1ELGA

Nature of the inactivation of elastase by n-peptidyl-o-aroyl hydroxylamine as a function of ph
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Nature of the inactivation of elastase by N-peptidyl-O-aroyl hydroxylamine as a function of pH.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (hydrolase/inhibitor)
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elgA01
2A4RA 2GV7A 1VITH 3GCHC 3VB4A 1C1TA 1MTNB 4F4OC 5GPIB 4LK4A 5I46H 1Y3YA 1IAUA 2H9EH 1N8OB 1K1LA 4ABDA 3TGIE 2R2MB 5A0AE 3QGJA 3RXCA 1ORFA 4CBOA 1V2ST 1J8AA 4AG2A 1YGCH 1S81A 1OP2A 2FI3E 4X1PU 2A4GA 4ZXXH 3QLPH 5T6GA 1BMNH 4INKA 1QL7A 4D9RA 2XRCA 2Y7XA 3SNDA 1K22H 4ZMAH 4UD9H 3RM2H 2RDLA 1T8NA 3RXTA 3O8CA 5F8ZA 5EW2H 4GCHF 1XUGA 3OX7U 2A4QA 1GMCF 1TNHA 5FBIA 1N1LA 3TU7H 1AFEH 2ZFFH 4IMZA 4ISOA 3URCA 3GCHB 1ZTJA 1D6RA 1FMGA 2IJOB 3QN7A 1ZSJA 1H8DH 1J17T 2H9HA 1V2MT 3ZZCA 1AQ7A 1LVMA 3EA9A 1ZPZA 5AHGH 1TGTA 1QBNA 2CN0H 1V2UT 2TGTA 2FODA 3A8DA 3A86A 2VVUA 3BTTE 1GJCB 3RU4T 4B2CA 4NWKA 1WV7H 2HNTE 2ALPA 3KEEA 1XXDA 3CENA 5IYTA 1TABE 4JK5A 1C4U2 1C4Y2 2Q1JA 1XUKA 3RXIA 3QK1A 4NIVA 5C1XA 2H2ZA 1SFQB 1SLVB 1ETSH 1RGQA 2FMJA 4XBDA 4HTCH 1NFUA 2VGCC 4B2AA 1GMDF 4DCDA 1UTQA 4NZQA 1HAGE 3UIRA 3A82A 4FUHA 1QB9A 3UPEA 1C5SA 2CGAA 1K28D 1VGCC 2WYGA 1WYKA 2ZU4A 1DS2E 3TH2H 4NIYA 3SUFA 3KIDU 3P95A 1KXAA 2QGRA 1VJ9U 2YNAA 2ILNA 1PPZA 5ESBA 5C1YA 4GPGA 1O2OA 3HK3B 2WUCA 4B2BA 1EX3A 1UK4A 1O2JA 4TPYA 3TIUA 1Y3UA 1TX6A 1YPMH 1B7XB 2VWMA 1ANEA 3FZZA 1NROH 4OS2A 1UCYH 1PFXC 1ARBA 3GY7A 3LGWA 4GVUA 2GCHF 5E2OA 4MLFB 2ZNKH 4E06H 4K3JA 1XKAC 1DSTA 2VGCB 3M5NA 1GJDB 1GVZA 1Z1JA 2P8OC 1MQ5A 4JCNA 3RU4E 1TA2A 6ESTA 5JPMH 1EOJA 1MKXH 1VGCB 4FUFA 2WUBA 1H4WA 2RA3A 1AU8A 1DUEA 5A0CA 3FFGA 1Z6EA 1Z7KA 4E7RG 1GI3A 4ISNA 2ZHDA 1O3OA 1W13U 3SU4A 1EPTC 5DP4A 1FY3A 1FPCH 3SBKA 3SUGA 2FXRA 2J9NA 2ZG0H 2VIQA 1TOCB 2G00A 4IS5A 2TGDA 2PSYA 1NRNH 3CS7A 3E0PB 2GGVB 4AOQA 4NFFA 1DPOA 1SB1H 2FYQA 4IMQA 3PMHB 1LPKB 3LOXA 4PROA 3BTDE 4ISLA 1QGFA 2BZAA 2UUKB 3GCTG 1ELEE 1ZLRA 2P8OB 2ZQ2A 3EGKH 1D3QB 4NG9H 1K1IA 1GGDC 2VWLA 1HAIH 2R0KA 2FS8A 1OXGA 3A7ZA 1DUAA 2VWOA 1TB6H 1FY8E 1LPGB 4DIIH 3DT0H 1AZZA 1UO6A 1TAWA 1EUFA 1KIGH 2G81E 4UE7H 3Q3KA 1GHWH 7LPRA 1ZGVA 3BEUA 2I6QA 1EPTB 1GBCA 4YLQH 3S0NA 1GWAA 1EPTA 1FN6A 2DE8A 2ZDNA 1XUFA 4U2WA 1T8LA 3BEFB 5JB8S 1OSSA 1V2QT 1SC8U 2XBVA 3RXEA 4LXBH 2CHAB 2QF3A 3RC6A 1YPHC 1QTFA 1C5OH 3QX5H 1XX9A 4FU7A 2HVXA 1YCPM 3P70B 1TALA 1TPOA 5DP5A 1G3DA 1W0ZU 1W8BH 1KSNA 4K60A 1GPZA 1G3BA 2TPIZ 4I8HA 4DGJA 1FAXA 5E8EH 1C2EA 2BY7X 2OBOA 1ZSLA 1GGDB 1ESTA 3NPSA 2STAE 1A5IA 1OOKB 2C8WB 2Z3DA 3M7UA 2XXLA 4Q7YA 5JBTA 1RFNA 1QA7A 1MKWH 2V0BA 3PMAB 3V7TA 1K1JA 1T8MA 1THSH 4FVBA 1DITH 1NO9H 2W7UA 3VFEA 4YO9A 1ZTKA 2I6SA 1K2I1 4FXGH 5DJ7A 2P3TB 1KXEA 3LGYA 2A7HA 3MI4A 1TBQH 1P04A 4K2YA 1QIXB 3T5FH 1O3EA 4OGYA 3U1JB 4CH2B 1ELFA 1P3CA 2QXJA 3LC5A 3TK6A 4HFPB 1NC6A 1W14U 1Y3WA 1F92A 4GLYA 3A88A 1O2ZA 3GDSA 3PLPA 1TA6A 1WSSH 5DK1A 1DY9A 3ATWA 3K6YA 4X2VA 2BZ6H 1O2VA 1Z71A 1C5MD 1YCPH 4I33A 1UVPA 3UOUA 4FUBA 4M7GA 3NK8A 4X1NU 1IOEA 1DSUA 1YPHE 4YLUA 1NS3A 1FLEE 3TJOA 1DWDH 1GBEA 1PQAA 1YLDA 1TX8A 1QRZA 5L2ZH 1A4WH 4CR5A 1GI2A 2OP9A 3MH5A 1T31A 3P8NA 1HDTH 3TGJE 1ID5H 3MWIU 4MVNA 1GDQA 2AH4X 2A45B 2BOHB 2PKAA 1ANDA 5C5OA 4U30A 1IQHA 3LJOA 1QRXA 1EB1H 3F6UH 2VB0A 1UTLM 4ABGA 1A3BH 1QURH 2HOBA 1P10A 2BDCA 2Y6TA 3LT3A 4GSOA 2A2XH 3SGAE 3TJUA 5B6OA 3ZZ8A 1ABJH 4A7IB 2P93A 1OWIA 2BD3A 3M5MA 3LJJA 2BD9A 4Y10E 4BTUB 2ZU1A 2QC2A 1A5GH 3STJA 3M7QA 3LGUA 4I31A 3B23B 4AFSA 1XVMA 2C8ZB 1K21H 1OS8A 1V2TT 1UMAH 2JH0D 2ZGXH 1NU7B 3E1XB 3PTBA 1O2KA 2P3FH 4AGKA 2WYJA 5C3NA 3LIWA 3KL6A 1P57B 3KQEA 1FIWA 3V3MA 4CHAC 1K1OA 3M37A 3TK5A 1BJVA 4TWYA 4SGBE 1LCYA 5A0BA 1IQFA 1GL0E 1TQ7B 4LOYH 1EQ9A 4ZHMU 3SJIA 4BTIB 3Q3XA 3QGNB 3M3SA 1E35B 1Q31A 4MNWA 1P09A 3LGIA 4DW2U 2ZGJA 1CHOG 3H7OA 2WPKS 3UQVA 1O3BA 5AVDA 2HLCA 1GVKB 2D8WA 2XCNA 3O8DA 1S83A 1F0TA 2BY5X 4TYDA 4CRBA 4TWWA 1HGTH 1O34A 1J15A 4IC5A 4JZIA 1CSOE 3OSYA 4FU8A 1GI6A 3D65E 1MUEB 3ATKA 4U01A 4MG3A 1F0RA 1C2JA 2J2UA 2VIVA 1C5XB 1AGJA 4ZKOU 4X8VH 1BTWA 1QL9A 5BPEA 2GDDA 3C27B 2FP7B 1TGNA 1TQ0B 4CHAB 2ZHFH 1CGIE 1PPGE 5EXLA 3SU2A 1UHBA 2BDAA 2FS9A 3TK9A 2GKVE 1OP8A 5LH8A 4JZ1A 2FO9A 1DY8A 1GHAF 1HAZB 1WBGB 1QJ1B 4O3UA 2FLRH 1BCUH 3BG8A 3TGKE 4XFQA 1SHYA 3R0FA 4OS5A 3MO3A 4NZLA 1BHXB 1ELGA 3HKIB 4RKJB 1W7GH 3TNTA 1O2QA 4INLA 4KTCA 3NWUA 2FOBA 3SV6A 2B0FA 1KXCA 2VJ1A 4XBBA 2VH6A 4ISHH 2BVXH 3GCOA 3ZZDA 1O3GA 3ZVAA 1GI9B 4BXWA 1ZSKA 2SGDE 1EZSC 1D3PB 3RMMH 1YF4A 1B5GH 2W3KA 1C2FA 4NIXA 3A81A 7ESTE 2OQUA 2CJIA 3SNCA 3FZDA 1P2QA 1P2IA 4ZKNU 1EAXA 4OS6A 1XVOA 1F5KU 1PPHE 2OINA 3Q77A 2TGAA 5LPFA 2LNCA 2AGIX 2R0LA 2F9PA 2A1DB 4NCYA 3SNAA 2ANMH 3UR9A 2PTNA 4FUJA 4IW4E 2WPIS 1PYTD 1AUTC 5DP9A 3STIA 1FZZA 3KQDA 2VIPA 5T3HA 2Y80A 4GHQA 3T62A 3PYHA 1DXPA 2WPMS 2BLQA 1KDQB 1YPEH 5HM2A 4AYYB 2O8MA 4AFZA 3SJ8A 1AI8H 1RTKA 1KDQA 1S0QA 1NFWA 4X2XA 1Z6JH 2ZFQH 5GCHF 5GWZA 2ZA5A 2ZO3H 2CF9H 4I8LA 1UK3A 1V2KT 4Y71A 1LQDB 2R3UA 4AB9A 2AGEX 4Y6DA 3BG4C 3ATLA 1C5TA 1GBMA 1O3IA 1S6FA 3EDXB 1TNKA 3EA8A 4NSYA 3P8GA 3MNBA 4WF8A 1KXBA 2BX3A 3EAJA 1FXYA 1O35A 2XW9A 3MTYA 4IBLH 4ISIH 4DOQA 2ZI2H 1H1BA 2J38A 4CRCA 2QCYA 1O2WA 3SUEA 2Z3CA 1DWBH 1FY4A 1MD8A 1FDPA 1UTPA 2FWWA 2VNTA 1GI8B 1ZMJA 2BDYA 1GHBG 2BY8X 3E90B 1C2GA 1QBVH 8GCHG 1DVAH 1CT0E 1SGQE 1KY9A 1TNGA 1FUJA 1O2YA 1DE7H 3ELAH 1XUHA 2HNTC 1IQLA 4CRAA 3KQBA 2PFEA 4X2WA 2EI6A 3S9BA 1B0EA 1BZXE 1L1JA 5EPNA 1JRSA 1Y5UT 4D8NA 1V2WT 2BTCE 3BG4B 4K5ZA 4A92A 2JKHA 2FOCA 3DFJA 4MDSA 1M9UA 3SGBE 2Z7FE 2ZDAH 3RDZA 2AIQA 2DUCA 2OC7A 1DM4B 4MQAA 1LHEH 1IQJA 3TVJB 2OTVA 4GHTA 1O2NA 3E0NB 3DFLA 1O31A 3ESTA 3ZZ9A 1O5BB 3ZZAA 1O2PA 1GG6B 4NA8A 3ZV9A 4E7NA 2ZEBA 3SQHE 2R3YA 3SHCH 2IOTA 1MKXK 2PSXA 4FUDA 2NU1E 1YM0A 2AEIH 1DANH 5EXNA 3VXEH 1HAPH 4XE4A 4ZROA 2NWNA 1BBRH 1IHSH 2ZF0H 4AYVB 2FOGA 4FUGA 1E36B 1LPZB 1JWTA 1G32B 2FEQH 1A2CH 3QWCH 4ABJA 2D26C 3P92A 1UVSH 4AN7A 2G4UA 3E6PH 2F3CE 4OS4A 5DGJA 3I77A 1LVYA 3P6ZB 5CHAC 3GY8A 1S84A 5EQQA 1JIRA 5J4SA 5FPTA 3A8CA 1G2MA 2ULLA 3SV9A 3BIUH 5SGAE 1MQ6A 2TGPZ 2ZCHP 4ABEA 3BTFE 2ZU3A 1WAYB 4Y7BA 4MNXA 8KME2 1GBLA 1H9IE 1JRTA 3LPRA 3QZQA 4JZEH 4XDEA 1GVLA 2SGPE 1C1RA 2QY0B 5EQSA 1GHVH 1VITG 3LH1A 2A4OA 1GJ6A 4Q7ZA 1O3HA 1BHXF 3O8BA 3UFAA 1Y3VA 4UFFH 5EODA 4NA7A 4FUIA 1ANBA 3Q00A 1V2PT 2G52A 1AWFH 1EAWA 4JYVH 5F6MA 4RSPA 5C1UA 4THNH 1KLIH 1NN6A 4FUEA 1G2LA 3B9FH 1DT2A 4DY7B 5DO4H 3VB3A 3ITIA 4FVDA 3W94A 1C5LH 4Z6AH 2A5KA 5CHAB 3QTVH 5HGGA 2O8LA 1OWJA 1P9UA 1WOFA 4A6LA 1O39A 2QXIA 2FLBH 1V3XA 1P2MA 1O3DA 5ABWA 1HUTH 3BTKE 1P11E 1NPMA 4X8TH 4KELA 4DT7B 4NA9H 1TMTH 3RXVA 4B1TA 2OLGA 1VCPA 3S7HB 5HYOA 4YM9A 3AVZA 1O5GH 1TMBH 3A8BA 1A0LA 1O3NA 4E05H 1EOLA 2BD4A 4MPWA 4TPIZ 5ETXA 1BRAA 2BD7A 1QNJA 1RXPA 4KKDA 1GMHG 1EAUA 1TOMH 1TIOA 2ZGHA 4B74A 4FU9A 2WPJS 1MKWK 3RXDA 2VVVA 2K1QA 5T6DA 1F0SA 5LPRA 1MBQA 3F1SB 2WPLS 3A7YA 4WXVA 2CV3A 2J94A 2W7SA 3EYDA 1V6DA 1ZR0A 1ACBE 4IN2A 6GCHF 3RMOH 3GY5A 1TONA 4IGDA 3ZYDA 3KCGH 2CHAC 1C1NA 3BEIB 1MCVA 1MD7A 1GBAA 2QV1A 4K1EA 5LGOA 2GTBA 3KGPA 4A1VA 2VWNA 1EP6A 1O36A 2FOMB 3FP8E 4INHA 2A5IA 7GCHF 1CGJE 5FHTA 3KNXA 5K7RA 1O3FA 4GAWA 3HKJB 2TRMA 2FESH 3LONA 1LDTT 4Q2KA 1P0SH 3SJ9A 2H5DA 3MYWA 1Z8JB 1GJ7B 2FDAA 2ZDVH 1KLJH 1SOTA 1D4PB 1XXFA 1GHXH 1TWXB 4X8SH 4Y8XA 1MTWA 1SSXA 3UOPA 4ZHLU 1LVOA 1MMJN 3QZRA 1DWCH 4K69A 1P2NA 1UK2A 3SQEE 1ZPCA 3K65B 4U32A 3RMLH 2HALA 1P02A 1UCYE 2G5NA 3TJNA 1OWHA 1JIMA 2STBE 1NFYA 3SV8A 2ZHQH 3RXUA 2GD4B 3RLYH 4ZHAA 1C2LA 5C67A 3M61U 1FN8A 1FI8A 3UR6A 3QTOH 1ZPBA 2BLWA 4JK6A 1C1SA 4AZ2B 2QN5T 5GIBA 1DWEH 2PLXA 1DOJA 2F9VA 3FP6E 1BTUA 2ODYB 2QYIA 2ZPSA 2RCEA 2OC0A 3BTME 3PLBA 4D7GA 2Z6BD 2BX4A 1QL8A 3A84A 1ELVA 3ZVFA 3SORA 2TIOA 2Y5GA 1E37B 1S0RA 3JZ2B 3NXPA 1BMLA 2BVRH 1HCGA 3PROA 2JH6D 2PV9B 4FUCA 1FPHH 4YTAA 1ESAA 3A89A 2HNTF 3W95A 1CO7E 4LZ1H 2Y5FA 3TNSA 1FY5A 2GMTC 1AWHB 3AW1A 2O8UA 2ODPA 2AFQB 1ELAA 1P2KA 3RM0H 1L1GA 1LHCH 1LKBA 3B8JA 4I8GA 1W11U 3S9CA 1IQIA 2FPZA 2ZHEH 3V13A 9LPRA 1OYTH 1C5RA 4WJG2 2FTMA 4AFUA 4B76A 2A2QH 5FPYA 2B7DH 4JMYA 2SGQE 3SU1A 2QIQA 1BOQA 5A09A 1TE0A 1G36A 2PKSC 1IHTH 3PB1E 1HBTH 1NTPA 3MU1A 1T4VH 3D23A 5JBAS 1D3TB 2ZFTA 3MOCA 5C2ZA 5TCAA 1F7ZA 1EJMA 1MBMA 2GVFA 2BDIA 4A5TS 1H9LB 1YP9A 1SGIB 1Y8TA 5A8ZA 4JYUH 4OS7A 3VEQB 3VPKA 3L33A 2C4FH 1GL1A 1HJAC 2G51A 2A7CA 4I8KA 3PMBB 1XUIA 2UWOA 3N7OA 1ZHRA 2GMTB 2CMYA 5C5NA 3LC3A 3MNXA 5TJXA 1O3JA 1ZRBA 5DP8A 1O3PB 5JB9S 1SGYE 1GBFA 1O30A 1XMNB 1PPEE 1SGFG 5GJ4B 3DUXH 6LPRA 2ANKH 3G01A 3UUZA 1NRQH 1DICA 1O2GH 3JZ1B 3VB5A 3OY6U 3RXMA 1BIOA 3UREA 4NSVA 3NUMA 2PKSB 2G4TA 5A2MH 2PW8H 3RP2A 4I7YH 1GI5A 2F9OA 2ZFSA 2Y5HA 3RXBA 2Q6DA 1AO5A 2R9PA 1IQEA 3SZNA 3M3VA 1GBIA 2J4IA 2O9QA 1SMFE 3S69A 3SV7A 1KXFA 5DG6A 1O3KA 2V3HH 1ELDE 4BXSA 1W2KH 3SUDA 2Z9KA 1GHYH 4X6NA 5J4QA 3LDXH 1LVBA 2IPHA 2Q6GA 1GJAB 1LHDH 1FAKH 2P95A 4RKOB 4WMDA 1HJAB 1N6XA 3UY9A 2EI7A 5EW1H 2HPPH 2F83A 2BQWB 4BANB 1WQSA 1GHZA 4D9QA 4ABAA 1WTGH 3EE0B 3GCTF 3V12A 3A7WA 1MTUA 1AY6H 1SLUB 1TNJA 4Y76A 1L0ZA 1W12U 2UUJB 1K1PA 1AKSB 4NIWA 3LGVA 1JMOH 1C5YB 1AKSA 2BDBA 3M7TA 5F8XA 3HK6B 3OYPA 3BTGE 1HAOH 2BD2A 2OUAA 5A8YA 1BA8B 1HAXB 2BMGB 1HJ9A 1PJPA 1SVPA 3PV4A 1KTSB 1QJ6B 3M35A 4IC6A 3ZVGA 2F9NA 1NU9A 1L4ZA 2A7JA 1H8IH 5T6FA 3SNEA 9ESTA 1GBBA 1T8OA 1DLEA 3SO3A 8LPRA 2RA0A 1WCZA 1YPGH 2YOLA 3M3TA 3RUOA 2BXTH 1TBRH 1Q2WA 3QDZB 4GCHG 1GMCG 1Y3XA 1AVXA 1W3CA 3F9EA 2C90B 2KAIB 4UFDH 2BVSH 2KAIA 4AX9H 2AS9A 2A31A 3SU5A 1ETRH 1HYLA 4NFEA 2XBWA 1TMUH 3VXFH 1LHGH 3AASA 1P05A 8ESTE 3U9AH 1AMHA 1ZGIA 1ESBA 2ALVA 1GBDA 2FOFA 3A87A 2AERH 4OS1A 4J1YA 1ZJKA 5E0GA 3KQCA 1DX5M 5EG4A 1C2KA 5I25A 1O33A 4R8TB 3RXLA 1L2EA 2THFB 3U1IB 3MH4A 1QR3E 5BRRE 4O03A 3A7TA 1JOUB 2VINA 1ANCA 4KTSA 1BJUA 1O2TA 2VVCA 1SGEE 1GI7B 2P3UB 3BSQA 1GMDG 2EC9H 1SLXB 3TITA 2FIRH 1RS0A 3TH4H 2D2DA 3BTEE 4O97A 5EGMA 4H42U 5FX6A 1QJ7B 3PWCA 1C5NH 2O8WA 2ANYA 1AFQC 1Z8GA 2BDGA 5H4IB 1VJAU 1ZMLA 2UUFB 1GJ5H 3FVFB 3ZVDA 1TBZH 2NU0E 3U8OH 3ENSB 3OU0A 2UWLA 4X0WU 1BBRK 1ABIH 1QCPA 1AHTH 1HNEE 3MMGA 2H1UA 5F8TA 2AYWA 2ZFRH 4CBNA 1OP0A 3GY3A 2GCHG 3A85A 2XWAA 2SGFE 1CVWH 4KTUA 3SGQE 3AW0A 3P8FA 2Y7ZA 4X6PA 1RJXB 1TPAE 5IDKA 3ZZ4A 2Y82A 4H6SB 3TLOA 2BY9X 3UWJH 1PPFE 1D6WA 2ZCKP 1C1QA 1SFIA 3ODFA 1HV7A 2AMDA 3MU4A 1HPGA 2ANWA 4YOGA 4O3TA 1O3AA 2XTTB 4H6TA 1CQQA 3UTUH 1C1OA 2NU3E 3ZZ5A 1WUNH 1P03A 4BAOB 1BMMH 2ODQA 4BAQB 3GCNA 1SQOA 1Y5BT 4GUXA 1YC0A 5AFZH 3URDA 3M5LA 3T27A 1C5ZB 2OCVB 2V3OH 1O37A 1AFQB 1CHGA 3MH7A 2QXHA 1GG6C 2DE9A 3VGCC 1HIAB 1AVGH 3ZV8A 1BTPA 1BITA 1HIAA 1G9IE 2VH0A 4IN1A 2GV6A 1MZAA 4CH8B 1MTVA 2TBSA 1O32A 2Z3EA 1EXFA 1AN1E 2PTCE 2D1JA 2W26A 3P8OA 5DP6A 4YESB 1MH0A 2P59A 3TJVA 1GBHA 2FYRA 2ZC9H 1FONA 1KLTA 3SU3A 1RTFB 2EA3A 1CHOF 1PQ7A 2BD5A 2PR3A 3I29A 3UNRA 1S6HA 1BMAA 1UCYK 1A0HB 3AAUA 1PQ5A 4MPXA 2C3SA 1KXDA 1GI1A 2GZ9A 2PGBB 2ZDKA 3D49H 4ABBA 1RRKA 2A0QB 4HZHA 3T26A 4ZKRU 2ZU2A 1FV9A 3Q3YA 1JBUH 1O2HA 2XBXA 1W7XH 1BQYA 3S9AA 3VGCB 2FX4A 3DA9B 1C1WH 3FP7E 1IQMA 2HGTH 2SNVA 1VR1H 2F91A 1GCTC 3CP7A 4KP0A 1T32A 3BTQE 3GICB 1EASA 1O2RA 1V2RT 3SW2B 1J9CH 2NU2E 1MU6B 3CS0A 1SGTA 3R3GB 1P2OA 3UWIA 3SJOA 1G37A 1SGRE 4K1SA 3EQ0H 1B0FA 4X1RU 4UFEH 4X1QU 2H5CA 1K1NA 3UNQA 1WTHD 4JZDH 1V2LT 1Z8IB 4WH6A 1AB9C 3MNSA 1EJAA 4WH8A 1E34B 1W10U 5AFYH 1T4UH 2WPHS 1BTXA 1YBWA 3TPIZ 4VGCC 5DP3A 2XYAA 1SL3A 4UFGH 1TRMA 2SGEE 1V2JT 1EZUC 1GJ8B 1L4DA 3ATIA 3IG6B 3RXAA 4AGJA 1MAXA 2CF8H 1UVUH 3MU8A 2GX4A 1INCA 1P8VC 5DPAA 1O5FH 4CR9A 1GCTB 2ZKSA 1IQKA 2ZTYA 1CGHA 2ZZUH 1TPSA 2OQ5A 1C2HA 4YOIA 3ZZ7A 1ETTH 1ELCA 1GBKA 2BLOA 2BY6X 1C1PA 4UDWH 1ZJDA 5EXMA 3HATH 2W5EA 1SPJA 1CU1A 1HJ8A 3SI3H 1NFXA 3GY6A 1SGNE 3NKKA 4NGAH 1AB9B 2ZPQA 2HRVA 1HRTH 1VCQA 1VZQH 1ZYOA 1QB1A 1TX7A 2ZDLA 4Y0ZE 4ZXYH 1PYTC 1NESE 1ZZZA 4MNVA 4X6OA 1A5HA 3F68H 3BIVH 1CE5A 4VGCB 3L3TA 2O8TA 4B73A 3WY8A 2RG3A 1SGPE 3ZVEA 1ZRKA 5L6NH 3FANA 2BB4A 1UVTH 3HGNA 1FIZA 4YZUA 2W3IA 1BTHH 1SOZA 3U8TH 1C1MA 1VCWA 1JXPA 1BBRE 1A1RA 1C2MA 4HI3A 2F9UA 3T25A 4WY3A 3PLKA 3SU6A 1RD3B 1SLWB 5TCCA 1A0JA 2G8TA 2J95A 1ZTLA 2FI5E 4RN6A 1CA8B 1AE5A 1J14A 4XOJA 1QA0A 1C5UA 1EKBB 3ODDA 3FAOA 3GISB 3RXGA 4AG1A 1S82A 2BQ7B 2ZFPH 1P9SA 4BNRA 2JH5D 2G55A 3T28A 3RXOA 1OPHB 2C8YB 1O5EH 3PMJA 5GDSH 5EPYA 1TPPA 4Y7AA 1V2OT 2V6NA 4BOHA 3BTHE 1O2XA 2AGGX 1CBWC 2PGQB 1MU8B 3PTNA 5E0HA 3RXFA 1YPJH 1EP5A 5L30H 3ZYEA 4D76A 1W0YH 1GHBF 2FTLE 3GOVB 2ZGBH 1YYY1 1OYQA 8GCHF 2A32A 1A46H 4UEHH 1NRRH 1SQTA 2BHGA 5K0HA 1GJ9B 3LH3A 1YCPK 1G3CA 4DURA 2QAAA 1SBWA 1QBOA 5L2YH 2FOHA 1HB0B 2BD8A 1TRNA 2F9BH 3RC4A 4ASHA 3GY4A 1CA0C 3MO9A 2AMQA 2ZCLP 2FI4E 1RIWC 3SN8A 3E8LA 2XC4A 3K2UA 1AUJA 1AIXH 1EZQA 4R0IA 1A61H 1S85A 2XC0A 1C4V2 1NRPH 1TNIA 1GDUA 1EJNA 3RXPA 3ZZ3A 1O3CA 1G3EA 1HAHH 4Y11E 4X8UH 1D3DB 5EOKA 4JYTA 1F0UA 3SI4H 1AZ8A 1CBWB 2YNBA 2GDEH 3ZZ6A 2BYAX 3P17H 2A5AA 3RXQA 4K1TA 1QQUA 4Y0YE 3SHAH 1EATA 3RMNH 4B71A 2Z9JA 3T29A 3MH6A 1QRWA 1LQEA 3TH3H 3PO1C 1IQGA 1C2IA 1GHAG 1K1MA 1UJ1A 1CA0B 3AAVA 3H5CB 1RIWB 4ABIA 3EA7A 2Y81A 5AF9H 1SQAA 3E91A 1TRYA 1BRCE 1WU1A 3PM3A 1P12E 1TGCA 2XCFA 1MAYA 4WVPE 3V0XA 3A80A 1UTNA 1QFKH 1EAIA 1SG8B 3ATMA 4X2YA 1HFDA 1XKBC 4K8BA 1ELBA 4BAKB 5CMXH 1VITF 3MU5A 1O2UA 1YPKH 4CRFA 6CHAC 4X1SU 3OTJE 2BOKA 1SI5H 1HLTH 1KYNA 2IN2A 4MPVA 1O3LA 5DP7A 1OWEA 1L1NA 3GYMA 1ELTA 2QF0A 1HXFH 2BXUH 4X6MA 5E0JA 4Z0KA 5JBCS 1O3MA 2ZPRA 2EI8A 3IITA 3PO1B 2HWLB 2OXSA 3Q76A 5A8XA 2JETC 4YT6H 5EQRA 3UNSA 1A7SA 1C9PA 4MTBA 1DLKB 2Q6FA 3QO6A 3RC5A 1NM6A 2FM2A 2SGAA 1RTLA 1SGFA 3LKWA 3HGPA 4SGAE 2PWXA 5HMAA 2XC5A 3VB7A 2OC8A 5HM9A 2B8OH 5EU8A 1WQVH 3BTWE 2ASUB 5FXLA 2C8XB 1GDNA 2ZGCA 1GJ4H 1FY1A 1E38B 1SR5C 2OBQA 1GI4A 1GJBB 3SV2H 5GCHG 2ZQ1A 6CHAB 2AMPA 2ZHWH 1C9TA 2ESTE 2C93B 1BRBE 2PKAB 3BV9B 1ARCA 4ZKSU 3MO6A 1GMHF 3MHWU 1QHRB 2WV4A 1TLDA 4MPUA 2FOAA 4UONA 2VIDA 1O5DH 4AB8A 3I78A 3SNBA 3SU0A 4H4FA 1O5AB 2JETB 4BTTB 5LPEA 2UUYA 1UTOA 2ZIQH 3F9GA 4ESTE 1NRSH 1BT7A 1YPLH 3DHKH 2XWBI 3QUMP 1F2SE 1MCTA 2B9LA 4DJZB 1A3EH 1AVWA 1C1VH 3NZIA 2R2WU 2GT8A 4DVAU 2BM2A 3MFJA 1O2IA 1YLCA 4AFQA 1O5CB 3RXJA 3ZVCA 5C20A 5JBBS 4K8YA 3F9HA 5HXFA 5FPSA 1HAYB 4CREA 2HPQH 2FX6A 3KN2A 1TYNA 4ZUHA 4ZAEA 1U6QA 1G30B 4BAHB 1C5WB 1THRH 3M36A 1OX1A 3GYLB 3A7VA 1UTKA 1J16A 2CXVA 3M5OA 1P3EA 5JDUB 3ZVBA 1BTYA 1MTSA 1P01A 3MU0A 1MZDA 4QT8C 3U69H 1C1UH 5GXPA 4CRDA 1PPBH 3U98H 2QA9E 4LZ4B 5G4BA 1OWDA 1V2NT 1UTMA 2SFAA 4D7FA 1C2DA 3O8RA 3K6ZA 3RLWH 3A83A 2PUXB 5FBEA 1H9HE 1EB2A 2Z9IA 2Z94A 5ESTE 2FZZA 4AORA 5FCRA 2G5VA 2GZ8A 1GI0A 3A8AA 3RXSA 1ZOMA 2V35A 5DKMA 3RXRA 4DG4A 4YOJA 4XBCA 1HXEH 3GY2A 3K9XB 1C5QA 2Z9LA 4WWYA 3KHVA 1C5VA 1F5RA 4JZFH 1FNIA 1OKXA 2UWPA 1Y59T 1AD8H 4WMEA 1F5LA 4Y8YA 1UHBB 1UVOA 3SJKA 3LU9B 4Y8ZA 4I8JA 4ABHA 1Y5AT 3E3TA 4BAMB 2GT7A 1Q3XA 2BLVA 2H6MA 4XSKU 1LO6A 1DDJA 4B75A 1O2MA 2ZWLH 3KF2A 1NT1A 2PUQH 1SHHB 3BF6H 1DFPA 1N6YA 1O0DH 1PPCE 3RU4D 1DXWA 4WMFA 1CT2E 3NCLA 5CE1A 1ZMNA 4J2YB 1IQNA 4DIHH 1BUIA 4ZH8A 1FQ3A 1NY22 1O2LA 4ABFA 1TNLA 4Y79A 2NU4E 4F49A 2SNWA 3IWMA 1QB6A 3S7KB 2GP9B 5F03A 5E2PA 2VIOA 3F9FA 2XBYA 2VIWA 4I32A 2GZ7A 2ZTZA 5FCKA 1SGCA 7KMEH 2ZP0H 2AIPA 1TGSZ 1CT4E 2WINI 2WV5A 4KGAA 3C1KA 3ZZBA 1O38A 2PHBA 3PWBA 2GCTC 2Z9GA 3D62A 1XUJA 1THPB 5FAHA 1LHFH 4Q80A 3RXHA 1P06A 3MNCA 1GCDA 1HAVB 5PTPA 4TY7A 4OGXA 1HAVA 1TFXA 1LKAA 1O2SA 1E0FD 3DD2H 2J92A 2H9TH 4MNYA 1S5SA 1SGDE 2P94A 1FJSA 5FX5A 1C5PA 4NWLA 4A1XA 3L6PA 5JYIA 1QY6A 3UQOA 1QQ4A 1PQ8A 3VB6A 1MTNC 1UTJA 1GBTA 3T2NA 2FOEA 2ZDMA 1D9IA 1NZQH 1BDAA 3H7TA 1N8OC 2ZU5A 1BRUP 1ZHPA 1BTZA 1LTOA 1K9OE 1KTTB 1T7CA 1OWKA 4Q7XA 3BN9A 1XM1A 2GCTB 3RXKA 3A7XA 3OY5U 1X7AC 2QXGA 1LMWB 2BQ6B 2LPRA 2ZTXA 2P16A 2XNIA 4WXIA 3SOSA 1EZXC 2ZECA 3GDUA 4TY6A 1YKTA 4CRGA 2OC1A 6GCHG 1Z8RA 2J34A 2B5TB 2BDHA 1AE8H 4O9VA 2VU8E 2OD3B 4YT7H 3U8RH 2M5TA 1V2VT 3HPTB 1P2JA 1BB0B 4A1TA 1Z1IA 1TGBA 7GCHG 3GDVA 4HGCA 3E16B 2EEKA 1ZHMA 1GBJA 3LGTA
chains in the Genus database with same CATH superfamily
2A4RA 2GV7A 1VITH 3GCHC 3VB4A 1C1TA 1MTNB 4F4OC 5GPIB 4LK4A 5I46H 1Y3YA 4P02A 1IAUA 2H9EH 1N8OB 1K1LA 4ABDA 3TGIE 4RT1A 2R2MB 5A0AE 3N7EA 3QGJA 3RXCA 1ORFA 4CBOA 1V2ST 1J8AA 4AG2A 1YGCH 1S81A 1OP2A 2FI3E 4X1PU 2A4GA 4ZXXH 3QLPH 5T6GA 1W0JD 1BMNH 4INKA 1QL7A 4D9RA 2XRCA 2Y7XA 3SNDA 1K22H 3UAIC 4ZMAH 1W0KD 4UD9H 3RM2H 2RDLA 1T8NA 3RXTA 3O8CA 5F8ZA 5EW2H 5B6LA 4GCHF 1XUGA 3OX7U 2A4QA 1GMCF 1TNHA 5FBIA 1N1LA 3TU7H 1AFEH 2ZFFH 4IMZA 4ISOA 3URCA 3GCHB 1ZTJA 1D6RA 1FMGA 2IJOB 3QN7A 1ZSJA 1H8DH 1J17T 2H9HA 3FKSD 1V2MT 3ZZCA 1AQ7A 1LVMA 3EA9A 1ZPZA 5AHGH 1TGTA 1QBNA 2CN0H 1V2UT 2TGTA 2FODA 3A8DA 3A86A 2VVUA 3BTTE 1GJCB 3RU4T 4B2CA 4NWKA 1WV7H 4F55A 2HNTE 2ALPA 3KEEA 1XXDA 3CENA 5IYTA 1TABE 4JK5A 3PRDA 1C4U2 1C4Y2 2Q1JA 1XUKA 4Q63A 3N99A 3RXIA 3QK1A 4NIVA 5C1XA 2H2ZA 1SFQB 1SLVB 1ETSH 1RGQA 2FMJA 4XBDA 4HTCH 1NFUA 2VGCC 4B2AA 1GMDF 4DCDA 1UTQA 4NZQA 1HAGE 3UIRA 3A82A 4FUHA 1QB9A 3UPEA 1C5SA 2CGAA 1K28D 1VGCC 2WYGA 1WYKA 2ZU4A 1DS2E 3TH2H 4NIYA 3WWFA 3SUFA 3KIDU 3P95A 1KXAA 2QGRA 1VJ9U 2YNAA 2ILNA 1PPZA 5ESBA 5C1YA 4GPGA 1O2OA 3HK3B 2WUCA 4B2BA 1EX3A 1UK4A 1O2JA 4TPYA 3TIUA 1Y3UA 1TX6A 1YPMH 1B7XB 2VWMA 1ANEA 3FZZA 1NROH 5HIZA 4OS2A 1UCYH 1PFXC 1ARBA 3GY7A 3LGWA 4GVUA 2GCHF 5E2OA 4MLFB 2ZNKH 4E06H 3ZIAD 4K3JA 1XKAC 1DSTA 2VGCB 3M5NA 1GJDB 1GVZA 1Z1JA 2P8OC 1MQ5A 4JCNA 3RU4E 1TA2A 6ESTA 5JPMH 1EOJA 1MKXH 1VGCB 4FUFA 2WUBA 1H4WA 2RA3A 1AU8A 4RI0A 1DUEA 5A0CA 3FFGA 1Z6EA 1Z7KA 4E7RG 1GI3A 4ISNA 2ZHDA 1O3OA 1W13U 3SU4A 1EPTC 5DP4A 1FY3A 1FPCH 3SBKA 3SUGA 2FXRA 2J9NA 2ZG0H 2VIQA 1TOCB 2G00A 4IS5A 2TGDA 2PSYA 1NRNH 3CS7A 3E0PB 2GGVB 4AOQA 4NFFA 1DPOA 1SB1H 2FYQA 4IMQA 3PMHB 1LPKB 3LOXA 4PROA 3BTDE 4ISLA 1QGFA 2BZAA 2UUKB 3GCTG 1ELEE 1ZLRA 2P8OB 2ZQ2A 3EGKH 1D3QB 4NG9H 1K1IA 1GGDC 2VWLA 1HAIH 2R0KA 2FS8A 1OXGA 3A7ZA 1DUAA 2VWOA 1TB6H 1FY8E 1LPGB 4DIIH 3DT0H 1AZZA 1MABB 1TAWA 1UO6A 1EUFA 1KIGH 2G81E 4UE7H 3Q3KA 1GHWH 7LPRA 1ZGVA 3BEUA 2I6QA 1EPTB 1GBCA 4YLQH 3S0NA 1GWAA 1EPTA 1FN6A 3VG8A 2DE8A 2LELA 2ZDNA 1XUFA 4U2WA 1T8LA 3BEFB 5JB8S 4DT4A 1OSSA 1V2QT 1SC8U 2XBVA 3RXEA 4LXBH 2CHAB 2QF3A 3KQ5A 1E1RD 3RC6A 1YPHC 1QTFA 1C5OH 3QX5H 1XX9A 2KX4A 2HVXA 1YCPM 3P70B 4FU7A 1TALA 1TPOA 5DP5A 1G3DA 1W0ZU 1W8BH 1KSNA 4K60A 1GPZA 1G3BA 2TPIZ 3OEED 4I8HA 1FAXA 4DGJA 5E8EH 1C2EA 2BY7X 2OBOA 1ZSLA 1GGDB 1ESTA 3NPSA 2STAE 1A5IA 1OOKB 2C8WB 2Z3DA 3M7UA 2XXLA 4Q7YA 5JBTA 1RFNA 1QA7A 1MKWH 2V0BA 3PMAB 3V7TA 1K1JA 1T8MA 1THSH 2AHME 4FVBA 1DITH 1NO9H 2W7UA 3VFEA 4YO9A 1ZTKA 2I6SA 1K2I1 4FXGH 5DJ7A 2P3TB 1KXEA 3LGYA 2A7HA 3MI4A 1TBQH 1P04A 4K2YA 1QIXB 3T5FH 1O3EA 4OGYA 3U1JB 4CH2B 2IJD1 1ELFA 1P3CA 2QXJA 3LC5A 5IK2D 3TK6A 4HFPB 1NC6A 1W14U 1Y3WA 1F92A 4GLYA 3A88A 1O2ZA 3GDSA 3PLPA 1TA6A 1WSSH 5DK1A 1DY9A 3ATWA 3K6YA 4X2VA 2BZ6H 1O2VA 1Z71A 1C5MD 1YCPH 1NBMD 4I33A 1UVPA 3UOUA 4FUBA 4M7GA 3NK8A 4X1NU 1IOEA 1DSUA 1YPHE 4YLUA 1NS3A 1FLEE 3TJOA 1DWDH 1GBEA 1PQAA 1YLDA 4TT3D 1TX8A 1QRZA 5L2ZH 1A4WH 4CR5A 1GI2A 2OP9A 3MH5A 1T31A 3P8NA 1HDTH 3TGJE 1ID5H 3MWIU 4MVNA 1GDQA 2AH4X 2A45B 2BOHB 1EFRD 2PKAA 1ANDA 5C5OA 4U30A 1IQHA 3LJOA 1QRXA 1EB1H 5C0UA 3F6UH 2VB0A 1UTLM 4ABGA 1A3BH 1QURH 2HOBA 1P10A 2BDCA 2Y6TA 3DSGA 3LT3A 4GSOA 2A2XH 3SGAE 3TJUA 5B6OA 3ZZ8A 1ABJH 4A7IB 2P93A 1OWIA 2BD3A 3M5MA 3LJJA 2BD9A 4Y10E 4BTUB 2ZU1A 2QC2A 1A5GH 3STJA 3M7QA 3LGUA 4I31A 3B23B 4AFSA 1XVMA 2KCAA 2C8ZB 1K21H 1OS8A 1V2TT 3DSOA 1UMAH 2JH0D 2ZGXH 1NU7B 3E1XB 3PTBA 1O2KA 2P3FH 4AGKA 2WYJA 5C3NA 3LIWA 3KL6A 1P57B 3KQEA 1FIWA 3V3MA 4CHAC 1K1OA 3M37A 3TK5A 1BJVA 4TWYA 4SGBE 1LCYA 5A0BA 1IQFA 1GL0E 1TQ7B 4LOYH 1EQ9A 4ZHMU 3SJIA 4BTIB 3Q3XA 3QGNB 3M3SA 1E35B 1Q31A 4MNWA 1P09A 3LGIA 4B6EA 3N7DA 4DW2U 2ZGJA 1CHOG 3H7OA 2WPKS 2RFKC 3UQVA 1O3BA 5AVDA 2HLCA 1GVKB 2D8WA 2XCNA 2YMSC 1S83A 1F0TA 2BY5X 3O8DA 4TYDA 4CRBA 4TWWA 1HGTH 1O34A 1J15A 4IC5A 4JZIA 1CSOE 3OSYA 4FU8A 1GI6A 3D65E 1MUEB 3ATKA 4U01A 4MG3A 1F0RA 1C2JA 2J2UA 2VIVA 1C5XB 1AGJA 4ZKOU 4X8VH 1BTWA 1QL9A 5BPEA 2GDDA 3C27B 2FP7B 1TGNA 1TQ0B 4CHAB 2ZHFH 1CGIE 1PPGE 5EXLA 3SU2A 1UHBA 2BDAA 2FS9A 2CK3D 3TK9A 2GKVE 1OP8A 5LH8A 4JZ1A 2KCYA 2FO9A 1DY8A 1GHAF 2PP6A 1HAZB 1WBGB 1QJ1B 4O3UA 2FLRH 1BCUH 3BG8A 3TGKE 4XFQA 1SHYA 2YMSB 3R0FA 4OS5A 3MO3A 4NZLA 1BHXB 1ELGA 3HKIB 4RKJB 1W7GH 3TNTA 1O2QA 4INLA 4KTCA 3NWUA 2FOBA 3SV6A 2B0FA 5EJ1A 1KXCA 2VJ1A 4XBBA 2VH6A 4ISHH 2BVXH 3GCOA 3ZZDA 1O3GA 3ZVAA 1GI9B 1SKYE 1ZSKA 2SGDE 5HIYA 4BXWA 1EZSC 1D3PB 3RMMH 1YF4A 1B5GH 2W3KA 1C2FA 4NIXA 3A81A 7ESTE 2OQUA 2CJIA 3SNCA 3FZDA 1P2QA 1P2IA 4ZKNU 1EAXA 4OS6A 1XVOA 1F5KU 1PPHE 2OINA 3Q77A 2TGAA 5EIYA 5LPFA 2LNCA 2AGIX 2R0LA 2F9PA 2A1DB 4NCYA 3SNAA 2ANMH 3UR9A 2PTNA 4FUJA 4IW4E 2WPIS 1PYTD 4ZCNA 1AUTC 5DP9A 3STIA 1FZZA 3KQDA 2VIPA 5T3HA 2Y80A 4GHQA 3T62A 3PYHA 1DXPA 5T1VA 2WPMS 2BLQA 1KDQB 1YPEH 5HM2A 4AYYB 2O8MA 4AFZA 3SJ8A 1AI8H 1RTKA 1KDQA 4ASUD 1S0QA 1NFWA 4X2XA 1Z6JH 2ZFQH 5GCHF 5GWZA 2ZA5A 2ZO3H 2CF9H 4I8LA 1UK3A 1V2KT 4Y71A 1LQDB 2R3UA 4AB9A 2AGEX 4Y6DA 3BG4C 3ATLA 1C5TA 1GBMA 1O3IA 1S6FA 3EDXB 1TNKA 3EA8A 3PRBA 4NSYA 3P8GA 3MNBA 4WF8A 1KXBA 2BX3A 3EAJA 1FXYA 1O35A 2XW9A 3MTYA 4IBLH 4ISIH 4DOQA 2ZI2H 1H1BA 2J38A 2WZQA 4CRCA 2QCYA 1O2WA 3SUEA 2Z3CA 1DWBH 1FY4A 1MD8A 1FDPA 1UTPA 2FWWA 2VNTA 1GI8B 1ZMJA 2BDYA 3F2HA 1GHBG 2BY8X 3E90B 1C2GA 1QBVH 8GCHG 1DVAH 1CT0E 1SGQE 2WPDD 2WSSD 1KY9A 1TNGA 1FUJA 1O2YA 1DE7H 3ELAH 1XUHA 2HNTC 1IQLA 4CRAA 3KQBA 2PFEA 4X2WA 2EI6A 3S9BA 2K8IA 1B0EA 1BZXE 1NBME 1L1JA 5EPNA 1JRSA 1Y5UT 4D8NA 1V2WT 2BTCE 3BG4B 4K5ZA 4A92A 2JKHA 2FOCA 3DFJA 4MDSA 1M9UA 3SGBE 2Z7FE 2ZDAH 3RDZA 2AIQA 2DUCA 2OC7A 1DM4B 4MQAA 1LHEH 3PV5A 1IQJA 3TVJB 2OTVA 4GHTA 1O2NA 3E0NB 3DFLA 1O31A 3ESTA 3ZZ9A 1UW7A 1O5BB 3ZZAA 1O2PA 1GG6B 4NA8A 3ZV9A 4E7NA 2ZEBA 3SQHE 2R3YA 3SHCH 2V7QD 2IOTA 1MKXK 2PSXA 4FUDA 2NU1E 1YM0A 2AEIH 1DANH 5EXNA 3VXEH 1HAPH 4XE4A 4ZROA 2NWNA 1BBRH 1IHSH 2ZF0H 4AYVB 1H8ED 2FOGA 4FUGA 1E36B 1LPZB 1JWTA 1G32B 2FEQH 1A2CH 3QWCH 4ABJA 2D26C 3P92A 1UVSH 4AN7A 2G4UA 3E6PH 2F3CE 4OS4A 5DGJA 3I77A 1LVYA 3FOAA 3P6ZB 5CHAC 3GY8A 1S84A 5EQQA 1JIRA 5J4SA 5FPTA 3A8CA 1G2MA 2ULLA 3SV9A 3SYJA 3BIUH 5SGAE 3U28C 1MQ6A 2TGPZ 2ZCHP 4ABEA 3BTFE 2ZU3A 1WAYB 3PV2A 4Y7BA 4MNXA 1KMHB 1GBLA 1H9IE 1JRTA 8KME2 3LPRA 3QZQA 4JZEH 4XDEA 1GVLA 2SGPE 3CNRA 1C1RA 2QY0B 5EQSA 1GHVH 1VITG 3LH1A 2A4OA 1GJ6A 4Q7ZA 1O3HA 1BHXF 3O8BA 3UFAA 1Y3VA 4UFFH 5EODA 4NA7A 4FUIA 1ANBA 3Q00A 1V2PT 2G52A 1AWFH 1EAWA 4JYVH 5F6MA 4RSPA 5C1UA 4THNH 1KLIH 1NN6A 4FUEA 1G2LA 3B9FH 1DT2A 4DY7B 5DO4H 3VB3A 3F2GA 3ITIA 4FVDA 3W94A 1C5LH 4Z6AH 2A5KA 2L74A 5CHAB 3QTVH 5HGGA 2O8LA 1OWJA 1P9UA 1WOFA 4A6LA 1O39A 2QXIA 2FLBH 1V3XA 1P2MA 1O3DA 5ABWA 1HUTH 3BTKE 1P11E 1NPMA 1YLNA 4X8TH 4KELA 4DT7B 4NA9H 1TMTH 3RXVA 2J5UA 4B1TA 2OLGA 1VCPA 3S7HB 5HYOA 4YM9A 3AVZA 1O5GH 1TMBH 2EQNA 1A0LA 1O3NA 3A8BA 4E05H 1EOLA 2BD4A 4MPWA 4TPIZ 5ETXA 3KYFA 1BRAA 2BD7A 1QNJA 1RXPA 4KKDA 1GMHG 1EAUA 1TOMH 1TIOA 2ZGHA 3F0OA 4B74A 4FU9A 2WPJS 1MKWK 3RXDA 2VVVA 2K1QA 5T6DA 1F0SA 5LPRA 1MBQA 3F1SB 2WPLS 3A7YA 4WXVA 2CV3A 2J94A 2W7SA 3EYDA 3OEHD 1V6DA 1ZR0A 1ACBE 4IN2A 6GCHF 2XNDD 3RMOH 3GY5A 1TONA 4IGDA 2OK5A 3ZYDA 3KCGH 2CHAC 1C1NA 3BEIB 1MCVA 3WW7A 1MD7A 1GBAA 2QV1A 4K1EA 5LGOA 2GTBA 3KGPA 4A1VA 2VWNA 1EP6A 1O36A 2FOMB 3FP8E 4INHA 2A5IA 7GCHF 1CGJE 5FHTA 3KNXA 2IPQX 5K7RA 1O3FA 4GAWA 3HKJB 2TRMA 2FESH 3LONA 1LDTT 4Q2KA 1P0SH 3SJ9A 2H5DA 3MYWA 1Z8JB 1GJ7B 2FDAA 2ZDVH 1KLJH 1SOTA 1D4PB 1XXFA 1GHXH 1TWXB 4X8SH 4Y8XA 1MTWA 1SSXA 3UOPA 4ZHLU 1LVOA 1MMJN 3QZRA 1DWCH 4K69A 1P2NA 1UK2A 3SQEE 1ZPCA 3K65B 5KGOA 4U32A 3RMLH 2HALA 1P02A 1UCYE 2G5NA 3TJNA 1OWHA 1JIMA 2STBE 1NFYA 3SV8A 2ZHQH 3RXUA 2GD4B 3RLYH 4ZHAA 1C2LA 5C67A 3M61U 1FN8A 1FI8A 3UR6A 3QTOH 4AC9A 1ZPBA 2BLWA 4JK6A 1C1SA 2JJ2D 4AZ2B 2QN5T 5GIBA 1DWEH 2PLXA 1DOJA 2F9VA 3FP6E 1BTUA 2ODYB 2QYIA 2ZPSA 2RCEA 2OC0A 1S6LA 3BTME 4XRNA 3PLBA 4D7GA 2Z6BD 2BX4A 1QL8A 3A84A 1ELVA 2KR7A 3ZVFA 3SORA 2TIOA 2Y5GA 1E37B 1S0RA 3FN8A 3JZ2B 3NXPA 1BMLA 2BVRH 1HCGA 3PROA 2JH6D 2PV9B 4FUCA 1FPHH 4YTAA 1ESAA 3A89A 2HNTF 3W95A 3WWBA 1CO7E 4LZ1H 2Y5FA 3TNSA 1FY5A 2GMTC 1AWHB 3AW1A 2O8UA 2ODPA 2AFQB 1ELAA 1P2KA 3RM0H 1L1GA 1LHCH 1LKBA 3B8JA 4I8GA 4Q4LA 1W11U 3S9CA 1IQIA 2FPZA 2ZHEH 3V13A 9LPRA 1OYTH 1C5RA 4WJG2 2FTMA 3EE7A 4AFUA 4B76A 2A2QH 5FPYA 2B7DH 4JMYA 2SGQE 3SU1A 2QIQA 1BOQA 5A09A 1TE0A 1G36A 2PKSC 1IHTH 3PB1E 1HBTH 1NTPA 3MU1A 1T4VH 3D23A 5JBAS 1D3TB 2ZFTA 3MOCA 5C2ZA 5TCAA 1WDIA 1F7ZA 1EJMA 1MBMA 2GVFA 2BDIA 4A5TS 1H9LB 1YP9A 1SGIB 1Y8TA 5A8ZA 3DSPA 4JYUH 4OS7A 3VEQB 3VPKA 3OTPA 3L33A 2C4FH 1GL1A 1HJAC 2G51A 2A7CA 4I8KA 3PMBB 1XUIA 2UWOA 3N7OA 1ZHRA 2GMTB 2CMYA 5C5NA 3LC3A 3MNXA 5TJXA 1O3JA 1ZRBA 5DP8A 1O3PB 5JB9S 1SGYE 1GBFA 1O30A 1XMNB 1PPEE 1SGFG 5GJ4B 3DUXH 6LPRA 2ANKH 3G01A 3UUZA 1NRQH 1DICA 1O2GH 3JZ1B 3VB5A 3OY6U 3RXMA 1BIOA 3UREA 4NSVA 5C17A 3NUMA 2PKSB 2G4TA 5A2MH 2PW8H 3RP2A 4I7YH 1GI5A 2F9OA 2VBCA 2ZFSA 2Y5HA 2GJGA 3RXBA 2Q6DA 1AO5A 2R9PA 1IQEA 3SZNA 3M3VA 1GBIA 2J4IA 5C94A 2O9QA 2RDEA 3OAAD 1SMFE 3S69A 3SV7A 1KXFA 5DG6A 1O3KA 2V3HH 1ELDE 4BXSA 1W2KH 3SUDA 2Z9KA 1GHYH 2V3MA 4X6NA 3LDXH 1LVBA 5J4QA 2IPHA 2Q6GA 1GJAB 1LHDH 1FAKH 5HKKD 2P95A 4RKOB 4WMDA 1HJAB 1N6XA 3UY9A 2EI7A 5EW1H 2HPPH 2F83A 2BQWB 4BANB 1WQSA 1GHZA 4D9QA 4ABAA 1WTGH 3EE0B 3GCTF 3V12A 3A7WA 1MTUA 1AY6H 1SLUB 1TNJA 4Y76A 1L0ZA 2KM0A 1W12U 2UUJB 1K1PA 1AKSB 4NIWA 3LGVA 1JMOH 1C5YB 1AKSA 2BDBA 3M7TA 5F8XA 3HK6B 3OYPA 1YY3A 3BTGE 1HAOH 2BD2A 2OUAA 5A8YA 3AK5A 1BA8B 1HAXB 2BMGB 1HJ9A 1PJPA 1SVPA 3PV4A 1KTSB 1QJ6B 3M35A 4IC6A 3ZVGA 2F9NA 1NU9A 1L4ZA 2A7JA 1H8IH 5T6FA 3SNEA 2K0QA 9ESTA 1GBBA 1T8OA 1DLEA 3SO3A 8LPRA 2RA0A 1WCZA 1YPGH 2YOLA 3M3TA 3RUOA 2BXTH 1TBRH 1Q2WA 3QDZB 4GCHG 1GMCG 1Y3XA 1AVXA 1W3CA 3F9EA 2C90B 1COWD 2KAIB 4UFDH 2BVSH 2KAIA 4RT0A 4AX9H 2AS9A 2A31A 3SU5A 2WHXA 1ETRH 1HYLA 4NFEA 2XBWA 1TMUH 3VXFH 1LHGH 3AASA 1P05A 8ESTE 3U9AH 1AMHA 5C0TA 1ZGIA 1ESBA 2ALVA 1GBDA 2FOFA 3A87A 2AERH 4OS1A 4J1YA 1ZJKA 5E0GA 3KQCA 1DX5M 5EG4A 1C2KA 5I25A 1O33A 4R8TB 3RXLA 1L2EA 2THFB 3U1IB 3MH4A 1QR3E 5BRRE 4O03A 3A7TA 1JOUB 2VINA 1ANCA 4KTSA 1BJUA 1O2TA 2VVCA 1SGEE 1GI7B 2P3UB 3BSQA 1GMDG 2EC9H 5EJZA 1SLXB 3TITA 2FIRH 1RS0A 4OM9A 3TH4H 2D2DA 3BTEE 4O97A 5EGMA 4H42U 5FX6A 3FO8D 1QJ7B 3PWCA 1C5NH 2O8WA 2ANYA 5CHBA 1AFQC 1Z8GA 2BDGA 5H4IB 1VJAU 1ZMLA 2UUFB 1GJ5H 3FVFB 3ZVDA 1TBZH 2NU0E 3U8OH 3ENSB 3OU0A 2UWLA 4X0WU 1BBRK 1ABIH 1QCPA 1AHTH 1HNEE 3MMGA 2H1UA 5F8TA 2AYWA 2ZFRH 3F0PA 4CBNA 1OP0A 3GY3A 3F3BA 2GCHG 3A85A 2XWAA 2SGFE 1CVWH 4KTUA 3SGQE 3AW0A 3P8FA 2Y7ZA 4X6PA 1RJXB 1TPAE 5IDKA 3ZZ4A 2Y82A 4H6SB 3TLOA 2BY9X 3UWJH 1PPFE 1D6WA 2ZCKP 1C1QA 1SFIA 3ODFA 1HV7A 2AMDA 3MU4A 1HPGA 2ANWA 4YOGA 4O3TA 1O3AA 2XTTB 4H6TA 1CQQA 3UTUH 1C1OA 2NU3E 3ZZ5A 1WUNH 1P03A 4BAOB 1BMMH 2ODQA 4BAQB 3GCNA 1SQOA 1Y5BT 4GUXA 1YC0A 5AFZH 3URDA 3M5LA 2F43B 3T27A 1C5ZB 2OCVB 2V3OH 1O37A 1AFQB 1CHGA 3MH7A 2QXHA 1GG6C 2DE9A 3VGCC 1HIAB 1AVGH 2EY4C 3ZV8A 1BTPA 4YXWD 1BITA 1HIAA 1G9IE 2VH0A 4IN1A 2GV6A 1MZAA 4CH8B 1MTVA 2TBSA 1O32A 2Z3EA 1EXFA 1AN1E 2PTCE 2D1JA 2W26A 3P8OA 5DP6A 4YESB 1MH0A 2P59A 3TJVA 4Z1MD 1GBHA 2QF5A 2FYRA 2ZC9H 1FONA 1KLTA 3SU3A 1RTFB 2EA3A 1CHOF 5DN6D 1PQ7A 2BD5A 2PR3A 3I29A 3UNRA 1S6HA 1BMAA 3H09A 1UCYK 1A0HB 2QE7D 1PQ5A 3AAUA 4MPXA 2C3SA 1KXDA 1GI1A 2GZ9A 2PGBB 2ZDKA 3D49H 4ABBA 1RRKA 2A0QB 4HZHA 3T26A 4ZKRU 2ZU2A 1FV9A 3Q3YA 1JBUH 1O2HA 2XBXA 1W7XH 1BQYA 3S9AA 3VGCB 2FX4A 3DA9B 1C1WH 3FP7E 1IQMA 2HGTH 2SNVA 1VR1H 2F91A 3OE7D 1GCTC 3CP7A 4KP0A 1T32A 3BTQE 3GICB 1EASA 1O2RA 1V2RT 3SW2B 5F53A 1J9CH 4ACAA 2NU2E 1MU6B 3CS0A 1SGTA 3R3GB 1P2OA 3UWIA 3SJOA 1G37A 1SGRE 4K1SA 3EQ0H 1B0FA 4X1RU 4UFEH 4X1QU 2H5CA 1K1NA 3UNQA 1WTHD 4HG6A 1V2LT 1Z8IB 4JZDH 4WH6A 1AB9C 3MNSA 1EJAA 4WH8A 2LP6A 2J98B 1E34B 1W10U 5AFYH 1T4UH 2J98A 2WPHS 1BTXA 1YBWA 3TPIZ 4VGCC 5DP3A 2XYAA 1SL3A 4UFGH 1TRMA 2SGEE 1V2JT 1EZUC 1GJ8B 1L4DA 3ATIA 3IG6B 3RXAA 4AGJA 1MAXA 1H8HD 2CF8H 1UVUH 3MU8A 2GX4A 1E79D 1INCA 1P8VC 5DPAA 1O5FH 4CR9A 1GCTB 2ZKSA 1IQKA 2ZTYA 1CGHA 2ZZUH 1TPSA 2OQ5A 2XOKD 1C2HA 4YOIA 3ZZ7A 1ETTH 1ELCA 1GBKA 2BLOA 1E1QD 2BY6X 1C1PA 4UDWH 1ZJDA 5EXMA 3HATH 2W5EA 1SPJA 1CU1A 1HJ8A 3SI3H 1NFXA 3GY6A 1SGNE 3NKKA 4NGAH 1AB9B 2ZPQA 2HRVA 1HRTH 1VCQA 1VZQH 1ZYOA 1QB1A 1TX7A 2ZDLA 4Y0ZE 4ZXYH 1PYTC 1NESE 1ZZZA 4MNVA 3SZEA 4X6OA 1A5HA 3F68H 3BIVH 1CE5A 4VGCB 2KZ4A 3L3TA 2O8TA 4B73A 5FL7D 3WY8A 2RG3A 1SGPE 3ZVEA 1ZRKA 5L6NH 3FANA 2BB4A 1UVTH 3HGNA 1FIZA 4YZUA 1SQRA 2W3IA 1BTHH 1SOZA 3U8TH 1C1MA 1VCWA 1JXPA 1BBRE 1A1RA 1C2MA 3KYGA 4HI3A 2F9UA 2L6OA 3T25A 4WY3A 3PLKA 3SU6A 1RD3B 1SLWB 5TCCA 4F48B 5CDFE 1A0JA 2G8TA 2J95A 1ZTLA 2FI5E 4RN6A 1CA8B 1AE5A 2HLDD 1J14A 4XOJA 1QA0A 1C5UA 1EKBB 3ODDA 3FAOA 3GISB 3RXGA 4AG1A 1S82A 2J97A 2BQ7B 2ZFPH 1P9SA 4BNRA 2JH5D 2G55A 3T28A 3RXOA 1OPHB 2C8YB 1O5EH 3PMJA 5GDSH 3GS9A 5EPYA 1TPPA 4Y7AA 1V2OT 2V6NA 4BOHA 3BTHE 5DSFA 1O2XA 2AGGX 1CBWC 2PGQB 1MU8B 3PTNA 5E0HA 3RXFA 1YPJH 1EP5A 5L30H 3ZYEA 1BMFD 4D76A 1W0YH 1GHBF 2FTLE 3GOVB 2ZGBH 1YYY1 1OYQA 8GCHF 2A32A 3DCLA 1A46H 3F2FA 4UEHH 1NRRH 5KECA 1SQTA 2BHGA 5K0HA 1GJ9B 3LH3A 1YCPK 1G3CA 4DURA 2JJ1D 2QAAA 1SBWA 1QBOA 5L2YH 2FOHA 1HB0B 2BD8A 1TRNA 2F9BH 3RC4A 4ASHA 3GY4A 1CA0C 3MO9A 2AMQA 2ZCLP 2FI4E 1RIWC 3SN8A 3E8LA 2XC4A 3K2UA 1AUJA 4I86A 1AIXH 1EZQA 2YMSD 1A61H 1S85A 2XC0A 4R0IA 1C4V2 1NRPH 1TNIA 3W1EA 1GDUA 4M9FA 1EJNA 3RXPA 3ZZ3A 1O3CA 1G3EA 1HAHH 4Y11E 4X8UH 1D3DB 5EOKA 4JYTA 1F0UA 3SI4H 1AZ8A 1CBWB 2YNBA 2GDEH 3ZZ6A 2BYAX 3P17H 2A5AA 3RXQA 4K1TA 1QQUA 4Y0YE 3SHAH 1YWUA 1EATA 3RMNH 4B71A 2Z9JA 1FX0B 3T29A 3MH6A 1QRWA 1LQEA 3TH3H 2JIZD 3PO1C 1IQGA 1C2IA 1GHAG 1K1MA 1UJ1A 1CA0B 3AAVA 3H5CB 1RIWB 4ABIA 3EA7A 2Y81A 5AF9H 1SQAA 3E91A 1TRYA 2W6ID 1BRCE 1WU1A 3PM3A 1P12E 1TGCA 2XCFA 1MAYA 4WVPE 3V0XA 3A80A 1UTNA 1QFKH 1EAIA 1SG8B 3ATMA 4X2YA 1HFDA 1XKBC 4K8BA 1ELBA 4BAKB 5CMXH 1VITF 3MU5A 1O2UA 1YPKH 4CRFA 6CHAC 4X1SU 3NRLA 3OTJE 2BOKA 1SI5H 1HLTH 1KYNA 2IN2A 4MPVA 1O3LA 5DP7A 1OWEA 1L1NA 3GYMA 1ELTA 2QF0A 1HXFH 2BXUH 4X6MA 5E0JA 4Z0KA 5JBCS 1O3MA 2ZPRA 2EI8A 3IITA 3PO1B 1VKYA 2HWLB 2OXSA 3Q76A 5A8XA 2JETC 4YT6H 5EQRA 3UNSA 1A7SA 1C9PA 5GNDA 4MTBA 1DLKB 2Q6FA 3QO6A 3RC5A 1NM6A 2FM2A 2SGAA 1RTLA 1SGFA 3LKWA 3HGPA 4SGAE 4FOUC 1K0HA 2PWXA 5HMAA 2XC5A 4P00A 3VB7A 2OC8A 5HM9A 2B8OH 5EU8A 4B6FA 1WQVH 3BTWE 2ASUB 5FXLA 2C8XB 1GDNA 2ZGCA 1GJ4H 1FY1A 1E38B 1SR5C 2OBQA 1GI4A 1GJBB 1WXRA 3SV2H 5GCHG 2ZQ1A 6CHAB 2AMPA 2JDID 1C9TA 2ZHWH 2ESTE 2C93B 1BRBE 2PKAB 3BV9B 1ARCA 4ZKSU 3MO6A 1GMHF 3MHWU 1QHRB 2WV4A 1TLDA 4MPUA 2FOAA 4UONA 2VIDA 1O5DH 2M2AA 4AB8A 3I78A 3SNBA 3SU0A 4H4FA 1O5AB 5KEDA 2JETB 4BTTB 5LPEA 2UUYA 1UTOA 2ZIQH 3F9GA 4ESTE 1NRSH 1BT7A 1YPLH 3DHKH 2XWBI 3QUMP 1F2SE 1MCTA 2W6JD 2B9LA 4DJZB 1A3EH 1AVWA 1C1VH 3NZIA 2R2WU 3OFND 2GT8A 2HVYB 4DVAU 4FETA 2BM2A 3MFJA 1O2IA 1YLCA 4AFQA 1O5CB 3RXJA 3ZVCA 5C20A 5JBBS 4K8YA 3F9HA 4ACBA 5HXFA 5FPSA 1HAYB 4CREA 2HPQH 2FX6A 3KN2A 1TYNA 4ZUHA 4ZAEA 1U6QA 1G30B 4BAHB 1C5WB 1THRH 3M36A 1OX1A 3GYLB 3A7VA 1UTKA 1J16A 2CXVA 3M5OA 1P3EA 5JDUB 3ZVBA 1BTYA 1MTSA 1P01A 3MU0A 1MZDA 4QT8C 3U69H 1C1UH 5GXPA 4CRDA 1PPBH 3U98H 2QA9E 4LZ4B 5G4BA 1OWDA 1V2NT 1UTMA 2SFAA 4D7FA 1C2DA 3O8RA 2KFWA 3K6ZA 3RLWH 3A83A 2PUXB 5FBEA 1H9HE 1EB2A 2Z9IA 2Z94A 5ESTE 2FZZA 4AORA 5FCRA 2G5VA 2GZ8A 1QZ8A 1GI0A 3A8AA 3RXSA 1ZOMA 2V35A 5DKMA 3RXRA 4DG4A 4YOJA 4XBCA 1HXEH 3GY2A 3K9XB 1C5QA 2Z9LA 4WWYA 3KHVA 1C5VA 1F5RA 4JZFH 1FNIA 1OKXA 2UWPA 1Y59T 1AD8H 4WMEA 1F5LA 4Y8YA 1UHBB 1UVOA 3SJKA 3LU9B 4Y8ZA 4I8JA 4ABHA 1Y5AT 3E3TA 4BAMB 5EJLA 1OHHD 2GT7A 1Q3XA 2BLVA 2H6MA 4XSKU 1LO6A 1DDJA 4B75A 1O2MA 2ZWLH 3KF2A 1NT1A 2PUQH 1SHHB 3BF6H 1DFPA 1N6YA 1O0DH 1PPCE 3RU4D 1DXWA 4WMFA 1CT2E 3NCLA 5CE1A 1ZMNA 4J2YB 1IQNA 4DIHH 1BUIA 4ZH8A 1FQ3A 1NY22 1O2LA 4ABFA 1TNLA 4Y79A 2NU4E 4F49A 2SNWA 3IWMA 1QB6A 3S7KB 2GP9B 5F03A 5E2PA 2VIOA 3F9FA 2XBYA 2VIWA 4I32A 2GZ7A 2ZTZA 5FCKA 1SGCA 7KMEH 2ZP0H 2AIPA 1TGSZ 1CT4E 2WINI 2WV5A 4KGAA 3C1KA 3ZZBA 1O38A 2PHBA 3PWBA 2GCTC 2Z9GA 3D62A 1XUJA 1THPB 5FAHA 1LHFH 4Q80A 3RXHA 1P06A 3MNCA 3UB0A 1GCDA 1HAVB 5PTPA 4TY7A 4OGXA 1HAVA 1TFXA 1LKAA 1O2SA 1E0FD 3DD2H 2J92A 2H9TH 4MNYA 1S5SA 1SGDE 2P94A 1FJSA 5FX5A 3MQKC 1C5PA 4TSFD 4NWLA 4A1XA 3L6PA 5JYIA 1QY6A 3UQOA 1QQ4A 1PQ8A 3VB6A 1MTNC 1UTJA 1GBTA 3T2NA 2FOEA 2ZDMA 1D9IA 1NZQH 1BDAA 2KCOA 1N8OC 2WV9A 2ZU5A 3H7TA 1BRUP 1ZHPA 1BTZA 1LTOA 1K9OE 1KTTB 1T7CA 1OWKA 4Q7XA 3BN9A 1XM1A 2GCTB 3RXKA 2QF4A 3A7XA 3OY5U 1X7AC 2QXGA 1LMWB 2BQ6B 2LPRA 2ZTXA 2P16A 2XNIA 4WXIA 3SOSA 1EZXC 2ZECA 3GDUA 4TY6A 1YKTA 2KCPA 4CRGA 2OC1A 6GCHG 1Z8RA 2J34A 2B5TB 2BDHA 1AE8H 4O9VA 2VU8E 2OD3B 2F4LA 4YT7H 3U8RH 2M5TA 1V2VT 3HPTB 4XD7D 1P2JA 1BB0B 4A1TA 1Z1IA 1TGBA 7GCHG 3GDVA 4HGCA 3E16B 2EEKA 1ZHMA 1GBJA 3LGTA
chains in the Genus database with same CATH topology
2A4RA 2GV7A 1VITH 3GCHC 3VB4A 1C1TA 1MTNB 4F4OC 5GPIB 4LK4A 5I46H 1Y3YA 1IAUA 2H9EH 1N8OB 1K1LA 4ABDA 3TGIE 2R2MB 5A0AE 3QGJA 3RXCA 1ORFA 4CBOA 1V2ST 1J8AA 4AG2A 1YGCH 1S81A 1OP2A 2FI3E 4X1PU 2A4GA 4ZXXH 3QLPH 5T6GA 1BMNH 4INKA 1QL7A 4D9RA 2XRCA 2Y7XA 3SNDA 1K22H 4ZMAH 4UD9H 3RM2H 2RDLA 1T8NA 3RXTA 3O8CA 5F8ZA 5EW2H 4GCHF 1XUGA 3OX7U 2A4QA 1GMCF 1TNHA 5FBIA 1N1LA 3TU7H 1AFEH 2ZFFH 4IMZA 4ISOA 3URCA 3GCHB 1ZTJA 1D6RA 1FMGA 2IJOB 3QN7A 1ZSJA 1H8DH 1J17T 2H9HA 1V2MT 3ZZCA 1AQ7A 1LVMA 3EA9A 1ZPZA 5AHGH 1TGTA 1QBNA 2CN0H 1V2UT 2TGTA 2FODA 3A8DA 3A86A 2VVUA 3BTTE 1GJCB 3RU4T 4B2CA 4NWKA 1WV7H 2HNTE 2ALPA 3KEEA 1XXDA 3CENA 5IYTA 1TABE 4JK5A 1C4U2 1C4Y2 2Q1JA 1XUKA 3RXIA 3QK1A 4NIVA 5C1XA 2H2ZA 1SFQB 1SLVB 1ETSH 1RGQA 2FMJA 4XBDA 4HTCH 1NFUA 2VGCC 4B2AA 1GMDF 4DCDA 1UTQA 4NZQA 1HAGE 3UIRA 3A82A 4FUHA 1QB9A 3UPEA 1C5SA 2CGAA 1K28D 1VGCC 2WYGA 1WYKA 2ZU4A 1DS2E 3TH2H 4NIYA 3SUFA 3KIDU 3P95A 1KXAA 2QGRA 1VJ9U 2YNAA 2ILNA 1PPZA 5ESBA 5C1YA 4GPGA 1O2OA 3HK3B 2WUCA 4B2BA 1EX3A 1UK4A 1O2JA 4TPYA 3TIUA 1Y3UA 1TX6A 1YPMH 1B7XB 2VWMA 1ANEA 3FZZA 1NROH 4OS2A 1UCYH 1PFXC 1ARBA 3GY7A 3LGWA 4GVUA 2GCHF 5E2OA 4MLFB 2ZNKH 4E06H 4K3JA 1XKAC 1DSTA 2VGCB 3M5NA 1GJDB 1GVZA 1Z1JA 2P8OC 1MQ5A 4JCNA 3RU4E 1TA2A 6ESTA 5JPMH 1EOJA 1MKXH 1VGCB 4FUFA 2WUBA 1H4WA 2RA3A 1AU8A 1DUEA 5A0CA 3FFGA 1Z6EA 1Z7KA 4E7RG 1GI3A 4ISNA 2ZHDA 1O3OA 1W13U 3SU4A 1EPTC 5DP4A 1FY3A 1FPCH 3SBKA 3SUGA 2FXRA 2J9NA 2ZG0H 2VIQA 1TOCB 2G00A 4IS5A 2TGDA 2PSYA 1NRNH 3CS7A 3E0PB 2GGVB 4AOQA 4NFFA 1DPOA 1SB1H 2FYQA 4IMQA 3PMHB 1LPKB 3LOXA 4PROA 3BTDE 4ISLA 1QGFA 2BZAA 2UUKB 3GCTG 1ELEE 1ZLRA 2P8OB 2ZQ2A 3EGKH 1D3QB 4NG9H 1K1IA 1GGDC 2VWLA 1HAIH 2R0KA 2FS8A 1OXGA 3A7ZA 1DUAA 2VWOA 1TB6H 1FY8E 1LPGB 4DIIH 3DT0H 1AZZA 1UO6A 1TAWA 1EUFA 1KIGH 2G81E 4UE7H 3Q3KA 1GHWH 7LPRA 1ZGVA 3BEUA 2I6QA 1EPTB 1GBCA 4YLQH 3S0NA 1GWAA 1EPTA 1FN6A 2DE8A 2ZDNA 1XUFA 4U2WA 1T8LA 3BEFB 5JB8S 1OSSA 1V2QT 1SC8U 2XBVA 3RXEA 4LXBH 2CHAB 2QF3A 3RC6A 1YPHC 1QTFA 1C5OH 3QX5H 1XX9A 4FU7A 2HVXA 1YCPM 3P70B 1TALA 1TPOA 5DP5A 1G3DA 1W0ZU 1W8BH 1KSNA 4K60A 1GPZA 1G3BA 2TPIZ 4I8HA 4DGJA 1FAXA 5E8EH 1C2EA 2BY7X 2OBOA 1ZSLA 1GGDB 1ESTA 3NPSA 2STAE 1A5IA 1OOKB 2C8WB 2Z3DA 3M7UA 2XXLA 4Q7YA 5JBTA 1RFNA 1QA7A 1MKWH 2V0BA 3PMAB 3V7TA 1K1JA 1T8MA 1THSH 4FVBA 1DITH 1NO9H 2W7UA 3VFEA 4YO9A 1ZTKA 2I6SA 1K2I1 4FXGH 5DJ7A 2P3TB 1KXEA 3LGYA 2A7HA 3MI4A 1TBQH 1P04A 4K2YA 1QIXB 3T5FH 1O3EA 4OGYA 3U1JB 4CH2B 1ELFA 1P3CA 2QXJA 3LC5A 3TK6A 4HFPB 1NC6A 1W14U 1Y3WA 1F92A 4GLYA 3A88A 1O2ZA 3GDSA 3PLPA 1TA6A 1WSSH 5DK1A 1DY9A 3ATWA 3K6YA 4X2VA 2BZ6H 1O2VA 1Z71A 1C5MD 1YCPH 4I33A 1UVPA 3UOUA 4FUBA 4M7GA 3NK8A 4X1NU 1IOEA 1DSUA 1YPHE 4YLUA 1NS3A 1FLEE 3TJOA 1DWDH 1GBEA 1PQAA 1YLDA 1TX8A 1QRZA 5L2ZH 1A4WH 4CR5A 1GI2A 2OP9A 3MH5A 1T31A 3P8NA 1HDTH 3TGJE 1ID5H 3MWIU 4MVNA 1GDQA 2AH4X 2A45B 2BOHB 2PKAA 1ANDA 5C5OA 4U30A 1IQHA 3LJOA 1QRXA 1EB1H 3F6UH 2VB0A 1UTLM 4ABGA 1A3BH 1QURH 2HOBA 1P10A 2BDCA 2Y6TA 3LT3A 4GSOA 2A2XH 3SGAE 3TJUA 5B6OA 3ZZ8A 1ABJH 4A7IB 2P93A 1OWIA 2BD3A 3M5MA 3LJJA 2BD9A 4Y10E 4BTUB 2ZU1A 2QC2A 1A5GH 3STJA 3M7QA 3LGUA 4I31A 3B23B 4AFSA 1XVMA 2C8ZB 1K21H 1OS8A 1V2TT 1UMAH 2JH0D 2ZGXH 1NU7B 3E1XB 3PTBA 1O2KA 2P3FH 4AGKA 2WYJA 5C3NA 3LIWA 3KL6A 1P57B 3KQEA 1FIWA 3V3MA 4CHAC 1K1OA 3M37A 3TK5A 1BJVA 4TWYA 4SGBE 1LCYA 5A0BA 1IQFA 1GL0E 1TQ7B 4LOYH 1EQ9A 4ZHMU 3SJIA 4BTIB 3Q3XA 3QGNB 3M3SA 1E35B 1Q31A 4MNWA 1P09A 3LGIA 4DW2U 2ZGJA 1CHOG 3H7OA 2WPKS 3UQVA 1O3BA 5AVDA 2HLCA 1GVKB 2D8WA 2XCNA 3O8DA 1S83A 1F0TA 2BY5X 4TYDA 4CRBA 4TWWA 1HGTH 1O34A 1J15A 4IC5A 4JZIA 1CSOE 3OSYA 4FU8A 1GI6A 3D65E 1MUEB 3ATKA 4U01A 4MG3A 1F0RA 1C2JA 2J2UA 2VIVA 1C5XB 1AGJA 4ZKOU 4X8VH 1BTWA 1QL9A 5BPEA 2GDDA 3C27B 2FP7B 1TGNA 1TQ0B 4CHAB 2ZHFH 1CGIE 1PPGE 5EXLA 3SU2A 1UHBA 2BDAA 2FS9A 3TK9A 2GKVE 1OP8A 5LH8A 4JZ1A 2FO9A 1DY8A 1GHAF 1HAZB 1WBGB 1QJ1B 4O3UA 2FLRH 1BCUH 3BG8A 3TGKE 4XFQA 1SHYA 3R0FA 4OS5A 3MO3A 4NZLA 1BHXB 1ELGA 3HKIB 4RKJB 1W7GH 3TNTA 1O2QA 4INLA 4KTCA 3NWUA 2FOBA 3SV6A 2B0FA 1KXCA 2VJ1A 4XBBA 2VH6A 4ISHH 2BVXH 3GCOA 3ZZDA 1O3GA 3ZVAA 1GI9B 4BXWA 1ZSKA 2SGDE 1EZSC 1D3PB 3RMMH 1YF4A 1B5GH 2W3KA 1C2FA 4NIXA 3A81A 7ESTE 2OQUA 2CJIA 3SNCA 3FZDA 1P2QA 1P2IA 4ZKNU 1EAXA 4OS6A 1XVOA 1F5KU 1PPHE 2OINA 3Q77A 2TGAA 5LPFA 2LNCA 2AGIX 2R0LA 2F9PA 2A1DB 4NCYA 3SNAA 2ANMH 3UR9A 2PTNA 4FUJA 4IW4E 2WPIS 1PYTD 1AUTC 5DP9A 3STIA 1FZZA 3KQDA 2VIPA 5T3HA 2Y80A 4GHQA 3T62A 3PYHA 1DXPA 2WPMS 2BLQA 1KDQB 1YPEH 5HM2A 4AYYB 2O8MA 4AFZA 3SJ8A 1AI8H 1RTKA 1KDQA 1S0QA 1NFWA 4X2XA 1Z6JH 2ZFQH 5GCHF 5GWZA 2ZA5A 2ZO3H 2CF9H 4I8LA 1UK3A 1V2KT 4Y71A 1LQDB 2R3UA 4AB9A 2AGEX 4Y6DA 3BG4C 3ATLA 1C5TA 1GBMA 1O3IA 1S6FA 3EDXB 1TNKA 3EA8A 4NSYA 3P8GA 3MNBA 4WF8A 1KXBA 2BX3A 3EAJA 1FXYA 1O35A 2XW9A 3MTYA 4IBLH 4ISIH 4DOQA 2ZI2H 1H1BA 2J38A 4CRCA 2QCYA 1O2WA 3SUEA 2Z3CA 1DWBH 1FY4A 1MD8A 1FDPA 1UTPA 2FWWA 2VNTA 1GI8B 1ZMJA 2BDYA 1GHBG 2BY8X 3E90B 1C2GA 1QBVH 8GCHG 1DVAH 1CT0E 1SGQE 1KY9A 1TNGA 1FUJA 1O2YA 1DE7H 3ELAH 1XUHA 2HNTC 1IQLA 4CRAA 3KQBA 2PFEA 4X2WA 2EI6A 3S9BA 1B0EA 1BZXE 1L1JA 5EPNA 1JRSA 1Y5UT 4D8NA 1V2WT 2BTCE 3BG4B 4K5ZA 4A92A 2JKHA 2FOCA 3DFJA 4MDSA 1M9UA 3SGBE 2Z7FE 2ZDAH 3RDZA 2AIQA 2DUCA 2OC7A 1DM4B 4MQAA 1LHEH 1IQJA 3TVJB 2OTVA 4GHTA 1O2NA 3E0NB 3DFLA 1O31A 3ESTA 3ZZ9A 1O5BB 3ZZAA 1O2PA 1GG6B 4NA8A 3ZV9A 4E7NA 2ZEBA 3SQHE 2R3YA 3SHCH 2IOTA 1MKXK 2PSXA 4FUDA 2NU1E 1YM0A 2AEIH 1DANH 5EXNA 3VXEH 1HAPH 4XE4A 4ZROA 2NWNA 1BBRH 1IHSH 2ZF0H 4AYVB 2FOGA 4FUGA 1E36B 1LPZB 1JWTA 1G32B 2FEQH 1A2CH 3QWCH 4ABJA 2D26C 3P92A 1UVSH 4AN7A 2G4UA 3E6PH 2F3CE 4OS4A 5DGJA 3I77A 1LVYA 3P6ZB 5CHAC 3GY8A 1S84A 5EQQA 1JIRA 5J4SA 5FPTA 3A8CA 1G2MA 2ULLA 3SV9A 3BIUH 5SGAE 1MQ6A 2TGPZ 2ZCHP 4ABEA 3BTFE 2ZU3A 1WAYB 4Y7BA 4MNXA 8KME2 1GBLA 1H9IE 1JRTA 3LPRA 3QZQA 4JZEH 4XDEA 1GVLA 2SGPE 1C1RA 2QY0B 5EQSA 1GHVH 1VITG 3LH1A 2A4OA 1GJ6A 4Q7ZA 1O3HA 1BHXF 3O8BA 3UFAA 1Y3VA 4UFFH 5EODA 4NA7A 4FUIA 1ANBA 3Q00A 1V2PT 2G52A 1AWFH 1EAWA 4JYVH 5F6MA 4RSPA 5C1UA 4THNH 1KLIH 1NN6A 4FUEA 1G2LA 3B9FH 1DT2A 4DY7B 5DO4H 3VB3A 3ITIA 4FVDA 3W94A 1C5LH 4Z6AH 2A5KA 5CHAB 3QTVH 5HGGA 2O8LA 1OWJA 1P9UA 1WOFA 4A6LA 1O39A 2QXIA 2FLBH 1V3XA 1P2MA 1O3DA 5ABWA 1HUTH 3BTKE 1P11E 1NPMA 4X8TH 4KELA 4DT7B 4NA9H 1TMTH 3RXVA 4B1TA 2OLGA 1VCPA 3S7HB 5HYOA 4YM9A 3AVZA 1O5GH 1TMBH 3A8BA 1A0LA 1O3NA 4E05H 1EOLA 2BD4A 4MPWA 4TPIZ 5ETXA 1BRAA 2BD7A 1QNJA 1RXPA 4KKDA 1GMHG 1EAUA 1TOMH 1TIOA 2ZGHA 4B74A 4FU9A 2WPJS 1MKWK 3RXDA 2VVVA 2K1QA 5T6DA 1F0SA 5LPRA 1MBQA 3F1SB 2WPLS 3A7YA 4WXVA 2CV3A 2J94A 2W7SA 3EYDA 1V6DA 1ZR0A 1ACBE 4IN2A 6GCHF 3RMOH 3GY5A 1TONA 4IGDA 3ZYDA 3KCGH 2CHAC 1C1NA 3BEIB 1MCVA 1MD7A 1GBAA 2QV1A 4K1EA 5LGOA 2GTBA 3KGPA 4A1VA 2VWNA 1EP6A 1O36A 2FOMB 3FP8E 4INHA 2A5IA 7GCHF 1CGJE 5FHTA 3KNXA 5K7RA 1O3FA 4GAWA 3HKJB 2TRMA 2FESH 3LONA 1LDTT 4Q2KA 1P0SH 3SJ9A 2H5DA 3MYWA 1Z8JB 1GJ7B 2FDAA 2ZDVH 1KLJH 1SOTA 1D4PB 1XXFA 1GHXH 1TWXB 4X8SH 4Y8XA 1MTWA 1SSXA 3UOPA 4ZHLU 1LVOA 1MMJN 3QZRA 1DWCH 4K69A 1P2NA 1UK2A 3SQEE 1ZPCA 3K65B 4U32A 3RMLH 2HALA 1P02A 1UCYE 2G5NA 3TJNA 1OWHA 1JIMA 2STBE 1NFYA 3SV8A 2ZHQH 3RXUA 2GD4B 3RLYH 4ZHAA 1C2LA 5C67A 3M61U 1FN8A 1FI8A 3UR6A 3QTOH 1ZPBA 2BLWA 4JK6A 1C1SA 4AZ2B 2QN5T 5GIBA 1DWEH 2PLXA 1DOJA 2F9VA 3FP6E 1BTUA 2ODYB 2QYIA 2ZPSA 2RCEA 2OC0A 3BTME 3PLBA 4D7GA 2Z6BD 2BX4A 1QL8A 3A84A 1ELVA 3ZVFA 3SORA 2TIOA 2Y5GA 1E37B 1S0RA 3JZ2B 3NXPA 1BMLA 2BVRH 1HCGA 3PROA 2JH6D 2PV9B 4FUCA 1FPHH 4YTAA 1ESAA 3A89A 2HNTF 3W95A 1CO7E 4LZ1H 2Y5FA 3TNSA 1FY5A 2GMTC 1AWHB 3AW1A 2O8UA 2ODPA 2AFQB 1ELAA 1P2KA 3RM0H 1L1GA 1LHCH 1LKBA 3B8JA 4I8GA 1W11U 3S9CA 1IQIA 2FPZA 2ZHEH 3V13A 9LPRA 1OYTH 1C5RA 4WJG2 2FTMA 4AFUA 4B76A 2A2QH 5FPYA 2B7DH 4JMYA 2SGQE 3SU1A 2QIQA 1BOQA 5A09A 1TE0A 1G36A 2PKSC 1IHTH 3PB1E 1HBTH 1NTPA 3MU1A 1T4VH 3D23A 5JBAS 1D3TB 2ZFTA 3MOCA 5C2ZA 5TCAA 1F7ZA 1EJMA 1MBMA 2GVFA 2BDIA 4A5TS 1H9LB 1YP9A 1SGIB 1Y8TA 5A8ZA 4JYUH