1EL0A

Solution structure of the human cc chemokine, i-309
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human CC chemokine I-309, structural consequences of the additional disulfide bond.
pubmed doi rcsb
molecule tags Immune system
molecule keywords I-309
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1el0A00
3IL8A 1WTQA 5CMDA 3I8ZA 1HFNA 4IUTA 1RHPA 1HHVA 4CJ2C 1LV9A 1IKLA 3I90A 1DONA 4DN4M 5DNFA 2K04A 5JJZA 1ML0D 2B2YC 1HFGA 2HUGA 2RA4A 4XDXA 3TN2A 5CBAE 1AZPA 1DZ1A 1EOTA 5EKIA 1F9SA 1B50A 1BO0A 4XT1B 4HSVA 1WTPA 2MGSA 1WD1A 1EL0A 5COYA 1O7ZA 3I91A 2B2WA 4IURA 3UI2A 1WD0A 2B2WC 5CBEE 1ILQA 1U4PA 2BDNA 1PDQA 1SSOA 1WTRA 1MSGA 1RTOA 1WTXA 5CORA 1WTWA 1ZXTA 1XX8A 2K28A 2B2UC 1EIGA 4NW2A 2MPMA 2D9UA 4QUCA 4RWSC 4QUFA 4ZK9B 2B2TC 3HP3A 3KUPA 1CA6A 4MHEA 2B2TA 1TVXA 2K03A 2Q8TA 2KOLA 2CVRA 1PFMA 3G7LA 1B2TA 2VXWA 1PFBA 2K01A 1WTVA 1ILPA 5EQ0A 1IKMA 2NZ1D 1NCVA 1CM9A 1QG7A 3TZDA 1QE6A 1QNKA 1X32A 5EJWA 3FPUB 1SDFA 1RTNA 1VMCA 2FFKB 2HCCA 4IUQA 4CJ1B 1WTOA 2MP1A 1X3PA 2HDLA 3F2UA 1G6ZA 2K1BA 2R3ZA 4O42A 1CA5A 4HCSA 2NWGA 4U68A 2MJ8A 1G2TA 1DOKA 5EPKA 1JE4A 3MTSA 4XT3B 1IL8A 3DEOA 1EQTA 1DOLA 1XYIA 1RODA 2JYOA 1MI2A 5T1IA 1PLFA 5E4WC 1C8CA 2J7ZA 1BNZA 2N88A 4UAIA 1MSHA 2B2YA 4X3KA 2L1BA 3GV6A 1B53A 1KNAA 1DOMA 1F9RA 2KUMA 1M8AA 4RAUC 4ZLTF 1O80A 1NR2A 2IL8A 3DM1A 1RJTA 2B2UA 1O7YA 2X6LA 2X69A 2HDMA 3H91A 2XIWA 4X3TA 2L4NA 4IUPA 1Q3LA 4IUUA 2KEDA 4MN3A 1HA6A 2KVMA 2FJ2A 4X3SA 4ZAIA 2X6GA 5EPJA 1EIHA 3Q6SA 2NYZD 2DY8A 1JICA 1X3QA 3I3CA 4IUVA 3P7JA 5EPLA 4X3UA 1F2LA 2H1EA 3MWYW 4ZKBB 3DEPA 1NR4A 2K05A 4OIKA 1U4MA 1G2SA 1B4OA 2KECA 2SDFA 1SAPA 1KNEA 2Q8RE 2M2LA 2FMMA 1F9QA 4HAEA 5D14A 4LMQD 4CJ0B 1U4RA 1NAPA 2JP1A 3IFDA 1S4ZA 2N55A 3D6WA 1HUMA 2EPBA 1A15A 3GV3A 3ONAB 1J9OA 5T1GA 1J8IA 1GUWA 2EE1A 4OIJA 1BBXC 3N52A 3FDTA 2L9HA 4R8IA 2FINB 1HUNA 2FHTA 3KBXA 2L11A 1MGSA 1B3AA 1ESRA 5E4XA 2B2VC 4R9WA 1PFNA 2HCIA 1G91A 5D65A 2B2VA 2RSNA 1E0BA 2RSOA 1AZQA 5AFWA 4HEDA 1WVLA 1HRJA 3R93A 2DY7A 1AP0A 2RVLA 2L12A 1U4LA 3LWEA 4RA8A 3SVMA 1VMPA 1ICWA 3QO2A 2KEEA 1BF4A 1F9PA 4ZKCB 2EOTA
chains in the Genus database with same CATH superfamily
3K7UC 2AQ1B 3S14H 1HHVA 1JB3A 4CDEC 3T1YQ 3RZOH 2F0NA 3M4QA 3AFPA 1CKNA 4ZQ3A 5H1SE 4C1NK 2GN5A 2F0WA 3PO3G 5M3MH 4A3LG 1TIID 2EXZA 1YNJD 3HOVH 2UU9L 2BDNA 2DNCA 3W1GA 1RTOA 1GKHA 1TQOA 2QGQA 3URYA 1Y1WG 3H3VH 3GTGH 3FKIB 4CBVA 2CVRA 1ILPA 1OXSC 2R7ZH 2PMZE 1AE2A 4AQYL 1WTOA 2BA1A 1U0LA 5CYUA 2OXPA 2JA7H 1W6KA 2ZJQA 5C0XG 2WIIB 2F4IA 4DV1L 4LF8L 1VQJA 2XTIA 1PH5A 1K8AC 4Q0FA 2N88A 4DFAA 1JR0D 4K2KA 1RL2A 5JJZA 2K5HA 2A68D 1YHAA 1LTBD 2X69A 2JA8B 5HGTA 4X3TA 4MN3A 2XRQD 1S72A 4JYAL 4KMUC 3T56B 4AIMA 2H4OA 5EPLA 1ASZA 1I4RA 4MTKA 4ZKBB 1G8ZD 1C7YA 5FO8B 4HJ5A 1LM0A 3I2ZA 4EQPA 4XXEA 1STNA 1KTKA 2HT1A 5C6AA 4A3GB 5D14A 4HAEA 3BDOA 2IX3A 2MNAA 1BBUA 1YZ6A 1K0RA 2NBFA 1LTTD 4JI3L 5IWAQ 4O1NA 3SK8A 3GTJB 1SRUA 1OXVA 1EYAA 4GN5A 3TS0A 1Q8KA 1WFQA 4LF6L 5C44G 1E24A 3R2TA 5D3IB 3KDFB 3CF5A 2SNSA 4HJAA 2TSSA 5HGQA 4A3MH 4DR2L 1DJRD 4OXPA 2ZJPA 4GOPB 1AZQA 4N9TA 1RF2D 2AQ3B 4KY6A 3CCJA 4DAMA 4YCVA 1JJ2A 2E75C 2K52A 2KUMA 2BH8A 5IYCH 4IUTA 4X64L 1WI5A 4O2DA 5LMNQ 3I90A 1KD1C 4F87A 2KJXA 2F4VQ 2JJQA 3F2BA 1F9SA 5HURA 3JAMc 1BO0A 3HOUH 1GUNA 1KABA 5C3XA 3MXNB 1N36Q 1XPUA 2ZT9C 3FRPB 5LMUL 2D0PA 1WTRA 1SFOB 4B3RL 4UPAA 2LSSA 1EIGA 2VB3X 4JCVE 3JC66 1LT4D 3G4SA 2WAQG 2VL6A 1HPCA 4A93B 1TS3A 2CCZA 1JJCB 1WTVA 1EFID 2B63B 3MFYA 3D4RA 2OTLA 5IP9H 3TP5A 4EX5A 3J81L 1PYSB 5C4XB 4K5XA 1LTLA 4GN4B 4HCSA 1MJEA 4NKLA 2F0DA 4ID6A 1STGA 1BCPF 4ULLA 4DAVA 1VQPA 1XMQQ 1H9RA 1NUCA 2PMZB 2B2UA 1O7YA 5M5WB 2PO4A 3HOXH 1V1PA 3EROA 3KJPA 3RNUA 1EYCA 2F0TA 2ZTCA 3L7ZC 3EA6A 3DWAA 2K6AA 5KIXA 2R93B 1KRTA 3AFQA 2ASBA 3WDNA 4YY3L 4LFBL 2UXDL 4X64Q 2MO0A 3R3OA 3NSWA 5IYDG 2EZVA 3S17H 3CCMA 1FD7D 2EYJA 4DUYQ 4LMQD 3HOYB 4XQNA 4HIDA 2WFWA 3J7AF 5T1GA 3A8KE 4JI4Q 3K5LA 1PV4A 3WOFA 3HZXA 5IWAL 1TT2A 1A3TA 1UUPA 3HOUB 1QUQA 3OPOA 4ABNA 4DR6L 3HOZG 2R6GA 3KLSA 2R92B 4HJ9A 2B2VA 2F0OA 1IXRA 3BYYB 2IX0A 3TZUA 1DGSA 4L5QA 4P74A 1K83B 1WOCA 2F0FA 3DHQA 2IWHA 4ZKCB 1HFNA 1Y8PB 4PMWA 4DA2A 3IL8A 2ZM6L 3I72A 2ZXOA 4BY7H 3CU7A 3S1QH 2CWPA 2ICIA 1K3BC 1JWSD 3KLWA 3S2DH 1EOTA 4A3JB 3SGIA 1B50A 1V1OA 1QUQB 3GTPB 1TS2A 3NXWA 2N49A 5KGUA 1DD2A 4POFA 2V1CC 5LHY1 3G6EA 3RLOA 1EU3A 1VQAA 1LO5D 1PFSA 4JBJA 3UI2A 4AH6A 4OWXB 4WJWA 2GA4B 4YCUA 3PUZA 2QA4A 1E1TA 2PI2E 1XX8A 3OWFA 1GJXA 5K36G 1W2BA 5GAGC 2K03A 4GKKL 3MA2B 1B2TA 1PFBA 1PRTF 1CK1A 4QCLA 3K57A 1IKMA 3S2HH 5EJWA 4A3FG 1F77A 2MP1A 2HDLA 4JI6L 2K1BA 1XMOQ 3KF8B 1SYDA 2NWGA 3NBHB 3H3VI 3PUXA 1QJOA 3GD7A 3MTSA 4BA2I 3MEFA 3J80L 1SNQA 4QMGA 3NEMA 1YJNA 3I4MG 1TWHB 1EYDA 1VQGA 4K6LA 4X3KA 3BDCA 3OIQA 4MZ9A 4ZLTF 1O80A 1FR3A 2XN9C 1TWHH 4ME5A 4DV2L 1NMGA 1OO9B 1J5EL 4B3ML 4R4IA 1OTCA 5FLXE 3MEHA 2NYZD 2DY8A 3AMUA 3P7JA 3HKZB 4JBKA 2K14A 4JI2L 3DEPA 5CV6A 3S1NB 3FP9A 2Y0SE 1XMOL 2ATWA 5IGGA 2KCMA 1PXUA 4UDUC 1YIJA 3ZYYX 1ET9A 1Y1VB 3D6WA 3DWQA 3KLSX 3S2DB 4MIUA 1CKNB 2F0IA 4EQOA 1Y1VH 3K5NA 4KTAA 2L11A 1XNQQ 1IYUA 5A2QE 3M4OB 4DNRB 5D65A 2EYOA 1PZID 1V8QA 4LF9L 1YEZA 4FNFA 4K6DA 3D4DA 3ND8A 2B8GA 5GAEC 2M00A 2WP8J 2EY1A 4LFAL 4GS3A 4HMIA 5IYBG 1RDPD 4G7HC 3J81E 2AMCB 2NVYH 4C3JG 2RA4A 2AQ2B 1N33Q 5LMUQ 4H02A 2RQXA 3EN2A 1KLGD 1PHJA 4ZUIA 3HOZB 4XT1B 5C5MA 1WTPA 1EY9A 2F0VA 4KJOA 1HNWQ 1N8RC 4QF4A 1OXUA 3IFTA 5E3FA 2XRSD 1PRTB 5CORA 2AHOB 3PUWA 1VQ4A 3MXPA 1TWGB 3P75A 1HNXQ 4O0AA 3X3MA 4DR6Q 2Z6BA 1UE1A 1ENAA 4P71A 1Z47A 5EQ0A 2JXMB 2I0QA 4C3IG 3RN5A 4DR7L 3D8GA 1SMYC 1X32A 1X3FA 2FFKB 3L2PA 2K32A 4GKJQ 2O5IC 3M3YH 1O78A 2RHSB 4PZ6A 1HQRD 2OTJA 1BDOA 5BN5A 4DU9A 3EIVA 3J7YW 1YBYA 3DEOA 2DJFC 2VUMH 2CW0C 4YWMA 4QIWB 1PLFA 1C8CA 3IAYA 1EOVA 2Z6KC 1F2MA 3GTKH 4QL5A 4B9WA 1DOMA 1FYCA 3SHLA 3K7AB 3GTKB 1XPRA 1HZ9A 3BVMA 4DK6C 3HRZC 3K7AH 4A3DG 3CAMA 4HJ7A 3RLFA 2RF4A 1Y1WB 1EIHA 5M3MG 1XJVA 2L15A 4X65L 4A3MG 1LLRD 4KV6A 4IOCA 2LXJA 1J5EQ 2C35B 1R4QB 1GM5A 4H0LC 1ICFB 3CCRA 3HGBA 5AJ3Q 1CUKA 1EIFA 4A3EB 1ET6A 1HZBA 1STBA 1B7YB 3PCOB 1IHZA 2LY7A 1G291 1IYJB 2R7ZG 1UEAB 1LTGD 3KBXA 3Q8DA 4XTCS 3V96A 1LT6D 1UAPA 3S1NH 1L0YB 4B3RQ 4RGMA 5C0XH 3AQQA 1T9HA 4HEDA 3PMFA 4ZUJA 1CQVA 3OTOL 2RVLA 4GKKQ 4R1JA 1JCKB 5DM73 3A7LA 3F8TA 1U9RA 5ELDA 4A3CG 2WAQB 5M5XB 3OYYA 3A5ZB 4LWCA 5F2DA 2UXBL 2QKIC 2F0GA 1DZ1A 1SROA 1B3QA 3GTQB 4DV4L 3D4WA 2NUCA 2R61A 3L3OC 3T51B 5IODA 1JJGA 1AH9A 3NBIA 1SSOA 4GZYC 2ZM6Q 2K28A 1Q8IA 4ZK9B 3F2DA 1KL9A 2PQAB 4CDFC 3HOXG 2K01A 2I46A 2RDFA 1YNNC 1E1OA 3T1HL 3I4MB 3VDYA 3FPUB 4BXXG 3C1EA 2IHEA 3CQZH 3I7FA 4DNIA 1DOKA 3EQLC 2CW0D 5EPKA 1TWGH 3CMEA 1FVIA 1SNCA 3KLRA 1H9SB 4JI4L 1MBYA 2QDBA 2WACA 3BVGA 2BDOA 1BNZA 5J39A 5C4HA 2A6ED 1FNWA 1E2VA 4HIOA 4IUPA 2G5DA 3L0OA 1HA6A 4X3SA 3HOUG 3RLNA 2VNUD 2NVTB 1K0SA 1IW7D 1X6OA 4FF4A 1CZGA 3M4PA 4QQBX 2IPKD 2SDFA 2HD3A 1L1OB 3S1MH 4BY7B 3NWTA 1MHWC 4K8JA 2J0TD 4AQYQ 1S4ZA 1SYBA 4X6AH 2GVBA 3UE1A 2VY3A 3K6OA 3RZDB 4LK1C 1IBKL 5J22A 3MXNA 1G91A 4XQJA 3SXHA 1GUTA 1EWHA 1VQMA 1CKOA 2EDGA 3R93A 4JBWA 3D0FA 3UDFA 1SR3A 3OMCA 1VMPA 4NXNL 1K8OA 5K36H 1BCPC 3N6RA 2E2JH 2BE5D 1EZ6A 2E5LQ 2KCNA 1M1KC 3I70A 3ERQA 1SYGA 4UP8A 2B2YC 5DM63 4TKOB 1AZPA 3FVQA 3CQZB 1NE3A 4XYOA 4HSVA 2LFNA 3PO2G 5DAUA 5HY6A 2NVXH 2JE6I 3KDFA 2IT1A 4JI5Q 3TS2A 5JPMC 1ILQA 1HZAA 2UUBQ 1VQBA 2D62A 3D31A 4RWSC 5I2YA 3KUPA 2VS1A 1H9SA 4JVZA 1TVXA 3K5OA 1I94L 5C0XJ 1TU2B 2EYMA 1NCVA 3TREA 5IGEA 1ONLA 2N8NA 1QE6A 4XIGS 2AWOA 2EIFA 5CR3A 1R4PB 2OQKA 3A5UA 4U68A 5CV8A 2MJ8A 1PH6A 3JAMi 2LXKA 1PZKD 1IL8A 2OF1A 1QWYA 5M3MB 3MAQA 1Y14B 5T1IA 5E4WC 1RD9D 3H94A 2B2YA 3FPPA 4ZRZA 4YHHQ 2EJFC 3BU2A 1Y1VG 2NN6I 2Z0SA 2ZTEA 2G9HD 4A3EG 1KAWA 1EEID 2FJ2A 4HJ8A 1Q86C 3NK9A 3CCUA 1E7ZA 4PV1C 4GOPA 5KYIA 2YU9B 1SE3A 2PZWA 2A73B 2K05A 3HKZE 1U4MA 4BBRB 2E2HH 2UUAQ 1EQVA 4OO1I 2VZAA 2KECA 4UY8C 1LT5D 4IUNA 1QVCA 2JA7B 5IYBH 4DGZA 5IOCA 3QOJA 3P20A 1I3QH 2PYKA 3ICEA 1HA5A 4LF8Q 5ELFA 2E8GA 3HOWB 4OIJA 1Z6HA 2IJ0A 3SR1A 1I94Q 4Y7NH 2RCNA 4Q5VA 2WINB 4KD4A 5E4XA 4F7XA 2EYLA 1A0IA 3CCQA 1E0BA 2TMPA 2F03A 1XNRL 5FLMH 3A74A 5TSSA 3VA5A 2DY7A 4PNYA 4UP9A 3SEBA 1XTCD 1F9PA 4KI0A 5M3FG 1SMYD 1UE6A 3R2IA 5CMDA 3CPWA 1RHPA 1IBML 3GTQH 4KHZA 3H0GB 1DONA 2XNAC 4C3IH 4I7ZC 2HUGA 2PNHA 1A2TA 2D5DA 3RMHA 5EKIA 5I4DA 3BS1A 3RZOB 1VQ8A 2B29A 5BR8L 3PGZA 3BZCA 3M85A 2MGSA 1WD1A 4IURA 2VUMG 2J4XA 2ID0A 2O4XA 1SEBD 4DR1Q 4DNTB 3L9AX 1MSGA 3T1YL 3FHWA 2H5XA 1LYLA 4DV5L 2JA5B 2B3GA 4KKTA 5IYDH 1CFMA 5JVG3 4JI1Q 2QDLA 4LUVA 3G7LA 2I5LX 5C4XG 1Q82C 3GTGB 3NENA 3OMGA 2NZHA 1NSNS 4IFDG 3F2UA 3AU7A 4HMJA 1FGBD 1UWVA 1VQ9A 1SNOA 2V4DA 2JA6B 4RKLA 4GLVB 1DOLA 1MI2A 2I5MX 2OQ0A 2K5DA 3MVVA 1STYA 5JEAJ 3KK7A 1X9NA 1M8AA 1A3UA 2SEBD 4UHVA 4XQQA 1N34L 3T4AC 4FO2A 3S14B 4BY7G 5C4JH 3NPPA 3CD6A 5C4JB 3CKIB 2M9VA 2Q2TA 1DXMA 1OXTA 1MJCA 3TBIB 3MXUA 4A3IB 4V0BA 4C3HB 4C56C 1QVGA 1ENCA 3E0JA 2QW7A 5IT9c 2LMCB 3PUVA 4JK1C 1JWMD 4DKAC 2HHHQ 1GO3E 4TRDA 5G3LD 1AFPA 4JPBW 4BS9A 3BVZA 1J8IA 4LFCL 2N3SA 1QNUA 1HR0W 3DMUA 1D5ZC 2YTYA 1MGSA 2B2VC 4R9WA 1EQQA 1XWEA 3J80c 1V43A 2ICEC 2A6HC 2F3VA 4HN7A 2A8VA 3PIOA 1BQQT 4EGVA 1VQIA 5FOBB 3A8IE 2KENA 3O13A 1BF4A 1EL0A 4DV0Q 4RH6A 1D8LA 3QR8A 1WTQA 1SFOH 3GTOB 4PMCA 4I7AA 4LFBQ 2F52A 1HFGA 4XDXA 5M5YH 2EJMA 1QB5D 4OL7A 4IPGA 1CTMA 3QIAA 2R7ZB 1H9MA 3OTOQ 1II3A 1WYDA 3CW2C 4DV3L 1SE8A 1WCMH 2UUCL 1VQKA 1GHJA 4QGUA 5M3FB 5D3DA 3OSOA 4N8X1 2NZOA 3VYTA 5CGKA 4L5RC 1RTNA 3QB3A 5I2XA 1VS0A 2N78A 4ALPA 1Q7YC 2RDHA 1PTOH 5EAYA 1B1ZA 3ZJYC 4A3BG 2QILA 1C9OA 2AUJD 3SK5A 5C3WA 2AKWB 3DM3A 3CRKC 4RHSA 2WKCA 3PIPA 1A3VA 3ITPA 2HDMA 4DR3L 5ELOA 1N36L 4C3JH 1B9NA 1X65A 4JC0A 4KHPQ 2BCOA 2NTSA 4BBRH 1EQRA 1GVPA 4S3SA 3TQYA 3EBEA 1SJED 3S1RB 3HOXB 4NXNQ 1BCPD 2D0OA 3I4NH 2F4VL 4OIKA 4UP7A 2BE5C 5FLXL 3HFZB 1B4OA 1K9MC 3E9IA 3QG1A 2DN8A 2PW7A 4A75A 3MZ5A 2QF7A 2M2LA 5KEEA 2ALYB 1IBKQ 3ER0A 4NMZA 3LX0A 4CKEA 4DV6Q 2A5HA 3IFDA 5JAVA 4A93G 5M5YB 4GNXB 4TSSA 2EE1A 2L55A 1K28A 3JAME 3U9OA 3HOYH 1GD7A 4BXXH 5J3BA 4JI7Q 2WB1G 5C3EB 2UUCQ 1TWFH 3PO2H 4K14A 3CHBD 2WB1E 3M7GA 1K3RA 3PO2B 1PZJD 2RSOA 3U58A 2CQAA 1LT3D 1WCMB 1Q81C 1HNWL 1PRTC 5NUCA 2VQEL 4B3TQ 3VR3A 3KYHC 4BBSG 2F0MA 3Q24A 1LV9A 4DN4M 1PTOD 2K04A 1PH2A 4LF7Q 1A8VA 4CKBA 2Z9HA 2NVQB 4ZYSA 1S5FD 2R93G 4OHJA 4B3SL 1LTID 2QCPX 4DPGA 5KNBA 3K59A 1WD0A 1KDBA 1RKNA 1GOZA 3SK6A 1WTWA 3A56A 5IY0A 4BY1B 4A3KB 1A6XA 4C3IB 2MUYA 2YTXA 1F2YA 2WKDA 3HP3A 3K0XA 4DR5L 1PFMA 4DV1Q 3TP7A 5IGBA 2VXWA 2EVBA 3A0JA 2RCFA 3LGJA 2F0KA 4FF1A 2PW5A 3TZDA 5EKLA 2JA6H 2HHHL 2HQEA 4IPHA 2O5JC 1G6ZA 2R3ZA 3AEVA 4R8NA 3VYRA 2MHVA 1BUVT 5FO9B 2E2DC 1LTAD 3J7ZC 3CCVA 3QJYA 4F8MA 5C5LA 4X66L 1VF5C 2JA8G 2Z6KA 2I07B 4HR7B 4YWKA 1EWIA 3KOJA 4RAUC 2UXDQ 5IE8A 4V190 2X6LA 1KHIA 4A3CH 1I6HB 2GVAA 2F3WA 1PTOC 1KXLA 2AWNA 1VQ5A 1TY0A 4B3TL 5M9OA 1I6HH 4GN3B 1TWCB 1ESFA 3PQIA 4K8IA 1EWCA 1NR4A 1Y8OB 4IPCA 3K81C 1SNMA 3H0GH 3S24A 4G7ZC 1QOHA 2K7VA 3TMEA 1HXYD 2D2CC 1NAPA 3M4YA 4A3GG 1A15A 3S15H 3PSIA 1W3SA 4OELB 3TDQA 3FDTA 4RG1A 2L9HA 2DGYA 2Q2IA 1QZHA 5LMNW 4MTNA 1B3AA 4M8AA 4WJ4A 2A74C 2RKSA 2CHBD 4J8QA 5E7NA 1HQMC 4A3IH 5I9PA 4OWTB 1M4VA 3I4LA 2PQEA 3CP0A 1SAPA 3I56A 5BR8Q 4L5SA 4P2CB 3CCEA 1TS5A 2MQHA 2BH2A 4BWGB 4I65A 4A3EH 4LF7L 1CQFA 5DNFA 4LF5Q 1I4GA 3AYHB 1YI2A 1Q1EA 1X3EA 3RD4A 4HCEA 4IN3A 3TSSA 4F88A 1JE5A 5JEAG 3KFUA 4GNXC 3V05A 3E9HA 4OO1G 5LMNL 1PDQA 3MFGA 1WTXA 1LUZA 3NBHA 3A7AB 1ZXTA 3QWNA 1VQNA 2B2UC 1HR0Q 1BBWA 1IBLL 2LS01 1CKMA 2B2TA 2KOLA 4BBSB 4DXGA 1CM9A 2C5CA 4CJ1B 1YNND 4DUZL 1LTRD 1HR0L 4XYQA 3Q23A 5FLMG 2R7FA 1CA5A 4CHTB 1AE3A 1L0WA 1RODA 1SJHD 1YVCA 5I6YA 1L1OC 1EY5A 2MFIA 1HTLD 2A19A 5M3FH 4J15A 4UAIA 1DM0B 1CI3M 4EQNA 1TWAB 4A3KG 1BKBA 1KNAA 1F9RA 2FXQA 1Z9FA 3PUYA 4C3JB 1D2BA 1NR2A 2F0EA 1RJTA 2K5WA 3GTLB 2UXCL 4LJZC 2KQ3A 2XIWA 3F1ZA 4IO9A 1GUGA 3SDZA 4YHHL 2JA5G 4RGNA 2KA7A 2CKZB 1SYCA 2F0UA 4FYDA 2VQFL 3I3CA 4IUVA 4B08A 1Q1BA 4FP5D 2JN4A 1NTGA 1VQFA 3EVQA 3M4OH 1HH2P 1F2ZA 5ELBA 4CKCA 5FLXc 1FNVA 3GDEA 2SNMA 4OX9Q 2F0SA 1LACA 1N9WA 3G71A 3MC0B 1HUMA 3GV3A 3ND9A 3ONAB 5CC4A 3CXCA 1GUWA 3FKIG 5ELCA 1EY4A 1HNZQ 1R9TB 3KJOA 4IFDH 1S5DD 1KAAA 1SLJA 2EQSA 2RSNA 4WORA 3OW7A 1I6VC 2R92H 3J80i 1S5ED 5FKAC 5AFWA 4HTHA 4AYBG 4ILWA 3S15B 1ICWA 3GTJH 2KEEA 3Q22A 1BXTA 5EBCA 1EY7A 1NNXA 2JEAI 4FVMA 5KYLA 3NTKA 3FEWX 3ULLA 4A3JG 4C3HG 4LNQA 2Z4HA 4P72A 1CT1D 3S1QB 3OHXC 2Z8LA 1C48A 3NP8A 1E2ZA 2Q2UA 1HJPA 3HS0C 4GLAC 5GROA 1QZGA 2B2WA 3CC7A 1EYGA 3M3YB 2OEOA 2E2IH 4JI6Q 4IPDA 4X66Q 4M1UB 5ELEA 2E2IB 4IZ8A 4P75A 3GTMB 1NMFA 1JMCA 1I50B 4K2LA 1B70B 2DJGC 3STBC 4A3FB 1XNRQ 1DCZA 4YWLA 4JI8L 1QNKA 4DK0A 5CV9A 1VMCA 2C9OA 5G3LF 3ERSX 5DLQE 4ME3A 1SNDA 4YCWA 4K5VA 3WOEA 1SYFA 1JE4A 3M9BA 4CDDC 5CV7A 3DWPA 4A93H 3T53B 3HG9A 3J7AV 1FGUA 4JYAQ 2A69D 5GQOA 1B44D 4NP5A 4K0KL 3VYUA 1L1OA 1I4QA 2NB0A 1JC7A 2VQFQ 3Q6SA 1V1QA 1SXTA 4IOAA 1JICA 3ULJA 1CSQA 1I5FA 1E3PA 3NHHA 4JI0L 4KJNA 4DAYB 4FDBA 2YV5A 1WCMG 5BN3A 2Q8RE 1AN8A 2Y0SB 5IP7H 2PZTA 2ES2A 3J7A5 2NTTA 3T1HQ 1VQCA 1J9OA 4R8IA 3KBGA 5C4XH 3IRBA 3PF5A 1ESRA 4CGYB 4TVAB 3OWEB 1UEBA 4JI7L 2B39A 1HNZL 1CZWA 1Q12A 3RZDH 1PH3A 1WJJA 1WVLA 1VQOA 4POGA 4KY7A 3CPFA 3SK4A 3SVMA 3A54A 1TY2A 2Z1CA 3MXGA 4DV4Q 1R9TH 3S9WA 5AJ3L 1WTHA 4KKSA 5KNDA 1IKLA 2UXBQ 1S40A 1ML0D 2KHJA 2RDGA 1QILA 3CCLA 2F1MA 5CBAE 2CQOA 2WV6D 2I5HA 3IKJA 3E5SA 4DF7A 2EY5A 3T16A 5IGFA 3K80C 1UE7A 4QIWE 3S16H 2BA0A 5JJLA 4HSPA 1U4PA 1FJGL 1EZ8A 2WB1B 5C3EG 1IW7C 4L8JA 4QUCA 2JA8H 4NW2A 4QUFA 2B63H 5J1ZA 1GUSA 4DK3C 2VB2X 4IQZA 4PQXA 3HOYG 1JOOA 1S3OA 1LTSD 2NN6G 4LW1A 1A62A 3VR4A 4RCOA 4EQ5A 1HZCA 1ZEQX 1SDFA 3M7NA 1OXXK 4WFN3 5EBDA 1E2WA 4KHVA 1GXDC 2HQLA 1VF7A 1JT8A 1I50H 4BBSH 1MSHA 1HNXL 3UDGA 3GV6A 1STHA 1TKWB 3DUZA 2IL8A 3DM1A 5C0XI 4B9XA 2LKVA 4JI0Q 4H13C 3GTPH 1Q3LA 2KEDA 1KC8C 2R93H 1PVOA 4BY1G 4ZAIA 1E22A 1H9KA 4GNXA 3HOVB 4A3IG 1XPOA 4A3DB 4PG3A 1X3QA 2K5VA 2RBMA 3K58A 1K8GA 4R4CA 5I9OA 1TWAH 4K0KQ 1STEA 5IYCG 4DUZQ 2HIVA 4RCNA 4DV0L 2JP1A 1UNSA 2N55A 2EPBA 4HIMA 4JOIC 1IL2A 2OT2A 5JJKA 3N52A 3NUCA 2FINB 1FL0A 4ODGA 2ZXRA 3I73A 4RGOS 2P5ZX 4N8FA 2L0CA 5I6WA 4OO1H 2UUBL 1HRJA 2NVTH 1L2FA 2ZJRA 1QCBD 2G9DA 1U4LA 2A6HD 4PZ7A 4RA8A 5JOBA 3LNNA 1KQSA 1GUOA 2YYZA 1PH1A 3I8ZA 4YIJA 1N33L 4P73A 2JSOA 2JQOA 3C1FA 5A2QL 3TN2A 4DAPA 4KK7A 1V9PA 3VR6A 5IGDA 4CDCC 1FNUA 4BBRG 4B3MQ 5COYA 4GOPC 3NWSA 4C1NI 1N34Q 4WJ3M 2QEXA 2YU9H 3I4NG 3GTMH 3TP8A 4JOIA 4WRDA 1C0AA 3I55A 3GTLH 3K8AA 2MPMA 1N32Q 1EY6A 3KF6A 3AB9A 3UDIA 4Z9CB 3HOWG 3S2HB 4JI8Q 1CSPA 3H3VC 4NXMQ 3R8BA 2NZ1D 5C4ZA 4JI1L 1JWUD 1EUJA 3BJUA 3NE5B 3BG3A 1CHPD 4Y7NB 4O42A 4RHRA 1KRSA 4OWWB 3E6ZX 4LAAA 1W6JA 1NY4A 1VQ6A 1PH9A 1XYIA 4DR5Q 5GADC 1A63A 4BA1I 3D6CA 1CHQD 2IY5B 3C46A 2PCFB 2L1BA 2NVYB 4FXGC 2Q2HA 2VW9A 1K73C 3FMCA 3HOZH 4IALA 4IUUA 3H15A 2ZXPA 3RN2A 2KHSA 2KVMA 3LWUA 4JBMA 5EPJA 1YHQA 4B3SQ 5JEAH 3GQBA 4LUZA 2IHFA 4OEMB 3F2CA 1F2LA 2H1EA 3U9SA 2NVQH 1C4QA 1VQLA 2UXCQ 3VYSA 1G2SA 3PO3B 2XSCA 3E3XA 1X3GA 2JK8A 4PMBA 1AW7A 1F9QA 4A3BH 2EY6A 1Q46A 4QB4A 1V1PB 4A3JH 1S5CD 4RMFA 3CMAA 1MIUA 3VA7A 3RR5A 4R4QA 2EJGC 3DLLA 1VDZA 5ELNA 1J6QA 4EVOA 1RCVD 1KDAA 2JA6G 3OOCA 1O7IA 1SNPA 2JEBI 4DV6L 4TQUS 1T5EA 1IBLQ 4ZCKA 4PZ8A 2KHIA 4A4IA 4DUYL 4X65Q 3GO5A 4AYBE 3CC4A 1BVSA 3SE0A 2K50A 1YJ9A 1KIXA 2E2JB 1Y8NB 2UUAL 4LUOA 1EEFD 2JA5H 2YTVA 3PF4A 1EU4A 2ZTDA 5FJ8H 3G48A 1SBBB 4U673 1Z7TA 2VQEQ 3EFXD 1XTDA 4NB3A 5DEHA 4LF5L 4QY7A 1GHKA 4DV7L 2D9UA 3BZKA 1MKHA 3P1HA 2ENBA 2Q8TA 4X62Q 4A3GH 2CH4A 5GAHC 2SOBA 2F0LA 3A55A 4J6HA 2K4KA 4L5TA 2AUKA 4H7BA 3BDLA 3NELA 2F0PA 4IJHA 3PO3H 2EY2A 1NJIC 4YY3Q 1O7LA 3S1MB 4A3LH 4LFCQ 4XT3B 1EQTA 3K5MA 3W5OA 3HOVG 3D3RA 1H95A 3C3LA 4C3HH 1Y1WH 1FJGQ 4JI2Q 2RHQB 1X55A 2L4NA 4GLXA 1SMXA 5LL6X 3UDXA 4G4KA 3BYTB 1HCZA 4JV5Q 4R4TA 1JOQA 1PH4A 3U4ZA 4DV2Q 2JA7G 1G6PA 4LF9Q 1I3QB 1KNEA 3HKZG 1G51A 3OW2A 2EYFA 2A1AA 1U5KA 1U4RA 4KD3A 3TEHB 1SN8A 2L5TA 1SE4A 2K75A 4QJFA 1PH7A 1T5XD 3HEJA 4X62L 3GTOH 2FHTA 2A68C 4C2MH 1YITA 1PTOF 1VQDA 3J81c 4DV3Q 4DV7Q 2QEJC 5IP9G 2OCEA 4LF6Q 2CH4W 5KRUA 1EY0A 1B8AA 5C3EH 1X54A 4A3BB 4NXML 1HTPA 5K5PA 4JI3Q 2L12A 1EIYB 2XWJB 3LWEA 4DAYA 2B63G 1I4PA 1PTOB 1JOKA 3QO2A 4OONA 3VR2A 1N32L 3QOLA 4DV5Q 3U50C 1ZYRC 3H0GG 4KN4C 3PIO3 4CJ2C 4MNOA 1P16A 5C44B 3NTHA 1JQYD 1STAA 5E1FA 1B9MA 5IIFA 1MD2D 3JAML 4LFAQ 5M5WH 5C44H 2VUMB 1TXYA 3EJIA 4DXFA 1VCIA 3I91A 4JW0A 2JA9A 5IP7G 2WAQE 3NQIA 4DR4Q 3PV0A 4L6TB 4RGTA 2B2TC 5JVH3 1CA6A 3T13A 4MHEA 2Q8IB 2IX1A 2DNEA 2XVSA 2E74C 5IT9E 3FKIH 1K8MA 1X56A 2XGTA 1AEXA 4G57A 1BCPB 2F0JA 2CWAA 3BZDB 3OIPA 1D7QA 4DR4L 1L0XB 5FK9C 2B8FA 1TS4A 4NPSA 5LL6S 1D5MC 3ULPA 2R92G 2MO1A 4DK1A 2F3IA 3A8JE 2JYOA 5A35A 1IZ6A 2J7ZA 4IFDI 1B53A 4APVA 1K83H 4KY5A 3CRLC 1LABA 1ZYRD 2UU9Q 3H91A 1PA6A 3Q0AA 3CC2A 3S16B 4H44C 4KHPL 4RKBA 4X3UA 1PMRA 4KN7C 3MWYW 1ASYA 2A6EC 4DR3Q 4A3MB 3WWVA 4JG2A 1IBMQ 5M5XH 1XMQL 1YJWA 1BR9A 4CJ0B 2XWBB 5FO7B 1PYBA 2NN6H 3I4OA 4A3KH 1SYEA 1VQ7A 3NQTA 1P8LA 5ISRA 4FF3A 1HUNA 1KDCA 3E0EA 1PFNA 4AYBB 2FMCA 1PYWD 4A3FH 3U4VA 1Y69U 1JORA 4DR1L 3S1RH 2K5QA 3RUZA 4N9PA 1I4XA 5IT9L 3HOWH 3V2TA 5BN4A 4JV5L 2Z4IA 3B6YA 2OWOA 1D5XC 4OX9L 2PPBC 3S17B 1IYVA 4A3DH 2PZUA 4BY1H 3W3AA 5JJIA 4J1MA 4RFBA 1PH8A 2BOSA 1S5BD 2PQAA 4G7OC 2F0HA 3UE0A 5CV5A 3NTIA 4A76A 5IGCA 1O7ZA 3DXJC 1QVFA 4FXDA 1VQHA 3J81i 1TR5A 2B2WC 3K0YA 5CBEE 3W1BA 1TWCH 4HIKA 3CCSA 2E5LL 1RIPA 4GKJL 5KNCA 2K5NA 1D1IA 1JB7A 4LF4Q 1PRTD 4C2MB 1EY8A 3TP6A 1EFWA 4E6IA 3J81j 3VR5A 4NDXA 4DR2Q 4IFDJ 1QG7A 1YNXA 2KBNA 3MHBA 2NVXB 4IUQA 1UE5A 2HCCA 3STBD 1D1KA 1X3PA 5EKKA 4DR7Q 1G2TA 3H09A 1D6EC 2PNRC 2K33A 3KF6B 1M90C 5L37A 4KKUA 3X3NA 4FF2A 1I4HA 2KCTA 5JPNC 2R7DA 2DUDA 2O2LD 3GP7A 2A69C 3KF8A 2EYHA 4FXKC 5EGTA 1NBWA 4R4OA 2X6GA 4KLKA 2F0QA 1Q90A 1YHBA 1YNJC 2EYPA 3PIP3 3I4NB 1XXGA 4IJLA 4OGQC 2CFMA 2Y0SG 1DYQA 2IW3A 1SE2A 3H6MA 4L63B 2FMMA 3G6JB 1KLUD 1H9JA 2EXDA 3I4MH 4Y52H 1BBXC 1TWFB 1VQEA 4K5WA 1BOSA 5CV4A 5FJ8G 3C2PA 4LF4L 3W2DA 1ENFA 3HKSA 2HCIA 1XNQL 2E2HB 3TRZA 2KCCA 1AP0A 4JI5L 2E76C 2HIXA 2PI2A 1A2UA 3J80E 1ZKOA 2EOTA
chains in the Genus database with same CATH topology
2AQ1B 1HHVA 1JB3A 2F0NA 4ZQ3A 4C1NK 2F0WA 1TIID 2EXZA 1YNJD 2BDNA 2DNCA 1RTOA 1TQOA 3URYA 3FKIB 4CBVA 2CVRA 1ILPA 1OXSC 1WTOA 2BA1A 5CYUA 2OXPA 1W6KA 5C0XG 2WIIB 2F4IA 4Q0FA 2N88A 4DFAA 1JR0D 4K2KA 5JJZA 2A68D 1LTBD 2X69A 2JA8B 5HGTA 4X3TA 4MN3A 2XRQD 4KMUC 3T56B 2H4OA 5EPLA 1I4RA 4ZKBB 1G8ZD 5FO8B 4EQPA 4XXEA 1STNA 1KTKA 5C6AA 4A3GB 5D14A 4HAEA 3BDOA 2IX3A 2NBFA 1LTTD 3GTJB 4O1NA 3SK8A 1OXVA 1EYAA 3R2TA 5D3IB 2SNSA 2TSSA 1DJRD 1AZQA 4N9TA 1RF2D 2AQ3B 4KY6A 2E75C 2KUMA 4IUTA 3I90A 4F87A 2KJXA 1F9SA 5HURA 1BO0A 1GUNA 1KABA 5C3XA 2ZT9C 3FRPB 1WTRA 1SFOB 1EIGA 2VB3X 1LT4D 1HPCA 4A93B 1TS3A 1WTVA 1EFID 2B63B 3MFYA 3D4RA 3TP5A 3J81L 5C4XB 4K5XA 4HCSA 4NKLA 2F0DA 4ID6A 1STGA 1BCPF 4ULLA 4DAVA 1H9RA 1NUCA 2PMZB 2B2UA 1O7YA 5M5WB 2PO4A 1V1PA 3EROA 1EYCA 2F0TA 3L7ZC 3EA6A 3DWAA 2K6AA 5KIXA 2R93B 3WDNA 3R3OA 3NSWA 2EZVA 1FD7D 2EYJA 4LMQD 3HOYB 4XQNA 3J7AF 5T1GA 3A8KE 3K5LA 3WOFA 3HZXA 1TT2A 1A3TA 1UUPA 3HOUB 3OPOA 4ABNA 2R6GA 3KLSA 2R92B 2B2VA 2F0OA 3BYYB 2IX0A 3TZUA 1K83B 2F0FA 3DHQA 2IWHA 4ZKCB 1HFNA 1Y8PB 4PMWA 4DA2A 3IL8A 3I72A 2ZXOA 3CU7A 2ICIA 1JWSD 4A3JB 1EOTA 1B50A 1V1OA 3GTPB 1TS2A 3NXWA 5KGUA 1DD2A 5LHY1 1EU3A 1LO5D 3UI2A 4WJWA 2GA4B 3PUZA 1XX8A 3OWFA 1GJXA 5K36G 2K03A 3MA2B 1B2TA 1PFBA 1PRTF 1CK1A 4QCLA 3K57A 1IKMA 5EJWA 1F77A 2MP1A 2HDLA 2K1BA 1SYDA 2NWGA 3PUXA 1QJOA 3GD7A 3MTSA 4BA2I 3J80L 1SNQA 4QMGA 1TWHB 1EYDA 4K6LA 4X3KA 3BDCA 3OIQA 4ZLTF 1O80A 1FR3A 2XN9C 4ME5A 1OO9B 5FLXE 3MEHA 2NYZD 2DY8A 3AMUA 3P7JA 3HKZB 3DEPA 5CV6A 3S1NB 5IGGA 1PXUA 4UDUC 3ZYYX 1ET9A 1Y1VB 3D6WA 3DWQA 3KLSX 3S2DB 4MIUA 2F0IA 4EQOA 3K5NA 4KTAA 2L11A 1IYUA 5A2QE 3M4OB 4DNRB 5D65A 2EYOA 1PZID 1V8QA 4FNFA 4K6DA 3D4DA 3ND8A 2B8GA 2M00A 2WP8J 2EY1A 4HMIA 1RDPD 4G7HC 3J81E 4C3JG 2RA4A 2AQ2B 2RQXA 1KLGD 4ZUIA 3HOZB 4XT1B 5C5MA 1WTPA 1EY9A 2F0VA 4KJOA 4QF4A 1OXUA 3IFTA 5E3FA 2XRSD 1PRTB 5CORA 3PUWA 3MXPA 1TWGB 3P75A 3X3MA 1ENAA 1Z47A 5EQ0A 2JXMB 4C3IG 3D8GA 1SMYC 1X32A 2FFKB 2K32A 2O5IC 1O78A 1HQRD 1BDOA 5BN5A 4DU9A 3J7YW 3DEOA 2CW0C 4QIWB 1PLFA 1C8CA 3IAYA 1F2MA 4B9WA 1DOMA 1FYCA 3SHLA 3K7AB 3GTKB 3BVMA 3HRZC 3RLFA 1Y1WB 1EIHA 1LLRD 4KV6A 1R4QB 4H0LC 3HGBA 4A3EB 1ET6A 1STBA 1IHZA 2LY7A 1G291 1UEAB 1LTGD 3KBXA 4XTCS 3V96A 1LT6D 1UAPA 1L0YB 4RGMA 5C0XH 4ZUJA 4HEDA 3PMFA 1CQVA 2RVLA 1JCKB 5DM73 3A7LA 1U9RA 5ELDA 2WAQB 5M5XB 5F2DA 2QKIC 2F0GA 1DZ1A 3GTQB 3D4WA 2NUCA 2R61A 3L3OC 3T51B 5IODA 3NBIA 1SSOA 4GZYC 2K28A 1Q8IA 4ZK9B 2K01A 2I46A 2RDFA 1YNNC 3I4MB 3FPUB 3C1EA 1DOKA 3EQLC 2CW0D 5EPKA 1SNCA 3KLRA 1H9SB 1MBYA 2QDBA 2WACA 3BVGA 2BDOA 1BNZA 5J39A 5C4HA 2A6ED 1FNWA 1E2VA 4IUPA 1HA6A 4X3SA 2VNUD 2NVTB 1IW7D 4FF4A 1CZGA 2IPKD 2SDFA 4BY7B 3NWTA 4K8JA 2J0TD 1S4ZA 1SYBA 3K6OA 3RZDB 4LK1C 5J22A 3MXNA 1G91A 4XQJA 3SXHA 1GUTA 1EWHA 2EDGA 3R93A 4JBWA 3OMCA 1VMPA 1K8OA 5K36H 1BCPC 3N6RA 2BE5D 1EZ6A 2KCNA 3I70A 3ERQA 1SYGA 2B2YC 5DM63 4TKOB 1AZPA 3FVQA 3CQZB 4XYOA 4HSVA 2LFNA 5DAUA 2JE6I 2IT1A 5JPMC 1ILQA 2D62A 3D31A 4RWSC 5I2YA 3KUPA 1H9SA 1TVXA 3K5OA 5C0XJ 1TU2B 2EYMA 1NCVA 5IGEA 1ONLA 1QE6A 4XIGS 2AWOA 5CR3A 1R4PB 4U68A 5CV8A 2MJ8A 1PZKD 1IL8A 2OF1A 1QWYA 5M3MB 3MAQA 5T1IA 5E4WC 1RD9D 3H94A 2B2YA 3FPPA 4ZRZA 2EJFC 2NN6I 2G9HD 1EEID 2FJ2A 3NK9A 4PV1C 5KYIA 2YU9B 1SE3A 2PZWA 2A73B 2K05A 4OO1I 1U4MA 4BBRB 1EQVA 2KECA 1LT5D 4IUNA 2JA7B 4DGZA 5IOCA 3QOJA 3P20A 2PYKA 1HA5A 5ELFA 3HOWB 4OIJA 1Z6HA 2IJ0A 3SR1A 4Q5VA 2WINB 4KD4A 5E4XA 4F7XA 2EYLA 1E0BA 2TMPA 2F03A 5TSSA 3VA5A 2DY7A 4PNYA 3SEBA 1XTCD 1F9PA 4KI0A 1SMYD 3R2IA 5CMDA 1RHPA 4KHZA 3H0GB 1DONA 2XNAC 4I7ZC 2HUGA 1A2TA 2D5DA 3RMHA 5EKIA 5I4DA 3BS1A 3RZOB 3M85A 2MGSA 1WD1A 4IURA 2J4XA 2ID0A 2O4XA 1SEBD 4DNTB 3L9AX 1MSGA 2JA5B 4KKTA 1CFMA 5JVG3 3G7LA 3GTGB 3OMGA 1NSNS 4IFDG 3F2UA 3AU7A 4HMJA 1FGBD 1SNOA 2V4DA 2JA6B 4RKLA 1DOLA 1MI2A 2K5DA 3MVVA 1STYA 5JEAJ 3KK7A 1M8AA 1A3UA 2SEBD 4XQQA 3T4AC 4FO2A 3S14B 3NPPA 5C4JB 3CKIB 2M9VA 1DXMA 1OXTA 3TBIB 3MXUA 4A3IB 4V0BA 4C3HB 4C56C 1ENCA 3E0JA 2LMCB 3PUVA 4JK1C 1JWMD 4TRDA 5G3LD 1AFPA 4BS9A 3BVZA 1J8IA 1QNUA 3DMUA 1D5ZC 1MGSA 2B2VC 4R9WA 1XWEA 1V43A 2ICEC 2A6HC 2F3VA 4HN7A 1BQQT 4EGVA 5FOBB 3A8IE 3O13A 1BF4A 1EL0A 4RH6A 1WTQA 3GTOB 4PMCA 1HFGA 4XDXA 2EJMA 1QB5D 4OL7A 1CTMA 3QIAA 2R7ZB 1H9MA 1II3A 1GHJA 5M3FB 5D3DA 3OSOA 3VYTA 5CGKA 1RTNA 3QB3A 5I2XA 2RDHA 1PTOH 1B1ZA 2QILA 2AUJD 3SK5A 5C3WA 3CRKC 4RHSA 2WKCA 1A3VA 3ITPA 2HDMA 1B9NA 2BCOA 2NTSA 4S3SA 1SJED 3S1RB 3HOXB 1BCPD 4OIKA 2BE5C 5FLXL 1B4OA 3QG1A 2DN8A 2PW7A 3MZ5A 2QF7A 2M2LA 5KEEA 4CKEA 4NMZA 3LX0A 2A5HA 3IFDA 5JAVA 5M5YB 4TSSA 2EE1A 2L55A 3JAME 3U9OA 5C3EB 4K14A 3CHBD 3M7GA 3PO2B 1PZJD 2RSOA 2CQAA 1LT3D 1WCMB 1PRTC 5NUCA 3VR3A 2F0MA 3Q24A 1LV9A 4DN4M 1PTOD 2K04A 4CKBA 2NVQB 4ZYSA 1S5FD 4OHJA 1LTID 2QCPX 5KNBA 3K59A 1WD0A 1KDBA 1RKNA 1GOZA 3SK6A 1WTWA 3A56A 4BY1B 4A3KB 1A6XA 4C3IB 2MUYA 3HP3A 1F2YA 2WKDA 1PFMA 3TP7A 5IGBA 2VXWA 2EVBA 2F0KA 4FF1A 2PW5A 3TZDA 5EKLA 2HQEA 2O5JC 1G6ZA 2R3ZA 4R8NA 3VYRA 2MHVA 1BUVT 5FO9B 2E2DC 1LTAD 3QJYA 4F8MA 5C5LA 1VF5C 2I07B 4HR7B 4RAUC 4V190 2X6LA 1I6HB 2F3WA 1PTOC 2AWNA 1TY0A 5M9OA 1TWCB 1ESFA 4K8IA 1EWCA 1NR4A 1Y8OB 1SNMA 4G7ZC 1QOHA 2K7VA 3TMEA 1HXYD 2D2CC 1NAPA 3M4YA 1A15A 3TDQA 3FDTA 2L9HA 1B3AA 4M8AA 2A74C 2RKSA 2CHBD 4J8QA 1HQMC 5I9PA 1M4VA 3I4LA 2PQEA 1SAPA 4P2CB 1TS5A 4BWGB 4I65A 1CQFA 5DNFA 1I4GA 1Q1EA 3RD4A 4HCEA 4IN3A 3TSSA 4F88A 5JEAG 3V05A 4OO1G 1PDQA 3MFGA 1WTXA 3NBHA 3A7AB 1ZXTA 3QWNA 2B2UC 2LS01 2B2TA 2KOLA 4BBSB 4DXGA 1CM9A 2C5CA 4CJ1B 1YNND 1LTRD 4XYQA 3Q23A 1CA5A 4CHTB 1RODA 1SJHD 5I6YA 1EY5A 1HTLD 4UAIA 1DM0B 1CI3M 4EQNA 1TWAB 1KNAA 1F9RA 3PUYA 1D2BA 4C3JB 1NR2A 2F0EA 1RJTA 2K5WA 3GTLB 2KQ3A 2XIWA 4LJZC 1GUGA 3SDZA 4RGNA 2KA7A 1SYCA 2F0UA 4FYDA 3I3CA 4IUVA 4B08A 1Q1BA 4FP5D 3EVQA 1F2ZA 5ELBA 4CKCA 1FNVA 2SNMA 2F0SA 1LACA 3MC0B 1HUMA 3GV3A 3ND9A 3ONAB 5CC4A 1GUWA 5ELCA 1EY4A 1R9TB 4IFDH 1S5DD 1KAAA 2RSNA 4WORA 3OW7A 1I6VC 1S5ED 5FKAC 5AFWA 4HTHA 4ILWA 3S15B 1ICWA 2KEEA 3Q22A 1BXTA 5EBCA 1EY7A 2JEAI 4FVMA 5KYLA 3NTKA 3FEWX 4C3HG 2Z4HA 1CT1D 3S1QB 3OHXC 2Z8LA 1C48A 3NP8A 1E2ZA 3HS0C 2B2WA 3M3YB 2OEOA 4M1UB 5ELEA 2E2IB 4IZ8A 3GTMB 1I50B 4K2LA 4A3FB 1DCZA 1QNKA 4DK0A 5CV9A 1VMCA 2C9OA 5G3LF 1SNDA 4K5VA 3WOEA 1SYFA 1JE4A 5CV7A 3DWPA 3T53B 3HG9A 3J7AV 2A69D 1B44D 4NP5A 3VYUA 1I4QA 2NB0A 1JC7A 3Q6SA 1SXTA 1JICA 3NHHA 4KJNA 5BN3A 2Q8RE 1AN8A 2Y0SB 2PZTA 2NTTA 1J9OA 4R8IA 3KBGA 1ESRA 4CGYB 3OWEB 2B39A 1CZWA 1Q12A 1WVLA 4KY7A 3SK4A 3SVMA 3A54A 1TY2A 2Z1CA 3MXGA 3S9WA 4KKSA 5KNDA 1IKLA 1ML0D 2RDGA 1QILA 2F1MA 5CBAE 2WV6D 3IKJA 3E5SA 4DF7A 2EY5A 3T16A 5IGFA 2BA0A 4HSPA 1U4PA 1EZ8A 2WB1B 1IW7C 4L8JA 4QUCA 4NW2A 4QUFA 5J1ZA 1GUSA 2VB2X 4IQZA 4PQXA 1JOOA 1LTSD 2NN6G 3VR4A 4RCOA 1ZEQX 1SDFA 3M7NA 1OXXK 4WFN3 5EBDA 1E2WA 4KHVA 1GXDC 1VF7A 1MSHA 3GV6A 1STHA 1TKWB 3DUZA 2IL8A 3DM1A 5C0XI 4B9XA 2LKVA 4H13C 1Q3LA 2KEDA 4ZAIA 1H9KA 3HOVB 4A3DB 1X3QA 2RBMA 3K58A 5I9OA 1STEA 4RCNA 2JP1A 1UNSA 2N55A 2EPBA 2OT2A 3N52A 3NUCA 2FINB 4ODGA 2ZXRA 3I73A 4RGOS 2L0CA 5I6WA 4OO1H 1HRJA 1QCBD 2G9DA 1U4LA 2A6HD 4RA8A 5JOBA 3LNNA 1GUOA 2YYZA 3I8ZA 4YIJA 2JSOA 3C1FA 5A2QL 3TN2A 4DAPA 4KK7A 5IGDA 3VR6A 1FNUA 5COYA 3NWSA 4C1NI 3TP8A 4WRDA 2MPMA 1EY6A 3S2HB 3AB9A 4Z9CB 3H3VC 3R8BA 2NZ1D 5C4ZA 1JWUD 3NE5B 3BG3A 1CHPD 4Y7NB 4O42A 4RHRA 3E6ZX 4LAAA 1W6JA 1XYIA 4BA1I 3D6CA 1CHQD 3C46A 2PCFB 2L1BA 2NVYB 4FXGC 3FMCA 4IALA 4IUUA 2ZXPA 2KHSA 2KVMA 3LWUA 5EPJA 5JEAH 3GQBA 1F2LA 2H1EA 3U9SA 1C4QA 3VYSA 1G2SA 3PO3B 2XSCA 4PMBA 1AW7A 1F9QA 2EY6A 4QB4A 1V1PB 1S5CD 3VA7A 2EJGC 1VDZA 4EVOA 1RCVD 1KDAA 3OOCA 1SNPA 2JEBI 4TQUS 1T5EA 3GO5A 3SE0A 2E2JB 1Y8NB 1EEFD 1EU4A 1SBBB 4U673 1Z7TA 3EFXD 5DEHA 1GHKA 2D9UA 3P1HA 2ENBA 2Q8TA 2SOBA 2F0LA 3A55A 4J6HA 2AUKA 4H7BA 3BDLA 2F0PA 2EY2A 1O7LA 3S1MB 4XT3B 1EQTA 3K5MA 3D3RA 3C3LA 2L4NA 5LL6X 4G4KA 3BYTB 1HCZA 1JOQA 1I3QB 1KNEA 2EYFA 1U4RA 4KD3A 2L5TA 1SE4A 1T5XD 3HEJA 2FHTA 2A68C 1PTOF 2QEJC 5KRUA 1EY0A 4A3BB 1HTPA 5K5PA 2L12A 2XWJB 3LWEA 4DAYA 1I4PA 1PTOB 1JOKA 3QO2A 3VR2A 3QOLA 1ZYRC 4KN4C 3PIO3 4CJ2C 5C44B 3NTHA 1JQYD 1STAA 5E1FA 1B9MA 5IIFA 1MD2D 3JAML 2VUMB 3EJIA 4DXFA 1VCIA 3I91A 3NQIA 3PV0A 4L6TB 4RGTA 2B2TC 5JVH3 1CA6A 3T13A 4MHEA 2Q8IB 2IX1A 2DNEA 2XVSA 2E74C 5IT9E 1K8MA 1AEXA 4G57A 1BCPB 2F0JA 3BZDB 3OIPA 1L0XB 5FK9C 2B8FA 1TS4A 5LL6S 1D5MC 4DK1A 3A8JE 2JYOA 5A35A 2J7ZA 4IFDI 1B53A 4KY5A 3CRLC 1LABA 1ZYRD 3H91A 3Q0AA 3S16B 4H44C 4RKBA 4X3UA 1PMRA 4KN7C 3MWYW 2A6EC 4A3MB 1BR9A 4CJ0B 2XWBB 5FO7B 2NN6H 1SYEA 3NQTA 5ISRA 4FF3A 1HUNA 1KDCA 1PFNA 4AYBB 2FMCA 1PYWD 1Y69U 1JORA 2K5QA 3RUZA 4N9PA 1I4XA 5IT9L 3V2TA 5BN4A 2Z4IA 1D5XC 2PPBC 3S17B 1IYVA 2PZUA 3W3AA 4J1MA 4RFBA 2BOSA 1S5BD 4G7OC 2F0HA 5CV5A 3NTIA 5IGCA 1O7ZA 3DXJC 4FXDA 1TR5A 2B2WC 3K0YA 5CBEE 5KNCA 1D1IA 1PRTD 4C2MB 1EY8A 3TP6A 4E6IA 3VR5A 4NDXA 4IFDJ 1QG7A 3MHBA 2NVXB 4IUQA 2HCCA 1D1KA 1X3PA 5EKKA 1G2TA 3H09A 1D6EC 2PNRC 2K33A 4KKUA 3X3NA 4FF2A 1I4HA 5JPNC 2O2LD 3GP7A 2A69C 3KF8A 2EYHA 4FXKC 5EGTA 2X6GA 3PIP3 2F0QA 1Q90A 1YNJC 2EYPA 3I4NB 1XXGA 4OGQC 1DYQA 2IW3A 1SE2A 3H6MA 4L63B 2FMMA 3G6JB 1KLUD 1H9JA 1BBXC 1TWFB 4K5WA 1BOSA 5CV4A 3C2PA 3W2DA 1ENFA 2HCIA 2E2HB 2KCCA 1AP0A 2E76C 1A2UA 3J80E 1ZKOA 2EOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IL8 A;  1WTQ A;  5CMD A;  3I8Z A;  1HFN A;  4IUT A;  1RHP A;  1HHV A;  4CJ2 C;  1LV9 A;  1IKL A;  3I90 A;  1DON A;  4DN4 M;  5DNF A;  2K04 A;  5JJZ A;  1ML0 D;  2B2Y C;  1HFG A;  2HUG A;  2RA4 A;  4XDX A;  3TN2 A;  5CBA E;  1AZP A;  1DZ1 A;  1EOT A;  5EKI A;  1F9S A;  1B50 A;  1BO0 A;  4XT1 B;  4HSV A;  1WTP A;  2MGS A;  1WD1 A;  1EL0 A;  5COY A;  1O7Z A;  3I91 A;  2B2W A;  4IUR A;  3UI2 A;  1WD0 A;  2B2W C;  5CBE E;  1ILQ A;  1U4P A;  2BDN A;  1PDQ A;  1SSO A;  1WTR A;  1MSG A;  1RTO A;  1WTX A;  5COR A;  1WTW A;  1ZXT A;  1XX8 A;  2K28 A;  2B2U C;  1EIG A;  4NW2 A;  2MPM A;  2D9U A;  4QUC A;  4RWS C;  4QUF A;  4ZK9 B;  2B2T C;  3HP3 A;  3KUP A;  1CA6 A;  4MHE A;  2B2T A;  1TVX A;  2K03 A;  2Q8T A;  2KOL A;  2CVR A;  1PFM A;  3G7L A;  1B2T A;  2VXW A;  1PFB A;  2K01 A;  1WTV A;  1ILP A;  5EQ0 A;  1IKM A;  2NZ1 D;  1NCV A;  1CM9 A;  1QG7 A;  3TZD A;  1QE6 A;  1QNK A;  1X32 A;  5EJW A;  3FPU B;  1SDF A;  1RTN A;  1VMC A;  2FFK B;  2HCC A;  4IUQ A;  4CJ1 B;  1WTO A;  2MP1 A;  1X3P A;  2HDL A;  3F2U A;  1G6Z A;  2K1B A;  2R3Z A;  4O42 A;  1CA5 A;  4HCS A;  2NWG A;  4U68 A;  2MJ8 A;  1G2T A;  1DOK A;  5EPK A;  1JE4 A;  3MTS A;  4XT3 B;  1IL8 A;  3DEO A;  1EQT A;  1DOL A;  1XYI A;  1ROD A;  2JYO A;  1MI2 A;  5T1I A;  1PLF A;  5E4W C;  1C8C A;  2J7Z A;  1BNZ A;  2N88 A;  4UAI A;  1MSH A;  2B2Y A;  4X3K A;  2L1B A;  3GV6 A;  1B53 A;  1KNA A;  1DOM A;  1F9R A;  2KUM A;  1M8A A;  4RAU C;  4ZLT F;  1O80 A;  1NR2 A;  2IL8 A;  3DM1 A;  1RJT A;  2B2U A;  1O7Y A;  2X6L A;  2X69 A;  2HDM A;  3H91 A;  2XIW A;  4X3T A;  2L4N A;  4IUP A;  1Q3L A;  4IUU A;  2KED A;  4MN3 A;  1HA6 A;  2KVM A;  2FJ2 A;  4X3S A;  4ZAI A;  2X6G A;  5EPJ A;  1EIH A;  3Q6S A;  2NYZ D;  2DY8 A;  1JIC A;  1X3Q A;  3I3C A;  4IUV A;  3P7J A;  5EPL A;  4X3U A;  1F2L A;  2H1E A;  3MWY W;  4ZKB B;  3DEP A;  1NR4 A;  2K05 A;  4OIK A;  1U4M A;  1G2S A;  1B4O A;  2KEC A;  2SDF A;  1SAP A;  1KNE A;  2Q8R E;  2M2L A;  2FMM A;  1F9Q A;  4HAE A;  5D14 A;  4LMQ D;  4CJ0 B;  1U4R A;  1NAP A;  2JP1 A;  3IFD A;  1S4Z A;  2N55 A;  3D6W A;  1HUM A;  2EPB A;  1A15 A;  3GV3 A;  3ONA B;  1J9O A;  5T1G A;  1J8I A;  1GUW A;  2EE1 A;  4OIJ A;  1BBX C;  3N52 A;  3FDT A;  2L9H A;  4R8I A;  2FIN B;  1HUN A;  2FHT A;  3KBX A;  2L11 A;  1MGS A;  1B3A A;  1ESR A;  5E4X A;  2B2V C;  4R9W A;  1PFN A;  2HCI A;  1G91 A;  5D65 A;  2B2V A;  2RSN A;  1E0B A;  2RSO A;  1AZQ A;  5AFW A;  4HED A;  1WVL A;  1HRJ A;  3R93 A;  2DY7 A;  1AP0 A;  2RVL A;  2L12 A;  1U4L A;  3LWE A;  4RA8 A;  3SVM A;  1VMP A;  1ICW A;  3QO2 A;  2KEE A;  1BF4 A;  1F9P A;  4ZKC B;  2EOT A; 
#chains in the Genus database with same CATH topology
 3K7U C;  2AQ1 B;  3S14 H;  1HHV A;  1JB3 A;  4CDE C;  3T1Y Q;  3RZO H;  2F0N A;  3M4Q A;  3AFP A;  1CKN A;  4ZQ3 A;  5H1S E;  4C1N K;  2GN5 A;  2F0W A;  3PO3 G;  5M3M H;  4A3L G;  1TII D;  2EXZ A;  1YNJ D;  3HOV H;  2UU9 L;  2BDN A;  2DNC A;  3W1G A;  1RTO A;  1GKH A;  1TQO A;  2QGQ A;  3URY A;  1Y1W G;  3H3V H;  3GTG H;  3FKI B;  4CBV A;  2CVR A;  1ILP A;  1OXS C;  2R7Z H;  2PMZ E;  1AE2 A;  4AQY L;  1WTO A;  2BA1 A;  1U0L A;  5CYU A;  2OXP A;  2JA7 H;  1W6K A;  2ZJQ A;  5C0X G;  2WII B;  2F4I A;  4DV1 L;  4LF8 L;  1VQJ A;  2XTI A;  1PH5 A;  1K8A C;  4Q0F A;  2N88 A;  4DFA A;  1JR0 D;  4K2K A;  1RL2 A;  5JJZ A;  2K5H A;  2A68 D;  1YHA A;  1LTB D;  2X69 A;  2JA8 B;  5HGT A;  4X3T A;  4MN3 A;  2XRQ D;  1S72 A;  4JYA L;  4KMU C;  3T56 B;  4AIM A;  2H4O A;  5EPL A;  1ASZ A;  1I4R A;  4MTK A;  4ZKB B;  1G8Z D;  1C7Y A;  5FO8 B;  4HJ5 A;  1LM0 A;  3I2Z A;  4EQP A;  4XXE A;  1STN A;  1KTK A;  2HT1 A;  5C6A A;  4A3G B;  5D14 A;  4HAE A;  3BDO A;  2IX3 A;  2MNA A;  1BBU A;  1YZ6 A;  1K0R A;  2NBF A;  1LTT D;  4JI3 L;  5IWA Q;  4O1N A;  3SK8 A;  3GTJ B;  1SRU A;  1OXV A;  1EYA A;  4GN5 A;  3TS0 A;  1Q8K A;  1WFQ A;  4LF6 L;  5C44 G;  1E24 A;  3R2T A;  5D3I B;  3KDF B;  3CF5 A;  2SNS A;  4HJA A;  2TSS A;  5HGQ A;  4A3M H;  4DR2 L;  1DJR D;  4OXP A;  2ZJP A;  4GOP B;  1AZQ A;  4N9T A;  1RF2 D;  2AQ3 B;  4KY6 A;  3CCJ A;  4DAM A;  4YCV A;  1JJ2 A;  2E75 C;  2K52 A;  2KUM A;  2BH8 A;  5IYC H;  4IUT A;  4X64 L;  1WI5 A;  4O2D A;  5LMN Q;  3I90 A;  1KD1 C;  4F87 A;  2KJX A;  2F4V Q;  2JJQ A;  3F2B A;  1F9S A;  5HUR A;  3JAM c;  1BO0 A;  3HOU H;  1GUN A;  1KAB A;  5C3X A;  3MXN B;  1N36 Q;  1XPU A;  2ZT9 C;  3FRP B;  5LMU L;  2D0P A;  1WTR A;  1SFO B;  4B3R L;  4UPA A;  2LSS A;  1EIG A;  2VB3 X;  4JCV E;  3JC6 6;  1LT4 D;  3G4S A;  2WAQ G;  2VL6 A;  1HPC A;  4A93 B;  1TS3 A;  2CCZ A;  1JJC B;  1WTV A;  1EFI D;  2B63 B;  3MFY A;  3D4R A;  2OTL A;  5IP9 H;  3TP5 A;  4EX5 A;  3J81 L;  1PYS B;  5C4X B;  4K5X A;  1LTL A;  4GN4 B;  4HCS A;  1MJE A;  4NKL A;  2F0D A;  4ID6 A;  1STG A;  1BCP F;  4ULL A;  4DAV A;  1VQP A;  1XMQ Q;  1H9R A;  1NUC A;  2PMZ B;  2B2U A;  1O7Y A;  5M5W B;  2PO4 A;  3HOX H;  1V1P A;  3ERO A;  3KJP A;  3RNU A;  1EYC A;  2F0T A;  2ZTC A;  3L7Z C;  3EA6 A;  3DWA A;  2K6A A;  5KIX A;  2R93 B;  1KRT A;  3AFQ A;  2ASB A;  3WDN A;  4YY3 L;  4LFB L;  2UXD L;  4X64 Q;  2MO0 A;  3R3O A;  3NSW A;  5IYD G;  2EZV A;  3S17 H;  3CCM A;  1FD7 D;  2EYJ A;  4DUY Q;  4LMQ D;  3HOY B;  4XQN A;  4HID A;  2WFW A;  3J7A F;  5T1G A;  3A8K E;  4JI4 Q;  3K5L A;  1PV4 A;  3WOF A;  3HZX A;  5IWA L;  1TT2 A;  1A3T A;  1UUP A;  3HOU B;  1QUQ A;  3OPO A;  4ABN A;  4DR6 L;  3HOZ G;  2R6G A;  3KLS A;  2R92 B;  4HJ9 A;  2B2V A;  2F0O A;  1IXR A;  3BYY B;  2IX0 A;  3TZU A;  1DGS A;  4L5Q A;  4P74 A;  1K83 B;  1WOC A;  2F0F A;  3DHQ A;  2IWH A;  4ZKC B;  1HFN A;  1Y8P B;  4PMW A;  4DA2 A;  3IL8 A;  2ZM6 L;  3I72 A;  2ZXO A;  4BY7 H;  3CU7 A;  3S1Q H;  2CWP A;  2ICI A;  1K3B C;  1JWS D;  3KLW A;  3S2D H;  1EOT A;  4A3J B;  3SGI A;  1B50 A;  1V1O A;  1QUQ B;  3GTP B;  1TS2 A;  3NXW A;  2N49 A;  5KGU A;  1DD2 A;  4POF A;  2V1C C;  5LHY 1;  3G6E A;  3RLO A;  1EU3 A;  1VQA A;  1LO5 D;  1PFS A;  4JBJ A;  3UI2 A;  4AH6 A;  4OWX B;  4WJW A;  2GA4 B;  4YCU A;  3PUZ A;  2QA4 A;  1E1T A;  2PI2 E;  1XX8 A;  3OWF A;  1GJX A;  5K36 G;  1W2B A;  5GAG C;  2K03 A;  4GKK L;  3MA2 B;  1B2T A;  1PFB A;  1PRT F;  1CK1 A;  4QCL A;  3K57 A;  1IKM A;  3S2H H;  5EJW A;  4A3F G;  1F77 A;  2MP1 A;  2HDL A;  4JI6 L;  2K1B A;  1XMO Q;  3KF8 B;  1SYD A;  2NWG A;  3NBH B;  3H3V I;  3PUX A;  1QJO A;  3GD7 A;  3MTS A;  4BA2 I;  3MEF A;  3J80 L;  1SNQ A;  4QMG A;  3NEM A;  1YJN A;  3I4M G;  1TWH B;  1EYD A;  1VQG A;  4K6L A;  4X3K A;  3BDC A;  3OIQ A;  4MZ9 A;  4ZLT F;  1O80 A;  1FR3 A;  2XN9 C;  1TWH H;  4ME5 A;  4DV2 L;  1NMG A;  1OO9 B;  1J5E L;  4B3M L;  4R4I A;  1OTC A;  5FLX E;  3MEH A;  2NYZ D;  2DY8 A;  3AMU A;  3P7J A;  3HKZ B;  4JBK A;  2K14 A;  4JI2 L;  3DEP A;  5CV6 A;  3S1N B;  3FP9 A;  2Y0S E;  1XMO L;  2ATW A;  5IGG A;  2KCM A;  1PXU A;  4UDU C;  1YIJ A;  3ZYY X;  1ET9 A;  1Y1V B;  3D6W A;  3DWQ A;  3KLS X;  3S2D B;  4MIU A;  1CKN B;  2F0I A;  4EQO A;  1Y1V H;  3K5N A;  4KTA A;  2L11 A;  1XNQ Q;  1IYU A;  5A2Q E;  3M4O B;  4DNR B;  5D65 A;  2EYO A;  1PZI D;  1V8Q A;  4LF9 L;  1YEZ A;  4FNF A;  4K6D A;  3D4D A;  3ND8 A;  2B8G A;  5GAE C;  2M00 A;  2WP8 J;  2EY1 A;  4LFA L;  4GS3 A;  4HMI A;  5IYB G;  1RDP D;  4G7H C;  3J81 E;  2AMC B;  2NVY H;  4C3J G;  2RA4 A;  2AQ2 B;  1N33 Q;  5LMU Q;  4H02 A;  2RQX A;  3EN2 A;  1KLG D;  1PHJ A;  4ZUI A;  3HOZ B;  4XT1 B;  5C5M A;  1WTP A;  1EY9 A;  2F0V A;  4KJO A;  1HNW Q;  1N8R C;  4QF4 A;  1OXU A;  3IFT A;  5E3F A;  2XRS D;  1PRT B;  5COR A;  2AHO B;  3PUW A;  1VQ4 A;  3MXP A;  1TWG B;  3P75 A;  1HNX Q;  4O0A A;  3X3M A;  4DR6 Q;  2Z6B A;  1UE1 A;  1ENA A;  4P71 A;  1Z47 A;  5EQ0 A;  2JXM B;  2I0Q A;  4C3I G;  3RN5 A;  4DR7 L;  3D8G A;  1SMY C;  1X32 A;  1X3F A;  2FFK B;  3L2P A;  2K32 A;  4GKJ Q;  2O5I C;  3M3Y H;  1O78 A;  2RHS B;  4PZ6 A;  1HQR D;  2OTJ A;  1BDO A;  5BN5 A;  4DU9 A;  3EIV A;  3J7Y W;  1YBY A;  3DEO A;  2DJF C;  2VUM H;  2CW0 C;  4YWM A;  4QIW B;  1PLF A;  1C8C A;  3IAY A;  1EOV A;  2Z6K C;  1F2M A;  3GTK H;  4QL5 A;  4B9W A;  1DOM A;  1FYC A;  3SHL A;  3K7A B;  3GTK B;  1XPR A;  1HZ9 A;  3BVM A;  4DK6 C;  3HRZ C;  3K7A H;  4A3D G;  3CAM A;  4HJ7 A;  3RLF A;  2RF4 A;  1Y1W B;  1EIH A;  5M3M G;  1XJV A;  2L15 A;  4X65 L;  4A3M G;  1LLR D;  4KV6 A;  4IOC A;  2LXJ A;  1J5E Q;  2C35 B;  1R4Q B;  1GM5 A;  4H0L C;  1ICF B;  3CCR A;  3HGB A;  5AJ3 Q;  1CUK A;  1EIF A;  4A3E B;  1ET6 A;  1HZB A;  1STB A;  1B7Y B;  3PCO B;  1IHZ A;  2LY7 A;  1G29 1;  1IYJ B;  2R7Z G;  1UEA B;  1LTG D;  3KBX A;  3Q8D A;  4XTC S;  3V96 A;  1LT6 D;  1UAP A;  3S1N H;  1L0Y B;  4B3R Q;  4RGM A;  5C0X H;  3AQQ A;  1T9H A;  4HED A;  3PMF A;  4ZUJ A;  1CQV A;  3OTO L;  2RVL A;  4GKK Q;  4R1J A;  1JCK B;  5DM7 3;  3A7L A;  3F8T A;  1U9R A;  5ELD A;  4A3C G;  2WAQ B;  5M5X B;  3OYY A;  3A5Z B;  4LWC A;  5F2D A;  2UXB L;  2QKI C;  2F0G A;  1DZ1 A;  1SRO A;  1B3Q A;  3GTQ B;  4DV4 L;  3D4W A;  2NUC A;  2R61 A;  3L3O C;  3T51 B;  5IOD A;  1JJG A;  1AH9 A;  3NBI A;  1SSO A;  4GZY C;  2ZM6 Q;  2K28 A;  1Q8I A;  4ZK9 B;  3F2D A;  1KL9 A;  2PQA B;  4CDF C;  3HOX G;  2K01 A;  2I46 A;  2RDF A;  1YNN C;  1E1O A;  3T1H L;  3I4M B;  3VDY A;  3FPU B;  4BXX G;  3C1E A;  2IHE A;  3CQZ H;  3I7F A;  4DNI A;  1DOK A;  3EQL C;  2CW0 D;  5EPK A;  1TWG H;  3CME A;  1FVI A;  1SNC A;  3KLR A;  1H9S B;  4JI4 L;  1MBY A;  2QDB A;  2WAC A;  3BVG A;  2BDO A;  1BNZ A;  5J39 A;  5C4H A;  2A6E D;  1FNW A;  1E2V A;  4HIO A;  4IUP A;  2G5D A;  3L0O A;  1HA6 A;  4X3S A;  3HOU G;  3RLN A;  2VNU D;  2NVT B;  1K0S A;  1IW7 D;  1X6O A;  4FF4 A;  1CZG A;  3M4P A;  4QQB X;  2IPK D;  2SDF A;  2HD3 A;  1L1O B;  3S1M H;  4BY7 B;  3NWT A;  1MHW C;  4K8J A;  2J0T D;  4AQY Q;  1S4Z A;  1SYB A;  4X6A H;  2GVB A;  3UE1 A;  2VY3 A;  3K6O A;  3RZD B;  4LK1 C;  1IBK L;  5J22 A;  3MXN A;  1G91 A;  4XQJ A;  3SXH A;  1GUT A;  1EWH A;  1VQM A;  1CKO A;  2EDG A;  3R93 A;  4JBW A;  3D0F A;  3UDF A;  1SR3 A;  3OMC A;  1VMP A;  4NXN L;  1K8O A;  5K36 H;  1BCP C;  3N6R A;  2E2J H;  2BE5 D;  1EZ6 A;  2E5L Q;  2KCN A;  1M1K C;  3I70 A;  3ERQ A;  1SYG A;  4UP8 A;  2B2Y C;  5DM6 3;  4TKO B;  1AZP A;  3FVQ A;  3CQZ B;  1NE3 A;  4XYO A;  4HSV A;  2LFN A;  3PO2 G;  5DAU A;  5HY6 A;  2NVX H;  2JE6 I;  3KDF A;  2IT1 A;  4JI5 Q;  3TS2 A;  5JPM C;  1ILQ A;  1HZA A;  2UUB Q;  1VQB A;  2D62 A;  3D31 A;  4RWS C;  5I2Y A;  3KUP A;  2VS1 A;  1H9S A;  4JVZ A;  1TVX A;  3K5O A;  1I94 L;  5C0X J;  1TU2 B;  2EYM A;  1NCV A;  3TRE A;  5IGE A;  1ONL A;  2N8N A;  1QE6 A;  4XIG S;  2AWO A;  2EIF A;  5CR3 A;  1R4P B;  2OQK A;  3A5U A;  4U68 A;  5CV8 A;  2MJ8 A;  1PH6 A;  3JAM i;  2LXK A;  1PZK D;  1IL8 A;  2OF1 A;  1QWY A;  5M3M B;  3MAQ A;  1Y14 B;  5T1I A;  5E4W C;  1RD9 D;  3H94 A;  2B2Y A;  3FPP A;  4ZRZ A;  4YHH Q;  2EJF C;  3BU2 A;  1Y1V G;  2NN6 I;  2Z0S A;  2ZTE A;  2G9H D;  4A3E G;  1KAW A;  1EEI D;  2FJ2 A;  4HJ8 A;  1Q86 C;  3NK9 A;  3CCU A;  1E7Z A;  4PV1 C;  4GOP A;  5KYI A;  2YU9 B;  1SE3 A;  2PZW A;  2A73 B;  2K05 A;  3HKZ E;  1U4M A;  4BBR B;  2E2H H;  2UUA Q;  1EQV A;  4OO1 I;  2VZA A;  2KEC A;  4UY8 C;  1LT5 D;  4IUN A;  1QVC A;  2JA7 B;  5IYB H;  4DGZ A;  5IOC A;  3QOJ A;  3P20 A;  1I3Q H;  2PYK A;  3ICE A;  1HA5 A;  4LF8 Q;  5ELF A;  2E8G A;  3HOW B;  4OIJ A;  1Z6H A;  2IJ0 A;  3SR1 A;  1I94 Q;  4Y7N H;  2RCN A;  4Q5V A;  2WIN B;  4KD4 A;  5E4X A;  4F7X A;  2EYL A;  1A0I A;  3CCQ A;  1E0B A;  2TMP A;  2F03 A;  1XNR L;  5FLM H;  3A74 A;  5TSS A;  3VA5 A;  2DY7 A;  4PNY A;  4UP9 A;  3SEB A;  1XTC D;  1F9P A;  4KI0 A;  5M3F G;  1SMY D;  1UE6 A;  3R2I A;  5CMD A;  3CPW A;  1RHP A;  1IBM L;  3GTQ H;  4KHZ A;  3H0G B;  1DON A;  2XNA C;  4C3I H;  4I7Z C;  2HUG A;  2PNH A;  1A2T A;  2D5D A;  3RMH A;  5EKI A;  5I4D A;  3BS1 A;  3RZO B;  1VQ8 A;  2B29 A;  5BR8 L;  3PGZ A;  3BZC A;  3M85 A;  2MGS A;  1WD1 A;  4IUR A;  2VUM G;  2J4X A;  2ID0 A;  2O4X A;  1SEB D;  4DR1 Q;  4DNT B;  3L9A X;  1MSG A;  3T1Y L;  3FHW A;  2H5X A;  1LYL A;  4DV5 L;  2JA5 B;  2B3G A;  4KKT A;  5IYD H;  1CFM A;  5JVG 3;  4JI1 Q;  2QDL A;  4LUV A;  3G7L A;  2I5L X;  5C4X G;  1Q82 C;  3GTG B;  3NEN A;  3OMG A;  2NZH A;  1NSN S;  4IFD G;  3F2U A;  3AU7 A;  4HMJ A;  1FGB D;  1UWV A;  1VQ9 A;  1SNO A;  2V4D A;  2JA6 B;  4RKL A;  4GLV B;  1DOL A;  1MI2 A;  2I5M X;  2OQ0 A;  2K5D A;  3MVV A;  1STY A;  5JEA J;  3KK7 A;  1X9N A;  1M8A A;  1A3U A;  2SEB D;  4UHV A;  4XQQ A;  1N34 L;  3T4A C;  4FO2 A;  3S14 B;  4BY7 G;  5C4J H;  3NPP A;  3CD6 A;  5C4J B;  3CKI B;  2M9V A;  2Q2T A;  1DXM A;  1OXT A;  1MJC A;  3TBI B;  3MXU A;  4A3I B;  4V0B A;  4C3H B;  4C56 C;  1QVG A;  1ENC A;  3E0J A;  2QW7 A;  5IT9 c;  2LMC B;  3PUV A;  4JK1 C;  1JWM D;  4DKA C;  2HHH Q;  1GO3 E;  4TRD A;  5G3L D;  1AFP A;  4JPB W;  4BS9 A;  3BVZ A;  1J8I A;  4LFC L;  2N3S A;  1QNU A;  1HR0 W;  3DMU A;  1D5Z C;  2YTY A;  1MGS A;  2B2V C;  4R9W A;  1EQQ A;  1XWE A;  3J80 c;  1V43 A;  2ICE C;  2A6H C;  2F3V A;  4HN7 A;  2A8V A;  3PIO A;  1BQQ T;  4EGV A;  1VQI A;  5FOB B;  3A8I E;  2KEN A;  3O13 A;  1BF4 A;  1EL0 A;  4DV0 Q;  4RH6 A;  1D8L A;  3QR8 A;  1WTQ A;  1SFO H;  3GTO B;  4PMC A;  4I7A A;  4LFB Q;  2F52 A;  1HFG A;  4XDX A;  5M5Y H;  2EJM A;  1QB5 D;  4OL7 A;  4IPG A;  1CTM A;  3QIA A;  2R7Z B;  1H9M A;  3OTO Q;  1II3 A;  1WYD A;  3CW2 C;  4DV3 L;  1SE8 A;  1WCM H;  2UUC L;  1VQK A;  1GHJ A;  4QGU A;  5M3F B;  5D3D A;  3OSO A;  4N8X 1;  2NZO A;  3VYT A;  5CGK A;  4L5R C;  1RTN A;  3QB3 A;  5I2X A;  1VS0 A;  2N78 A;  4ALP A;  1Q7Y C;  2RDH A;  1PTO H;  5EAY A;  1B1Z A;  3ZJY C;  4A3B G;  2QIL A;  1C9O A;  2AUJ D;  3SK5 A;  5C3W A;  2AKW B;  3DM3 A;  3CRK C;  4RHS A;  2WKC A;  3PIP A;  1A3V A;  3ITP A;  2HDM A;  4DR3 L;  5ELO A;  1N36 L;  4C3J H;  1B9N A;  1X65 A;  4JC0 A;  4KHP Q;  2BCO A;  2NTS A;  4BBR H;  1EQR A;  1GVP A;  4S3S A;  3TQY A;  3EBE A;  1SJE D;  3S1R B;  3HOX B;  4NXN Q;  1BCP D;  2D0O A;  3I4N H;  2F4V L;  4OIK A;  4UP7 A;  2BE5 C;  5FLX L;  3HFZ B;  1B4O A;  1K9M C;  3E9I A;  3QG1 A;  2DN8 A;  2PW7 A;  4A75 A;  3MZ5 A;  2QF7 A;  2M2L A;  5KEE A;  2ALY B;  1IBK Q;  3ER0 A;  4NMZ A;  3LX0 A;  4CKE A;  4DV6 Q;  2A5H A;  3IFD A;  5JAV A;  4A93 G;  5M5Y B;  4GNX B;  4TSS A;  2EE1 A;  2L55 A;  1K28 A;  3JAM E;  3U9O A;  3HOY H;  1GD7 A;  4BXX H;  5J3B A;  4JI7 Q;  2WB1 G;  5C3E B;  2UUC Q;  1TWF H;  3PO2 H;  4K14 A;  3CHB D;  2WB1 E;  3M7G A;  1K3R A;  3PO2 B;  1PZJ D;  2RSO A;  3U58 A;  2CQA A;  1LT3 D;  1WCM B;  1Q81 C;  1HNW L;  1PRT C;  5NUC A;  2VQE L;  4B3T Q;  3VR3 A;  3KYH C;  4BBS G;  2F0M A;  3Q24 A;  1LV9 A;  4DN4 M;  1PTO D;  2K04 A;  1PH2 A;  4LF7 Q;  1A8V A;  4CKB A;  2Z9H A;  2NVQ B;  4ZYS A;  1S5F D;  2R93 G;  4OHJ A;  4B3S L;  1LTI D;  2QCP X;  4DPG A;  5KNB A;  3K59 A;  1WD0 A;  1KDB A;  1RKN A;  1GOZ A;  3SK6 A;  1WTW A;  3A56 A;  5IY0 A;  4BY1 B;  4A3K B;  1A6X A;  4C3I B;  2MUY A;  2YTX A;  1F2Y A;  2WKD A;  3HP3 A;  3K0X A;  4DR5 L;  1PFM A;  4DV1 Q;  3TP7 A;  5IGB A;  2VXW A;  2EVB A;  3A0J A;  2RCF A;  3LGJ A;  2F0K A;  4FF1 A;  2PW5 A;  3TZD A;  5EKL A;  2JA6 H;  2HHH L;  2HQE A;  4IPH A;  2O5J C;  1G6Z A;  2R3Z A;  3AEV A;  4R8N A;  3VYR A;  2MHV A;  1BUV T;  5FO9 B;  2E2D C;  1LTA D;  3J7Z C;  3CCV A;  3QJY A;  4F8M A;  5C5L A;  4X66 L;  1VF5 C;  2JA8 G;  2Z6K A;  2I07 B;  4HR7 B;  4YWK A;  1EWI A;  3KOJ A;  4RAU C;  2UXD Q;  5IE8 A;  4V19 0;  2X6L A;  1KHI A;  4A3C H;  1I6H B;  2GVA A;  2F3W A;  1PTO C;  1KXL A;  2AWN A;  1VQ5 A;  1TY0 A;  4B3T L;  5M9O A;  1I6H H;  4GN3 B;  1TWC B;  1ESF A;  3PQI A;  4K8I A;  1EWC A;  1NR4 A;  1Y8O B;  4IPC A;  3K81 C;  1SNM A;  3H0G H;  3S24 A;  4G7Z C;  1QOH A;  2K7V A;  3TME A;  1HXY D;  2D2C C;  1NAP A;  3M4Y A;  4A3G G;  1A15 A;  3S15 H;  3PSI A;  1W3S A;  4OEL B;  3TDQ A;  3FDT A;  4RG1 A;  2L9H A;  2DGY A;  2Q2I A;  1QZH A;  5LMN W;  4MTN A;  1B3A A;  4M8A A;  4WJ4 A;  2A74 C;  2RKS A;  2CHB D;  4J8Q A;  5E7N A;  1HQM C;  4A3I H;  5I9P A;  4OWT B;  1M4V A;  3I4L A;  2PQE A;  3CP0 A;  1SAP A;  3I56 A;  5BR8 Q;  4L5S A;  4P2C B;  3CCE A;  1TS5 A;  2MQH A;  2BH2 A;  4BWG B;  4I65 A;  4A3E H;  4LF7 L;  1CQF A;  5DNF A;  4LF5 Q;  1I4G A;  3AYH B;  1YI2 A;  1Q1E A;  1X3E A;  3RD4 A;  4HCE A;  4IN3 A;  3TSS A;  4F88 A;  1JE5 A;  5JEA G;  3KFU A;  4GNX C;  3V05 A;  3E9H A;  4OO1 G;  5LMN L;  1PDQ A;  3MFG A;  1WTX A;  1LUZ A;  3NBH A;  3A7A B;  1ZXT A;  3QWN A;  1VQN A;  2B2U C;  1HR0 Q;  1BBW A;  1IBL L;  2LS0 1;  1CKM A;  2B2T A;  2KOL A;  4BBS B;  4DXG A;  1CM9 A;  2C5C A;  4CJ1 B;  1YNN D;  4DUZ L;  1LTR D;  1HR0 L;  4XYQ A;  3Q23 A;  5FLM G;  2R7F A;  1CA5 A;  4CHT B;  1AE3 A;  1L0W A;  1ROD A;  1SJH D;  1YVC A;  5I6Y A;  1L1O C;  1EY5 A;  2MFI A;  1HTL D;  2A19 A;  5M3F H;  4J15 A;  4UAI A;  1DM0 B;  1CI3 M;  4EQN A;  1TWA B;  4A3K G;  1BKB A;  1KNA A;  1F9R A;  2FXQ A;  1Z9F A;  3PUY A;  4C3J B;  1D2B A;  1NR2 A;  2F0E A;  1RJT A;  2K5W A;  3GTL B;  2UXC L;  4LJZ C;  2KQ3 A;  2XIW A;  3F1Z A;  4IO9 A;  1GUG A;  3SDZ A;  4YHH L;  2JA5 G;  4RGN A;  2KA7 A;  2CKZ B;  1SYC A;  2F0U A;  4FYD A;  2VQF L;  3I3C A;  4IUV A;  4B08 A;  1Q1B A;  4FP5 D;  2JN4 A;  1NTG A;  1VQF A;  3EVQ A;  3M4O H;  1HH2 P;  1F2Z A;  5ELB A;  4CKC A;  5FLX c;  1FNV A;  3GDE A;  2SNM A;  4OX9 Q;  2F0S A;  1LAC A;  1N9W A;  3G71 A;  3MC0 B;  1HUM A;  3GV3 A;  3ND9 A;  3ONA B;  5CC4 A;  3CXC A;  1GUW A;  3FKI G;  5ELC A;  1EY4 A;  1HNZ Q;  1R9T B;  3KJO A;  4IFD H;  1S5D D;  1KAA A;  1SLJ A;  2EQS A;  2RSN A;  4WOR A;  3OW7 A;  1I6V C;  2R92 H;  3J80 i;  1S5E D;  5FKA C;  5AFW A;  4HTH A;  4AYB G;  4ILW A;  3S15 B;  1ICW A;  3GTJ H;  2KEE A;  3Q22 A;  1BXT A;  5EBC A;  1EY7 A;  1NNX A;  2JEA I;  4FVM A;  5KYL A;  3NTK A;  3FEW X;  3ULL A;  4A3J G;  4C3H G;  4LNQ A;  2Z4H A;  4P72 A;  1CT1 D;  3S1Q B;  3OHX C;  2Z8L A;  1C48 A;  3NP8 A;  1E2Z A;  2Q2U A;  1HJP A;  3HS0 C;  4GLA C;  5GRO A;  1QZG A;  2B2W A;  3CC7 A;  1EYG A;  3M3Y B;  2OEO A;  2E2I H;  4JI6 Q;  4IPD A;  4X66 Q;  4M1U B;  5ELE A;  2E2I B;  4IZ8 A;  4P75 A;  3GTM B;  1NMF A;  1JMC A;  1I50 B;  4K2L A;  1B70 B;  2DJG C;  3STB C;  4A3F B;  1XNR Q;  1DCZ A;  4YWL A;  4JI8 L;  1QNK A;  4DK0 A;  5CV9 A;  1VMC A;  2C9O A;  5G3L F;  3ERS X;  5DLQ E;  4ME3 A;  1SND A;  4YCW A;  4K5V A;  3WOE A;  1SYF A;  1JE4 A;  3M9B A;  4CDD C;  5CV7 A;  3DWP A;  4A93 H;  3T53 B;  3HG9 A;  3J7A V;  1FGU A;  4JYA Q;  2A69 D;  5GQO A;  1B44 D;  4NP5 A;  4K0K L;  3VYU A;  1L1O A;  1I4Q A;  2NB0 A;  1JC7 A;  2VQF Q;  3Q6S A;  1V1Q A;  1SXT A;  4IOA A;  1JIC A;  3ULJ A;  1CSQ A;  1I5F A;  1E3P A;  3NHH A;  4JI0 L;  4KJN A;  4DAY B;  4FDB A;  2YV5 A;  1WCM G;  5BN3 A;  2Q8R E;  1AN8 A;  2Y0S B;  5IP7 H;  2PZT A;  2ES2 A;  3J7A 5;  2NTT A;  3T1H Q;  1VQC A;  1J9O A;  4R8I A;  3KBG A;  5C4X H;  3IRB A;  3PF5 A;  1ESR A;  4CGY B;  4TVA B;  3OWE B;  1UEB A;  4JI7 L;  2B39 A;  1HNZ L;  1CZW A;  1Q12 A;  3RZD H;  1PH3 A;  1WJJ A;  1WVL A;  1VQO A;  4POG A;  4KY7 A;  3CPF A;  3SK4 A;  3SVM A;  3A54 A;  1TY2 A;  2Z1C A;  3MXG A;  4DV4 Q;  1R9T H;  3S9W A;  5AJ3 L;  1WTH A;  4KKS A;  5KND A;  1IKL A;  2UXB Q;  1S40 A;  1ML0 D;  2KHJ A;  2RDG A;  1QIL A;  3CCL A;  2F1M A;  5CBA E;  2CQO A;  2WV6 D;  2I5H A;  3IKJ A;  3E5S A;  4DF7 A;  2EY5 A;  3T16 A;  5IGF A;  3K80 C;  1UE7 A;  4QIW E;  3S16 H;  2BA0 A;  5JJL A;  4HSP A;  1U4P A;  1FJG L;  1EZ8 A;  2WB1 B;  5C3E G;  1IW7 C;  4L8J A;  4QUC A;  2JA8 H;  4NW2 A;  4QUF A;  2B63 H;  5J1Z A;  1GUS A;  4DK3 C;  2VB2 X;  4IQZ A;  4PQX A;  3HOY G;  1JOO A;  1S3O A;  1LTS D;  2NN6 G;  4LW1 A;  1A62 A;  3VR4 A;  4RCO A;  4EQ5 A;  1HZC A;  1ZEQ X;  1SDF A;  3M7N A;  1OXX K;  4WFN 3;  5EBD A;  1E2W A;  4KHV A;  1GXD C;  2HQL A;  1VF7 A;  1JT8 A;  1I50 H;  4BBS H;  1MSH A;  1HNX L;  3UDG A;  3GV6 A;  1STH A;  1TKW B;  3DUZ A;  2IL8 A;  3DM1 A;  5C0X I;  4B9X A;  2LKV A;  4JI0 Q;  4H13 C;  3GTP H;  1Q3L A;  2KED A;  1KC8 C;  2R93 H;  1PVO A;  4BY1 G;  4ZAI A;  1E22 A;  1H9K A;  4GNX A;  3HOV B;  4A3I G;  1XPO A;  4A3D B;  4PG3 A;  1X3Q A;  2K5V A;  2RBM A;  3K58 A;  1K8G A;  4R4C A;  5I9O A;  1TWA H;  4K0K Q;  1STE A;  5IYC G;  4DUZ Q;  2HIV A;  4RCN A;  4DV0 L;  2JP1 A;  1UNS A;  2N55 A;  2EPB A;  4HIM A;  4JOI C;  1IL2 A;  2OT2 A;  5JJK A;  3N52 A;  3NUC A;  2FIN B;  1FL0 A;  4ODG A;  2ZXR A;  3I73 A;  4RGO S;  2P5Z X;  4N8F A;  2L0C A;  5I6W A;  4OO1 H;  2UUB L;  1HRJ A;  2NVT H;  1L2F A;  2ZJR A;  1QCB D;  2G9D A;  1U4L A;  2A6H D;  4PZ7 A;  4RA8 A;  5JOB A;  3LNN A;  1KQS A;  1GUO A;  2YYZ A;  1PH1 A;  3I8Z A;  4YIJ A;  1N33 L;  4P73 A;  2JSO A;  2JQO A;  3C1F A;  5A2Q L;  3TN2 A;  4DAP A;  4KK7 A;  1V9P A;  3VR6 A;  5IGD A;  4CDC C;  1FNU A;  4BBR G;  4B3M Q;  5COY A;  4GOP C;  3NWS A;  4C1N I;  1N34 Q;  4WJ3 M;  2QEX A;  2YU9 H;  3I4N G;  3GTM H;  3TP8 A;  4JOI A;  4WRD A;  1C0A A;  3I55 A;  3GTL H;  3K8A A;  2MPM A;  1N32 Q;  1EY6 A;  3KF6 A;  3AB9 A;  3UDI A;  4Z9C B;  3HOW G;  3S2H B;  4JI8 Q;  1CSP A;  3H3V C;  4NXM Q;  3R8B A;  2NZ1 D;  5C4Z A;  4JI1 L;  1JWU D;  1EUJ A;  3BJU A;  3NE5 B;  3BG3 A;  1CHP D;  4Y7N B;  4O42 A;  4RHR A;  1KRS A;  4OWW B;  3E6Z X;  4LAA A;  1W6J A;  1NY4 A;  1VQ6 A;  1PH9 A;  1XYI A;  4DR5 Q;  5GAD C;  1A63 A;  4BA1 I;  3D6C A;  1CHQ D;  2IY5 B;  3C46 A;  2PCF B;  2L1B A;  2NVY B;  4FXG C;  2Q2H A;  2VW9 A;  1K73 C;  3FMC A;  3HOZ H;  4IAL A;  4IUU A;  3H15 A;  2ZXP A;  3RN2 A;  2KHS A;  2KVM A;  3LWU A;  4JBM A;  5EPJ A;  1YHQ A;  4B3S Q;  5JEA H;  3GQB A;  4LUZ A;  2IHF A;  4OEM B;  3F2C A;  1F2L A;  2H1E A;  3U9S A;  2NVQ H;  1C4Q A;  1VQL A;  2UXC Q;  3VYS A;  1G2S A;  3PO3 B;  2XSC A;  3E3X A;  1X3G A;  2JK8 A;  4PMB A;  1AW7 A;  1F9Q A;  4A3B H;  2EY6 A;  1Q46 A;  4QB4 A;  1V1P B;  4A3J H;  1S5C D;  4RMF A;  3CMA A;  1MIU A;  3VA7 A;  3RR5 A;  4R4Q A;  2EJG C;  3DLL A;  1VDZ A;  5ELN A;  1J6Q A;  4EVO A;  1RCV D;  1KDA A;  2JA6 G;  3OOC A;  1O7I A;  1SNP A;  2JEB I;  4DV6 L;  4TQU S;  1T5E A;  1IBL Q;  4ZCK A;  4PZ8 A;  2KHI A;  4A4I A;  4DUY L;  4X65 Q;  3GO5 A;  4AYB E;  3CC4 A;  1BVS A;  3SE0 A;  2K50 A;  1YJ9 A;  1KIX A;  2E2J B;  1Y8N B;  2UUA L;  4LUO A;  1EEF D;  2JA5 H;  2YTV A;  3PF4 A;  1EU4 A;  2ZTD A;  5FJ8 H;  3G48 A;  1SBB B;  4U67 3;  1Z7T A;  2VQE Q;  3EFX D;  1XTD A;  4NB3 A;  5DEH A;  4LF5 L;  4QY7 A;  1GHK A;  4DV7 L;  2D9U A;  3BZK A;  1MKH A;  3P1H A;  2ENB A;  2Q8T A;  4X62 Q;  4A3G H;  2CH4 A;  5GAH C;  2SOB A;  2F0L A;  3A55 A;  4J6H A;  2K4K A;  4L5T A;  2AUK A;  4H7B A;  3BDL A;  3NEL A;  2F0P A;  4IJH A;  3PO3 H;  2EY2 A;  1NJI C;  4YY3 Q;  1O7L A;  3S1M B;  4A3L H;  4LFC Q;  4XT3 B;  1EQT A;  3K5M A;  3W5O A;  3HOV G;  3D3R A;  1H95 A;  3C3L A;  4C3H H;  1Y1W H;  1FJG Q;  4JI2 Q;  2RHQ B;  1X55 A;  2L4N A;  4GLX A;  1SMX A;  5LL6 X;  3UDX A;  4G4K A;  3BYT B;  1HCZ A;  4JV5 Q;  4R4T A;  1JOQ A;  1PH4 A;  3U4Z A;  4DV2 Q;  2JA7 G;  1G6P A;  4LF9 Q;  1I3Q B;  1KNE A;  3HKZ G;  1G51 A;  3OW2 A;  2EYF A;  2A1A A;  1U5K A;  1U4R A;  4KD3 A;  3TEH B;  1SN8 A;  2L5T A;  1SE4 A;  2K75 A;  4QJF A;  1PH7 A;  1T5X D;  3HEJ A;  4X62 L;  3GTO H;  2FHT A;  2A68 C;  4C2M H;  1YIT A;  1PTO F;  1VQD A;  3J81 c;  4DV3 Q;  4DV7 Q;  2QEJ C;  5IP9 G;  2OCE A;  4LF6 Q;  2CH4 W;  5KRU A;  1EY0 A;  1B8A A;  5C3E H;  1X54 A;  4A3B B;  4NXM L;  1HTP A;  5K5P A;  4JI3 Q;  2L12 A;  1EIY B;  2XWJ B;  3LWE A;  4DAY A;  2B63 G;  1I4P A;  1PTO B;  1JOK A;  3QO2 A;  4OON A;  3VR2 A;  1N32 L;  3QOL A;  4DV5 Q;  3U50 C;  1ZYR C;  3H0G G;  4KN4 C;  3PIO 3;  4CJ2 C;  4MNO A;  1P16 A;  5C44 B;  3NTH A;  1JQY D;  1STA A;  5E1F A;  1B9M A;  5IIF A;  1MD2 D;  3JAM L;  4LFA Q;  5M5W H;  5C44 H;  2VUM B;  1TXY A;  3EJI A;  4DXF A;  1VCI A;  3I91 A;  4JW0 A;  2JA9 A;  5IP7 G;  2WAQ E;  3NQI A;  4DR4 Q;  3PV0 A;  4L6T B;  4RGT A;  2B2T C;  5JVH 3;  1CA6 A;  3T13 A;  4MHE A;  2Q8I B;  2IX1 A;  2DNE A;  2XVS A;  2E74 C;  5IT9 E;  3FKI H;  1K8M A;  1X56 A;  2XGT A;  1AEX A;  4G57 A;  1BCP B;  2F0J A;  2CWA A;  3BZD B;  3OIP A;  1D7Q A;  4DR4 L;  1L0X B;  5FK9 C;  2B8F A;  1TS4 A;  4NPS A;  5LL6 S;  1D5M C;  3ULP A;  2R92 G;  2MO1 A;  4DK1 A;  2F3I A;  3A8J E;  2JYO A;  5A35 A;  1IZ6 A;  2J7Z A;  4IFD I;  1B53 A;  4APV A;  1K83 H;  4KY5 A;  3CRL C;  1LAB A;  1ZYR D;  2UU9 Q;  3H91 A;  1PA6 A;  3Q0A A;  3CC2 A;  3S16 B;  4H44 C;  4KHP L;  4RKB A;  4X3U A;  1PMR A;  4KN7 C;  3MWY W;  1ASY A;  2A6E C;  4DR3 Q;  4A3M B;  3WWV A;  4JG2 A;  1IBM Q;  5M5X H;  1XMQ L;  1YJW A;  1BR9 A;  4CJ0 B;  2XWB B;  5FO7 B;  1PYB A;  2NN6 H;  3I4O A;  4A3K H;  1SYE A;  1VQ7 A;  3NQT A;  1P8L A;  5ISR A;  4FF3 A;  1HUN A;  1KDC A;  3E0E A;  1PFN A;  4AYB B;  2FMC A;  1PYW D;  4A3F H;  3U4V A;  1Y69 U;  1JOR A;  4DR1 L;  3S1R H;  2K5Q A;  3RUZ A;  4N9P A;  1I4X A;  5IT9 L;  3HOW H;  3V2T A;  5BN4 A;  4JV5 L;  2Z4I A;  3B6Y A;  2OWO A;  1D5X C;  4OX9 L;  2PPB C;  3S17 B;  1IYV A;  4A3D H;  2PZU A;  4BY1 H;  3W3A A;  5JJI A;  4J1M A;  4RFB A;  1PH8 A;  2BOS A;  1S5B D;  2PQA A;  4G7O C;  2F0H A;  3UE0 A;  5CV5 A;  3NTI A;  4A76 A;  5IGC A;  1O7Z A;  3DXJ C;  1QVF A;  4FXD A;  1VQH A;  3J81 i;  1TR5 A;  2B2W C;  3K0Y A;  5CBE E;  3W1B A;  1TWC H;  4HIK A;  3CCS A;  2E5L L;  1RIP A;  4GKJ L;  5KNC A;  2K5N A;  1D1I A;  1JB7 A;  4LF4 Q;  1PRT D;  4C2M B;  1EY8 A;  3TP6 A;  1EFW A;  4E6I A;  3J81 j;  3VR5 A;  4NDX A;  4DR2 Q;  4IFD J;  1QG7 A;  1YNX A;  2KBN A;  3MHB A;  2NVX B;  4IUQ A;  1UE5 A;  2HCC A;  3STB D;  1D1K A;  1X3P A;  5EKK A;  4DR7 Q;  1G2T A;  3H09 A;  1D6E C;  2PNR C;  2K33 A;  3KF6 B;  1M90 C;  5L37 A;  4KKU A;  3X3N A;  4FF2 A;  1I4H A;  2KCT A;  5JPN C;  2R7D A;  2DUD A;  2O2L D;  3GP7 A;  2A69 C;  3KF8 A;  2EYH A;  4FXK C;  5EGT A;  1NBW A;  4R4O A;  2X6G A;  4KLK A;  2F0Q A;  1Q90 A;  1YHB A;  1YNJ C;  2EYP A;  3PIP 3;  3I4N B;  1XXG A;  4IJL A;  4OGQ C;  2CFM A;  2Y0S G;  1DYQ A;  2IW3 A;  1SE2 A;  3H6M A;  4L63 B;  2FMM A;  3G6J B;  1KLU D;  1H9J A;  2EXD A;  3I4M H;  4Y52 H;  1BBX C;  1TWF B;  1VQE A;  4K5W A;  1BOS A;  5CV4 A;  5FJ8 G;  3C2P A;  4LF4 L;  3W2D A;  1ENF A;  3HKS A;  2HCI A;  1XNQ L;  2E2H B;  3TRZ A;  2KCC A;  1AP0 A;  4JI5 L;  2E76 C;  2HIX A;  2PI2 A;  1A2U A;  3J80 E;  1ZKO A;  2EOT A; 
#chains in the Genus database with same CATH homology
 2AQ1 B;  1HHV A;  1JB3 A;  2F0N A;  4ZQ3 A;  4C1N K;  2F0W A;  1TII D;  2EXZ A;  1YNJ D;  2BDN A;  2DNC A;  1RTO A;  1TQO A;  3URY A;  3FKI B;  4CBV A;  2CVR A;  1ILP A;  1OXS C;  1WTO A;  2BA1 A;  5CYU A;  2OXP A;  1W6K A;  5C0X G;  2WII B;  2F4I A;  4Q0F A;  2N88 A;  4DFA A;  1JR0 D;  4K2K A;  5JJZ A;  2A68 D;  1LTB D;  2X69 A;  2JA8 B;  5HGT A;  4X3T A;  4MN3 A;  2XRQ D;  4KMU C;  3T56 B;  2H4O A;  5EPL A;  1I4R A;  4ZKB B;  1G8Z D;  5FO8 B;  4EQP A;  4XXE A;  1STN A;  1KTK A;  5C6A A;  4A3G B;  5D14 A;  4HAE A;  3BDO A;  2IX3 A;  2NBF A;  1LTT D;  3GTJ B;  4O1N A;  3SK8 A;  1OXV A;  1EYA A;  3R2T A;  5D3I B;  2SNS A;  2TSS A;  1DJR D;  1AZQ A;  4N9T A;  1RF2 D;  2AQ3 B;  4KY6 A;  2E75 C;  2KUM A;  4IUT A;  3I90 A;  4F87 A;  2KJX A;  1F9S A;  5HUR A;  1BO0 A;  1GUN A;  1KAB A;  5C3X A;  2ZT9 C;  3FRP B;  1WTR A;  1SFO B;  1EIG A;  2VB3 X;  1LT4 D;  1HPC A;  4A93 B;  1TS3 A;  1WTV A;  1EFI D;  2B63 B;  3MFY A;  3D4R A;  3TP5 A;  3J81 L;  5C4X B;  4K5X A;  4HCS A;  4NKL A;  2F0D A;  4ID6 A;  1STG A;  1BCP F;  4ULL A;  4DAV A;  1H9R A;  1NUC A;  2PMZ B;  2B2U A;  1O7Y A;  5M5W B;  2PO4 A;  1V1P A;  3ERO A;  1EYC A;  2F0T A;  3L7Z C;  3EA6 A;  3DWA A;  2K6A A;  5KIX A;  2R93 B;  3WDN A;  3R3O A;  3NSW A;  2EZV A;  1FD7 D;  2EYJ A;  4LMQ D;  3HOY B;  4XQN A;  3J7A F;  5T1G A;  3A8K E;  3K5L A;  3WOF A;  3HZX A;  1TT2 A;  1A3T A;  1UUP A;  3HOU B;  3OPO A;  4ABN A;  2R6G A;  3KLS A;  2R92 B;  2B2V A;  2F0O A;  3BYY B;  2IX0 A;  3TZU A;  1K83 B;  2F0F A;  3DHQ A;  2IWH A;  4ZKC B;  1HFN A;  1Y8P B;  4PMW A;  4DA2 A;  3IL8 A;  3I72 A;  2ZXO A;  3CU7 A;  2ICI A;  1JWS D;  4A3J B;  1EOT A;  1B50 A;  1V1O A;  3GTP B;  1TS2 A;  3NXW A;  5KGU A;  1DD2 A;  5LHY 1;  1EU3 A;  1LO5 D;  3UI2 A;  4WJW A;  2GA4 B;  3PUZ A;  1XX8 A;  3OWF A;  1GJX A;  5K36 G;  2K03 A;  3MA2 B;  1B2T A;  1PFB A;  1PRT F;  1CK1 A;  4QCL A;  3K57 A;  1IKM A;  5EJW A;  1F77 A;  2MP1 A;  2HDL A;  2K1B A;  1SYD A;  2NWG A;  3PUX A;  1QJO A;  3GD7 A;  3MTS A;  4BA2 I;  3J80 L;  1SNQ A;  4QMG A;  1TWH B;  1EYD A;  4K6L A;  4X3K A;  3BDC A;  3OIQ A;  4ZLT F;  1O80 A;  1FR3 A;  2XN9 C;  4ME5 A;  1OO9 B;  5FLX E;  3MEH A;  2NYZ D;  2DY8 A;  3AMU A;  3P7J A;  3HKZ B;  3DEP A;  5CV6 A;  3S1N B;  5IGG A;  1PXU A;  4UDU C;  3ZYY X;  1ET9 A;  1Y1V B;  3D6W A;  3DWQ A;  3KLS X;  3S2D B;  4MIU A;  2F0I A;  4EQO A;  3K5N A;  4KTA A;  2L11 A;  1IYU A;  5A2Q E;  3M4O B;  4DNR B;  5D65 A;  2EYO A;  1PZI D;  1V8Q A;  4FNF A;  4K6D A;  3D4D A;  3ND8 A;  2B8G A;  2M00 A;  2WP8 J;  2EY1 A;  4HMI A;  1RDP D;  4G7H C;  3J81 E;  4C3J G;  2RA4 A;  2AQ2 B;  2RQX A;  1KLG D;  4ZUI A;  3HOZ B;  4XT1 B;  5C5M A;  1WTP A;  1EY9 A;  2F0V A;  4KJO A;  4QF4 A;  1OXU A;  3IFT A;  5E3F A;  2XRS D;  1PRT B;  5COR A;  3PUW A;  3MXP A;  1TWG B;  3P75 A;  3X3M A;  1ENA A;  1Z47 A;  5EQ0 A;  2JXM B;  4C3I G;  3D8G A;  1SMY C;  1X32 A;  2FFK B;  2K32 A;  2O5I C;  1O78 A;  1HQR D;  1BDO A;  5BN5 A;  4DU9 A;  3J7Y W;  3DEO A;  2CW0 C;  4QIW B;  1PLF A;  1C8C A;  3IAY A;  1F2M A;  4B9W A;  1DOM A;  1FYC A;  3SHL A;  3K7A B;  3GTK B;  3BVM A;  3HRZ C;  3RLF A;  1Y1W B;  1EIH A;  1LLR D;  4KV6 A;  1R4Q B;  4H0L C;  3HGB A;  4A3E B;  1ET6 A;  1STB A;  1IHZ A;  2LY7 A;  1G29 1;  1UEA B;  1LTG D;  3KBX A;  4XTC S;  3V96 A;  1LT6 D;  1UAP A;  1L0Y B;  4RGM A;  5C0X H;  4ZUJ A;  4HED A;  3PMF A;  1CQV A;  2RVL A;  1JCK B;  5DM7 3;  3A7L A;  1U9R A;  5ELD A;  2WAQ B;  5M5X B;  5F2D A;  2QKI C;  2F0G A;  1DZ1 A;  3GTQ B;  3D4W A;  2NUC A;  2R61 A;  3L3O C;  3T51 B;  5IOD A;  3NBI A;  1SSO A;  4GZY C;  2K28 A;  1Q8I A;  4ZK9 B;  2K01 A;  2I46 A;  2RDF A;  1YNN C;  3I4M B;  3FPU B;  3C1E A;  1DOK A;  3EQL C;  2CW0 D;  5EPK A;  1SNC A;  3KLR A;  1H9S B;  1MBY A;  2QDB A;  2WAC A;  3BVG A;  2BDO A;  1BNZ A;  5J39 A;  5C4H A;  2A6E D;  1FNW A;  1E2V A;  4IUP A;  1HA6 A;  4X3S A;  2VNU D;  2NVT B;  1IW7 D;  4FF4 A;  1CZG A;  2IPK D;  2SDF A;  4BY7 B;  3NWT A;  4K8J A;  2J0T D;  1S4Z A;  1SYB A;  3K6O A;  3RZD B;  4LK1 C;  5J22 A;  3MXN A;  1G91 A;  4XQJ A;  3SXH A;  1GUT A;  1EWH A;  2EDG A;  3R93 A;  4JBW A;  3OMC A;  1VMP A;  1K8O A;  5K36 H;  1BCP C;  3N6R A;  2BE5 D;  1EZ6 A;  2KCN A;  3I70 A;  3ERQ A;  1SYG A;  2B2Y C;  5DM6 3;  4TKO B;  1AZP A;  3FVQ A;  3CQZ B;  4XYO A;  4HSV A;  2LFN A;  5DAU A;  2JE6 I;  2IT1 A;  5JPM C;  1ILQ A;  2D62 A;  3D31 A;  4RWS C;  5I2Y A;  3KUP A;  1H9S A;  1TVX A;  3K5O A;  5C0X J;  1TU2 B;  2EYM A;  1NCV A;  5IGE A;  1ONL A;  1QE6 A;  4XIG S;  2AWO A;  5CR3 A;  1R4P B;  4U68 A;  5CV8 A;  2MJ8 A;  1PZK D;  1IL8 A;  2OF1 A;  1QWY A;  5M3M B;  3MAQ A;  5T1I A;  5E4W C;  1RD9 D;  3H94 A;  2B2Y A;  3FPP A;  4ZRZ A;  2EJF C;  2NN6 I;  2G9H D;  1EEI D;  2FJ2 A;  3NK9 A;  4PV1 C;  5KYI A;  2YU9 B;  1SE3 A;  2PZW A;  2A73 B;  2K05 A;  4OO1 I;  1U4M A;  4BBR B;  1EQV A;  2KEC A;  1LT5 D;  4IUN A;  2JA7 B;  4DGZ A;  5IOC A;  3QOJ A;  3P20 A;  2PYK A;  1HA5 A;  5ELF A;  3HOW B;  4OIJ A;  1Z6H A;  2IJ0 A;  3SR1 A;  4Q5V A;  2WIN B;  4KD4 A;  5E4X A;  4F7X A;  2EYL A;  1E0B A;  2TMP A;  2F03 A;  5TSS A;  3VA5 A;  2DY7 A;  4PNY A;  3SEB A;  1XTC D;  1F9P A;  4KI0 A;  1SMY D;  3R2I A;  5CMD A;  1RHP A;  4KHZ A;  3H0G B;  1DON A;  2XNA C;  4I7Z C;  2HUG A;  1A2T A;  2D5D A;  3RMH A;  5EKI A;  5I4D A;  3BS1 A;  3RZO B;  3M85 A;  2MGS A;  1WD1 A;  4IUR A;  2J4X A;  2ID0 A;  2O4X A;  1SEB D;  4DNT B;  3L9A X;  1MSG A;  2JA5 B;  4KKT A;  1CFM A;  5JVG 3;  3G7L A;  3GTG B;  3OMG A;  1NSN S;  4IFD G;  3F2U A;  3AU7 A;  4HMJ A;  1FGB D;  1SNO A;  2V4D A;  2JA6 B;  4RKL A;  1DOL A;  1MI2 A;  2K5D A;  3MVV A;  1STY A;  5JEA J;  3KK7 A;  1M8A A;  1A3U A;  2SEB D;  4XQQ A;  3T4A C;  4FO2 A;  3S14 B;  3NPP A;  5C4J B;  3CKI B;  2M9V A;  1DXM A;  1OXT A;  3TBI B;  3MXU A;  4A3I B;  4V0B A;  4C3H B;  4C56 C;  1ENC A;  3E0J A;  2LMC B;  3PUV A;  4JK1 C;  1JWM D;  4TRD A;  5G3L D;  1AFP A;  4BS9 A;  3BVZ A;  1J8I A;  1QNU A;  3DMU A;  1D5Z C;  1MGS A;  2B2V C;  4R9W A;  1XWE A;  1V43 A;  2ICE C;  2A6H C;  2F3V A;  4HN7 A;  1BQQ T;  4EGV A;  5FOB B;  3A8I E;  3O13 A;  1BF4 A;  1EL0 A;  4RH6 A;  1WTQ A;  3GTO B;  4PMC A;  1HFG A;  4XDX A;  2EJM A;  1QB5 D;  4OL7 A;  1CTM A;  3QIA A;  2R7Z B;  1H9M A;  1II3 A;  1GHJ A;  5M3F B;  5D3D A;  3OSO A;  3VYT A;  5CGK A;  1RTN A;  3QB3 A;  5I2X A;  2RDH A;  1PTO H;  1B1Z A;  2QIL A;  2AUJ D;  3SK5 A;  5C3W A;  3CRK C;  4RHS A;  2WKC A;  1A3V A;  3ITP A;  2HDM A;  1B9N A;  2BCO A;  2NTS A;  4S3S A;  1SJE D;  3S1R B;  3HOX B;  1BCP D;  4OIK A;  2BE5 C;  5FLX L;  1B4O A;  3QG1 A;  2DN8 A;  2PW7 A;  3MZ5 A;  2QF7 A;  2M2L A;  5KEE A;  4CKE A;  4NMZ A;  3LX0 A;  2A5H A;  3IFD A;  5JAV A;  5M5Y B;  4TSS A;  2EE1 A;  2L55 A;  3JAM E;  3U9O A;  5C3E B;  4K14 A;  3CHB D;  3M7G A;  3PO2 B;  1PZJ D;  2RSO A;  2CQA A;  1LT3 D;  1WCM B;  1PRT C;  5NUC A;  3VR3 A;  2F0M A;  3Q24 A;  1LV9 A;  4DN4 M;  1PTO D;  2K04 A;  4CKB A;  2NVQ B;  4ZYS A;  1S5F D;  4OHJ A;  1LTI D;  2QCP X;  5KNB A;  3K59 A;  1WD0 A;  1KDB A;  1RKN A;  1GOZ A;  3SK6 A;  1WTW A;  3A56 A;  4BY1 B;  4A3K B;  1A6X A;  4C3I B;  2MUY A;  3HP3 A;  1F2Y A;  2WKD A;  1PFM A;  3TP7 A;  5IGB A;  2VXW A;  2EVB A;  2F0K A;  4FF1 A;  2PW5 A;  3TZD A;  5EKL A;  2HQE A;  2O5J C;  1G6Z A;  2R3Z A;  4R8N A;  3VYR A;  2MHV A;  1BUV T;  5FO9 B;  2E2D C;  1LTA D;  3QJY A;  4F8M A;  5C5L A;  1VF5 C;  2I07 B;  4HR7 B;  4RAU C;  4V19 0;  2X6L A;  1I6H B;  2F3W A;  1PTO C;  2AWN A;  1TY0 A;  5M9O A;  1TWC B;  1ESF A;  4K8I A;  1EWC A;  1NR4 A;  1Y8O B;  1SNM A;  4G7Z C;  1QOH A;  2K7V A;  3TME A;  1HXY D;  2D2C C;  1NAP A;  3M4Y A;  1A15 A;  3TDQ A;  3FDT A;  2L9H A;  1B3A A;  4M8A A;  2A74 C;  2RKS A;  2CHB D;  4J8Q A;  1HQM C;  5I9P A;  1M4V A;  3I4L A;  2PQE A;  1SAP A;  4P2C B;  1TS5 A;  4BWG B;  4I65 A;  1CQF A;  5DNF A;  1I4G A;  1Q1E A;  3RD4 A;  4HCE A;  4IN3 A;  3TSS A;  4F88 A;  5JEA G;  3V05 A;  4OO1 G;  1PDQ A;  3MFG A;  1WTX A;  3NBH A;  3A7A B;  1ZXT A;  3QWN A;  2B2U C;  2LS0 1;  2B2T A;  2KOL A;  4BBS B;  4DXG A;  1CM9 A;  2C5C A;  4CJ1 B;  1YNN D;  1LTR D;  4XYQ A;  3Q23 A;  1CA5 A;  4CHT B;  1ROD A;  1SJH D;  5I6Y A;  1EY5 A;  1HTL D;  4UAI A;  1DM0 B;  1CI3 M;  4EQN A;  1TWA B;  1KNA A;  1F9R A;  3PUY A;  1D2B A;  4C3J B;  1NR2 A;  2F0E A;  1RJT A;  2K5W A;  3GTL B;  2KQ3 A;  2XIW A;  4LJZ C;  1GUG A;  3SDZ A;  4RGN A;  2KA7 A;  1SYC A;  2F0U A;  4FYD A;  3I3C A;  4IUV A;  4B08 A;  1Q1B A;  4FP5 D;  3EVQ A;  1F2Z A;  5ELB A;  4CKC A;  1FNV A;  2SNM A;  2F0S A;  1LAC A;  3MC0 B;  1HUM A;  3GV3 A;  3ND9 A;  3ONA B;  5CC4 A;  1GUW A;  5ELC A;  1EY4 A;  1R9T B;  4IFD H;  1S5D D;  1KAA A;  2RSN A;  4WOR A;  3OW7 A;  1I6V C;  1S5E D;  5FKA C;  5AFW A;  4HTH A;  4ILW A;  3S15 B;  1ICW A;  2KEE A;  3Q22 A;  1BXT A;  5EBC A;  1EY7 A;  2JEA I;  4FVM A;  5KYL A;  3NTK A;  3FEW X;  4C3H G;  2Z4H A;  1CT1 D;  3S1Q B;  3OHX C;  2Z8L A;  1C48 A;  3NP8 A;  1E2Z A;  3HS0 C;  2B2W A;  3M3Y B;  2OEO A;  4M1U B;  5ELE A;  2E2I B;  4IZ8 A;  3GTM B;  1I50 B;  4K2L A;  4A3F B;  1DCZ A;  1QNK A;  4DK0 A;  5CV9 A;  1VMC A;  2C9O A;  5G3L F;  1SND A;  4K5V A;  3WOE A;  1SYF A;  1JE4 A;  5CV7 A;  3DWP A;  3T53 B;  3HG9 A;  3J7A V;  2A69 D;  1B44 D;  4NP5 A;  3VYU A;  1I4Q A;  2NB0 A;  1JC7 A;  3Q6S A;  1SXT A;  1JIC A;  3NHH A;  4KJN A;  5BN3 A;  2Q8R E;  1AN8 A;  2Y0S B;  2PZT A;  2NTT A;  1J9O A;  4R8I A;  3KBG A;  1ESR A;  4CGY B;  3OWE B;  2B39 A;  1CZW A;  1Q12 A;  1WVL A;  4KY7 A;  3SK4 A;  3SVM A;  3A54 A;  1TY2 A;  2Z1C A;  3MXG A;  3S9W A;  4KKS A;  5KND A;  1IKL A;  1ML0 D;  2RDG A;  1QIL A;  2F1M A;  5CBA E;  2WV6 D;  3IKJ A;  3E5S A;  4DF7 A;  2EY5 A;  3T16 A;  5IGF A;  2BA0 A;  4HSP A;  1U4P A;  1EZ8 A;  2WB1 B;  1IW7 C;  4L8J A;  4QUC A;  4NW2 A;  4QUF A;  5J1Z A;  1GUS A;  2VB2 X;  4IQZ A;  4PQX A;  1JOO A;  1LTS D;  2NN6 G;  3VR4 A;  4RCO A;  1ZEQ X;  1SDF A;  3M7N A;  1OXX K;  4WFN 3;  5EBD A;  1E2W A;  4KHV A;  1GXD C;  1VF7 A;  1MSH A;  3GV6 A;  1STH A;  1TKW B;  3DUZ A;  2IL8 A;  3DM1 A;  5C0X I;  4B9X A;  2LKV A;  4H13 C;  1Q3L A;  2KED A;  4ZAI A;  1H9K A;  3HOV B;  4A3D B;  1X3Q A;  2RBM A;  3K58 A;  5I9O A;  1STE A;  4RCN A;  2JP1 A;  1UNS A;  2N55 A;  2EPB A;  2OT2 A;  3N52 A;  3NUC A;  2FIN B;  4ODG A;  2ZXR A;  3I73 A;  4RGO S;  2L0C A;  5I6W A;  4OO1 H;  1HRJ A;  1QCB D;  2G9D A;  1U4L A;  2A6H D;  4RA8 A;  5JOB A;  3LNN A;  1GUO A;  2YYZ A;  3I8Z A;  4YIJ A;  2JSO A;  3C1F A;  5A2Q L;  3TN2 A;  4DAP A;  4KK7 A;  5IGD A;  3VR6 A;  1FNU A;  5COY A;  3NWS A;  4C1N I;  3TP8 A;  4WRD A;  2MPM A;  1EY6 A;  3S2H B;  3AB9 A;  4Z9C B;  3H3V C;  3R8B A;  2NZ1 D;  5C4Z A;  1JWU D;  3NE5 B;  3BG3 A;  1CHP D;  4Y7N B;  4O42 A;  4RHR A;  3E6Z X;  4LAA A;  1W6J A;  1XYI A;  4BA1 I;  3D6C A;  1CHQ D;  3C46 A;  2PCF B;  2L1B A;  2NVY B;  4FXG C;  3FMC A;  4IAL A;  4IUU A;  2ZXP A;  2KHS A;  2KVM A;  3LWU A;  5EPJ A;  5JEA H;  3GQB A;  1F2L A;  2H1E A;  3U9S A;  1C4Q A;  3VYS A;  1G2S A;  3PO3 B;  2XSC A;  4PMB A;  1AW7 A;  1F9Q A;  2EY6 A;  4QB4 A;  1V1P B;  1S5C D;  3VA7 A;  2EJG C;  1VDZ A;  4EVO A;  1RCV D;  1KDA A;  3OOC A;  1SNP A;  2JEB I;  4TQU S;  1T5E A;  3GO5 A;  3SE0 A;  2E2J B;  1Y8N B;  1EEF D;  1EU4 A;  1SBB B;  4U67 3;  1Z7T A;  3EFX D;  5DEH A;  1GHK A;  2D9U A;  3P1H A;  2ENB A;  2Q8T A;  2SOB A;  2F0L A;  3A55 A;  4J6H A;  2AUK A;  4H7B A;  3BDL A;  2F0P A;  2EY2 A;  1O7L A;  3S1M B;  4XT3 B;  1EQT A;  3K5M A;  3D3R A;  3C3L A;  2L4N A;  5LL6 X;  4G4K A;  3BYT B;  1HCZ A;  1JOQ A;  1I3Q B;  1KNE A;  2EYF A;  1U4R A;  4KD3 A;  2L5T A;  1SE4 A;  1T5X D;  3HEJ A;  2FHT A;  2A68 C;  1PTO F;  2QEJ C;  5KRU A;  1EY0 A;  4A3B B;  1HTP A;  5K5P A;  2L12 A;  2XWJ B;  3LWE A;  4DAY A;  1I4P A;  1PTO B;  1JOK A;  3QO2 A;  3VR2 A;  3QOL A;  1ZYR C;  4KN4 C;  3PIO 3;  4CJ2 C;  5C44 B;  3NTH A;  1JQY D;  1STA A;  5E1F A;  1B9M A;  5IIF A;  1MD2 D;  3JAM L;  2VUM B;  3EJI A;  4DXF A;  1VCI A;  3I91 A;  3NQI A;  3PV0 A;  4L6T B;  4RGT A;  2B2T C;  5JVH 3;  1CA6 A;  3T13 A;  4MHE A;  2Q8I B;  2IX1 A;  2DNE A;  2XVS A;  2E74 C;  5IT9 E;  1K8M A;  1AEX A;  4G57 A;  1BCP B;  2F0J A;  3BZD B;  3OIP A;  1L0X B;  5FK9 C;  2B8F A;  1TS4 A;  5LL6 S;  1D5M C;  4DK1 A;  3A8J E;  2JYO A;  5A35 A;  2J7Z A;  4IFD I;  1B53 A;  4KY5 A;  3CRL C;  1LAB A;  1ZYR D;  3H91 A;  3Q0A A;  3S16 B;  4H44 C;  4RKB A;  4X3U A;  1PMR A;  4KN7 C;  3MWY W;  2A6E C;  4A3M B;  1BR9 A;  4CJ0 B;  2XWB B;  5FO7 B;  2NN6 H;  1SYE A;  3NQT A;  5ISR A;  4FF3 A;  1HUN A;  1KDC A;  1PFN A;  4AYB B;  2FMC A;  1PYW D;  1Y69 U;  1JOR A;  2K5Q A;  3RUZ A;  4N9P A;  1I4X A;  5IT9 L;  3V2T A;  5BN4 A;  2Z4I A;  1D5X C;  2PPB C;  3S17 B;  1IYV A;  2PZU A;  3W3A A;  4J1M A;  4RFB A;  2BOS A;  1S5B D;  4G7O C;  2F0H A;  5CV5 A;  3NTI A;  5IGC A;  1O7Z A;  3DXJ C;  4FXD A;  1TR5 A;  2B2W C;  3K0Y A;  5CBE E;  5KNC A;  1D1I A;  1PRT D;  4C2M B;  1EY8 A;  3TP6 A;  4E6I A;  3VR5 A;  4NDX A;  4IFD J;  1QG7 A;  3MHB A;  2NVX B;  4IUQ A;  2HCC A;  1D1K A;  1X3P A;  5EKK A;  1G2T A;  3H09 A;  1D6E C;  2PNR C;  2K33 A;  4KKU A;  3X3N A;  4FF2 A;  1I4H A;  5JPN C;  2O2L D;  3GP7 A;  2A69 C;  3KF8 A;  2EYH A;  4FXK C;  5EGT A;  2X6G A;  3PIP 3;  2F0Q A;  1Q90 A;  1YNJ C;  2EYP A;  3I4N B;  1XXG A;  4OGQ C;  1DYQ A;  2IW3 A;  1SE2 A;  3H6M A;  4L63 B;  2FMM A;  3G6J B;  1KLU D;  1H9J A;  1BBX C;  1TWF B;  4K5W A;  1BOS A;  5CV4 A;  3C2P A;  3W2D A;  1ENF A;  2HCI A;  2E2H B;  2KCC A;  1AP0 A;  2E76 C;  1A2U A;  3J80 E;  1ZKO A;  2EOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...