1ELGA

Nature of the inactivation of elastase by n-peptidyl-o-aroyl hydroxylamine as a function of ph
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nature of the inactivation of elastase by N-peptidyl-O-aroyl hydroxylamine as a function of pH.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (hydrolase/inhibitor)
molecule keywords PORCINE PANCREATIC ELASTASE
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elgA01
4WXIA 2CV3A 1MU8B 4ZHMU 1J17T 1H9HE 1NZQH 5ABWA 3SNDA 3VGCB 1TB6H 2G4UA 1HDTH 1XM1A 1D3TB 1YLCA 1O3FA 4O3TA 3T25A 3SN8A 2ZNKH 3T28A 1LMWB 1GI5A 3E0NB 2Y81A 4NGAH 3GDVA 1O36A 1GWAA 1HV7A 1P02A 3S0NA 4INLA 4D76A 1ESTA 1CA8B 1BTYA 3IWMA 5EXLA 3H7TA 4ASHA 4XE4A 1IHSH 4A1XA 1FIWA 2Q6GA 4TWYA 3R3GB 5A2MH 2JETC 2A4GA 3V7TA 4GUXA 4IGDA 4FUDA 2ZKSA 5B6OA 3SUEA 5DP5A 5JBCS 1O2ZA 1FONA 1QRWA 1CE5A 2NU1E 3A8AA 1LQEA 2AYWA 2XC0A 4JYUH 4NIXA 1EPTA 3MWIU 5LPEA 2ZEBA 1GJ5H 4OS5A 2V0BA 4X1NU 2UUJB 8GCHG 1C1WH 1K2I1 2NU4E 3BTTE 2CN0H 4MQAA 5E2OA 4KKDA 1CT0E 2QC2A 3ATMA 2ESTE 4A6LA 1L4DA 1D9IA 1W8BH 3ZVBA 2BTCE 1OWEA 3M3TA 1FQ3A 2AMQA 1AZ8A 1V2UT 1TMBH 2AS9A 3EA7A 1C2LA 1WTGH 3RMNH 3P95A 1JMOH 3TK6A 1CHGA 2BZAA 2TGPZ 1PPHE 1SOZA 3P17H 1CA0B 4HI3A 5C67A 2GVFA 2C90B 1LKAA 2FPZA 2ZU2A 4F49A 2TRMA 5EW2H 1E38B 3R0FA 1VJAU 2HPQH 1QURH 4UFFH 1RD3B 1T7CA 5IYTA 1V2LT 2SNWA 2ZFQH 1F0UA 3ZVDA 3MO3A 1PQ8A 4AFUA 1AB9C 4AG2A 3NKKA 1SGNE 3SHCH 2XC5A 2ZFPH 3GICB 1GHBG 1G2MA 1HIAA 3VXFH 1SB1H 2HNTC 1SLXB 1Y59T 1H9IE 2ZTZA 3A80A 5EGMA 5GDSH 2Z9LA 3ZYDA 4MPWA 1JXPA 3SV2H 1TGBA 5FCRA 5EQSA 3DA9B 5ESTE 3A7TA 3MNCA 4ABDA 5A0AE 1O37A 3QZRA 1L1NA 2AIQA 2BD5A 5C20A 2ZC9H 4Q7ZA 2Z6BD 3SZNA 3TH4H 1FN8A 2P16A 1C5UA 3EQ0H 2W7SA 4LZ4B 1MZDA 3RXLA 2HRVA 4QT8C 1BTXA 1EJAA 3TK5A 3RXEA 1MBMA 1GMHG 3I77A 3KL6A 4KGAA 1C5WB 1CA0C 4B1TA 1VGCB 4ISNA 4WMDA 2TBSA 2BY6X 1ELBA 1V2PT 4E06H 1KXBA 3HKIB 4WH6A 4AYYB 1Z1JA 1ELVA 1UO6A 1F0SA 1O2KA 1O3NA 2ZP0H 2ZQ2A 1C5LH 5HMAA 2O8UA 1O5FH 1C1PA 1H9LB 1LPKB 3QDZB 2H6MA 9ESTA 2FM2A 1UCYH 3RXAA 1Z6JH 4BOHA 1DANH 1DWCH 4K5ZA 1LO6A 1CGJE 3SNAA 2A7CA 2I6QA 5F03A 5C1UA 3L33A 1C2KA 1A0LA 3GY2A 1UTOA 1UMAH 2WV5A 1GDUA 1HFDA 1SFIA 1HIAB 3M36A 2XWAA 1C1NA 2WYGA 3Q3XA 3HK6B 2XWBI 3VXEH 5C2ZA 2SGQE 2ANMH 1IQEA 3PYHA 1A5GH 1WV7H 3MTYA 2ZHWH 1BTWA 3ZVAA 1BB0B 1BRUP 3LOXA 3SUDA 1G2LA 4RN6A 1K21H 5AFZH 3F9FA 1WSSH 2O8LA 2ODYB 2Y6TA 1G3DA 1T8NA 1V2MT 1O2OA 2A5AA 5LPRA 1E37B 1LKBA 1K9OE 1ELDE 1MKWH 1MD7A 1GHXH 1MTWA 2G5VA 3M35A 3A86A 1PPFE 4BAOB 1DSTA 3TJUA 1J16A 5FX5A 1DLKB 1EZXC 4I8JA 5LH8A 2FOEA 5FHTA 1O3BA 3BTEE 1LVYA 2VU8E 1F92A 2ZCHP 2ZHEH 1G3CA 2ZTXA 1KXAA 4Q2KA 1GVZA 1GMDF 1UTNA 2J38A 1BHXB 1SQTA 1TFXA 3ATLA 3LU9B 1TNHA 1LVOA 3RMMH 1P2IA 2FTMA 1DT2A 3QX5H 4I32A 1OWIA 5E0GA 1QB6A 1HJ9A 2BD7A 1W7GH 1C2EA 1L0ZA 2VIQA 4UONA 4THNH 2ZTYA 1Z8IB 2P93A 3LDXH 1BMMH 1FXYA 3B9FH 3MU5A 1ELAA 1TX6A 3JZ2B 1K28D 4UFEH 3MO9A 5T6DA 3BEFB 4MNYA 2GMTB 1K1PA 2BY7X 4E7RG 1JBUH 1S84A 3KQBA 3BTGE 4NG9H 4B2AA 1GJ4H 1AUJA 1MQ6A 1SC8U 1YPHE 1GI7B 1DWEH 3RXVA 1J15A 1W0ZU 2AH4X 1FN6A 2ZGBH 1GBJA 3PTNA 4A1VA 4DURA 3K2UA 3M7UA 5JDUB 1ID5H 1YPMH 2FS9A 3U98H 4Q7YA 3F6UH 5JB9S 1Z8RA 3MH7A 5C1YA 1V2WT 3TLOA 3ZZBA 2Y5FA 4KTSA 3O8RA 1CT2E 3S7KB 1YPKH 3PLKA 3ESTA 1BTUA 3GY5A 3DUXH 1ZZZA 2GP9B 2VWOA 1CBWB 1O32A 4MNVA 2RG3A 2QA9E 3PWCA 1C1QA 1SGEE 2WPIS 1ETSH 1CVWH 3ATKA 3GCNA 1ZLRA 2C8WB 1C2IA 3PLPA 1ZOMA 1OP0A 4Y8XA 5A0CA 1SGDE 1DDJA 1NRRH 2ODQA 5JPMH 2Z3CA 4DW2U 1A5IA 3GCTG 4NIVA 5I25A 2BD9A 4FVDA 2XRCA 1GJDB 4IC6A 2OC0A 1WBGB 1OP2A 4D7GA 1WU1A 3ZZ8A 3ZZCA 4DG4A 3BTFE 4CHAB 2ZGHA 1PYTD 2R3YA 3NZIA 4NZQA 3SU4A 2CGAA 3FVFB 1EOLA 3TGKE 1MAXA 1UTQA 1HAPH 1JRTA 1HAIH 3NCLA 1JRSA 1TAWA 1J8AA 2BX4A 5PTPA 3LIWA 1BBRK 1P01A 2PTCE 3RC6A 1V2JT 3ENSB 4DVAU 3OTJE 4H6TA 1SGCA 3RXSA 1YPJH 3GY3A 3SGBE 1IAUA 2V6NA 3PMBB 3SQEE 1IQMA 3SUGA 2ZCLP 4CRCA 3AAVA 1OYQA 1YKTA 3KHVA 1KLJH 2B9LA 2Y80A 4KP0A 1OWHA 1MAYA 1G36A 4H42U 2BXTH 4GHTA 1Y5UT 1DY8A 3BEIB 1GDQA 2HWLB 1ELTA 5T6FA 5JBAS 3E1XB 4ZUHA 3QTOH 1EATA 3RXCA 1O2IA 3UY9A 4IN1A 5SGAE 1TRYA 3E8LA 1GI1A 4CRFA 3KCGH 3E90B 1NC6A 1O2WA 1C2HA 4MDSA 4O9VA 4FUBA 1XXDA 1GBTA 4GHQA 4YESB 2Y5HA 5DPAA 1D6RA 2PKSC 2VGCB 3C1KA 3STIA 1AKSA 2XBXA 1LCYA 1GMCG 2BVSH 1AWHB 2QXGA 2Q6DA 3D62A 4AZ2B 4R8TB 3GYLB 1W10U 2RA3A 1LPZB 1RIWB 4YT6H 1SGIB 4ABAA 2TPIZ 3P8FA 3TJVA 2BM2A 1GHWH 1T8MA 2P3UB 1TBZH 2H9TH 3U9AH 1VR1H 1O3JA 1A61H 1QRXA 1G9IE 5T6GA 3KIDU 2ZU4A 5DGJA 1FY5A 1Z1IA 3S69A 1ETTH 2LNCA 1EUFA 1UCYE 2J9NA 2ZHDA 2JH0D 1QTFA 2F9NA 1ZHPA 3RXIA 1YPGH 2V3HH 3RXKA 5G4BA 3T2NA 2QF3A 3MHWU 3U1IB 1O3MA 5DP8A 1AFQB 3FP7E 2V35A 1O5EH 6CHAB 2ASUB 3UR6A 4FUJA 1KDQA 1GJAB 1SVPA 1Z8JB 5EW1H 4WXVA 1C5YB 1M9UA 2A5IA 4ZXYH 3SUFA 4WMEA 1KTSB 5TCCA 5C3NA 3HGPA 5HYOA 1O3LA 1YLDA 3GY4A 3ODDA 1PQ7A 2UUFB 5C5OA 2ZU1A 5C5NA 4MVNA 1TNIA 1VITH 2B5TB 4XOJA 4I31A 1D3PB 1AD8H 2XCNA 5GPIB 2CHAC 1NRPH 2UWOA 1GI3A 1KXFA 1O34A 2FI3E 1EJNA 3M5NA 1AKSB 1BJUA 2STAE 3P8GA 1W14U 2VINA 2JH5D 3SV8A 1TA2A 3V13A 7GCHG 1UVSH 4HZHA 3PTBA 4GCHG 3ZVCA 2BHGA 2C4FH 3MYWA 1BITA 2GT7A 3IG6B 2ZU5A 4MPUA 1B0FA 1RS0A 2OC7A 4TY6A 1W0YH 2AGIX 1YCPH 4E05H 4YTAA 1QHRB 1VCPA 1HXFH 2ZI2H 3TH2H 1HCGA 3FZDA 2BZ6H 2WUBA 1O2UA 3UIRA 1A1RA 1TBQH 4K60A 4RKJB 1AE8H 1SSXA 5DP7A 3ZV8A 1P9SA 3BEUA 2GX4A 1O3KA 4HGCA 3GCTF 3OY6U 3PM3A 3T62A 1HAOH 6GCHG 5DO4H 3SU1A 1Z8GA 3E16B 2BD8A 2FO9A 1MUEB 1O3OA 2PUXB 1AUTC 1GCDA 4JCNA 2VWMA 2AERH 4NCYA 4WMFA 1DOJA 2W3IA 4X8VH 3RXUA 3BG4C 3MU1A 1P2QA 5FAHA 2ZA5A 3SJ9A 4DCDA 4B74A 1SPJA 2CHAB 3T26A 5TCAA 3EA9A 3RLWH 1GDNA 3VB3A 1SQAA 1MBQA 4I8KA 2ZGXH 2GMTC 2GZ7A 3K6YA 1TPPA 5HGGA 2TGDA 1V2KT 1XX9A 2XTTB 1ZTKA 2FOGA 4IC5A 1FY4A 1TLDA 5A09A 1QL9A 1V2ST 2Y82A 1C2DA 2FMJA 2HOBA 1ZPCA 1A0HB 1YF4A 3V12A 1F5RA 1Y3UA 4XDEA 1BTPA 1EPTC 1TE0A 2QCYA 3VB5A 1OX1A 4ABBA 2CF8H 8LPRA 5J4QA 1TPAE 1O33A 3EYDA 1PPBH 1QY6A 3MU4A 1K22H 3MFJA 2G5NA 3OY5U 1TALA 4I8HA 3S9CA 4D9QA 3PMHB 1YP9A 4ABFA 3UOUA 1VITF 5IDKA 4FUHA 2H1UA 3GCHC 4LXBH 3A7ZA 2ZU3A 5HM2A 2THFB 4X6NA 3KEEA 1XUFA 1P2JA 4X1SU 1NO9H 1O2RA 3MH5A 1O2MA 1XUJA 3E91A 1PPZA 3TNSA 2QXJA 2WPKS 2VNTA 3BIUH 5CMXH 3V0XA 1GI0A 4ZAEA 1C5NH 1YCPM 1C4U2 1E0FD 4Y71A 3RLYH 2F9OA 1S85A 4ZHAA 1C2JA 2SGDE 5E0HA 4WWYA 1FDPA 3KGPA 4ZKNU 1N6XA 2GKVE 4NSYA 1GI8B 4BXSA 3HKJB 2QXHA 3PMAB 4ISLA 1S6HA 3FANA 1GBHA 3OSYA 1BUIA 3SU0A 4JYTA 2PFEA 1JWTA 5F8ZA 1HJAC 4D7FA 2O9QA 2C8XB 4U30A 2RDLA 1GBDA 1S82A 3U8TH 4UEHH 1O3IA 2VVVA 4TPYA 1EASA 4Y7BA 4ZH8A 2A4RA 3RXTA 4VGCC 1VJ9U 1F5KU 1QB1A 1UK4A 7ESTE 1NFXA 3U8RH 4YOJA 4AFQA 3SV9A 1YC0A 1FY8E 3RU4T 1P06A 1K1MA 1WOFA 1O5GH 1ZJKA 1AMHA 1FPCH 3I78A 3MO6A 1EAUA 1G37A 3RXFA 3SJKA 4HTCH 1G30B 4GVUA 2R0LA 3NWUA 1DICA 1MKXK 4JZ1A 1P10A 1B0EA 3LPRA 1XUKA 5EPNA 4H6SB 1QFKH 3RXPA 3TIUA 1OS8A 3F9EA 3SU6A 3F1SB 3ZZ5A 1SHHB 1L1GA 3STJA 1H1BA 4AGJA 1ESAA 3RMOH 3RXJA 1C2FA 3FP6E 3LGTA 3I29A 3M7QA 3PB1E 4K8YA 3ZVFA 3QUMP 1A2CH 1GMDG 4FU7A 4AB9A 2R0KA 1FV9A 1SGRE 2DE9A 4CHAC 3A7WA 3M5LA 3E6PH 2R2MB 2B7DH 2ZFTA 1GI9B 1C5OH 2V3OH 4JZFH 1PPEE 3ATIA 1SGPE 3EDXB 1P03A 1OKXA 2GD4B 1ZSLA 2ZQ1A 1W12U 1SHYA 3AW1A 1O2PA 3VPKA 3A8BA 1EP6A 5L30H 1V2OT 1XXFA 3RUOA 2BDBA 2ODPA 2R9PA 4INHA 1PPCE 1K1JA 1GMCF 1FY3A 2W7UA 2VVCA 4AX9H 3LKWA 1MD8A 1TWXB 1DY9A 2BDHA 2FI5E 1P09A 1EB2A 1ZSKA 4YLUA 1GHVH 2Y5GA 5DG6A 5L6NH 1ZGVA 2GZ9A 2PKSB 1XVMA 1D3QB 1F7ZA 1Y5BT 1D3DB 3RXQA 5ETXA 1N8OB 4TWWA 2PW8H 4ABEA 5EQRA 3U69H 1AGJA 1T31A 4ESTE 3LC5A 4GSOA 4Y0ZE 2XC4A 1MCTA 1P0SH 2OCVB 5E2PA 2J4IA 2F91A 4K8BA 1WYKA 3D65E 3BTHE 3M3VA 1S5SA 1QGFA 1XKBC 1C1VH 1DSUA 1C1UH 3UWJH 5GXPA 2WPJS 1RXPA 1FI8A 2P95A 1VZQH 1QBOA 2YNBA 2ZFFH 2D8WA 2AEIH 3BG8A 3RXGA 2RA0A 1LDTT 1VCQA 1ZTJA 2ALVA 4INKA 8ESTE 1TYNA 3RP2A 1O2HA 4BTUB 2ZWLH 4AN7A 1NTPA 3ZZ6A 2FDAA 1AU8A 2ZGJA 1UK2A 3M7TA 2ALPA 1V6DA 2Z7FE 2HALA 1S0RA 1DWDH 1UVUH 1T32A 2D2DA 2OC8A 4O97A 3K9XB 3SO3A 1IQNA 1X7AC 2FTLE 2WPMS 1W11U 3AASA 5A8YA 1TGTA 3UUZA 2J34A 5HM9A 1AFQC 1ANEA 1JIMA 3LGIA 3VB4A 1GGDC 1A7SA 3O8CA 2F9UA 1GHAG 1HNEE 2BD3A 2ZDNA 4BAHB 4E7NA 1BMLA 5DP6A 1SBWA 2NU2E 1NU9A 1ZPZA 1ESBA 1EB1H 1NRQH 3UOPA 1K1NA 3HATH 1GJ7B 4O03A 3UQVA 1FIZA 1TX8A 1EPTB 1Y8TA 4DGJA 3MU8A 3SGQE 3SW2B 2FIRH 1NESE 1THRH 2G51A 2Z9GA 3UTUH 2HNTF 1WQVH 3O8BA 1QA0A 1GHZA 1NFWA 3CS7A 3C27B 1O30A 2VIWA 2BVXH 1FPHH 1O3PB 4NA8A 1EP5A 3QTVH 2AMDA 2FLBH 2FP7B 1C5QA 2F9VA 1A0JA 3M5OA 3LH3A 4ZHLU 2EI6A 4O3UA 1ARBA 1ZSJA 1BA8B 2J95A 3MNSA 1O2LA 4X0WU 2A31A 5T3HA 2PKAB 2EC9H 2IOTA 2ZECA 5AFYH 3A7YA 1Z7KA 3SNCA 1CGHA 4XBDA 3LH1A 4ISHH 1GMHF 4WY3A 4ABGA 3ZZ7A 2VB0A 4JMYA 4X6MA 1FAXA 1MTUA 1RGQA 1U6QA 1S0QA 3MH4A 4MPXA 4A5TS 1KDQB 1EJMA 1HAXB 2ZIQH 4DJZB 1O3GA 5DP4A 3SORA 2PKAA 1WCZA 1CBWC 4BAKB 1MZAA 3BTME 3QGJA 2BLOA 2UWLA 3BG4B 1O38A 2CXVA 1T8OA 2GCHF 1TPOA 1SLVB 3M3SA 3U8OH 3P8OA 2HVXA 1ZHMA 3BTKE 5EODA 2ZO3H 3P92A 3GISB 2FX4A 1QJ6B 2G00A 4FU8A 1UVPA 5AHGH 4DT7B 2QY0B 3PROA 1G3BA 7KMEH 4OS2A 4X1PU 2PLXA 1SOTA 1Z6EA 4CBNA 1IQJA 3S9AA 1SLWB 4WJG2 1BOQA 2FX6A 1PQAA 4TYDA 1S83A 4LK4A 1GBMA 1YM0A 1UTMA 1BRCE 3UPEA 1GBCA 5J4SA 2XNIA 1P3CA 1HAVA 2BLVA 4H4FA 2UWPA 1OP8A 2J2UA 1C9PA 3DFLA 3T27A 1JIRA 3VFEA 3U1JB 4AFZA 1ABJH 3MH6A 1TNJA 4AG1A 3RC4A 2ZDMA 4ZXXH 4KTCA 5BRRE 4IBLH 2O8TA 1GI6A 2OLGA 2P8OB 2PGBB 3TITA 1IOEA 2BY9X 1ZPBA 2UUKB 1CHOG 2XBYA 1OPHB 1E34B 2EI8A 4JZDH 3MI4A 2FLRH 2FODA 2C8YB 4CH8B 2ZF0H 2A1DB 1EOJA 5AF9H 1C9TA 1LHGH 1MKWK 1F0RA 1P57B 3SJIA 2PUQH 1NT1A 1UVOA 1GPZA 1KXDA 1K1LA 2ZCKP 1AE5A 4X1RU 1BMNH 1TBRH 4NA9H 2GZ8A 2P3TB 3SU5A 2NU0E 3O8DA 3RXOA 1RIWC 1RTFB 2P94A 1D6WA 1LHFH 2CF9H 1V2VT 3UNSA 3ZYEA 3TPIZ 1BHXF 1KLIH 1ZR0A 2FEQH 2SGAA 1FY1A 1GL0E 1TOMH 5EU8A 3Q3YA 3ZZ4A 1SLUB 4RKOB 5HXFA 3VB6A 1YPHC 1HJAB 2A0QB 2C8ZB 2WV4A 1W2KH 1SQOA 4GPGA 4NIYA 1ZMNA 2ZDKA 3RXMA 1XKAC 4JK5A 4RSPA 1LHDH 2GT8A 3LJOA 1JOUB 4LOYH 1MCVA 2ZFSA 2JH6D 4DIHH 1A3EH 3A85A 1XUHA 1C5MD 5CE1A 2QAAA 5A0BA 2CMYA 4MNWA 2OQ5A 3L3TA 3ZZDA 1PYTC 2FYRA 5A8XA 1ORFA 4NZLA 3M5MA 2VJ1A 3PO1B 1GCTB 1C5VA 1HAHH 1QCPA 3RM0H 1O2JA 2JETB 2OQUA 1VITG 4NFEA 2G52A 2XCFA 1C5RA 4JZEH 4BANB 1GBAA 5F8XA 3UR9A 1WAYB 1P2OA 3M61U 3CS0A 3QLPH 1INCA 2FOBA 3UQOA 3ODFA 6GCHF 1O2VA 3TVJB 2H9EH 4ABJA 4I7YH 4M7GA 2A7HA 4X8TH 1HAVB 2EA3A 1S6FA 1O5AB 1C5TA 4OS1A 4FUEA 1GG6B 4IS5A 1P8VC 3BN9A 1O5CB 3DFJA 4TY7A 1G32B 5FPSA 4MTBA 4BTTB 2GV6A 1GI2A 1AFEH 1TGSZ 2FESH 3B23B 4UE7H 2VWLA 4OGYA 3V3MA 4B2CA 1QJ7B 1UCYK 2R2WU 1QBNA 1GBFA 4ISOA 2BDIA 1DITH 4NWLA 2A4QA 2PWXA 3PV4A 4AYVB 2BQ6B 3SI3H 1BBRH 1SGYE 1ETRH 2OBOA 1KYNA 2VIPA 5EOKA 1DVAH 3A89A 2BQWB 3BV9B 4OS6A 1EQ9A 2A7JA 1MTVA 3BTDE 4SGAE 1J14A 1GJ8B 1IQHA 2QXIA 4YOIA 1ANCA 1EX3A 2OBQA 2Q6FA 2SFAA 2IN2A 3E0PB 3ZZAA 1F0TA 2OD3B 4K3JA 2GCTC 3GOVB 5GJ4B 2A4OA 2BYAX 5FCKA 3GY7A 1HBTH 1F5LA 5FX6A 3VB7A 4Q7XA 6CHAC 1C1TA 4AOQA 4Y11E 1O3HA 2AFQB 1SL3A 2Z3DA 1P04A 2PR3A 2KAIA 2C93B 1YPEH 2BLQA 1FNIA 2WUCA 1Y3XA 3RM2H 3P8NA 1P3EA 1CHOF 2W5EA 4JYVH 7LPRA 3PLBA 2Y7ZA 1IQGA 1KY9A 3RMLH 4NIWA 1SFQB 1THPB 2XXLA 5FBEA 3BTQE 3RDZA 2BVRH 1N6YA 3A7VA 5DP3A 3LGUA 4Z6AH 1GBKA 1V2QT 4Y8YA 2GCTB 2R3UA 4AORA 3ZZ9A 4Y6DA 1Y3YA 2F83A 1BJVA 1SMFE 4DIIH 1K1IA 1DFPA 1DE7H 1WTHD 1GHYH 2A45B 3A83A 1GJBB 1C2MA 2TGAA 3EA8A 1DUAA 4IMZA 5L2YH 4U32A 5E8EH 3SV7A 2OC1A 1UK3A 3TNTA 1TONA 4FVBA 1NS3A 1RFNA 1SI5H 3G01A 5FXLA 4FUIA 3URCA 3B8JA 1NRNH 1O3EA 2OINA 4X8SH 1TQ0B 1ACBE 1OWDA 2A32A 4J2YB 1GGDB 4Q80A 4PROA 2PTNA 1TA6A 2SGFE 4X2VA 4J1YA 4WH8A 4XBCA 2ZFRH 2AIPA 4MNXA 1O2TA 4X2WA 3TGJE 1GJ9B 2NWNA 4YLQH 4HFPB 4K1SA 1AB9B 1K1OA 1DLEA 5A8ZA 5K7RA 2QF0A 3H7OA 1C1SA 2DUCA 3RXBA 2STBE 3SI4H 4X1QU 1QIXB 3NK8A 2VWNA 1T4VH 3UFAA 2FS8A 4BAMB 1KSNA 1TX7A 3E3TA 3GDSA 3PWBA 4KTUA 4CRAA 4DY7B 5K0HA 1BZXE 3K6ZA 1XMNB 1KTTB 1QB9A 3RXHA 1HLTH 2BQ7B 5FBIA 2ZHQH 5GCHF 1E35B 5TJXA 3SU3A 1NFYA 2P59A 4UD9H 3SGAE 1OOKB 5DJ7A 4Z0KA 1AN1E 1BCUH 1O0DH 1HXEH 1A4WH 1DXPA 1HYLA 4UDWH 1O2NA 4OGXA 3LONA 1C1RA 1TABE 1GVLA 4I8LA 3MNXA 1Y5AT 2VIDA 1XUGA 4X2YA 1BRAA 3A81A 3S9BA 4B73A 1GVKB 3NXPA 1T4UH 1HAYB 5F8TA 3N7OA 2PSXA 1TRMA 4XBBA 1TMTH 1ZRBA 1Q2WA 1IQKA 2EEKA 3RU4E 3ELAH 1Z71A 1LPGB 1W3CA 3BTWE 1W7XH 1YGCH 1E36B 1WUNH 3UWIA 4FXGH 2FYQA 1NROH 1SR5C 3SBKA 3ITIA 3ZZ3A 1VCWA 5EXMA 3RXDA 2Z9JA 1QRZA 2WPLS 5JB8S 1H8IH 1D4PB 3IITA 1KIGH 2BDCA 2Z3EA 2BB4A 2IPHA 1RTKA 3GDUA 2QGRA 3SJ8A 3BIVH 1TIOA 4AFSA 3UREA 1TNGA 1LTOA 2Y7XA 3NPSA 1C1MA 1GHBF 2PSYA 2XBVA 3HK3B 4NA7A 2ANKH 1ZYOA 3LC3A 4WVPE 2BOHB 3DD2H 2BY8X 1MMJN 3KQCA 4ABHA 1AVWA 2ZPQA 4BXWA 4K69A 3TGIE 2GV7A 4OS4A 1GCTC 3HPTB 3AAUA 3FAOA 3RC5A 3QZQA 4XFQA 1V2NT 2VIVA 1QJ1B 4K1TA 1C2GA 4JK6A 3WY8A 1BT7A 1IQFA 4YO9A 1O5DH 1KXEA 1O39A 1C5SA 1UTJA 1OWJA 5FPTA 5JBTA 4Y79A 4D9RA 3A87A 1C5ZB 3RXRA 4GLYA 4VGCB 3MMGA 2C3SA 2BD4A 4MLFB 3VGCC 3W95A 1XUIA 1EAIA 3UNQA 5LGOA 1P12E 1UHBB 2WINI 2GDEH 4X6PA 1Q3XA 1GBBA 1O5BB 2F9PA 2ZPRA 3A8CA 2ZDAH 1GI4A 1MH0A 5ESBA 4B2BA 3Q76A 3AVZA 1HUTH 3LT3A 1N8OC 1UTLM 2A5KA 3A8DA 1XVOA 3QK1A 3A7XA 3LGYA 2Q1JA 1TRNA 2XYAA 3TJOA 2XW9A 1ELGA 3JZ1B 1NFUA 3QWCH 2GDDA 2J92A 1C5XB 3NUMA 1HAZB 1FLEE 1TNKA 2PV9B 5GIBA 4B75A 2OUAA 1BTHH 3Q77A 2ZDVH 3MU0A 4CREA 3KNXA 1BDAA 2D1JA 3QGNB 8GCHF 1TGNA 2FOMB 3SJOA 2TIOA 3L6PA 3BF6H 1ZTLA 2F9BH 1CSOE 2H5CA 4UFGH 2WYJA 1DWBH 2AGGX 1EKBB 1TPSA 2HNTE 1N1LA 3MNBA 5GCHG 5JYIA 2VGCC 1QQ4A 1DXWA 1NY22 1GBIA 3SOSA 2AMPA 5GWZA 4ZMAH 1FUJA 3FP8E 3QO6A 2BD2A 2BLWA 4CR9A 2OXSA 1UTPA 1SGFA 5H4IB 2VH6A 1IHTH 2BOKA 3QN7A 1S81A 3PO1C 1Y3WA 1YBWA 4CR5A 3SQHE 2Z9KA 2XBWA 3HGNA 4I8GA 2P3FH 3BSQA 3Q3KA 2QV1A 1QBVH 1YCPK 2QN5T 1EAWA 1AI8H 3GY6A 3S7HB 4X8UH 1DPOA 1H4WA 5E0JA 4ABIA 4D8NA 3LGWA 2H9HA 5FPYA 2FZZA 1H8DH 2F3CE 1LQDB 1V2TT 1QL8A 4Y7AA 1ZHRA 5DK1A 3EAJA 3ZV9A 1CGIE 1NPMA 4BTIB 5C1XA 1O3AA 3VEQB 1YYY1 4CRGA 2GCHG 4YM9A 1GBEA 2HLCA 1L1JA 1TGCA 1OXGA 4I33A 2LPRA 5BPEA 4SGBE 1GG6C 1MKXH 1AY6H 2YOLA 1P2MA 3GCOA 6ESTA 3DHKH 4R0IA 1P11E 2YNAA 3OX7U 1FJSA 4BNRA 1ARCA 1ELFA 1AWFH 2BDGA 4X2XA 1ZGIA 1SGFG 3P6ZB 1O2YA 1TQ7B 1RRKA 1TMUH 1L2EA 2GGVB 2KAIB 2SNVA 4IW4E 9LPRA 1OYTH 1T8LA 1EZQA 1O3CA 3D49H 2DE8A 2HPPH 4IMQA 4MPVA 1EZUC 3H5CB 1F2SE 1OWKA 3ZVEA 4WF8A 4B76A 1C4V2 1BQYA 5I46H 2I6SA 1IQIA 1GHAF 3OU0A 1NN6A 4A7IB 6LPRA 4XSKU 4NFFA 1V3XA 2FOHA 2Z9IA 4IN2A 1NRSH 3A82A 1A46H 2CJIA 5DP9A 1GJCB 1ZJDA 2ZGCA 4MG3A 1AIXH 2PHBA 2HGTH 3TK9A 3D23A 3SU2A 2BX3A 1WQSA 1ANDA 1Y3VA 2EI7A 2ZPSA 3F68H 1J9CH 1LHEH 1QL7A 2Z94A 3SNBA 1GL1A 1SGQE 2ANYA 2GTBA 4YZUA 1HJ8A 3TU7H 4OS7A 4B71A 1EXFA 2BMGB 5DKMA 3URDA 3AW0A 1C5PA 4A1TA 1O31A 2VH0A 4Y76A 1PQ5A 4U01A 3Q00A 2VIOA 1FZZA 1QNJA 2QYIA 4X6OA 4AGKA 1TOCB 4CBOA 2FXRA 1P05A 2WPHS 4DOQA 1OSSA 1AZZA 4FUCA 1PFXC 1CT4E 1SG8B 2FOFA 3W94A 2PGQB 1CQQA 1DUEA 3GY8A 2O8WA 4CH2B 4KELA 1TNLA 5EPYA 2OP9A 1CU1A 4JZIA 1MQ5A 3A84A 4CRDA 4AB8A 3P70B 3EE0B 3T29A 4ZKOU 2P8OC 1P2KA 1QQUA 2ZHFH 5LPFA 1SGTA 2BDYA 2SGPE 4LZ1H 1IQLA 3LJJA 1V2RT 4TPIZ 2A2QH 3LGVA 1O3DA 3ZVGA 2SGEE 2BY5X 1P2NA 1EAXA 5CHAB 1UHBA 1B7XB 1VGCC 2G55A 2O8MA 3DT0H 3F9GA 1ELEE 4GAWA 4A92A 4U2WA 1EZSC 4ZKRU 1THSH 2W3KA 1RTLA 1AVXA 4K1EA 1QR3E 2TGTA 1PPGE 1YPLH 1LVBA 2A2XH 1GJ6A 2NU3E 4CRBA 1AHTH 4BAQB 3KQDA 2JKHA 5JBBS 3GCHB 2ZG0H 1FAKH 1GBLA 2FWWA 1UTKA 4UFDH 3PMJA 4F4OC 3KF2A 2W26A 4Y0YE 4ZROA 3KN2A 1HGTH 2QIQA 8KME2 1BIOA 1Q31A 2ANWA 1NU7B 1KLTA 5EQQA 2BXUH 5EXNA 3MOCA 5CHAC 4ZKSU 1LVMA 3M37A 4K2YA 3KQEA 1G3EA 1C4Y2 1ABIH 4YT7H 2BDAA 1FMGA 1AO5A 3T5FH 3A88A 2ULLA 1A3BH 3SNEA 1AVGH 1QA7A 1BMAA 4FUFA 1O2QA 3TJNA 3SHAH 4ISIH 2M5TA 2ZDLA 1UVTH 2IJOB 3FZZA 2D26C 4Y10E 1MTNC 5AVDA 2J94A 1O35A 1O2GH 2G4TA 4NWKA 5L2ZH 1MU6B 1DS2E 1HRTH 2AGEX 3EGKH 2UUYA 3RU4D 2OTVA 1O2XA 5F6MA 2FI4E 2G81E 1ANBA 1HPGA 1ZMJA 2H2ZA 1BRBE 3TH3H 1BTZA 1LHCH 1ZRKA 3FFGA 2ZZUH 1HAGE 2VVUA 3K65B 1L4ZA 1DX5M 3OYPA 1HB0B 1ZMLA 1ELCA 2B0FA 7GCHF 5EG4A 3GYMA 3SV6A 3F9HA 4GCHF 2B8OH 1MTSA 2RCEA 4FU9A 4Y8ZA 2H5DA 1NM6A 2K1QA 4YOGA 1AQ7A 2FOCA 1DM4B 1O2SA 3CP7A 2FOAA 1UJ1A 1C1OA 1MTNB 1A5HA 3UNRA 3ATWA 4NSVA 1RJXB 2G8TA 4FUGA 1P9UA 2ILNA 1CO7E 3CENA 1BBRE 1KXCA 1PJPA 1B5GH 1W13U
chains in the Genus database with same CATH superfamily
4WXIA 2CV3A 1MU8B 4ZHMU 1J17T 1H9HE 1NZQH 5ABWA 3SNDA 3VGCB 1TB6H 2G4UA 1HDTH 1XM1A 1D3TB 1YLCA 1O3FA 4O3TA 3T25A 3SN8A 2ZNKH 3T28A 1LMWB 1GI5A 3E0NB 2Y81A 4NGAH 3GDVA 1O36A 1GWAA 1HV7A 1P02A 2KM0A 3S0NA 4INLA 4D76A 1ESTA 1CA8B 1BTYA 3IWMA 2IPQX 5EXLA 3H7TA 4ASHA 4XE4A 1IHSH 4A1XA 1FIWA 2Q6GA 4TWYA 3R3GB 5A2MH 2JETC 2A4GA 3V7TA 4GUXA 4IGDA 4P00A 4FUDA 2ZKSA 5B6OA 3SUEA 5DP5A 5JBCS 1O2ZA 1FONA 1QRWA 1CE5A 2NU1E 3A8AA 1LQEA 2AYWA 2XC0A 4JYUH 4NIXA 1EPTA 3MWIU 5LPEA 3H09A 2ZEBA 1GJ5H 4OS5A 2V0BA 4X1NU 2UUJB 8GCHG 1C1WH 1K2I1 2NU4E 3BTTE 3WWBA 2CN0H 4MQAA 5E2OA 4KKDA 1CT0E 2QC2A 3ATMA 2ESTE 4A6LA 1L4DA 1D9IA 1W8BH 3ZVBA 2BTCE 1OWEA 3M3TA 1FQ3A 2AMQA 1AZ8A 1V2UT 1TMBH 2AS9A 3EA7A 1C2LA 4B6FA 1WTGH 2GJGA 3RMNH 3P95A 1JMOH 3TK6A 1CHGA 3N7DA 2BZAA 2TGPZ 1PPHE 1SOZA 3P17H 1CA0B 4HI3A 5C67A 2GVFA 2C90B 1LKAA 2FPZA 2ZU2A 4F49A 2TRMA 5EW2H 1E38B 3R0FA 1VJAU 2HPQH 2L6OA 1QURH 4UFFH 1RD3B 1T7CA 5IYTA 1V2LT 2SNWA 2ZFQH 1F0UA 3ZVDA 3MO3A 1PQ8A 4AFUA 1AB9C 4AG2A 3NKKA 1SGNE 3SHCH 2XC5A 2ZFPH 3GICB 1GHBG 1G2MA 1HIAA 3VXFH 1SB1H 2HNTC 1SLXB 1Y59T 1H9IE 2ZTZA 3A80A 5EGMA 5GDSH 5IK2D 2Z9LA 2J98B 3ZYDA 4MPWA 1JXPA 3SV2H 1TGBA 3DCLA 5FCRA 5EQSA 1COWD 3DA9B 5ESTE 3A7TA 3MNCA 4ABDA 5A0AE 1O37A 3QZRA 1L1NA 2AIQA 2BD5A 5C20A 2ZC9H 2M2AA 4Q7ZA 2Z6BD 3SZNA 3TH4H 1FN8A 2P16A 1C5UA 3EQ0H 2W7SA 4LZ4B 1MZDA 3RXLA 2HRVA 4QT8C 1BTXA 1EJAA 3TK5A 3RXEA 1MBMA 1GMHG 3I77A 3KL6A 4KGAA 1C5WB 1CA0C 1E79D 4B1TA 1VGCB 4ISNA 4WMDA 2TBSA 1WXRA 2BY6X 1ELBA 1V2PT 4E06H 1KXBA 3HKIB 4WH6A 4AYYB 1Z1JA 1ELVA 1UO6A 1F0SA 1O2KA 1O3NA 2ZP0H 2ZQ2A 1C5LH 5HMAA 2O8UA 1O5FH 1C1PA 1H9LB 1LPKB 3QDZB 2H6MA 9ESTA 2FM2A 1UCYH 3RXAA 1Z6JH 4BOHA 1DANH 1DWCH 4K5ZA 1LO6A 1CGJE 3SNAA 2A7CA 2I6QA 5F03A 5C1UA 2F43B 3L33A 1C2KA 1A0LA 3GY2A 1UTOA 1UMAH 2OK5A 2WV5A 3OAAD 1GDUA 1HFDA 1SFIA 4OM9A 1HIAB 3M36A 2XWAA 5KGOA 1C1NA 2WYGA 3Q3XA 3HK6B 2XWBI 3VXEH 5C2ZA 2SGQE 2ANMH 1IQEA 3PYHA 1A5GH 1WV7H 3MTYA 2ZHWH 1BTWA 3ZVAA 1BB0B 1BRUP 3LOXA 3SUDA 1G2LA 4RN6A 1K21H 5AFZH 3F9FA 1WSSH 2O8LA 1YWUA 2ODYB 2Y6TA 1G3DA 1T8NA 1V2MT 1W0KD 1O2OA 2A5AA 5LPRA 1E37B 1LKBA 2IJD1 1K9OE 1ELDE 1MKWH 1MD7A 1GHXH 1MTWA 2G5VA 3M35A 3A86A 1PPFE 4BAOB 1MABB 1DSTA 3TJUA 1J16A 5HIYA 5FX5A 1DLKB 1EZXC 4I8JA 5LH8A 2FOEA 5FHTA 1O3BA 3BTEE 1LVYA 2VU8E 1F92A 2ZCHP 2ZHEH 1G3CA 2ZTXA 1KXAA 4Q2KA 1GVZA 1GMDF 1UTNA 2J38A 1BHXB 1SQTA 1TFXA 3ATLA 3LU9B 2PP6A 1TNHA 1LVOA 3RMMH 1P2IA 2FTMA 1DT2A 3QX5H 4I32A 1OWIA 5E0GA 1QB6A 1HJ9A 2BD7A 1W7GH 1C2EA 1L0ZA 2VIQA 4UONA 5KEDA 4THNH 2ZTYA 1Z8IB 2P93A 3LDXH 1BMMH 1FXYA 3B9FH 3MU5A 1ELAA 1TX6A 3JZ2B 1K28D 4UFEH 3MO9A 5T6DA 3BEFB 4MNYA 2GMTB 1K1PA 4FETA 2BY7X 4E7RG 1JBUH 1S84A 5C94A 3KQBA 3BTGE 4NG9H 4B2AA 1GJ4H 1AUJA 1MQ6A 1SC8U 1YPHE 2F4LA 1GI7B 1DWEH 3RXVA 1J15A 1W0ZU 2AH4X 1FN6A 2ZGBH 1GBJA 3PTNA 4A1VA 4DURA 3K2UA 3M7UA 5JDUB 1ID5H 1YPMH 2FS9A 3U98H 4Q7YA 3F6UH 3FN8A 5JB9S 1Z8RA 3MH7A 5C1YA 1V2WT 3TLOA 3ZZBA 2Y5FA 4KTSA 3O8RA 1CT2E 3S7KB 1YPKH 3PLKA 3ESTA 1BTUA 3GY5A 3DUXH 1ZZZA 2GP9B 2VWOA 1CBWB 1O32A 4MNVA 2RG3A 2QA9E 3PWCA 1C1QA 1SGEE 2WPIS 1ETSH 2WSSD 1CVWH 3ATKA 4XRNA 3GCNA 5GNDA 1ZLRA 2C8WB 1C2IA 3PLPA 1ZOMA 1OP0A 4Y8XA 5A0CA 1SGDE 1DDJA 1NRRH 2ODQA 1WDIA 5JPMH 5EJ1A 2Z3CA 4DW2U 1A5IA 3GCTG 4NIVA 5I25A 2BD9A 4FVDA 2XRCA 1GJDB 4IC6A 2OC0A 1WBGB 1OP2A 4D7GA 1WU1A 3ZZ8A 3ZZCA 4DG4A 3BTFE 4CHAB 2ZGHA 1PYTD 2R3YA 3NZIA 4NZQA 3SU4A 2CGAA 3FVFB 1EOLA 3TGKE 1MAXA 1UTQA 1HAPH 1JRTA 1HAIH 3NCLA 1JRSA 1TAWA 1J8AA 2BX4A 5PTPA 3LIWA 1BBRK 1P01A 2PTCE 3RC6A 1V2JT 3ENSB 4M9FA 4DVAU 3OTJE 4H6TA 1SGCA 3RXSA 1YPJH 3OE7D 3GY3A 3SGBE 1IAUA 2V6NA 3PMBB 3SQEE 1IQMA 3SUGA 2ZCLP 4CRCA 3AAVA 1OYQA 1YKTA 3KHVA 1KLJH 2B9LA 2Y80A 4KP0A 1OWHA 1MAYA 1G36A 4H42U 2BXTH 4GHTA 1Y5UT 1DY8A 3BEIB 1GDQA 2HWLB 1ELTA 5T6FA 5JBAS 3E1XB 4ZUHA 3QTOH 1EATA 3RXCA 1O2IA 3UY9A 4IN1A 5SGAE 1TRYA 3E8LA 1GI1A 4CRFA 3KCGH 3E90B 1NC6A 1O2WA 1C2HA 4MDSA 4O9VA 4FUBA 1YY3A 1XXDA 1GBTA 4GHQA 4YESB 2Y5HA 5DPAA 1D6RA 2PKSC 2VGCB 3C1KA 3STIA 1AKSA 1LCYA 1GMCG 2BVSH 2XBXA 1AWHB 2QXGA 2Q6DA 3D62A 4AZ2B 2J98A 4R8TB 3GYLB 1W10U 2J5UA 2RA3A 1LPZB 1RIWB 4YT6H 1SGIB 4ABAA 2TPIZ 3P8FA 3TJVA 2BM2A 1GHWH 1T8MA 2P3UB 1TBZH 2H9TH 3U9AH 1VR1H 1O3JA 1A61H 1QRXA 1G9IE 4TT3D 4RT0A 5T6GA 3KIDU 2ZU4A 5DGJA 1FY5A 1Z1IA 3S69A 1ETTH 2LNCA 1EUFA 1UCYE 2J9NA 2ZHDA 1E1RD 2JH0D 1QTFA 2F9NA 1ZHPA 3RXIA 1YPGH 2V3HH 3RXKA 5G4BA 3T2NA 2QF3A 3MHWU 3U1IB 1O3MA 5DP8A 1AFQB 3FP7E 2V35A 1O5EH 6CHAB 2ASUB 3UR6A 4FUJA 1KDQA 1GJAB 1SVPA 1Z8JB 5EW1H 4WXVA 1C5YB 1M9UA 2A5IA 4ZXYH 3SUFA 4WMEA 1KTSB 5TCCA 5C3NA 3HGPA 5HYOA 1O3LA 1YLDA 3GY4A 3ODDA 1PQ7A 2UUFB 5C5OA 2ZU1A 5C5NA 4MVNA 1TNIA 1VITH 2WZQA 2B5TB 4XOJA 4I31A 1D3PB 1AD8H 2XCNA 5GPIB 2CHAC 1NRPH 2UWOA 1GI3A 1KXFA 1O34A 2FI3E 1EJNA 3M5NA 1AKSB 1BJUA 2STAE 3P8GA 5T1VA 1W14U 2VINA 2JH5D 3SV8A 1TA2A 3V13A 3OEHD 7GCHG 1UVSH 5HIZA 4HZHA 3PTBA 2EQNA 4GCHG 2BHGA 2C4FH 3MYWA 3ZVCA 1BITA 2GT7A 3IG6B 2ZU5A 4MPUA 4Q63A 1B0FA 1RS0A 2OC7A 2K8IA 4TY6A 1W0YH 2AGIX 1YCPH 4E05H 4YTAA 1QHRB 1VCPA 1HXFH 2ZI2H 3TH2H 1HCGA 3FZDA 2BZ6H 2WUBA 1O2UA 3UIRA 1A1RA 1TBQH 5EIYA 4K60A 4RKJB 1AE8H 1SSXA 5DP7A 3ZV8A 1P9SA 3BEUA 2GX4A 1O3KA 4HGCA 3GCTF 3OY6U 3PM3A 3T62A 1HAOH 6GCHG 5DO4H 3SU1A 1Z8GA 3E16B 2BD8A 2FO9A 1MUEB 1O3OA 2PUXB 1AUTC 1GCDA 4JCNA 2VWMA 2AERH 4NCYA 4WMFA 1DOJA 2W3IA 4X8VH 3RXUA 3BG4C 3MU1A 1P2QA 5FAHA 2ZA5A 3SJ9A 4DCDA 4B74A 1SPJA 2CHAB 3T26A 5TCAA 3EA9A 3RLWH 1GDNA 3VB3A 1SQAA 1MBQA 4I8KA 2ZGXH 2GMTC 2GZ7A 3K6YA 1TPPA 5HGGA 2TGDA 1V2KT 1XX9A 2XTTB 1ZTKA 2FOGA 4IC5A 1FY4A 2JJ1D 1TLDA 5CDFE 5A09A 1QL9A 1V2ST 3DSGA 2Y82A 1C2DA 2FMJA 2HOBA 3PV5A 4AC9A 1ZPCA 1A0HB 1YF4A 3V12A 1F5RA 1Y3UA 4XDEA 1BTPA 1EPTC 1TE0A 2QCYA 3VB5A 1OX1A 4ABBA 2CF8H 8LPRA 5J4QA 1TPAE 1O33A 3EYDA 1PPBH 1QY6A 3MU4A 1K22H 3MFJA 3SZEA 2G5NA 3OY5U 1TALA 4I8HA 3S9CA 4D9QA 3PMHB 1YP9A 4ABFA 3UOUA 1VITF 5IDKA 4FUHA 2H1UA 3GCHC 4LXBH 3A7ZA 2ZU3A 5HM2A 2THFB 4X6NA 3KEEA 1XUFA 1P2JA 4X1SU 1NO9H 1O2RA 3MH5A 1O2MA 1XUJA 3E91A 5DN6D 1PPZA 3TNSA 2QXJA 2WPKS 2VNTA 3BIUH 5CMXH 3V0XA 1GI0A 4ZAEA 1C5NH 1YCPM 1C4U2 1E0FD 4Y71A 3RLYH 2F9OA 1S85A 4ZHAA 1C2JA 2SGDE 5E0HA 4WWYA 1FDPA 3KGPA 4ZKNU 1N6XA 2GKVE 4NSYA 1GI8B 1EFRD 4BXSA 3HKJB 2QXHA 2J97A 3PMAB 4ISLA 1S6HA 3FANA 1GBHA 2KCOA 3OSYA 1BUIA 3SU0A 5C0TA 5B6LA 2QE7D 4JYTA 2HVYB 3FO8D 2PFEA 1JWTA 5F8ZA 1HJAC 4D7FA 2O9QA 2C8XB 4U30A 2RDLA 1GBDA 1S82A 3U8TH 4UEHH 1O3IA 2VVVA 4TPYA 1EASA 3KQ5A 4Y7BA 4ZH8A 2A4RA 3RXTA 4VGCC 1VJ9U 1F5KU 1QB1A 1UK4A 7ESTE 1NFXA 3U8RH 4YOJA 4AFQA 3SV9A 1YC0A 1FY8E 3RU4T 1P06A 1K1MA 1WOFA 1O5GH 1ZJKA 1AMHA 1FPCH 3I78A 3MO6A 1EAUA 1G37A 3RXFA 3SJKA 4HTCH 1G30B 4GVUA 2R0LA 3NWUA 1DICA 1MKXK 4JZ1A 1P10A 1B0EA 3LPRA 1XUKA 5EPNA 4H6SB 1QFKH 3RXPA 3TIUA 1OS8A 3F9EA 3SU6A 2KX4A 3F1SB 3ZZ5A 1SHHB 1L1GA 3STJA 1H1BA 4AGJA 1ESAA 3RMOH 3RXJA 1C2FA 3FP6E 3LGTA 3I29A 3M7QA 3PB1E 4K8YA 3ZVFA 3QUMP 1A2CH 1GMDG 4FU7A 4AB9A 2R0KA 1FV9A 1SGRE 2DE9A 4CHAC 3A7WA 3M5LA 3E6PH 2R2MB 2B7DH 2ZFTA 1GI9B 1C5OH 2V3OH 4JZFH 1PPEE 3ATIA 4P02A 1SGPE 3FOAA 3EDXB 3WW7A 1P03A 1OKXA 2GD4B 1ZSLA 2ZQ1A 1W12U 1SHYA 3AW1A 1O2PA 3VPKA 3A8BA 1EP6A 5L30H 1V2OT 1XXFA 3RUOA 2BDBA 2ODPA 2R9PA 2WPDD 3U28C 4F48B 4INHA 1PPCE 1K1JA 1GMCF 1FY3A 2W7UA 2VVCA 4AX9H 3LKWA 1MD8A 1TWXB 1DY9A 2BDHA 2FI5E 1P09A 1EB2A 1ZSKA 4YLUA 1GHVH 2Y5GA 5DG6A 5L6NH 1ZGVA 2GZ9A 2PKSB 1XVMA 1D3QB 1F7ZA 1Y5BT 1D3DB 3RXQA 3W1EA 5ETXA 1N8OB 4TWWA 2PW8H 4ABEA 3N7EA 5EQRA 1AGJA 1T31A 3U69H 4ESTE 3LC5A 4GSOA 4Y0ZE 2XC4A 1MCTA 1P0SH 2OCVB 5E2PA 4YXWD 2J4IA 2F91A 4K8BA 1WYKA 3D65E 3BTHE 3M3VA 1S5SA 3KYFA 1QGFA 1XKBC 1C1VH 1DSUA 1C1UH 3UWJH 5GXPA 2WPJS 1RXPA 1FI8A 2P95A 1VZQH 1QBOA 2YNBA 2ZFFH 2D8WA 2AEIH 3BG8A 3RXGA 2RA0A 1LDTT 1VCQA 1ZTJA 2ALVA 4INKA 8ESTE 1TYNA 3RP2A 1O2HA 4BTUB 2ZWLH 4AN7A 1NTPA 3ZZ6A 2FDAA 1AU8A 2ZGJA 1UK2A 3M7TA 2ALPA 1V6DA 2CK3D 2Z7FE 2HALA 1S0RA 1DWDH 1SKYE 1UVUH 2JIZD 1T32A 2D2DA 2OC8A 4O97A 3K9XB 3SO3A 1IQNA 1X7AC 2FTLE 4B6EA 2WPMS 1W11U 3AASA 5A8YA 1TGTA 3UUZA 2J34A 5HM9A 1AFQC 1ANEA 1JIMA 3LGIA 3VB4A 1GGDC 1A7SA 3O8CA 3GS9A 2F9UA 1NBME 1GHAG 1HNEE 2BD3A 3MQKC 2ZDNA 4BAHB 4E7NA 1BMLA 5DP6A 1SBWA 2NU2E 1NU9A 1ZPZA 2XNDD 2LELA 1ESBA 1EB1H 1NRQH 3UOPA 1K1NA 3HATH 1GJ7B 4O03A 3UQVA 1FIZA 1TX8A 1EPTB 1Y8TA 4DGJA 3MU8A 3SGQE 3SW2B 2FIRH 1NESE 1THRH 2G51A 2Z9GA 3UTUH 2HNTF 1WQVH 3O8BA 1GHZA 1QA0A 1NFWA 3CS7A 3C27B 3PRBA 1O30A 2VIWA 2BVXH 1FPHH 1O3PB 4NA8A 2AHME 1EP5A 3QTVH 2W6JD 3ZIAD 2AMDA 2FLBH 2FP7B 1C5QA 2F9VA 1A0JA 3M5OA 3LH3A 4ZHLU 2EI6A 4O3UA 1ARBA 1ZSJA 1BA8B 2J95A 3MNSA 1O2LA 4X0WU 2A31A 5T3HA 2PKAB 2EC9H 2IOTA 2ZECA 5AFYH 3A7YA 1Z7KA 3SNCA 1CGHA 4XBDA 3LH1A 2YMSC 4ISHH 1GMHF 4WY3A 4ABGA 3ZZ7A 2VB0A 4JMYA 4X6MA 1FAXA 1MTUA 1RGQA 1U6QA 2QF5A 1S0QA 3MH4A 4MPXA 4A5TS 1KDQB 1EJMA 1HAXB 2ZIQH 4DJZB 1O3GA 4RT1A 5DP4A 3SORA 2RFKC 2PKAA 1WCZA 1CBWC 4BAKB 2V3MA 1MZAA 3BTME 3QGJA 2BLOA 2UWLA 1YLNA 3BG4B 4DT4A 1O38A 2CXVA 1T8OA 2GCHF 1TPOA 5C17A 1SLVB 3M3SA 3U8OH 3P8OA 2HVXA 1ZHMA 3BTKE 5F53A 2KR7A 5EODA 2ZO3H 3P92A 3NRLA 3GISB 2FX4A 2KCPA 1QJ6B 2G00A 4FU8A 1UVPA 1KMHB 5AHGH 4DT7B 2QY0B 3PROA 1G3BA 7KMEH 4OS2A 4X1PU 2PLXA 1SOTA 1Z6EA 4CBNA 1IQJA 3S9AA 1SLWB 3F2FA 4WJG2 1BOQA 2FX6A 1PQAA 5C0UA 4TYDA 1S83A 4LK4A 1GBMA 1YM0A 1UTMA 1BRCE 3UPEA 1GBCA 5J4SA 2XNIA 1P3CA 1HAVA 2BLVA 4H4FA 2UWPA 1OP8A 2J2UA 1C9PA 3DFLA 3T27A 1JIRA 3VFEA 3U1JB 4AFZA 1ABJH 3MH6A 1TNJA 4AG1A 3RC4A 2VBCA 2ZDMA 4ZXXH 4KTCA 5BRRE 4IBLH 1QZ8A 2O8TA 1GI6A 2OLGA 2P8OB 2PGBB 3TITA 1IOEA 2BY9X 1ZPBA 1SQRA 1H8HD 2UUKB 1CHOG 2XBYA 1OPHB 1E34B 2EI8A 4JZDH 3MI4A 2FLRH 2FODA 4TSFD 2C8YB 4CH8B 2ZF0H 2A1DB 1EOJA 5AF9H 1C9TA 1LHGH 1MKWK 1F0RA 1P57B 3SJIA 2PUQH 1NT1A 3F3BA 1UVOA 1GPZA 1KXDA 1K1LA 2ZCKP 1AE5A 4X1RU 1BMNH 1TBRH 4NA9H 2GZ8A 2EY4C 2P3TB 2V7QD 3SU5A 2NU0E 3O8DA 3RXOA 1RIWC 1RTFB 2P94A 1D6WA 1LHFH 2CF9H 1V2VT 3UNSA 3ZYEA 3TPIZ 1BHXF 1KLIH 1ZR0A 2FEQH 2SGAA 1FY1A 1GL0E 1TOMH 1UW7A 3Q3YA 5EU8A 3ZZ4A 1SLUB 3DSPA 4RKOB 5HXFA 3VB6A 1YPHC 1HJAB 2A0QB 2C8ZB 2WV4A 1W2KH 1SQOA 4GPGA 4NIYA 1ZMNA 2ZDKA 3RXMA 1XKAC 4JK5A 4RSPA 1LHDH 2GT8A 2L74A 3LJOA 1JOUB 4LOYH 1MCVA 2ZFSA 2JH6D 4DIHH 1A3EH 3A85A 1XUHA 1C5MD 5CE1A 2QAAA 5A0BA 2K0QA 2CMYA 4MNWA 2OQ5A 3L3TA 3ZZDA 1PYTC 2FYRA 5A8XA 1ORFA 3KYGA 4ASUD 4NZLA 3M5MA 4F55A 2VJ1A 3PO1B 1GCTB 1C5VA 1HAHH 1QCPA 3RM0H 1O2JA 2JETB 2OQUA 1VITG 4NFEA 2G52A 2XCFA 1C5RA 4JZEH 4BANB 1GBAA 5F8XA 3UR9A 2KFWA 1WAYB 1P2OA 3M61U 3CS0A 3QLPH 1INCA 2FOBA 3UQOA 3ODFA 2WV9A 6GCHF 1O2VA 3UB0A 3TVJB 2H9EH 4ABJA 4I7YH 4M7GA 2A7HA 4X8TH 1HAVB 2EA3A 1S6FA 1O5AB 1C5TA 4OS1A 3F0OA 4FUEA 1GG6B 4IS5A 1P8VC 3BN9A 1O5CB 3EE7A 3DFJA 4TY7A 1G32B 5FPSA 4MTBA 1H8ED 1W0JD 3CNRA 4BTTB 2GV6A 1GI2A 1AFEH 1TGSZ 2FESH 3B23B 4UE7H 2VWLA 4OGYA 3V3MA 4B2CA 1QJ7B 1UCYK 2R2WU 1QBNA 1GBFA 4ISOA 2BDIA 1DITH 4NWLA 2A4QA 2PWXA 3PV4A 4AYVB 2BQ6B 3SI3H 1BBRH 1SGYE 1ETRH 2OBOA 1KYNA 2VIPA 5EOKA 1DVAH 3A89A 2BQWB 3BV9B 4OS6A 1EQ9A 2A7JA 1MTVA 3BTDE 4SGAE 1J14A 1GJ8B 1IQHA 2QXIA 4YOIA 1ANCA 1EX3A 2OBQA 2Q6FA 2SFAA 2IN2A 3E0PB 2JDID 3ZZAA 1F0TA 2OD3B 4K3JA 5DSFA 2GCTC 3GOVB 5FL7D 5GJ4B 2A4OA 2BYAX 5FCKA 3GY7A 1HBTH 1F5LA 5FX6A 3VB7A 1NBMD 4Q7XA 6CHAC 1C1TA 4AOQA 4Y11E 1O3HA 2AFQB 1SL3A 2Z3DA 1P04A 2PR3A 2KAIA 2C93B 1YPEH 2BLQA 1FNIA 2WUCA 1Y3XA 3RM2H 3P8NA 1P3EA 1CHOF 2W5EA 4JYVH 7LPRA 3PLBA 2Y7ZA 1IQGA 1KY9A 3RMLH 4NIWA 1SFQB 1THPB 2XXLA 5FBEA 3BTQE 3RDZA 2BVRH 1N6YA 3A7VA 5DP3A 3LGUA 4Z6AH 1GBKA 1V2QT 4Y8YA 2GCTB 2R3UA 4AORA 3ZZ9A 4Y6DA 1Y3YA 2F83A 1BJVA 1SMFE 4DIIH 1K1IA 1DFPA 1DE7H 1WTHD 1GHYH 2A45B 3A83A 1GJBB 1C2MA 2TGAA 3EA8A 3DSOA 1DUAA 4IMZA 5L2YH 2KCAA 4U32A 5E8EH 3SV7A 2OC1A 1UK3A 3TNTA 1TONA 1FX0B 4FVBA 1NS3A 1RFNA 1SI5H 3G01A 5FXLA 4FUIA 3URCA 1VKYA 3B8JA 1NRNH 1O3EA 2OINA 4X8SH 1TQ0B 4RI0A 1ACBE 1OWDA 2A32A 4J2YB 5HKKD 1E1QD 1GGDB 4Q80A 4PROA 2PTNA 1TA6A 2SGFE 4X2VA 4J1YA 4WH8A 4XBCA 2ZFRH 2AIPA 4MNXA 1O2TA 4X2WA 3TGJE 1GJ9B 2NWNA 4YLQH 4HFPB 4K1SA 1AB9B 1K1OA 1DLEA 5A8ZA 5K7RA 2QF0A 3H7OA 1C1SA 2DUCA 3RXBA 2STBE 3SI4H 4X1QU 3VG8A 1QIXB 3NK8A 2VWNA 1T4VH 3UFAA 2FS8A 4BAMB 1KSNA 1TX7A 3E3TA 3GDSA 3PWBA 4KTUA 4CRAA 4DY7B 5K0HA 1BZXE 1S6LA 3K6ZA 1XMNB 1KTTB 1QB9A 3OTPA 3RXHA 1HLTH 2BQ7B 5FBIA 2ZHQH 5GCHF 1E35B 5TJXA 3SU3A 1NFYA 2P59A 4UD9H 3SGAE 1OOKB 5DJ7A 4Z0KA 1AN1E 1BCUH 1O0DH 1HXEH 2YMSD 1A4WH 1DXPA 1HYLA 4UDWH 1O2NA 4OGXA 3LONA 1C1RA 1TABE 1GVLA 4I8LA 3MNXA 1Y5AT 2VIDA 1XUGA 4X2YA 1BRAA 3OEED 3A81A 3S9BA 4B73A 1GVKB 3NXPA 1T4UH 1HAYB 5F8TA 3N7OA 2PSXA 3F2HA 1TRMA 4XBBA 1TMTH 1ZRBA 1Q2WA 1IQKA 2EEKA 3RU4E 3ELAH 1Z71A 1LPGB 1W3CA 3BTWE 1W7XH 1YGCH 1E36B 1WUNH 3UWIA 4FXGH 2FYQA 1NROH 1SR5C 3SBKA 4ACBA 3ITIA 3ZZ3A 1VCWA 5EXMA 3RXDA 2Z9JA 1QRZA 2WPLS 5JB8S 1H8IH 1D4PB 3IITA 1KIGH 2BDCA 2Z3EA 2BB4A 2IPHA 1RTKA 4Q4LA 3GDUA 2QGRA 3UAIC 3SJ8A 3BIVH 1TIOA 4AFSA 3UREA 1TNGA 1LTOA 5EJZA 2Y7XA 3NPSA 1C1MA 1GHBF 2PSYA 2XBVA 3HK3B 4NA7A 2ANKH 1ZYOA 5EJLA 1BMFD 3LC3A 4WVPE 2BOHB 3DD2H 2BY8X 1MMJN 3KQCA 4ABHA 1AVWA 2ZPQA 4BXWA 4K69A 3TGIE 2GV7A 4OS4A 1GCTC 3HPTB 3AAUA 3FAOA 3RC5A 3QZQA 4XFQA 1V2NT 2VIVA 1QJ1B 2QF4A 4K1TA 1C2GA 4JK6A 3WY8A 1BT7A 1IQFA 4YO9A 1O5DH 1KXEA 1O39A 1C5SA 1UTJA 1OWJA 5FPTA 5JBTA 4Y79A 4D9RA 3A87A 1C5ZB 3RXRA 4GLYA 4VGCB 3MMGA 2C3SA 2BD4A 4MLFB 3VGCC 3W95A 1XUIA 1EAIA 3UNQA 5LGOA 1P12E 1UHBB 2WINI 2GDEH 4X6PA 1Q3XA 1GBBA 1O5BB 2F9PA 2ZPRA 3A8CA 2ZDAH 1GI4A 1MH0A 3F2GA 5ESBA 4B2BA 3Q76A 3AVZA 1HUTH 2W6ID 3LT3A 1N8OC 1UTLM 2A5KA 3A8DA 1XVOA 3QK1A 3A7XA 3LGYA 2Q1JA 1TRNA 2XYAA 3TJOA 2XW9A 3PRDA 1ELGA 3JZ1B 1NFUA 3QWCH 2GDDA 2J92A 1C5XB 3NUMA 1HAZB 1FLEE 1TNKA 2PV9B 5GIBA 4B75A 2OUAA 1BTHH 3Q77A 2ZDVH 3MU0A 4CREA 3KNXA 1BDAA 2D1JA 3QGNB 8GCHF 1TGNA 2FOMB 3SJOA 2TIOA 3L6PA 3BF6H 1ZTLA 2F9BH 1CSOE 2H5CA 4UFGH 2WYJA 1DWBH 2AGGX 1EKBB 1TPSA 2HNTE 1N1LA 3MNBA 5GCHG 5JYIA 2VGCC 1QQ4A 1DXWA 1NY22 1GBIA 3SOSA 2AMPA 5GWZA 4ZMAH 1FUJA 3FP8E 3QO6A 2BD2A 2BLWA 4CR9A 2OXSA 2XOKD 1UTPA 1SGFA 5H4IB 2VH6A 1IHTH 2BOKA 3QN7A 1S81A 3PO1C 1Y3WA 1YBWA 4CR5A 3SQHE 4ZCNA 2Z9KA 2XBWA 3HGNA 4I8GA 2P3FH 3BSQA 3Q3KA 2QV1A 1QBVH 1YCPK 2QN5T 1EAWA 1AI8H 3GY6A 3S7HB 4X8UH 1DPOA 1H4WA 5E0JA 4ABIA 4D8NA 3LGWA 2H9HA 5FPYA 2FZZA 1H8DH 2F3CE 1LQDB 1V2TT 1QL8A 4Y7AA 1ZHRA 5DK1A 3EAJA 3ZV9A 1CGIE 1NPMA 4BTIB 5C1XA 1O3AA 3VEQB 1YYY1 4XD7D 2GCHG 4CRGA 4YM9A 1GBEA 2HLCA 1L1JA 1TGCA 1OXGA 4I33A 2LPRA 5BPEA 4SGBE 1GG6C 1MKXH 1AY6H 2YOLA 1P2MA 3GCOA 6ESTA 3DHKH 4R0IA 1P11E 5CHBA 2YNAA 3OX7U 1FJSA 4BNRA 1ARCA 1ELFA 1AWFH 2BDGA 4X2XA 1ZGIA 1SGFG 3P6ZB 1O2YA 1TQ7B 1RRKA 1TMUH 1L2EA 2GGVB 2KAIB 2SNVA 4IW4E 9LPRA 2WHXA 1OYTH 1T8LA 1EZQA 1O3CA 3D49H 2DE8A 2HPPH 4IMQA 4MPVA 1EZUC 3FKSD 3H5CB 1F2SE 1OWKA 3ZVEA 4WF8A 4B76A 1C4V2 1BQYA 5I46H 2I6SA 1IQIA 1GHAF 3OU0A 1NN6A 4A7IB 6LPRA 4XSKU 4NFFA 1V3XA 2FOHA 2Z9IA 4IN2A 1NRSH 3A82A 1A46H 2CJIA 5KECA 5DP9A 1GJCB 1ZJDA 2ZGCA 4MG3A 1AIXH 2PHBA 2HGTH 3TK9A 3D23A 3SU2A 2BX3A 2LP6A 1WQSA 1ANDA 1Y3VA 2EI7A 2ZPSA 3F68H 1J9CH 1LHEH 1QL7A 2Z94A 3SNBA 1GL1A 1SGQE 2ANYA 2GTBA 4YZUA 1HJ8A 3TU7H 4OS7A 3SYJA 4B71A 1EXFA 2BMGB 5DKMA 3URDA 3AW0A 1C5PA 4A1TA 1OHHD 1O31A 2VH0A 4Y76A 1PQ5A 4U01A 3Q00A 2VIOA 1FZZA 1QNJA 2QYIA 4X6OA 4AGKA 1TOCB 4CBOA 2FXRA 1P05A 2WPHS 4ACAA 4DOQA 1OSSA 1AZZA 4FUCA 2KZ4A 1PFXC 1CT4E 1SG8B 2FOFA 3W94A 2PGQB 1CQQA 1DUEA 3GY8A 2O8WA 4CH2B 4KELA 1TNLA 3AK5A 5EPYA 2OP9A 1CU1A 4JZIA 4FOUC 1MQ5A 3A84A 4CRDA 4AB8A 3P70B 2RDEA 3EE0B 3T29A 4ZKOU 2P8OC 1P2KA 1QQUA 2ZHFH 5LPFA 1SGTA 3F0PA 2BDYA 2SGPE 4LZ1H 1IQLA 3LJJA 1V2RT 3PV2A 4TPIZ 2A2QH 3LGVA 1O3DA 3ZVGA 2SGEE 2BY5X 1P2NA 1EAXA 2YMSB 5CHAB 1UHBA 1B7XB 1VGCC 2G55A 2O8MA 3DT0H 3F9GA 4Z1MD 2JJ2D 1ELEE 4GAWA 4A92A 4U2WA 1EZSC 4ZKRU 1THSH 2W3KA 1RTLA 1AVXA 4K1EA 1QR3E 2TGTA 1PPGE 1YPLH 1LVBA 2A2XH 1GJ6A 2NU3E 3N99A 4CRBA 1AHTH 4BAQB 3KQDA 2JKHA 5JBBS 3GCHB 2ZG0H 1FAKH 1GBLA 2FWWA 1UTKA 4UFDH 3PMJA 4F4OC 4I86A 3KF2A 3OFND 2W26A 4Y0YE 4ZROA 3KN2A 2HLDD 1HGTH 4HG6A 2QIQA 8KME2 1BIOA 1Q31A 2ANWA 1NU7B 1KLTA 5EQQA 2BXUH 5EXNA 3MOCA 5CHAC 4ZKSU 1LVMA 3M37A 4K2YA 3KQEA 1G3EA 1C4Y2 1ABIH 4YT7H 2BDAA 1FMGA 1AO5A 3T5FH 3A88A 2ULLA 1A3BH 3SNEA 1AVGH 1QA7A 1BMAA 4FUFA 2KCYA 1O2QA 3TJNA 3SHAH 4ISIH 2M5TA 2ZDLA 1UVTH 2IJOB 3FZZA 2D26C 4Y10E 1MTNC 5AVDA 3WWFA 2J94A 1O35A 1O2GH 2G4TA 4NWKA 5L2ZH 1MU6B 1DS2E 1HRTH 2AGEX 3EGKH 2UUYA 3RU4D 2OTVA 1O2XA 5F6MA 2FI4E 2G81E 1K0HA 1ANBA 1HPGA 1ZMJA 2H2ZA 1BRBE 3TH3H 1BTZA 1LHCH 1ZRKA 3FFGA 2ZZUH 1HAGE 2VVUA 3K65B 1L4ZA 1DX5M 3OYPA 1HB0B 1ZMLA 1ELCA 2B0FA 7GCHF 5EG4A 3GYMA 3SV6A 3F9HA 4GCHF 2B8OH 1MTSA 2RCEA 4FU9A 4Y8ZA 2H5DA 1NM6A 2K1QA 4YOGA 1AQ7A 2FOCA 1DM4B 1O2SA 3CP7A 2FOAA 1UJ1A 1C1OA 1MTNB 1A5HA 3UNRA 3ATWA 4NSVA 1RJXB 2G8TA 4FUGA 1P9UA 2ILNA 1CO7E 3CENA 1BBRE 1KXCA 1PJPA 1B5GH 1W13U
chains in the Genus database with same CATH topology
4WXIA 2CV3A 1MU8B 4ZHMU 1J17T 1H9HE 1NZQH 5ABWA 3SNDA 3VGCB 1TB6H 2G4UA 1HDTH 1XM1A 1D3TB 1YLCA 1O3FA 4O3TA 3T25A 3SN8A 2ZNKH 3T28A 1LMWB 1GI5A 3E0NB 2Y81A 4NGAH 3GDVA 1O36A 1GWAA 1HV7A 1P02A 3S0NA 4INLA 4D76A 1ESTA 1CA8B 1BTYA 3IWMA 5EXLA 3H7TA 4ASHA 4XE4A 1IHSH 4A1XA 1FIWA 2Q6GA 4TWYA 3R3GB 5A2MH 2JETC 2A4GA 3V7TA 4GUXA 4IGDA 4FUDA 2ZKSA 5B6OA 3SUEA 5DP5A 5JBCS 1O2ZA 1FONA 1QRWA 1CE5A 2NU1E 3A8AA 1LQEA 2AYWA 2XC0A 4JYUH 4NIXA 1EPTA 3MWIU 5LPEA 2ZEBA 1GJ5H 4OS5A 2V0BA 4X1NU 2UUJB 8GCHG 1C1WH 1K2I1 2NU4E 3BTTE 2CN0H 4MQAA 5E2OA 4KKDA 1CT0E 2QC2A 3ATMA 2ESTE 4A6LA 1L4DA 1D9IA 1W8BH 3ZVBA 2BTCE 1OWEA 3M3TA 1FQ3A 2AMQA 1AZ8A 1V2UT 1TMBH 2AS9A 3EA7A 1C2LA 1WTGH 3RMNH 3P95A 1JMOH 3TK6A 1CHGA 2BZAA 2TGPZ 1PPHE 1SOZA 3P17H 1CA0B 4HI3A 5C67A 2GVFA 2C90B 1LKAA 2FPZA 2ZU2A 4F49A 2TRMA 5EW2H 1E38B 3R0FA 1VJAU 2HPQH 1QURH 4UFFH 1RD3B 1T7CA 5IYTA 1V2LT 2SNWA 2ZFQH 1F0UA 3ZVDA 3MO3A 1PQ8A 4AFUA 1AB9C 4AG2A 3NKKA 1SGNE 3SHCH 2XC5A 2ZFPH 3GICB 1GHBG 1G2MA 1HIAA 3VXFH 1SB1H 2HNTC 1SLXB 1Y59T 1H9IE 2ZTZA 3A80A 5EGMA 5GDSH 2Z9LA 3ZYDA 4MPWA 1JXPA 3SV2H 1TGBA 5FCRA 5EQSA 3DA9B 5ESTE 3A7TA 3MNCA 4ABDA 5A0AE 1O37A 3QZRA 1L1NA 2AIQA 2BD5A 5C20A 2ZC9H 4Q7ZA 2Z6BD 3SZNA 3TH4H 1FN8A 2P16A 1C5UA 3EQ0H 2W7SA 4LZ4B 1MZDA 3RXLA 2HRVA 4QT8C 1BTXA 1EJAA 3TK5A 3RXEA 1MBMA 1GMHG 3I77A 3KL6A 4KGAA 1C5WB 1CA0C 4B1TA 1VGCB 4ISNA 4WMDA 2TBSA 2BY6X 1ELBA 1V2PT 4E06H 1KXBA 3HKIB 4WH6A 4AYYB 1Z1JA 1ELVA 1UO6A 1F0SA 1O2KA 1O3NA 2ZP0H 2ZQ2A 1C5LH 5HMAA 2O8UA 1O5FH 1C1PA 1H9LB 1LPKB 3QDZB 2H6MA 9ESTA 2FM2A 1UCYH 3RXAA 1Z6JH 4BOHA 1DANH 1DWCH 4K5ZA 1LO6A 1CGJE 3SNAA 2A7CA 2I6QA 5F03A 5C1UA 3L33A 1C2KA 1A0LA 3GY2A 1UTOA 1UMAH 2WV5A 1GDUA 1HFDA 1SFIA 1HIAB 3M36A 2XWAA 1C1NA 2WYGA 3Q3XA 3HK6B 2XWBI 3VXEH 5C2ZA 2SGQE 2ANMH 1IQEA 3PYHA 1A5GH 1WV7H 3MTYA 2ZHWH 1BTWA 3ZVAA 1BB0B 1BRUP 3LOXA 3SUDA 1G2LA 4RN6A 1K21H 5AFZH 3F9FA 1WSSH 2O8LA 2ODYB 2Y6TA 1G3DA 1T8NA 1V2MT 1O2OA 2A5AA 5LPRA 1E37B 1LKBA 1K9OE 1ELDE 1MKWH 1MD7A 1GHXH 1MTWA 2G5VA 3M35A 3A86A 1PPFE 4BAOB 1DSTA 3TJUA 1J16A 5FX5A 1DLKB 1EZXC 4I8JA 5LH8A 2FOEA 5FHTA 1O3BA 3BTEE 1LVYA 2VU8E 1F92A 2ZCHP 2ZHEH 1G3CA 2ZTXA 1KXAA 4Q2KA 1GVZA 1GMDF 1UTNA 2J38A 1BHXB 1SQTA 1TFXA 3ATLA 3LU9B 1TNHA 1LVOA 3RMMH 1P2IA 2FTMA 1DT2A 3QX5H 4I32A 1OWIA 5E0GA 1QB6A 1HJ9A 2BD7A 1W7GH 1C2EA 1L0ZA 2VIQA 4UONA 4THNH 2ZTYA 1Z8IB 2P93A 3LDXH 1BMMH 1FXYA 3B9FH 3MU5A 1ELAA 1TX6A 3JZ2B 1K28D 4UFEH 3MO9A 5T6DA 3BEFB 4MNYA 2GMTB 1K1PA 2BY7X 4E7RG 1JBUH 1S84A 3KQBA 3BTGE 4NG9H 4B2AA 1GJ4H 1AUJA 1MQ6A 1SC8U 1YPHE 1GI7B 1DWEH 3RXVA 1J15A 1W0ZU 2AH4X 1FN6A 2ZGBH 1GBJA 3PTNA 4A1VA 4DURA 3K2UA 3M7UA 5JDUB 1ID5H 1YPMH 2FS9A 3U98H 4Q7YA 3F6UH 5JB9S 1Z8RA 3MH7A 5C1YA 1V2WT 3TLOA 3ZZBA 2Y5FA 4KTSA 3O8RA 1CT2E 3S7KB 1YPKH 3PLKA 3ESTA 1BTUA 3GY5A 3DUXH 1ZZZA 2GP9B 2VWOA 1CBWB 1O32A 4MNVA 2RG3A 2QA9E 3PWCA 1C1QA 1SGEE 2WPIS 1ETSH 1CVWH 3ATKA 3GCNA 1ZLRA 2C8WB 1C2IA 3PLPA 1ZOMA 1OP0A 4Y8XA 5A0CA 1SGDE 1DDJA 1NRRH 2ODQA 5JPMH 2Z3CA 4DW2U 1A5IA 3GCTG 4NIVA 5I25A 2BD9A 4FVDA 2XRCA 1GJDB 4IC6A 2OC0A 1WBGB 1OP2A 4D7GA 1WU1A 3ZZ8A 3ZZCA 4DG4A 3BTFE 4CHAB 2ZGHA 1PYTD 2R3YA 3NZIA 4NZQA 3SU4A 2CGAA 3FVFB 1EOLA 3TGKE 1MAXA 1UTQA 1HAPH 1JRTA 1HAIH 3NCLA 1JRSA 1TAWA 1J8AA 2BX4A 5PTPA 3LIWA 1BBRK 1P01A 2PTCE 3RC6A 1V2JT 3ENSB 4DVAU 3OTJE 4H6TA 1SGCA 3RXSA 1YPJH 3GY3A 3SGBE 1IAUA 2V6NA 3PMBB 3SQEE 1IQMA 3SUGA 2ZCLP 4CRCA 3AAVA 1OYQA 1YKTA 3KHVA 1KLJH 2B9LA 2Y80A 4KP0A 1OWHA 1MAYA 1G36A 4H42U 2BXTH 4GHTA 1Y5UT 1DY8A 3BEIB 1GDQA 2HWLB 1ELTA 5T6FA 5JBAS 3E1XB 4ZUHA 3QTOH 1EATA 3RXCA 1O2IA 3UY9A 4IN1A 5SGAE 1TRYA 3E8LA 1GI1A 4CRFA 3KCGH 3E90B 1NC6A 1O2WA 1C2HA 4MDSA 4O9VA 4FUBA 1XXDA 1GBTA 4GHQA 4YESB 2Y5HA 5DPAA 1D6RA 2PKSC 2VGCB 3C1KA 3STIA 1AKSA 2XBXA 1LCYA 1GMCG 2BVSH 1AWHB 2QXGA 2Q6DA 3D62A 4AZ2B 4R8TB 3GYLB 1W10U 2RA3A 1LPZB 1RIWB 4YT6H 1SGIB 4ABAA 2TPIZ 3P8FA 3TJVA 2BM2A 1GHWH 1T8MA 2P3UB 1TBZH 2H9TH 3U9AH 1VR1H 1O3JA 1A61H 1QRXA 1G9IE 5T6GA 3KIDU 2ZU4A 5DGJA 1FY5A 1Z1IA 3S69A 1ETTH 2LNCA 1EUFA 1UCYE 2J9NA 2ZHDA 2JH0D 1QTFA 2F9NA 1ZHPA 3RXIA 1YPGH 2V3HH 3RXKA 5G4BA 3T2NA 2QF3A 3MHWU 3U1IB 1O3MA 5DP8A 1AFQB 3FP7E 2V35A 1O5EH 6CHAB 2ASUB 3UR6A 4FUJA 1KDQA 1GJAB 1SVPA 1Z8JB 5EW1H 4WXVA 1C5YB 1M9UA 2A5IA 4ZXYH 3SUFA 4WMEA 1KTSB 5TCCA 5C3NA 3HGPA 5HYOA 1O3LA 1YLDA 3GY4A 3ODDA 1PQ7A 2UUFB 5C5OA 2ZU1A 5C5NA 4MVNA 1TNIA 1VITH 2B5TB 4XOJA 4I31A 1D3PB 1AD8H 2XCNA 5GPIB 2CHAC 1NRPH 2UWOA 1GI3A 1KXFA 1O34A 2FI3E 1EJNA 3M5NA 1AKSB 1BJUA 2STAE 3P8GA 1W14U 2VINA 2JH5D 3SV8A 1TA2A 3V13A 7GCHG 1UVSH 4HZHA 3PTBA 4GCHG 3ZVCA 2BHGA 2C4FH 3MYWA 1BITA 2GT7A 3IG6B 2ZU5A 4MPUA 1B0FA 1RS0A 2OC7A 4TY6A 1W0YH 2AGIX 1YCPH 4E05H 4YTAA 1QHRB 1VCPA 1HXFH 2ZI2H 3TH2H 1HCGA 3FZDA 2BZ6H 2WUBA 1O2UA 3UIRA 1A1RA 1TBQH 4K60A 4RKJB 1AE8H 1SSXA 5DP7A 3ZV8A 1P9SA 3BEUA 2GX4A 1O3KA 4HGCA 3GCTF 3OY6U 3PM3A 3T62A 1HAOH 6GCHG 5DO4H 3SU1A 1Z8GA 3E16B 2BD8A 2FO9A 1MUEB 1O3OA 2PUXB 1AUTC 1GCDA 4JCNA 2VWMA 2AERH 4NCYA 4WMFA 1DOJA 2W3IA 4X8VH 3RXUA 3BG4C 3MU1A 1P2QA 5FAHA 2ZA5A 3SJ9A 4DCDA 4B74A 1SPJA 2CHAB 3T26A 5TCAA 3EA9A 3RLWH 1GDNA 3VB3A 1SQAA 1MBQA 4I8KA 2ZGXH 2GMTC 2GZ7A 3K6YA 1TPPA 5HGGA 2TGDA 1V2KT 1XX9A 2XTTB 1ZTKA 2FOGA 4IC5A 1FY4A 1TLDA 5A09A 1QL9A 1V2ST 2Y82A 1C2DA 2FMJA 2HOBA 1ZPCA 1A0HB 1YF4A 3V12A 1F5RA 1Y3UA 4XDEA 1BTPA 1EPTC 1TE0A 2QCYA 3VB5A 1OX1A 4ABBA 2CF8H 8LPRA 5J4QA 1TPAE 1O33A 3EYDA 1PPBH 1QY6A 3MU4A 1K22H 3MFJA 2G5NA 3OY5U 1TALA 4I8HA 3S9CA 4D9QA 3PMHB 1YP9A 4ABFA 3UOUA 1VITF 5IDKA 4FUHA 2H1UA 3GCHC 4LXBH 3A7ZA 2ZU3A 5HM2A 2THFB 4X6NA 3KEEA 1XUFA 1P2JA 4X1SU 1NO9H 1O2RA 3MH5A 1O2MA 1XUJA 3E91A 1PPZA 3TNSA 2QXJA 2WPKS 2VNTA 3BIUH 5CMXH 3V0XA 1GI0A 4ZAEA 1C5NH 1YCPM 1C4U2 1E0FD 4Y71A 3RLYH 2F9OA 1S85A 4ZHAA 1C2JA 2SGDE 5E0HA 4WWYA 1FDPA 3KGPA 4ZKNU 1N6XA 2GKVE 4NSYA 1GI8B 4BXSA 3HKJB 2QXHA 3PMAB 4ISLA 1S6HA 3FANA 1GBHA 3OSYA 1BUIA 3SU0A 4JYTA 2PFEA 1JWTA 5F8ZA 1HJAC 4D7FA 2O9QA 2C8XB 4U30A 2RDLA 1GBDA 1S82A 3U8TH 4UEHH 1O3IA 2VVVA 4TPYA 1EASA 4Y7BA 4ZH8A 2A4RA 3RXTA 4VGCC 1VJ9U 1F5KU 1QB1A 1UK4A 7ESTE 1NFXA 3U8RH 4YOJA 4AFQA 3SV9A 1YC0A 1FY8E 3RU4T 1P06A 1K1MA 1WOFA 1O5GH 1ZJKA 1AMHA 1FPCH 3I78A 3MO6A 1EAUA 1G37A 3RXFA 3SJKA 4HTCH 1G30B 4GVUA 2R0LA 3NWUA 1DICA 1MKXK 4JZ1A 1P10A 1B0EA 3LPRA 1XUKA 5EPNA 4H6SB 1QFKH 3RXPA 3TIUA 1OS8A 3F9EA 3SU6A 3F1SB 3ZZ5A 1SHHB 1L1GA 3STJA 1H1BA 4AGJA 1ESAA 3RMOH 3RXJA 1C2FA 3FP6E 3LGTA 3I29A 3M7QA 3PB1E 4K8YA 3ZVFA 3QUMP 1A2CH 1GMDG 4FU7A 4AB9A 2R0KA 1FV9A 1SGRE 2DE9A 4CHAC 3A7WA 3M5LA 3E6PH 2R2MB 2B7DH 2ZFTA 1GI9B 1C5OH 2V3OH 4JZFH 1PPEE 3ATIA 1SGPE 3EDXB 1P03A 1OKXA 2GD4B 1ZSLA 2ZQ1A 1W12U 1SHYA 3AW1A 1O2PA 3VPKA 3A8BA 1EP6A 5L30H 1V2OT 1XXFA 3RUOA 2BDBA 2ODPA 2R9PA 4INHA 1PPCE 1K1JA 1GMCF 1FY3A 2W7UA 2VVCA 4AX9H 3LKWA 1MD8A 1TWXB 1DY9A 2BDHA 2FI5E 1P09A 1EB2A 1ZSKA 4YLUA 1GHVH 2Y5GA 5DG6A 5L6NH 1ZGVA 2GZ9A 2PKSB 1XVMA 1D3QB 1F7ZA 1Y5BT 1D3DB 3RXQA 5ETXA 1N8OB 4TWWA 2PW8H 4ABEA 5EQRA 3U69H 1AGJA 1T31A 4ESTE 3LC5A 4GSOA 4Y0ZE 2XC4A 1MCTA 1P0SH 2OCVB 5E2PA 2J4IA 2F91A 4K8BA 1WYKA 3D65E 3BTHE 3M3VA 1S5SA 1QGFA 1XKBC 1C1VH 1DSUA 1C1UH 3UWJH 5GXPA 2WPJS 1RXPA 1FI8A 2P95A 1VZQH 1QBOA 2YNBA 2ZFFH 2D8WA 2AEIH 3BG8A 3RXGA 2RA0A 1LDTT 1VCQA 1ZTJA 2ALVA 4INKA 8ESTE 1TYNA 3RP2A 1O2HA 4BTUB 2ZWLH 4AN7A 1NTPA 3ZZ6A 2FDAA 1AU8A 2ZGJA 1UK2A 3M7TA 2ALPA 1V6DA 2Z7FE 2HALA 1S0RA 1DWDH 1UVUH 1T32A 2D2DA 2OC8A 4O97A 3K9XB 3SO3A 1IQNA 1X7AC 2FTLE 2WPMS 1W11U 3AASA 5A8YA 1TGTA 3UUZA 2J34A 5HM9A 1AFQC 1ANEA 1JIMA 3LGIA 3VB4A 1GGDC 1A7SA 3O8CA 2F9UA 1GHAG 1HNEE 2BD3A 2ZDNA 4BAHB 4E7NA 1BMLA 5DP6A 1SBWA 2NU2E 1NU9A 1ZPZA 1ESBA 1EB1H 1NRQH 3UOPA 1K1NA 3HATH 1GJ7B 4O03A 3UQVA 1FIZA 1TX8A 1EPTB 1Y8TA 4DGJA 3MU8A 3SGQE 3SW2B 2FIRH 1NESE 1THRH 2G51A 2Z9GA 3UTUH 2HNTF 1WQVH 3O8BA 1QA0A 1GHZA 1NFWA 3CS7A 3C27B 1O30A 2VIWA 2BVXH 1FPHH 1O3PB 4NA8A 1EP5A 3QTVH 2AMDA 2FLBH 2FP7B 1C5QA 2F9VA 1A0JA 3M5OA 3LH3A 4ZHLU 2EI6A