AUKA 1MGSA 1DOMA 1QJOA 1LTSD 2OEOA 5EBDA 3S1MB 2JA8B 3H91A 1DZ1A 2F0EA 1I4QA 3PV0A 5ELFA 4ZLTF 2NVXB 1TWFB 4RGMA 1GUOA 4ZAIA 2ICEC 4CKEA 2DN8A 2BE5D 5I2YA 3S17B 1H9RA 2RSOA 2G9DA 1Q12A 2WKDA 1AEXA 2SDFA 4ZYSA 4F8MA 4FF2A 3I4MB 4HEDA 1BBXC 1EL0A 4QCLA 3NUCA 4OIKA 1F2LA 2JYOA 3NTHA 3NWTA 4F7XA 3D31A 1SDFA 4DK1A 3EA6A 4OHJA 2EJMA 3T13A 2AQ3B 1XXGA 5CV7A 2RA4A 1LTAD 1BCPB 1EIHA 1PFNA 1KABA 4QMGA 2F1MA 1NSNS 5C0XG 5D3DA 1XX8A 4ILWA 2VXWA 5J1ZA 2ZXRA 3HOWB 1EIGA 3DHQA 3NWSA 1STNA 1G2SA 1EYDA 1STEA 4DXFA 4R9WA 4L6TB 1EZ8A 4E6IA 1K8MA 3SK6A 1U4PA 3NQIA 4CJ1B 3H6MA 4KD4A 2F3VA 2SEBD 3J81L 4WRDA 1FGBD 2EYJA 1Z6HA 4QF4A 2B2TA 3HRZC 4MIUA 3BZDB 3CRKC 4KV6A 1FNWA 5JEAJ 2QDBA 1GHJA 2KHSA 5C3WA 3G7LA 5CC4A 5FK9C 2D62A 2FFKB 3I3CA 1NUCA 5CYUA 4I65A 3I4NB 3BDOA 1QB5D 4RGOS 5J22A 3E6ZX 1LABA 1IW7C 2K1BA 1CTMA 1TS3A 3MTSA 5T1GA 1Y8PB 1F2ZA 2EYFA 5D65A 1D5XC 1HXYD 1V1PA 2CQAA 5COYA 2BCOA 3HS0C 1JOOA 5E3FA 5AFWA 1TWGB 3WOFA 5JEAG 2E74C 5NUCA 4JK1C 4PMCA 4H7BA 1G2TA 4TRDA 4KKSA 2B63B 3K6OA 2EPBA 1PZKD 3BS1A 4IALA 1DONA 1QWYA 1CM9A 2AUJD 2F0DA 1B3AA 5TSSA 4A3DB 1AN8A 3GTKB 1CZGA 1A6XA 4DAPA 2BDNA 1WTXA 3MEHA 3SVMA 1DCZA 2WV6D 1LTTD 5I6YA 5FO8B 1TQOA 1I4GA 3S16B 1SYGA 2XNAC 3HGBA 4EQOA 4Y7NB 1SYCA 5CV4A 2HQEA 4KK7A 2EVBA 1IL8A 2WIIB 1Z7TA 5IGEA 2HUGA 4C3HB 3OWEB 3GQBA 3A56A 1D5MC 4F88A 4RGTA 3OPOA 5EGTA 3PMFA 2EOTA 2E2HB 3K0YA 1NR2A 1E0BA 1QILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIH A;  5CMD A;  1C8C A;  1B50 A;  1PFN A;  1F9R A;  1S4Z A;  3I8Z A;  5D65 A;  5E4X A;  1O7Y A;  2HCC A;  2XIW A;  1HA6 A;  5CBE E;  3DEP A;  2K03 A;  2H1E A;  1HFG A;  3DM1 A;  1B4O A;  5COY A;  4ZKB B;  2B2V C;  1U4L A;  2NWG A;  1B2T A;  4RA8 A;  1XX8 A;  1MI2 A;  4DN4 M;  2L12 A;  4XT3 B;  2B2Y A;  1F9P A;  1IKL A;  1U4M A;  4IUV A;  5AFW A;  4R8I A;  4X3U A;  1WD0 A;  5EQ0 A;  3Q6S A;  1AZP A;  2K28 A;  4IUP A;  1B53 A;  2VXW A;  4IUQ A;  2KED A;  1HRJ A;  2RSN A;  1NR4 A;  4CJ0 B;  2B2W C;  4MHE A;  2K01 A;  1MGS A;  1DOM A;  2B2U C;  3QO2 A;  4MN3 A;  1Q3L A;  2X6L A;  5EPK A;  2MJ8 A;  3GV3 A;  3GV6 A;  3TZD A;  1O80 A;  1EIG A;  3H91 A;  2EPB A;  4OIJ A;  1AZQ A;  2X6G A;  1DZ1 A;  1BF4 A;  2CVR A;  2MGS A;  1G2S A;  1ML0 D;  3KBX A;  1TVX A;  1ICW A;  4IUR A;  1DON A;  1ZXT A;  1CM9 A;  1DOK A;  2J7Z A;  4R9W A;  2R3Z A;  2KEC A;  1VMP A;  5EJW A;  1MSH A;  2FMM A;  3UI2 A;  4ZLT F;  1KNE A;  1MSG A;  1B3A A;  1ESR A;  2FJ2 A;  2FHT A;  2NYZ D;  4ZAI A;  1WTV A;  3KUP A;  2NZ1 D;  2JP1 A;  5EKI A;  1PFM A;  3LWE A;  4RWS C;  3FPU B;  1X3P A;  2KOL A;  1HHV A;  2DY7 A;  1LV9 A;  1U4P A;  3R93 A;  3MWY W;  4HSV A;  2B2Y C;  1G91 A;  3I91 A;  4X3K A;  2RSO A;  2D9U A;  1AP0 A;  2RVL A;  4CJ1 B;  1CA5 A;  1WTR A;  1IKM A;  2K05 A;  2DY8 A;  1F9Q A;  2BDN A;  4UAI A;  1WTX A;  4ZKC B;  4HCS A;  3ONA B;  1HUN A;  3SVM A;  2SDF A;  4HAE A;  4QUC A;  4QUF A;  1BNZ A;  2HCI A;  3IL8 A;  2L9H A;  2KVM A;  4LMQ D;  1PFB A;  2K04 A;  2KEE A;  5EPJ A;  2HDL A;  1JE4 A;  1HUM A;  1XYI A;  1VMC A;  1PLF A;  4ZK9 B;  5JJZ A;  2B2T A;  2MP1 A;  4HED A;  4NW2 A;  1WTO A;  1WTP A;  1SAP A;  2L11 A;  1HFN A;  1JIC A;  1RJT A;  1SSO A;  1BBX C;  3FDT A;  4X3S A;  4IUU A;  5DNF A;  1G2T A;  1EL0 A;  2MPM A;  1J8I A;  2N55 A;  1KNA A;  3DEO A;  1WTW A;  3TN2 A;  4XT1 B;  1F9S A;  1EQT A;  2Q8T A;  1U4R A;  2KUM A;  1J9O A;  4XDX A;  1IL8 A;  1QNK A;  4OIK A;  3D6W A;  2FIN B;  3I90 A;  4IUT A;  5E4W C;  1CA6 A;  3G7L A;  1ILQ A;  3HP3 A;  2L1B A;  1DOL A;  1RTN A;  5CBA E;  1F2L A;  3IFD A;  1A15 A;  1X3Q A;  4CJ2 C;  2B2V A;  1BO0 A;  1GUW A;  4RAU C;  1ROD A;  2HUG A;  1PDQ A;  2FFK B;  2IL8 A;  2Q8R E;  3F2U A;  3I3C A;  1WTQ A;  1EOT A;  4X3T A;  5D14 A;  5EPL A;  2JYO A;  1RTO A;  1ILP A;  1X32 A;  2L4N A;  1SDF A;  1G6Z A;  4O42 A;  2M2L A;  2N88 A;  2X69 A;  2EOT A;  1NCV A;  1O7Z A;  3N52 A;  2B2T C;  1NAP A;  2B2W A;  2B2U A;  1WVL A;  1M8A A;  1QG7 A;  2K1B A;  5T1I A;  2HDM A;  1RHP A;  3P7J A;  1NR2 A;  2EE1 A;  2RA4 A;  5COR A;  1WD1 A;  3MTS A;  4U68 A;  1E0B A;  5T1G A;  1QE6 A; 
#chains in the Genus database with same CATH topology
 5GAE C;  3QR8 A;  3BVZ A;  3F2D A;  3KLS A;  2UU9 L;  3T56 B;  5FLX L;  2H1E A;  1L1O A;  1GM5 A;  2F03 A;  1SRO A;  4RA8 A;  4PQX A;  3GTG H;  4DKA C;  3M3Y B;  1VQC A;  2F0H A;  2F52 A;  3MA2 B;  1OTC A;  1E3P A;  3MEF A;  1KTK A;  2P5Z X;  3BG3 A;  1LLR D;  4A3C H;  2LFN A;  1TT2 A;  1Q3L A;  4CGY B;  1SR3 A;  4A3I B;  1IBK L;  2F0S A;  2RCF A;  2VL6 A;  3S15 H;  1WOC A;  1GOZ A;  2CW0 D;  3JAM E;  4RKB A;  3AFP A;  4FXK C;  2DNE A;  3GTQ H;  5FLX c;  3F2B A;  1SRU A;  4RKL A;  3K8A A;  5ELE A;  2K5Q A;  4TKO B;  1RF2 D;  2KOL A;  1PTO C;  2VQE Q;  3GTO B;  2CKZ B;  4A3D G;  1ONL A;  1KDB A;  2B2Y C;  2D0P A;  1N8R C;  5M5W B;  3BVM A;  4YCU A;  1Y69 U;  3C46 A;  1VQK A;  1PYS B;  4JI4 L;  2C9O A;  4WOR A;  3RN2 A;  4P71 A;  5M3F H;  2OT2 A;  1HZ9 A;  1XWE A;  2QF7 A;  1EOV A;  3Q0A A;  1A2T A;  1SNP A;  1YI2 A;  2IT1 A;  4Y52 H;  1R9T B;  3MXN A;  4JI3 Q;  1STH A;  1GKH A;  3PUX A;  3VR6 A;  2SNM A;  4A93 H;  5GAG C;  3A55 A;  1EUJ A;  4JBW A;  3CCJ A;  4U67 3;  2K52 A;  4GN4 B;  5C0X H;  4IUT A;  5E4W C;  4Q5V A;  4DU9 A;  3HP3 A;  1QUQ A;  1S5D D;  1TS5 A;  4JV5 L;  4HTH A;  2MNA A;  2VNU D;  2B2V A;  3UE0 A;  2PQA B;  3DWA A;  3F2U A;  3PUV A;  3UE1 A;  1S5F D;  4YCV A;  4H44 C;  1RTO A;  3JC6 6;  1KDC A;  4HMJ A;  1G6Z A;  5EBC A;  4C3H G;  2M2L A;  3SHL A;  1JWU D;  2B2W A;  4XQQ A;  4DR5 Q;  3D3R A;  1II3 A;  1A3V A;  3EJI A;  2JA8 H;  2NVT H;  3CPW A;  1QVG A;  3KK7 A;  1GO3 E;  1E2W A;  1VQB A;  5C4Z A;  4U68 A;  3TME A;  1VQM A;  2RDG A;  1QE6 A;  3A8K E;  4DV0 Q;  4L63 B;  4HCE A;  3CQZ B;  2SOB A;  4B3S Q;  4GKJ L;  4DAY A;  2Z0S A;  1EY6 A;  1SMY C;  2NVX H;  1TWF H;  1B4O A;  4A3M B;  2R93 B;  1U4L A;  3SK4 A;  1PV4 A;  1EU3 A;  1F9P A;  3CU7 A;  3S17 H;  2BH2 A;  1STB A;  1Z47 A;  3TBI B;  4LFA L;  2A6E C;  4IPD A;  2JJQ A;  4DV2 L;  2UXB Q;  3SE0 A;  1DYQ A;  3SK8 A;  4A4I A;  2B2U C;  4PG3 A;  4IOA A;  5D3I B;  2JA5 B;  4R8N A;  1SXT A;  3I4M H;  2YTY A;  4DV4 L;  3OIQ A;  2WAQ B;  1DOK A;  2R3Z A;  2AWO A;  4LF5 Q;  1PZJ D;  3KYH C;  3W1B A;  1MSG A;  3D4D A;  2CWP A;  2QDL A;  3NBH B;  3STB D;  1RCV D;  4KN4 C;  5IGB A;  1P8L A;  4BA2 I;  2IX3 A;  2D9U A;  4JI6 L;  1Q90 A;  1CA5 A;  4UAI A;  2EJG C;  2G5D A;  2JA9 A;  1I50 B;  2NN6 I;  5BR8 Q;  3S1R B;  1VQG A;  4LMQ D;  3CCS A;  3KF6 B;  1H95 A;  3CRL C;  3FMC A;  1H9S B;  4KY7 A;  4A76 A;  1SEB D;  2L5T A;  5FJ8 H;  1PLF A;  4PV1 C;  4I7A A;  2MP1 A;  5G3L D;  1KD1 C;  4NW2 A;  4WFN 3;  4LFB L;  1SAP A;  4DV6 Q;  4OO1 I;  1JIC A;  3MXP A;  3FDT A;  2KEN A;  1C4Q A;  1SNO A;  2LS0 1;  1KQS A;  4A3L H;  3PUW A;  2IHF A;  2A69 D;  1DXM A;  2JA7 B;  3H3V I;  4JYA Q;  3J80 c;  4NP5 A;  1OXX K;  3H09 A;  3U58 A;  2FIN B;  4EGV A;  1TXY A;  1JOK A;  3S14 H;  3OYY A;  3HOU B;  1N9W A;  1BO0 A;  1NJI C;  5JEA H;  3J7Z C;  4OL7 A;  1KRT A;  3T53 B;  3UDG A;  1SNQ A;  1SLJ A;  1VQD A;  3A7L A;  1XNR L;  4IOC A;  1Q8I A;  3BYY B;  1YIJ A;  1NCV A;  4B3T L;  4FF4 A;  1X3F A;  3H0G G;  3HOW H;  1YEZ A;  2ICI A;  3IRB A;  4JBK A;  2GA4 B;  2XWJ B;  2E8G A;  4GLA C;  5CMD A;  2N8N A;  1B50 A;  4PZ7 A;  4DA2 A;  2B39 A;  3I70 A;  2CCZ A;  1UNS A;  2K03 A;  4EQP A;  4X65 Q;  5I6W A;  1VF7 A;  3A5U A;  4XT3 B;  2KHJ A;  3RMH A;  4C3J B;  1H9K A;  3J81 i;  2Q2T A;  4A3M G;  3L3O C;  4IUQ A;  3J7A F;  1J5E Q;  2PW5 A;  5BN3 A;  2RDF A;  4J6H A;  4P2C B;  1G6P A;  3G48 A;  4JVZ A;  2TSS A;  4X62 L;  1HNW Q;  1Q1E A;  2MJ8 A;  2D0O A;  1EYG A;  5G3L F;  2EYP A;  4BY1 B;  3VA5 A;  1O78 A;  3OWF A;  1ICW A;  3ZYY X;  2JA5 G;  5EJW A;  3RN5 A;  2KCT A;  4C2M B;  2A6H C;  1E22 A;  3S1Q B;  4X66 Q;  2NUC A;  1VF5 C;  2QEJ C;  2MO1 A;  4LAA A;  1YNX A;  2WAQ G;  1EQR A;  1X3P A;  1HHV A;  1E1T A;  2PCF B;  1K9M C;  3A7A B;  3I91 A;  2M9V A;  3OW2 A;  1WTR A;  1JMC A;  1B8A A;  1PMR A;  3RR5 A;  4ZKC B;  3ONA B;  1PH9 A;  1SMY D;  4EVO A;  3DWQ A;  2KVM A;  2ZTD A;  4OWT B;  3HOZ B;  3I4N H;  3VR4 A;  2L11 A;  4FF1 A;  1HFN A;  1SSO A;  4IUU A;  1QNU A;  1AE3 A;  4O1N A;  2GVA A;  5FO9 B;  3C1E A;  4GZY C;  4IO9 A;  1Q1B A;  4XDX A;  2Y0S E;  3J7A V;  1F2Y A;  4OX9 L;  1R4P B;  1DOL A;  2QEX A;  3B6Y A;  4ME5 A;  4P72 A;  1J6Q A;  2F4I A;  1PYB A;  4X3T A;  2KCC A;  4HJ7 A;  3HOU G;  4IFD I;  1FD7 D;  1X32 A;  2J4X A;  1TWG H;  1EQQ A;  2NTT A;  2X69 A;  4C56 C;  5KND A;  1LT3 D;  1O7Z A;  2B2T C;  1OXS C;  1LO5 D;  3HG9 A;  4K6L A;  2MFI A;  4ODG A;  4A3G B;  1N36 L;  1B7Y B;  3OMG A;  2B63 H;  2A1A A;  2LY7 A;  4LF6 L;  2Z1C A;  1O7Y A;  1Y1V B;  1G8Z D;  2HHH L;  4A3D H;  1HFG A;  1MIU A;  3DUZ A;  2VB3 X;  1HNX L;  2DJG C;  5IY0 A;  1VQE A;  3NK9 A;  2JA6 B;  5C4H A;  5M5Y H;  4QB4 A;  3FVQ A;  5CGK A;  5M3F G;  4C1N I;  4OON A;  1EYC A;  2O5I C;  4IFD J;  4C3J G;  3O13 A;  4MHE A;  1V1O A;  3K5L A;  4A3J B;  1I6H B;  1S5B D;  2AKW B;  2X6G A;  2EXD A;  3EIV A;  4A93 G;  2E76 C;  1OXV A;  2R61 A;  1VMP A;  2SNS A;  1MSH A;  4BY1 G;  4Y7N H;  5IT9 E;  4K8I A;  2PQE A;  1WTV A;  1O7I A;  1Q8K A;  1IBK Q;  3R93 A;  2LMC B;  3M7G A;  3RZO B;  3A54 A;  5CV8 A;  2PYK A;  3MAQ A;  4C3H H;  1ENF A;  1I4P A;  3VYS A;  5EAY A;  4V19 0;  3F8T A;  3OIP A;  3Q23 A;  1SE4 A;  4KHV A;  2JQO A;  3QB3 A;  2JA8 G;  1WTP A;  2ZTE A;  1IYV A;  5M5X B;  2IW3 A;  3D4R A;  3HOZ G;  1VQP A;  4JI4 Q;  2K50 A;  4RFB A;  1KNA A;  2E2J B;  2I46 A;  1YJW A;  1BBW A;  3PO3 B;  1UUP A;  1U4R A;  4DR1 Q;  1QCB D;  1JE5 A;  1BCP D;  5JAV A;  5K36 H;  2DGY A;  3HOX B;  4LNQ A;  2PNH A;  3S9W A;  3CCU A;  5DLQ E;  1A15 A;  1GUW A;  1ROD A;  3HKS A;  1IHZ A;  1SNC A;  4A3E B;  4ZUJ A;  3T16 A;  3M3Y H;  5JJI A;  5C4J B;  4KJO A;  1CT1 D;  2XWB B;  3WDN A;  4JV5 Q;  3E9H A;  1SNM A;  5M3M B;  3PIP A;  2K7V A;  2E2I B;  4KKU A;  1D8L A;  1WVL A;  1IYU A;  3KBG A;  3J7Y W;  3URY A;  2R7Z B;  1FVI A;  3SGI A;  2UXD L;  2R7D A;  1I6V C;  4A3G G;  1GUT A;  2RKS A;  1VQI A;  2XIW A;  3HEJ A;  4DK6 C;  5KYL A;  5LMN L;  2EY6 A;  1EWC A;  4DUZ L;  5IYC G;  1VQO A;  1Y1V G;  5J39 A;  3GTO H;  1LT6 D;  2C35 B;  5IP9 G;  1Q7Y C;  3RLN A;  5M5W H;  1TU2 B;  4GKJ Q;  4XQN A;  3UDI A;  3VR3 A;  4IUP A;  1B53 A;  3K57 A;  1A2U A;  2Y0S B;  3T1H L;  3U9S A;  1Y1W B;  2YU9 H;  2RQX A;  1A62 A;  3QO2 A;  1NMG A;  1TS4 A;  4YHH Q;  2HIV A;  1A3U A;  3GV3 A;  3LWU A;  1F77 A;  3K81 C;  2Q8I B;  1HH2 P;  2XSC A;  3M4P A;  2MGS A;  2Z8L A;  2F0V A;  4LFA Q;  5KRU A;  1R9T H;  4PZ8 A;  1K8A C;  4C3I B;  2A5H A;  4MTN A;  4DV2 Q;  3CCL A;  1JWS D;  1ET9 A;  1V1P B;  2R7F A;  3CAM A;  3NSW A;  4ZQ3 A;  2NZ1 D;  1BCP F;  1YNN C;  4K14 A;  1L1O C;  4KI0 A;  3KJO A;  1HR0 W;  2PZT A;  1TY2 A;  1JQY D;  4GOP A;  5DM6 3;  1EWH A;  4DV4 Q;  3V2T A;  1JT8 A;  4JI2 L;  1AW7 A;  1EU4 A;  4YIJ A;  1HTP A;  3ERO A;  3IL8 A;  1KIX A;  3RNU A;  3GTL B;  3Q8D A;  4JI6 Q;  3BZK A;  3R2T A;  1UEB A;  1K3B C;  2PI2 A;  1EY9 A;  3LX0 A;  2LSS A;  4RG1 A;  5GRO A;  2B29 A;  1CKN A;  4KKT A;  4KY6 A;  1K28 A;  3CQZ H;  4KLK A;  3J81 E;  2Z4I A;  3D6W A;  1KLG D;  3NTI A;  4LFB Q;  3M4Y A;  3MC0 B;  3OMC A;  5HY6 A;  3IFD A;  4LUZ A;  3U4V A;  3HOX G;  4J8Q A;  4A3M H;  2E5L L;  3QWN A;  2K32 A;  5I9O A;  2R93 H;  2A19 A;  1U9R A;  4BY7 B;  3C3L A;  1ZYR C;  3PIO A;  3ERS X;  1EYA A;  1HA5 A;  1B3Q A;  3EQL C;  4A3E G;  2ZXP A;  1GUN A;  4HIK A;  2JA5 H;  4JI5 L;  2AQ1 B;  5M9O A;  5I4D A;  1YHA A;  4XQJ A;  1XNR Q;  1YZ6 A;  2R7Z G;  2HCC A;  4CDC C;  4B3T Q;  1S72 A;  3VR2 A;  4DK0 A;  3J80 i;  5H1S E;  2C5C A;  1K0R A;  2B2V C;  4DNT B;  5HGQ A;  3M4O B;  4BBS B;  2H4O A;  2H5X A;  3KFU A;  1WD0 A;  3Q24 A;  4PMB A;  1AZP A;  4UP7 A;  3D0F A;  5DEH A;  4BA1 I;  5FO7 B;  4HJ8 A;  3KDF B;  4CJ0 B;  3S1R H;  2B2W C;  1BOS A;  3BDC A;  2K5H A;  1D2B A;  2LXK A;  1PRT C;  2IX0 A;  2Y0S G;  4OIJ A;  3AYH B;  1Y1W G;  1TVX A;  5C44 B;  2PMZ E;  5FOB B;  4NB3 A;  2FJ2 A;  4X62 Q;  4C3I G;  1L1O B;  2JP1 A;  5EKI A;  2NB0 A;  4NMZ A;  1K3R A;  5A2Q L;  3T4A C;  3VA7 A;  4HIO A;  4X3K A;  1AP0 A;  3HOU H;  1HTL D;  3NTK A;  1LTI D;  4MNO A;  4RMF A;  4HAE A;  4GNX A;  1CI3 M;  4TQU S;  1A63 A;  4JI0 Q;  3VYR A;  4LF9 L;  1QVF A;  2HDL A;  1JE4 A;  2B63 G;  5ELD A;  4R4Q A;  5JJZ A;  4RGN A;  3S2H H;  4FXG C;  4DR4 Q;  1KAW A;  1RJT A;  4H13 C;  4K5X A;  4X3S A;  4DXG A;  1CQF A;  2D5D A;  1IW7 D;  3TS0 A;  1TS2 A;  3N6R A;  4KTA A;  4XT1 B;  3TRZ A;  1ENC A;  1SJH D;  1TR5 A;  1IBL L;  4NXN L;  2KQ3 A;  2ASB A;  1Q46 A;  1QOH A;  3S1N B;  3H3V C;  3LNN A;  1HNZ L;  5CBA E;  1E2V A;  3PSI A;  2JE6 I;  4CHT B;  1Q81 C;  2R92 B;  2CQO A;  2F0F A;  4ME3 A;  2L0C A;  4C3J H;  4DR6 L;  2F4V L;  3D6C A;  2IY5 B;  4B3R L;  1ASY A;  3MFY A;  1PH2 A;  4BY7 G;  2VZA A;  1SJE D;  1Q86 C;  1N34 L;  5C6A A;  3CP0 A;  3ERQ A;  1CK1 A;  2HDM A;  3P7J A;  2A68 C;  4G57 A;  4DFA A;  1PH1 A;  5JJL A;  3CHB D;  4BY1 H;  1BQQ T;  5IE8 A;  4A3F B;  3MVV A;  4C2M H;  2QCP X;  4FXD A;  1QUQ B;  3S1Q H;  2MUY A;  1N36 Q;  2K6A A;  3QOJ A;  2PNR C;  1JB3 A;  1XMO L;  2F0G A;  3DXJ C;  1MI2 A;  4FF3 A;  4GN3 B;  4F87 A;  4X3U A;  4A3K B;  5KNC A;  4LF6 Q;  5EQ0 A;  4PNY A;  5L37 A;  3W1G A;  4BBS G;  2HHH Q;  2KA7 A;  2UXC L;  3S1M H;  1X56 A;  1HNX Q;  1PYW D;  1UE7 A;  1G29 1;  2HIX A;  2PQA A;  1PRT B;  1BDO A;  1RDP D;  3HOZ H;  2TMP A;  1KDA A;  3AQQ A;  3M85 A;  1ZYR D;  5FLX E;  1ZEQ X;  1ML0 D;  4ALP A;  4V0B A;  2F0N A;  1ZXT A;  2F0U A;  3G4S A;  4QIW E;  1S40 A;  4DAY B;  2FMM A;  5K36 G;  4YY3 L;  1CFM A;  2WB1 B;  3TDQ A;  4O0A A;  1CHQ D;  3MXG A;  4M1U B;  3X3M A;  3H94 A;  4KHP L;  4CDD C;  1CKM A;  2YTX A;  3QJY A;  5C4X B;  4TSS A;  2PO4 A;  1LYL A;  2F0O A;  3HOV B;  4QUC A;  4QUF A;  1X9N A;  1I4R A;  4IZ8 A;  3CKI B;  4JOI A;  4DK3 C;  1F2M A;  3P75 A;  3CC2 A;  4G7O C;  4A3I G;  2WAC A;  4NDX A;  1I3Q B;  4A3G H;  1EEF D;  3J81 j;  5DNF A;  3VYU A;  3MFG A;  2B3G A;  1R4Q B;  1WI5 A;  1ET6 A;  4NKL A;  1V9P A;  1IYJ B;  1PTO B;  3I4L A;  1WCM B;  2F0M A;  1HQR D;  3BZC A;  3ND8 A;  3J80 L;  2Q8T A;  4L5Q A;  1UWV A;  2BE5 C;  1CA6 A;  5IYC H;  1Y1V H;  3GDE A;  2L1B A;  1YBY A;  5IP9 H;  1HZC A;  2F0L A;  1TWH B;  4RAU C;  2PMZ B;  3KF8 A;  2Q2U A;  4DNI A;  1ILP A;  4ABN A;  2JA6 H;  2L4N A;  5BN4 A;  2WFW A;  2R92 G;  1PH3 A;  3NEN A;  2N88 A;  2DJF C;  4FO2 A;  2VW9 A;  5C5M A;  4B3M L;  1STY A;  3M7N A;  3CCV A;  5JVG 3;  3K80 C;  5T1I A;  1VQJ A;  1RHP A;  4EQ5 A;  1ENA A;  1NE3 A;  1CZW A;  3UDX A;  1WD1 A;  4ZUI A;  3FKI B;  1H9S A;  5KIX A;  5LMU Q;  4APV A;  3EN2 A;  2XRQ D;  4JI1 L;  4A3F G;  3TP5 A;  2XTI A;  3MHB A;  4N8F A;  4DN4 M;  1T5E A;  2UXD Q;  1PTO D;  5ELO A;  1U4M A;  2VY3 A;  3ULL A;  3RZO H;  3Q6S A;  1E2Z A;  4GKK L;  5LMN Q;  3DMU A;  4DUZ Q;  5IWA Q;  2EJF C;  3TZD A;  1DM0 B;  1SYF A;  2OF1 A;  3PQI A;  5IGC A;  1YIT A;  1VDZ A;  1NMF A;  4YWL A;  4X64 L;  5BN5 A;  1GUS A;  3T1H Q;  4QJF A;  2E2J H;  4BS9 A;  1BXT A;  1PFM A;  1DJR D;  5DM7 3;  2J0T D;  3LGJ A;  4RWS C;  2BA1 A;  1K8O A;  3HOX H;  3ULP A;  2R93 G;  1B9N A;  3FEW X;  1I4X A;  1E0B A;  3MWY W;  4HSV A;  2N78 A;  3AMU A;  1F9Q A;  2HD3 A;  5C3E B;  5CR3 A;  2WKC A;  1VQ4 A;  2F0W A;  4A3E H;  3IKJ A;  3TSS A;  5C4X G;  5C4J H;  3CME A;  2L9H A;  3KLW A;  1PFB A;  3L9A X;  4K8J A;  1XNQ L;  1XYI A;  5M3M H;  1WTO A;  2OTJ A;  4JI2 Q;  5JOB A;  4KD3 A;  2EYM A;  5IOD A;  2WIN B;  3J80 E;  2R7Z H;  1VQL A;  2Z4H A;  4XIG S;  1C9O A;  1JJ2 A;  5HGT A;  2KJX A;  4OO1 G;  4POG A;  2BOS A;  3W2D A;  1PVO A;  3IFT A;  1SE2 A;  1WCM G;  2QKI C;  2NTS A;  3OOC A;  2O2L D;  2I07 B;  4GS3 A;  1W2B A;  4S3S A;  1X3Q A;  2BH8 A;  4CJ2 C;  3M9B A;  4FP5 D;  4M8A A;  4QIW B;  3K5O A;  1GD7 A;  4LJZ C;  2F0P A;  3ULJ A;  2N3S A;  4DV5 L;  2A6E D;  3SEB A;  1Y1W H;  2E5L Q;  3E0E A;  1T9H A;  1SE3 A;  3Q22 A;  5C0X I;  5GAD C;  1XJV A;  3H15 A;  2NVT B;  2IHE A;  2QGQ A;  2DUD A;  2JA7 G;  4TVA B;  4AH6 A;  3F1Z A;  3V05 A;  3I8Z A;  4C3I H;  4LUV A;  1TWA B;  4N9P A;  1Y8O B;  3AU7 A;  3FKI G;  3ICE A;  4WJW A;  2F3I A;  1B2T A;  1LM0 A;  5ELB A;  1EY0 A;  4IQZ A;  1EFI D;  4JI5 Q;  1B44 D;  3ITP A;  4HIM A;  3TP8 A;  2K28 A;  3BVG A;  2KED A;  2O4X A;  5EKL A;  1WYD A;  3P1H A;  3CC7 A;  3PO2 B;  1K83 B;  1KAA A;  2F0K A;  3GTL H;  1K0S A;  1FJG L;  1TII D;  4DV1 L;  2ALY B;  2NBF A;  1S5C D;  2N49 A;  4YWM A;  5A35 A;  3D8G A;  1U5K A;  2J7Z A;  1EY4 A;  4K5W A;  4RCO A;  5C0X J;  3OTO L;  1KNE A;  1ESR A;  4EQN A;  3GTK H;  1AFP A;  2RBM A;  4OWW B;  1YJN A;  2ENB A;  2L55 A;  1I4H A;  2RCN A;  2CWA A;  1JOQ A;  2ZM6 L;  3CC4 A;  2UU9 Q;  2E2D C;  3PGZ A;  2PI2 E;  2IWH A;  1EY8 A;  2B8F A;  2MHV A;  3I72 A;  1V43 A;  1PZI D;  4RH6 A;  4LFC L;  3CPF A;  2Z6K A;  1BNZ A;  5KEE A;  4BY7 H;  4YWK A;  2VUM B;  5C3E G;  4BBR B;  3S16 H;  3PIP 3;  3A74 A;  5IGG A;  2I0Q A;  5IGD A;  4DV0 L;  2K5N A;  1LT5 D;  2QW7 A;  4B3S L;  3A8I E;  3CCE A;  4KMU C;  4NXM L;  2O5J C;  1WTW A;  1F9S A;  1RD9 D;  4AYB E;  5ELC A;  2JEA I;  1JR0 D;  4LF9 Q;  3GTJ B;  1L0Y B;  3NBI A;  4P74 A;  3FHW A;  2BDO A;  1H9M A;  3I90 A;  3HKZ E;  5K5P A;  5DAU A;  4GOP C;  1ILQ A;  1X65 A;  3CCM A;  3AFQ A;  4RHR A;  4DGZ A;  3DM3 A;  3S14 B;  1ZKO A;  2MO0 A;  2NVQ B;  3KJP A;  2DNC A;  3SDZ A;  3M4O H;  4BBS H;  2KCM A;  4UPA A;  3WOE A;  1GUG A;  2F3W A;  1SFO B;  4NXN Q;  1KLU D;  1KXL A;  1SN8 A;  2F0T A;  3DWP A;  1HNZ Q;  2E2H H;  4O2D A;  4Q0F A;  4JI7 L;  2OTL A;  3BDL A;  2K4K A;  2K5D A;  4IFD G;  4LF5 L;  3K59 A;  2EE1 A;  3VYT A;  4HR7 B;  1BBU A;  4DR6 Q;  3K7A B;  3PCO B;  2F4V Q;  2KBN A;  3W3A A;  1A0I A;  4IPC A;  4LK1 C;  3CXC A;  2A6H D;  2YYZ A;  3T51 B;  1N34 Q;  4ZKB B;  4UY8 C;  2NWG A;  5KNB A;  1JB7 A;  1G51 A;  3I55 A;  4JI8 L;  3U4Z A;  4CKC A;  1BUV T;  2K33 A;  4DV6 L;  3NHH A;  4HMI A;  4B9X A;  1M1K C;  4A3I H;  2KHI A;  4MN3 A;  2ATW A;  3A5Z B;  2X6L A;  3K7U C;  4UP8 A;  3V96 A;  5IYB G;  1GJX A;  2VB2 X;  1JC7 A;  1YJ9 A;  3OW7 A;  3TEH B;  3KBX A;  1VQH A;  3PO2 G;  3NXW A;  3UI2 A;  4K0K L;  1VQN A;  3SXH A;  2FHT A;  3X3N A;  1TY0 A;  4AQY L;  3LWE A;  1O7L A;  1YNJ C;  1N32 L;  1LV9 A;  4L8J A;  2A74 C;  3S1N H;  1HUN A;  4UDU C;  2JA6 G;  2F0J A;  4YY3 Q;  2R92 H;  4ID6 A;  3J81 c;  2EIF A;  3PIO 3;  5IYD G;  3FRP B;  2OCE A;  1XTC D;  1IBM L;  1JCK B;  2I5M X;  5EPJ A;  2K04 A;  2KEE A;  1HUM A;  3NE5 B;  3NEL A;  2K5W A;  5KGU A;  4A3J G;  4ZK9 B;  4LF8 L;  2CW0 C;  4BBR G;  3PUZ A;  2MPM A;  1J8I A;  5JPM C;  1EY7 A;  2N55 A;  4FNF A;  5LL6 S;  3UDF A;  4BXX G;  5FLM G;  3RZD B;  1IXR A;  3C1F A;  4FVM A;  1PXU A;  1LTG D;  5LL6 X;  4A3F H;  3K5M A;  1LAC A;  4K2L A;  1XMQ L;  1QNK A;  3R3O A;  4GOP B;  4IPH A;  4OGQ C;  2CHB D;  1EEI D;  5CV5 A;  2RDH A;  5FKA C;  1PDQ A;  1J5E L;  3NPP A;  3U50 C;  1C7Y A;  5ISR A;  5KYI A;  4GNX C;  1E7Z A;  5JVH 3;  1C48 A;  4RCN A;  3L7Z C;  1FR3 A;  4O42 A;  3FPP A;  2WP8 J;  3F2C A;  1E24 A;  3N52 A;  4K5V A;  1FL0 A;  5CV9 A;  4I7Z C;  3EVQ A;  2IJ0 A;  5AJ3 L;  5COR A;  1CKN B;  4A3B B;  1BF4 A;  3PO3 G;  2EYL A;  1C8C A;  1JWM D;  3GD7 A;  3SR1 A;  4DPG A;  4B3M Q;  1VQ8 A;  1OO9 B;  3GTM B;  4BWG B;  3JAM L;  3AEV A;  1ESF A;  2EXZ A;  5JPN C;  1HCZ A;  1HPC A;  1RIP A;  4IJH A;  5GQO A;  2UUB L;  2AQ2 B;  2A8V A;  2EQS A;  5C4X H;  2WB1 E;  3RUZ A;  4AYB B;  3GO5 A;  5M5Y B;  4JI1 Q;  2UUA L;  1HRJ A;  3HKZ B;  5M3M G;  2F0Q A;  1FNU A;  2L15 A;  3D4W A;  3GV6 A;  2NN6 H;  2EYO A;  2CVR A;  1UEA B;  3TQY A;  4DUY L;  4DR7 L;  2B8G A;  1I3Q H;  3QG1 A;  4IUR A;  3HOY B;  1S3O A;  4GKK Q;  2KEC A;  2I5L X;  3TRE A;  1Z9F A;  2Q2H A;  3C2P A;  4OO1 H;  4R4T A;  3JAM c;  1PTO H;  1WCM H;  3SK5 A;  4OEM B;  1CQV A;  2FXQ A;  1QZG A;  4C1N K;  1HQM C;  2DY7 A;  3H3V H;  3G6E A;  5EKK A;  4JCV E;  1I50 H;  1TWH H;  2K14 A;  3L0O A;  1YHQ A;  4H0L C;  2HCI A;  3FP9 A;  3A0J A;  4DR3 L;  3S2D B;  2EYH A;  1LT4 D;  1HR0 L;  1BR9 A;  3MXU A;  1AH9 A;  1PFS A;  2NVY B;  1Y8N B;  4G7Z C;  1SYD A;  2JA7 H;  3KDF A;  4Z9C B;  3QOL A;  1W6K A;  3DEO A;  2G9H D;  1SBB B;  3STB C;  2LKV A;  3E5S A;  3ZJY C;  2PZW A;  4DNR B;  1J9O A;  3FKI H;  1T5X D;  4CDF C;  1XNQ Q;  3E9I A;  3QIA A;  1TWC B;  4K2K A;  3OHX C;  4UHV A;  1RTN A;  3AB9 A;  2V4D A;  4DF7 A;  2HQL A;  4J1M A;  4HJ9 A;  2PZU A;  2Q8R E;  1WTQ A;  4GNX B;  3PF5 A;  2EY5 A;  5C3X A;  1EIY B;  1D7Q A;  1YNJ D;  4JOI C;  3K58 A;  3PF4 A;  3EFX D;  4H02 A;  3VR5 A;  5GAH C;  3BYT B;  2A69 C;  3GP7 A;  4CBV A;  1SE8 A;  3R2I A;  4ULL A;  4DV5 Q;  2ID0 A;  1D1I A;  1X3E A;  4R1J A;  1HA6 A;  5CBE E;  4A3B G;  1NBW A;  4KN7 C;  4KJN A;  3IAY A;  1YNN D;  4NPS A;  2R6G A;  5I9P A;  4PMW A;  3TZU A;  1PH8 A;  4QL5 A;  3G71 A;  2AWN A;  4OX9 Q;  3MXN B;  4MZ9 A;  5C3E H;  3GTP B;  3CF5 A;  2JXM B;  1FYC A;  4KY5 A;  2ZTC A;  1D5Z C;  1GHK A;  1KL9 A;  1NR4 A;  2K01 A;  2E75 C;  3R8B A;  5F2D A;  4AYB G;  1A3T A;  4FYD A;  3KOJ A;  2YU9 B;  2VQF L;  3HKZ G;  4IUN A;  4DV7 L;  4DR1 L;  3T1Y L;  2XVS A;  2NZH A;  4HN7 A;  4B9W A;  2IPK D;  1SYB A;  3HOY G;  2F0I A;  2VS1 A;  3FPU B;  3NEM A;  1FJG Q;  4K6D A;  1A8V A;  4DV1 Q;  5IIF A;  1N33 L;  5IOC A;  1GVP A;  2RVL A;  2K05 A;  3OTO Q;  2RF4 A;  3HZX A;  4HCS A;  2EDG A;  4IN3 A;  4DAV A;  2PW7 A;  2ZXO A;  4DR2 L;  4R4O A;  2ZM6 Q;  4IFD H;  2ZJP A;  2Q2I A;  3H0G B;  4LF7 L;  4LFC Q;  5A2Q E;  5C44 G;  3K5N A;  1VQ9 A;  3KLR A;  4OEL B;  1TWA H;  3RD4 A;  3ER0 A;  2CH4 W;  3TP6 A;  4NXM Q;  2D2C C;  2M00 A;  1CKO A;  4IJL A;  1EOT A;  5D14 A;  3NP8 A;  4XYO A;  4MTK A;  4XYQ A;  2YV5 A;  4YHH L;  1D1K A;  3M4Q A;  3EBE A;  5IYB H;  2V1C C;  4JC0 A;  5HUR A;  1QG7 A;  1C0A A;  3PUY A;  1VS0 A;  1K83 H;  1PH5 A;  3PO2 H;  2FMC A;  1PRT D;  5I2X A;  4OWX B;  1F9R A;  1S4Z A;  3A8J E;  5E4X A;  4JI7 Q;  1I5F A;  3TS2 A;  3DM1 A;  1EQV A;  4B08 A;  3NBH A;  1H9J A;  2EZV A;  2B2Y A;  3KF8 B;  4HSP A;  4R8I A;  1OXU A;  5IYD H;  1P16 A;  3NQT A;  1JOR A;  4CKB A;  1OXT A;  4LF4 L;  4LWC A;  2RSN A;  4A3J H;  1I6H H;  4KHZ A;  1L0X B;  2VUM H;  1MD2 D;  1S5E D;  1CHP D;  3E0J A;  5EPK A;  3KF6 A;  4BBR H;  1O80 A;  3TP7 A;  1AZQ A;  4BXX H;  2XRS D;  5FLM H;  4JI8 Q;  1B9M A;  2QIL A;  4J15 A;  1XTD A;  1DD2 A;  1B1Z A;  5CV6 A;  2RHS B;  3MZ5 A;  1STA A;  4RHS A;  2NYZ D;  2JN4 A;  3E3X A;  3GTJ H;  1W6J A;  1B70 B;  3GTG B;  1G91 A;  2UUC L;  1M4V A;  1I94 L;  4WJ3 M;  1IKM A;  2EY2 A;  2DY8 A;  4A3K G;  2JSO A;  1UAP A;  4K0K Q;  2NVQ H;  4AQY Q;  3OSO A;  4N8X 1;  1SFO H;  1WJJ A;  2RHQ B;  1N32 Q;  1SYE A;  2NZO A;  5M5X H;  4N9T A;  2EY1 A;  1VMC A;  2OWO A;  1EZ6 A;  1UE6 A;  3S15 B;  4GLV B;  5E1F A;  1VCI A;  3PO3 H;  1PRT F;  3S2H B;  1MBY A;  3GTQ B;  3I73 A;  1SND A;  1YVC A;  1PA6 A;  5IP7 G;  3TN2 A;  2A68 D;  3J7A 5;  1IBM Q;  1GXD C;  1EQT A;  3K7A H;  4DAM A;  2KUM A;  3WWV A;  2JEB I;  4LF8 Q;  2WB1 G;  2IX1 A;  1PH4 A;  1Y14 B;  2IL8 A;  4JW0 A;  5LHY 1;  2OQ0 A;  1V8Q A;  5EPL A;  1TKW B;  2Z6K C;  4DV3 L;  5M3F B;  1LTB D;  3HOV G;  1XMQ Q;  4G4K A;  1FNV A;  2KCN A;  2E2I H;  3G6J B;  2NN6 G;  1NAP A;  2B2U A;  1M8A A;  4XXE A;  1MKH A;  3KLS X;  2K75 A;  4A93 B;  4P73 A;  4R4C A;  2BA0 A;  3RLF A;  3KUP A;  1BCP C;  1UE1 A;  2ZT9 C;  1HZB A;  2XN9 C;  2PPB C;  3DEP A;  1D6E C;  1PTO F;  1STG A;  4XTC S;  5C5L A;  1AE2 A;  2A73 B;  2OXP A;  4G7H C;  4ZRZ A;  2ZJR A;  3ND9 A;  5IGF A;  4ZCK A;  5AJ3 Q;  2L12 A;  1KC8 C;  1IKL A;  5IT9 L;  4IUV A;  3S24 A;  4JI0 L;  3U9O A;  1EY5 A;  1RKN A;  1KHI A;  3I2Z A;  3P20 A;  4DR4 L;  1LTR D;  4PZ6 A;  4X6A H;  2AUK A;  1MGS A;  1DOM A;  1QJO A;  1LTS D;  2OEO A;  5EBD A;  3S1M B;  2JA8 B;  3H91 A;  2UUB Q;  1DZ1 A;  2VQE L;  4OXP A;  2F0E A;  1I4Q A;  3PV0 A;  2K5V A;  5ELF A;  2UUA Q;  4ZLT F;  2NVX B;  1TWF B;  1MHW C;  4RGM A;  1GUO A;  4ZAI A;  3RZD H;  1MJC A;  2ICE C;  1EIF A;  4CKE A;  5ELN A;  5IT9 c;  2DN8 A;  2BE5 D;  4DUY Q;  4DR7 Q;  5I2Y A;  3S17 B;  1H9R A;  2RSO A;  1NTG A;  1Q12 A;  2G9D A;  4HJA A;  4JI3 L;  4CDE C;  4POF A;  2WKD A;  1LUZ A;  1AEX A;  2SDF A;  4R4I A;  4ZYS A;  1FGU A;  4F8M A;  4QGU A;  4FF2 A;  2ES2 A;  4A3C G;  3I4M B;  4HED A;  4IPG A;  1BBX C;  1EL0 A;  4EX5 A;  1XPR A;  4DR3 Q;  4QCL A;  4HID A;  2QA4 A;  4A3B H;  4YCW A;  3NUC A;  1HR0 Q;  4OIK A;  1X55 A;  3JAM i;  1F2L A;  3GTM H;  4FDB A;  1EFW A;  4DR5 L;  1RL2 A;  1DGS A;  2JYO A;  3NTH A;  3NWT A;  4F7X A;  2LXJ A;  1E1O A;  3D31 A;  1SDF A;  4DK1 A;  3EA6 A;  2MQH A;  4GN5 A;  1W3S A;  1HJP A;  2Z9H A;  4OHJ A;  2EJM A;  5LMN W;  1M90 C;  1IL2 A;  3T13 A;  1X3G A;  4LW1 A;  2AQ3 B;  1XXG A;  5CV7 A;  2RA4 A;  1LTA D;  1BVS A;  1BCP B;  1EIH A;  3HOY H;  1PH7 A;  1PFN A;  1KAB A;  3CD6 A;  4QMG A;  4QQB X;  3I56 A;  3CMA A;  2UXB L;  2F1M A;  2ZJQ A;  1NSN S;  5C0X G;  5D3D A;  1K73 C;  1JJG A;  1IBL Q;  1NNX A;  1JJC B;  1XX8 A;  1K8G A;  4ILW A;  1HZA A;  2VXW A;  5J1Z A;  2ZXR A;  4JG2 A;  3HFZ B;  4JBJ A;  3HOW B;  3S2D H;  1EIG A;  4B3R Q;  5C44 H;  3K0X A;  3DHQ A;  4GLX A;  3NWS A;  1STN A;  1G2S A;  1EYD A;  2NVY H;  1STE A;  4DXF A;  3CW2 C;  1SMX A;  3W5O A;  4R9W A;  1VQ5 A;  4L6T B;  1EZ8 A;  4E6I A;  5BR8 L;  2VQF Q;  1K8M A;  3SK6 A;  4JPB W;  4DV7 Q;  1U4P A;  1TWC H;  3T1Y Q;  3NQI A;  4CJ1 B;  2AMC B;  3H6M A;  4KD4 A;  2F3V A;  2SEB D;  2OQK A;  3J81 L;  1CSP A;  1FGB D;  2YTV A;  4WRD A;  1XMO Q;  2EYJ A;  1Z6H A;  2AHO B;  1N33 Q;  4JYA L;  4QF4 A;  4HJ5 A;  2B2T A;  2UXC Q;  3HRZ C;  1CSQ A;  4MIU A;  3BZD B;  5LMU L;  3I4M G;  3CRK C;  1Q82 C;  4KV6 A;  1FNW A;  5JEA J;  4DR2 Q;  2QDB A;  1GHJ A;  2KHS A;  5C3W A;  3G7L A;  3DLL A;  4LF7 Q;  5CC4 A;  1ASZ A;  3BJU A;  5FK9 C;  2D62 A;  2FFK B;  3I3C A;  1NUC A;  5IWA L;  5CYU A;  4KHP Q;  1QVC A;  4I65 A;  2VUM G;  3I4N B;  4P75 A;  3GTP H;  4UP9 A;  3BDO A;  1QB5 D;  4RGO S;  5J22 A;  3E6Z X;  1LAB A;  1IW7 C;  4QY7 A;  5FJ8 G;  2K1B A;  1BKB A;  4X65 L;  1CTM A;  1TS3 A;  3MTS A;  5T1G A;  4L5S A;  1Y8P B;  1F2Z A;  4A3L G;  4WJ4 A;  2EYF A;  5D65 A;  3CCQ A;  1D5X C;  1HXY D;  1V1P A;  2CQA A;  3L2P A;  5COY A;  2BCO A;  2CH4 A;  1PHJ A;  1ICF B;  3HS0 C;  1HNW L;  4A3K H;  5JJK A;  1JOO A;  1LTL A;  2JK8 A;  5E3F A;  5AFW A;  2HT1 A;  1L0W A;  1TWG B;  3WOF A;  5JEA G;  2E74 C;  1VQ6 A;  5NUC A;  4JK1 C;  4PMC A;  2Z6B A;  4X66 L;  4H7B A;  1G2T A;  4TRD A;  1U0L A;  4KKS A;  1CUK A;  1X54 A;  4L5R C;  1IZ6 A;  2B63 B;  3K6O A;  2EPB A;  1PZK D;  3BS1 A;  4IAL A;  3H0G H;  1WFQ A;  5IP7 H;  3HOW G;  1DON A;  1QWY A;  1CM9 A;  2AUJ D;  3RLO A;  4LF4 Q;  1PH6 A;  2F0D A;  1B3A A;  5TSS A;  4A3D B;  1AN8 A;  1VQA A;  3CCR A;  3GTK B;  1NY4 A;  1CZG A;  1A6X A;  4AIM A;  4DAP A;  3VDY A;  1XPU A;  1VQF A;  2BDN A;  3HOV H;  1WTX A;  1WTH A;  3MEH A;  3SVM A;  1VQ7 A;  4LUO A;  1DCZ A;  1XPO A;  2GN5 A;  2WV6 D;  1LTT D;  5I6Y A;  1QZH A;  5FO8 B;  1TQO A;  2UUC Q;  1YHB A;  1I94 Q;  1I4G A;  3S16 B;  2I5H A;  1SYG A;  2XNA C;  3HGB A;  5J3B A;  4EQO A;  1MJE A;  2CFM A;  4Y7N B;  1SYC A;  5CV4 A;  2HQE A;  4KK7 A;  2EVB A;  4X64 Q;  1IL8 A;  4L5T A;  5E7N A;  1L2F A;  3I4O A;  2GVB A;  1UE5 A;  2WII B;  1EWI A;  1Z7T A;  5IGE A;  2HUG A;  1V1Q A;  3OWE B;  4C3H B;  3GQB A;  2WAQ E;  3A56 A;  4A75 A;  1D5M C;  4F88 A;  4RGT A;  3OPO A;  5EGT A;  1KRS A;  2XGT A;  3PMF A;  2EOT A;  4JBM A;  3I4N G;  1X6O A;  3BU2 A;  2E2H B;  3K0Y A;  1NR2 A;  4DV3 Q;  3I7F A;  1QIL A; 
#chains in the Genus database with same CATH homology
 3BVZ A;  3KLS A;  3T56 B;  5FLX L;  2H1E A;  2F03 A;  4RA8 A;  4PQX A;  3M3Y B;  2F0H A;  3MA2 B;  1KTK A;  3BG3 A;  1LLR D;  2LFN A;  1TT2 A;  1Q3L A;  4CGY B;  4A3I B;  2F0S A;  2CW0 D;  1GOZ A;  3JAM E;  4RKB A;  4FXK C;  2DNE A;  4RKL A;  5ELE A;  2K5Q A;  4TKO B;  1RF2 D;  2KOL A;  1PTO C;  3GTO B;  1ONL A;  1KDB A;  2B2Y C;  5M5W B;  3BVM A;  1Y69 U;  3C46 A;  2C9O A;  4WOR A;  2OT2 A;  1XWE A;  2QF7 A;  3Q0A A;  1A2T A;  1SNP A;  2IT1 A;  1R9T B;  3MXN A;  1STH A;  3PUX A;  3VR6 A;  2SNM A;  3A55 A;  4JBW A;  4U67 3;  5C0X H;  4IUT A;  5E4W C;  4Q5V A;  4DU9 A;  3HP3 A;  1S5D D;  1TS5 A;  4HTH A;  2VNU D;  2B2V A;  3DWA A;  3F2U A;  3PUV A;  1S5F D;  4H44 C;  1RTO A;  1KDC A;  4HMJ A;  1G6Z A;  5EBC A;  4C3H G;  2M2L A;  3SHL A;  1JWU D;  2B2W A;  4XQQ A;  3D3R A;  1II3 A;  1A3V A;  3EJI A;  3KK7 A;  1E2W A;  5C4Z A;  4U68 A;  3TME A;  2RDG A;  1QE6 A;  3A8K E;  4L63 B;  4HCE A;  3CQZ B;  2SOB A;  4DAY A;  1EY6 A;  1SMY C;  1B4O A;  4A3M B;  2R93 B;  1U4L A;  3SK4 A;  1EU3 A;  1F9P A;  3CU7 A;  1STB A;  1Z47 A;  3TBI B;  2A6E C;  3SE0 A;  1DYQ A;  3SK8 A;  2B2U C;  5D3I B;  2JA5 B;  4R8N A;  1SXT A;  3OIQ A;  2WAQ B;  1DOK A;  2R3Z A;  2AWO A;  1PZJ D;  1MSG A;  3D4D A;  5IGB A;  1RCV D;  4KN4 C;  4BA2 I;  2IX3 A;  2D9U A;  1Q90 A;  1CA5 A;  4UAI A;  2EJG C;  1I50 B;  2NN6 I;  3S1R B;  4LMQ D;  3CRL C;  3FMC A;  1H9S B;  4KY7 A;  1SEB D;  2L5T A;  1PLF A;  4PV1 C;  5G3L D;  2MP1 A;  4NW2 A;  4WFN 3;  1SAP A;  4OO1 I;  1JIC A;  3MXP A;  3FDT A;  1C4Q A;  1SNO A;  2LS0 1;  3PUW A;  2A69 D;  1DXM A;  2JA7 B;  4NP5 A;  1OXX K;  3H09 A;  2FIN B;  4EGV A;  1JOK A;  3HOU B;  1BO0 A;  5JEA H;  4OL7 A;  3T53 B;  1SNQ A;  3A7L A;  1Q8I A;  3BYY B;  1NCV A;  4FF4 A;  2ICI A;  2GA4 B;  2XWJ B;  5CMD A;  1B50 A;  4DA2 A;  2B39 A;  3I70 A;  1UNS A;  2K03 A;  4EQP A;  5I6W A;  1VF7 A;  4XT3 B;  3RMH A;  4C3J B;  1H9K A;  3L3O C;  4IUQ A;  3J7A F;  2PW5 A;  5BN3 A;  2RDF A;  4J6H A;  4P2C B;  2TSS A;  1Q1E A;  2MJ8 A;  5G3L F;  2EYP A;  4BY1 B;  3VA5 A;  1O78 A;  3OWF A;  1ICW A;  3ZYY X;  5EJW A;  4C2M B;  2A6H C;  3S1Q B;  2NUC A;  1VF5 C;  2QEJ C;  4LAA A;  1X3P A;  1HHV A;  2PCF B;  3A7A B;  3I91 A;  2M9V A;  1WTR A;  1PMR A;  4ZKC B;  3ONA B;  1SMY D;  4EVO A;  3DWQ A;  2KVM A;  3HOZ B;  3VR4 A;  2L11 A;  4FF1 A;  1HFN A;  1SSO A;  4IUU A;  1QNU A;  4O1N A;  5FO9 B;  3C1E A;  4GZY C;  1Q1B A;  4XDX A;  3J7A V;  1F2Y A;  1R4P B;  1DOL A;  4ME5 A;  2F4I A;  4X3T A;  2KCC A;  4IFD I;  1FD7 D;  1X32 A;  2J4X A;  2NTT A;  2X69 A;  4C56 C;  5KND A;  1LT3 D;  1O7Z A;  2B2T C;  1OXS C;  1LO5 D;  3HG9 A;  4K6L A;  4ODG A;  4A3G B;  3OMG A;  2LY7 A;  2Z1C A;  1O7Y A;  1Y1V B;  1G8Z D;  1HFG A;  3DUZ A;  2VB3 X;  3NK9 A;  2JA6 B;  5C4H A;  4QB4 A;  3FVQ A;  5CGK A;  4C1N I;  1EYC A;  2O5I C;  4IFD J;  4C3J G;  3O13 A;  4MHE A;  1V1O A;  3K5L A;  4A3J B;  1I6H B;  1S5B D;  2X6G A;  2E76 C;  1OXV A;  2R61 A;  1VMP A;  2SNS A;  1MSH A;  5IT9 E;  4K8I A;  2PQE A;  1WTV A;  3R93 A;  2LMC B;  3M7G A;  3RZO B;  3A54 A;  5CV8 A;  2PYK A;  3MAQ A;  1ENF A;  1I4P A;  3VYS A;  4V19 0;  3OIP A;  3Q23 A;  1SE4 A;  4KHV A;  3QB3 A;  1WTP A;  1IYV A;  5M5X B;  2IW3 A;  3D4R A;  4RFB A;  1KNA A;  2E2J B;  2I46 A;  3PO3 B;  1UUP A;  1U4R A;  1QCB D;  1BCP D;  5JAV A;  5K36 H;  3HOX B;  3S9W A;  1A15 A;  1GUW A;  1ROD A;  1IHZ A;  1SNC A;  4A3E B;  4ZUJ A;  3T16 A;  5C4J B;  4KJO A;  1CT1 D;  2XWB B;  3WDN A;  1SNM A;  5M3M B;  2E2I B;  2K7V A;  4KKU A;  1WVL A;  1IYU A;  3KBG A;  3J7Y W;  3URY A;  2R7Z B;  1I6V C;  1GUT A;  2RKS A;  2XIW A;  3HEJ A;  5KYL A;  2EY6 A;  1EWC A;  5J39 A;  1LT6 D;  1TU2 B;  4XQN A;  3VR3 A;  4IUP A;  1B53 A;  3K57 A;  1A2U A;  2Y0S B;  3U9S A;  1Y1W B;  2RQX A;  3QO2 A;  1TS4 A;  3GV3 A;  1A3U A;  3LWU A;  1F77 A;  2Q8I B;  2XSC A;  2Z8L A;  2MGS A;  2F0V A;  5KRU A;  4C3I B;  2A5H A;  1JWS D;  1ET9 A;  1V1P B;  4ZQ3 A;  3NSW A;  2NZ1 D;  1BCP F;  1YNN C;  4K14 A;  4KI0 A;  2PZT A;  1TY2 A;  1JQY D;  5DM6 3;  1EWH A;  3V2T A;  1AW7 A;  1EU4 A;  4YIJ A;  1HTP A;  3ERO A;  3IL8 A;  3GTL B;  3R2T A;  1EY9 A;  3LX0 A;  4KKT A;  4KY6 A;  3J81 E;  2Z4I A;  3D6W A;  1KLG D;  3NTI A;  3M4Y A;  3MC0 B;  3OMC A;  3IFD A;  4J8Q A;  3QWN A;  2K32 A;  5I9O A;  1U9R A;  4BY7 B;  3C3L A;  1ZYR C;  1EYA A;  1HA5 A;  3EQL C;  2ZXP A;  1GUN A;  2AQ1 B;  5M9O A;  5I4D A;  4XQJ A;  2HCC A;  3VR2 A;  4DK0 A;  2C5C A;  2B2V C;  4DNT B;  3M4O B;  4BBS B;  2H4O A;  1WD0 A;  3Q24 A;  4PMB A;  1AZP A;  5DEH A;  4BA1 I;  5FO7 B;  4CJ0 B;  2B2W C;  1BOS A;  3BDC A;  1D2B A;  1PRT C;  2IX0 A;  4OIJ A;  1TVX A;  5C44 B;  5FOB B;  2FJ2 A;  4C3I G;  2JP1 A;  5EKI A;  2NB0 A;  4NMZ A;  5A2Q L;  3T4A C;  3VA7 A;  4X3K A;  1AP0 A;  1HTL D;  3NTK A;  1LTI D;  4HAE A;  1CI3 M;  4TQU S;  3VYR A;  2HDL A;  1JE4 A;  5ELD A;  5JJZ A;  4RGN A;  4FXG C;  4K5X A;  1RJT A;  4H13 C;  4X3S A;  4DXG A;  1CQF A;  2D5D A;  1IW7 D;  1TS2 A;  3N6R A;  4KTA A;  4XT1 B;  1ENC A;  1SJH D;  1TR5 A;  2KQ3 A;  1QOH A;  3S1N B;  3H3V C;  3LNN A;  5CBA E;  1E2V A;  2JE6 I;  4CHT B;  2R92 B;  2F0F A;  2L0C A;  3D6C A;  3MFY A;  1SJE D;  5C6A A;  3ERQ A;  1CK1 A;  2HDM A;  3P7J A;  2A68 C;  4G57 A;  4DFA A;  3CHB D;  1BQQ T;  4A3F B;  3MVV A;  2QCP X;  4FXD A;  2MUY A;  2K6A A;  3QOJ A;  2PNR C;  1JB3 A;  2F0G A;  3DXJ C;  1MI2 A;  4FF3 A;  4F87 A;  4X3U A;  4A3K B;  5KNC A;  5EQ0 A;  4PNY A;  2KA7 A;  1PYW D;  1G29 1;  1PRT B;  1BDO A;  1RDP D;  2TMP A;  1KDA A;  3M85 A;  1ZYR D;  5FLX E;  1ZEQ X;  1ML0 D;  4V0B A;  2F0N A;  1ZXT A;  2F0U A;  2FMM A;  5K36 G;  1CFM A;  2WB1 B;  3TDQ A;  1CHQ D;  3MXG A;  4M1U B;  3X3M A;  3H94 A;  3QJY A;  5C4X B;  4TSS A;  2PO4 A;  2F0O A;  3HOV B;  4QUC A;  4QUF A;  1I4R A;  4IZ8 A;  3CKI B;  1F2M A;  3P75 A;  4G7O C;  2WAC A;  4NDX A;  1I3Q B;  1EEF D;  5DNF A;  3VYU A;  3MFG A;  1R4Q B;  1ET6 A;  4NKL A;  1PTO B;  3I4L A;  1WCM B;  2F0M A;  1HQR D;  3ND8 A;  3J80 L;  2Q8T A;  2BE5 C;  1CA6 A;  2L1B A;  2F0L A;  1TWH B;  4RAU C;  2PMZ B;  3KF8 A;  1ILP A;  4ABN A;  2L4N A;  5BN4 A;  2N88 A;  4FO2 A;  5C5M A;  1STY A;  3M7N A;  5JVG 3;  5T1I A;  1RHP A;  1ENA A;  1CZW A;  1WD1 A;  4ZUI A;  3FKI B;  1H9S A;  5KIX A;  2XRQ D;  3TP5 A;  3MHB A;  4DN4 M;  1T5E A;  1PTO D;  1U4M A;  3Q6S A;  1E2Z A;  3DMU A;  3TZD A;  2EJF C;  1DM0 B;  1SYF A;  2OF1 A;  5IGC A;  1VDZ A;  5BN5 A;  1GUS A;  4BS9 A;  1BXT A;  1PFM A;  1DJR D;  5DM7 3;  2J0T D;  4RWS C;  2BA1 A;  1K8O A;  1B9N A;  3FEW X;  1I4X A;  3MWY W;  4HSV A;  3AMU A;  1F9Q A;  5C3E B;  5CR3 A;  2WKC A;  2F0W A;  3IKJ A;  3TSS A;  2L9H A;  1PFB A;  3L9A X;  4K8J A;  1XYI A;  1WTO A;  5JOB A;  4KD3 A;  2EYM A;  5IOD A;  2WIN B;  3J80 E;  2Z4H A;  4XIG S;  5HGT A;  2KJX A;  4OO1 G;  2BOS A;  3W2D A;  1SE2 A;  3IFT A;  2QKI C;  2NTS A;  3OOC A;  2O2L D;  2I07 B;  4S3S A;  1X3Q A;  4CJ2 C;  4FP5 D;  4M8A A;  4QIW B;  3K5O A;  4LJZ C;  2F0P A;  2A6E D;  3SEB A;  1SE3 A;  3Q22 A;  5C0X I;  2NVT B;  3V05 A;  3I8Z A;  1TWA B;  4N9P A;  1Y8O B;  3AU7 A;  4WJW A;  1B2T A;  5ELB A;  1EY0 A;  4IQZ A;  1EFI D;  1B44 D;  3ITP A;  3TP8 A;  2K28 A;  3BVG A;  2KED A;  2O4X A;  5EKL A;  3P1H A;  3PO2 B;  1K83 B;  1KAA A;  2F0K A;  1TII D;  2NBF A;  1S5C D;  5A35 A;  3D8G A;  2J7Z A;  1EY4 A;  4K5W A;  4RCO A;  5C0X J;  1KNE A;  1ESR A;  4EQN A;  1AFP A;  2RBM A;  2ENB A;  2L55 A;  1I4H A;  1JOQ A;  2E2D C;  2IWH A;  1EY8 A;  2B8F A;  2MHV A;  3I72 A;  1V43 A;  1PZI D;  4RH6 A;  1BNZ A;  5KEE A;  2VUM B;  4BBR B;  3PIP 3;  5IGG A;  5IGD A;  1LT5 D;  3A8I E;  4KMU C;  2O5J C;  1WTW A;  1F9S A;  1RD9 D;  2JEA I;  5ELC A;  1JR0 D;  3GTJ B;  1L0Y B;  3NBI A;  2BDO A;  1H9M A;  3I90 A;  5K5P A;  5DAU A;  1ILQ A;  4RHR A;  4DGZ A;  3S14 B;  1ZKO A;  2NVQ B;  2DNC A;  3SDZ A;  3WOE A;  1GUG A;  2F3W A;  1SFO B;  1KLU D;  2F0T A;  3DWP A;  4Q0F A;  3BDL A;  2K5D A;  4IFD G;  3K59 A;  2EE1 A;  3VYT A;  4HR7 B;  3K7A B;  3W3A A;  4LK1 C;  2A6H D;  2YYZ A;  3T51 B;  4ZKB B;  2NWG A;  5KNB A;  4CKC A;  1BUV T;  2K33 A;  3NHH A;  4HMI A;  4B9X A;  4MN3 A;  2X6L A;  3V96 A;  1GJX A;  2VB2 X;  1JC7 A;  3OW7 A;  3KBX A;  3NXW A;  3UI2 A;  3SXH A;  2FHT A;  3X3N A;  1TY0 A;  3LWE A;  1O7L A;  1YNJ C;  1LV9 A;  4L8J A;  2A74 C;  1HUN A;  4UDU C;  2F0J A;  4ID6 A;  3PIO 3;  3FRP B;  1XTC D;  1JCK B;  5EPJ A;  2K04 A;  2KEE A;  1HUM A;  3NE5 B;  2K5W A;  5KGU A;  4ZK9 B;  2CW0 C;  3PUZ A;  2MPM A;  1J8I A;  5JPM C;  1EY7 A;  2N55 A;  4FNF A;  5LL6 S;  3RZD B;  3C1F A;  4FVM A;  1PXU A;  1LTG D;  5LL6 X;  3K5M A;  1LAC A;  4K2L A;  1QNK A;  3R3O A;  4OGQ C;  2CHB D;  1EEI D;  5CV5 A;  2RDH A;  5FKA C;  1PDQ A;  3NPP A;  5ISR A;  5KYI A;  5JVH 3;  1C48 A;  4RCN A;  3L7Z C;  1FR3 A;  4O42 A;  3FPP A;  2WP8 J;  3N52 A;  4K5V A;  5CV9 A;  4I7Z C;  3EVQ A;  2IJ0 A;  5COR A;  4A3B B;  1BF4 A;  2EYL A;  1C8C A;  1JWM D;  3GD7 A;  3SR1 A;  1OO9 B;  3GTM B;  4BWG B;  3JAM L;  1ESF A;  2EXZ A;  5JPN C;  1HCZ A;  1HPC A;  2AQ2 B;  3RUZ A;  4AYB B;  3GO5 A;  5M5Y B;  1HRJ A;  3HKZ B;  2F0Q A;  1FNU A;  3D4W A;  3GV6 A;  2NN6 H;  2EYO A;  2CVR A;  1UEA B;  2B8G A;  3QG1 A;  4IUR A;  3HOY B;  2KEC A;  3C2P A;  4OO1 H;  1PTO H;  3SK5 A;  1CQV A;  4C1N K;  1HQM C;  2DY7 A;  5EKK A;  4H0L C;  2HCI A;  3S2D B;  2EYH A;  1LT4 D;  1BR9 A;  3MXU A;  2NVY B;  1Y8N B;  4G7Z C;  1SYD A;  4Z9C B;  3QOL A;  1W6K A;  3DEO A;  2G9H D;  1SBB B;  2LKV A;  3E5S A;  2PZW A;  4DNR B;  1J9O A;  1T5X D;  3QIA A;  1TWC B;  4K2K A;  3OHX C;  1RTN A;  3AB9 A;  2V4D A;  4DF7 A;  4J1M A;  2PZU A;  2Q8R E;  1WTQ A;  2EY5 A;  5C3X A;  1YNJ D;  3K58 A;  3EFX D;  3VR5 A;  3BYT B;  2A69 C;  3GP7 A;  4CBV A;  3R2I A;  4ULL A;  2ID0 A;  1D1I A;  1HA6 A;  5CBE E;  4KN7 C;  4KJN A;  3IAY A;  1YNN D;  2R6G A;  5I9P A;  4PMW A;  3TZU A;  2AWN A;  3GTP B;  2JXM B;  1FYC A;  4KY5 A;  1D5Z C;  1GHK A;  1NR4 A;  2K01 A;  2E75 C;  3R8B A;  5F2D A;  4FYD A;  1A3T A;  2YU9 B;  4IUN A;  2XVS A;  4HN7 A;  4B9W A;  2IPK D;  1SYB A;  2F0I A;  3FPU B;  4K6D A;  5IIF A;  5IOC A;  2RVL A;  2K05 A;  3HZX A;  4HCS A;  2EDG A;  4IN3 A;  4DAV A;  2PW7 A;  2ZXO A;  4IFD H;  3H0G B;  5A2Q E;  3K5N A;  3KLR A;  3RD4 A;  3TP6 A;  2D2C C;  2M00 A;  1EOT A;  5D14 A;  3NP8 A;  4XYO A;  4XYQ A;  1D1K A;  5HUR A;  1QG7 A;  3PUY A;  2FMC A;  1PRT D;  5I2X A;  1F9R A;  1S4Z A;  3A8J E;  5E4X A;  3DM1 A;  1EQV A;  4B08 A;  3NBH A;  1H9J A;  2EZV A;  2B2Y A;  4HSP A;  4R8I A;  1OXU A;  3NQT A;  1JOR A;  4CKB A;  1OXT A;  2RSN A;  4KHZ A;  1L0X B;  1MD2 D;  1S5E D;  1CHP D;  3E0J A;  5EPK A;  1O80 A;  3TP7 A;  1AZQ A;  2XRS D;  1B9M A;  2QIL A;  1DD2 A;  1B1Z A;  5CV6 A;  3MZ5 A;  1STA A;  4RHS A;  2NYZ D;  1W6J A;  3GTG B;  1G91 A;  1M4V A;  1IKM A;  2EY2 A;  2DY8 A;  2JSO A;  1UAP A;  3OSO A;  1SYE A;  4N9T A;  2EY1 A;  1VMC A;  1EZ6 A;  3S15 B;  5E1F A;  1VCI A;  3S2H B;  1PRT F;  1MBY A;  3GTQ B;  3I73 A;  1SND A;  3TN2 A;  2A68 D;  1GXD C;  1EQT A;  2KUM A;  2JEB I;  2IX1 A;  2IL8 A;  5LHY 1;  1V8Q A;  5EPL A;  1TKW B;  5M3F B;  1LTB D;  4G4K A;  1FNV A;  2KCN A;  3G6J B;  2NN6 G;  1NAP A;  2B2U A;  1M8A A;  4XXE A;  3KLS X;  4A93 B;  2BA0 A;  3RLF A;  3KUP A;  1BCP C;  2ZT9 C;  2XN9 C;  2PPB C;  3DEP A;  1D6E C;  1PTO F;  1STG A;  4XTC S;  5C5L A;  2A73 B;  2OXP A;  4G7H C;  4ZRZ A;  3ND9 A;  5IGF A;  2L12 A;  1IKL A;  5IT9 L;  4IUV A;  3U9O A;  1EY5 A;  1RKN A;  3P20 A;  1LTR D;  2AUK A;  1MGS A;  1DOM A;  1QJO A;  1LTS D;  2OEO A;  5EBD A;  3S1M B;  2JA8 B;  3H91 A;  1DZ1 A;  2F0E A;  1I4Q A;  3PV0 A;  5ELF A;  4ZLT F;  2NVX B;  1TWF B;  4RGM A;  1GUO A;  4ZAI A;  2ICE C;  4CKE A;  2DN8 A;  2BE5 D;  5I2Y A;  3S17 B;  1H9R A;  2RSO A;  2G9D A;  1Q12 A;  2WKD A;  1AEX A;  2SDF A;  4ZYS A;  4F8M A;  4FF2 A;  3I4M B;  4HED A;  1BBX C;  1EL0 A;  4QCL A;  3NUC A;  4OIK A;  1F2L A;  2JYO A;  3NTH A;  3NWT A;  4F7X A;  3D31 A;  1SDF A;  4DK1 A;  3EA6 A;  4OHJ A;  2EJM A;  3T13 A;  2AQ3 B;  1XXG A;  5CV7 A;  2RA4 A;  1LTA D;  1BCP B;  1EIH A;  1PFN A;  1KAB A;  4QMG A;  2F1M A;  1NSN S;  5C0X G;  5D3D A;  1XX8 A;  4ILW A;  2VXW A;  5J1Z A;  2ZXR A;  3HOW B;  1EIG A;  3DHQ A;  3NWS A;  1STN A;  1G2S A;  1EYD A;  1STE A;  4DXF A;  4R9W A;  4L6T B;  1EZ8 A;  4E6I A;  1K8M A;  3SK6 A;  1U4P A;  3NQI A;  4CJ1 B;  3H6M A;  4KD4 A;  2F3V A;  2SEB D;  3J81 L;  4WRD A;  1FGB D;  2EYJ A;  1Z6H A;  4QF4 A;  2B2T A;  3HRZ C;  4MIU A;  3BZD B;  3CRK C;  4KV6 A;  1FNW A;  5JEA J;  2QDB A;  1GHJ A;  2KHS A;  5C3W A;  3G7L A;  5CC4 A;  5FK9 C;  2D62 A;  2FFK B;  3I3C A;  1NUC A;  5CYU A;  4I65 A;  3I4N B;  3BDO A;  1QB5 D;  4RGO S;  5J22 A;  3E6Z X;  1LAB A;  1IW7 C;  2K1B A;  1CTM A;  1TS3 A;  3MTS A;  5T1G A;  1Y8P B;  1F2Z A;  2EYF A;  5D65 A;  1D5X C;  1HXY D;  1V1P A;  2CQA A;  5COY A;  2BCO A;  3HS0 C;  1JOO A;  5E3F A;  5AFW A;  1TWG B;  3WOF A;  5JEA G;  2E74 C;  5NUC A;  4JK1 C;  4PMC A;  4H7B A;  1G2T A;  4TRD A;  4KKS A;  2B63 B;  3K6O A;  2EPB A;  1PZK D;  3BS1 A;  4IAL A;  1DON A;  1QWY A;  1CM9 A;  2AUJ D;  2F0D A;  1B3A A;  5TSS A;  4A3D B;  1AN8 A;  3GTK B;  1CZG A;  1A6X A;  4DAP A;  2BDN A;  1WTX A;  3MEH A;  3SVM A;  1DCZ A;  2WV6 D;  1LTT D;  5I6Y A;  5FO8 B;  1TQO A;  1I4G A;  3S16 B;  1SYG A;  2XNA C;  3HGB A;  4EQO A;  4Y7N B;  1SYC A;  5CV4 A;  2HQE A;  4KK7 A;  2EVB A;  1IL8 A;  2WII B;  1Z7T A;  5IGE A;  2HUG A;  4C3H B;  3OWE B;  3GQB A;  3A56 A;  1D5M C;  4F88 A;  4RGT A;  3OPO A;  5EGT A;  3PMF A;  2EOT A;  2E2H B;  3K0Y A;  1NR2 A;  1E0B A;  1QIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...