1ELWA

Crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords TPR1-DOMAIN OF HOP
total genus 49
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elwA00
1ELWA 3ZHEA 3LY8A 4UI9C 2WPVA 5DIZA 4CGWA 4GYYA 4ABNA 4J0UA 3QKYA 4HOSA 2XEVA 4G23A 1B89A 2FI7A 1WM5A 2FEZA 3LCAA 1KT1A 2UWJG 3ASFA 3MV2B 4GYWA 3TGOA 4CGVA 4HOQA 4XIFA 2P58C 2BUGA 2Y4TA 2KATA 1HZ4A 2XCBA 4GZ6A 4JA7A 5M72A 4BWRA 2VSYA 5CCLA 1IHGA 3CVPA 2XPIA 5CCMA 2FO7A 3CKBA 2YHCA 4UQYA 2WQHA 4G24A 4WUYA 2HYZA 2KCLA 4Y6WA 3GYZA 3QWVA 5DBKA 1KT0A 2C0LA 3VTXA 2YQ8A 3S7DA 4WNEA 2KC7A 3MA5A 4N39A 3ESKA 1IYGA 2UY1A 2PZIA 5A6CA 3QOUA 3WXXA 2FF4A 4UQZA 4UI9J 4APOA 3R9AB 4GA2A 5G04J 3EDTB 4J8DA 1FCHA 2XCCA 4RG6A 4RG9A 5EX3A 3RU0A 3ZHEB 5FZQA 2JLBA 5G04C 2PQNA 3CV0A 3Q15A 3SZ7A 4F3VA 2DBAA 2I6HA 5LCWJ 4JHRA 5BT1A 3FFLA 3Q47B 4N5CA 3CK8A 1XNFA 4LEUA 4U0ZA 5HQ8A 3OXFA 3GZ2A 5LCWC 3U3WA 1PC2A 3ASHA 4N2QA 4BTBA 3FP3A 5KJMA 3HYMB 4GCOA 4HOUA 2LNIA 4I9EA 4WNGA 4UI9K 5KJKA 4AY5A 4I17A 3CK9A 3K9IA 4YNDA 2NC9A 5FTPA 1YA0A 4GZ3A 5G05J 4UQXA 5AYWD 4BT8A 4GPKA 1OUVA 3N71A 3LY7A 5G05C 3CKCA 1QQEA 2IF4A 3UQ3A 4N2SA 1W3BA 3U4TA 3UUXA 2XGMA 1A17A 3KAEA 4J8FA 3TAXA 4A1SA 4AIFA 4AM9A 5FZSA 2VQ2A 3CVQA 5JJ7A 4G2VA 5KJNA 3S7BA 5EKQD 5EX0A 2ONDA 3CEQA 4GCNA 2AVPA 4B94A 4EQFA 4AY6A 4IN3B 4GA0A 3LPZA 2Q7FA 4XI0A 5C1DA 3PE3A 3Q5MA 4G1TA 3JYSA 3LKUA 3PDNA 1WAO1 4N3BA 1HH8A 4G25A 4BT9A 3RO2A 3GW4A 3MEKA 3BEEA 4I1AA 2VGYA 3GZ1A 3MV3B 5ARFA 3ZPJA 4GZ5A 3AS8A 3ASGA 4H7XA 2LSVA 2UY1B 3AS5A 2KCVA 4O6FA 5BW8C 1NZNA 1ZU2A 2R5SA 4I2WA 4NQ0A 5A7DB 4H7YA 3TG4A 5CHEE 1TJCA 1NA0A 1ZBPA 2C2LA 3SF4A 3VTYA 4CDRA 5D0OD 3ZFWA 5FJYA 4KBQA 5KJLA 3RKVA 2Y4UA 2VGXA 4Y6CA 2VYIA 3FWVA 2VSNA 1HXIA 4I2ZA 4WNFA 4HOTA 4GYOA 4JA9A 3RO3A 3QWWA 3LYAA 3MKRA 2MHKA 3IEGA 4ME2A 5FZRA 2LSUA 2HO1A 2KCKA 1Y8MA 4NRHB 3OXGA 3ZGQA 2PL2A 2IFUA 2FBNA 1E96B 2XGOA 3OXLA 3ASDA 3PE4A 4I9CA 2QFCA 2PQRA 3RJVA 5JJ6A 3S7JA 4BTAA 4WNDA 4XI9A 4YVOA 2E2EA 2OOEA 3O48A 4N3AA 3URZA 4KXKB 5BNWA 4U0UA 4GA1A 4U07A 1KLXA 5JJTA 3Q49B 4KYOB 2L6JA 1QZ2A 3CVNA 4U0SA 5FT9A 3S7FA 3ULQA 4G26A 4YVQC 3E4BA 1NA3A 3AS4A 2GW1A 3KS2A 3CK7A 2C0MA 3LY9A 3UPVA 3QWPA 4U04A 1P5QA 3KD7A 4JL0A 3Q4AB 2VGXB 4J8EA 3RIBA 3CVLA 3NF1A 4W9RA 5D0QD 3QDNA 4HORA 2HR2A 3TG5A 5ARGA 5HI7A 3ZN3A 1ELRA 2XGSA 2J9QA 2V5FA 4N3CA
chains in the Genus database with same CATH superfamily
3FTVA 1NL4A 5DIZA 3CVVA 1LF8A 3D3MA 4J8YA 3TGOA 4HOQA 2P58C 2XCBA 4JZYA 2WXGA 1BD8A 2L6BA 3SBSA 4GTPA 4JHKA 2CHZA 1H6OA 2FF4A 4C48B 2F0YA 1HG5A 3ONLA 4RG9A 4RG6A 2ETAA 3RU0A 2P9SG 1TNZA 5T3RA 2OCCE 4FU3A 4A55A 3FUKA 4LSZE 2PM6A 1N95A 3CK9A 5EDSA 5G05J 2DZOA 3Q79A 1N11A 4OAVB 3KAEA 3TAXA 3U9WA 3FTYA 2P9NG 2CFZA 1H0AA 3GW4A 2QYJA 4OYSA 3TG4A 4B93B 3UM0A 2DYRE 3FH5A 2VYIA 2AXUA 3L9TA 1N4QA 2KCKA 3QK0A 2QFCA 5AQAA 2FO1E 3V2XA 4DPRA 4BTAA 4GA1A 2RKKA 1NA3A 5CEAA 5ENSD 4BX9A 4D10C 5ENTD 5D0QD 2V8SE 1K1BA 2H6HA 3ZUVB 1RW2A 4ACKA 4L2YA 3SO8A 1BPOA 3B7RL 1SVXA 3ZXSA 4XKCA 4YDWA 3KEAA 4Q94A 5CCLA 4UQYA 1OCRE 2I9CA 3TXMA 1H6PA 1AWCB 1INZA 3EHMA 3VLDA 1IYGA 4Z68A 3R9AB 3ZHEB 3SFXA 3LDZA 3FY4A 4PS8A 3OXFA 4FHKA 3DXMG 3K9IA 4KVMA 4BFRA 3UM3A 3UT8A 4F6RD 1ZB1A 3N71A 3V2OA 2WXMA 1N0RA 1N54A 4IN3B 3VLEA 4BT9A 4H7XA 2LSVA 2P9KG 4J6IA 4I2WA 1H2UA 5CHEE 3SF4A 2BEDA 3FULA 4JA9A 3MKRA 4NRHB 2PL2A 4G8LA 4CDMA 2ZISA 3AG3E 3EUVA 5JJTA 5IY5E 5FT9A 3E30A 4LCTA 3KS2A 3UPVA 1TN7A 3ZN3A 2V5FA 4N3CA 3CVXA 3TWWA 4HB5A 1K3ZD 4FP7A 4F1SA 2XZDG 2XS1A 4MS6A 2J07A 4GMLA 4GZ6A 3ZKJA 4UWKA 3HXCA 4G24A 2HYZA 3MJWA 3HXFA 4N39A 1UN9A 2BKKB 4APOA 4B0ZA 4LNBA 5T4YA 4HS2A 4DI4A 4WWPA 1MX2A 2A4ZA 4JHRA 3AG1E 5AAOA 4KT6B 2XZTG 3ASHA 2WXRA 3FP3A 4HRNA 5AJLA 2VSOE 1YA0A 3JUEA 5G05C 4URKA 3FUIA 3KSQA 4AIFA 5EX0A 4EQFA 3D9PA 4EPZA 2AVPA 2Q7FA 3LKUA 4N3BA 4RVBA 1Z3XA 2QC9A 3J5QB 3P2BA 2KXPC 2VGXA 3D9OA 4ME2A 2LSUA 5BV0A 5B1AE 2P9IG 4XI9A 4ANUA 3J5PA 4CT0A 3U66A 5FINA 4QFVA 3L17A 1E8ZA 3CVLA 3X2QE 3MZLB 1U3DA 5ARGA 5ENNA 3ULEG 2I1KA 3DPDA 2V4HC 2WVIA 1TEZA 3LCAA 2FEZA 1U3CA 3MV2B 4HBDA 2Y4TA 3T5XA 3Q7FA 4AV7A 2YHCA 3OTNA 4U7EB 1E7VA 4L2LA 2DCPA 3HRAA 4DLOA 3JQ0A 1PC2A 2WXIA 1OWPA 5J90A 3APFA 4HXIA 3ABLE 3FEYA 4A3TA 4AM9A 5JJ7A 3CHMA 3BQOA 4GCNA 4AJWA 4U8HA 3PE3A 1WAO1 4I1AA 1S70B 4CGVA 3Q7AA 4PS7A 5ANLA 4A1GA 3NAWA 1BI7B 4TRQA 1MJ0A 4HOTA 1K8KG 1HE8A 3FEXA 2GGFA 5CMWA 5FZRA 2HO1A 4AVXA 5FQ6A 2OVBA 1IQUA 4DRXE 4DUIA 2OOEA 3O48A 4N3AA 5D66A 1E8YA 3Q49B 4NIKA 4U0SA 3PREA 1BLXB 1P5QA 3L13A 1LD7A 2GRQB 2OV8A 4FC8A 3UMVA 3L54A 3DEPA 3LY8A 4EBAG 3PZ2A 1B89A 2XRYA 3JXIA 5A23A 1UN8A 1SZAA 2Y69E 5CCMA 1KZPA 5EIDA 4C0EA 2H6FA 3QWVA 4U8YD 3ZRHA 3IHVA 2XEEA 3W9FA 1Q2ZA 2UY1A 1TJFA 4JPSA 1JPLA 2NSZA 2JLBA 3CV0A 1SQMA 4DI3A 1IXVA 3SFZA 3PVLA 4ILGA 3CVYA 2MOWA 4FLHA 4LNGA 1E7UA 3UXGA 3G2SA 2ETCA 5EYLA 5KJNA 5FZSA 2XPZA 1S0PA 3B7UX 2J08A 4P29A 4J8SA 4G1TA 3JYSA 1LD8A 4AOFA 3MKQB 1H2VC 5A7DB 3CSTA 4H7YA 2C2LA 1ZBPA 2X6HA 5LP0A 1Z3YA 1MHQA 3Q9NC 4GYOA 3HVEB 3OXGA 1E96B 4K03A 2PNNA 3CLJA 4GTMA 4HRLA 1DC2A 2R02A 5AQBA 4MLPA 3PRZA 4U0UA 2WXQA 2YNQA 4KYOB 4O1PA 4J8EA 2J09A 3NF1A 3FDHA 4CZ2D 2HR2A 3MCXA 3G2WA 3S2AA 4N5QA 2XEVA 4UUCA 4GYWA 1YMPA 1O1SA 5KCMA 2EILE 1MYOA 4TXPA 1HO8A 2KC7A 3FUHA 2PZIA 4U8VD 4B89A 1OWOA 2XCCA 5ENPD 1HG2A 2AXZA 2X6IA 2EINE 2WM9A 3CVWA 3UT4A 3ZYLA 1TNOA 2LNIA 3IHYA 4UI9K 5CERB 4I17A 3SQVA 2NC9A 1H19A 3UQ3A 2DYSE 2ZIRA 4PS3A 5T8IA 2IQCA 3MGBA 3EHNA 3IV0A 3LPZA 4XI0A 5C1DA 2GRRB 4JVSA 3PEVB 4DX7D 3LEWA 3VTXA 3W9GA 2WXNA 5KNHD 2DVWA 4DX5D 5CECB 3FUNA 4KZCA 5B1BE 3FUEA 2MHKA 3C72A 3SNXA 3OXLA 2VTBA 3URZA 3HDXA 5BNWA 5CEDB 4U07A 4GPKA 1N4PA 1QZ2A 2RFMA 3UT7A 2VGXB 5FQ8A 2ZGDA 1EYHA 1TNUA 2RG8A 4NURA 5AQ7A 4CRWA 2OVFA 4UI9C 3NOCD 1LTXA 3D9JA 5KBAA 5M72A 2KM4A 2R59A 4I1OB 5CBOA 2X6KA 3D9KA 5J08A 1WG0A 5A6CA 3JCKC 3WXXA 3D9IA 3QAQA 3EDTB 1FCHA 2RFAA 2R03A 4G8KA 4F3VA 3L16A 1X5BA 4ACLA 1G3NB 5BT1A 2WB2A 5HQ8A 4UWHA 5CRVA 1E90A 2X6JA 4FA6A 3LY7A 3FU6A 4N2SA 4ATGA 3ZNGA 2P9PG 4A1SA 5E75A 4EZKA 2J4DA 3AU4A 3AS8A 3AS5A 3C3OA 4HI9A 3ASOE 4KBQA 5FJYA 3EIQC 4I2ZA 5CRUA 2AJAA 3CIAA 4FJYA 3SY2A 1OXJA 4ILHB 3ASDA 2IU1A 4LERA 1H2TC 1SW6A 4KXKB 2L6JA 4ANVA 1DNPA 2ZGGA 2GW1A 2F37A 3R9MA 1ELKA 3G2UA 2GRPB 2VTBB 3LVRE 3JUIA 2FI7A 3EIJA 3ZYQA 4BEPA 1VDYA 1O5MA 4JA7A 5LFAA 1TN6A 3GYZA 2XS8A 4ANXA 2L9BA 3CR3A 3NB2A 3SI5A 2WQ7A 5G04C 4XEIG 2EIJE 3L6AA 4HLEA 3SZ7A 1HFAA 1PY1A 4U63A 1EPUA 4CCAA 1EF1C 4U0ZA 4F53A 2M63A 4JW1A 4TUUA 4I9EA 3RAUA 3V31A 4V3IA 4GZ3A 1OUVA 3IXEA 3CKCA 5HRYA 3ABKE 5AN8A 4DX2A 5ENQD 1OWNA 3B13A 4M3OA 3Q5MA 2GROB 4G25A 4GTTA 4GZDA 2R5SA 4HLLA 4NQ0A 4HI8A 1D9SA 2CHXA 1Z5SC 5JMND 3RJVA 4WNDA 3I4RB 1JCQA 4XE0A 2WQ6A 1TR4A 4AXHA 3B7SA 4APFA 3CVNA 3S7FA 3E4BA 5B3SE 3EHQA 3KD7A 4W9RA 3BUAA 1JCRA 3UINC 2CHWA 3RK6A 4HOSA 2UWJG 2X38A 3UKRG 5JHBA 2QZAA 5EIBE 4WWNA 4FJZA 3R7QA 5AARA 4ILIA 4Y6WA 2C0LA 1EDUA 3ESKA 3QOUA 3AJIA 5G04J 4O60A 1DVPA 5EX3A 2DZNA 5D2MC 3FFLA 3Q47B 4N5CA 3T9KA 2WXKA 3TWUA 4BTBA 1S64A 5FQ4A 4AY5A 4YNDA 4JEUA 4B8AA 1BU9A 4XKBA 4MRUA 4BX8A 1OCZE 3UM1A 3CVQA 3HHMA 5AJDA 3ULYA 5ARFA 3MV3B 1WY6A 4GZ5A 5ENRD 3UI2A 4K5BA 1ZU2A 4A63B 4BETA 5FQ7A 4LG6A 5D0OD 3DSSA 1IQRA 4PDXA 4DX6D 2IONA 2KBXA 5BXOA 2WXOA 1HU3A 1NP7A 4X8QA 2B0OE 5H7PA 3JQ1A 3G2VA 5HS0A 2IJGX 2Y1LE 4U04A 3CHOA 3CHPA 3IKOB 4JL0A 2B6CA 4XX5A 4FADA 3HXDA 5HI7A 3FUJA 2H6GA 4GYYA 5KNGA 4GZCA 2LXLA 2V5QC 3UIOC 2LAHA 4CEMA 4BWRA 2VSYA 1IHGA 3PNTB 2FO7A 1FVHA 2GRLA 2NYJA 4YDOA 1D8DA 1O1TA 1PAQA 3QB2A 4G11A 2IY0C 2JABA 4QQIA 3ZVVA 4K5AB 3TWSA 2HM8A 3BU8A 3CHSA 5JHAA 4E6HA 4RLYA 1N9AA 4EBAA 4LEUA 3CSFA 4GU5A 5KJMA 3MYVA 2V0PA 3C5RA 2WXLA 1JCSA 2ZXWE 1TNBA 1W3BA 3UUXA 3QNKA 2GRMA 1RZ4A 4J8FA 4I6GA 3APCA 3FU0A 2IEJA 3ZU7B 3PDNA 3MEKA 5G2NA 3DWLG 3ASGA 3FUDA 4CDRA 1XGWA 1V55E 1N4RA 1AP7A 2CG2A 4JC8A 4FULA 4GPMA 3PE4A 3E37A 1D8EA 3S7JA 4YVOA 5ENOD 3FTXA 4IULA 2KZTB 3AS4A 4I1MA 4EHMA 3Q4AB 2IOLA 5G55A 3V79K 3CHRA 3ZW3A 3JXJA 3EJNA 3I5PA 5BXUA 4CGWA 4J0UA 3HXBA 5CMYA 5ITZF 2DIWA 2YINA 4L9PA 1HZ4A 3Q78A 2EQXA 4I6JA 5DBKA 1A5EA 4AEZC 2WXFA 3ONKA 3C3RA 2R17C 4R7LA 4RQIA 1BI8B 4TXQA 3GZ2A 2LO6A 3TWXA 1MQSA 2VJ8A 5AYWD 4UQXA 4AP2A 5ANRA 3U4TA 5LOZA 3EU5A 2VSXE 4G2VA 2WXJA 4AY6A 2IO3C 4HFGA 1HH8A 1O1RA 3DSUA 3KEZA 2KCVA 3FTZA 4O6FA 5E76A 3OAWA 3DSVA 4GTOA 4L7TA 1N52A 2QYUA 3PZ1A 2Y4UA 4Y6CA 3NZUA 3QWWA 3RSEG 3LJNA 3E32A 3FUFA 1Y8MA 3ZGQA 4LUNU 3NBNB 3B7TA 2V4LA 2XEHA 3L82A 3IBEA 2BTDA 3LJ3A 1MX4A 1OT8A 4GTRA 3V30A 1NFIE 3QWPA 3QDNA 3ISMC 3ZHEA 3QKYA 1L5JA 1KT1A 3Q9UC 2J49A 3D9NA 4XIFA 3FTSA 4I6EA 2XENA 3E33A 1SZ9A 3C3QA 2OEWA 3TXNA 3HG0D 3MA5A 3Q73A 4OVUA 2FULA 3TWQA 4UI9J 4GAAA 4HNAD 3ZYMA 4GA2A 4TV3A 3U64A 3ZXPA 2DBAA 4UWGA 4U96D 5KJKA 2J8SD 2WXPA 4ATZD 3MX3A 3ENEA 3PS6A 2AWIA 2VGEA 2PM7A 2ONDA 2E0IA 2HE0A 3ZPJA 4LNUD 2UY1B 3CQCB 1NZNA 2LUHA 2ILRA 3QC1A 3FHEA 4K0RA 4HVBA 2IO2C 1E8WA 2VSNA 3FWVA 4WNFA 3LVQE 3TWRA 3IEGA 2WXHA 5JJ6A 3DRAA 4TUMA 4G26A 1HF8A 3B7BA 3L08A 1IHBA 2A5EA 3ABME 4MBGA 4KVOA 2XHEA 1MX6A 3EU9A 1WM5A 4DLQA 3ASFA 2Y3AA 2OEVA 2BUGA 1JUQA 4DK5A 2XPIA 4CDNA 2KCLA 3PZ4A 4GB9A 1SA5A 4EZLA 2NXPA 3RRMB 4NACA 3Q15A 3SHFA 3CK8A 4DX1A 3WG7E 4BESA 3UTMA 4C9BB 4JHJA 1A17A 1NI1A 3DEOA 3DPYA 3TWVA 3S7BA 3L22A 4Q96A 3BEEA 4ZFHA 3PZDA 4GMRA 3CHQA 3ZFWA 3RKVA 1YCSB 4YDYA 3ZYKA 3SGHA 3SBTB 3LS8A 2PQRA 2JEKA 5FIOA 4HRMB 3T8MA 1KLXA 3FTWA 2RD0A 1FT2A 2LXMA 4YVQC 3SD5A 4HQDA 5C2YA 2Y0BG 3FTUA 4HORA 3ULQA 1OCOE 4PUCA 1ELWA 5KWDA 3R7RA 1HS6A 1OWLA 2L0TB 4G23A 5HKPA 3I4GA 2XRZA 2AW6A 3ZEFA 2A5UA 3NQPA 1GW6A 4MKTA 2DWZA 3CVPA 2WQHA 3C98A 1KT0A 1HX8A 3B95A 3DSTA 3AG2E 2PQNA 4ANWA 5LCWJ 1TNYA 3PUJA 1QYMA 2MRIA 4KMOA 3HYMB 1OWMA 4TXRA 3NOGD 2WMOA 3FU3A 3QARA 5FTPA 1UJKA 1S63A 3UX4A 3DXKG 3Q75A 4ZHBA 1QQEA 2IF4A 1UG3A 4IRUA 3T8KA 2R2LA 4M7CA 2BF0X 4GA0A 3RO2A 2VGYA 3ML8A 1N4SA 5JA4D 1IKND 2CFUA 1HXIA 3QJZA 3MKQA 3CGHA 3O4ZA 3FH8A 3PNLB 4XZ4A 4F1PA 1TYQG 1YYHA 4FHJA 1KPSB 3HVEA 5EYPF 5EN5D 2I2OA 4OAUC 1V54E 2H6IA 1WDYA 3DSXA 3RIBA 3CQGB 3TJPA 3ESLA 4BY6A 4BERA 3EHRA 4KZ0A 3UM2A 3DBSA 2WPVA 3P1UA 1Y6IA 4K5CA 3PUKA 1UJJA 3HIZA 2KATA 1H6KA 3AG4E 4EECA 1X81A 2BKGA 4WUYA 1N0QA 2YQ8A 1FVFA 4WNEA 3F6QA 2QY7A 1UW4B 3KSLA 4FLBA 4UQZA 5LX8A 4J8DA 5FZQA 3PZ3A 5BV1A 2WMNA 2I6HA 4B8CB 1XNFA 4YDEA 3DSWA 3FU5A 4GCOA 4HOUA 4WNGA 2YHEA 3PH0C 4GTVA 3ML9A 4BT8A 4I43A 3AU5A 1K1AA 3TWTA 3E34A 3CVUA 4L23A 1KZOA 3SFYA 5EKQD 3G2TA 2XQ0A 3D9HA 5BW8C 1U2VG 4RSYA 1NA0A 4GTSA 1JWGA 5KJLA 3VTYA 4PH4B 4C0MA 3UKUG 3RO3A 3VLFA 2ETBA 3T5VA 4JXTA 4U95D 1OY3D 4I9CA 1Z6TA 1E8XA 2E2EA 1JWFA 4UWLA 4J7WA 4JB8P 4DJAA 1SA4A 3NZSA 4IYPA 3RRNB 2P9UG 2J4BA 1DCQA 1N94A 4JEHA 3BG0B 3TG5A 5AENA 3LY9A 2XGSA 2J9QA 5AIJA 4F7AA 3GZSA 4L1BA 4ABNA 1TN8A 4BSXA 2I1JA 3D9MA 4LRZA 2EIKE 2F8XK 3CKBA 4E85A 3UIPC 2KZTA 3TL5A 3LXUX 3S7DA 3HXEA 3APDA 3D9LA 2L0IA 4O1OA 1MZCA 2GRNB 4EZJA 2CG3A 1UOHA 1OCCE 1QNFA 5AQ9A 3ASNE 4CYMD 4JD2G 4OVVA 5LCWC 3U3WA 1QBQA 4N2QA 5EILA 4UWFA 3I3NA 2ZU6B 4Q69A 5FWQA 5BPPA 4WAFA 2X6FA 2XGMA 2P2CP 2VQ2A 2IOSA 3CEQA 4B94A 2LAIA 2R05A 4GTQA 3GZ1A 2XPYA 1TJCA 4WWOA 2AXVA 5BUZA 4GMJA 2EIME 1FT1A 3RRUA 3LYAA 3AAAC 2FBNA 2IFUA 2X3MA 2XGOA 4BSZB 2F8YA 2P9LG 3FH7A 1FPPA 3PEUB 2MYOA 3CK7A 2C0MA 4A3VA 4CT4A 3BG1B 3ZIMA 5CBNA 3FUMA 1DCEA 1ELRA
chains in the Genus database with same CATH topology
3FTVA 3LY8A 2XHEA 5DIZA 4EBAG 3CVVA 2CHWA 3RK6A 1LF8A 3D3MA 4HOSA 1B89A 3TGOA 1WM5A 4DLQA 3ASFA 2UWJG 2Y3AA 4HOQA 2X38A 2XRYA 2P58C 2BUGA 2XCBA 4JZYA 1UN8A 1SZAA 1JUQA 5A23A 5JHBA 2WXGA 4WWNA 4DK5A 2XPIA 5CCMA 4FJZA 3R7QA 4ILIA 4C0EA 4CDNA 4Y6WA 2KCLA 3SBSA 4GB9A 3QWVA 3ZRHA 2C0LA 3IHVA 4JHKA 1EDUA 3ESKA 2UY1A 4EZLA 2CHZA 1TJFA 2NXPA 3QOUA 4JPSA 2FF4A 1JPLA 1HG5A 3RRMB 3ONLA 5G04J 1DVPA 4RG9A 4RG6A 4NACA 5EX3A 3RU0A 2NSZA 2JLBA 3CV0A 3Q15A 1SQMA 4DI3A 5T3RA 3FFLA 3Q47B 3SHFA 4N5CA 3CK8A 4FU3A 4A55A 3FUKA 2WXKA 4BTBA 3SFZA 2PM6A 3PVLA 5FQ4A 4AY5A 3CK9A 4YNDA 4JEUA 5EDSA 4ILGA 4B8AA 5G05J 4XKBA 4C9BB 3CVYA 2MOWA 4FLHA 4JHJA 4MRUA 1E7UA 4BX8A 3G2SA 1A17A 3KAEA 3TAXA 5KJNA 5FZSA 2XPZA 3CVQA 3U9WA 3S7BA 1S0PA 3FTYA 3B7UX 2J08A 4P29A 2CFZA 4J8SA 3HHMA 3L22A 4G1TA 1H0AA 3JYSA 4Q96A 4AOFA 5AJDA 3GW4A 5ARFA 3BEEA 3MV3B 4OYSA 1WY6A 4GZ5A 3MKQB 3PZDA 1ZU2A 1H2VC 5A7DB 3CSTA 4H7YA 3TG4A 2C2LA 1ZBPA 5FQ7A 3CHQA 3FH5A 5D0OD 3ZFWA 2X6HA 3RKVA 2VYIA 5LP0A 1IQRA 2AXUA 1Z3YA 1MHQA 4PDXA 4GYOA 3ZYKA 3SGHA 2IONA 2KCKA 3HVEB 3OXGA 1E96B 1HU3A 1NP7A 2WXOA 3QK0A 4K03A 3SBTB 3LS8A 2QFCA 2PQRA 4DPRA 4BTAA 3CLJA 2JEKA 4MLPA 3PRZA 4U0UA 2WXQA 3JQ1A 4GA1A 3T8MA 2YNQA 1KLXA 3G2VA 4KYOB 3FTWA 2RD0A 2IJGX 4YVQC 1NA3A 3SD5A 4U04A 3CHOA 3CHPA 3IKOB 4BX9A 4JL0A 5C2YA 4J8EA 3FTUA 4D10C 2J09A 3NF1A 3FDHA 4XX5A 5D0QD 4FADA 4HORA 2HR2A 3MCXA 5HI7A 3G2WA 2V8SE 3FUJA 3ULQA 4PUCA 1ELWA 3R7RA 4ACKA 4L2YA 1HS6A 4GYYA 1OWLA 3S2AA 2L0TB 2XEVA 4G23A 4GZCA 4GYWA 1BPOA 3B7RL 5KCMA 3ZXSA 3I4GA 2LAHA 4CEMA 4XKCA 2AW6A 3ZEFA 2XRZA 2A5UA 3NQPA 1GW6A 4MKTA 4BWRA 2VSYA 4Q94A 5CCLA 1IHGA 3PNTB 3CVPA 2FO7A 1FVHA 2GRLA 4UQYA 2WQHA 2I9CA 3TXMA 3C98A 1KT0A 1PAQA 3QB2A 4G11A 1INZA 3EHMA 1HO8A 1HX8A 2KC7A 3VLDA 3FUHA 1IYGA 2PZIA 3R9AB 4B89A 1OWOA 2XCCA 3ZHEB 3ZVVA 1HG2A 2AXZA 2HM8A 2PQNA 4ANWA 3CHSA 3LDZA 2X6IA 5LCWJ 5JHAA 4E6HA 4EBAA 4LEUA 3FY4A 2WM9A 4PS8A 3CSFA 3OXFA 3PUJA 3UT4A 3CVWA 3ZYLA 2MRIA 4GU5A 4KMOA 5KJMA 3HYMB 1OWMA 2LNIA 3IHYA 3MYVA 4UI9K 4FHKA 2WMOA 3FU3A 4I17A 3K9IA 3QARA 4KVMA 2NC9A 5FTPA 4BFRA 1UJKA 3UT8A 2V0PA 3UX4A 3N71A 1H19A 2WXLA 2WXMA 1QQEA 2IF4A 3UQ3A 1W3BA 3UUXA 3QNKA 1UG3A 4IRUA 2GRMA 4PS3A 5T8IA 4J8FA 2IQCA 3MGBA 4I6GA 3APCA 3FU0A 1N54A 3EHNA 2BF0X 3IV0A 4IN3B 4GA0A 3LPZA 3VLEA 4XI0A 5C1DA 3PDNA 4BT9A 3RO2A 4JVSA 3PEVB 3MEKA 5G2NA 2VGYA 3ASGA 3LEWA 2LSVA 4H7XA 3ML8A 2WXNA 3VTXA 4J6IA 4I2WA 1H2UA 5CHEE 3FUDA 4CDRA 3SF4A 3FUNA 1XGWA 4KZCA 2CFUA 3FULA 1HXIA 3QJZA 4JA9A 3FUEA 3MKQA 3CGHA 2CG2A 3MKRA 2MHKA 3O4ZA 4JC8A 4FULA 4NRHB 3SNXA 2PL2A 3FH8A 4CDMA 3OXLA 3PE4A 2VTBA 3PNLB 4XZ4A 3S7JA 4YVOA 3URZA 3HDXA 5BNWA 3FTXA 4FHJA 4U07A 5JJTA 3HVEA 5FT9A 4GPKA 1QZ2A 4IULA 2KZTB 3AS4A 4LCTA 2I2OA 3KS2A 4I1MA 3UPVA 3UT7A 3RIBA 3Q4AB 2VGXB 2IOLA 5FQ8A 5G55A 3CQGB 1EYHA 2RG8A 4NURA 3TJPA 3CHRA 3ESLA 4CRWA 2OVFA 3ZW3A 3ZN3A 4BY6A 3EJNA 3I5PA 2V5FA 4N3CA 3CVXA 4KZ0A 3DBSA 2WPVA 4UI9C 4CGWA 4FP7A 4J0UA 3P1UA 1Y6IA 5CMYA 4F1SA 2DIWA 3D9JA 3PUKA 4MS6A 2J07A 1UJJA 2YINA 3HIZA 4GMLA 2KATA 1HZ4A 4GZ6A 5M72A 2KM4A 1H6KA 2EQXA 2R59A 4I1OB 4UWKA 4I6JA 4EECA 4G24A 4WUYA 2HYZA 5DBKA 3MJWA 2X6KA 2YQ8A 3D9KA 1FVFA 4WNEA 5J08A 2QY7A 4N39A 2WXFA 1UN9A 4AEZC 1UW4B 5A6CA 3JCKC 4FLBA 3ONKA 3WXXA 3D9IA 4UQZA 4APOA 4B0ZA 3QAQA 5LX8A 5T4YA 2R17C 4HS2A 3EDTB 4DI4A 4J8DA 1FCHA 4R7LA 4WWPA 5FZQA 5BV1A 2WMNA 4F3VA 2I6HA 3L16A 1X5BA 2A4ZA 4JHRA 4ACLA 4B8CB 5BT1A 2WB2A 1XNFA 5HQ8A 4UWHA 3GZ2A 4KT6B 3ASHA 2LO6A 2WXRA 3FU5A 1MQSA 3FP3A 2VJ8A 4GCOA 4HOUA 4WNGA 2YHEA 3PH0C 5AJLA 1E90A 2VSOE 2X6JA 4FA6A 3ML9A 1YA0A 4I43A 5AYWD 4UQXA 4BT8A 3LY7A 5G05C 3FU6A 4AP2A 4URKA 3AU5A 4N2SA 5ANRA 3U4TA 4ATGA 3FUIA 5LOZA 3CVUA 4AIFA 4L23A 4A1SA 2VSXE 4G2VA 5EKQD 5EX0A 3D9PA 4EQFA 4EPZA 2AVPA 2WXJA 4AY6A 3G2TA 2Q7FA 5E75A 2XQ0A 3LKUA 4N3BA 4HFGA 1HH8A 4EZKA 4RVBA 2J4DA 1Z3XA 3KEZA 3AU4A 3AS8A 5BW8C 3AS5A 4RSYA 2KCVA 3FTZA 4O6FA 3P2BA 5E76A 3OAWA 4L7TA 1NA0A 1N52A 1JWGA 5KJLA 3VTYA 5FJYA 4KBQA 2Y4UA 2VGXA 4PH4B 4Y6CA 4C0MA 3D9OA 3EIQC 3NZUA 4I2ZA 3RO3A 3VLFA 3QWWA 3CIAA 4ME2A 2LSUA 3FUFA 3ZGQA 1Y8MA 4FJYA 4LUNU 3T5VA 3B7TA 4JXTA 4ILHB 3ASDA 2V4LA 4I9CA 1Z6TA 2IU1A 4LERA 5BV0A 1H2TC 1E8XA 4XI9A 4ANUA 2E2EA 3IBEA 1JWFA 4UWLA 4KXKB 4CT0A 3U66A 2BTDA 4DJAA 2L6JA 3LJ3A 4QFVA 3L17A 3NZSA 1E8ZA 4IYPA 4ANVA 1DNPA 3RRNB 2GW1A 3QWPA 2J4BA 4JEHA 1ELKA 3CVLA 3MZLB 3G2UA 1U3DA 3BG0B 3QDNA 3TG5A 5ARGA 5AENA 3LY9A 2XGSA 2J9QA 5ENNA 2VTBB 5AIJA 2I1KA 3DPDA 3ZHEA 3LVRE 3JUIA 4F7AA 3GZSA 4L1BA 4ABNA 2WVIA 3QKYA 1TEZA 1L5JA 4BSXA 2FI7A 2FEZA 3EIJA 3LCAA 1KT1A 3ZYQA 1U3CA 3MV2B 2I1JA 2J49A 3D9NA 4XIFA 3FTSA 1VDYA 4I6EA 2Y4TA 4JA7A 1SZ9A 3D9MA 4LRZA 3T5XA 4AV7A 5LFAA 3CKBA 2YHCA 4E85A 3OTNA 2KZTA 3GYZA 3TXNA 3TL5A 3LXUX 1E7VA 3S7DA 4ANXA 3MA5A 3APDA 3D9LA 2L9BA 4OVUA 2FULA 2L0IA 4L2LA 4UI9J 4GAAA 2DCPA 3ZYMA 4GA2A 3CR3A 4TV3A 4EZJA 2CG3A 3SI5A 2WQ7A 5G04C 1QNFA 3U64A 3L6AA 3SZ7A 4HLEA 1HFAA 2DBAA 1PY1A 4UWGA 4U63A 4DLOA 1EPUA 4CCAA 1EF1C 4U0ZA 4OVVA 3JQ0A 5LCWC 3U3WA 1PC2A 2WXIA 4F53A 4N2QA 1OWPA 2M63A 4JW1A 4TUUA 4I9EA 5KJKA 4UWFA 5J90A 2WXPA 3I3NA 2ZU6B 4Q69A 4V3IA 3APFA 4GZ3A 5FWQA 1OUVA 4HXIA 5BPPA 3CKCA 4WAFA 2X6FA 3MX3A 2XGMA 3ENEA 3PS6A 3FEYA 4A3TA 2AWIA 4AM9A 5JJ7A 3CHMA 2VQ2A 1OWNA 2PM7A 2IOSA 2ONDA 3CEQA 4GCNA 4B94A 2E0IA 4AJWA 3B13A 2LAIA 4M3OA 4U8HA 3PE3A 3Q5MA 1WAO1 4G25A 3ZPJA 4I1AA 3GZ1A 2XPYA 4CGVA 2UY1B 4GZDA 3CQCB 1NZNA 2R5SA 4NQ0A 2ILRA 3QC1A 1TJCA 3FHEA 4K0RA 4PS7A 4WWOA 5ANLA 4HVBA 4A1GA 2AXVA 1E8WA 2VSNA 3FWVA 4TRQA 2CHXA 4GMJA 5BUZA 4WNFA 4HOTA 3LVQE 3RRUA 1HE8A 3FEXA 3LYAA 2GGFA 3IEGA 5CMWA 5FZRA 2HO1A 4AVXA 2FBNA 2IFUA 2WXHA 5FQ6A 2X3MA 2XGOA 2OVBA 1IQUA 3RJVA 5JJ6A 4WNDA 3I4RB 4XE0A 2WQ6A 2OOEA 3O48A 4N3AA 4AXHA 1E8YA 3B7SA 4APFA 3Q49B 3CVNA 3S7FA 4U0SA 3PREA 3FH7A 4G26A 1HF8A 3E4BA 3PEUB 3CK7A 2C0MA 1P5QA 4A3VA 3KD7A 3L13A 4CT4A 3BG1B 4W9RA 2OV8A 3L08A 4FC8A 3ZIMA 3FUMA 3UMVA 3L54A 1ELRA 4KVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELW A;  3ZHE A;  3LY8 A;  4UI9 C;  2WPV A;  5DIZ A;  4CGW A;  4GYY A;  4ABN A;  4J0U A;  3QKY A;  4HOS A;  2XEV A;  4G23 A;  1B89 A;  2FI7 A;  1WM5 A;  2FEZ A;  3LCA A;  1KT1 A;  2UWJ G;  3ASF A;  3MV2 B;  4GYW A;  3TGO A;  4CGV A;  4HOQ A;  4XIF A;  2P58 C;  2BUG A;  2Y4T A;  2KAT A;  1HZ4 A;  2XCB A;  4GZ6 A;  4JA7 A;  5M72 A;  4BWR A;  2VSY A;  5CCL A;  1IHG A;  3CVP A;  2XPI A;  5CCM A;  2FO7 A;  3CKB A;  2YHC A;  4UQY A;  2WQH A;  4G24 A;  4WUY A;  2HYZ A;  2KCL A;  4Y6W A;  3GYZ A;  3QWV A;  5DBK A;  1KT0 A;  2C0L A;  3VTX A;  2YQ8 A;  3S7D A;  4WNE A;  2KC7 A;  3MA5 A;  4N39 A;  3ESK A;  1IYG A;  2UY1 A;  2PZI A;  5A6C A;  3QOU A;  3WXX A;  2FF4 A;  4UQZ A;  4UI9 J;  4APO A;  3R9A B;  4GA2 A;  5G04 J;  3EDT B;  4J8D A;  1FCH A;  2XCC A;  4RG6 A;  4RG9 A;  5EX3 A;  3RU0 A;  3ZHE B;  5FZQ A;  2JLB A;  5G04 C;  2PQN A;  3CV0 A;  3Q15 A;  3SZ7 A;  4F3V A;  2DBA A;  2I6H A;  5LCW J;  4JHR A;  5BT1 A;  3FFL A;  3Q47 B;  4N5C A;  3CK8 A;  1XNF A;  4LEU A;  4U0Z A;  5HQ8 A;  3OXF A;  3GZ2 A;  5LCW C;  3U3W A;  1PC2 A;  3ASH A;  4N2Q A;  4BTB A;  3FP3 A;  5KJM A;  3HYM B;  4GCO A;  4HOU A;  2LNI A;  4I9E A;  4WNG A;  4UI9 K;  5KJK A;  4AY5 A;  4I17 A;  3CK9 A;  3K9I A;  4YND A;  2NC9 A;  5FTP A;  1YA0 A;  4GZ3 A;  5G05 J;  4UQX A;  5AYW D;  4BT8 A;  4GPK A;  1OUV A;  3N71 A;  3LY7 A;  5G05 C;  3CKC A;  1QQE A;  2IF4 A;  3UQ3 A;  4N2S A;  1W3B A;  3U4T A;  3UUX A;  2XGM A;  1A17 A;  3KAE A;  4J8F A;  3TAX A;  4A1S A;  4AIF A;  4AM9 A;  5FZS A;  2VQ2 A;  3CVQ A;  5JJ7 A;  4G2V A;  5KJN A;  3S7B A;  5EKQ D;  5EX0 A;  2OND A;  3CEQ A;  4GCN A;  2AVP A;  4B94 A;  4EQF A;  4AY6 A;  4IN3 B;  4GA0 A;  3LPZ A;  2Q7F A;  4XI0 A;  5C1D A;  3PE3 A;  3Q5M A;  4G1T A;  3JYS A;  3LKU A;  3PDN A;  1WAO 1;  4N3B A;  1HH8 A;  4G25 A;  4BT9 A;  3RO2 A;  3GW4 A;  3MEK A;  3BEE A;  4I1A A;  2VGY A;  3GZ1 A;  3MV3 B;  5ARF A;  3ZPJ A;  4GZ5 A;  3AS8 A;  3ASG A;  4H7X A;  2LSV A;  2UY1 B;  3AS5 A;  2KCV A;  4O6F A;  5BW8 C;  1NZN A;  1ZU2 A;  2R5S A;  4I2W A;  4NQ0 A;  5A7D B;  4H7Y A;  3TG4 A;  5CHE E;  1TJC A;  1NA0 A;  1ZBP A;  2C2L A;  3SF4 A;  3VTY A;  4CDR A;  5D0O D;  3ZFW A;  5FJY A;  4KBQ A;  5KJL A;  3RKV A;  2Y4U A;  2VGX A;  4Y6C A;  2VYI A;  3FWV A;  2VSN A;  1HXI A;  4I2Z A;  4WNF A;  4HOT A;  4GYO A;  4JA9 A;  3RO3 A;  3QWW A;  3LYA A;  3MKR A;  2MHK A;  3IEG A;  4ME2 A;  5FZR A;  2LSU A;  2HO1 A;  2KCK A;  1Y8M A;  4NRH B;  3OXG A;  3ZGQ A;  2PL2 A;  2IFU A;  2FBN A;  1E96 B;  2XGO A;  3OXL A;  3ASD A;  3PE4 A;  4I9C A;  2QFC A;  2PQR A;  3RJV A;  5JJ6 A;  3S7J A;  4BTA A;  4WND A;  4XI9 A;  4YVO A;  2E2E A;  2OOE A;  3O48 A;  4N3A A;  3URZ A;  4KXK B;  5BNW A;  4U0U A;  4GA1 A;  4U07 A;  1KLX A;  5JJT A;  3Q49 B;  4KYO B;  2L6J A;  1QZ2 A;  3CVN A;  4U0S A;  5FT9 A;  3S7F A;  3ULQ A;  4G26 A;  4YVQ C;  3E4B A;  1NA3 A;  3AS4 A;  2GW1 A;  3KS2 A;  3CK7 A;  2C0M A;  3LY9 A;  3UPV A;  3QWP A;  4U04 A;  1P5Q A;  3KD7 A;  4JL0 A;  3Q4A B;  2VGX B;  4J8E A;  3RIB A;  3CVL A;  3NF1 A;  4W9R A;  5D0Q D;  3QDN A;  4HOR A;  2HR2 A;  3TG5 A;  5ARG A;  5HI7 A;  3ZN3 A;  1ELR A;  2XGS A;  2J9Q A;  2V5F A;  4N3C A; 
#chains in the Genus database with same CATH topology
 3FTV A;  1NL4 A;  5DIZ A;  3CVV A;  1LF8 A;  3D3M A;  4J8Y A;  3TGO A;  4HOQ A;  2P58 C;  2XCB A;  4JZY A;  2WXG A;  1BD8 A;  2L6B A;  3SBS A;  4GTP A;  4JHK A;  2CHZ A;  1H6O A;  2FF4 A;  4C48 B;  2F0Y A;  1HG5 A;  3ONL A;  4RG9 A;  4RG6 A;  2ETA A;  3RU0 A;  2P9S G;  1TNZ A;  5T3R A;  2OCC E;  4FU3 A;  4A55 A;  3FUK A;  4LSZ E;  2PM6 A;  1N95 A;  3CK9 A;  5EDS A;  5G05 J;  2DZO A;  3Q79 A;  1N11 A;  4OAV B;  3KAE A;  3TAX A;  3U9W A;  3FTY A;  2P9N G;  2CFZ A;  1H0A A;  3GW4 A;  2QYJ A;  4OYS A;  3TG4 A;  4B93 B;  3UM0 A;  2DYR E;  3FH5 A;  2VYI A;  2AXU A;  3L9T A;  1N4Q A;  2KCK A;  3QK0 A;  2QFC A;  5AQA A;  2FO1 E;  3V2X A;  4DPR A;  4BTA A;  4GA1 A;  2RKK A;  1NA3 A;  5CEA A;  5ENS D;  4BX9 A;  4D10 C;  5ENT D;  5D0Q D;  2V8S E;  1K1B A;  2H6H A;  3ZUV B;  1RW2 A;  4ACK A;  4L2Y A;  3SO8 A;  1BPO A;  3B7R L;  1SVX A;  3ZXS A;  4XKC A;  4YDW A;  3KEA A;  4Q94 A;  5CCL A;  4UQY A;  1OCR E;  2I9C A;  3TXM A;  1H6P A;  1AWC B;  1INZ A;  3EHM A;  3VLD A;  1IYG A;  4Z68 A;  3R9A B;  3ZHE B;  3SFX A;  3LDZ A;  3FY4 A;  4PS8 A;  3OXF A;  4FHK A;  3DXM G;  3K9I A;  4KVM A;  4BFR A;  3UM3 A;  3UT8 A;  4F6R D;  1ZB1 A;  3N71 A;  3V2O A;  2WXM A;  1N0R A;  1N54 A;  4IN3 B;  3VLE A;  4BT9 A;  4H7X A;  2LSV A;  2P9K G;  4J6I A;  4I2W A;  1H2U A;  5CHE E;  3SF4 A;  2BED A;  3FUL A;  4JA9 A;  3MKR A;  4NRH B;  2PL2 A;  4G8L A;  4CDM A;  2ZIS A;  3AG3 E;  3EUV A;  5JJT A;  5IY5 E;  5FT9 A;  3E30 A;  4LCT A;  3KS2 A;  3UPV A;  1TN7 A;  3ZN3 A;  2V5F A;  4N3C A;  3CVX A;  3TWW A;  4HB5 A;  1K3Z D;  4FP7 A;  4F1S A;  2XZD G;  2XS1 A;  4MS6 A;  2J07 A;  4GML A;  4GZ6 A;  3ZKJ A;  4UWK A;  3HXC A;  4G24 A;  2HYZ A;  3MJW A;  3HXF A;  4N39 A;  1UN9 A;  2BKK B;  4APO A;  4B0Z A;  4LNB A;  5T4Y A;  4HS2 A;  4DI4 A;  4WWP A;  1MX2 A;  2A4Z A;  4JHR A;  3AG1 E;  5AAO A;  4KT6 B;  2XZT G;  3ASH A;  2WXR A;  3FP3 A;  4HRN A;  5AJL A;  2VSO E;  1YA0 A;  3JUE A;  5G05 C;  4URK A;  3FUI A;  3KSQ A;  4AIF A;  5EX0 A;  4EQF A;  3D9P A;  4EPZ A;  2AVP A;  2Q7F A;  3LKU A;  4N3B A;  4RVB A;  1Z3X A;  2QC9 A;  3J5Q B;  3P2B A;  2KXP C;  2VGX A;  3D9O A;  4ME2 A;  2LSU A;  5BV0 A;  5B1A E;  2P9I G;  4XI9 A;  4ANU A;  3J5P A;  4CT0 A;  3U66 A;  5FIN A;  4QFV A;  3L17 A;  1E8Z A;  3CVL A;  3X2Q E;  3MZL B;  1U3D A;  5ARG A;  5ENN A;  3ULE G;  2I1K A;  3DPD A;  2V4H C;  2WVI A;  1TEZ A;  3LCA A;  2FEZ A;  1U3C A;  3MV2 B;  4HBD A;  2Y4T A;  3T5X A;  3Q7F A;  4AV7 A;  2YHC A;  3OTN A;  4U7E B;  1E7V A;  4L2L A;  2DCP A;  3HRA A;  4DLO A;  3JQ0 A;  1PC2 A;  2WXI A;  1OWP A;  5J90 A;  3APF A;  4HXI A;  3ABL E;  3FEY A;  4A3T A;  4AM9 A;  5JJ7 A;  3CHM A;  3BQO A;  4GCN A;  4AJW A;  4U8H A;  3PE3 A;  1WAO 1;  4I1A A;  1S70 B;  4CGV A;  3Q7A A;  4PS7 A;  5ANL A;  4A1G A;  3NAW A;  1BI7 B;  4TRQ A;  1MJ0 A;  4HOT A;  1K8K G;  1HE8 A;  3FEX A;  2GGF A;  5CMW A;  5FZR A;  2HO1 A;  4AVX A;  5FQ6 A;  2OVB A;  1IQU A;  4DRX E;  4DUI A;  2OOE A;  3O48 A;  4N3A A;  5D66 A;  1E8Y A;  3Q49 B;  4NIK A;  4U0S A;  3PRE A;  1BLX B;  1P5Q A;  3L13 A;  1LD7 A;  2GRQ B;  2OV8 A;  4FC8 A;  3UMV A;  3L54 A;  3DEP A;  3LY8 A;  4EBA G;  3PZ2 A;  1B89 A;  2XRY A;  3JXI A;  5A23 A;  1UN8 A;  1SZA A;  2Y69 E;  5CCM A;  1KZP A;  5EID A;  4C0E A;  2H6F A;  3QWV A;  4U8Y D;  3ZRH A;  3IHV A;  2XEE A;  3W9F A;  1Q2Z A;  2UY1 A;  1TJF A;  4JPS A;  1JPL A;  2NSZ A;  2JLB A;  3CV0 A;  1SQM A;  4DI3 A;  1IXV A;  3SFZ A;  3PVL A;  4ILG A;  3CVY A;  2MOW A;  4FLH A;  4LNG A;  1E7U A;  3UXG A;  3G2S A;  2ETC A;  5EYL A;  5KJN A;  5FZS A;  2XPZ A;  1S0P A;  3B7U X;  2J08 A;  4P29 A;  4J8S A;  4G1T A;  3JYS A;  1LD8 A;  4AOF A;  3MKQ B;  1H2V C;  5A7D B;  3CST A;  4H7Y A;  2C2L A;  1ZBP A;  2X6H A;  5LP0 A;  1Z3Y A;  1MHQ A;  3Q9N C;  4GYO A;  3HVE B;  3OXG A;  1E96 B;  4K03 A;  2PNN A;  3CLJ A;  4GTM A;  4HRL A;  1DC2 A;  2R02 A;  5AQB A;  4MLP A;  3PRZ A;  4U0U A;  2WXQ A;  2YNQ A;  4KYO B;  4O1P A;  4J8E A;  2J09 A;  3NF1 A;  3FDH A;  4CZ2 D;  2HR2 A;  3MCX A;  3G2W A;  3S2A A;  4N5Q A;  2XEV A;  4UUC A;  4GYW A;  1YMP A;  1O1S A;  5KCM A;  2EIL E;  1MYO A;  4TXP A;  1HO8 A;  2KC7 A;  3FUH A;  2PZI A;  4U8V D;  4B89 A;  1OWO A;  2XCC A;  5ENP D;  1HG2 A;  2AXZ A;  2X6I A;  2EIN E;  2WM9 A;  3CVW A;  3UT4 A;  3ZYL A;  1TNO A;  2LNI A;  3IHY A;  4UI9 K;  5CER B;  4I17 A;  3SQV A;  2NC9 A;  1H19 A;  3UQ3 A;  2DYS E;  2ZIR A;  4PS3 A;  5T8I A;  2IQC A;  3MGB A;  3EHN A;  3IV0 A;  3LPZ A;  4XI0 A;  5C1D A;  2GRR B;  4JVS A;  3PEV B;  4DX7 D;  3LEW A;  3VTX A;  3W9G A;  2WXN A;  5KNH D;  2DVW A;  4DX5 D;  5CEC B;  3FUN A;  4KZC A;  5B1B E;  3FUE A;  2MHK A;  3C72 A;  3SNX A;  3OXL A;  2VTB A;  3URZ A;  3HDX A;  5BNW A;  5CED B;  4U07 A;  4GPK A;  1N4P A;  1QZ2 A;  2RFM A;  3UT7 A;  2VGX B;  5FQ8 A;  2ZGD A;  1EYH A;  1TNU A;  2RG8 A;  4NUR A;  5AQ7 A;  4CRW A;  2OVF A;  4UI9 C;  3NOC D;  1LTX A;  3D9J A;  5KBA A;  5M72 A;  2KM4 A;  2R59 A;  4I1O B;  5CBO A;  2X6K A;  3D9K A;  5J08 A;  1WG0 A;  5A6C A;  3JCK C;  3WXX A;  3D9I A;  3QAQ A;  3EDT B;  1FCH A;  2RFA A;  2R03 A;  4G8K A;  4F3V A;  3L16 A;  1X5B A;  4ACL A;  1G3N B;  5BT1 A;  2WB2 A;  5HQ8 A;  4UWH A;  5CRV A;  1E90 A;  2X6J A;  4FA6 A;  3LY7 A;  3FU6 A;  4N2S A;  4ATG A;  3ZNG A;  2P9P G;  4A1S A;  5E75 A;  4EZK A;  2J4D A;  3AU4 A;  3AS8 A;  3AS5 A;  3C3O A;  4HI9 A;  3ASO E;  4KBQ A;  5FJY A;  3EIQ C;  4I2Z A;  5CRU A;  2AJA A;  3CIA A;  4FJY A;  3SY2 A;  1OXJ A;  4ILH B;  3ASD A;  2IU1 A;  4LER A;  1H2T C;  1SW6 A;  4KXK B;  2L6J A;  4ANV A;  1DNP A;  2ZGG A;  2GW1 A;  2F37 A;  3R9M A;  1ELK A;  3G2U A;  2GRP B;  2VTB B;  3LVR E;  3JUI A;  2FI7 A;  3EIJ A;  3ZYQ A;  4BEP A;  1VDY A;  1O5M A;  4JA7 A;  5LFA A;  1TN6 A;  3GYZ A;  2XS8 A;  4ANX A;  2L9B A;  3CR3 A;  3NB2 A;  3SI5 A;  2WQ7 A;  5G04 C;  4XEI G;  2EIJ E;  3L6A A;  4HLE A;  3SZ7 A;  1HFA A;  1PY1 A;  4U63 A;  1EPU A;  4CCA A;  1EF1 C;  4U0Z A;  4F53 A;  2M63 A;  4JW1 A;  4TUU A;  4I9E A;  3RAU A;  3V31 A;  4V3I A;  4GZ3 A;  1OUV A;  3IXE A;  3CKC A;  5HRY A;  3ABK E;  5AN8 A;  4DX2 A;  5ENQ D;  1OWN A;  3B13 A;  4M3O A;  3Q5M A;  2GRO B;  4G25 A;  4GTT A;  4GZD A;  2R5S A;  4HLL A;  4NQ0 A;  4HI8 A;  1D9S A;  2CHX A;  1Z5S C;  5JMN D;  3RJV A;  4WND A;  3I4R B;  1JCQ A;  4XE0 A;  2WQ6 A;  1TR4 A;  4AXH A;  3B7S A;  4APF A;  3CVN A;  3S7F A;  3E4B A;  5B3S E;  3EHQ A;  3KD7 A;  4W9R A;  3BUA A;  1JCR A;  3UIN C;  2CHW A;  3RK6 A;  4HOS A;  2UWJ G;  2X38 A;  3UKR G;  5JHB A;  2QZA A;  5EIB E;  4WWN A;  4FJZ A;  3R7Q A;  5AAR A;  4ILI A;  4Y6W A;  2C0L A;  1EDU A;  3ESK A;  3QOU A;  3AJI A;  5G04 J;  4O60 A;  1DVP A;  5EX3 A;  2DZN A;  5D2M C;  3FFL A;  3Q47 B;  4N5C A;  3T9K A;  2WXK A;  3TWU A;  4BTB A;  1S64 A;  5FQ4 A;  4AY5 A;  4YND A;  4JEU A;  4B8A A;  1BU9 A;  4XKB A;  4MRU A;  4BX8 A;  1OCZ E;  3UM1 A;  3CVQ A;  3HHM A;  5AJD A;  3ULY A;  5ARF A;  3MV3 B;  1WY6 A;  4GZ5 A;  5ENR D;  3UI2 A;  4K5B A;  1ZU2 A;  4A63 B;  4BET A;  5FQ7 A;  4LG6 A;  5D0O D;  3DSS A;  1IQR A;  4PDX A;  4DX6 D;  2ION A;  2KBX A;  5BXO A;  2WXO A;  1HU3 A;  1NP7 A;  4X8Q A;  2B0O E;  5H7P A;  3JQ1 A;  3G2V A;  5HS0 A;  2IJG X;  2Y1L E;  4U04 A;  3CHO A;  3CHP A;  3IKO B;  4JL0 A;  2B6C A;  4XX5 A;  4FAD A;  3HXD A;  5HI7 A;  3FUJ A;  2H6G A;  4GYY A;  5KNG A;  4GZC A;  2LXL A;  2V5Q C;  3UIO C;  2LAH A;  4CEM A;  4BWR A;  2VSY A;  1IHG A;  3PNT B;  2FO7 A;  1FVH A;  2GRL A;  2NYJ A;  4YDO A;  1D8D A;  1O1T A;  1PAQ A;  3QB2 A;  4G11 A;  2IY0 C;  2JAB A;  4QQI A;  3ZVV A;  4K5A B;  3TWS A;  2HM8 A;  3BU8 A;  3CHS A;  5JHA A;  4E6H A;  4RLY A;  1N9A A;  4EBA A;  4LEU A;  3CSF A;  4GU5 A;  5KJM A;  3MYV A;  2V0P A;  3C5R A;  2WXL A;  1JCS A;  2ZXW E;  1TNB A;  1W3B A;  3UUX A;  3QNK A;  2GRM A;  1RZ4 A;  4J8F A;  4I6G A;  3APC A;  3FU0 A;  2IEJ A;  3ZU7 B;  3PDN A;  3MEK A;  5G2N A;  3DWL G;  3ASG A;  3FUD A;  4CDR A;  1XGW A;  1V55 E;  1N4R A;  1AP7 A;  2CG2 A;  4JC8 A;  4FUL A;  4GPM A;  3PE4 A;  3E37 A;  1D8E A;  3S7J A;  4YVO A;  5ENO D;  3FTX A;  4IUL A;  2KZT B;  3AS4 A;  4I1M A;  4EHM A;  3Q4A B;  2IOL A;  5G55 A;  3V79 K;  3CHR A;  3ZW3 A;  3JXJ A;  3EJN A;  3I5P A;  5BXU A;  4CGW A;  4J0U A;  3HXB A;  5CMY A;  5ITZ F;  2DIW A;  2YIN A;  4L9P A;  1HZ4 A;  3Q78 A;  2EQX A;  4I6J A;  5DBK A;  1A5E A;  4AEZ C;  2WXF A;  3ONK A;  3C3R A;  2R17 C;  4R7L A;  4RQI A;  1BI8 B;  4TXQ A;  3GZ2 A;  2LO6 A;  3TWX A;  1MQS A;  2VJ8 A;  5AYW D;  4UQX A;  4AP2 A;  5ANR A;  3U4T A;  5LOZ A;  3EU5 A;  2VSX E;  4G2V A;  2WXJ A;  4AY6 A;  2IO3 C;  4HFG A;  1HH8 A;  1O1R A;  3DSU A;  3KEZ A;  2KCV A;  3FTZ A;  4O6F A;  5E76 A;  3OAW A;  3DSV A;  4GTO A;  4L7T A;  1N52 A;  2QYU A;  3PZ1 A;  2Y4U A;  4Y6C A;  3NZU A;  3QWW A;  3RSE G;  3LJN A;  3E32 A;  3FUF A;  1Y8M A;  3ZGQ A;  4LUN U;  3NBN B;  3B7T A;  2V4L A;  2XEH A;  3L82 A;  3IBE A;  2BTD A;  3LJ3 A;  1MX4 A;  1OT8 A;  4GTR A;  3V30 A;  1NFI E;  3QWP A;  3QDN A;  3ISM C;  3ZHE A;  3QKY A;  1L5J A;  1KT1 A;  3Q9U C;  2J49 A;  3D9N A;  4XIF A;  3FTS A;  4I6E A;  2XEN A;  3E33 A;  1SZ9 A;  3C3Q A;  2OEW A;  3TXN A;  3HG0 D;  3MA5 A;  3Q73 A;  4OVU A;  2FUL A;  3TWQ A;  4UI9 J;  4GAA A;  4HNA D;  3ZYM A;  4GA2 A;  4TV3 A;  3U64 A;  3ZXP A;  2DBA A;  4UWG A;  4U96 D;  5KJK A;  2J8S D;  2WXP A;  4ATZ D;  3MX3 A;  3ENE A;  3PS6 A;  2AWI A;  2VGE A;  2PM7 A;  2OND A;  2E0I A;  2HE0 A;  3ZPJ A;  4LNU D;  2UY1 B;  3CQC B;  1NZN A;  2LUH A;  2ILR A;  3QC1 A;  3FHE A;  4K0R A;  4HVB A;  2IO2 C;  1E8W A;  2VSN A;  3FWV A;  4WNF A;  3LVQ E;  3TWR A;  3IEG A;  2WXH A;  5JJ6 A;  3DRA A;  4TUM A;  4G26 A;  1HF8 A;  3B7B A;  3L08 A;  1IHB A;  2A5E A;  3ABM E;  4MBG A;  4KVO A;  2XHE A;  1MX6 A;  3EU9 A;  1WM5 A;  4DLQ A;  3ASF A;  2Y3A A;  2OEV A;  2BUG A;  1JUQ A;  4DK5 A;  2XPI A;  4CDN A;  2KCL A;  3PZ4 A;  4GB9 A;  1SA5 A;  4EZL A;  2NXP A;  3RRM B;  4NAC A;  3Q15 A;  3SHF A;  3CK8 A;  4DX1 A;  3WG7 E;  4BES A;  3UTM A;  4C9B B;  4JHJ A;  1A17 A;  1NI1 A;  3DEO A;  3DPY A;  3TWV A;  3S7B A;  3L22 A;  4Q96 A;  3BEE A;  4ZFH A;  3PZD A;  4GMR A;  3CHQ A;  3ZFW A;  3RKV A;  1YCS B;  4YDY A;  3ZYK A;  3SGH A;  3SBT B;  3LS8 A;  2PQR A;  2JEK A;  5FIO A;  4HRM B;  3T8M A;  1KLX A;  3FTW A;  2RD0 A;  1FT2 A;  2LXM A;  4YVQ C;  3SD5 A;  4HQD A;  5C2Y A;  2Y0B G;  3FTU A;  4HOR A;  3ULQ A;  1OCO E;  4PUC A;  1ELW A;  5KWD A;  3R7R A;  1HS6 A;  1OWL A;  2L0T B;  4G23 A;  5HKP A;  3I4G A;  2XRZ A;  2AW6 A;  3ZEF A;  2A5U A;  3NQP A;  1GW6 A;  4MKT A;  2DWZ A;  3CVP A;  2WQH A;  3C98 A;  1KT0 A;  1HX8 A;  3B95 A;  3DST A;  3AG2 E;  2PQN A;  4ANW A;  5LCW J;  1TNY A;  3PUJ A;  1QYM A;  2MRI A;  4KMO A;  3HYM B;  1OWM A;  4TXR A;  3NOG D;  2WMO A;  3FU3 A;  3QAR A;  5FTP A;  1UJK A;  1S63 A;  3UX4 A;  3DXK G;  3Q75 A;  4ZHB A;  1QQE A;  2IF4 A;  1UG3 A;  4IRU A;  3T8K A;  2R2L A;  4M7C A;  2BF0 X;  4GA0 A;  3RO2 A;  2VGY A;  3ML8 A;  1N4S A;  5JA4 D;  1IKN D;  2CFU A;  1HXI A;  3QJZ A;  3MKQ A;  3CGH A;  3O4Z A;  3FH8 A;  3PNL B;  4XZ4 A;  4F1P A;  1TYQ G;  1YYH A;  4FHJ A;  1KPS B;  3HVE A;  5EYP F;  5EN5 D;  2I2O A;  4OAU C;  1V54 E;  2H6I A;  1WDY A;  3DSX A;  3RIB A;  3CQG B;  3TJP A;  3ESL A;  4BY6 A;  4BER A;  3EHR A;  4KZ0 A;  3UM2 A;  3DBS A;  2WPV A;  3P1U A;  1Y6I A;  4K5C A;  3PUK A;  1UJJ A;  3HIZ A;  2KAT A;  1H6K A;  3AG4 E;  4EEC A;  1X81 A;  2BKG A;  4WUY A;  1N0Q A;  2YQ8 A;  1FVF A;  4WNE A;  3F6Q A;  2QY7 A;  1UW4 B;  3KSL A;  4FLB A;  4UQZ A;  5LX8 A;  4J8D A;  5FZQ A;  3PZ3 A;  5BV1 A;  2WMN A;  2I6H A;  4B8C B;  1XNF A;  4YDE A;  3DSW A;  3FU5 A;  4GCO A;  4HOU A;  4WNG A;  2YHE A;  3PH0 C;  4GTV A;  3ML9 A;  4BT8 A;  4I43 A;  3AU5 A;  1K1A A;  3TWT A;  3E34 A;  3CVU A;  4L23 A;  1KZO A;  3SFY A;  5EKQ D;  3G2T A;  2XQ0 A;  3D9H A;  5BW8 C;  1U2V G;  4RSY A;  1NA0 A;  4GTS A;  1JWG A;  5KJL A;  3VTY A;  4PH4 B;  4C0M A;  3UKU G;  3RO3 A;  3VLF A;  2ETB A;  3T5V A;  4JXT A;  4U95 D;  1OY3 D;  4I9C A;  1Z6T A;  1E8X A;  2E2E A;  1JWF A;  4UWL A;  4J7W A;  4JB8 P;  4DJA A;  1SA4 A;  3NZS A;  4IYP A;  3RRN B;  2P9U G;  2J4B A;  1DCQ A;  1N94 A;  4JEH A;  3BG0 B;  3TG5 A;  5AEN A;  3LY9 A;  2XGS A;  2J9Q A;  5AIJ A;  4F7A A;  3GZS A;  4L1B A;  4ABN A;  1TN8 A;  4BSX A;  2I1J A;  3D9M A;  4LRZ A;  2EIK E;  2F8X K;  3CKB A;  4E85 A;  3UIP C;  2KZT A;  3TL5 A;  3LXU X;  3S7D A;  3HXE A;  3APD A;  3D9L A;  2L0I A;  4O1O A;  1MZC A;  2GRN B;  4EZJ A;  2CG3 A;  1UOH A;  1OCC E;  1QNF A;  5AQ9 A;  3ASN E;  4CYM D;  4JD2 G;  4OVV A;  5LCW C;  3U3W A;  1QBQ A;  4N2Q A;  5EIL A;  4UWF A;  3I3N A;  2ZU6 B;  4Q69 A;  5FWQ A;  5BPP A;  4WAF A;  2X6F A;  2XGM A;  2P2C P;  2VQ2 A;  2IOS A;  3CEQ A;  4B94 A;  2LAI A;  2R05 A;  4GTQ A;  3GZ1 A;  2XPY A;  1TJC A;  4WWO A;  2AXV A;  5BUZ A;  4GMJ A;  2EIM E;  1FT1 A;  3RRU A;  3LYA A;  3AAA C;  2FBN A;  2IFU A;  2X3M A;  2XGO A;  4BSZ B;  2F8Y A;  2P9L G;  3FH7 A;  1FPP A;  3PEU B;  2MYO A;  3CK7 A;  2C0M A;  4A3V A;  4CT4 A;  3BG1 B;  3ZIM A;  5CBN A;  3FUM A;  1DCE A;  1ELR A; 
#chains in the Genus database with same CATH homology
 3FTV A;  3LY8 A;  2XHE A;  5DIZ A;  4EBA G;  3CVV A;  2CHW A;  3RK6 A;  1LF8 A;  3D3M A;  4HOS A;  1B89 A;  3TGO A;  1WM5 A;  4DLQ A;  3ASF A;  2UWJ G;  2Y3A A;  4HOQ A;  2X38 A;  2XRY A;  2P58 C;  2BUG A;  2XCB A;  4JZY A;  1UN8 A;  1SZA A;  1JUQ A;  5A23 A;  5JHB A;  2WXG A;  4WWN A;  4DK5 A;  2XPI A;  5CCM A;  4FJZ A;  3R7Q A;  4ILI A;  4C0E A;  4CDN A;  4Y6W A;  2KCL A;  3SBS A;  4GB9 A;  3QWV A;  3ZRH A;  2C0L A;  3IHV A;  4JHK A;  1EDU A;  3ESK A;  2UY1 A;  4EZL A;  2CHZ A;  1TJF A;  2NXP A;  3QOU A;  4JPS A;  2FF4 A;  1JPL A;  1HG5 A;  3RRM B;  3ONL A;  5G04 J;  1DVP A;  4RG9 A;  4RG6 A;  4NAC A;  5EX3 A;  3RU0 A;  2NSZ A;  2JLB A;  3CV0 A;  3Q15 A;  1SQM A;  4DI3 A;  5T3R A;  3FFL A;  3Q47 B;  3SHF A;  4N5C A;  3CK8 A;  4FU3 A;  4A55 A;  3FUK A;  2WXK A;  4BTB A;  3SFZ A;  2PM6 A;  3PVL A;  5FQ4 A;  4AY5 A;  3CK9 A;  4YND A;  4JEU A;  5EDS A;  4ILG A;  4B8A A;  5G05 J;  4XKB A;  4C9B B;  3CVY A;  2MOW A;  4FLH A;  4JHJ A;  4MRU A;  1E7U A;  4BX8 A;  3G2S A;  1A17 A;  3KAE A;  3TAX A;  5KJN A;  5FZS A;  2XPZ A;  3CVQ A;  3U9W A;  3S7B A;  1S0P A;  3FTY A;  3B7U X;  2J08 A;  4P29 A;  2CFZ A;  4J8S A;  3HHM A;  3L22 A;  4G1T A;  1H0A A;  3JYS A;  4Q96 A;  4AOF A;  5AJD A;  3GW4 A;  5ARF A;  3BEE A;  3MV3 B;  4OYS A;  1WY6 A;  4GZ5 A;  3MKQ B;  3PZD A;  1ZU2 A;  1H2V C;  5A7D B;  3CST A;  4H7Y A;  3TG4 A;  2C2L A;  1ZBP A;  5FQ7 A;  3CHQ A;  3FH5 A;  5D0O D;  3ZFW A;  2X6H A;  3RKV A;  2VYI A;  5LP0 A;  1IQR A;  2AXU A;  1Z3Y A;  1MHQ A;  4PDX A;  4GYO A;  3ZYK A;  3SGH A;  2ION A;  2KCK A;  3HVE B;  3OXG A;  1E96 B;  1HU3 A;  1NP7 A;  2WXO A;  3QK0 A;  4K03 A;  3SBT B;  3LS8 A;  2QFC A;  2PQR A;  4DPR A;  4BTA A;  3CLJ A;  2JEK A;  4MLP A;  3PRZ A;  4U0U A;  2WXQ A;  3JQ1 A;  4GA1 A;  3T8M A;  2YNQ A;  1KLX A;  3G2V A;  4KYO B;  3FTW A;  2RD0 A;  2IJG X;  4YVQ C;  1NA3 A;  3SD5 A;  4U04 A;  3CHO A;  3CHP A;  3IKO B;  4BX9 A;  4JL0 A;  5C2Y A;  4J8E A;  3FTU A;  4D10 C;  2J09 A;  3NF1 A;  3FDH A;  4XX5 A;  5D0Q D;  4FAD A;  4HOR A;  2HR2 A;  3MCX A;  5HI7 A;  3G2W A;  2V8S E;  3FUJ A;  3ULQ A;  4PUC A;  1ELW A;  3R7R A;  4ACK A;  4L2Y A;  1HS6 A;  4GYY A;  1OWL A;  3S2A A;  2L0T B;  2XEV A;  4G23 A;  4GZC A;  4GYW A;  1BPO A;  3B7R L;  5KCM A;  3ZXS A;  3I4G A;  2LAH A;  4CEM A;  4XKC A;  2AW6 A;  3ZEF A;  2XRZ A;  2A5U A;  3NQP A;  1GW6 A;  4MKT A;  4BWR A;  2VSY A;  4Q94 A;  5CCL A;  1IHG A;  3PNT B;  3CVP A;  2FO7 A;  1FVH A;  2GRL A;  4UQY A;  2WQH A;  2I9C A;  3TXM A;  3C98 A;  1KT0 A;  1PAQ A;  3QB2 A;  4G11 A;  1INZ A;  3EHM A;  1HO8 A;  1HX8 A;  2KC7 A;  3VLD A;  3FUH A;  1IYG A;  2PZI A;  3R9A B;  4B89 A;  1OWO A;  2XCC A;  3ZHE B;  3ZVV A;  1HG2 A;  2AXZ A;  2HM8 A;  2PQN A;  4ANW A;  3CHS A;  3LDZ A;  2X6I A;  5LCW J;  5JHA A;  4E6H A;  4EBA A;  4LEU A;  3FY4 A;  2WM9 A;  4PS8 A;  3CSF A;  3OXF A;  3PUJ A;  3UT4 A;  3CVW A;  3ZYL A;  2MRI A;  4GU5 A;  4KMO A;  5KJM A;  3HYM B;  1OWM A;  2LNI A;  3IHY A;  3MYV A;  4UI9 K;  4FHK A;  2WMO A;  3FU3 A;  4I17 A;  3K9I A;  3QAR A;  4KVM A;  2NC9 A;  5FTP A;  4BFR A;  1UJK A;  3UT8 A;  2V0P A;  3UX4 A;  3N71 A;  1H19 A;  2WXL A;  2WXM A;  1QQE A;  2IF4 A;  3UQ3 A;  1W3B A;  3UUX A;  3QNK A;  1UG3 A;  4IRU A;  2GRM A;  4PS3 A;  5T8I A;  4J8F A;  2IQC A;  3MGB A;  4I6G A;  3APC A;  3FU0 A;  1N54 A;  3EHN A;  2BF0 X;  3IV0 A;  4IN3 B;  4GA0 A;  3LPZ A;  3VLE A;  4XI0 A;  5C1D A;  3PDN A;  4BT9 A;  3RO2 A;  4JVS A;  3PEV B;  3MEK A;  5G2N A;  2VGY A;  3ASG A;  3LEW A;  2LSV A;  4H7X A;  3ML8 A;  2WXN A;  3VTX A;  4J6I A;  4I2W A;  1H2U A;  5CHE E;  3FUD A;  4CDR A;  3SF4 A;  3FUN A;  1XGW A;  4KZC A;  2CFU A;  3FUL A;  1HXI A;  3QJZ A;  4JA9 A;  3FUE A;  3MKQ A;  3CGH A;  2CG2 A;  3MKR A;  2MHK A;  3O4Z A;  4JC8 A;  4FUL A;  4NRH B;  3SNX A;  2PL2 A;  3FH8 A;  4CDM A;  3OXL A;  3PE4 A;  2VTB A;  3PNL B;  4XZ4 A;  3S7J A;  4YVO A;  3URZ A;  3HDX A;  5BNW A;  3FTX A;  4FHJ A;  4U07 A;  5JJT A;  3HVE A;  5FT9 A;  4GPK A;  1QZ2 A;  4IUL A;  2KZT B;  3AS4 A;  4LCT A;  2I2O A;  3KS2 A;  4I1M A;  3UPV A;  3UT7 A;  3RIB A;  3Q4A B;  2VGX B;  2IOL A;  5FQ8 A;  5G55 A;  3CQG B;  1EYH A;  2RG8 A;  4NUR A;  3TJP A;  3CHR A;  3ESL A;  4CRW A;  2OVF A;  3ZW3 A;  3ZN3 A;  4BY6 A;  3EJN A;  3I5P A;  2V5F A;  4N3C A;  3CVX A;  4KZ0 A;  3DBS A;  2WPV A;  4UI9 C;  4CGW A;  4FP7 A;  4J0U A;  3P1U A;  1Y6I A;  5CMY A;  4F1S A;  2DIW A;  3D9J A;  3PUK A;  4MS6 A;  2J07 A;  1UJJ A;  2YIN A;  3HIZ A;  4GML A;  2KAT A;  1HZ4 A;  4GZ6 A;  5M72 A;  2KM4 A;  1H6K A;  2EQX A;  2R59 A;  4I1O B;  4UWK A;  4I6J A;  4EEC A;  4G24 A;  4WUY A;  2HYZ A;  5DBK A;  3MJW A;  2X6K A;  2YQ8 A;  3D9K A;  1FVF A;  4WNE A;  5J08 A;  2QY7 A;  4N39 A;  2WXF A;  1UN9 A;  4AEZ C;  1UW4 B;  5A6C A;  3JCK C;  4FLB A;  3ONK A;  3WXX A;  3D9I A;  4UQZ A;  4APO A;  4B0Z A;  3QAQ A;  5LX8 A;  5T4Y A;  2R17 C;  4HS2 A;  3EDT B;  4DI4 A;  4J8D A;  1FCH A;  4R7L A;  4WWP A;  5FZQ A;  5BV1 A;  2WMN A;  4F3V A;  2I6H A;  3L16 A;  1X5B A;  2A4Z A;  4JHR A;  4ACL A;  4B8C B;  5BT1 A;  2WB2 A;  1XNF A;  5HQ8 A;  4UWH A;  3GZ2 A;  4KT6 B;  3ASH A;  2LO6 A;  2WXR A;  3FU5 A;  1MQS A;  3FP3 A;  2VJ8 A;  4GCO A;  4HOU A;  4WNG A;  2YHE A;  3PH0 C;  5AJL A;  1E90 A;  2VSO E;  2X6J A;  4FA6 A;  3ML9 A;  1YA0 A;  4I43 A;  5AYW D;  4UQX A;  4BT8 A;  3LY7 A;  5G05 C;  3FU6 A;  4AP2 A;  4URK A;  3AU5 A;  4N2S A;  5ANR A;  3U4T A;  4ATG A;  3FUI A;  5LOZ A;  3CVU A;  4AIF A;  4L23 A;  4A1S A;  2VSX E;  4G2V A;  5EKQ D;  5EX0 A;  3D9P A;  4EQF A;  4EPZ A;  2AVP A;  2WXJ A;  4AY6 A;  3G2T A;  2Q7F A;  5E75 A;  2XQ0 A;  3LKU A;  4N3B A;  4HFG A;  1HH8 A;  4EZK A;  4RVB A;  2J4D A;  1Z3X A;  3KEZ A;  3AU4 A;  3AS8 A;  5BW8 C;  3AS5 A;  4RSY A;  2KCV A;  3FTZ A;  4O6F A;  3P2B A;  5E76 A;  3OAW A;  4L7T A;  1NA0 A;  1N52 A;  1JWG A;  5KJL A;  3VTY A;  5FJY A;  4KBQ A;  2Y4U A;  2VGX A;  4PH4 B;  4Y6C A;  4C0M A;  3D9O A;  3EIQ C;  3NZU A;  4I2Z A;  3RO3 A;  3VLF A;  3QWW A;  3CIA A;  4ME2 A;  2LSU A;  3FUF A;  3ZGQ A;  1Y8M A;  4FJY A;  4LUN U;  3T5V A;  3B7T A;  4JXT A;  4ILH B;  3ASD A;  2V4L A;  4I9C A;  1Z6T A;  2IU1 A;  4LER A;  5BV0 A;  1H2T C;  1E8X A;  4XI9 A;  4ANU A;  2E2E A;  3IBE A;  1JWF A;  4UWL A;  4KXK B;  4CT0 A;  3U66 A;  2BTD A;  4DJA A;  2L6J A;  3LJ3 A;  4QFV A;  3L17 A;  3NZS A;  1E8Z A;  4IYP A;  4ANV A;  1DNP A;  3RRN B;  2GW1 A;  3QWP A;  2J4B A;  4JEH A;  1ELK A;  3CVL A;  3MZL B;  3G2U A;  1U3D A;  3BG0 B;  3QDN A;  3TG5 A;  5ARG A;  5AEN A;  3LY9 A;  2XGS A;  2J9Q A;  5ENN A;  2VTB B;  5AIJ A;  2I1K A;  3DPD A;  3ZHE A;  3LVR E;  3JUI A;  4F7A A;  3GZS A;  4L1B A;  4ABN A;  2WVI A;  3QKY A;  1TEZ A;  1L5J A;  4BSX A;  2FI7 A;  2FEZ A;  3EIJ A;  3LCA A;  1KT1 A;  3ZYQ A;  1U3C A;  3MV2 B;  2I1J A;  2J49 A;  3D9N A;  4XIF A;  3FTS A;  1VDY A;  4I6E A;  2Y4T A;  4JA7 A;  1SZ9 A;  3D9M A;  4LRZ A;  3T5X A;  4AV7 A;  5LFA A;  3CKB A;  2YHC A;  4E85 A;  3OTN A;  2KZT A;  3GYZ A;  3TXN A;  3TL5 A;  3LXU X;  1E7V A;  3S7D A;  4ANX A;  3MA5 A;  3APD A;  3D9L A;  2L9B A;  4OVU A;  2FUL A;  2L0I A;  4L2L A;  4UI9 J;  4GAA A;  2DCP A;  3ZYM A;  4GA2 A;  3CR3 A;  4TV3 A;  4EZJ A;  2CG3 A;  3SI5 A;  2WQ7 A;  5G04 C;  1QNF A;  3U64 A;  3L6A A;  3SZ7 A;  4HLE A;  1HFA A;  2DBA A;  1PY1 A;  4UWG A;  4U63 A;  4DLO A;  1EPU A;  4CCA A;  1EF1 C;  4U0Z A;  4OVV A;  3JQ0 A;  5LCW C;  3U3W A;  1PC2 A;  2WXI A;  4F53 A;  4N2Q A;  1OWP A;  2M63 A;  4JW1 A;  4TUU A;  4I9E A;  5KJK A;  4UWF A;  5J90 A;  2WXP A;  3I3N A;  2ZU6 B;  4Q69 A;  4V3I A;  3APF A;  4GZ3 A;  5FWQ A;  1OUV A;  4HXI A;  5BPP A;  3CKC A;  4WAF A;  2X6F A;  3MX3 A;  2XGM A;  3ENE A;  3PS6 A;  3FEY A;  4A3T A;  2AWI A;  4AM9 A;  5JJ7 A;  3CHM A;  2VQ2 A;  1OWN A;  2PM7 A;  2IOS A;  2OND A;  3CEQ A;  4GCN A;  4B94 A;  2E0I A;  4AJW A;  3B13 A;  2LAI A;  4M3O A;  4U8H A;  3PE3 A;  3Q5M A;  1WAO 1;  4G25 A;  3ZPJ A;  4I1A A;  3GZ1 A;  2XPY A;  4CGV A;  2UY1 B;  4GZD A;  3CQC B;  1NZN A;  2R5S A;  4NQ0 A;  2ILR A;  3QC1 A;  1TJC A;  3FHE A;  4K0R A;  4PS7 A;  4WWO A;  5ANL A;  4HVB A;  4A1G A;  2AXV A;  1E8W A;  2VSN A;  3FWV A;  4TRQ A;  2CHX A;  4GMJ A;  5BUZ A;  4WNF A;  4HOT A;  3LVQ E;  3RRU A;  1HE8 A;  3FEX A;  3LYA A;  2GGF A;  3IEG A;  5CMW A;  5FZR A;  2HO1 A;  4AVX A;  2FBN A;  2IFU A;  2WXH A;  5FQ6 A;  2X3M A;  2XGO A;  2OVB A;  1IQU A;  3RJV A;  5JJ6 A;  4WND A;  3I4R B;  4XE0 A;  2WQ6 A;  2OOE A;  3O48 A;  4N3A A;  4AXH A;  1E8Y A;  3B7S A;  4APF A;  3Q49 B;  3CVN A;  3S7F A;  4U0S A;  3PRE A;  3FH7 A;  4G26 A;  1HF8 A;  3E4B A;  3PEU B;  3CK7 A;  2C0M A;  1P5Q A;  4A3V A;  3KD7 A;  3L13 A;  4CT4 A;  3BG1 B;  4W9R A;  2OV8 A;  3L08 A;  4FC8 A;  3ZIM A;  3FUM A;  3UMV A;  3L54 A;  1ELR A;  4KVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...