1EL0A

Solution structure of the human cc chemokine, i-309
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords I-309
publication title Human CC chemokine I-309, structural consequences of the additional disulfide bond.
pubmed doi rcsb
molecule tags Immune system
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1el0A00
4R9WA 2X6LA 2HCCA 2MP1A 1SDFA 3P7JA 1WTWA 2K03A 1B4OA 1F9SA 1G91A 1SAPA 3DM1A 1TVXA 1JE4A 3I3CA 1AZQA 1F2LA 2L9HA 3FDTA 4X3KA 1HHVA 4RWSC 2H1EA 1U4LA 3KUPA 1S4ZA 1DOLA 2B2YA 1A15A 1DOKA 1PDQA 1U4MA 2B2TC 3TZDA 1EL0A 3I8ZA 1KNAA 1MGSA 4X3UA 2JYOA 3LWEA 5COYA 2MGSA 1VMPA 2J7ZA 4HSVA 4QUFA 4ZK9B 1HUNA 2RSNA 1HFNA 4IUUA 4DN4M 1GUWA 1AP0A 1MI2A 2B2VC 1NCVA 1B53A 2N55A 1HFGA 1DZ1A 1MSGA 1PLFA 5CMDA 2K28A 4ZKCB 2L4NA 2EE1A 2K04A 4HAEA 1RTNA 2CVRA 1C8CA 2VXWA 2K05A 2B2WA 1J8IA 1EIGA 2D9UA 2L1BA 3I91A 4IURA 4O42A 4XT1B 1RHPA 1CA6A 1HRJA 2KUMA 1IKMA 1X3QA 1Q3LA 4CJ0B 4RA8A 1ICWA 1SSOA 1X3PA 2X69A 1EQTA 1XX8A 3N52A 2KECA 2B2UC 5CBAE 1QG7A 2DY8A 3FPUB 4IUQA 2FINB 2N88A 3GV3A 4UAIA 5DNFA 2HDLA 1PFMA 5EJWA 1WTVA 2NWGA 1NR2A 1IL8A 3DEOA 1CM9A 2MJ8A 3I90A 1EIHA 1G2TA 1G6ZA 2HCIA 1ILQA 2K01A 3Q6SA 4X3TA 2KEEA 2K1BA 3QO2A 1J9OA 3HP3A 5CBEE 1HA6A 4IUVA 3R93A 1WD0A 2IL8A 1MSHA 2JP1A 3TN2A 2FFKB 4RAUC 1B3AA 4ZKBB 2L12A 3SVMA 5T1IA 1WVLA 1CA5A 1O7YA 1QNKA 1JICA 2EOTA 2HUGA 2FJ2A 1WTQA 2RSOA 1WTPA 5EPJA 1U4RA 4MHEA 4CJ1B 1F9RA 1WTOA 4MN3A 2FMMA 2X6GA 5T1GA 1B50A 2SDFA 1F9QA 1BNZA 4ZAIA 4HCSA 2M2LA 2RVLA 4OIJA 1PFBA 4XT3B 4X3SA 4R8IA 1BBXC 1HUMA 3MTSA 1M8AA 2KEDA 1X32A 1WD1A 5EPLA 3F2UA 1IKLA 2NYZD 3IL8A 2B2WC 1RTOA 2DY7A 4XDXA 1QE6A 4CJ2C 3GV6A 5CORA 2B2TA 5E4XA 1BF4A 3D6WA 4OIKA 2B2YC 3G7LA 5D14A 1ILPA 5E4WC 1RODA 2XIWA 1ML0D 1DOMA 2HDMA 1BO0A 2Q8RE 5EKIA 5EPKA 1ZXTA 2MPMA 1LV9A 1G2SA 2B2VA 4ZLTF 1NAPA 1WTRA 1AZPA 1RJTA 2FHTA 1WTXA 2KOLA 4IUTA 3DEPA 4LMQD 3H91A 3IFDA 4QUCA 2BDNA 1VMCA 3KBXA 5EQ0A 5JJZA 1E0BA 1KNEA 2Q8TA 2KVMA 5D65A 1B2TA 1DONA 2EPBA 3ONAB 1EOTA 1O7ZA 1PFNA 1U4PA 2RA4A 4HEDA 4NW2A 3UI2A 1O80A 4U68A 3MWYW 2NZ1D 5AFWA 1ESRA 1NR4A 1XYIA 4IUPA 2R3ZA 2B2UA 2L11A 1F9PA
chains in the Genus database with same CATH superfamily
2MP1A 2LY7A 1IBMQ 1B4OA 3DM1A 5ELDA 4L8JA 3K8AA 2B63B 2PW7A 3K0YA 3M9BA 2E74C 3ZJYC 5AJ3L 1O7IA 3MVVA 1EL0A 4IPCA 3NXWA 4ZK9B 1B3QA 2Z6KC 1B9NA 1SYDA 2NTSA 4DGZA 4BY1B 4DFAA 2K75A 4YWMA 4YWKA 3J81c 2K28A 2EXDA 3MFYA 5ELFA 4F87A 2Q2TA 4K5XA 4IALA 4UDUC 1EY8A 3J80E 3NHHA 4DV1Q 4LFBQ 4ID6A 4KY7A 4MTKA 4ZRZA 2B2UC 1I6HB 3OPOA 4DV2L 4N9TA 5I9PA 2N88A 4X62Q 1YEZA 2F1MA 4KMUC 4KTAA 2I46A 1LT4D 3NELA 1WD0A 4L6TB 2FFKB 2NZOA 1V1PA 1CUKA 3T1YL 1L0YB 4XQQA 3ND8A 3I4NB 1TWFH 4F88A 2R93G 3I4MH 1QNUA 4RHRA 4XT3B 1HNWQ 2Q2UA 1FYCA 1KTKA 2A69C 2F4IA 4RGMA 1QCBD 2F0LA 1NMGA 5CV8A 5G3LF 1HZCA 1EQRA 4K6LA 2K5NA 4B9XA 4POFA 5GAHC 4LF7L 2VNUD 4A3EG 1H9SB 3RZDH 5JAVA 3PIP3 2EYHA 1AN8A 3I55A 4DK3C 5ELCA 5JPNC 1CQVA 2CFMA 1YNJC 4JI0Q 1KLGD 1JT8A 2NZHA 2PQEA 4UP7A 4DR4Q 1O7ZA 4JVZA 4HEDA 1V43A 4LF4Q 1XYIA 3I72A 1LTTD 3QG1A 3K6OA 1CFMA 1UE1A 4DV3L 2BA1A 4PMCA 3O13A 1NTGA 1N36L 5I2XA 2GVAA 2LKVA 1VQ9A 3QR8A 5ISRA 2XWBB 1UEAB 4DNRB 1KAWA 2PMZE 4ME3A 1CI3M 3BZDB 4O1NA 3E9HA 3OHXC 3P1HA 4A3IG 1SNDA 1QOHA 4A3BG 3K58A 2K5WA 3S1NH 2PCFB 4PMWA 2RSNA 3K7AH 1MI2A 1O7LA 2B2VC 1D8LA 2K5QA 1HZ9A 4QB4A 2ZJRA 1STYA 1H9RA 1STHA 1JJ2A 4ODGA 1B9MA 4OX9Q 3TRZA 3ULPA 3NEMA 1K8MA 1AEXA 4K6DA 5IGEA 3I70A 4UY8C 1H9KA 4B08A 1WYDA 2B2WA 1PH1A 5A2QE 1TWAB 1CA6A 2UUBL 4XT1B 5JJLA 4X66Q 2D2CC 3J81L 1SLJA 4DV5Q 1Q8KA 4L63B 3DMUA 4JI4Q 4GNXA 3STBC 4X65L 2UXDL 1LTGD 3Q6SA 2NVTH 3PO3B 1JC7A 3C46A 1MSHA 4R4QA 1VQEA 3KFUA 2RDGA 3E0JA 1MHWC 2ICEC 1PH3A 2FJ2A 1ONLA 5C3WA 4A3EH 1GHJA 1IYVA 4R1JA 1EIFA 3HOUB 1EU4A 2Y0SE 1KLUD 1T5EA 1T5XD 2F03A 4J15A 2CQAA 1YVCA 1ENCA 1BBXC 3UDIA 1M8AA 5I4DA 3KYHC 1FR3A 4DUYL 3A8JE 4ILWA 4DF7A 3BG3A 3CU7A 3K59A 2VW9A 1JJCB 3D6WA 3D31A 4QCLA 5FOBB 1U9RA 2ICIA 5E4WC 2ZTEA 4GZYC 1VQGA 4LF9L 4RGTA 1G2SA 1WTRA 2F3VA 2EIFA 1J5EL 1JMCA 1LLRD 1E2WA 3DM3A 2J0TD 2PNHA 3NBHA 4NPSA 4OO1I 1BR9A 3KBXA 4R4TA 1EY7A 1PXUA 3JAMc 1GD7A 1TT2A 4A3IH 1Y69U 5GADC 4A3BH 1U4PA 1V1PB 5J22A 4G7OC 4MTNA 4QIWB 4X64Q 1KRSA 4IUPA 2R3ZA 5KIXA 2K5HA 4B3TL 2AQ3B 1SDFA 4O0AA 3GTQB 2QGQA 1F9SA 3S1QH 4ZQ3A 2QDLA 1WCMG 1HR0L 1S4ZA 5ELNA 3RR5A 3TZDA 2F0HA 1TS4A 5FO7B 5LL6S 4DR6L 1VMPA 1QZHA 3VA7A 1XNRL 1DXMA 4IPGA 4C3IB 2XSCA 4FXGC 4IUUA 1FJGQ 1GUWA 4S3SA 4BS9A 5IGCA 3J81i 5M5WH 4GN4B 2O5JC 3FKIG 1PH5A 3MFGA 2Y0SB 5KEEA 1RTNA 3QOLA 4AH6A 3VR4A 1L0XB 1D5ZC 1PTOH 4YCUA 4KK7A 3H3VH 5DLQE 1GUGA 1QG7A 4DA2A 1LTLA 2VB3X 1GUTA 3TP8A 3CCVA 4ULLA 1XTDA 1KDCA 3I90A 3TQYA 4OWWB 5HURA 1G6ZA 4DXGA 5M3FG 1S5DD 2G9HD 5LMUL 2UXCQ 1CKNA 3AB9A 2LFNA 3I2ZA 1O7YA 1WTQA 3K7UC 3LWUA 4KY5A 2H4OA 5EPJA 4DR5L 5ELEA 1SR3A 4BY7H 2OQKA 4JG2A 2M2LA 1SRUA 4JI5L 2F52A 1VQMA 4K5VA 4CDFC 4BBSB 4DUZL 2ZTDA 3R8BA 1FD7D 3ULLA 3K5MA 3Q0AA 1WTHA 2BH8A 1MJEA 1TKWB 5FLMG 3I4LA 1S5ED 4C1NK 1HNZL 1Q46A 2Z6BA 1VF7A 1WCMH 2R7ZG 3M4OH 1TWFB 4CKCA 1VQBA 1M4VA 3I4MB 1IZ6A 2JE6I 4DV4L 4DR7Q 1FGUA 3EJIA 4QJFA 1C0AA 4HTHA 3JAML 5BN5A 1WTWA 3A7AB 3FKIH 4ZUJA 2PZUA 1PZKD 1IBKQ 3X3NA 2VY3A 4DR2L 3RZDB 1C7YA 3S2HB 1NMFA 3UDFA 3KUPA 3HZXA 2BCOA 1PDQA 1EY6A 1RCVD 3I8ZA 1MGSA 3K5NA 4G7ZC 1BCPB 2FMCA 1PYSB 5C44B 4KD3A 3CKIB 3MXPA 4HIDA 1B8AA 4AYBE 3WDNA 2KENA 5JJIA 1YITA 3NE5B 4ABNA 3MAQA 4Q5VA 1ENFA 2A19A 2BDOA 1PA6A 1X3GA 2EYFA 1D6EC 3NBHB 1C8CA 4K8IA 3E3XA 1PFSA 3DWAA 4A3GB 3DLLA 1Q3LA 1Y1VG 3QB3A 1JE5A 2X69A 1K0SA 3TDQA 2JEAI 4DV6Q 2BH2A 4FF3A 2FINB 1YNJD 4MZ9A 1UE5A 1GUNA 4G57A 5IYCG 5KNCA 3HOWG 3S1NB 1U0LA 4GOPC 1ICFB 1GXDC 1VQJA 3K7AB 3SR1A 2WB1G 5TSSA 2K5DA 4H44C 3HKZG 2SOBA 2JP1A 1XTCD 3S9WA 2JA5B 1QNKA 4NXMQ 1X9NA 1S72A 2MHVA 1Q81C 3MXNA 3W1BA 4C2MH 4K0KQ 1PH7A 2E2IB 2JEBI 5FLMH 1AFPA 5T1GA 2RVLA 3CPWA 2EYOA 4X3SA 2WAQE 1PZJD 2CCZA 1BF4A 4OIKA 4B3RL 3CCEA 2NVTB 4NKLA 3IAYA 4A93H 4GN3B 1W6KA 2DUDA 2MPMA 3HEJA 1SNQA 4XQJA 4A3EB 1DJRD 4QF4A 4AYBB 3JAMi 2HD3A 5EQ0A 1JOQA 2B29A 2BOSA 1NY4A 4DU9A 3ONAB 4DPGA 1CKNB 5JPMC 2K6AA 3AFQA 1TXYA 3STBD 3R2IA 5H1SE 1XNQQ 1G51A 4A3KG 3H3VI 1NUCA 1G91A 1O78A 4FYDA 3NP8A 1VS0A 1F2LA 1RDPD 3L9AX 1SMYC 5FLXc 2VQFQ 1Y1VH 1YNXA 4IJLA 2MGSA 3OOCA 2NVXH 4YWLA 1SNPA 3J81j 5EKKA 2E2HH 1PYBA 2O2LD 3CP0A 4A3IB 1AP0A 3EQLC 5IYCH 4A3BB 1B44D 1Y8PB 1MSGA 2CKZB 5KYLA 4ZKCB 1CKOA 2EXZA 3TS0A 4YCVA 2A5HA 1EIGA 4LWCA 4O42A 4LFAQ 3S1QB 2WAQB 2PPBC 5DM73 3OIPA 1GVPA 1STAA 2DJFC 1TWCH 3NTIA 4KKSA 1ILQA 2KCCA 1YJWA 3U58A 1L2FA 4FVMA 5M5WB 1MD2D 1V8QA 4RAUC 1CHPD 5L37A 2MO0A 1EY9A 3J81E 3GTKH 1Q86C 4LF5L 3TMEA 1U4RA 5M3MG 1CQFA 2YTVA 2R92H 1FNVA 1PTOB 3EBEA 3EN2A 2LSSA 2QCPX 5EBDA 5IP9H 3PIOA 4CKEA 3F2CA 2B8FA 4HSPA 1N32Q 4OO1G 3KOJA 1EEFD 1ASZA 1VQ4A 3PUZA 1SEBD 4I7AA 4A3DG 3C3LA 3E9IA 1EYCA 1A3UA 4TQUS 1U5KA 1AH9A 1XMQL 1PRTB 3S1RH 3ER0A 1SXTA 4UP8A 1VQPA 3NWTA 1YHAA 2KVMA 1UNSA 4BY7B 4NW2A 2IT1A 5CGKA 5FK9C 1VQCA 4FXKC 2I5LX 5AFWA 3MXNB 3U50C 3D4WA 4GKKQ 3HOZG 4KKTA 1SE8A 4TVAB 4KN7C 1B70B 2VUMG 1X3EA 1JJGA 5M5XH 3HOXB 1RL2A 2F0TA 2M9VA 1JORA 1J6QA 1DOLA 4IN3A 3L7ZC 3M4YA 1WCMB 2SNMA 3LWEA 5COYA 4GLVB 1QVFA 4HSVA 3M4OB 3SK8A 4DAMA 3OMGA 5LMNW 1ASYA 3OTOL 3UE0A 3VR2A 2KA7A 3E6ZX 4HAEA 1TY0A 3RN5A 2F0FA 2VXWA 4GLAC 3S17H 3FKIB 3MZ5A 1J8IA 2L1BA 2CW0C 4NP5A 5IGDA 4A3JB 3DWQA 3HS0C 4IPDA 2P5ZX 1I94L 3B6YA 5M3MH 3UDGA 1STNA 4HIMA 3GV3A 1LM0A 2YYZA 1NR2A 1TWGH 1IL8A 3DEOA 5HY6A 4A3FG 2A6HC 4QY7A 5JVG3 1YHBA 3R93A 1H9MA 4OO1H 2UUCQ 5D3DA 2KBNA 1MJCA 3PMFA 4HJ8A 2DNEA 3MEFA 4A3DH 1PVOA 5IWAQ 3FMCA 3RLFA 1WTOA 3URYA 1GJXA 3C1FA 2ZM6L 3MTSA 2NVQH 4OELB 4C3HG 2B2WC 2DY7A 2VQEQ 4H7BA 1FNUA 1C4QA 3CD6A 1LT3D 3G7LA 1VQAA 2VL6A 3A55A 3HOZH 1EUJA 3BDCA 1ML0D 4JV5Q 4JBWA 2RDFA 1AZPA 4GNXC 1EYDA 1VQKA 2MO1A 4LMQD 2A1AA 2MNAA 5E1FA 3HKZE 1KNEA 1BBUA 3CMAA 5J1ZA 1ESFA 2ASBA 3U9OA 1NR4A 4H0LC 1Z47A 4KLKA 2X6LA 3P7JA 3M3YB 4CHTB 4JI8L 3V05A 3FDTA 4RGOS 4A93B 4X3KA 2Z4HA 2UUAL 3E5SA 3CCLA 3GTMH 2I5MX 4B3SQ 1A2TA 3PUYA 1K83H 3JAME 4CBVA 1L1OA 2ZXPA 3EA6A 4NDXA 2OT2A 1UWVA 4CDEC 3F1ZA 1N34L 4G7HC 1VQ5A 2EE1A 1I4RA 1TWHH 1YIJA 2KHIA 2CH4A 2IHFA 3EFXD 1HRJA 1WOCA 3SK5A 1XX8A 1YHQA 2K32A 4JK1C 3VYTA 3H09A 1IBML 3A8IE 1Y1VB 2HDLA 4CDCC 1EIHA 3IFTA 4JI6Q 1Z6HA 3GTLH 2E2HB 1TU2B 3G6JB 4CGYB 1I50B 4C3HH 5CBEE 4MIUA 5DAUA 3G48A 4PG3A 5T1IA 3G4SA 4FXDA 2WB1B 2C9OA 4C56C 3EIVA 1OXSC 3MEHA 3HKZB 4QIWE 3OWEB 4G4KA 4JI1Q 4ME5A 1SMYD 1F9QA 5C4XG 4OIJA 1YZ6A 2E2JH 2R93H 1SE3A 2A68C 1SYEA 1TWCB 4DV1L 4CJ2C 4LFBL 2JK8A 1SYBA 4KY6A 4DR3Q 2F0MA 4X62L 3J80c 3NTHA 3WOEA 1BQQT 2ZT9C 3D4RA 3H94A 3M4QA 5IGGA 1RJTA 3I56A 3GTKB 3C2PA 2WV6D 3H91A 1TQOA 2Z1CA 2R92B 2E8GA 1HTLD 2D0OA 2F0KA 2AQ1B 3A54A 3QIAA 4WJWA 2KCTA 2PZTA 2RDHA 3A56A 4L5RC 3PO2G 4HJAA 4HJ9A 3T1HQ 4EQNA 4L5SA 3DHQA 1HNWL 2RHSB 4XYQA 1SAPA 1AZQA 3TP7A 1NSNS 3PUXA 1I4XA 1GHKA 1HHVA 2R7DA 1IXRA 4WJ4A 2F0VA 2RCFA 4XQNA 3GP7A 4HJ5A 3S1RB 1QZGA 4CKBA 3SK6A 3CCJA 4J1MA 1HPCA 1EWIA 1VF5C 3LGJA 3BVZA 1OXXK 2ZTCA 4JI0L 2JQOA 4KD4A 4Z9CB 4DR4L 2CWAA 4B3MQ 3NK9A 3RLNA 4LF4L 5HGQA 1B2TA 3NUCA 1EY0A 2EYLA 5M5XB 4LK1C 3NENA 1EQTA 3VYRA 2JA9A 2KECA 1W6JA 4M1UB 3FPUB 4FF2A 3CCMA 5C4XH 2WP8J 3P20A 4KI0A 1X54A 1M1KC 1D5MC 4PZ8A 1II3A 4JI3Q 1ENAA 1MKHA 4IUVA 2QILA 5C3EB 5IT9E 3G6EA 1EZ6A 4DNIA 1R4QB 1BVSA 1JICA 2JA8G 4H02A 4DV7Q 5IGBA 1GM5A 3S17B 4DR1Q 4OX9L 1L1OB 1F9RA 4OONA 3H0GG 3KJPA 4L5TA 1B50A 4JBKA 2GN5A 5KGUA 1LTID 5M3MB 3MHBA 4BBRG 4X66L 3OW2A 1IKLA 2VB2X 1TWGB 5IGFA 1A0IA 2B63G 4DV5L 3PO2H 2Z0SA 3NTKA 4JI4L 2TSSA 1V1QA 1BO0A 5EKIA 2E5LQ 1PRTC 4IFDJ 4KHZA 4JYAQ 3I7FA 4Y7NH 2CW0D 2L5TA 2D0PA 3OW7A 1TS5A 1D1KA 1Q1BA 1UEBA 4A3DB 1AE3A 3UE1A 4QUCA 3J80L 3J7AV 1FGBD 1DM0B 1W2BA 1ET9A 4WFN3 2HT1A 2NVQB 3MWYW 4EQOA 1G291 2AUJD 2A6HD 4KHPQ 2RBMA 1E2ZA 1D2BA 1OXUA 2K03A 4HCEA 4CDDC 1TVXA 3HOZB 1D1IA 1B7YB 3M7NA 3GTPH 1FVIA 3PF4A 4ZYSA 3PCOB 2JSOA 4TRDA 1SE4A 3CRLC 2EJFC 3CCSA 1JWSD 2JA6G 3U4VA 1ZEQX 4WORA 3GTJH 4DV0Q 1GUOA 1JR0D 4QMGA 4XYOA 1EU3A 4UP9A 1KL9A 2GVBA 1SBBB 3W3AA 1IHZA 4X64L 2JA8H 3KF8A 3HGBA 1D5XC 3S15H 4P2CB 1D7QA 2R6GA 3N52A 1G6PA 3VR5A 4AQYQ 3GTMB 5CV9A 1ZYRC 1QWYA 5EJWA 2QEJC 5KNBA 2IX3A 5LMNQ 1K83B 3FRPB 3L3OC 4BBRH 1N33Q 4DXFA 1HR0W 4KJNA 1J9OA 2NBFA 5J3BA 2B63H 5M3FH 1IKMA 2EDGA 4LF6Q 1E1OA 1S5FD 4OXPA 3CF5A 4GKJQ 1FJGL 1PH2A 1SROA 1TWHB 1NNXA 4YHHQ 4MHEA 4GS3A 5BR8Q 2VS1A 3D0FA 1KIXA 5M5YH 4PZ7A 1BCPD 1RD9D 1A8VA 2WINB 5C5MA 1YNND 1F2MA 1SMXA 1Y14B 5M9OA 3L2PA 5CORA 3GTLB 1CT1D 3ERSX 2B2YC 4LFCQ 4C3HB 5EBCA 3VR3A 1I3QH 4RKLA 4DKAC 4DNTB 4QL5A 3R2TA 3DXJC 2BE5C 1HXYD 2ZJQA 4BWGB 1HNXQ 3TREA 2UXCL 2F0SA 2ATWA 2C35B 3K5LA 2ES2A 5A2QL 3W1GA 2R7ZH 3NBIA 1DONA 2EY1A 3MC0B 5IYBG 2R93B 1X55A 5FO9B 2UU9Q 1BDOA 1A3TA 4LW1A 2JA6H 3M7GA 1STBA 5C4JH 1DD2A 4HN7A 2YU9H 3BDOA 1C48A 1M90C 4DK6C 2H1EA 1VQ7A 2AMCB 3T16A 3OMCA 1U4MA 3CRKC 1KNAA 3HOYG 2Z9HA 1IBLQ 4DN4M 2A68D 3RMHA 3PGZA 2N55A 1V1OA 2HQLA 3OSOA 1Y1WG 1DZ1A 2F4VQ 3A5ZB 1SNOA 1TIID 4RHSA 4EGVA 1S40A 4NXNQ 2PNRC 4PQXA 2K05A 1LT5D 1XXGA 2A73B 1W3SA 4WRDA 4IO9A 3CHBD 4DR7L 2XWJB 2YTYA 1ZKOA 1ICWA 1SSOA 3T13A 3CCUA 4HMIA 2OWOA 2NVYH 2DY8A 2HHHQ 3PUWA 1LTAD 4K5WA 1IBKL 2V4DA 3DUZA 2EJMA 1A62A 1K0RA 4LF8Q 1SYGA 2KEEA 3HOWH 4KJOA 2F0IA 4BXXG 1SFOH 2L12A 5C3XA 4YY3Q 1CA5A 1BKBA 1EWCA 2UXBQ 3DWPA 2WACA 4NB3A 4A3LG 2FMMA 1IYUA 4UPAA 1VQLA 1EQVA 1XMOQ 1BNZA 4GN5A 1PRTF 4JI7Q 2ENBA 3H6MA 2O5IC 2F0JA 1P16A 1N9WA 1X32A 3A5UA 3KJOA 5C4XB 1E3PA 1RTOA 2HQEA 5IYBH 4A3MG 1I4PA 2RCNA 4DV6L 1VQOA 3KF8B 4PMBA 1KDBA 3Q8DA 1G8ZD 5AJ3Q 1ILPA 1SN8A 2QDBA 3GDEA 4EX5A 5JJKA 1EZ8A 2H5XA 4GOPA 1B1ZA 4R8NA 2CQOA 3X3MA 4JCVE 5E7NA 4C3IG 4HIOA 4IFDI 4APVA 1HZAA 4Q0FA 4NMZA 4NXML 4IOCA 1NE3A 2KQ3A 5D65A 4IPHA 4WJ3M 1A3VA 1PFNA 3HOYH 4K0KL 1ET6A 1E7ZA 2Y0SG 1RKNA 1K3RA 4Y52H 2JN4A 1S3OA 1NBWA 1GOZA 1Y1WH 4KN4C 2HCCA 4ALPA 5HGTA 3VYUA 4JBMA 4DV2Q 4A3KH 3U4ZA 1N8RC 2L9HA 3T53B 5CYUA 4RWSC 1CTMA 2F0QA 4Y7NB 1KQSA 2EYMA 3I4OA 1GUSA 1Z7TA 5CV5A 1PH6A 5BN3A 3T1YQ 1B53A 1HFGA 2OCEA 1LO5D 4FNFA 1PH8A 3NQTA 5EGTA 5F2DA 2CH4W 4K14A 1PRTD 1R4PB 2D9UA 3I91A 1DYQA 4IURA 1MIUA 1XNQL 1X3QA 2HIXA 1HH2P 3GTPB 4LNQA 1K73C 4LF7Q 5CBAE 4BBSG 4A3LH 1LYLA 4OGQC 5DNFA 1CZGA 2A6EC 1PFMA 4XXEA 1R9TH 2ZXRA 4JC0A 5JOBA 4J8QA 2MJ8A 1G2TA 3RNUA 2K01A 2VQFL 1UE6A 5FLXL 3H15A 2E75C 2K1BA 2OTLA 1SE2A 1QVCA 2D62A 2RHQB 4A3MH 2IL8A 3GTJB 1B3AA 2IPKD 4K8JA 4JPBW 3PIO3 3AU7A 2JXMB 2RSOA 1L1OC 1WTPA 3I4MG 1SJHD 4CJ1B 5FJ8G 2JA8B 2X6GA 2MUYA 3WOFA 4A75A 3S15B 4KV6A 4IUNA 4P71A 4DV3Q 1IL2A 4LFAL 1IW7C 1N36Q 2IW3A 5EPLA 4RCOA 1I4GA 3EVQA 3IL8A 3FHWA 2B2TA 1V9PA 4BBRB 2ALYB 1XPRA 3K0XA 3PUVA 2NN6G 2ZXOA 1XPOA 2TMPA 5M3FB 1LV9A 3PF5A 2FHTA 5C44G 1WTXA 4JBJA 1F2ZA 2WKCA 2YV5A 1VQNA 4P74A 4R4CA 5I6WA 2IY5B 5I9OA 3HOVG 1CSQA 3CC2A 2MFIA 5M5YB 2EPBA 1ZYRD 1EOTA 2RA4A 1FL0A 2EY5A 4U68A 2RQXA 4DAPA 2EQSA 2NZ1D 2AWNA 4TSSA 2UUBQ 3PIPA 4R9WA 3ULJA 2I0QA 4A3GG 3MXUA 2R7FA 4RKBA 1LABA 4P73A 4ZCKA 3V96A 1N32L 1I3QB 5IYDG 2VUMH 4X65Q 2UXDQ 5D3IB 1A15A 2XN9C 3NPPA 4C2MB 4JI2Q 2WB1E 2F0DA 5IP7G 1PHJA 1GO3E 1S5CD 4BBSH 2NUCA 3NWSA 3T51B 2R7ZB 3JC66 1WI5A 3TP6A 2JA5G 4N9PA 4GOPB 3GTGH 5CMDA 4DK1A 3V2TA 2JA6B 2XRQD 1TY2A 4RFBA 5C4JB 3VR6A 4PZ6A 3IKJA 1HJPA 4RCNA 2YU9B 4DUYQ 4C3JG 1F2YA 2B3GA 2BE5D 1RHPA 2FXQA 5GAGC 4GLXA 4GKKL 1X3PA 2L15A 5EAYA 5FJ8H 3TBIB 1BCPC 1LTBD 1EIYB 2OXPA 1IYJB 5NUCA 2AHOB 2SNSA 4JOIA 3TP5A 1YJ9A 1PH4A 1EYGA 1KXLA 1YNNC 4H13C 4BA1I 1CM9A 5LL6X 4LF9Q 3FVQA 2N3SA 4C1NI 2AWOA 3S24A 3QO2A 3HP3A 1J5EQ 4A3FH 2LXJA 4X6AH 3QWNA 2F0EA 1HA5A 3SVMA 4M8AA 2A74C 4AYBG 5BN4A 3CMEA 2E76C 2I5HA 4LAAA 2K4KA 3S2HH 2OTJA 2NN6H 1AW7A 2F0NA 1XWEA 2G5DA 3D6CA 1JOOA 1EWHA 5C44H 3HFZB 3T56B 1Q82C 1JCKB 4B3TQ 2NVYB 3P75A 3HG9A 3HOVH 1VQ6A 1WD1A 1TS2A 1VCIA 2NVXB 4KHVA 2LMCB 3GV6A 1HR0Q 5D14A 4QGUA 4O2DA 3HOWB 3OYYA 1RODA 3F8TA 1PH9A 2Z6KA 2XIWA 2Q8RE 2HDMA 4DR6Q 4A3GH 1SFOB 1XNRQ 5C4ZA 3BVMA 3D3RA 5IYDH 3PQIA 2UUCL 2QEXA 3VA5A 1WJJA 1UUPA 2PW5A 2OF1A 5IP7H 2IJ0A 1HTPA 3D4DA 5KYIA 5IWAL 1ESRA 2B2UA 2JA5H 4LJZC 2L11A 5LHY1 1Y8OB 2WAQG 3KLRA 1KD1C 4FF1A 1XPUA 2XGTA 2E2IH 3S16H 1OXTA 2VQEL 4PV1C 5IIFA 1UE7A 4C3JH 5G3LD 3ERQA 1DOKA 1VQFA 5FKAC 5LMUQ 4JV5L 1JOKA 3HRZC 4YCWA 4I65A 3AYHB 2L55A 1F77A 4A76A 1YJNA 1KDAA 3HOYB 4JI2L 4LUOA 3CAMA 1Q12A 4XIGS 1JWMD 4DR5Q 3HKSA 5E3FA 1Y1WB 2CHBD 3CW2C 4EQPA 3A74A 3A8KE 4N8X1 4K2LA 2KHSA 4A3KB 4JI5Q 3RLOA 3ICEA 2WFWA 4CJ0B 4RA8A 2NTTA 4DUZQ 3F2BA 2ZJPA 3BU2A 4B9WA 4KKUA 1T9HA 4L5QA 1DGSA 2EJGC 4RGNA 2IX1A 4B3SL 3L0OA 4X3TA 4RMFA 2PMZB 1HNZQ 2K52A 3S1MH 4ZUIA 4ZKBB 1K9MC 3M85A 2HUGA 3J7YW 3I73A 2EY2A 4P72A 3VYSA 4BY7G 1I5FA 4DV4Q 1EQQA 2SDFA 3T4AC 3FP9A 1PV4A 4ZAIA 1X56A 2HIVA 3SXHA 2JA7G 2C5CA 1EYAA 2RKSA 3EROA 3KF6A 2NYZD 4N8FA 1S5BD 1R9TB 1QE6A 2R61A 1UAPA 4IFDG 5CV4A 5I6YA 4DR2Q 1VDZA 3HOXG 3SGIA 3SE0A 4MNOA 3WWVA 4A3MB 5EKLA 4OL7A 4JI6L 1KRTA 4FO2A 5GAEC 2B2VA 5CR3A 4ZLTF 4RH6A 3S14H 5IE8A 2BA0A 2KOLA 2CWPA 1I4QA 1PTOC 3BS1A 3H3VC 5J39A 4FP5D 1QJOA 5FO8B 1QILA 2F3WA 2A6ED 2DGYA 4JI1L 2AKWB 3S2DH 5I2YA 1KABA 3Q24A 2IWHA 3TEHB 1F9PA 2J4XA 4A3JG 3PV0A 4IQZA 4UHVA 5K36G 1I4HA 1Q1EA 1PMRA 4EQ5A 3KLSX 1JE4A 3GO5A 2Q8IB 1KC8C 2EZVA 4DR3L 1K8GA 4BY1G 2J7ZA 3KLWA 1CZWA 2QKIC 4HMJA 1IW7D 2NN6I 1BCPF 3NQIA 2DN8A 1Z9FA 2L0CA 5C4HA 5CV6A 1X6OA 2K5VA 1EEID 3OWFA 1SYFA 3T1HL 1PZID 4A3CG 2VUMB 2K33A 3J7AF 1BUVT 1LTRD 4UAIA 4B3RQ 2JA7H 1OTCA 4HIKA 3CQZH 3RN2A 2B39A 4E6IA 4V190 3J7A5 1QUQA 3RZOH 4IFDH 3C1EA 3GTOH 2PQAA 2F0OA 4LUZA 3TZUA 3TN2A 5GROA 3CCRA 3I4NG 2D5DA 1X65A 3HOXH 3GTGB 3Q22A 5GQOA 4HR7B 5C0XG 4FDBA 5C5LA 4GNXB 2KJXA 5CV7A 3Q23A 3TSSA 2PYKA 4R4IA 1RIPA 2NB0A 4B3ML 1CK1A 5FLXE 3H0GH 3KDFA 1XJVA 2XRSD 4K2KA 2QA4A 5A35A 3F2UA 3RUZA 3J7ZC 4IOAA 1KHIA 2EVBA 5IY0A 2OEOA 4A93G 5IODA 3A7LA 2Z4IA 4A3FB 4A3JH 5K36H 4JI3L 1CHQD 2IHEA 3E0EA 3IFDA 1CKMA 1HCZA 4BA2I 2K14A 3AQQA 3AMUA 4J6HA 4DAYA 1TS3A 4BY1H 4DV7L 2A69D 3UI2A 5IT9c 4DR1L 4IJHA 5C0XJ 3HOVB 4OEMB 3GQBA 5DM63 4AIMA 1RF2D 3AEVA 4OWTB 2G9DA 1JB3A 2AQ2B 1K28A 3J80i 5ELBA 2F3IA 4IZ8A 2OQ0A 5KNDA 2N8NA 4U673 3ZYYX 3KF6B 1U4LA 1I6HH 4RG1A 2Q2HA 1QB5D 2XNAC 4A3CH 1E24A 2JYOA 4DAVA 2E5LL 2KCMA 2KCNA 4JYAL 3BVGA 2JJQA 2E2JB 1NCVA 1OO9B 1L0WA 4LF5Q 4YIJA 1EFID 4TKOB 1JB7A 3K81C 2N78A 4P75A 1JWUD 3A0JA 3CXCA 1BOSA 2K04A 1A6XA 2EYJA 2CVRA 3I4NH 3IRBA 1LT6D 2ID0A 4XTCS 3S16B 2PZWA 2KHJA 4KHPL 3U9SA 1HQRD 5C0XH 1A2UA 4A4IA 4C3JB 4IUQA 1Q7YC 1PYWD 1SJED 3KLSA 1WTVA 3PO3G 1Y8NB 2DJGC 5K5PA 2K7VA 2A8VA 2HCIA 3CC4A 1HQMC 3NSWA 2LXKA 1XMQQ 4POGA 1EY4A 3M3YH 1JQYD 1HA6A 1C9OA 3SEBA 3F2DA 1WVLA 1VQ8A 2F0GA 1LUZA 1LTSD 3HOUG 2MQHA 1SNMA 5ELOA 1QVGA 1P8LA 3FEWX 2LS01 2R92G 4DV0L 3QOJA 3M4PA 3W2DA 5CC4A 5JEAG 4MN3A 4EVOA 1TR5A 1EY5A 4F7XA 3CCQA 1VQDA 4FF4A 4HCSA 3BZCA 1PFBA 5IP9G 3K5OA 4R8IA 1HUMA 2KEDA 2VZAA 1YI2A 4XDXA 2GA4B 2N49A 2QF7A 1PTOF 1A63A 3BYTB 1YBYA 3GD7A 3BYYB 4AQYL 4LUVA 3RD4A 3S1MB 1DOMA 1GKHA 5LMNL 1ZXTA 3PSIA 1N33L 1NAPA 2YTXA 3DEPA 3OTOQ 4DK0A 1LACA 5JJZA 4LF6L 1QUQB 4GKJL 1H95A 3G71A 1E0BA 2Q8TA 1OXVA 1BBWA 2PQAB 3MXGA 2E2DC 2EY6A 1I50H 3BDLA 4YHHL 5BR8L 1AE2A 3QJYA 5JEAJ 4HJ7A 1SNCA 1I94Q 2PI2A 3D8GA 1TWAH 3I3CA 1EFWA 1H9JA 5IT9L 3KDFB 1I6VC 4I7ZC 2B2YA 3S14B 4LFCL 2B2TC 4QQBX 3SDZA 4X3UA 5C6AA 2F0UA 2B8GA 4QUFA 1HUNA 5C3EG 1HFNA 1HNXL 3W5OA 3PO3H 2EYPA 3ND9A 3S2DB 2IX0A 4OHJA 1PLFA 2L4NA 1WFQA 2ZM6Q 3PO2B 2UU9L 3SHLA 3HOUH 4DAYB 2O4XA 2KUMA 3OIQA 1H9SA 3R3OA 5JEAH 1BXTA 1DCZA 1VQIA 3MA2B 1PTOD 3K80C 1STEA 3LNNA 2Z8LA 2NWGA 3N6RA 2F0PA 3KBGA 3VDYA 2PO4A 2I07B 1E1TA 2QW7A 3AFPA 2SEBD 4V0BA 1K3BC 1IBLL 2EOTA 1X3FA 1K8AC 4BXXH 4R4OA 3CC7A 2WIIB 2F4VL 3TS2A 5JVH3 1E22A 3KK7A 3BZKA 2RF4A 4NXNL 2XVSA 2WKDA 1K8OA 3SK4A 4JI8Q 2JA7B 2K50A 2UUAQ 1FNWA 3CQZB 5E4XA 3GTQH 2HHHL 3BJUA 2M00A 3CPFA 3RZOB 1MBYA 5KRUA 1EOVA 3GTOB 1KAAA 5EPKA 2PI2E 4JOIC 5DEHA 1STGA 2AUKA 2XTIA 1SYCA 3FPPA 4LF8L 4PNYA 1Q8IA 4F8MA 1E2VA 3LX0A 4IUTA 1CSPA 3UDXA 4YY3L 1Q90A 2BDNA 1VMCA 1VQHA 2Q2IA 4C3IH 2V1CC 2DNCA 2F0WA 1HZBA 1N34Q 1NJIC 4OWXB 2UXBL 3H0GB 3K57A 5IOCA 1O80A 5C3EH 4JW0A 3ITPA 1XMOL 4JI7L 5C0XI
chains in the Genus database with same CATH topology
2MP1A 2LY7A 1B4OA 3DM1A 5ELDA 4L8JA 2B63B 2PW7A 3K0YA 2E74C 3MVVA 1EL0A 3NXWA 4ZK9B 1B9NA 1SYDA 2NTSA 4DGZA 4BY1B 4DFAA 2K28A 3MFYA 5ELFA 4F87A 4K5XA 4IALA 4UDUC 1EY8A 3J80E 3NHHA 4ID6A 4KY7A 4ZRZA 2B2UC 1I6HB 3OPOA 4N9TA 5I9PA 2N88A 2F1MA 4KMUC 4KTAA 2I46A 1LT4D 1WD0A 4L6TB 2FFKB 1V1PA 1L0YB 4XQQA 3ND8A 3I4NB 4F88A 1QNUA 4RHRA 4XT3B 1FYCA 1KTKA 2A69C 2F4IA 4RGMA 1QCBD 2F0LA 5CV8A 5G3LF 4K6LA 4B9XA 2VNUD 1H9SB 5JAVA 3PIP3 2EYHA 1AN8A 5ELCA 5JPNC 1CQVA 1YNJC 1KLGD 2PQEA 1O7ZA 4HEDA 1V43A 1XYIA 3I72A 1LTTD 3QG1A 3K6OA 1CFMA 2BA1A 4PMCA 3O13A 5I2XA 2LKVA 5ISRA 2XWBB 1UEAB 4DNRB 1CI3M 3BZDB 4O1NA 3OHXC 3P1HA 1SNDA 1QOHA 3K58A 2K5WA 2PCFB 4PMWA 2RSNA 1MI2A 1O7LA 2B2VC 2K5QA 4QB4A 1STYA 1H9RA 1STHA 4ODGA 1B9MA 1K8MA 1AEXA 4K6DA 5IGEA 3I70A 1H9KA 4B08A 2B2WA 5A2QE 1TWAB 1CA6A 4XT1B 2D2CC 3J81L 4L63B 3DMUA 1LTGD 3Q6SA 3PO3B 1JC7A 3C46A 1MSHA 2RDGA 3E0JA 2ICEC 2FJ2A 1ONLA 5C3WA 1GHJA 1IYVA 3HOUB 1EU4A 1KLUD 1T5EA 1T5XD 2F03A 2CQAA 1ENCA 1BBXC 1M8AA 5I4DA 1FR3A 3A8JE 4ILWA 4DF7A 3BG3A 3CU7A 3K59A 3D6WA 3D31A 4QCLA 5FOBB 1U9RA 2ICIA 5E4WC 4GZYC 4RGTA 1G2SA 1WTRA 2F3VA 1LLRD 1E2WA 2J0TD 3NBHA 4OO1I 1BR9A 3KBXA 1EY7A 1PXUA 1TT2A 1Y69U 1U4PA 1V1PB 5J22A 4G7OC 4QIWB 4IUPA 2R3ZA 5KIXA 2AQ3B 1SDFA 3GTQB 1F9SA 4ZQ3A 1S4ZA 3TZDA 2F0HA 1TS4A 5FO7B 5LL6S 1VMPA 3VA7A 1DXMA 4C3IB 2XSCA 4FXGC 4IUUA 1GUWA 4S3SA 4BS9A 5IGCA 2O5JC 3MFGA 2Y0SB 5KEEA 1RTNA 3QOLA 3VR4A 1L0XB 1D5ZC 1PTOH 4KK7A 1GUGA 1QG7A 4DA2A 2VB3X 1GUTA 3TP8A 4ULLA 1KDCA 3I90A 1G6ZA 5HURA 4DXGA 1S5DD 2G9HD 3AB9A 2LFNA 1O7YA 1WTQA 3LWUA 4KY5A 2H4OA 5EPJA 5ELEA 2M2LA 4K5VA 4BBSB 3R8BA 1FD7D 3K5MA 3Q0AA 1TKWB 3I4LA 1S5ED 4C1NK 1VF7A 1TWFB 4CKCA 1M4VA 3I4MB 2JE6I 3EJIA 4HTHA 3JAML 5BN5A 1WTWA 3A7AB 4ZUJA 2PZUA 1PZKD 3X3NA 3RZDB 3S2HB 3KUPA 3HZXA 2BCOA 1PDQA 1EY6A 1RCVD 3I8ZA 1MGSA 3K5NA 4G7ZC 1BCPB 2FMCA 5C44B 4KD3A 3CKIB 3MXPA 3WDNA 3NE5B 4ABNA 3MAQA 4Q5VA 1ENFA 2BDOA 2EYFA 1D6EC 1C8CA 4K8IA 3DWAA 4A3GB 1Q3LA 3QB3A 2X69A 3TDQA 2JEAI 4FF3A 2FINB 1YNJD 1GUNA 4G57A 5KNCA 3S1NB 1GXDC 3SR1A 3K7AB 5TSSA 2K5DA 4H44C 2SOBA 2JP1A 1XTCD 3S9WA 2JA5B 1QNKA 2MHVA 3MXNA 2E2IB 2JEBI 1AFPA 5T1GA 2RVLA 2EYOA 4X3SA 1PZJD 1BF4A 4OIKA 2NVTB 4NKLA 3IAYA 1W6KA 2MPMA 3HEJA 1SNQA 4XQJA 4A3EB 1DJRD 4QF4A 4AYBB 5EQ0A 1JOQA 2BOSA 4DU9A 3ONAB 5JPMC 2K6AA 3R2IA 1NUCA 1G91A 1O78A 4FYDA 3NP8A 1F2LA 1RDPD 3L9AX 1SMYC 2MGSA 3OOCA 1SNPA 5EKKA 2O2LD 4A3IB 1AP0A 3EQLC 4A3BB 1B44D 1Y8PB 1MSGA 5KYLA 4ZKCB 2EXZA 2A5HA 1EIGA 4O42A 3S1QB 2WAQB 2PPBC 5DM73 3OIPA 1STAA 3NTIA 4KKSA 1ILQA 2KCCA 4FVMA 5M5WB 1MD2D 1V8QA 4RAUC 1CHPD 3J81E 1EY9A 3TMEA 1U4RA 1CQFA 1FNVA 1PTOB 5EBDA 2QCPX 4CKEA 2B8FA 4HSPA 4OO1G 1EEFD 3PUZA 1SEBD 3C3LA 1EYCA 1A3UA 4TQUS 1PRTB 1SXTA 3NWTA 2KVMA 1UNSA 4BY7B 4NW2A 2IT1A 5CGKA 5FK9C 4FXKC 5AFWA 3D4WA 4KKTA 4KN7C 3HOXB 2F0TA 2M9VA 1JORA 1DOLA 4IN3A 3L7ZC 3M4YA 1WCMB 2SNMA 3LWEA 5COYA 4HSVA 3M4OB 3SK8A 3OMGA 3VR2A 2KA7A 3E6ZX 4HAEA 1TY0A 2F0FA 2VXWA 3FKIB 3MZ5A 1J8IA 2L1BA 2CW0C 4NP5A 5IGDA 4A3JB 3DWQA 3HS0C 1STNA 3GV3A 2YYZA 1NR2A 1IL8A 3DEOA 2A6HC 5JVG3 3R93A 1H9MA 4OO1H 5D3DA 3PMFA 2DNEA 3FMCA 3RLFA 1WTOA 3URYA 1GJXA 3C1FA 3MTSA 4C3HG 2B2WC 2DY7A 4H7BA 1FNUA 1C4QA 1LT3D 3G7LA 3A55A 3BDCA 1ML0D 4JBWA 2RDFA 1AZPA 1EYDA 4LMQD 5E1FA 1KNEA 5J1ZA 1ESFA 3U9OA 1NR4A 4H0LC 1Z47A 2X6LA 3P7JA 3M3YB 4CHTB 3V05A 3FDTA 4RGOS 4A93B 4X3KA 2Z4HA 3E5SA 1A2TA 3PUYA 3JAME 4CBVA 2ZXPA 3EA6A 4NDXA 2OT2A 4G7HC 2EE1A 1I4RA 3EFXD 1HRJA 3SK5A 1XX8A 2K32A 4JK1C 3VYTA 3H09A 3A8IE 1Y1VB 2HDLA 1EIHA 3IFTA 1Z6HA 2E2HB 1TU2B 3G6JB 4CGYB 1I50B 5CBEE 4MIUA 5DAUA 4FXDA 5T1IA 2WB1B 2C9OA 4C56C 1OXSC 3MEHA 3HKZB 3OWEB 4G4KA 4ME5A 1SMYD 1F9QA 4OIJA 1SE3A 2A68C 1SYEA 1TWCB 4CJ2C 1SYBA 4KY6A 2F0MA 3NTHA 3WOEA 1BQQT 2ZT9C 3D4RA 3H94A 5IGGA 3GTKB 1RJTA 3C2PA 2WV6D 3H91A 1TQOA 2Z1CA 2R92B 1HTLD 2F0KA 2AQ1B 3A54A 3QIAA 4WJWA 2PZTA 2RDHA 3A56A 4EQNA 3DHQA 4XYQA 1SAPA 1AZQA 3TP7A 1NSNS 3PUXA 1I4XA 1GHKA 1HHVA 2F0VA 4XQNA 3GP7A 3S1RB 4CKBA 3SK6A 4J1MA 1HPCA 1VF5C 3BVZA 1OXXK 4KD4A 4Z9CB 3NK9A 1B2TA 3NUCA 1EY0A 2EYLA 5M5XB 4LK1C 1EQTA 3VYRA 2KECA 1W6JA 4M1UB 3FPUB 4FF2A 2WP8J 3P20A 4KI0A 1D5MC 1II3A 1ENAA 4IUVA 2QILA 5C3EB 5IT9E 1EZ6A 1R4QB 1JICA 5IGBA 3S17B 1F9RA 1B50A 5KGUA 1LTID 5M3MB 3MHBA 1IKLA 2VB2X 1TWGB 5IGFA 3NTKA 2TSSA 1BO0A 5EKIA 1PRTC 4IFDJ 4KHZA 2CW0D 2L5TA 3OW7A 1TS5A 1D1KA 1Q1BA 4A3DB 4QUCA 3J80L 3J7AV 1FGBD 1DM0B 1ET9A 4WFN3 2NVQB 3MWYW 4EQOA 1G291 2AUJD 2A6HD 2RBMA 1E2ZA 1D2BA 1OXUA 2K03A 4HCEA 1TVXA 3HOZB 1D1IA 3M7NA 4ZYSA 2JSOA 4TRDA 1SE4A 3CRLC 2EJFC 1JWSD 1ZEQX 4WORA 1GUOA 1JR0D 4QMGA 4XYOA 1EU3A 1SBBB 3W3AA 1IHZA 3KF8A 3HGBA 1D5XC 4P2CB 2R6GA 3N52A 3VR5A 3GTMB 5CV9A 1ZYRC 1QWYA 5EJWA 2QEJC 5KNBA 2IX3A 1K83B 3FRPB 3L3OC 4DXFA 4KJNA 1J9OA 2NBFA 1IKMA 2EDGA 1S5FD 1TWHB 4MHEA 1BCPD 1RD9D 2WINB 5C5MA 1YNND 1F2MA 5M9OA 5CORA 3GTLB 1CT1D 2B2YC 4C3HB 5EBCA 3VR3A 4RKLA 4DNTB 3R2TA 3DXJC 2BE5C 1HXYD 4BWGB 2F0SA 3K5LA 5A2QL 3NBIA 1DONA 2EY1A 3MC0B 2R93B 5FO9B 1BDOA 1A3TA 3M7GA 1STBA 1DD2A 4HN7A 3BDOA 1C48A 2H1EA 3T16A 3OMCA 1U4MA 3CRKC 1KNAA 4DN4M 2A68D 3RMHA 2N55A 1V1OA 3OSOA 1DZ1A 1SNOA 1TIID 4RHSA 4EGVA 2PNRC 4PQXA 2K05A 1LT5D 1XXGA 2A73B 4WRDA 3CHBD 2XWJB 1ZKOA 1ICWA 1SSOA 3T13A 4HMIA 2DY8A 3PUWA 1LTAD 4K5WA 2V4DA 3DUZA 2EJMA 1SYGA 2KEEA 4KJOA 2F0IA 2L12A 5C3XA 1CA5A 1EWCA 3DWPA 2WACA 2FMMA 1IYUA 1EQVA 1BNZA 1PRTF 2ENBA 3H6MA 2O5IC 2F0JA 1X32A 5C4XB 1RTOA 2HQEA 1I4PA 4PMBA 1KDBA 1G8ZD 1ILPA 2QDBA 1EZ8A 1B1ZA 4R8NA 3X3MA 4C3IG 4IFDI 4Q0FA 4NMZA 2KQ3A 5D65A 1A3VA 1PFNA 1ET6A 1RKNA 1GOZA 4KN4C 2HCCA 5HGTA 3VYUA 2L9HA 3T53B 5CYUA 4RWSC 1CTMA 2F0QA 4Y7NB 2EYMA 1GUSA 1Z7TA 5CV5A 5BN3A 1B53A 1HFGA 1LO5D 4FNFA 3NQTA 5EGTA 5F2DA 4K14A 1PRTD 1R4PB 2D9UA 3I91A 1DYQA 4IURA 1X3QA 3GTPB 5CBAE 4OGQC 5DNFA 1CZGA 2A6EC 1PFMA 4XXEA 2ZXRA 5JOBA 4J8QA 2MJ8A 1G2TA 2K01A 5FLXL 2E75C 2K1BA 1SE2A 2D62A 2IL8A 3GTJB 1B3AA 2IPKD 4K8JA 3PIO3 3AU7A 2JXMB 2RSOA 1WTPA 1SJHD 4CJ1B 2JA8B 2X6GA 2MUYA 3WOFA 3S15B 4KV6A 4IUNA 1IW7C 2IW3A 5EPLA 4RCOA 1I4GA 3EVQA 3IL8A 2B2TA 4BBRB 3PUVA 2NN6G 2ZXOA 2TMPA 5M3FB 1LV9A 2FHTA 1WTXA 1F2ZA 2WKCA 5I6WA 5I9OA 5M5YB 2EPBA 1ZYRD 1EOTA 2RA4A 2EY5A 4U68A 2RQXA 4DAPA 2NZ1D 2AWNA 4TSSA 4R9WA 3MXUA 4RKBA 1LABA 3V96A 1I3QB 5D3IB 1A15A 2XN9C 3NPPA 4C2MB 2F0DA 1S5CD 2NUCA 3NWSA 3T51B 2R7ZB 3TP6A 4N9PA 5CMDA 4DK1A 3V2TA 2JA6B 2XRQD 1TY2A 4RFBA 5C4JB 3VR6A 3IKJA 4RCNA 2YU9B 4C3JG 1F2YA 2BE5D 1RHPA 1X3PA 3TBIB 1BCPC 1LTBD 2OXPA 5NUCA 2SNSA 3TP5A 1YNNC 4H13C 4BA1I 1CM9A 5LL6X 3FVQA 4C1NI 2AWOA 3QO2A 3HP3A 3QWNA 2F0EA 1HA5A 3SVMA 4M8AA 2A74C 5BN4A 2E76C 4LAAA 2NN6H 1AW7A 2F0NA 1XWEA 3D6CA 1JOOA 1EWHA 3T56B 1JCKB 2NVYB 3P75A 3HG9A 1WD1A 1TS2A 1VCIA 2NVXB 4KHVA 2LMCB 3GV6A 5D14A 3HOWB 1RODA 2XIWA 2Q8RE 2HDMA 1SFOB 5C4ZA 3BVMA 3D3RA 3VA5A 1UUPA 2PW5A 2OF1A 2IJ0A 1HTPA 3D4DA 5KYIA 1ESRA 2B2UA 4LJZC 2L11A 5LHY1 1Y8OB 3KLRA 4FF1A 1OXTA 4PV1C 5IIFA 5G3LD 3ERQA 1DOKA 5FKAC 1JOKA 3HRZC 4I65A 2L55A 1F77A 1KDAA 3HOYB 1Q12A 4XIGS 1JWMD 5E3FA 1Y1WB 2CHBD 4EQPA 3A8KE 4K2LA 2KHSA 4A3KB 4CJ0B 4RA8A 2NTTA 4B9WA 4KKUA 2EJGC 4RGNA 2IX1A 4X3TA 2PMZB 4ZUIA 4ZKBB 3M85A 2HUGA 3J7YW 3I73A 2EY2A 3VYSA 2SDFA 3T4AC 4ZAIA 3SXHA 2C5CA 1EYAA 2RKSA 3EROA 2NYZD 1S5BD 1R9TB 1QE6A 2R61A 1UAPA 4IFDG 5CV4A 5I6YA 1VDZA 3SE0A 4A3MB 5EKLA 4OL7A 4FO2A 2B2VA 5CR3A 4ZLTF 4RH6A 2BA0A 2KOLA 1I4QA 1PTOC 3BS1A 3H3VC 5J39A 4FP5D 1QJOA 5FO8B 1QILA 2F3WA 2A6ED 5I2YA 1KABA 3Q24A 2IWHA 1F9PA 2J4XA 3PV0A 4IQZA 5K36G 1I4HA 1Q1EA 1PMRA 3KLSX 1JE4A 3GO5A 2Q8IB 2EZVA 2J7ZA 1CZWA 2QKIC 4HMJA 1IW7D 2NN6I 1BCPF 3NQIA 2DN8A 2L0CA 5C4HA 5CV6A 1EEID 3OWFA 1SYFA 1PZID 2VUMB 2K33A 3J7AF 1BUVT 1LTRD 4UAIA 4V190 2B39A 4E6IA 4IFDH 3C1EA 2F0OA 3TZUA 3TN2A 2D5DA 3GTGB 3Q22A 4HR7B 5C0XG 5C5LA 2KJXA 5CV7A 3Q23A 3TSSA 2PYKA 2NB0A 1CK1A 5FLXE 2XRSD 4K2KA 5A35A 3F2UA 3RUZA 2EVBA 2OEOA 5IODA 3A7LA 2Z4IA 4A3FB 5K36H 1CHQD 3IFDA 1HCZA 4BA2I 3AMUA 4J6HA 4DAYA 1TS3A 2A69D 3UI2A 5C0XJ 3HOVB 5DM63 3GQBA 1RF2D 2G9DA 1JB3A 2AQ2B 5ELBA 4IZ8A 5KNDA 4U673 3ZYYX 1U4LA 1QB5D 2XNAC 2JYOA 4DAVA 2KCNA 3BVGA 2E2JB 1NCVA 1OO9B 4YIJA 1EFID 4TKOB 1JWUD 1BOSA 2K04A 1A6XA 2EYJA 2CVRA 1LT6D 2ID0A 4XTCS 3S16B 2PZWA 3U9SA 1HQRD 5C0XH 1A2UA 4C3JB 4IUQA 1PYWD 1SJED 3KLSA 1WTVA 1Y8NB 5K5PA 2K7VA 2HCIA 1HQMC 3NSWA 1EY4A 1HA6A 1JQYD 3SEBA 1WVLA 2F0GA 1LTSD 1SNMA 3FEWX 2LS01 3QOJA 3W2DA 5CC4A 5JEAG 4MN3A 4EVOA 1TR5A 1EY5A 4F7XA 4FF4A 4HCSA 1PFBA 3K5OA 4R8IA 1HUMA 2KEDA 4XDXA 2GA4B 2QF7A 1PTOF 3BYTB 3GD7A 3BYYB 3RD4A 3S1MB 1DOMA 1ZXTA 1NAPA 3DEPA 4DK0A 1LACA 5JJZA 1E0BA 2Q8TA 1OXVA 3MXGA 2E2DC 2EY6A 3BDLA 3QJYA 5JEAJ 1SNCA 3D8GA 3I3CA 1H9JA 5IT9L 1I6VC 4I7ZC 2B2YA 3S14B 2B2TC 3SDZA 4X3UA 5C6AA 2F0UA 2B8GA 4QUFA 1HUNA 1HFNA 2EYPA 3ND9A 3S2DB 2IX0A 4OHJA 1PLFA 2L4NA 3PO2B 3SHLA 2O4XA 2KUMA 3OIQA 1H9SA 3R3OA 5JEAH 1BXTA 1DCZA 3MA2B 1PTOD 1STEA 3LNNA 2Z8LA 2NWGA 3N6RA 2F0PA 3KBGA 2PO4A 2I07B 2SEBD 4V0BA 2EOTA 2WIIB 5JVH3 3KK7A 2XVSA 2WKDA 1K8OA 3SK4A 2JA7B 1FNWA 3CQZB 5E4XA 2M00A 3RZOB 1MBYA 5KRUA 3GTOB 1KAAA 5EPKA 5DEHA 1STGA 2AUKA 1SYCA 3FPPA 4PNYA 1Q8IA 4F8MA 1E2VA 3LX0A 4IUTA 1Q90A 2BDNA 1VMCA 2DNCA 2F0WA 3H0GB 3K57A 5IOCA 1O80A 3ITPA 5C0XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9W A;  2X6L A;  2HCC A;  2MP1 A;  1SDF A;  3P7J A;  1WTW A;  2K03 A;  1B4O A;  1F9S A;  1G91 A;  1SAP A;  3DM1 A;  1TVX A;  1JE4 A;  3I3C A;  1AZQ A;  1F2L A;  2L9H A;  3FDT A;  4X3K A;  1HHV A;  4RWS C;  2H1E A;  1U4L A;  3KUP A;  1S4Z A;  1DOL A;  2B2Y A;  1A15 A;  1DOK A;  1PDQ A;  1U4M A;  2B2T C;  3TZD A;  1EL0 A;  3I8Z A;  1KNA A;  1MGS A;  4X3U A;  2JYO A;  3LWE A;  5COY A;  2MGS A;  1VMP A;  2J7Z A;  4HSV A;  4QUF A;  4ZK9 B;  1HUN A;  2RSN A;  1HFN A;  4IUU A;  4DN4 M;  1GUW A;  1AP0 A;  1MI2 A;  2B2V C;  1NCV A;  1B53 A;  2N55 A;  1HFG A;  1DZ1 A;  1MSG A;  1PLF A;  5CMD A;  2K28 A;  4ZKC B;  2L4N A;  2EE1 A;  2K04 A;  4HAE A;  1RTN A;  2CVR A;  1C8C A;  2VXW A;  2K05 A;  2B2W A;  1J8I A;  1EIG A;  2D9U A;  2L1B A;  3I91 A;  4IUR A;  4O42 A;  4XT1 B;  1RHP A;  1CA6 A;  1HRJ A;  2KUM A;  1IKM A;  1X3Q A;  1Q3L A;  4CJ0 B;  4RA8 A;  1ICW A;  1SSO A;  1X3P A;  2X69 A;  1EQT A;  1XX8 A;  3N52 A;  2KEC A;  2B2U C;  5CBA E;  1QG7 A;  2DY8 A;  3FPU B;  4IUQ A;  2FIN B;  2N88 A;  3GV3 A;  4UAI A;  5DNF A;  2HDL A;  1PFM A;  5EJW A;  1WTV A;  2NWG A;  1NR2 A;  1IL8 A;  3DEO A;  1CM9 A;  2MJ8 A;  3I90 A;  1EIH A;  1G2T A;  1G6Z A;  2HCI A;  1ILQ A;  2K01 A;  3Q6S A;  4X3T A;  2KEE A;  2K1B A;  3QO2 A;  1J9O A;  3HP3 A;  5CBE E;  1HA6 A;  4IUV A;  3R93 A;  1WD0 A;  2IL8 A;  1MSH A;  2JP1 A;  3TN2 A;  2FFK B;  4RAU C;  1B3A A;  4ZKB B;  2L12 A;  3SVM A;  5T1I A;  1WVL A;  1CA5 A;  1O7Y A;  1QNK A;  1JIC A;  2EOT A;  2HUG A;  2FJ2 A;  1WTQ A;  2RSO A;  1WTP A;  5EPJ A;  1U4R A;  4MHE A;  4CJ1 B;  1F9R A;  1WTO A;  4MN3 A;  2FMM A;  2X6G A;  5T1G A;  1B50 A;  2SDF A;  1F9Q A;  1BNZ A;  4ZAI A;  4HCS A;  2M2L A;  2RVL A;  4OIJ A;  1PFB A;  4XT3 B;  4X3S A;  4R8I A;  1BBX C;  1HUM A;  3MTS A;  1M8A A;  2KED A;  1X32 A;  1WD1 A;  5EPL A;  3F2U A;  1IKL A;  2NYZ D;  3IL8 A;  2B2W C;  1RTO A;  2DY7 A;  4XDX A;  1QE6 A;  4CJ2 C;  3GV6 A;  5COR A;  2B2T A;  5E4X A;  1BF4 A;  3D6W A;  4OIK A;  2B2Y C;  3G7L A;  5D14 A;  1ILP A;  5E4W C;  1ROD A;  2XIW A;  1ML0 D;  1DOM A;  2HDM A;  1BO0 A;  2Q8R E;  5EKI A;  5EPK A;  1ZXT A;  2MPM A;  1LV9 A;  1G2S A;  2B2V A;  4ZLT F;  1NAP A;  1WTR A;  1AZP A;  1RJT A;  2FHT A;  1WTX A;  2KOL A;  4IUT A;  3DEP A;  4LMQ D;  3H91 A;  3IFD A;  4QUC A;  2BDN A;  1VMC A;  3KBX A;  5EQ0 A;  5JJZ A;  1E0B A;  1KNE A;  2Q8T A;  2KVM A;  5D65 A;  1B2T A;  1DON A;  2EPB A;  3ONA B;  1EOT A;  1O7Z A;  1PFN A;  1U4P A;  2RA4 A;  4HED A;  4NW2 A;  3UI2 A;  1O80 A;  4U68 A;  3MWY W;  2NZ1 D;  5AFW A;  1ESR A;  1NR4 A;  1XYI A;  4IUP A;  2R3Z A;  2B2U A;  2L11 A;  1F9P A; 
#chains in the Genus database with same CATH topology
 2MP1 A;  2LY7 A;  1IBM Q;  1B4O A;  3DM1 A;  5ELD A;  4L8J A;  3K8A A;  2B63 B;  2PW7 A;  3K0Y A;  3M9B A;  2E74 C;  3ZJY C;  5AJ3 L;  1O7I A;  3MVV A;  1EL0 A;  4IPC A;  3NXW A;  4ZK9 B;  1B3Q A;  2Z6K C;  1B9N A;  1SYD A;  2NTS A;  4DGZ A;  4BY1 B;  4DFA A;  2K75 A;  4YWM A;  4YWK A;  3J81 c;  2K28 A;  2EXD A;  3MFY A;  5ELF A;  4F87 A;  2Q2T A;  4K5X A;  4IAL A;  4UDU C;  1EY8 A;  3J80 E;  3NHH A;  4DV1 Q;  4LFB Q;  4ID6 A;  4KY7 A;  4MTK A;  4ZRZ A;  2B2U C;  1I6H B;  3OPO A;  4DV2 L;  4N9T A;  5I9P A;  2N88 A;  4X62 Q;  1YEZ A;  2F1M A;  4KMU C;  4KTA A;  2I46 A;  1LT4 D;  3NEL A;  1WD0 A;  4L6T B;  2FFK B;  2NZO A;  1V1P A;  1CUK A;  3T1Y L;  1L0Y B;  4XQQ A;  3ND8 A;  3I4N B;  1TWF H;  4F88 A;  2R93 G;  3I4M H;  1QNU A;  4RHR A;  4XT3 B;  1HNW Q;  2Q2U A;  1FYC A;  1KTK A;  2A69 C;  2F4I A;  4RGM A;  1QCB D;  2F0L A;  1NMG A;  5CV8 A;  5G3L F;  1HZC A;  1EQR A;  4K6L A;  2K5N A;  4B9X A;  4POF A;  5GAH C;  4LF7 L;  2VNU D;  4A3E G;  1H9S B;  3RZD H;  5JAV A;  3PIP 3;  2EYH A;  1AN8 A;  3I55 A;  4DK3 C;  5ELC A;  5JPN C;  1CQV A;  2CFM A;  1YNJ C;  4JI0 Q;  1KLG D;  1JT8 A;  2NZH A;  2PQE A;  4UP7 A;  4DR4 Q;  1O7Z A;  4JVZ A;  4HED A;  1V43 A;  4LF4 Q;  1XYI A;  3I72 A;  1LTT D;  3QG1 A;  3K6O A;  1CFM A;  1UE1 A;  4DV3 L;  2BA1 A;  4PMC A;  3O13 A;  1NTG A;  1N36 L;  5I2X A;  2GVA A;  2LKV A;  1VQ9 A;  3QR8 A;  5ISR A;  2XWB B;  1UEA B;  4DNR B;  1KAW A;  2PMZ E;  4ME3 A;  1CI3 M;  3BZD B;  4O1N A;  3E9H A;  3OHX C;  3P1H A;  4A3I G;  1SND A;  1QOH A;  4A3B G;  3K58 A;  2K5W A;  3S1N H;  2PCF B;  4PMW A;  2RSN A;  3K7A H;  1MI2 A;  1O7L A;  2B2V C;  1D8L A;  2K5Q A;  1HZ9 A;  4QB4 A;  2ZJR A;  1STY A;  1H9R A;  1STH A;  1JJ2 A;  4ODG A;  1B9M A;  4OX9 Q;  3TRZ A;  3ULP A;  3NEM A;  1K8M A;  1AEX A;  4K6D A;  5IGE A;  3I70 A;  4UY8 C;  1H9K A;  4B08 A;  1WYD A;  2B2W A;  1PH1 A;  5A2Q E;  1TWA B;  1CA6 A;  2UUB L;  4XT1 B;  5JJL A;  4X66 Q;  2D2C C;  3J81 L;  1SLJ A;  4DV5 Q;  1Q8K A;  4L63 B;  3DMU A;  4JI4 Q;  4GNX A;  3STB C;  4X65 L;  2UXD L;  1LTG D;  3Q6S A;  2NVT H;  3PO3 B;  1JC7 A;  3C46 A;  1MSH A;  4R4Q A;  1VQE A;  3KFU A;  2RDG A;  3E0J A;  1MHW C;  2ICE C;  1PH3 A;  2FJ2 A;  1ONL A;  5C3W A;  4A3E H;  1GHJ A;  1IYV A;  4R1J A;  1EIF A;  3HOU B;  1EU4 A;  2Y0S E;  1KLU D;  1T5E A;  1T5X D;  2F03 A;  4J15 A;  2CQA A;  1YVC A;  1ENC A;  1BBX C;  3UDI A;  1M8A A;  5I4D A;  3KYH C;  1FR3 A;  4DUY L;  3A8J E;  4ILW A;  4DF7 A;  3BG3 A;  3CU7 A;  3K59 A;  2VW9 A;  1JJC B;  3D6W A;  3D31 A;  4QCL A;  5FOB B;  1U9R A;  2ICI A;  5E4W C;  2ZTE A;  4GZY C;  1VQG A;  4LF9 L;  4RGT A;  1G2S A;  1WTR A;  2F3V A;  2EIF A;  1J5E L;  1JMC A;  1LLR D;  1E2W A;  3DM3 A;  2J0T D;  2PNH A;  3NBH A;  4NPS A;  4OO1 I;  1BR9 A;  3KBX A;  4R4T A;  1EY7 A;  1PXU A;  3JAM c;  1GD7 A;  1TT2 A;  4A3I H;  1Y69 U;  5GAD C;  4A3B H;  1U4P A;  1V1P B;  5J22 A;  4G7O C;  4MTN A;  4QIW B;  4X64 Q;  1KRS A;  4IUP A;  2R3Z A;  5KIX A;  2K5H A;  4B3T L;  2AQ3 B;  1SDF A;  4O0A A;  3GTQ B;  2QGQ A;  1F9S A;  3S1Q H;  4ZQ3 A;  2QDL A;  1WCM G;  1HR0 L;  1S4Z A;  5ELN A;  3RR5 A;  3TZD A;  2F0H A;  1TS4 A;  5FO7 B;  5LL6 S;  4DR6 L;  1VMP A;  1QZH A;  3VA7 A;  1XNR L;  1DXM A;  4IPG A;  4C3I B;  2XSC A;  4FXG C;  4IUU A;  1FJG Q;  1GUW A;  4S3S A;  4BS9 A;  5IGC A;  3J81 i;  5M5W H;  4GN4 B;  2O5J C;  3FKI G;  1PH5 A;  3MFG A;  2Y0S B;  5KEE A;  1RTN A;  3QOL A;  4AH6 A;  3VR4 A;  1L0X B;  1D5Z C;  1PTO H;  4YCU A;  4KK7 A;  3H3V H;  5DLQ E;  1GUG A;  1QG7 A;  4DA2 A;  1LTL A;  2VB3 X;  1GUT A;  3TP8 A;  3CCV A;  4ULL A;  1XTD A;  1KDC A;  3I90 A;  3TQY A;  4OWW B;  5HUR A;  1G6Z A;  4DXG A;  5M3F G;  1S5D D;  2G9H D;  5LMU L;  2UXC Q;  1CKN A;  3AB9 A;  2LFN A;  3I2Z A;  1O7Y A;  1WTQ A;  3K7U C;  3LWU A;  4KY5 A;  2H4O A;  5EPJ A;  4DR5 L;  5ELE A;  1SR3 A;  4BY7 H;  2OQK A;  4JG2 A;  2M2L A;  1SRU A;  4JI5 L;  2F52 A;  1VQM A;  4K5V A;  4CDF C;  4BBS B;  4DUZ L;  2ZTD A;  3R8B A;  1FD7 D;  3ULL A;  3K5M A;  3Q0A A;  1WTH A;  2BH8 A;  1MJE A;  1TKW B;  5FLM G;  3I4L A;  1S5E D;  4C1N K;  1HNZ L;  1Q46 A;  2Z6B A;  1VF7 A;  1WCM H;  2R7Z G;  3M4O H;  1TWF B;  4CKC A;  1VQB A;  1M4V A;  3I4M B;  1IZ6 A;  2JE6 I;  4DV4 L;  4DR7 Q;  1FGU A;  3EJI A;  4QJF A;  1C0A A;  4HTH A;  3JAM L;  5BN5 A;  1WTW A;  3A7A B;  3FKI H;  4ZUJ A;  2PZU A;  1PZK D;  1IBK Q;  3X3N A;  2VY3 A;  4DR2 L;  3RZD B;  1C7Y A;  3S2H B;  1NMF A;  3UDF A;  3KUP A;  3HZX A;  2BCO A;  1PDQ A;  1EY6 A;  1RCV D;  3I8Z A;  1MGS A;  3K5N A;  4G7Z C;  1BCP B;  2FMC A;  1PYS B;  5C44 B;  4KD3 A;  3CKI B;  3MXP A;  4HID A;  1B8A A;  4AYB E;  3WDN A;  2KEN A;  5JJI A;  1YIT A;  3NE5 B;  4ABN A;  3MAQ A;  4Q5V A;  1ENF A;  2A19 A;  2BDO A;  1PA6 A;  1X3G A;  2EYF A;  1D6E C;  3NBH B;  1C8C A;  4K8I A;  3E3X A;  1PFS A;  3DWA A;  4A3G B;  3DLL A;  1Q3L A;  1Y1V G;  3QB3 A;  1JE5 A;  2X69 A;  1K0S A;  3TDQ A;  2JEA I;  4DV6 Q;  2BH2 A;  4FF3 A;  2FIN B;  1YNJ D;  4MZ9 A;  1UE5 A;  1GUN A;  4G57 A;  5IYC G;  5KNC A;  3HOW G;  3S1N B;  1U0L A;  4GOP C;  1ICF B;  1GXD C;  1VQJ A;  3K7A B;  3SR1 A;  2WB1 G;  5TSS A;  2K5D A;  4H44 C;  3HKZ G;  2SOB A;  2JP1 A;  1XTC D;  3S9W A;  2JA5 B;  1QNK A;  4NXM Q;  1X9N A;  1S72 A;  2MHV A;  1Q81 C;  3MXN A;  3W1B A;  4C2M H;  4K0K Q;  1PH7 A;  2E2I B;  2JEB I;  5FLM H;  1AFP A;  5T1G A;  2RVL A;  3CPW A;  2EYO A;  4X3S A;  2WAQ E;  1PZJ D;  2CCZ A;  1BF4 A;  4OIK A;  4B3R L;  3CCE A;  2NVT B;  4NKL A;  3IAY A;  4A93 H;  4GN3 B;  1W6K A;  2DUD A;  2MPM A;  3HEJ A;  1SNQ A;  4XQJ A;  4A3E B;  1DJR D;  4QF4 A;  4AYB B;  3JAM i;  2HD3 A;  5EQ0 A;  1JOQ A;  2B29 A;  2BOS A;  1NY4 A;  4DU9 A;  3ONA B;  4DPG A;  1CKN B;  5JPM C;  2K6A A;  3AFQ A;  1TXY A;  3STB D;  3R2I A;  5H1S E;  1XNQ Q;  1G51 A;  4A3K G;  3H3V I;  1NUC A;  1G91 A;  1O78 A;  4FYD A;  3NP8 A;  1VS0 A;  1F2L A;  1RDP D;  3L9A X;  1SMY C;  5FLX c;  2VQF Q;  1Y1V H;  1YNX A;  4IJL A;  2MGS A;  3OOC A;  2NVX H;  4YWL A;  1SNP A;  3J81 j;  5EKK A;  2E2H H;  1PYB A;  2O2L D;  3CP0 A;  4A3I B;  1AP0 A;  3EQL C;  5IYC H;  4A3B B;  1B44 D;  1Y8P B;  1MSG A;  2CKZ B;  5KYL A;  4ZKC B;  1CKO A;  2EXZ A;  3TS0 A;  4YCV A;  2A5H A;  1EIG A;  4LWC A;  4O42 A;  4LFA Q;  3S1Q B;  2WAQ B;  2PPB C;  5DM7 3;  3OIP A;  1GVP A;  1STA A;  2DJF C;  1TWC H;  3NTI A;  4KKS A;  1ILQ A;  2KCC A;  1YJW A;  3U58 A;  1L2F A;  4FVM A;  5M5W B;  1MD2 D;  1V8Q A;  4RAU C;  1CHP D;  5L37 A;  2MO0 A;  1EY9 A;  3J81 E;  3GTK H;  1Q86 C;  4LF5 L;  3TME A;  1U4R A;  5M3M G;  1CQF A;  2YTV A;  2R92 H;  1FNV A;  1PTO B;  3EBE A;  3EN2 A;  2LSS A;  2QCP X;  5EBD A;  5IP9 H;  3PIO A;  4CKE A;  3F2C A;  2B8F A;  4HSP A;  1N32 Q;  4OO1 G;  3KOJ A;  1EEF D;  1ASZ A;  1VQ4 A;  3PUZ A;  1SEB D;  4I7A A;  4A3D G;  3C3L A;  3E9I A;  1EYC A;  1A3U A;  4TQU S;  1U5K A;  1AH9 A;  1XMQ L;  1PRT B;  3S1R H;  3ER0 A;  1SXT A;  4UP8 A;  1VQP A;  3NWT A;  1YHA A;  2KVM A;  1UNS A;  4BY7 B;  4NW2 A;  2IT1 A;  5CGK A;  5FK9 C;  1VQC A;  4FXK C;  2I5L X;  5AFW A;  3MXN B;  3U50 C;  3D4W A;  4GKK Q;  3HOZ G;  4KKT A;  1SE8 A;  4TVA B;  4KN7 C;  1B70 B;  2VUM G;  1X3E A;  1JJG A;  5M5X H;  3HOX B;  1RL2 A;  2F0T A;  2M9V A;  1JOR A;  1J6Q A;  1DOL A;  4IN3 A;  3L7Z C;  3M4Y A;  1WCM B;  2SNM A;  3LWE A;  5COY A;  4GLV B;  1QVF A;  4HSV A;  3M4O B;  3SK8 A;  4DAM A;  3OMG A;  5LMN W;  1ASY A;  3OTO L;  3UE0 A;  3VR2 A;  2KA7 A;  3E6Z X;  4HAE A;  1TY0 A;  3RN5 A;  2F0F A;  2VXW A;  4GLA C;  3S17 H;  3FKI B;  3MZ5 A;  1J8I A;  2L1B A;  2CW0 C;  4NP5 A;  5IGD A;  4A3J B;  3DWQ A;  3HS0 C;  4IPD A;  2P5Z X;  1I94 L;  3B6Y A;  5M3M H;  3UDG A;  1STN A;  4HIM A;  3GV3 A;  1LM0 A;  2YYZ A;  1NR2 A;  1TWG H;  1IL8 A;  3DEO A;  5HY6 A;  4A3F G;  2A6H C;  4QY7 A;  5JVG 3;  1YHB A;  3R93 A;  1H9M A;  4OO1 H;  2UUC Q;  5D3D A;  2KBN A;  1MJC A;  3PMF A;  4HJ8 A;  2DNE A;  3MEF A;  4A3D H;  1PVO A;  5IWA Q;  3FMC A;  3RLF A;  1WTO A;  3URY A;  1GJX A;  3C1F A;  2ZM6 L;  3MTS A;  2NVQ H;  4OEL B;  4C3H G;  2B2W C;  2DY7 A;  2VQE Q;  4H7B A;  1FNU A;  1C4Q A;  3CD6 A;  1LT3 D;  3G7L A;  1VQA A;  2VL6 A;  3A55 A;  3HOZ H;  1EUJ A;  3BDC A;  1ML0 D;  4JV5 Q;  4JBW A;  2RDF A;  1AZP A;  4GNX C;  1EYD A;  1VQK A;  2MO1 A;  4LMQ D;  2A1A A;  2MNA A;  5E1F A;  3HKZ E;  1KNE A;  1BBU A;  3CMA A;  5J1Z A;  1ESF A;  2ASB A;  3U9O A;  1NR4 A;  4H0L C;  1Z47 A;  4KLK A;  2X6L A;  3P7J A;  3M3Y B;  4CHT B;  4JI8 L;  3V05 A;  3FDT A;  4RGO S;  4A93 B;  4X3K A;  2Z4H A;  2UUA L;  3E5S A;  3CCL A;  3GTM H;  2I5M X;  4B3S Q;  1A2T A;  3PUY A;  1K83 H;  3JAM E;  4CBV A;  1L1O A;  2ZXP A;  3EA6 A;  4NDX A;  2OT2 A;  1UWV A;  4CDE C;  3F1Z A;  1N34 L;  4G7H C;  1VQ5 A;  2EE1 A;  1I4R A;  1TWH H;  1YIJ A;  2KHI A;  2CH4 A;  2IHF A;  3EFX D;  1HRJ A;  1WOC A;  3SK5 A;  1XX8 A;  1YHQ A;  2K32 A;  4JK1 C;  3VYT A;  3H09 A;  1IBM L;  3A8I E;  1Y1V B;  2HDL A;  4CDC C;  1EIH A;  3IFT A;  4JI6 Q;  1Z6H A;  3GTL H;  2E2H B;  1TU2 B;  3G6J B;  4CGY B;  1I50 B;  4C3H H;  5CBE E;  4MIU A;  5DAU A;  3G48 A;  4PG3 A;  5T1I A;  3G4S A;  4FXD A;  2WB1 B;  2C9O A;  4C56 C;  3EIV A;  1OXS C;  3MEH A;  3HKZ B;  4QIW E;  3OWE B;  4G4K A;  4JI1 Q;  4ME5 A;  1SMY D;  1F9Q A;  5C4X G;  4OIJ A;  1YZ6 A;  2E2J H;  2R93 H;  1SE3 A;  2A68 C;  1SYE A;  1TWC B;  4DV1 L;  4CJ2 C;  4LFB L;  2JK8 A;  1SYB A;  4KY6 A;  4DR3 Q;  2F0M A;  4X62 L;  3J80 c;  3NTH A;  3WOE A;  1BQQ T;  2ZT9 C;  3D4R A;  3H94 A;  3M4Q A;  5IGG A;  1RJT A;  3I56 A;  3GTK B;  3C2P A;  2WV6 D;  3H91 A;  1TQO A;  2Z1C A;  2R92 B;  2E8G A;  1HTL D;  2D0O A;  2F0K A;  2AQ1 B;  3A54 A;  3QIA A;  4WJW A;  2KCT A;  2PZT A;  2RDH A;  3A56 A;  4L5R C;  3PO2 G;  4HJA A;  4HJ9 A;  3T1H Q;  4EQN A;  4L5S A;  3DHQ A;  1HNW L;  2RHS B;  4XYQ A;  1SAP A;  1AZQ A;  3TP7 A;  1NSN S;  3PUX A;  1I4X A;  1GHK A;  1HHV A;  2R7D A;  1IXR A;  4WJ4 A;  2F0V A;  2RCF A;  4XQN A;  3GP7 A;  4HJ5 A;  3S1R B;  1QZG A;  4CKB A;  3SK6 A;  3CCJ A;  4J1M A;  1HPC A;  1EWI A;  1VF5 C;  3LGJ A;  3BVZ A;  1OXX K;  2ZTC A;  4JI0 L;  2JQO A;  4KD4 A;  4Z9C B;  4DR4 L;  2CWA A;  4B3M Q;  3NK9 A;  3RLN A;  4LF4 L;  5HGQ A;  1B2T A;  3NUC A;  1EY0 A;  2EYL A;  5M5X B;  4LK1 C;  3NEN A;  1EQT A;  3VYR A;  2JA9 A;  2KEC A;  1W6J A;  4M1U B;  3FPU B;  4FF2 A;  3CCM A;  5C4X H;  2WP8 J;  3P20 A;  4KI0 A;  1X54 A;  1M1K C;  1D5M C;  4PZ8 A;  1II3 A;  4JI3 Q;  1ENA A;  1MKH A;  4IUV A;  2QIL A;  5C3E B;  5IT9 E;  3G6E A;  1EZ6 A;  4DNI A;  1R4Q B;  1BVS A;  1JIC A;  2JA8 G;  4H02 A;  4DV7 Q;  5IGB A;  1GM5 A;  3S17 B;  4DR1 Q;  4OX9 L;  1L1O B;  1F9R A;  4OON A;  3H0G G;  3KJP A;  4L5T A;  1B50 A;  4JBK A;  2GN5 A;  5KGU A;  1LTI D;  5M3M B;  3MHB A;  4BBR G;  4X66 L;  3OW2 A;  1IKL A;  2VB2 X;  1TWG B;  5IGF A;  1A0I A;  2B63 G;  4DV5 L;  3PO2 H;  2Z0S A;  3NTK A;  4JI4 L;  2TSS A;  1V1Q A;  1BO0 A;  5EKI A;  2E5L Q;  1PRT C;  4IFD J;  4KHZ A;  4JYA Q;  3I7F A;  4Y7N H;  2CW0 D;  2L5T A;  2D0P A;  3OW7 A;  1TS5 A;  1D1K A;  1Q1B A;  1UEB A;  4A3D B;  1AE3 A;  3UE1 A;  4QUC A;  3J80 L;  3J7A V;  1FGB D;  1DM0 B;  1W2B A;  1ET9 A;  4WFN 3;  2HT1 A;  2NVQ B;  3MWY W;  4EQO A;  1G29 1;  2AUJ D;  2A6H D;  4KHP Q;  2RBM A;  1E2Z A;  1D2B A;  1OXU A;  2K03 A;  4HCE A;  4CDD C;  1TVX A;  3HOZ B;  1D1I A;  1B7Y B;  3M7N A;  3GTP H;  1FVI A;  3PF4 A;  4ZYS A;  3PCO B;  2JSO A;  4TRD A;  1SE4 A;  3CRL C;  2EJF C;  3CCS A;  1JWS D;  2JA6 G;  3U4V A;  1ZEQ X;  4WOR A;  3GTJ H;  4DV0 Q;  1GUO A;  1JR0 D;  4QMG A;  4XYO A;  1EU3 A;  4UP9 A;  1KL9 A;  2GVB A;  1SBB B;  3W3A A;  1IHZ A;  4X64 L;  2JA8 H;  3KF8 A;  3HGB A;  1D5X C;  3S15 H;  4P2C B;  1D7Q A;  2R6G A;  3N52 A;  1G6P A;  3VR5 A;  4AQY Q;  3GTM B;  5CV9 A;  1ZYR C;  1QWY A;  5EJW A;  2QEJ C;  5KNB A;  2IX3 A;  5LMN Q;  1K83 B;  3FRP B;  3L3O C;  4BBR H;  1N33 Q;  4DXF A;  1HR0 W;  4KJN A;  1J9O A;  2NBF A;  5J3B A;  2B63 H;  5M3F H;  1IKM A;  2EDG A;  4LF6 Q;  1E1O A;  1S5F D;  4OXP A;  3CF5 A;  4GKJ Q;  1FJG L;  1PH2 A;  1SRO A;  1TWH B;  1NNX A;  4YHH Q;  4MHE A;  4GS3 A;  5BR8 Q;  2VS1 A;  3D0F A;  1KIX A;  5M5Y H;  4PZ7 A;  1BCP D;  1RD9 D;  1A8V A;  2WIN B;  5C5M A;  1YNN D;  1F2M A;  1SMX A;  1Y14 B;  5M9O A;  3L2P A;  5COR A;  3GTL B;  1CT1 D;  3ERS X;  2B2Y C;  4LFC Q;  4C3H B;  5EBC A;  3VR3 A;  1I3Q H;  4RKL A;  4DKA C;  4DNT B;  4QL5 A;  3R2T A;  3DXJ C;  2BE5 C;  1HXY D;  2ZJQ A;  4BWG B;  1HNX Q;  3TRE A;  2UXC L;  2F0S A;  2ATW A;  2C35 B;  3K5L A;  2ES2 A;  5A2Q L;  3W1G A;  2R7Z H;  3NBI A;  1DON A;  2EY1 A;  3MC0 B;  5IYB G;  2R93 B;  1X55 A;  5FO9 B;  2UU9 Q;  1BDO A;  1A3T A;  4LW1 A;  2JA6 H;  3M7G A;  1STB A;  5C4J H;  1DD2 A;  4HN7 A;  2YU9 H;  3BDO A;  1C48 A;  1M90 C;  4DK6 C;  2H1E A;  1VQ7 A;  2AMC B;  3T16 A;  3OMC A;  1U4M A;  3CRK C;  1KNA A;  3HOY G;  2Z9H A;  1IBL Q;  4DN4 M;  2A68 D;  3RMH A;  3PGZ A;  2N55 A;  1V1O A;  2HQL A;  3OSO A;  1Y1W G;  1DZ1 A;  2F4V Q;  3A5Z B;  1SNO A;  1TII D;  4RHS A;  4EGV A;  1S40 A;  4NXN Q;  2PNR C;  4PQX A;  2K05 A;  1LT5 D;  1XXG A;  2A73 B;  1W3S A;  4WRD A;  4IO9 A;  3CHB D;  4DR7 L;  2XWJ B;  2YTY A;  1ZKO A;  1ICW A;  1SSO A;  3T13 A;  3CCU A;  4HMI A;  2OWO A;  2NVY H;  2DY8 A;  2HHH Q;  3PUW A;  1LTA D;  4K5W A;  1IBK L;  2V4D A;  3DUZ A;  2EJM A;  1A62 A;  1K0R A;  4LF8 Q;  1SYG A;  2KEE A;  3HOW H;  4KJO A;  2F0I A;  4BXX G;  1SFO H;  2L12 A;  5C3X A;  4YY3 Q;  1CA5 A;  1BKB A;  1EWC A;  2UXB Q;  3DWP A;  2WAC A;  4NB3 A;  4A3L G;  2FMM A;  1IYU A;  4UPA A;  1VQL A;  1EQV A;  1XMO Q;  1BNZ A;  4GN5 A;  1PRT F;  4JI7 Q;  2ENB A;  3H6M A;  2O5I C;  2F0J A;  1P16 A;  1N9W A;  1X32 A;  3A5U A;  3KJO A;  5C4X B;  1E3P A;  1RTO A;  2HQE A;  5IYB H;  4A3M G;  1I4P A;  2RCN A;  4DV6 L;  1VQO A;  3KF8 B;  4PMB A;  1KDB A;  3Q8D A;  1G8Z D;  5AJ3 Q;  1ILP A;  1SN8 A;  2QDB A;  3GDE A;  4EX5 A;  5JJK A;  1EZ8 A;  2H5X A;  4GOP A;  1B1Z A;  4R8N A;  2CQO A;  3X3M A;  4JCV E;  5E7N A;  4C3I G;  4HIO A;  4IFD I;  4APV A;  1HZA A;  4Q0F A;  4NMZ A;  4NXM L;  4IOC A;  1NE3 A;  2KQ3 A;  5D65 A;  4IPH A;  4WJ3 M;  1A3V A;  1PFN A;  3HOY H;  4K0K L;  1ET6 A;  1E7Z A;  2Y0S G;  1RKN A;  1K3R A;  4Y52 H;  2JN4 A;  1S3O A;  1NBW A;  1GOZ A;  1Y1W H;  4KN4 C;  2HCC A;  4ALP A;  5HGT A;  3VYU A;  4JBM A;  4DV2 Q;  4A3K H;  3U4Z A;  1N8R C;  2L9H A;  3T53 B;  5CYU A;  4RWS C;  1CTM A;  2F0Q A;  4Y7N B;  1KQS A;  2EYM A;  3I4O A;  1GUS A;  1Z7T A;  5CV5 A;  1PH6 A;  5BN3 A;  3T1Y Q;  1B53 A;  1HFG A;  2OCE A;  1LO5 D;  4FNF A;  1PH8 A;  3NQT A;  5EGT A;  5F2D A;  2CH4 W;  4K14 A;  1PRT D;  1R4P B;  2D9U A;  3I91 A;  1DYQ A;  4IUR A;  1MIU A;  1XNQ L;  1X3Q A;  2HIX A;  1HH2 P;  3GTP B;  4LNQ A;  1K73 C;  4LF7 Q;  5CBA E;  4BBS G;  4A3L H;  1LYL A;  4OGQ C;  5DNF A;  1CZG A;  2A6E C;  1PFM A;  4XXE A;  1R9T H;  2ZXR A;  4JC0 A;  5JOB A;  4J8Q A;  2MJ8 A;  1G2T A;  3RNU A;  2K01 A;  2VQF L;  1UE6 A;  5FLX L;  3H15 A;  2E75 C;  2K1B A;  2OTL A;  1SE2 A;  1QVC A;  2D62 A;  2RHQ B;  4A3M H;  2IL8 A;  3GTJ B;  1B3A A;  2IPK D;  4K8J A;  4JPB W;  3PIO 3;  3AU7 A;  2JXM B;  2RSO A;  1L1O C;  1WTP A;  3I4M G;  1SJH D;  4CJ1 B;  5FJ8 G;  2JA8 B;  2X6G A;  2MUY A;  3WOF A;  4A75 A;  3S15 B;  4KV6 A;  4IUN A;  4P71 A;  4DV3 Q;  1IL2 A;  4LFA L;  1IW7 C;  1N36 Q;  2IW3 A;  5EPL A;  4RCO A;  1I4G A;  3EVQ A;  3IL8 A;  3FHW A;  2B2T A;  1V9P A;  4BBR B;  2ALY B;  1XPR A;  3K0X A;  3PUV A;  2NN6 G;  2ZXO A;  1XPO A;  2TMP A;  5M3F B;  1LV9 A;  3PF5 A;  2FHT A;  5C44 G;  1WTX A;  4JBJ A;  1F2Z A;  2WKC A;  2YV5 A;  1VQN A;  4P74 A;  4R4C A;  5I6W A;  2IY5 B;  5I9O A;  3HOV G;  1CSQ A;  3CC2 A;  2MFI A;  5M5Y B;  2EPB A;  1ZYR D;  1EOT A;  2RA4 A;  1FL0 A;  2EY5 A;  4U68 A;  2RQX A;  4DAP A;  2EQS A;  2NZ1 D;  2AWN A;  4TSS A;  2UUB Q;  3PIP A;  4R9W A;  3ULJ A;  2I0Q A;  4A3G G;  3MXU A;  2R7F A;  4RKB A;  1LAB A;  4P73 A;  4ZCK A;  3V96 A;  1N32 L;  1I3Q B;  5IYD G;  2VUM H;  4X65 Q;  2UXD Q;  5D3I B;  1A15 A;  2XN9 C;  3NPP A;  4C2M B;  4JI2 Q;  2WB1 E;  2F0D A;  5IP7 G;  1PHJ A;  1GO3 E;  1S5C D;  4BBS H;  2NUC A;  3NWS A;  3T51 B;  2R7Z B;  3JC6 6;  1WI5 A;  3TP6 A;  2JA5 G;  4N9P A;  4GOP B;  3GTG H;  5CMD A;  4DK1 A;  3V2T A;  2JA6 B;  2XRQ D;  1TY2 A;  4RFB A;  5C4J B;  3VR6 A;  4PZ6 A;  3IKJ A;  1HJP A;  4RCN A;  2YU9 B;  4DUY Q;  4C3J G;  1F2Y A;  2B3G A;  2BE5 D;  1RHP A;  2FXQ A;  5GAG C;  4GLX A;  4GKK L;  1X3P A;  2L15 A;  5EAY A;  5FJ8 H;  3TBI B;  1BCP C;  1LTB D;  1EIY B;  2OXP A;  1IYJ B;  5NUC A;  2AHO B;  2SNS A;  4JOI A;  3TP5 A;  1YJ9 A;  1PH4 A;  1EYG A;  1KXL A;  1YNN C;  4H13 C;  4BA1 I;  1CM9 A;  5LL6 X;  4LF9 Q;  3FVQ A;  2N3S A;  4C1N I;  2AWO A;  3S24 A;  3QO2 A;  3HP3 A;  1J5E Q;  4A3F H;  2LXJ A;  4X6A H;  3QWN A;  2F0E A;  1HA5 A;  3SVM A;  4M8A A;  2A74 C;  4AYB G;  5BN4 A;  3CME A;  2E76 C;  2I5H A;  4LAA A;  2K4K A;  3S2H H;  2OTJ A;  2NN6 H;  1AW7 A;  2F0N A;  1XWE A;  2G5D A;  3D6C A;  1JOO A;  1EWH A;  5C44 H;  3HFZ B;  3T56 B;  1Q82 C;  1JCK B;  4B3T Q;  2NVY B;  3P75 A;  3HG9 A;  3HOV H;  1VQ6 A;  1WD1 A;  1TS2 A;  1VCI A;  2NVX B;  4KHV A;  2LMC B;  3GV6 A;  1HR0 Q;  5D14 A;  4QGU A;  4O2D A;  3HOW B;  3OYY A;  1ROD A;  3F8T A;  1PH9 A;  2Z6K A;  2XIW A;  2Q8R E;  2HDM A;  4DR6 Q;  4A3G H;  1SFO B;  1XNR Q;  5C4Z A;  3BVM A;  3D3R A;  5IYD H;  3PQI A;  2UUC L;  2QEX A;  3VA5 A;  1WJJ A;  1UUP A;  2PW5 A;  2OF1 A;  5IP7 H;  2IJ0 A;  1HTP A;  3D4D A;  5KYI A;  5IWA L;  1ESR A;  2B2U A;  2JA5 H;  4LJZ C;  2L11 A;  5LHY 1;  1Y8O B;  2WAQ G;  3KLR A;  1KD1 C;  4FF1 A;  1XPU A;  2XGT A;  2E2I H;  3S16 H;  1OXT A;  2VQE L;  4PV1 C;  5IIF A;  1UE7 A;  4C3J H;  5G3L D;  3ERQ A;  1DOK A;  1VQF A;  5FKA C;  5LMU Q;  4JV5 L;  1JOK A;  3HRZ C;  4YCW A;  4I65 A;  3AYH B;  2L55 A;  1F77 A;  4A76 A;  1YJN A;  1KDA A;  3HOY B;  4JI2 L;  4LUO A;  3CAM A;  1Q12 A;  4XIG S;  1JWM D;  4DR5 Q;  3HKS A;  5E3F A;  1Y1W B;  2CHB D;  3CW2 C;  4EQP A;  3A74 A;  3A8K E;  4N8X 1;  4K2L A;  2KHS A;  4A3K B;  4JI5 Q;  3RLO A;  3ICE A;  2WFW A;  4CJ0 B;  4RA8 A;  2NTT A;  4DUZ Q;  3F2B A;  2ZJP A;  3BU2 A;  4B9W A;  4KKU A;  1T9H A;  4L5Q A;  1DGS A;  2EJG C;  4RGN A;  2IX1 A;  4B3S L;  3L0O A;  4X3T A;  4RMF A;  2PMZ B;  1HNZ Q;  2K52 A;  3S1M H;  4ZUI A;  4ZKB B;  1K9M C;  3M85 A;  2HUG A;  3J7Y W;  3I73 A;  2EY2 A;  4P72 A;  3VYS A;  4BY7 G;  1I5F A;  4DV4 Q;  1EQQ A;  2SDF A;  3T4A C;  3FP9 A;  1PV4 A;  4ZAI A;  1X56 A;  2HIV A;  3SXH A;  2JA7 G;  2C5C A;  1EYA A;  2RKS A;  3ERO A;  3KF6 A;  2NYZ D;  4N8F A;  1S5B D;  1R9T B;  1QE6 A;  2R61 A;  1UAP A;  4IFD G;  5CV4 A;  5I6Y A;  4DR2 Q;  1VDZ A;  3HOX G;  3SGI A;  3SE0 A;  4MNO A;  3WWV A;  4A3M B;  5EKL A;  4OL7 A;  4JI6 L;  1KRT A;  4FO2 A;  5GAE C;  2B2V A;  5CR3 A;  4ZLT F;  4RH6 A;  3S14 H;  5IE8 A;  2BA0 A;  2KOL A;  2CWP A;  1I4Q A;  1PTO C;  3BS1 A;  3H3V C;  5J39 A;  4FP5 D;  1QJO A;  5FO8 B;  1QIL A;  2F3W A;  2A6E D;  2DGY A;  4JI1 L;  2AKW B;  3S2D H;  5I2Y A;  1KAB A;  3Q24 A;  2IWH A;  3TEH B;  1F9P A;  2J4X A;  4A3J G;  3PV0 A;  4IQZ A;  4UHV A;  5K36 G;  1I4H A;  1Q1E A;  1PMR A;  4EQ5 A;  3KLS X;  1JE4 A;  3GO5 A;  2Q8I B;  1KC8 C;  2EZV A;  4DR3 L;  1K8G A;  4BY1 G;  2J7Z A;  3KLW A;  1CZW A;  2QKI C;  4HMJ A;  1IW7 D;  2NN6 I;  1BCP F;  3NQI A;  2DN8 A;  1Z9F A;  2L0C A;  5C4H A;  5CV6 A;  1X6O A;  2K5V A;  1EEI D;  3OWF A;  1SYF A;  3T1H L;  1PZI D;  4A3C G;  2VUM B;  2K33 A;  3J7A F;  1BUV T;  1LTR D;  4UAI A;  4B3R Q;  2JA7 H;  1OTC A;  4HIK A;  3CQZ H;  3RN2 A;  2B39 A;  4E6I A;  4V19 0;  3J7A 5;  1QUQ A;  3RZO H;  4IFD H;  3C1E A;  3GTO H;  2PQA A;  2F0O A;  4LUZ A;  3TZU A;  3TN2 A;  5GRO A;  3CCR A;  3I4N G;  2D5D A;  1X65 A;  3HOX H;  3GTG B;  3Q22 A;  5GQO A;  4HR7 B;  5C0X G;  4FDB A;  5C5L A;  4GNX B;  2KJX A;  5CV7 A;  3Q23 A;  3TSS A;  2PYK A;  4R4I A;  1RIP A;  2NB0 A;  4B3M L;  1CK1 A;  5FLX E;  3H0G H;  3KDF A;  1XJV A;  2XRS D;  4K2K A;  2QA4 A;  5A35 A;  3F2U A;  3RUZ A;  3J7Z C;  4IOA A;  1KHI A;  2EVB A;  5IY0 A;  2OEO A;  4A93 G;  5IOD A;  3A7L A;  2Z4I A;  4A3F B;  4A3J H;  5K36 H;  4JI3 L;  1CHQ D;  2IHE A;  3E0E A;  3IFD A;  1CKM A;  1HCZ A;  4BA2 I;  2K14 A;  3AQQ A;  3AMU A;  4J6H A;  4DAY A;  1TS3 A;  4BY1 H;  4DV7 L;  2A69 D;  3UI2 A;  5IT9 c;  4DR1 L;  4IJH A;  5C0X J;  3HOV B;  4OEM B;  3GQB A;  5DM6 3;  4AIM A;  1RF2 D;  3AEV A;  4OWT B;  2G9D A;  1JB3 A;  2AQ2 B;  1K28 A;  3J80 i;  5ELB A;  2F3I A;  4IZ8 A;  2OQ0 A;  5KND A;  2N8N A;  4U67 3;  3ZYY X;  3KF6 B;  1U4L A;  1I6H H;  4RG1 A;  2Q2H A;  1QB5 D;  2XNA C;  4A3C H;  1E24 A;  2JYO A;  4DAV A;  2E5L L;  2KCM A;  2KCN A;  4JYA L;  3BVG A;  2JJQ A;  2E2J B;  1NCV A;  1OO9 B;  1L0W A;  4LF5 Q;  4YIJ A;  1EFI D;  4TKO B;  1JB7 A;  3K81 C;  2N78 A;  4P75 A;  1JWU D;  3A0J A;  3CXC A;  1BOS A;  2K04 A;  1A6X A;  2EYJ A;  2CVR A;  3I4N H;  3IRB A;  1LT6 D;  2ID0 A;  4XTC S;  3S16 B;  2PZW A;  2KHJ A;  4KHP L;  3U9S A;  1HQR D;  5C0X H;  1A2U A;  4A4I A;  4C3J B;  4IUQ A;  1Q7Y C;  1PYW D;  1SJE D;  3KLS A;  1WTV A;  3PO3 G;  1Y8N B;  2DJG C;  5K5P A;  2K7V A;  2A8V A;  2HCI A;  3CC4 A;  1HQM C;  3NSW A;  2LXK A;  1XMQ Q;  4POG A;  1EY4 A;  3M3Y H;  1JQY D;  1HA6 A;  1C9O A;  3SEB A;  3F2D A;  1WVL A;  1VQ8 A;  2F0G A;  1LUZ A;  1LTS D;  3HOU G;  2MQH A;  1SNM A;  5ELO A;  1QVG A;  1P8L A;  3FEW X;  2LS0 1;  2R92 G;  4DV0 L;  3QOJ A;  3M4P A;  3W2D A;  5CC4 A;  5JEA G;  4MN3 A;  4EVO A;  1TR5 A;  1EY5 A;  4F7X A;  3CCQ A;  1VQD A;  4FF4 A;  4HCS A;  3BZC A;  1PFB A;  5IP9 G;  3K5O A;  4R8I A;  1HUM A;  2KED A;  2VZA A;  1YI2 A;  4XDX A;  2GA4 B;  2N49 A;  2QF7 A;  1PTO F;  1A63 A;  3BYT B;  1YBY A;  3GD7 A;  3BYY B;  4AQY L;  4LUV A;  3RD4 A;  3S1M B;  1DOM A;  1GKH A;  5LMN L;  1ZXT A;  3PSI A;  1N33 L;  1NAP A;  2YTX A;  3DEP A;  3OTO Q;  4DK0 A;  1LAC A;  5JJZ A;  4LF6 L;  1QUQ B;  4GKJ L;  1H95 A;  3G71 A;  1E0B A;  2Q8T A;  1OXV A;  1BBW A;  2PQA B;  3MXG A;  2E2D C;  2EY6 A;  1I50 H;  3BDL A;  4YHH L;  5BR8 L;  1AE2 A;  3QJY A;  5JEA J;  4HJ7 A;  1SNC A;  1I94 Q;  2PI2 A;  3D8G A;  1TWA H;  3I3C A;  1EFW A;  1H9J A;  5IT9 L;  3KDF B;  1I6V C;  4I7Z C;  2B2Y A;  3S14 B;  4LFC L;  2B2T C;  4QQB X;  3SDZ A;  4X3U A;  5C6A A;  2F0U A;  2B8G A;  4QUF A;  1HUN A;  5C3E G;  1HFN A;  1HNX L;  3W5O A;  3PO3 H;  2EYP A;  3ND9 A;  3S2D B;  2IX0 A;  4OHJ A;  1PLF A;  2L4N A;  1WFQ A;  2ZM6 Q;  3PO2 B;  2UU9 L;  3SHL A;  3HOU H;  4DAY B;  2O4X A;  2KUM A;  3OIQ A;  1H9S A;  3R3O A;  5JEA H;  1BXT A;  1DCZ A;  1VQI A;  3MA2 B;  1PTO D;  3K80 C;  1STE A;  3LNN A;  2Z8L A;  2NWG A;  3N6R A;  2F0P A;  3KBG A;  3VDY A;  2PO4 A;  2I07 B;  1E1T A;  2QW7 A;  3AFP A;  2SEB D;  4V0B A;  1K3B C;  1IBL L;  2EOT A;  1X3F A;  1K8A C;  4BXX H;  4R4O A;  3CC7 A;  2WII B;  2F4V L;  3TS2 A;  5JVH 3;  1E22 A;  3KK7 A;  3BZK A;  2RF4 A;  4NXN L;  2XVS A;  2WKD A;  1K8O A;  3SK4 A;  4JI8 Q;  2JA7 B;  2K50 A;  2UUA Q;  1FNW A;  3CQZ B;  5E4X A;  3GTQ H;  2HHH L;  3BJU A;  2M00 A;  3CPF A;  3RZO B;  1MBY A;  5KRU A;  1EOV A;  3GTO B;  1KAA A;  5EPK A;  2PI2 E;  4JOI C;  5DEH A;  1STG A;  2AUK A;  2XTI A;  1SYC A;  3FPP A;  4LF8 L;  4PNY A;  1Q8I A;  4F8M A;  1E2V A;  3LX0 A;  4IUT A;  1CSP A;  3UDX A;  4YY3 L;  1Q90 A;  2BDN A;  1VMC A;  1VQH A;  2Q2I A;  4C3I H;  2V1C C;  2DNC A;  2F0W A;  1HZB A;  1N34 Q;  1NJI C;  4OWX B;  2UXB L;  3H0G B;  3K57 A;  5IOC A;  1O80 A;  5C3E H;  4JW0 A;  3ITP A;  1XMO L;  4JI7 L;  5C0X I; 
#chains in the Genus database with same CATH homology
 2MP1 A;  2LY7 A;  1B4O A;  3DM1 A;  5ELD A;  4L8J A;  2B63 B;  2PW7 A;  3K0Y A;  2E74 C;  3MVV A;  1EL0 A;  3NXW A;  4ZK9 B;  1B9N A;  1SYD A;  2NTS A;  4DGZ A;  4BY1 B;  4DFA A;  2K28 A;  3MFY A;  5ELF A;  4F87 A;  4K5X A;  4IAL A;  4UDU C;  1EY8 A;  3J80 E;  3NHH A;  4ID6 A;  4KY7 A;  4ZRZ A;  2B2U C;  1I6H B;  3OPO A;  4N9T A;  5I9P A;  2N88 A;  2F1M A;  4KMU C;  4KTA A;  2I46 A;  1LT4 D;  1WD0 A;  4L6T B;  2FFK B;  1V1P A;  1L0Y B;  4XQQ A;  3ND8 A;  3I4N B;  4F88 A;  1QNU A;  4RHR A;  4XT3 B;  1FYC A;  1KTK A;  2A69 C;  2F4I A;  4RGM A;  1QCB D;  2F0L A;  5CV8 A;  5G3L F;  4K6L A;  4B9X A;  2VNU D;  1H9S B;  5JAV A;  3PIP 3;  2EYH A;  1AN8 A;  5ELC A;  5JPN C;  1CQV A;  1YNJ C;  1KLG D;  2PQE A;  1O7Z A;  4HED A;  1V43 A;  1XYI A;  3I72 A;  1LTT D;  3QG1 A;  3K6O A;  1CFM A;  2BA1 A;  4PMC A;  3O13 A;  5I2X A;  2LKV A;  5ISR A;  2XWB B;  1UEA B;  4DNR B;  1CI3 M;  3BZD B;  4O1N A;  3OHX C;  3P1H A;  1SND A;  1QOH A;  3K58 A;  2K5W A;  2PCF B;  4PMW A;  2RSN A;  1MI2 A;  1O7L A;  2B2V C;  2K5Q A;  4QB4 A;  1STY A;  1H9R A;  1STH A;  4ODG A;  1B9M A;  1K8M A;  1AEX A;  4K6D A;  5IGE A;  3I70 A;  1H9K A;  4B08 A;  2B2W A;  5A2Q E;  1TWA B;  1CA6 A;  4XT1 B;  2D2C C;  3J81 L;  4L63 B;  3DMU A;  1LTG D;  3Q6S A;  3PO3 B;  1JC7 A;  3C46 A;  1MSH A;  2RDG A;  3E0J A;  2ICE C;  2FJ2 A;  1ONL A;  5C3W A;  1GHJ A;  1IYV A;  3HOU B;  1EU4 A;  1KLU D;  1T5E A;  1T5X D;  2F03 A;  2CQA A;  1ENC A;  1BBX C;  1M8A A;  5I4D A;  1FR3 A;  3A8J E;  4ILW A;  4DF7 A;  3BG3 A;  3CU7 A;  3K59 A;  3D6W A;  3D31 A;  4QCL A;  5FOB B;  1U9R A;  2ICI A;  5E4W C;  4GZY C;  4RGT A;  1G2S A;  1WTR A;  2F3V A;  1LLR D;  1E2W A;  2J0T D;  3NBH A;  4OO1 I;  1BR9 A;  3KBX A;  1EY7 A;  1PXU A;  1TT2 A;  1Y69 U;  1U4P A;  1V1P B;  5J22 A;  4G7O C;  4QIW B;  4IUP A;  2R3Z A;  5KIX A;  2AQ3 B;  1SDF A;  3GTQ B;  1F9S A;  4ZQ3 A;  1S4Z A;  3TZD A;  2F0H A;  1TS4 A;  5FO7 B;  5LL6 S;  1VMP A;  3VA7 A;  1DXM A;  4C3I B;  2XSC A;  4FXG C;  4IUU A;  1GUW A;  4S3S A;  4BS9 A;  5IGC A;  2O5J C;  3MFG A;  2Y0S B;  5KEE A;  1RTN A;  3QOL A;  3VR4 A;  1L0X B;  1D5Z C;  1PTO H;  4KK7 A;  1GUG A;  1QG7 A;  4DA2 A;  2VB3 X;  1GUT A;  3TP8 A;  4ULL A;  1KDC A;  3I90 A;  1G6Z A;  5HUR A;  4DXG A;  1S5D D;  2G9H D;  3AB9 A;  2LFN A;  1O7Y A;  1WTQ A;  3LWU A;  4KY5 A;  2H4O A;  5EPJ A;  5ELE A;  2M2L A;  4K5V A;  4BBS B;  3R8B A;  1FD7 D;  3K5M A;  3Q0A A;  1TKW B;  3I4L A;  1S5E D;  4C1N K;  1VF7 A;  1TWF B;  4CKC A;  1M4V A;  3I4M B;  2JE6 I;  3EJI A;  4HTH A;  3JAM L;  5BN5 A;  1WTW A;  3A7A B;  4ZUJ A;  2PZU A;  1PZK D;  3X3N A;  3RZD B;  3S2H B;  3KUP A;  3HZX A;  2BCO A;  1PDQ A;  1EY6 A;  1RCV D;  3I8Z A;  1MGS A;  3K5N A;  4G7Z C;  1BCP B;  2FMC A;  5C44 B;  4KD3 A;  3CKI B;  3MXP A;  3WDN A;  3NE5 B;  4ABN A;  3MAQ A;  4Q5V A;  1ENF A;  2BDO A;  2EYF A;  1D6E C;  1C8C A;  4K8I A;  3DWA A;  4A3G B;  1Q3L A;  3QB3 A;  2X69 A;  3TDQ A;  2JEA I;  4FF3 A;  2FIN B;  1YNJ D;  1GUN A;  4G57 A;  5KNC A;  3S1N B;  1GXD C;  3SR1 A;  3K7A B;  5TSS A;  2K5D A;  4H44 C;  2SOB A;  2JP1 A;  1XTC D;  3S9W A;  2JA5 B;  1QNK A;  2MHV A;  3MXN A;  2E2I B;  2JEB I;  1AFP A;  5T1G A;  2RVL A;  2EYO A;  4X3S A;  1PZJ D;  1BF4 A;  4OIK A;  2NVT B;  4NKL A;  3IAY A;  1W6K A;  2MPM A;  3HEJ A;  1SNQ A;  4XQJ A;  4A3E B;  1DJR D;  4QF4 A;  4AYB B;  5EQ0 A;  1JOQ A;  2BOS A;  4DU9 A;  3ONA B;  5JPM C;  2K6A A;  3R2I A;  1NUC A;  1G91 A;  1O78 A;  4FYD A;  3NP8 A;  1F2L A;  1RDP D;  3L9A X;  1SMY C;  2MGS A;  3OOC A;  1SNP A;  5EKK A;  2O2L D;  4A3I B;  1AP0 A;  3EQL C;  4A3B B;  1B44 D;  1Y8P B;  1MSG A;  5KYL A;  4ZKC B;  2EXZ A;  2A5H A;  1EIG A;  4O42 A;  3S1Q B;  2WAQ B;  2PPB C;  5DM7 3;  3OIP A;  1STA A;  3NTI A;  4KKS A;  1ILQ A;  2KCC A;  4FVM A;  5M5W B;  1MD2 D;  1V8Q A;  4RAU C;  1CHP D;  3J81 E;  1EY9 A;  3TME A;  1U4R A;  1CQF A;  1FNV A;  1PTO B;  5EBD A;  2QCP X;  4CKE A;  2B8F A;  4HSP A;  4OO1 G;  1EEF D;  3PUZ A;  1SEB D;  3C3L A;  1EYC A;  1A3U A;  4TQU S;  1PRT B;  1SXT A;  3NWT A;  2KVM A;  1UNS A;  4BY7 B;  4NW2 A;  2IT1 A;  5CGK A;  5FK9 C;  4FXK C;  5AFW A;  3D4W A;  4KKT A;  4KN7 C;  3HOX B;  2F0T A;  2M9V A;  1JOR A;  1DOL A;  4IN3 A;  3L7Z C;  3M4Y A;  1WCM B;  2SNM A;  3LWE A;  5COY A;  4HSV A;  3M4O B;  3SK8 A;  3OMG A;  3VR2 A;  2KA7 A;  3E6Z X;  4HAE A;  1TY0 A;  2F0F A;  2VXW A;  3FKI B;  3MZ5 A;  1J8I A;  2L1B A;  2CW0 C;  4NP5 A;  5IGD A;  4A3J B;  3DWQ A;  3HS0 C;  1STN A;  3GV3 A;  2YYZ A;  1NR2 A;  1IL8 A;  3DEO A;  2A6H C;  5JVG 3;  3R93 A;  1H9M A;  4OO1 H;  5D3D A;  3PMF A;  2DNE A;  3FMC A;  3RLF A;  1WTO A;  3URY A;  1GJX A;  3C1F A;  3MTS A;  4C3H G;  2B2W C;  2DY7 A;  4H7B A;  1FNU A;  1C4Q A;  1LT3 D;  3G7L A;  3A55 A;  3BDC A;  1ML0 D;  4JBW A;  2RDF A;  1AZP A;  1EYD A;  4LMQ D;  5E1F A;  1KNE A;  5J1Z A;  1ESF A;  3U9O A;  1NR4 A;  4H0L C;  1Z47 A;  2X6L A;  3P7J A;  3M3Y B;  4CHT B;  3V05 A;  3FDT A;  4RGO S;  4A93 B;  4X3K A;  2Z4H A;  3E5S A;  1A2T A;  3PUY A;  3JAM E;  4CBV A;  2ZXP A;  3EA6 A;  4NDX A;  2OT2 A;  4G7H C;  2EE1 A;  1I4R A;  3EFX D;  1HRJ A;  3SK5 A;  1XX8 A;  2K32 A;  4JK1 C;  3VYT A;  3H09 A;  3A8I E;  1Y1V B;  2HDL A;  1EIH A;  3IFT A;  1Z6H A;  2E2H B;  1TU2 B;  3G6J B;  4CGY B;  1I50 B;  5CBE E;  4MIU A;  5DAU A;  4FXD A;  5T1I A;  2WB1 B;  2C9O A;  4C56 C;  1OXS C;  3MEH A;  3HKZ B;  3OWE B;  4G4K A;  4ME5 A;  1SMY D;  1F9Q A;  4OIJ A;  1SE3 A;  2A68 C;  1SYE A;  1TWC B;  4CJ2 C;  1SYB A;  4KY6 A;  2F0M A;  3NTH A;  3WOE A;  1BQQ T;  2ZT9 C;  3D4R A;  3H94 A;  5IGG A;  3GTK B;  1RJT A;  3C2P A;  2WV6 D;  3H91 A;  1TQO A;  2Z1C A;  2R92 B;  1HTL D;  2F0K A;  2AQ1 B;  3A54 A;  3QIA A;  4WJW A;  2PZT A;  2RDH A;  3A56 A;  4EQN A;  3DHQ A;  4XYQ A;  1SAP A;  1AZQ A;  3TP7 A;  1NSN S;  3PUX A;  1I4X A;  1GHK A;  1HHV A;  2F0V A;  4XQN A;  3GP7 A;  3S1R B;  4CKB A;  3SK6 A;  4J1M A;  1HPC A;  1VF5 C;  3BVZ A;  1OXX K;  4KD4 A;  4Z9C B;  3NK9 A;  1B2T A;  3NUC A;  1EY0 A;  2EYL A;  5M5X B;  4LK1 C;  1EQT A;  3VYR A;  2KEC A;  1W6J A;  4M1U B;  3FPU B;  4FF2 A;  2WP8 J;  3P20 A;  4KI0 A;  1D5M C;  1II3 A;  1ENA A;  4IUV A;  2QIL A;  5C3E B;  5IT9 E;  1EZ6 A;  1R4Q B;  1JIC A;  5IGB A;  3S17 B;  1F9R A;  1B50 A;  5KGU A;  1LTI D;  5M3M B;  3MHB A;  1IKL A;  2VB2 X;  1TWG B;  5IGF A;  3NTK A;  2TSS A;  1BO0 A;  5EKI A;  1PRT C;  4IFD J;  4KHZ A;  2CW0 D;  2L5T A;  3OW7 A;  1TS5 A;  1D1K A;  1Q1B A;  4A3D B;  4QUC A;  3J80 L;  3J7A V;  1FGB D;  1DM0 B;  1ET9 A;  4WFN 3;  2NVQ B;  3MWY W;  4EQO A;  1G29 1;  2AUJ D;  2A6H D;  2RBM A;  1E2Z A;  1D2B A;  1OXU A;  2K03 A;  4HCE A;  1TVX A;  3HOZ B;  1D1I A;  3M7N A;  4ZYS A;  2JSO A;  4TRD A;  1SE4 A;  3CRL C;  2EJF C;  1JWS D;  1ZEQ X;  4WOR A;  1GUO A;  1JR0 D;  4QMG A;  4XYO A;  1EU3 A;  1SBB B;  3W3A A;  1IHZ A;  3KF8 A;  3HGB A;  1D5X C;  4P2C B;  2R6G A;  3N52 A;  3VR5 A;  3GTM B;  5CV9 A;  1ZYR C;  1QWY A;  5EJW A;  2QEJ C;  5KNB A;  2IX3 A;  1K83 B;  3FRP B;  3L3O C;  4DXF A;  4KJN A;  1J9O A;  2NBF A;  1IKM A;  2EDG A;  1S5F D;  1TWH B;  4MHE A;  1BCP D;  1RD9 D;  2WIN B;  5C5M A;  1YNN D;  1F2M A;  5M9O A;  5COR A;  3GTL B;  1CT1 D;  2B2Y C;  4C3H B;  5EBC A;  3VR3 A;  4RKL A;  4DNT B;  3R2T A;  3DXJ C;  2BE5 C;  1HXY D;  4BWG B;  2F0S A;  3K5L A;  5A2Q L;  3NBI A;  1DON A;  2EY1 A;  3MC0 B;  2R93 B;  5FO9 B;  1BDO A;  1A3T A;  3M7G A;  1STB A;  1DD2 A;  4HN7 A;  3BDO A;  1C48 A;  2H1E A;  3T16 A;  3OMC A;  1U4M A;  3CRK C;  1KNA A;  4DN4 M;  2A68 D;  3RMH A;  2N55 A;  1V1O A;  3OSO A;  1DZ1 A;  1SNO A;  1TII D;  4RHS A;  4EGV A;  2PNR C;  4PQX A;  2K05 A;  1LT5 D;  1XXG A;  2A73 B;  4WRD A;  3CHB D;  2XWJ B;  1ZKO A;  1ICW A;  1SSO A;  3T13 A;  4HMI A;  2DY8 A;  3PUW A;  1LTA D;  4K5W A;  2V4D A;  3DUZ A;  2EJM A;  1SYG A;  2KEE A;  4KJO A;  2F0I A;  2L12 A;  5C3X A;  1CA5 A;  1EWC A;  3DWP A;  2WAC A;  2FMM A;  1IYU A;  1EQV A;  1BNZ A;  1PRT F;  2ENB A;  3H6M A;  2O5I C;  2F0J A;  1X32 A;  5C4X B;  1RTO A;  2HQE A;  1I4P A;  4PMB A;  1KDB A;  1G8Z D;  1ILP A;  2QDB A;  1EZ8 A;  1B1Z A;  4R8N A;  3X3M A;  4C3I G;  4IFD I;  4Q0F A;  4NMZ A;  2KQ3 A;  5D65 A;  1A3V A;  1PFN A;  1ET6 A;  1RKN A;  1GOZ A;  4KN4 C;  2HCC A;  5HGT A;  3VYU A;  2L9H A;  3T53 B;  5CYU A;  4RWS C;  1CTM A;  2F0Q A;  4Y7N B;  2EYM A;  1GUS A;  1Z7T A;  5CV5 A;  5BN3 A;  1B53 A;  1HFG A;  1LO5 D;  4FNF A;  3NQT A;  5EGT A;  5F2D A;  4K14 A;  1PRT D;  1R4P B;  2D9U A;  3I91 A;  1DYQ A;  4IUR A;  1X3Q A;  3GTP B;  5CBA E;  4OGQ C;  5DNF A;  1CZG A;  2A6E C;  1PFM A;  4XXE A;  2ZXR A;  5JOB A;  4J8Q A;  2MJ8 A;  1G2T A;  2K01 A;  5FLX L;  2E75 C;  2K1B A;  1SE2 A;  2D62 A;  2IL8 A;  3GTJ B;  1B3A A;  2IPK D;  4K8J A;  3PIO 3;  3AU7 A;  2JXM B;  2RSO A;  1WTP A;  1SJH D;  4CJ1 B;  2JA8 B;  2X6G A;  2MUY A;  3WOF A;  3S15 B;  4KV6 A;  4IUN A;  1IW7 C;  2IW3 A;  5EPL A;  4RCO A;  1I4G A;  3EVQ A;  3IL8 A;  2B2T A;  4BBR B;  3PUV A;  2NN6 G;  2ZXO A;  2TMP A;  5M3F B;  1LV9 A;  2FHT A;  1WTX A;  1F2Z A;  2WKC A;  5I6W A;  5I9O A;  5M5Y B;  2EPB A;  1ZYR D;  1EOT A;  2RA4 A;  2EY5 A;  4U68 A;  2RQX A;  4DAP A;  2NZ1 D;  2AWN A;  4TSS A;  4R9W A;  3MXU A;  4RKB A;  1LAB A;  3V96 A;  1I3Q B;  5D3I B;  1A15 A;  2XN9 C;  3NPP A;  4C2M B;  2F0D A;  1S5C D;  2NUC A;  3NWS A;  3T51 B;  2R7Z B;  3TP6 A;  4N9P A;  5CMD A;  4DK1 A;  3V2T A;  2JA6 B;  2XRQ D;  1TY2 A;  4RFB A;  5C4J B;  3VR6 A;  3IKJ A;  4RCN A;  2YU9 B;  4C3J G;  1F2Y A;  2BE5 D;  1RHP A;  1X3P A;  3TBI B;  1BCP C;  1LTB D;  2OXP A;  5NUC A;  2SNS A;  3TP5 A;  1YNN C;  4H13 C;  4BA1 I;  1CM9 A;  5LL6 X;  3FVQ A;  4C1N I;  2AWO A;  3QO2 A;  3HP3 A;  3QWN A;  2F0E A;  1HA5 A;  3SVM A;  4M8A A;  2A74 C;  5BN4 A;  2E76 C;  4LAA A;  2NN6 H;  1AW7 A;  2F0N A;  1XWE A;  3D6C A;  1JOO A;  1EWH A;  3T56 B;  1JCK B;  2NVY B;  3P75 A;  3HG9 A;  1WD1 A;  1TS2 A;  1VCI A;  2NVX B;  4KHV A;  2LMC B;  3GV6 A;  5D14 A;  3HOW B;  1ROD A;  2XIW A;  2Q8R E;  2HDM A;  1SFO B;  5C4Z A;  3BVM A;  3D3R A;  3VA5 A;  1UUP A;  2PW5 A;  2OF1 A;  2IJ0 A;  1HTP A;  3D4D A;  5KYI A;  1ESR A;  2B2U A;  4LJZ C;  2L11 A;  5LHY 1;  1Y8O B;  3KLR A;  4FF1 A;  1OXT A;  4PV1 C;  5IIF A;  5G3L D;  3ERQ A;  1DOK A;  5FKA C;  1JOK A;  3HRZ C;  4I65 A;  2L55 A;  1F77 A;  1KDA A;  3HOY B;  1Q12 A;  4XIG S;  1JWM D;  5E3F A;  1Y1W B;  2CHB D;  4EQP A;  3A8K E;  4K2L A;  2KHS A;  4A3K B;  4CJ0 B;  4RA8 A;  2NTT A;  4B9W A;  4KKU A;  2EJG C;  4RGN A;  2IX1 A;  4X3T A;  2PMZ B;  4ZUI A;  4ZKB B;  3M85 A;  2HUG A;  3J7Y W;  3I73 A;  2EY2 A;  3VYS A;  2SDF A;  3T4A C;  4ZAI A;  3SXH A;  2C5C A;  1EYA A;  2RKS A;  3ERO A;  2NYZ D;  1S5B D;  1R9T B;  1QE6 A;  2R61 A;  1UAP A;  4IFD G;  5CV4 A;  5I6Y A;  1VDZ A;  3SE0 A;  4A3M B;  5EKL A;  4OL7 A;  4FO2 A;  2B2V A;  5CR3 A;  4ZLT F;  4RH6 A;  2BA0 A;  2KOL A;  1I4Q A;  1PTO C;  3BS1 A;  3H3V C;  5J39 A;  4FP5 D;  1QJO A;  5FO8 B;  1QIL A;  2F3W A;  2A6E D;  5I2Y A;  1KAB A;  3Q24 A;  2IWH A;  1F9P A;  2J4X A;  3PV0 A;  4IQZ A;  5K36 G;  1I4H A;  1Q1E A;  1PMR A;  3KLS X;  1JE4 A;  3GO5 A;  2Q8I B;  2EZV A;  2J7Z A;  1CZW A;  2QKI C;  4HMJ A;  1IW7 D;  2NN6 I;  1BCP F;  3NQI A;  2DN8 A;  2L0C A;  5C4H A;  5CV6 A;  1EEI D;  3OWF A;  1SYF A;  1PZI D;  2VUM B;  2K33 A;  3J7A F;  1BUV T;  1LTR D;  4UAI A;  4V19 0;  2B39 A;  4E6I A;  4IFD H;  3C1E A;  2F0O A;  3TZU A;  3TN2 A;  2D5D A;  3GTG B;  3Q22 A;  4HR7 B;  5C0X G;  5C5L A;  2KJX A;  5CV7 A;  3Q23 A;  3TSS A;  2PYK A;  2NB0 A;  1CK1 A;  5FLX E;  2XRS D;  4K2K A;  5A35 A;  3F2U A;  3RUZ A;  2EVB A;  2OEO A;  5IOD A;  3A7L A;  2Z4I A;  4A3F B;  5K36 H;  1CHQ D;  3IFD A;  1HCZ A;  4BA2 I;  3AMU A;  4J6H A;  4DAY A;  1TS3 A;  2A69 D;  3UI2 A;  5C0X J;  3HOV B;  5DM6 3;  3GQB A;  1RF2 D;  2G9D A;  1JB3 A;  2AQ2 B;  5ELB A;  4IZ8 A;  5KND A;  4U67 3;  3ZYY X;  1U4L A;  1QB5 D;  2XNA C;  2JYO A;  4DAV A;  2KCN A;  3BVG A;  2E2J B;  1NCV A;  1OO9 B;  4YIJ A;  1EFI D;  4TKO B;  1JWU D;  1BOS A;  2K04 A;  1A6X A;  2EYJ A;  2CVR A;  1LT6 D;  2ID0 A;  4XTC S;  3S16 B;  2PZW A;  3U9S A;  1HQR D;  5C0X H;  1A2U A;  4C3J B;  4IUQ A;  1PYW D;  1SJE D;  3KLS A;  1WTV A;  1Y8N B;  5K5P A;  2K7V A;  2HCI A;  1HQM C;  3NSW A;  1EY4 A;  1HA6 A;  1JQY D;  3SEB A;  1WVL A;  2F0G A;  1LTS D;  1SNM A;  3FEW X;  2LS0 1;  3QOJ A;  3W2D A;  5CC4 A;  5JEA G;  4MN3 A;  4EVO A;  1TR5 A;  1EY5 A;  4F7X A;  4FF4 A;  4HCS A;  1PFB A;  3K5O A;  4R8I A;  1HUM A;  2KED A;  4XDX A;  2GA4 B;  2QF7 A;  1PTO F;  3BYT B;  3GD7 A;  3BYY B;  3RD4 A;  3S1M B;  1DOM A;  1ZXT A;  1NAP A;  3DEP A;  4DK0 A;  1LAC A;  5JJZ A;  1E0B A;  2Q8T A;  1OXV A;  3MXG A;  2E2D C;  2EY6 A;  3BDL A;  3QJY A;  5JEA J;  1SNC A;  3D8G A;  3I3C A;  1H9J A;  5IT9 L;  1I6V C;  4I7Z C;  2B2Y A;  3S14 B;  2B2T C;  3SDZ A;  4X3U A;  5C6A A;  2F0U A;  2B8G A;  4QUF A;  1HUN A;  1HFN A;  2EYP A;  3ND9 A;  3S2D B;  2IX0 A;  4OHJ A;  1PLF A;  2L4N A;  3PO2 B;  3SHL A;  2O4X A;  2KUM A;  3OIQ A;  1H9S A;  3R3O A;  5JEA H;  1BXT A;  1DCZ A;  3MA2 B;  1PTO D;  1STE A;  3LNN A;  2Z8L A;  2NWG A;  3N6R A;  2F0P A;  3KBG A;  2PO4 A;  2I07 B;  2SEB D;  4V0B A;  2EOT A;  2WII B;  5JVH 3;  3KK7 A;  2XVS A;  2WKD A;  1K8O A;  3SK4 A;  2JA7 B;  1FNW A;  3CQZ B;  5E4X A;  2M00 A;  3RZO B;  1MBY A;  5KRU A;  3GTO B;  1KAA A;  5EPK A;  5DEH A;  1STG A;  2AUK A;  1SYC A;  3FPP A;  4PNY A;  1Q8I A;  4F8M A;  1E2V A;  3LX0 A;  4IUT A;  1Q90 A;  2BDN A;  1VMC A;  2DNC A;  2F0W A;  3H0G B;  3K57 A;  5IOC A;  1O80 A;  3ITP A;  5C0X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...