1ELWA

Crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR1-DOMAIN OF HOP
publication title Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 49
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elwA00
5ARFA 5KJKA 2GW1A 2C0MA 3ASHA 3PE4A 1B89A 1WAO1 2XGOA 3OXGA 3Q49B 4G1TA 3UUXA 1PC2A 3FFLA 3ULQA 3K9IA 4U04A 5KJNA 2UWJG 3QWWA 1P5QA 4XI9A 2MHKA 5C1DA 3TAXA 1OUVA 2I6HA 3LKUA 2HR2A 4AY5A 4WUYA 4NRHB 5D0QD 3CVLA 4CGVA 4JA9A 2QFCA 1ZU2A 2Y4UA 2LNIA 2FF4A 2YHCA 3ZHEA 5LCWC 3WXXA 1QQEA 2FBNA 5FZRA 4GZ3A 5EKQD 3QWPA 4I2WA 4UQYA 2KCKA 4UQZA 5LCWJ 2KCVA 2DBAA 4B94A 3VTYA 4CGWA 1HH8A 3ESKA 3GW4A 3ZPJA 5M72A 3CVNA 4O6FA 3CK8A 3LY8A 4APOA 2KC7A 2NC9A 2UY1A 5DBKA 2OOEA 3JYSA 4UI9C 3CK9A 4N3BA 2XEVA 3GZ1A 3RO3A 2Y4TA 2VGYA 4JL0A 1E96B 3PDNA 2Q7FA 1WM5A 2VSYA 3LCAA 3SF4A 1IYGA 3TGOA 3RKVA 3RIBA 3ZHEB 5AYWD 5BT1A 1QZ2A 4KBQA 5FT9A 4GCOA 3S7JA 3HYMB 5CHEE 2PL2A 1KLXA 4KXKB 4I2ZA 3Q15A 4WNFA 3ZN3A 4YVQC 3AS5A 3ASFA 4U0SA 5BW8C 4J8EA 4Y6CA 1HZ4A 2UY1B 2PQRA 3UQ3A 2XGMA 4GA2A 5EX0A 4N3CA 3MV3B 4IN3B 3LY7A 2P58C 4CDRA 4EQFA 1KT0A 4G26A 5D0OD 3CV0A 2VGXA 2FO7A 5A6CA 2PZIA 2BUGA 3U4TA 1W3BA 3MV2B 4G24A 4UQXA 4ABNA 2FI7A 2LSVA 4G25A 4GZ6A 5DIZA 3Q5MA 3KS2A 3GYZA 2JLBA 4XIFA 3E4BA 3BEEA 5KJLA 3GZ2A 3U3WA 5FZQA 4KYOB 2XPIA 1A17A 3CVQA 3ZFWA 4GA0A 1YA0A 5EX3A 2IFUA 5CCLA 1NZNA 3ZGQA 3KAEA 4GYYA 3NF1A 4Y6WA 3MA5A 3QDNA 4HOUA 2L6JA 2E2EA 2IF4A 3IEGA 2VGXB 4H7YA 3CK7A 5CCMA 3QWVA 2R5SA 4LEUA 3Q47B 4I9CA 2XCBA 4J0UA 3AS8A 4XI0A 3TG5A 4I1AA 4HOSA 5FZSA 3S7FA 2YQ8A 4N5CA 4N2QA 3S7DA 1KT1A 2LSUA 5G05C 2KATA 1Y8MA 4AIFA 3KD7A 4BTBA 2HYZA 1FCHA 5G05J 2HO1A 3URZA 3CEQA 3EDTB 4N39A 3OXLA 4U0UA 4GYOA 2WQHA 5KJMA 1XNFA 4WNGA 3ASGA 4U0ZA 3RJVA 1ZBPA 5FTPA 5BNWA 2V5FA 2ONDA 2XGSA 3CVPA 5JJ6A 4WNDA 5G04C 3VTXA 4BWRA 3AS4A 2J9QA 4J8FA 4A1SA 4BT8A 4HOQA 3LYAA 5HQ8A 5G04J 2AVPA 4H7XA 3PE3A 3CKCA 3R9AB 3UPVA 2FEZA 5JJTA 4GZ5A 4WNEA 3MKRA 3TG4A 5FJYA 2VYIA 4HORA 4RG6A 4AM9A 5HI7A 5JJ7A 4F3VA 2WPVA 2C0LA 3OXFA 4HOTA 4ME2A 3ASDA 1IHGA 3N71A 4J8DA 3FWVA 3QKYA 4U07A 4BTAA 2XCCA 1ELRA 3LPZA 4N3AA 4UI9K 3CKBA 2C2LA 1NA0A 1NA3A 4YVOA 4I17A 3LY9A 4UI9J 4G2VA 1ELWA 3RU0A 4I9EA 4N2SA 5ARGA 4AY6A 2KCLA 4GYWA 4G23A 4GPKA 4BT9A 3MEKA 1HXIA 4W9RA 1TJCA 4JA7A 4GA1A 2VSNA 3S7BA 3RO2A 4YNDA 2VQ2A 3Q4AB 3FP3A 4JHRA 2PQNA 3SZ7A 5A7DB 3QOUA 4NQ0A 3O48A 4GCNA 4RG9A
chains in the Genus database with same CATH superfamily
5KJKA 2I1JA 4RQIA 2WXMA 5EYPF 5JHBA 3LJ3A 4XKBA 5J08A 3DWLG 1PC2A 3B7UX 3ULQA 2H6FA 1H6KA 1OY3D 4GMRA 3ZU7B 4XI9A 3CSFA 3PZ1A 4OVUA 4XKCA 2MHKA 3ML9A 1MX6A 2I6HA 4WUYA 2P9IG 2GRRB 3CVLA 1L5JA 4JA9A 4CCAA 2LNIA 1TNBA 2Y3AA 2AXVA 2JABA 5LCWC 4I6JA 2FBNA 2GRNB 4GZ3A 4I2WA 4PS8A 1BI8B 1NP7A 4EZLA 2WXGA 1HH8A 3RRUA 3LY8A 2KC7A 3ESLA 3AG2E 3ONLA 3FTYA 3SI5A 3PNLB 4F1PA 3TWVA 2RFAA 5CECB 4N3BA 2VGYA 4F1SA 4ILIA 4URKA 3V2XA 1WG0A 3PDNA 3ASOE 4O60A 1WM5A 2VSYA 3LCAA 4PS7A 3L13A 1FPPA 1TN8A 3TGOA 5LFAA 5AYWD 5CERB 2IJGX 2A4ZA 3ZUVB 3TWTA 4B8AA 3S7JA 3HYMB 2PL2A 1H2UA 4V3IA 2R05A 3FUKA 3Q15A 2EIKE 4CYMD 4DRXE 2ILRA 3R7RA 3ISMC 1TR4A 1HS6A 1E90A 4XX5A 2CHZA 2PQRA 3C3OA 5EX0A 2VJ8A 3EHRA 1Y6IA 4CZ2D 3LY7A 4HB5A 3NB2A 4CDRA 2PM7A 5EILA 3IHYA 3FULA 4BX8A 5ENPD 4UUCA 3PZ3A 4DLQA 1HU3A 4EBAA 5JMND 2FI7A 3AG4E 5CEAA 4G25A 5DIZA 5BV0A 4XIFA 3BEEA 3S2AA 3SQVA 3C72A 2HE0A 4I6GA 5ANRA 3U3WA 5ENSD 5FZQA 4F53A 3UM3A 2EQXA 4GA0A 3X2QE 2WQ7A 2A5UA 3OTNA 5BPPA 2XS8A 2P9UG 2V5QC 2WMNA 2NYJA 3APFA 3FEXA 1N4RA 3QDNA 2E2EA 1YMPA 4H7YA 4E85A 3CK7A 3C5RA 3HVEA 3D9NA 5CCMA 4LEUA 3U64A 3RRMB 2P9SG 3MZLB 2VSXE 1OCRE 2KM4A 4GTOA 3FTXA 3PZ4A 3UKRG 4CT0A 3DRAA 3E30A 4TRQA 2I1KA 4FADA 3DPDA 5FZSA 4PH4B 3MYVA 2YQ8A 1KT1A 2LSUA 4WWNA 4GTTA 3CHPA 1E7VA 4ANVA 4AIFA 3LJNA 1FCHA 5G05J 3TXMA 2HO1A 1E8ZA 3HXCA 1MJ0A 3CEQA 3PEVB 3TJPA 4EBAG 3D9KA 2WVIA 3OXLA 5EIDA 3HVEB 3U9WA 3U66A 2PNNA 2XHEA 4I1OB 4B8CB 2XPYA 1MHQA 3QB2A 4Q96A 4DX7D 1YYHA 2XRZA 5BNWA 4IULA 4L9PA 2VGEA 4WNDA 1HE8A 2P2CP 3FY4A 3VTXA 4AJWA 3I4GA 4U95D 1OCCE 4A1SA 3UM1A 4HOQA 2V8SE 3LYAA 2X6KA 3B7RL 2AVPA 2WB2A 3Q78A 4A3TA 1FVHA 3CKCA 3SBTB 4U96D 3I4RB 3W9FA 2L0TB 4D10C 2R03A 4WNEA 4J8YA 1HO8A 4GU5A 4HLEA 1TNUA 4QFVA 4RG6A 3B95A 4F3VA 3CVWA 1D8DA 3ABLE 4ME2A 1ZB1A 3ASDA 3N71A 3J5PA 3HHMA 4J8DA 3QKYA 3T5XA 2DYRE 1D9SA 2WXLA 4MBGA 1DC2A 4CRWA 4U63A 4EECA 1Q2ZA 3CKBA 1EYHA 2C2LA 3G2SA 2H6IA 5B1BE 3MX3A 4JHKA 3MGBA 4J6IA 4BESA 2P9KG 4IYPA 3LY9A 2CHWA 2AW6A 4BFRA 4LRZA 3D9PA 4FLBA 1TYQG 3DEOA 1E8YA 2YINA 4BT9A 4AOFA 5HRYA 1TJCA 4JA7A 4GA1A 2CG2A 2EINE 2VQ2A 3ZXSA 3LDZA 5FQ4A 1IQUA 2V4HC 3FTUA 4NQ0A 1INZA 2WXPA 3AAAC 2J07A 2ETCA 1BU9A 3I5PA 4CDMA 4MKTA 3CLJA 3BG1B 2XEHA 3PE4A 3CHMA 1K8KG 3OXGA 2RG8A 3TXNA 1JCSA 4PUCA 5LP0A 2QYJA 3FFLA 1UJKA 3LEWA 3D9OA 3L82A 4HRNA 5KJNA 3UM0A 1XGWA 5EN5D 2WXOA 2RKKA 3QJZA 2J8SD 5H7PA 3TAXA 4B93B 4K5CA 4NRHB 4PDXA 4Z68A 4CGVA 2Y4UA 2X6HA 4GTVA 1O5MA 2EILE 3MKQA 3T8KA 4HLLA 4UQZA 3SNXA 3DSUA 4CGWA 4M3OA 4K5BA 2Y0BG 4ILHB 4JEUA 2OCCE 3JCKC 4BX9A 1RW2A 4ZFHA 5DBKA 2OOEA 2GROB 2J08A 2Y1LE 1H2TC 4XZ4A 1NL4A 3CVVA 4EZKA 5FQ6A 5CRUA 3PS6A 4KZCA 3FH5A 2AXUA 4R7LA 4L23A 3EHQA 4BETA 5E76A 1ELKA 5T4YA 1JCQA 1FT2A 3FH7A 1OWPA 4C9BB 3CVYA 3SF4A 1IYGA 5B1AE 3RKVA 3IHVA 1HFAA 1O1TA 3D9LA 4KMOA 5BT1A 3V30A 5LOZA 4KBQA 2ZIRA 3NZUA 4HBDA 3TWWA 5KCMA 3MKQB 3FUIA 5CHEE 2OEVA 2J4BA 4A63B 4KXKB 5EYLA 3LVQE 3E32A 4Q94A 3ZN3A 4YVQC 5G55A 2R2LA 1UOHA 2XEEA 3ASFA 3MJWA 1HZ4A 2F8XK 1UJJA 1H19A 3HXFA 2WXRA 3UQ3A 5E75A 3ZW3A 2XGMA 4GA2A 2CG3A 4HS2A 4N3CA 3MV3B 4MLPA 2KBXA 4G8LA 1EPUA 2P58C 1OCZE 4EQFA 4G26A 1K1AA 5A6CA 2HM8A 4OVVA 2BUGA 1W3BA 3MV2B 4G24A 4UQXA 4TXQA 1OWLA 4I1MA 5FQ8A 3EIQC 2WXIA 4GZ6A 4ACLA 5FIOA 3E4BA 3J5QB 3IKOB 1PAQA 2XPIA 1OWMA 1BLXB 3FUFA 3CQGB 1YA0A 1TNYA 3KAEA 4GYYA 3UX4A 1JWFA 3SFZA 3UMVA 4L2YA 4Y6WA 3TWXA 4AVXA 4KZ0A 3PUKA 4A55A 4HOUA 2H6HA 3DSWA 2IEJA 2X38A 4CDNA 3BG0B 2GRLA 2WM9A 2KXPC 3O4ZA 4U7EB 3Q47B 3VLDA 4J0UA 3V79K 1N54A 1HG5A 3AS8A 3TG5A 4I1AA 4AEZC 1AP7A 1O1SA 4HOSA 4JC8A 1EF1C 2M63A 2V4LA 4FJZA 1N9AA 1N94A 3S7FA 2WXKA 3S7DA 3W9GA 4K03A 3UT4A 3B7SA 4GZDA 2KATA 1Y8MA 5B3SE 1UG3A 3ZYMA 4GPMA 2ETBA 1U3CA 1LF8A 2LXMA 1U2VG 1N0QA 2J09A 3CVXA 5HS0A 5C2YA 3L6AA 4AV7A 3EDTB 4U0UA 1UW4B 3B7BA 4TXRA 1XNFA 2H6GA 4RVBA 3D9JA 4U0ZA 3CGHA 3FUHA 5ENTD 3RK6A 5EIBE 3CVPA 3ZXPA 1E8WA 2LAIA 2J9QA 1X81A 3KEAA 5HQ8A 5G04J 2AWIA 2FO1E 3Q9UC 3HXDA 1WY6A 4Q69A 3UPVA 2FEZA 1SA4A 4GZ5A 2BF0X 3P2BA 1E8XA 2WMOA 3MKRA 5AAOA 5FJYA 1JPLA 2DWZA 3NZSA 4DJAA 5JJ7A 5BUZA 3ABME 2WPVA 4I43A 2C0LA 3SHFA 5AQ9A 4HOTA 3FWVA 1IHBA 4BEPA 3RSEG 1MQSA 5LX8A 1LD7A 2KZTA 3D3MA 3LPZA 3C3QA 1DVPA 4K5AB 2WXHA 2BEDA 1NA0A 4JEHA 4A3VA 1KZPA 4I17A 4UWGA 2ZGGA 3PVLA 2X6JA 1Z6TA 1ELWA 2NXPA 5ARGA 4JD2G 3NAWA 4AY6A 1N4PA 4O1OA 3UIOC 3MEKA 3EUVA 5T3RA 4FLHA 2VSNA 2EIME 1IQRA 2IO3C 2L6BA 4I6EA 3SZ7A 4JB8P 3DXMG 4GTQA 2IY0C 3AU4A 3D9IA 3QOUA 3ULYA 4GCNA 4UWKA 4RG9A 1FVFA 3AG1E 4WWOA 4HQDA 2KZTB 2OEWA 4TV3A 5ENNA 1NI1A 1B89A 4FULA 3JXJA 3Q49B 2WXFA 2DIWA 4FJYA 5G2NA 1D8EA 3HDXA 1QNFA 3K9IA 3ONKA 3G2WA 2UWJG 3QWWA 4L2LA 5C1DA 3LKUA 5KBAA 5AQBA 2HR2A 3FUEA 2AXZA 1OWNA 5D0QD 4B89A 1QBQA 3G2VA 2QFCA 2YHCA 3Q7AA 3PEUB 3ZHEA 4XEIG 3KSLA 3WXXA 4FHKA 1QQEA 5FZRA 2A5EA 3SY2A 2KCKA 3B7TA 4KVMA 3WG7E 5LCWJ 3VTYA 4E6HA 1JUQA 3ZPJA 1Z5SC 4UWLA 2XENA 3CVNA 4GMJA 4DX2A 4LNGA 4APOA 2NC9A 3D9MA 3IV0A 5FINA 3JYSA 4JZYA 4UI9C 2X3MA 4C48B 4FHJA 2R59A 3IBEA 5BXUA 4TXPA 3L16A 2IOLA 2Q7FA 3FU5A 4C0MA 5KWDA 2E0IA 3TWSA 3AU5A 3ZHEB 3L9TA 3Q73A 5FT9A 2ETAA 4AP2A 2MRIA 1KLXA 4DX1A 4WNFA 3G2TA 3T8MA 1G3NB 1RZ4A 4OAVB 3ZRHA 5BW8C 4J8EA 1FT1A 3ZKJA 5D2MC 3E34A 2L0IA 3DXKG 3AG3E 5HKPA 4L7TA 3P1UA 4HFGA 4IN3B 3MCXA 1KT0A 3PH0C 1LTXA 1OXJA 3CV0A 2VGXA 2MYOA 1BPOA 3DEPA 2PZIA 3U4TA 2P9NG 3FU6A 3LS8A 3ZYQA 1SW6A 2LSVA 5EDSA 3Q5MA 4GZCA 3UM2A 3GYZA 1N52A 3Q7FA 5ITZF 5KJLA 3GZ2A 4KYOB 1A17A 3ZYKA 2VSOE 3CVQA 3JQ1A 3ZFWA 5EX3A 1NZNA 4N5QA 4DUIA 3BU8A 3G2UA 4J8SA 1DCQA 2LUHA 3UT8A 3CHRA 4NURA 2IF4A 2VGXB 1UN9A 2B0OE 2J4DA 2DVWA 3HIZA 1N95A 2R02A 2YHEA 4I9CA 1SA5A 2XCBA 4KVOA 2GRPB 1O1RA 3AJIA 2OVBA 4JHJA 4YDEA 4OAUC 3QARA 1YCSB 3T9KA 4N2QA 4EZJA 5G05C 4HVBA 4ILGA 2V0PA 4O1PA 3KD7A 2HYZA 3FUMA 4OYSA 1N4QA 2WQ6A 3D9HA 3FTVA 5FQ7A 4HI9A 3CHOA 2WQHA 2RFMA 4GB9A 2XZTG 3APCA 3JXIA 2F0YA 1IKND 3ZNGA 1PY1A 3QK0A 1VDYA 4J7WA 1LD8A 1ZBPA 1SQMA 2V5FA 2MOWA 2ONDA 4FA6A 4RSYA 2XPZA 5A23A 4JPSA 1BI7B 3DSTA 3SD5A 4J8FA 2OVFA 1N0RA 1IXVA 4GTPA 1Z3XA 3ZIMA 3DSVA 3HG0D 4EPZA 3BQOA 3R9AB 1H2VC 3EJNA 2XRYA 2BKGA 2GRQB 5JJTA 2X6FA 4X8QA 5AN8A 1SVXA 1HF8A 4XE0A 3TWUA 3QNKA 1WDYA 3TG4A 4HORA 2WXQA 4AM9A 1S0PA 3OXFA 4YDWA 2P9LG 3I3NA 3Q79A 3BUAA 3KEZA 4ANXA 4WWPA 4U07A 4BTAA 4G8KA 3FUJA 4UI9K 3LXUX 2AJAA 3E37A 1NA3A 4YVOA 5CBNA 1TN6A 3NOCD 1H6PA 3SFYA 3FU0A 4TUMA 3FTZA 4UI9J 4G2VA 4I9EA 4G11A 2KCLA 4GYWA 4G23A 3ULEG 2ZGDA 2FULA 2QC9A 3L08A 4RLYA 3PZ2A 5AIJA 1BD8A 4BSXA 2IQCA 4YNDA 4GTRA 3Q4AB 1S64A 2EIJE 2CFZA 2PQNA 3ABKE 2DCPA 1TNZA 1KZOA 5ENRD 3DSXA 5D66A 3EHMA 3E33A 3CSTA 2OV8A 5ARFA 3FEYA 1HX8A 2GW1A 3NBNB 4FU3A 3FDHA 1H0AA 2C0MA 4HNAD 5AARA 3NQPA 2WXJA 3ASHA 3TWQA 3ASNE 1E7UA 2IOSA 2GRMA 4M7CA 1WAO1 2XGOA 3UUXA 4G1TA 1V55E 3IXEA 4PS3A 1V54E 3B13A 4U04A 5CMWA 4GMLA 4MS6A 1A5EA 1P5QA 4ANUA 4JVSA 2ZISA 1OUVA 1MZCA 4BY6A 3HXEA 4AY5A 3RRNB 3APDA 4TUUA 3CVUA 1EDUA 1ZU2A 4NACA 5ENOD 2FF4A 4ACKA 3VLEA 3EHNA 1MYOA 4DPRA 1K3ZD 2P9PG 4LUNU 2XS1A 1K1BA 1N4SA 1NFIE 5EKQD 3QWPA 5KNHD 4P29A 4UQYA 4UWHA 3PNTB 4MRUA 4BERA 2KCVA 2DBAA 4B94A 3R7QA 1HG2A 3ESKA 3GW4A 5M72A 2ZXWE 3FH8A 4O6FA 3T5VA 1DNPA 3CK8A 2UY1A 3CQCB 3CK9A 4ATZD 4IRUA 2RD0A 4CT4A 2XEVA 3GZ1A 2YNQA 3TWRA 3RO3A 2Y4TA 4JL0A 1Z3YA 2DZNA 4F6RD 1E96B 2I2OA 2L9BA 3CHQA 3FTWA 3V2OA 3KSQA 4LNBA 4JXTA 4HI8A 3RIBA 3FU3A 4L1BA 4LSZE 1QZ2A 2VTBA 3UINC 3UI2A 4GCOA 1S63A 1OCOE 4YDYA 1SZAA 5BV1A 2NSZA 3ZYLA 5AJLA 4DX6D 4I2ZA 4QQIA 1TJFA 3AS5A 2R17C 4U0SA 4U8VD 4APFA 4Y6CA 5T8IA 4LG6A 2UY1B 4LCTA 2BKKB 1X5BA 3V31A 4HRMB 2CHXA 3UT7A 3JQ0A 3FUDA 4GTMA 3TL5A 3UIPC 2XQ0A 3EIJA 5D0OD 5KNGA 2IO2C 2FO7A 2I9CA 3FUNA 3HXBA 2IU1A 2VTBB 4GTSA 1KPSB 4ABNA 5JA4D 5CMYA 3KS2A 3L54A 4DI4A 4DK5A 2JLBA 3JUIA 4UWFA 1S70B 4YDOA 2J49A 3VLFA 2QYUA 3UXGA 1GW6A 4ZHBA 2IFUA 5CCLA 3ZGQA 2B6CA 3NF1A 3EU5A 1U3DA 4NIKA 4A1GA 3ML8A 2F8YA 3MA5A 1SZ9A 3DBSA 5ANLA 2L6JA 2LXLA 3HRAA 1TN7A 3IEGA 4EHMA 5AENA 3DSSA 4F7AA 4DLOA 3Q9NC 3QWVA 2R5SA 4U8HA 3R9MA 3ZEFA 3FTSA 4LNUD 2LAHA 4DI3A 4B0ZA 5CEDB 4XI0A 5ENQD 3QAQA 3C3RA 3CHSA 2WXNA 1TEZA 4N5CA 2IONA 2DYSE 2BTDA 2XZDG 3CR3A 1N11A 2GGFA 1MX4A 3JUEA 2PM6A 3ZVVA 2LO6A 4U8YD 1OWOA 4AXHA 3FHEA 4BTBA 4HRLA 5AQ7A 3URZA 3PUJA 5J90A 3ENEA 4N39A 4GYOA 5KJMA 3LVRE 4WNGA 3ASGA 1UN8A 3RAUA 3RJVA 4JW1A 5FTPA 2XGSA 3SFXA 3GZSA 5JJ6A 2F37A 5G04C 5IY5E 3SBSA 4BWRA 3AS4A 4BSZB 4CEMA 5CRVA 4BT8A 3CIAA 4H7XA 3PE3A 3UKUG 1H6OA 3Q75A 1JWGA 3DPYA 3PRZA 1MX2A 4KT6B 2DZOA 2VYIA 3SO8A 1TNOA 1QYMA 3C98A 5JHAA 5HI7A 3EU9A 5AQAA 1IHGA 1DCEA 4DX5D 2X6IA 4ATGA 4WAFA 1AWCB 2JEKA 4LERA 2XCCA 3SGHA 2QY7A 4FP7A 1ELRA 2ZU6B 4N3AA 3PZDA 4FC8A 5BXOA 1JCRA 4ANWA 2Y69E 3RU0A 4N2SA 2CFUA 4GPKA 4C0EA 1HXIA 3NOGD 4W9RA 1OT8A 2QZAA 3QC1A 5CBOA 3PREA 3S7BA 5FWQA 3RO2A 3FP3A 4HXIA 4JHRA 3UTMA 3OAWA 5AJDA 5A7DB 3L17A 3O48A 3L22A 4GAAA 3F6QA 4K0RA
chains in the Genus database with same CATH topology
5ARFA 5KJKA 3FEYA 1FVFA 2WXPA 1HX8A 2GW1A 4WWOA 2I1JA 2WXMA 2J07A 2KZTB 4FU3A 3FDHA 3I5PA 1H0AA 4TV3A 5ENNA 4CDMA 2C0MA 3CLJA 3BG1B 4MKTA 3NQPA 2WXJA 3ASHA 3PE4A 5JHBA 3CHMA 1E7UA 3LJ3A 4XKBA 1B89A 2IOSA 2GRMA 4FULA 5J08A 1WAO1 2WXFA 2XGOA 2DIWA 3OXGA 2RG8A 3Q49B 4FJYA 4G1TA 5G2NA 3TXNA 3UUXA 4PUCA 5LP0A 3HDXA 1PC2A 3FFLA 3B7UX 3ULQA 1QNFA 3K9IA 4PS3A 3B13A 1UJKA 4U04A 5CMWA 1H6KA 3ONKA 3LEWA 3D9OA 4GMLA 5KJNA 3G2WA 4MS6A 2UWJG 3QWWA 1P5QA 4XI9A 4ANUA 3CSFA 1XGWA 4OVUA 4L2LA 4JVSA 4XKCA 2MHKA 2WXOA 3QJZA 5C1DA 3ML9A 3TAXA 1OUVA 2I6HA 3LKUA 4BY6A 2HR2A 4AY5A 3FUEA 2AXZA 4WUYA 3APDA 4NRHB 4PDXA 3RRNB 1OWNA 5D0QD 3CVLA 1L5JA 4TUUA 4CGVA 4JA9A 3CVUA 4B89A 1EDUA 4CCAA 3G2VA 2QFCA 1ZU2A 2Y4UA 2LNIA 2FF4A 2YHCA 4NACA 4ACKA 3PEUB 3ZHEA 3VLEA 2X6HA 3EHNA 4DPRA 2Y3AA 2AXVA 4LUNU 5LCWC 4I6JA 3WXXA 4FHKA 1QQEA 2FBNA 5FZRA 4GZ3A 5EKQD 3QWPA 4I2WA 3MKQA 4P29A 4UQYA 2KCKA 4UQZA 4UWHA 3B7TA 4PS8A 1NP7A 3PNTB 4MRUA 2WXGA 4KVMA 3SNXA 4EZLA 5LCWJ 2KCVA 2DBAA 4B94A 3VTYA 3R7QA 1HG2A 4E6HA 1HH8A 1JUQA 4M3OA 4CGWA 3ESKA 3GW4A 4ILHB 3ZPJA 4JEUA 5M72A 3JCKC 4BX9A 4UWLA 3RRUA 3CVNA 3FH8A 4O6FA 3T5VA 4GMJA 1DNPA 3CK8A 3LY8A 4APOA 2KC7A 2NC9A 3ESLA 3D9MA 3IV0A 2UY1A 3ONLA 5DBKA 2OOEA 3FTYA 3SI5A 3PNLB 3CQCB 2J08A 3JYSA 1H2TC 4JZYA 4UI9C 4XZ4A 3CK9A 3CVVA 2X3MA 4IRUA 2RD0A 4CT4A 4EZKA 5FQ6A 3PS6A 4N3BA 4FHJA 4KZCA 5BNWA 3FH5A 2XEVA 3GZ1A 2R59A 2YNQA 3RO3A 2AXUA 2Y4TA 2VGYA 4JL0A 4R7LA 1Z3YA 3IBEA 4L23A 4F1SA 5E76A 1ELKA 4ILIA 5T4YA 4URKA 1E96B 2I2OA 3FH7A 1OWPA 3L16A 3PDNA 4C9BB 2IOLA 2L9BA 2Q7FA 3CHQA 3FU5A 3CVYA 1WM5A 3FTWA 4C0MA 2VSYA 2E0IA 3LCAA 4PS7A 3SF4A 1IYGA 3L13A 3TGOA 3RKVA 3IHVA 5LFAA 3AU5A 4JXTA 1HFAA 3D9LA 3RIBA 4KMOA 3FU3A 3ZHEB 4L1BA 5AYWD 5BT1A 2IJGX 1QZ2A 2A4ZA 2VTBA 5LOZA 4KBQA 5FT9A 3NZUA 4B8AA 4GCOA 3S7JA 4AP2A 5KCMA 3MKQB 3FUIA 3HYMB 5CHEE 2PL2A 2MRIA 1KLXA 2J4BA 1SZAA 1H2UA 4KXKB 5BV1A 2NSZA 4V3IA 3ZYLA 5AJLA 4I2ZA 3LVQE 3FUKA 3Q15A 4Q94A 4WNFA 3ZN3A 3G2TA 4YVQC 5G55A 3T8MA 1TJFA 3AS5A 2R17C 3ASFA 4U0SA 3ZRHA 2ILRA 5BW8C 3R7RA 1HS6A 1E90A 3MJWA 4APFA 4J8EA 4Y6CA 1HZ4A 2CHZA 4XX5A 5T8IA 2UY1B 4LCTA 2PQRA 1UJJA 1H19A 2WXRA 1X5BA 3UQ3A 5E75A 2L0IA 3ZW3A 2XGMA 4GA2A 2CG3A 5EX0A 4HS2A 2VJ8A 4N3CA 3MV3B 2CHXA 3UT7A 4L7TA 3JQ0A 4MLPA 3P1UA 1Y6IA 4HFGA 4IN3B 3LY7A 3MCXA 3FUDA 1EPUA 2P58C 4CDRA 3TL5A 4EQFA 2PM7A 2XQ0A 3EIJA 1KT0A 4G26A 3PH0C 5D0OD 3CV0A 3IHYA 2VGXA 3FULA 4BX8A 2FO7A 2I9CA 3FUNA 5A6CA 2HM8A 1BPOA 4OVVA 2PZIA 2BUGA 2IU1A 3U4TA 2VTBB 4DLQA 1W3BA 1HU3A 3FU6A 3MV2B 4G24A 4UQXA 4EBAA 3LS8A 3ZYQA 4ABNA 2FI7A 4UWKA 1OWLA 4I1MA 5FQ8A 2LSVA 4G25A 3EIQC 2WXIA 5EDSA 4GZ6A 5CMYA 5DIZA 3Q5MA 4GZCA 3KS2A 3L54A 4DI4A 4DK5A 3GYZA 5BV0A 1N52A 2JLBA 4ACLA 3JUIA 4XIFA 3E4BA 3BEEA 4UWFA 3S2AA 5KJLA 4I6GA 3GZ2A 5ANRA 3U3WA 3IKOB 5FZQA 1PAQA 4KYOB 2XPIA 1A17A 1OWMA 3ZYKA 2VSOE 2J49A 3CVQA 3VLFA 3JQ1A 4F53A 3ZFWA 2EQXA 3FUFA 3CQGB 4GA0A 1GW6A 1YA0A 2WQ7A 5EX3A 2A5UA 2IFUA 5CCLA 3OTNA 1NZNA 3ZGQA 3KAEA 5BPPA 4GYYA 3UX4A 1JWFA 3SFZA 3NF1A 3UMVA 4L2YA 1U3DA 4Y6WA 4AVXA 4A1GA 3G2UA 4KZ0A 3PUKA 2WMNA 4J8SA 3ML8A 3APFA 3UT8A 3MA5A 1SZ9A 3FEXA 3CHRA 4NURA 3QDNA 4A55A 4HOUA 3DBSA 5ANLA 2L6JA 2E2EA 2IF4A 3IEGA 2X38A 2VGXB 4H7YA 4E85A 3CK7A 5AENA 4F7AA 3HVEA 4DLOA 3D9NA 4CDNA 1UN9A 5CCMA 3BG0B 3QWVA 2R5SA 4LEUA 3U64A 2J4DA 2GRLA 3RRMB 3HIZA 4U8HA 2WM9A 3MZLB 3O4ZA 2VSXE 2KM4A 3ZEFA 3FTSA 3Q47B 3FTXA 2YHEA 4I9CA 3VLDA 2LAHA 2XCBA 4CT0A 4DI3A 4B0ZA 4KVOA 4J0UA 1N54A 4JHJA 2OVBA 4TRQA 2I1KA 4FADA 1HG5A 3AS8A 4XI0A 3TG5A 4I1AA 4AEZC 3QAQA 4HOSA 4JC8A 3CHSA 1EF1C 2M63A 3DPDA 5FZSA 2WXNA 1TEZA 2V4LA 4FJZA 4PH4B 3MYVA 3S7FA 2YQ8A 3QARA 2IONA 4N5CA 2WXKA 4N2QA 2BTDA 3S7DA 3CR3A 1KT1A 4K03A 2GGFA 2LSUA 5G05C 3B7SA 4WWNA 4GZDA 2PM6A 3UT4A 2KATA 3ZVVA 2LO6A 1OWOA 4HVBA 1Y8MA 3CHPA 4ILGA 4AXHA 3FHEA 2V0PA 1E7VA 1UG3A 3ZYMA 4ANVA 4AIFA 3KD7A 4BTBA 2HYZA 1FCHA 3FUMA 1U3CA 5G05J 1LF8A 4OYSA 3TXMA 2J09A 3CVXA 2HO1A 1E8ZA 2WQ6A 5C2YA 3URZA 3PUJA 3CEQA 3PEVB 3L6AA 4AV7A 3FTVA 5J90A 5FQ7A 3TJPA 4EBAG 3ENEA 3EDTB 3D9KA 4N39A 2WVIA 3OXLA 4U0UA 3HVEB 4GYOA 3CHOA 3U9WA 3U66A 1UW4B 2WQHA 2XHEA 4I1OB 4B8CB 4GB9A 5KJMA 3LVRE 1XNFA 2XPYA 3APCA 1MHQA 4WNGA 3QB2A 4RVBA 1PY1A 3ASGA 3D9JA 3QK0A 4Q96A 1VDYA 4U0ZA 1UN8A 3RJVA 4JW1A 2XRZA 1ZBPA 5FTPA 1SQMA 2V5FA 2MOWA 2ONDA 2XGSA 3CGHA 4RSYA 2XPZA 4EZJA 3GZSA 4JPSA 4FA6A 5A23A 4IULA 3FUHA 3RK6A 3CVPA 5JJ6A 4WNDA 1HE8A 5G04C 3FY4A 3VTXA 4AJWA 3SD5A 1E8WA 3SBSA 2LAIA 4BWRA 3AS4A 3I4GA 4CEMA 2J9QA 4J8FA 2OVFA 4A1SA 4BT8A 3CIAA 1Z3XA 4HOQA 2V8SE 3LYAA 3ZIMA 5HQ8A 5G04J 2AWIA 2X6KA 3B7RL 2AVPA 4H7XA 3PE3A 2WB2A 4A3TA 4EPZA 1WY6A 1JWGA 4Q69A 1FVHA 3CKCA 3R9AB 1H2VC 3EJNA 3UPVA 3SBTB 2FEZA 2XRYA 3I4RB 2L0TB 4D10C 5JJTA 4GZ5A 2BF0X 4WNEA 2X6FA 1HO8A 3P2BA 1E8XA 3PRZA 1HF8A 4GU5A 4XE0A 4HLEA 2WMOA 3MKRA 4KT6B 3QNKA 3TG4A 5FJYA 1JPLA 2VYIA 4HORA 4QFVA 4RG6A 3C98A 2WXQA 4AM9A 5JHAA 3NZSA 5HI7A 4DJAA 1S0PA 5JJ7A 5BUZA 4F3VA 2WPVA 4I43A 2C0LA 3OXFA 3CVWA 3SHFA 3I3NA 4HOTA 4ME2A 3ASDA 1IHGA 3KEZA 3N71A 4ANXA 3HHMA 4J8DA 3FWVA 4WWPA 2X6IA 3QKYA 3T5XA 4ATGA 4WAFA 2JEKA 4U07A 4LERA 1MQSA 2WXLA 4BTAA 2XCCA 3SGHA 5LX8A 2QY7A 2KZTA 1ELRA 3D3MA 4FP7A 4CRWA 2ZU6B 3LPZA 4N3AA 3FUJA 4U63A 4UI9K 4EECA 1DVPA 3CKBA 3LXUX 3PZDA 1EYHA 2WXHA 4FC8A 2C2LA 3G2SA 1NA0A 1NA3A 3MX3A 4YVOA 4JHKA 4JEHA 3MGBA 4A3VA 4J6IA 4I17A 4UWGA 3FU0A 4ANWA 4IYPA 3PVLA 3LY9A 3FTZA 4UI9J 2X6JA 4G2VA 1Z6TA 2CHWA 1ELWA 3RU0A 4I9EA 2AW6A 4N2SA 4BFRA 2NXPA 4G11A 4LRZA 5ARGA 2CFUA 4AY6A 2KCLA 3D9PA 4FLBA 4GYWA 4G23A 1E8YA 2YINA 4GPKA 4BT9A 4AOFA 4C0EA 3MEKA 1HXIA 5T3RA 4W9RA 2FULA 1TJCA 4JA7A 3L08A 4FLHA 4GA1A 3QC1A 2VSNA 5AIJA 3PREA 3S7BA 4BSXA 5FWQA 3RO2A 2CG2A 1IQRA 2IQCA 4YNDA 2VQ2A 3Q4AB 3ZXSA 3FP3A 4HXIA 4I6EA 2CFZA 2PQNA 4JHRA 3LDZA 3OAWA 2DCPA 5FQ4A 5AJDA 1IQUA 3SZ7A 3AU4A 5A7DB 3D9IA 3FTUA 3QOUA 4NQ0A 3L17A 3EHMA 3O48A 3L22A 3CSTA 4GCNA 4GAAA 1INZA 4RG9A 2OV8A 4K0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ARF A;  5KJK A;  2GW1 A;  2C0M A;  3ASH A;  3PE4 A;  1B89 A;  1WAO 1;  2XGO A;  3OXG A;  3Q49 B;  4G1T A;  3UUX A;  1PC2 A;  3FFL A;  3ULQ A;  3K9I A;  4U04 A;  5KJN A;  2UWJ G;  3QWW A;  1P5Q A;  4XI9 A;  2MHK A;  5C1D A;  3TAX A;  1OUV A;  2I6H A;  3LKU A;  2HR2 A;  4AY5 A;  4WUY A;  4NRH B;  5D0Q D;  3CVL A;  4CGV A;  4JA9 A;  2QFC A;  1ZU2 A;  2Y4U A;  2LNI A;  2FF4 A;  2YHC A;  3ZHE A;  5LCW C;  3WXX A;  1QQE A;  2FBN A;  5FZR A;  4GZ3 A;  5EKQ D;  3QWP A;  4I2W A;  4UQY A;  2KCK A;  4UQZ A;  5LCW J;  2KCV A;  2DBA A;  4B94 A;  3VTY A;  4CGW A;  1HH8 A;  3ESK A;  3GW4 A;  3ZPJ A;  5M72 A;  3CVN A;  4O6F A;  3CK8 A;  3LY8 A;  4APO A;  2KC7 A;  2NC9 A;  2UY1 A;  5DBK A;  2OOE A;  3JYS A;  4UI9 C;  3CK9 A;  4N3B A;  2XEV A;  3GZ1 A;  3RO3 A;  2Y4T A;  2VGY A;  4JL0 A;  1E96 B;  3PDN A;  2Q7F A;  1WM5 A;  2VSY A;  3LCA A;  3SF4 A;  1IYG A;  3TGO A;  3RKV A;  3RIB A;  3ZHE B;  5AYW D;  5BT1 A;  1QZ2 A;  4KBQ A;  5FT9 A;  4GCO A;  3S7J A;  3HYM B;  5CHE E;  2PL2 A;  1KLX A;  4KXK B;  4I2Z A;  3Q15 A;  4WNF A;  3ZN3 A;  4YVQ C;  3AS5 A;  3ASF A;  4U0S A;  5BW8 C;  4J8E A;  4Y6C A;  1HZ4 A;  2UY1 B;  2PQR A;  3UQ3 A;  2XGM A;  4GA2 A;  5EX0 A;  4N3C A;  3MV3 B;  4IN3 B;  3LY7 A;  2P58 C;  4CDR A;  4EQF A;  1KT0 A;  4G26 A;  5D0O D;  3CV0 A;  2VGX A;  2FO7 A;  5A6C A;  2PZI A;  2BUG A;  3U4T A;  1W3B A;  3MV2 B;  4G24 A;  4UQX A;  4ABN A;  2FI7 A;  2LSV A;  4G25 A;  4GZ6 A;  5DIZ A;  3Q5M A;  3KS2 A;  3GYZ A;  2JLB A;  4XIF A;  3E4B A;  3BEE A;  5KJL A;  3GZ2 A;  3U3W A;  5FZQ A;  4KYO B;  2XPI A;  1A17 A;  3CVQ A;  3ZFW A;  4GA0 A;  1YA0 A;  5EX3 A;  2IFU A;  5CCL A;  1NZN A;  3ZGQ A;  3KAE A;  4GYY A;  3NF1 A;  4Y6W A;  3MA5 A;  3QDN A;  4HOU A;  2L6J A;  2E2E A;  2IF4 A;  3IEG A;  2VGX B;  4H7Y A;  3CK7 A;  5CCM A;  3QWV A;  2R5S A;  4LEU A;  3Q47 B;  4I9C A;  2XCB A;  4J0U A;  3AS8 A;  4XI0 A;  3TG5 A;  4I1A A;  4HOS A;  5FZS A;  3S7F A;  2YQ8 A;  4N5C A;  4N2Q A;  3S7D A;  1KT1 A;  2LSU A;  5G05 C;  2KAT A;  1Y8M A;  4AIF A;  3KD7 A;  4BTB A;  2HYZ A;  1FCH A;  5G05 J;  2HO1 A;  3URZ A;  3CEQ A;  3EDT B;  4N39 A;  3OXL A;  4U0U A;  4GYO A;  2WQH A;  5KJM A;  1XNF A;  4WNG A;  3ASG A;  4U0Z A;  3RJV A;  1ZBP A;  5FTP A;  5BNW A;  2V5F A;  2OND A;  2XGS A;  3CVP A;  5JJ6 A;  4WND A;  5G04 C;  3VTX A;  4BWR A;  3AS4 A;  2J9Q A;  4J8F A;  4A1S A;  4BT8 A;  4HOQ A;  3LYA A;  5HQ8 A;  5G04 J;  2AVP A;  4H7X A;  3PE3 A;  3CKC A;  3R9A B;  3UPV A;  2FEZ A;  5JJT A;  4GZ5 A;  4WNE A;  3MKR A;  3TG4 A;  5FJY A;  2VYI A;  4HOR A;  4RG6 A;  4AM9 A;  5HI7 A;  5JJ7 A;  4F3V A;  2WPV A;  2C0L A;  3OXF A;  4HOT A;  4ME2 A;  3ASD A;  1IHG A;  3N71 A;  4J8D A;  3FWV A;  3QKY A;  4U07 A;  4BTA A;  2XCC A;  1ELR A;  3LPZ A;  4N3A A;  4UI9 K;  3CKB A;  2C2L A;  1NA0 A;  1NA3 A;  4YVO A;  4I17 A;  3LY9 A;  4UI9 J;  4G2V A;  1ELW A;  3RU0 A;  4I9E A;  4N2S A;  5ARG A;  4AY6 A;  2KCL A;  4GYW A;  4G23 A;  4GPK A;  4BT9 A;  3MEK A;  1HXI A;  4W9R A;  1TJC A;  4JA7 A;  4GA1 A;  2VSN A;  3S7B A;  3RO2 A;  4YND A;  2VQ2 A;  3Q4A B;  3FP3 A;  4JHR A;  2PQN A;  3SZ7 A;  5A7D B;  3QOU A;  4NQ0 A;  3O48 A;  4GCN A;  4RG9 A; 
#chains in the Genus database with same CATH topology
 5KJK A;  2I1J A;  4RQI A;  2WXM A;  5EYP F;  5JHB A;  3LJ3 A;  4XKB A;  5J08 A;  3DWL G;  1PC2 A;  3B7U X;  3ULQ A;  2H6F A;  1H6K A;  1OY3 D;  4GMR A;  3ZU7 B;  4XI9 A;  3CSF A;  3PZ1 A;  4OVU A;  4XKC A;  2MHK A;  3ML9 A;  1MX6 A;  2I6H A;  4WUY A;  2P9I G;  2GRR B;  3CVL A;  1L5J A;  4JA9 A;  4CCA A;  2LNI A;  1TNB A;  2Y3A A;  2AXV A;  2JAB A;  5LCW C;  4I6J A;  2FBN A;  2GRN B;  4GZ3 A;  4I2W A;  4PS8 A;  1BI8 B;  1NP7 A;  4EZL A;  2WXG A;  1HH8 A;  3RRU A;  3LY8 A;  2KC7 A;  3ESL A;  3AG2 E;  3ONL A;  3FTY A;  3SI5 A;  3PNL B;  4F1P A;  3TWV A;  2RFA A;  5CEC B;  4N3B A;  2VGY A;  4F1S A;  4ILI A;  4URK A;  3V2X A;  1WG0 A;  3PDN A;  3ASO E;  4O60 A;  1WM5 A;  2VSY A;  3LCA A;  4PS7 A;  3L13 A;  1FPP A;  1TN8 A;  3TGO A;  5LFA A;  5AYW D;  5CER B;  2IJG X;  2A4Z A;  3ZUV B;  3TWT A;  4B8A A;  3S7J A;  3HYM B;  2PL2 A;  1H2U A;  4V3I A;  2R05 A;  3FUK A;  3Q15 A;  2EIK E;  4CYM D;  4DRX E;  2ILR A;  3R7R A;  3ISM C;  1TR4 A;  1HS6 A;  1E90 A;  4XX5 A;  2CHZ A;  2PQR A;  3C3O A;  5EX0 A;  2VJ8 A;  3EHR A;  1Y6I A;  4CZ2 D;  3LY7 A;  4HB5 A;  3NB2 A;  4CDR A;  2PM7 A;  5EIL A;  3IHY A;  3FUL A;  4BX8 A;  5ENP D;  4UUC A;  3PZ3 A;  4DLQ A;  1HU3 A;  4EBA A;  5JMN D;  2FI7 A;  3AG4 E;  5CEA A;  4G25 A;  5DIZ A;  5BV0 A;  4XIF A;  3BEE A;  3S2A A;  3SQV A;  3C72 A;  2HE0 A;  4I6G A;  5ANR A;  3U3W A;  5ENS D;  5FZQ A;  4F53 A;  3UM3 A;  2EQX A;  4GA0 A;  3X2Q E;  2WQ7 A;  2A5U A;  3OTN A;  5BPP A;  2XS8 A;  2P9U G;  2V5Q C;  2WMN A;  2NYJ A;  3APF A;  3FEX A;  1N4R A;  3QDN A;  2E2E A;  1YMP A;  4H7Y A;  4E85 A;  3CK7 A;  3C5R A;  3HVE A;  3D9N A;  5CCM A;  4LEU A;  3U64 A;  3RRM B;  2P9S G;  3MZL B;  2VSX E;  1OCR E;  2KM4 A;  4GTO A;  3FTX A;  3PZ4 A;  3UKR G;  4CT0 A;  3DRA A;  3E30 A;  4TRQ A;  2I1K A;  4FAD A;  3DPD A;  5FZS A;  4PH4 B;  3MYV A;  2YQ8 A;  1KT1 A;  2LSU A;  4WWN A;  4GTT A;  3CHP A;  1E7V A;  4ANV A;  4AIF A;  3LJN A;  1FCH A;  5G05 J;  3TXM A;  2HO1 A;  1E8Z A;  3HXC A;  1MJ0 A;  3CEQ A;  3PEV B;  3TJP A;  4EBA G;  3D9K A;  2WVI A;  3OXL A;  5EID A;  3HVE B;  3U9W A;  3U66 A;  2PNN A;  2XHE A;  4I1O B;  4B8C B;  2XPY A;  1MHQ A;  3QB2 A;  4Q96 A;  4DX7 D;  1YYH A;  2XRZ A;  5BNW A;  4IUL A;  4L9P A;  2VGE A;  4WND A;  1HE8 A;  2P2C P;  3FY4 A;  3VTX A;  4AJW A;  3I4G A;  4U95 D;  1OCC E;  4A1S A;  3UM1 A;  4HOQ A;  2V8S E;  3LYA A;  2X6K A;  3B7R L;  2AVP A;  2WB2 A;  3Q78 A;  4A3T A;  1FVH A;  3CKC A;  3SBT B;  4U96 D;  3I4R B;  3W9F A;  2L0T B;  4D10 C;  2R03 A;  4WNE A;  4J8Y A;  1HO8 A;  4GU5 A;  4HLE A;  1TNU A;  4QFV A;  4RG6 A;  3B95 A;  4F3V A;  3CVW A;  1D8D A;  3ABL E;  4ME2 A;  1ZB1 A;  3ASD A;  3N71 A;  3J5P A;  3HHM A;  4J8D A;  3QKY A;  3T5X A;  2DYR E;  1D9S A;  2WXL A;  4MBG A;  1DC2 A;  4CRW A;  4U63 A;  4EEC A;  1Q2Z A;  3CKB A;  1EYH A;  2C2L A;  3G2S A;  2H6I A;  5B1B E;  3MX3 A;  4JHK A;  3MGB A;  4J6I A;  4BES A;  2P9K G;  4IYP A;  3LY9 A;  2CHW A;  2AW6 A;  4BFR A;  4LRZ A;  3D9P A;  4FLB A;  1TYQ G;  3DEO A;  1E8Y A;  2YIN A;  4BT9 A;  4AOF A;  5HRY A;  1TJC A;  4JA7 A;  4GA1 A;  2CG2 A;  2EIN E;  2VQ2 A;  3ZXS A;  3LDZ A;  5FQ4 A;  1IQU A;  2V4H C;  3FTU A;  4NQ0 A;  1INZ A;  2WXP A;  3AAA C;  2J07 A;  2ETC A;  1BU9 A;  3I5P A;  4CDM A;  4MKT A;  3CLJ A;  3BG1 B;  2XEH A;  3PE4 A;  3CHM A;  1K8K G;  3OXG A;  2RG8 A;  3TXN A;  1JCS A;  4PUC A;  5LP0 A;  2QYJ A;  3FFL A;  1UJK A;  3LEW A;  3D9O A;  3L82 A;  4HRN A;  5KJN A;  3UM0 A;  1XGW A;  5EN5 D;  2WXO A;  2RKK A;  3QJZ A;  2J8S D;  5H7P A;  3TAX A;  4B93 B;  4K5C A;  4NRH B;  4PDX A;  4Z68 A;  4CGV A;  2Y4U A;  2X6H A;  4GTV A;  1O5M A;  2EIL E;  3MKQ A;  3T8K A;  4HLL A;  4UQZ A;  3SNX A;  3DSU A;  4CGW A;  4M3O A;  4K5B A;  2Y0B G;  4ILH B;  4JEU A;  2OCC E;  3JCK C;  4BX9 A;  1RW2 A;  4ZFH A;  5DBK A;  2OOE A;  2GRO B;  2J08 A;  2Y1L E;  1H2T C;  4XZ4 A;  1NL4 A;  3CVV A;  4EZK A;  5FQ6 A;  5CRU A;  3PS6 A;  4KZC A;  3FH5 A;  2AXU A;  4R7L A;  4L23 A;  3EHQ A;  4BET A;  5E76 A;  1ELK A;  5T4Y A;  1JCQ A;  1FT2 A;  3FH7 A;  1OWP A;  4C9B B;  3CVY A;  3SF4 A;  1IYG A;  5B1A E;  3RKV A;  3IHV A;  1HFA A;  1O1T A;  3D9L A;  4KMO A;  5BT1 A;  3V30 A;  5LOZ A;  4KBQ A;  2ZIR A;  3NZU A;  4HBD A;  3TWW A;  5KCM A;  3MKQ B;  3FUI A;  5CHE E;  2OEV A;  2J4B A;  4A63 B;  4KXK B;  5EYL A;  3LVQ E;  3E32 A;  4Q94 A;  3ZN3 A;  4YVQ C;  5G55 A;  2R2L A;  1UOH A;  2XEE A;  3ASF A;  3MJW A;  1HZ4 A;  2F8X K;  1UJJ A;  1H19 A;  3HXF A;  2WXR A;  3UQ3 A;  5E75 A;  3ZW3 A;  2XGM A;  4GA2 A;  2CG3 A;  4HS2 A;  4N3C A;  3MV3 B;  4MLP A;  2KBX A;  4G8L A;  1EPU A;  2P58 C;  1OCZ E;  4EQF A;  4G26 A;  1K1A A;  5A6C A;  2HM8 A;  4OVV A;  2BUG A;  1W3B A;  3MV2 B;  4G24 A;  4UQX A;  4TXQ A;  1OWL A;  4I1M A;  5FQ8 A;  3EIQ C;  2WXI A;  4GZ6 A;  4ACL A;  5FIO A;  3E4B A;  3J5Q B;  3IKO B;  1PAQ A;  2XPI A;  1OWM A;  1BLX B;  3FUF A;  3CQG B;  1YA0 A;  1TNY A;  3KAE A;  4GYY A;  3UX4 A;  1JWF A;  3SFZ A;  3UMV A;  4L2Y A;  4Y6W A;  3TWX A;  4AVX A;  4KZ0 A;  3PUK A;  4A55 A;  4HOU A;  2H6H A;  3DSW A;  2IEJ A;  2X38 A;  4CDN A;  3BG0 B;  2GRL A;  2WM9 A;  2KXP C;  3O4Z A;  4U7E B;  3Q47 B;  3VLD A;  4J0U A;  3V79 K;  1N54 A;  1HG5 A;  3AS8 A;  3TG5 A;  4I1A A;  4AEZ C;  1AP7 A;  1O1S A;  4HOS A;  4JC8 A;  1EF1 C;  2M63 A;  2V4L A;  4FJZ A;  1N9A A;  1N94 A;  3S7F A;  2WXK A;  3S7D A;  3W9G A;  4K03 A;  3UT4 A;  3B7S A;  4GZD A;  2KAT A;  1Y8M A;  5B3S E;  1UG3 A;  3ZYM A;  4GPM A;  2ETB A;  1U3C A;  1LF8 A;  2LXM A;  1U2V G;  1N0Q A;  2J09 A;  3CVX A;  5HS0 A;  5C2Y A;  3L6A A;  4AV7 A;  3EDT B;  4U0U A;  1UW4 B;  3B7B A;  4TXR A;  1XNF A;  2H6G A;  4RVB A;  3D9J A;  4U0Z A;  3CGH A;  3FUH A;  5ENT D;  3RK6 A;  5EIB E;  3CVP A;  3ZXP A;  1E8W A;  2LAI A;  2J9Q A;  1X81 A;  3KEA A;  5HQ8 A;  5G04 J;  2AWI A;  2FO1 E;  3Q9U C;  3HXD A;  1WY6 A;  4Q69 A;  3UPV A;  2FEZ A;  1SA4 A;  4GZ5 A;  2BF0 X;  3P2B A;  1E8X A;  2WMO A;  3MKR A;  5AAO A;  5FJY A;  1JPL A;  2DWZ A;  3NZS A;  4DJA A;  5JJ7 A;  5BUZ A;  3ABM E;  2WPV A;  4I43 A;  2C0L A;  3SHF A;  5AQ9 A;  4HOT A;  3FWV A;  1IHB A;  4BEP A;  3RSE G;  1MQS A;  5LX8 A;  1LD7 A;  2KZT A;  3D3M A;  3LPZ A;  3C3Q A;  1DVP A;  4K5A B;  2WXH A;  2BED A;  1NA0 A;  4JEH A;  4A3V A;  1KZP A;  4I17 A;  4UWG A;  2ZGG A;  3PVL A;  2X6J A;  1Z6T A;  1ELW A;  2NXP A;  5ARG A;  4JD2 G;  3NAW A;  4AY6 A;  1N4P A;  4O1O A;  3UIO C;  3MEK A;  3EUV A;  5T3R A;  4FLH A;  2VSN A;  2EIM E;  1IQR A;  2IO3 C;  2L6B A;  4I6E A;  3SZ7 A;  4JB8 P;  3DXM G;  4GTQ A;  2IY0 C;  3AU4 A;  3D9I A;  3QOU A;  3ULY A;  4GCN A;  4UWK A;  4RG9 A;  1FVF A;  3AG1 E;  4WWO A;  4HQD A;  2KZT B;  2OEW A;  4TV3 A;  5ENN A;  1NI1 A;  1B89 A;  4FUL A;  3JXJ A;  3Q49 B;  2WXF A;  2DIW A;  4FJY A;  5G2N A;  1D8E A;  3HDX A;  1QNF A;  3K9I A;  3ONK A;  3G2W A;  2UWJ G;  3QWW A;  4L2L A;  5C1D A;  3LKU A;  5KBA A;  5AQB A;  2HR2 A;  3FUE A;  2AXZ A;  1OWN A;  5D0Q D;  4B89 A;  1QBQ A;  3G2V A;  2QFC A;  2YHC A;  3Q7A A;  3PEU B;  3ZHE A;  4XEI G;  3KSL A;  3WXX A;  4FHK A;  1QQE A;  5FZR A;  2A5E A;  3SY2 A;  2KCK A;  3B7T A;  4KVM A;  3WG7 E;  5LCW J;  3VTY A;  4E6H A;  1JUQ A;  3ZPJ A;  1Z5S C;  4UWL A;  2XEN A;  3CVN A;  4GMJ A;  4DX2 A;  4LNG A;  4APO A;  2NC9 A;  3D9M A;  3IV0 A;  5FIN A;  3JYS A;  4JZY A;  4UI9 C;  2X3M A;  4C48 B;  4FHJ A;  2R59 A;  3IBE A;  5BXU A;  4TXP A;  3L16 A;  2IOL A;  2Q7F A;  3FU5 A;  4C0M A;  5KWD A;  2E0I A;  3TWS A;  3AU5 A;  3ZHE B;  3L9T A;  3Q73 A;  5FT9 A;  2ETA A;  4AP2 A;  2MRI A;  1KLX A;  4DX1 A;  4WNF A;  3G2T A;  3T8M A;  1G3N B;  1RZ4 A;  4OAV B;  3ZRH A;  5BW8 C;  4J8E A;  1FT1 A;  3ZKJ A;  5D2M C;  3E34 A;  2L0I A;  3DXK G;  3AG3 E;  5HKP A;  4L7T A;  3P1U A;  4HFG A;  4IN3 B;  3MCX A;  1KT0 A;  3PH0 C;  1LTX A;  1OXJ A;  3CV0 A;  2VGX A;  2MYO A;  1BPO A;  3DEP A;  2PZI A;  3U4T A;  2P9N G;  3FU6 A;  3LS8 A;  3ZYQ A;  1SW6 A;  2LSV A;  5EDS A;  3Q5M A;  4GZC A;  3UM2 A;  3GYZ A;  1N52 A;  3Q7F A;  5ITZ F;  5KJL A;  3GZ2 A;  4KYO B;  1A17 A;  3ZYK A;  2VSO E;  3CVQ A;  3JQ1 A;  3ZFW A;  5EX3 A;  1NZN A;  4N5Q A;  4DUI A;  3BU8 A;  3G2U A;  4J8S A;  1DCQ A;  2LUH A;  3UT8 A;  3CHR A;  4NUR A;  2IF4 A;  2VGX B;  1UN9 A;  2B0O E;  2J4D A;  2DVW A;  3HIZ A;  1N95 A;  2R02 A;  2YHE A;  4I9C A;  1SA5 A;  2XCB A;  4KVO A;  2GRP B;  1O1R A;  3AJI A;  2OVB A;  4JHJ A;  4YDE A;  4OAU C;  3QAR A;  1YCS B;  3T9K A;  4N2Q A;  4EZJ A;  5G05 C;  4HVB A;  4ILG A;  2V0P A;  4O1P A;  3KD7 A;  2HYZ A;  3FUM A;  4OYS A;  1N4Q A;  2WQ6 A;  3D9H A;  3FTV A;  5FQ7 A;  4HI9 A;  3CHO A;  2WQH A;  2RFM A;  4GB9 A;  2XZT G;  3APC A;  3JXI A;  2F0Y A;  1IKN D;  3ZNG A;  1PY1 A;  3QK0 A;  1VDY A;  4J7W A;  1LD8 A;  1ZBP A;  1SQM A;  2V5F A;  2MOW A;  2OND A;  4FA6 A;  4RSY A;  2XPZ A;  5A23 A;  4JPS A;  1BI7 B;  3DST A;  3SD5 A;  4J8F A;  2OVF A;  1N0R A;  1IXV A;  4GTP A;  1Z3X A;  3ZIM A;  3DSV A;  3HG0 D;  4EPZ A;  3BQO A;  3R9A B;  1H2V C;  3EJN A;  2XRY A;  2BKG A;  2GRQ B;  5JJT A;  2X6F A;  4X8Q A;  5AN8 A;  1SVX A;  1HF8 A;  4XE0 A;  3TWU A;  3QNK A;  1WDY A;  3TG4 A;  4HOR A;  2WXQ A;  4AM9 A;  1S0P A;  3OXF A;  4YDW A;  2P9L G;  3I3N A;  3Q79 A;  3BUA A;  3KEZ A;  4ANX A;  4WWP A;  4U07 A;  4BTA A;  4G8K A;  3FUJ A;  4UI9 K;  3LXU X;  2AJA A;  3E37 A;  1NA3 A;  4YVO A;  5CBN A;  1TN6 A;  3NOC D;  1H6P A;  3SFY A;  3FU0 A;  4TUM A;  3FTZ A;  4UI9 J;  4G2V A;  4I9E A;  4G11 A;  2KCL A;  4GYW A;  4G23 A;  3ULE G;  2ZGD A;  2FUL A;  2QC9 A;  3L08 A;  4RLY A;  3PZ2 A;  5AIJ A;  1BD8 A;  4BSX A;  2IQC A;  4YND A;  4GTR A;  3Q4A B;  1S64 A;  2EIJ E;  2CFZ A;  2PQN A;  3ABK E;  2DCP A;  1TNZ A;  1KZO A;  5ENR D;  3DSX A;  5D66 A;  3EHM A;  3E33 A;  3CST A;  2OV8 A;  5ARF A;  3FEY A;  1HX8 A;  2GW1 A;  3NBN B;  4FU3 A;  3FDH A;  1H0A A;  2C0M A;  4HNA D;  5AAR A;  3NQP A;  2WXJ A;  3ASH A;  3TWQ A;  3ASN E;  1E7U A;  2IOS A;  2GRM A;  4M7C A;  1WAO 1;  2XGO A;  3UUX A;  4G1T A;  1V55 E;  3IXE A;  4PS3 A;  1V54 E;  3B13 A;  4U04 A;  5CMW A;  4GML A;  4MS6 A;  1A5E A;  1P5Q A;  4ANU A;  4JVS A;  2ZIS A;  1OUV A;  1MZC A;  4BY6 A;  3HXE A;  4AY5 A;  3RRN B;  3APD A;  4TUU A;  3CVU A;  1EDU A;  1ZU2 A;  4NAC A;  5ENO D;  2FF4 A;  4ACK A;  3VLE A;  3EHN A;  1MYO A;  4DPR A;  1K3Z D;  2P9P G;  4LUN U;  2XS1 A;  1K1B A;  1N4S A;  1NFI E;  5EKQ D;  3QWP A;  5KNH D;  4P29 A;  4UQY A;  4UWH A;  3PNT B;  4MRU A;  4BER A;  2KCV A;  2DBA A;  4B94 A;  3R7Q A;  1HG2 A;  3ESK A;  3GW4 A;  5M72 A;  2ZXW E;  3FH8 A;  4O6F A;  3T5V A;  1DNP A;  3CK8 A;  2UY1 A;  3CQC B;  3CK9 A;  4ATZ D;  4IRU A;  2RD0 A;  4CT4 A;  2XEV A;  3GZ1 A;  2YNQ A;  3TWR A;  3RO3 A;  2Y4T A;  4JL0 A;  1Z3Y A;  2DZN A;  4F6R D;  1E96 B;  2I2O A;  2L9B A;  3CHQ A;  3FTW A;  3V2O A;  3KSQ A;  4LNB A;  4JXT A;  4HI8 A;  3RIB A;  3FU3 A;  4L1B A;  4LSZ E;  1QZ2 A;  2VTB A;  3UIN C;  3UI2 A;  4GCO A;  1S63 A;  1OCO E;  4YDY A;  1SZA A;  5BV1 A;  2NSZ A;  3ZYL A;  5AJL A;  4DX6 D;  4I2Z A;  4QQI A;  1TJF A;  3AS5 A;  2R17 C;  4U0S A;  4U8V D;  4APF A;  4Y6C A;  5T8I A;  4LG6 A;  2UY1 B;  4LCT A;  2BKK B;  1X5B A;  3V31 A;  4HRM B;  2CHX A;  3UT7 A;  3JQ0 A;  3FUD A;  4GTM A;  3TL5 A;  3UIP C;  2XQ0 A;  3EIJ A;  5D0O D;  5KNG A;  2IO2 C;  2FO7 A;  2I9C A;  3FUN A;  3HXB A;  2IU1 A;  2VTB B;  4GTS A;  1KPS B;  4ABN A;  5JA4 D;  5CMY A;  3KS2 A;  3L54 A;  4DI4 A;  4DK5 A;  2JLB A;  3JUI A;  4UWF A;  1S70 B;  4YDO A;  2J49 A;  3VLF A;  2QYU A;  3UXG A;  1GW6 A;  4ZHB A;  2IFU A;  5CCL A;  3ZGQ A;  2B6C A;  3NF1 A;  3EU5 A;  1U3D A;  4NIK A;  4A1G A;  3ML8 A;  2F8Y A;  3MA5 A;  1SZ9 A;  3DBS A;  5ANL A;  2L6J A;  2LXL A;  3HRA A;  1TN7 A;  3IEG A;  4EHM A;  5AEN A;  3DSS A;  4F7A A;  4DLO A;  3Q9N C;  3QWV A;  2R5S A;  4U8H A;  3R9M A;  3ZEF A;  3FTS A;  4LNU D;  2LAH A;  4DI3 A;  4B0Z A;  5CED B;  4XI0 A;  5ENQ D;  3QAQ A;  3C3R A;  3CHS A;  2WXN A;  1TEZ A;  4N5C A;  2ION A;  2DYS E;  2BTD A;  2XZD G;  3CR3 A;  1N11 A;  2GGF A;  1MX4 A;  3JUE A;  2PM6 A;  3ZVV A;  2LO6 A;  4U8Y D;  1OWO A;  4AXH A;  3FHE A;  4BTB A;  4HRL A;  5AQ7 A;  3URZ A;  3PUJ A;  5J90 A;  3ENE A;  4N39 A;  4GYO A;  5KJM A;  3LVR E;  4WNG A;  3ASG A;  1UN8 A;  3RAU A;  3RJV A;  4JW1 A;  5FTP A;  2XGS A;  3SFX A;  3GZS A;  5JJ6 A;  2F37 A;  5G04 C;  5IY5 E;  3SBS A;  4BWR A;  3AS4 A;  4BSZ B;  4CEM A;  5CRV A;  4BT8 A;  3CIA A;  4H7X A;  3PE3 A;  3UKU G;  1H6O A;  3Q75 A;  1JWG A;  3DPY A;  3PRZ A;  1MX2 A;  4KT6 B;  2DZO A;  2VYI A;  3SO8 A;  1TNO A;  1QYM A;  3C98 A;  5JHA A;  5HI7 A;  3EU9 A;  5AQA A;  1IHG A;  1DCE A;  4DX5 D;  2X6I A;  4ATG A;  4WAF A;  1AWC B;  2JEK A;  4LER A;  2XCC A;  3SGH A;  2QY7 A;  4FP7 A;  1ELR A;  2ZU6 B;  4N3A A;  3PZD A;  4FC8 A;  5BXO A;  1JCR A;  4ANW A;  2Y69 E;  3RU0 A;  4N2S A;  2CFU A;  4GPK A;  4C0E A;  1HXI A;  3NOG D;  4W9R A;  1OT8 A;  2QZA A;  3QC1 A;  5CBO A;  3PRE A;  3S7B A;  5FWQ A;  3RO2 A;  3FP3 A;  4HXI A;  4JHR A;  3UTM A;  3OAW A;  5AJD A;  5A7D B;  3L17 A;  3O48 A;  3L22 A;  4GAA A;  3F6Q A;  4K0R A; 
#chains in the Genus database with same CATH homology
 5ARF A;  5KJK A;  3FEY A;  1FVF A;  2WXP A;  1HX8 A;  2GW1 A;  4WWO A;  2I1J A;  2WXM A;  2J07 A;  2KZT B;  4FU3 A;  3FDH A;  3I5P A;  1H0A A;  4TV3 A;  5ENN A;  4CDM A;  2C0M A;  3CLJ A;  3BG1 B;  4MKT A;  3NQP A;  2WXJ A;  3ASH A;  3PE4 A;  5JHB A;  3CHM A;  1E7U A;  3LJ3 A;  4XKB A;  1B89 A;  2IOS A;  2GRM A;  4FUL A;  5J08 A;  1WAO 1;  2WXF A;  2XGO A;  2DIW A;  3OXG A;  2RG8 A;  3Q49 B;  4FJY A;  4G1T A;  5G2N A;  3TXN A;  3UUX A;  4PUC A;  5LP0 A;  3HDX A;  1PC2 A;  3FFL A;  3B7U X;  3ULQ A;  1QNF A;  3K9I A;  4PS3 A;  3B13 A;  1UJK A;  4U04 A;  5CMW A;  1H6K A;  3ONK A;  3LEW A;  3D9O A;  4GML A;  5KJN A;  3G2W A;  4MS6 A;  2UWJ G;  3QWW A;  1P5Q A;  4XI9 A;  4ANU A;  3CSF A;  1XGW A;  4OVU A;  4L2L A;  4JVS A;  4XKC A;  2MHK A;  2WXO A;  3QJZ A;  5C1D A;  3ML9 A;  3TAX A;  1OUV A;  2I6H A;  3LKU A;  4BY6 A;  2HR2 A;  4AY5 A;  3FUE A;  2AXZ A;  4WUY A;  3APD A;  4NRH B;  4PDX A;  3RRN B;  1OWN A;  5D0Q D;  3CVL A;  1L5J A;  4TUU A;  4CGV A;  4JA9 A;  3CVU A;  4B89 A;  1EDU A;  4CCA A;  3G2V A;  2QFC A;  1ZU2 A;  2Y4U A;  2LNI A;  2FF4 A;  2YHC A;  4NAC A;  4ACK A;  3PEU B;  3ZHE A;  3VLE A;  2X6H A;  3EHN A;  4DPR A;  2Y3A A;  2AXV A;  4LUN U;  5LCW C;  4I6J A;  3WXX A;  4FHK A;  1QQE A;  2FBN A;  5FZR A;  4GZ3 A;  5EKQ D;  3QWP A;  4I2W A;  3MKQ A;  4P29 A;  4UQY A;  2KCK A;  4UQZ A;  4UWH A;  3B7T A;  4PS8 A;  1NP7 A;  3PNT B;  4MRU A;  2WXG A;  4KVM A;  3SNX A;  4EZL A;  5LCW J;  2KCV A;  2DBA A;  4B94 A;  3VTY A;  3R7Q A;  1HG2 A;  4E6H A;  1HH8 A;  1JUQ A;  4M3O A;  4CGW A;  3ESK A;  3GW4 A;  4ILH B;  3ZPJ A;  4JEU A;  5M72 A;  3JCK C;  4BX9 A;  4UWL A;  3RRU A;  3CVN A;  3FH8 A;  4O6F A;  3T5V A;  4GMJ A;  1DNP A;  3CK8 A;  3LY8 A;  4APO A;  2KC7 A;  2NC9 A;  3ESL A;  3D9M A;  3IV0 A;  2UY1 A;  3ONL A;  5DBK A;  2OOE A;  3FTY A;  3SI5 A;  3PNL B;  3CQC B;  2J08 A;  3JYS A;  1H2T C;  4JZY A;  4UI9 C;  4XZ4 A;  3CK9 A;  3CVV A;  2X3M A;  4IRU A;  2RD0 A;  4CT4 A;  4EZK A;  5FQ6 A;  3PS6 A;  4N3B A;  4FHJ A;  4KZC A;  5BNW A;  3FH5 A;  2XEV A;  3GZ1 A;  2R59 A;  2YNQ A;  3RO3 A;  2AXU A;  2Y4T A;  2VGY A;  4JL0 A;  4R7L A;  1Z3Y A;  3IBE A;  4L23 A;  4F1S A;  5E76 A;  1ELK A;  4ILI A;  5T4Y A;  4URK A;  1E96 B;  2I2O A;  3FH7 A;  1OWP A;  3L16 A;  3PDN A;  4C9B B;  2IOL A;  2L9B A;  2Q7F A;  3CHQ A;  3FU5 A;  3CVY A;  1WM5 A;  3FTW A;  4C0M A;  2VSY A;  2E0I A;  3LCA A;  4PS7 A;  3SF4 A;  1IYG A;  3L13 A;  3TGO A;  3RKV A;  3IHV A;  5LFA A;  3AU5 A;  4JXT A;  1HFA A;  3D9L A;  3RIB A;  4KMO A;  3FU3 A;  3ZHE B;  4L1B A;  5AYW D;  5BT1 A;  2IJG X;  1QZ2 A;  2A4Z A;  2VTB A;  5LOZ A;  4KBQ A;  5FT9 A;  3NZU A;  4B8A A;  4GCO A;  3S7J A;  4AP2 A;  5KCM A;  3MKQ B;  3FUI A;  3HYM B;  5CHE E;  2PL2 A;  2MRI A;  1KLX A;  2J4B A;  1SZA A;  1H2U A;  4KXK B;  5BV1 A;  2NSZ A;  4V3I A;  3ZYL A;  5AJL A;  4I2Z A;  3LVQ E;  3FUK A;  3Q15 A;  4Q94 A;  4WNF A;  3ZN3 A;  3G2T A;  4YVQ C;  5G55 A;  3T8M A;  1TJF A;  3AS5 A;  2R17 C;  3ASF A;  4U0S A;  3ZRH A;  2ILR A;  5BW8 C;  3R7R A;  1HS6 A;  1E90 A;  3MJW A;  4APF A;  4J8E A;  4Y6C A;  1HZ4 A;  2CHZ A;  4XX5 A;  5T8I A;  2UY1 B;  4LCT A;  2PQR A;  1UJJ A;  1H19 A;  2WXR A;  1X5B A;  3UQ3 A;  5E75 A;  2L0I A;  3ZW3 A;  2XGM A;  4GA2 A;  2CG3 A;  5EX0 A;  4HS2 A;  2VJ8 A;  4N3C A;  3MV3 B;  2CHX A;  3UT7 A;  4L7T A;  3JQ0 A;  4MLP A;  3P1U A;  1Y6I A;  4HFG A;  4IN3 B;  3LY7 A;  3MCX A;  3FUD A;  1EPU A;  2P58 C;  4CDR A;  3TL5 A;  4EQF A;  2PM7 A;  2XQ0 A;  3EIJ A;  1KT0 A;  4G26 A;  3PH0 C;  5D0O D;  3CV0 A;  3IHY A;  2VGX A;  3FUL A;  4BX8 A;  2FO7 A;  2I9C A;  3FUN A;  5A6C A;  2HM8 A;  1BPO A;  4OVV A;  2PZI A;  2BUG A;  2IU1 A;  3U4T A;  2VTB B;  4DLQ A;  1W3B A;  1HU3 A;  3FU6 A;  3MV2 B;  4G24 A;  4UQX A;  4EBA A;  3LS8 A;  3ZYQ A;  4ABN A;  2FI7 A;  4UWK A;  1OWL A;  4I1M A;  5FQ8 A;  2LSV A;  4G25 A;  3EIQ C;  2WXI A;  5EDS A;  4GZ6 A;  5CMY A;  5DIZ A;  3Q5M A;  4GZC A;  3KS2 A;  3L54 A;  4DI4 A;  4DK5 A;  3GYZ A;  5BV0 A;  1N52 A;  2JLB A;  4ACL A;  3JUI A;  4XIF A;  3E4B A;  3BEE A;  4UWF A;  3S2A A;  5KJL A;  4I6G A;  3GZ2 A;  5ANR A;  3U3W A;  3IKO B;  5FZQ A;  1PAQ A;  4KYO B;  2XPI A;  1A17 A;  1OWM A;  3ZYK A;  2VSO E;  2J49 A;  3CVQ A;  3VLF A;  3JQ1 A;  4F53 A;  3ZFW A;  2EQX A;  3FUF A;  3CQG B;  4GA0 A;  1GW6 A;  1YA0 A;  2WQ7 A;  5EX3 A;  2A5U A;  2IFU A;  5CCL A;  3OTN A;  1NZN A;  3ZGQ A;  3KAE A;  5BPP A;  4GYY A;  3UX4 A;  1JWF A;  3SFZ A;  3NF1 A;  3UMV A;  4L2Y A;  1U3D A;  4Y6W A;  4AVX A;  4A1G A;  3G2U A;  4KZ0 A;  3PUK A;  2WMN A;  4J8S A;  3ML8 A;  3APF A;  3UT8 A;  3MA5 A;  1SZ9 A;  3FEX A;  3CHR A;  4NUR A;  3QDN A;  4A55 A;  4HOU A;  3DBS A;  5ANL A;  2L6J A;  2E2E A;  2IF4 A;  3IEG A;  2X38 A;  2VGX B;  4H7Y A;  4E85 A;  3CK7 A;  5AEN A;  4F7A A;  3HVE A;  4DLO A;  3D9N A;  4CDN A;  1UN9 A;  5CCM A;  3BG0 B;  3QWV A;  2R5S A;  4LEU A;  3U64 A;  2J4D A;  2GRL A;  3RRM B;  3HIZ A;  4U8H A;  2WM9 A;  3MZL B;  3O4Z A;  2VSX E;  2KM4 A;  3ZEF A;  3FTS A;  3Q47 B;  3FTX A;  2YHE A;  4I9C A;  3VLD A;  2LAH A;  2XCB A;  4CT0 A;  4DI3 A;  4B0Z A;  4KVO A;  4J0U A;  1N54 A;  4JHJ A;  2OVB A;  4TRQ A;  2I1K A;  4FAD A;  1HG5 A;  3AS8 A;  4XI0 A;  3TG5 A;  4I1A A;  4AEZ C;  3QAQ A;  4HOS A;  4JC8 A;  3CHS A;  1EF1 C;  2M63 A;  3DPD A;  5FZS A;  2WXN A;  1TEZ A;  2V4L A;  4FJZ A;  4PH4 B;  3MYV A;  3S7F A;  2YQ8 A;  3QAR A;  2ION A;  4N5C A;  2WXK A;  4N2Q A;  2BTD A;  3S7D A;  3CR3 A;  1KT1 A;  4K03 A;  2GGF A;  2LSU A;  5G05 C;  3B7S A;  4WWN A;  4GZD A;  2PM6 A;  3UT4 A;  2KAT A;  3ZVV A;  2LO6 A;  1OWO A;  4HVB A;  1Y8M A;  3CHP A;  4ILG A;  4AXH A;  3FHE A;  2V0P A;  1E7V A;  1UG3 A;  3ZYM A;  4ANV A;  4AIF A;  3KD7 A;  4BTB A;  2HYZ A;  1FCH A;  3FUM A;  1U3C A;  5G05 J;  1LF8 A;  4OYS A;  3TXM A;  2J09 A;  3CVX A;  2HO1 A;  1E8Z A;  2WQ6 A;  5C2Y A;  3URZ A;  3PUJ A;  3CEQ A;  3PEV B;  3L6A A;  4AV7 A;  3FTV A;  5J90 A;  5FQ7 A;  3TJP A;  4EBA G;  3ENE A;  3EDT B;  3D9K A;  4N39 A;  2WVI A;  3OXL A;  4U0U A;  3HVE B;  4GYO A;  3CHO A;  3U9W A;  3U66 A;  1UW4 B;  2WQH A;  2XHE A;  4I1O B;  4B8C B;  4GB9 A;  5KJM A;  3LVR E;  1XNF A;  2XPY A;  3APC A;  1MHQ A;  4WNG A;  3QB2 A;  4RVB A;  1PY1 A;  3ASG A;  3D9J A;  3QK0 A;  4Q96 A;  1VDY A;  4U0Z A;  1UN8 A;  3RJV A;  4JW1 A;  2XRZ A;  1ZBP A;  5FTP A;  1SQM A;  2V5F A;  2MOW A;  2OND A;  2XGS A;  3CGH A;  4RSY A;  2XPZ A;  4EZJ A;  3GZS A;  4JPS A;  4FA6 A;  5A23 A;  4IUL A;  3FUH A;  3RK6 A;  3CVP A;  5JJ6 A;  4WND A;  1HE8 A;  5G04 C;  3FY4 A;  3VTX A;  4AJW A;  3SD5 A;  1E8W A;  3SBS A;  2LAI A;  4BWR A;  3AS4 A;  3I4G A;  4CEM A;  2J9Q A;  4J8F A;  2OVF A;  4A1S A;  4BT8 A;  3CIA A;  1Z3X A;  4HOQ A;  2V8S E;  3LYA A;  3ZIM A;  5HQ8 A;  5G04 J;  2AWI A;  2X6K A;  3B7R L;  2AVP A;  4H7X A;  3PE3 A;  2WB2 A;  4A3T A;  4EPZ A;  1WY6 A;  1JWG A;  4Q69 A;  1FVH A;  3CKC A;  3R9A B;  1H2V C;  3EJN A;  3UPV A;  3SBT B;  2FEZ A;  2XRY A;  3I4R B;  2L0T B;  4D10 C;  5JJT A;  4GZ5 A;  2BF0 X;  4WNE A;  2X6F A;  1HO8 A;  3P2B A;  1E8X A;  3PRZ A;  1HF8 A;  4GU5 A;  4XE0 A;  4HLE A;  2WMO A;  3MKR A;  4KT6 B;  3QNK A;  3TG4 A;  5FJY A;  1JPL A;  2VYI A;  4HOR A;  4QFV A;  4RG6 A;  3C98 A;  2WXQ A;  4AM9 A;  5JHA A;  3NZS A;  5HI7 A;  4DJA A;  1S0P A;  5JJ7 A;  5BUZ A;  4F3V A;  2WPV A;  4I43 A;  2C0L A;  3OXF A;  3CVW A;  3SHF A;  3I3N A;  4HOT A;  4ME2 A;  3ASD A;  1IHG A;  3KEZ A;  3N71 A;  4ANX A;  3HHM A;  4J8D A;  3FWV A;  4WWP A;  2X6I A;  3QKY A;  3T5X A;  4ATG A;  4WAF A;  2JEK A;  4U07 A;  4LER A;  1MQS A;  2WXL A;  4BTA A;  2XCC A;  3SGH A;  5LX8 A;  2QY7 A;  2KZT A;  1ELR A;  3D3M A;  4FP7 A;  4CRW A;  2ZU6 B;  3LPZ A;  4N3A A;  3FUJ A;  4U63 A;  4UI9 K;  4EEC A;  1DVP A;  3CKB A;  3LXU X;  3PZD A;  1EYH A;  2WXH A;  4FC8 A;  2C2L A;  3G2S A;  1NA0 A;  1NA3 A;  3MX3 A;  4YVO A;  4JHK A;  4JEH A;  3MGB A;  4A3V A;  4J6I A;  4I17 A;  4UWG A;  3FU0 A;  4ANW A;  4IYP A;  3PVL A;  3LY9 A;  3FTZ A;  4UI9 J;  2X6J A;  4G2V A;  1Z6T A;  2CHW A;  1ELW A;  3RU0 A;  4I9E A;  2AW6 A;  4N2S A;  4BFR A;  2NXP A;  4G11 A;  4LRZ A;  5ARG A;  2CFU A;  4AY6 A;  2KCL A;  3D9P A;  4FLB A;  4GYW A;  4G23 A;  1E8Y A;  2YIN A;  4GPK A;  4BT9 A;  4AOF A;  4C0E A;  3MEK A;  1HXI A;  5T3R A;  4W9R A;  2FUL A;  1TJC A;  4JA7 A;  3L08 A;  4FLH A;  4GA1 A;  3QC1 A;  2VSN A;  5AIJ A;  3PRE A;  3S7B A;  4BSX A;  5FWQ A;  3RO2 A;  2CG2 A;  1IQR A;  2IQC A;  4YND A;  2VQ2 A;  3Q4A B;  3ZXS A;  3FP3 A;  4HXI A;  4I6E A;  2CFZ A;  2PQN A;  4JHR A;  3LDZ A;  3OAW A;  2DCP A;  5FQ4 A;  5AJD A;  1IQU A;  3SZ7 A;  3AU4 A;  5A7D B;  3D9I A;  3FTU A;  3QOU A;  4NQ0 A;  3L17 A;  3EHM A;  3O48 A;  3L22 A;  3CST A;  4GCN A;  4GAA A;  1INZ A;  4RG9 A;  2OV8 A;  4K0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...