1ELWA

Crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
117
structure length
117
Chain Sequence
EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords TPR1-DOMAIN OF HOP
total genus 49
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elwA00
1PC2A 4BTBA 3Q4AB 3KAEA 5M72A 3FP3A 3JYSA 4JHRA 2KC7A 4WNGA 3ZHEB 5KJKA 1NZNA 5D0QD 4J8DA 5DIZA 2HYZA 1WAO1 3HYMB 5CCLA 4J0UA 2XPIA 2VQ2A 2FBNA 3EDTB 2IFUA 2I6HA 4G26A 4UQXA 4WUYA 5FJYA 2UY1B 3LYAA 4G24A 2VGXA 4GA0A 5G05C 4GA1A 4HOQA 3RO3A 4U0UA 5A7DB 3N71A 5DBKA 2AVPA 3FFLA 4UI9K 3NF1A 3ASGA 2DBAA 4UI9J 4JA9A 4YVQC 5BW8C 3PDNA 3KD7A 3CK9A 3QKYA 3OXFA 2VSYA 1HH8A 2R5SA 3LCAA 5BT1A 4U04A 4GYOA 5JJ6A 3ZN3A 3ULQA 5LCWC 3LY8A 2HR2A 4AY6A 2YQ8A 3LPZA 4BT9A 4AM9A 3ESKA 4HORA 4CGVA 4ABNA 3MKRA 4N39A 1ZBPA 4GYYA 4KBQA 1ELRA 4Y6CA 2JLBA 5ARFA 5BNWA 3CKBA 2UWJG 1IYGA 3QWVA 2VYIA 4XIFA 1ZU2A 2FEZA 2C0MA 4AY5A 5JJ7A 3PE4A 3S7FA 4HOTA 3GW4A 2VGYA 4GZ6A 4I1AA 2PZIA 1W3BA 2Y4UA 1XNFA 2KCKA 4XI9A 5EX3A 3IEGA 4RG6A 3ASDA 3VTYA 4BWRA 3OXLA 3TAXA 2FF4A 2Y4TA 1Y8MA 3E4BA 3TG5A 3GZ2A 2HO1A 4J8EA 3TGOA 3QOUA 2P58C 3QWWA 4I2ZA 2BUGA 2YHCA 1IHGA 5C1DA 3CVLA 4U0SA 4WNFA 1NA0A 4G1TA 5EKQD 4JL0A 2ONDA 3Q49B 4KXKB 5FT9A 1QQEA 3CVPA 3CK7A 4N3AA 1KLXA 3SZ7A 3PE3A 5HQ8A 3K9IA 5G04J 3R9AB 4AIFA 2QFCA 4G2VA 1KT0A 4HOUA 3WXXA 4BTAA 5CCMA 1KT1A 2VGXB 2J9QA 3AS8A 4GZ5A 2KATA 3CKCA 3RU0A 4WNEA 5KJNA 3MV3B 5EX0A 2C2LA 3MV2B 5D0OD 2PL2A 3U3WA 4N2QA 4N3BA 4HOSA 3UUXA 4F3VA 1OUVA 3S7DA 3MA5A 1B89A 2XCBA 5CHEE 3CVNA 4I9CA 3CV0A 4YVOA 2GW1A 3VTXA 4A1SA 2V5FA 2FO7A 2LNIA 4B94A 2XCCA 2XGMA 5G04C 3RIBA 2WQHA 3AS4A 2OOEA 3BEEA 3FWVA 2IF4A 3LY7A 4NRHB 4CGWA 3Q15A 1HZ4A 2XEVA 4IN3B 4U07A 1QZ2A 4N3CA 5AYWD 4GA2A 1ELWA 2UY1A 5LCWJ 2MHKA 4UQZA 2WPVA 4H7YA 4U0ZA 2KCVA 3ASHA 3CK8A 3AS5A 5ARGA 2NC9A 5FZRA 5JJTA 1NA3A 5KJMA 2LSUA 3GZ1A 5G05J 4I2WA 3ZGQA 3QWPA 3UPVA 3OXGA 4G25A 3UQ3A 3ASFA 2PQRA 4GCOA 1YA0A 1FCHA 3SF4A 4GCNA 3TG4A 5FZSA 5HI7A 3U4TA 4APOA 1HXIA 4RG9A 4EQFA 4N2SA 2L6JA 3Q5MA 4I9EA 3RJVA 4O6FA 3CVQA 4UQYA 4BT8A 3ZFWA 3ZPJA 4ME2A 4Y6WA 3URZA 2LSVA 4GPKA 3LKUA 4CDRA 1E96B 2XGSA 5FZQA 3S7BA 4LEUA 2XGOA 4NQ0A 3S7JA 3O48A 3KS2A 4G23A 1TJCA 4I17A 4W9RA 2VSNA 3Q47B 3GYZA 3LY9A 4WNDA 2E2EA 3QDNA 2FI7A 4J8FA 2KCLA 3MEKA 3CEQA 4H7XA 2Q7FA 4KYOB 2C0LA 5FTPA 4N5CA 3RKVA 3RO2A 3ZHEA 1WM5A 4JA7A 4GZ3A 5A6CA 4XI0A 4UI9C 5KJLA 4YNDA 2PQNA 1A17A 4GYWA 1P5QA
chains in the Genus database with same CATH superfamily
1S70B 3OTNA 2OEWA 4J8DA 2BF0X 1WAO1 3DSSA 2JEKA 1S64A 1OCZE 3KEAA 3NQPA 5E76A 3ASGA 3J5PA 3CK9A 4U95D 3FTWA 3Q78A 5ENPD 2FO1E 1MHQA 4D10C 5JJ6A 3V79K 4TXPA 4QFVA 3NOCD 4GYYA 5ARFA 3S2AA 3QB2A 5CRUA 4HRNA 1QBQA 4HOTA 3PE4A 1X5BA 1N0QA 2PZIA 2AW6A 3TAXA 4PUCA 3QWWA 1ZB1A 5C1DA 3I5PA 1E7VA 4U0SA 5HQ8A 4OAVB 4R7LA 3UIPC 1DC2A 4L2YA 1EF1C 1KT1A 2J9QA 3FULA 4Z68A 4N3BA 3Q7FA 1S0PA 3CVNA 4J8SA 3SO8A 4CYMD 1MYOA 1O1RA 3ISMC 3TWQA 2XEVA 2Y69E 1OXJA 3UT7A 1H2VC 3DWLG 5ARGA 2H6FA 3BG0B 5KCMA 2GRPB 3CHPA 4APOA 2L6JA 3G2VA 4IULA 5FQ4A 4URKA 2X6FA 3Q47B 3FU6A 3PEUB 4KZCA 1FT2A 3FH8A 1WM5A 4TRQA 4GZ3A 1FVFA 1PC2A 2WXOA 5B1AE 2R59A 2RD0A 3MKQB 2F0YA 3ZHEB 1NZNA 3SI5A 4J0UA 5ENSD 1SQMA 1D8DA 4BX9A 3TWSA 3PUJA 4JEHA 2WXKA 4UI9J 3FEYA 3MCXA 4GTTA 4TV3A 3V2OA 1HE8A 5EN5D 5ENRD 4GMJA 3Q9UC 5LOZA 2BKKB 1K1AA 4KT6B 5HRYA 1OWPA 4I1MA 2HR2A 2WXQA 3ESKA 3FU0A 4CGVA 5KBAA 1OCRE 1ELRA 2JLBA 2UWJG 2X6IA 1HU3A 2QYUA 3D3MA 4NACA 3KSLA 3UM1A 1DCQA 4XZ4A 3Q7AA 3UMVA 2XEHA 3Q49B 5FT9A 3L13A 1BU9A 5B3SE 2AXUA 2XHEA 4JEUA 2VGXB 4M3OA 1Z3YA 4L1BA 3C5RA 4UWGA 1B89A 4PS7A 5CHEE 3VTXA 4MLPA 2XGMA 4F6RD 1UW4B 3UM0A 2ZGGA 3CHMA 4CGWA 1ELWA 4UQZA 3D9KA 1NA3A 1O5MA 3L54A 3DPYA 3ZYLA 3LS8A 1D8EA 3FUEA 2EIME 4LUNU 4O6FA 3PVLA 2XENA 3D9LA 1UN8A 2I1KA 2VSNA 2E0IA 1JCRA 3AG2E 2NYJA 3MEKA 1OCOE 2Q7FA 3ZHEA 4JA7A 4AP2A 3B95A 4ATGA 5E75A 4GTRA 2MYOA 3B7BA 1SVXA 4CDRA 4G24A 4GA0A 1N9AA 4J8YA 4WWOA 3ZN3A 1XGWA 3PEVB 3PZ3A 4O1PA 4HORA 3UKRG 4I6JA 2X6JA 2FEZA 3VTYA 2GRNB 5EX3A 3ASDA 1IXVA 3QOUA 3R7RA 4N3AA 4JXTA 3WXXA 3AS8A 1OCCE 1BI7B 4C48B 2P9LG 2XCBA 1GW6A 2XCCA 3JCKC 2V4HC 3BU8A 4RSYA 1QZ2A 2LSUA 3RRUA 4ZHBA 4MBGA 3ZGQA 4CDNA 4U8HA 4L23A 3NAWA 3ULEG 1HXIA 5CECB 4PS8A 2LSVA 2V4LA 4DUIA 2GRMA 2HE0A 5KNGA 4YDWA 4I17A 2A5UA 5ENOD 3GZSA 2WXMA 2OEVA 4JHRA 5D2MC 5CCLA 5G2NA 3TXMA 1MZCA 5DBKA 2NSZA 1Y6IA 1N4QA 2LXLA 3X2QE 3WG7E 2IJGX 4GYOA 3ULQA 2XRZA 3ESLA 5CERB 5A23A 3MKRA 4KBQA 1IYGA 4AOFA 4HB5A 4I1AA 3RK6A 2MRIA 4EBAG 1NFIE 3FUJA 1EPUA 4EZLA 4OVUA 3PNTB 4GZ5A 2GRQB 2QYJA 4N2QA 5BXOA 3UUXA 3S7DA 4EECA 1IQUA 3FTVA 2LXMA 5G04C 3FWVA 1K8KG 2P9NG 4H7YA 2H6IA 5KWDA 1HX8A 3UPVA 3W9FA 3CVUA 1LD8A 5JMND 1E96B 3S7BA 1WG0A 4I6EA 3KS2A 3T5XA 4GTOA 5FTPA 4KYOB 2C0LA 3CVXA 4DLOA 1TNBA 4UI9C 3AU4A 3I4RB 4GYWA 5BV0A 4RLYA 3C3RA 5M72A 1OWLA 4GPKA 5AARA 4UQXA 4PDXA 2ZISA 2ZXWE 3U66A 1E8YA 3OXFA 4IRUA 1E7UA 3EHQA 3PZ4A 4NURA 4AY6A 3ZIMA 3ASOE 3DSWA 1YMPA 3S7FA 2IU1A 4X8QA 3OXLA 2QY7A 3PRZA 5J90A 3ZW3A 4FHKA 4BEPA 1MX2A 2B0OE 5LP0A 4G8KA 4LNGA 1S63A 2B6CA 1TNYA 4UWFA 3LEWA 3R9MA 2J4DA 2RKKA 5FWQA 4U07A 4C9BB 4TXQA 2UY1A 3GZ1A 2KM4A 5LFAA 3SFZA 4FJYA 1V54E 2DCPA 4HBDA 3QK0A 4J7WA 4FADA 2WXPA 2KXPC 3URZA 2M63A 1E90A 2DWZA 3KEZA 4Q94A 4W9RA 1K3ZD 4BX8A 3MGBA 2J8SD 4U8VD 3ULYA 4XI0A 2YINA 1YYHA 2IO2C 5KJLA 4GMLA 3TWUA 4DX2A 3Q4AB 3FUKA 3MYVA 4HXIA 2UY1B 3E30A 3LYAA 4ILGA 3PZDA 3EHNA 3NOGD 1H6PA 4G11A 4GMRA 1Z3XA 5AQAA 1HH8A 4HRLA 2P9IG 1TN6A 3PH0C 4PS3A 2P9UG 1HFAA 2VYIA 4ACLA 5CMWA 2GROB 2IY0C 1WDYA 4A63B 4WNFA 2ONDA 3HVEB 1TR4A 5G04J 2X6HA 3BUAA 3DEOA 4BESA 3B13A 1AP7A 1WY6A 3FU5A 3CSTA 2PL2A 1DVPA 2ILRA 1QYMA 4BETA 2FO7A 3RRNB 3T9KA 4JD2G 2WQHA 3ZU7B 4CCAA 3UT8A 2WPVA 4U0ZA 2I1JA 3L6AA 3ML8A 3OXGA 4DI3A 2BKGA 1ELKA 5EDSA 4GCNA 5FZSA 5BUZA 3DSVA 3QARA 3L16A 4WNDA 4J8FA 1KZOA 1DCEA 4LSZE 3L9TA 3T5VA 2KC7A 1FT1A 2ZIRA 2DYSE 5FJYA 4ACKA 2BTDA 2VGXA 3JUIA 3ZNGA 4B8AA 4I6GA 1SZAA 4YVQC 3SBSA 3NZUA 3ONLA 3LCAA 3CVWA 4DPRA 4GTMA 3LY8A 2X3MA 2YQ8A 3BQOA 1BD8A 4HNAD 4AY5A 3UXGA 4RG6A 4A3TA 3ASNE 4K03A 4J8EA 1O1SA 2P58C 3UT4A 2BUGA 4F7AA 5EKQD 3EHMA 4LNUD 4AV7A 2XZDG 2OVFA 2XS8A 3K9IA 3I4GA 4FLBA 3AG4E 2C2LA 3MV2B 5ENNA 4HOSA 1OUVA 4HFGA 3SBTB 2WQ7A 2IF4A 4APFA 2VTBB 5G05J 3QWPA 3ASFA 3IKOB 1BPOA 3ZPJA 2J09A 4K5AB 2KZTA 3Q75A 3S7JA 1H2TC 3EUVA 2ETCA 4J6IA 2P9SG 3L82A 2WXIA 4AEZC 5ITZF 3UI2A 5CEDB 2OV8A 4GZDA 1TEZA 2PM6A 2VQ2A 4BTAA 2WXLA 1JPLA 2L9BA 2H6HA 4GA1A 3N71A 1JWGA 3ZVVA 3UM3A 2P9PG 2EQXA 2R5SA 4YDEA 3DXKG 1X81A 2A4ZA 3LPZA 4BT9A 2A5EA 2GRLA 1Z6TA 3IHVA 4EZKA 3FUHA 3J5QB 1SA5A 4B89A 3FY4A 1N4PA 3MJWA 5AJLA 4JPSA 1LTXA 3EJNA 5T3RA 1G3NB 3V30A 3ZRHA 4AIFA 2DVWA 2KATA 2QZAA 4B8CB 5D0OD 4GU5A 3TXNA 1E8XA 5CMYA 3D9HA 4E85A 2V5FA 4F1PA 3RIBA 2AXZA 4BERA 2V0PA 3JXIA 3AU5A 4N3CA 1INZA 2VTBA 3G2SA 5JJTA 2R05A 4I2WA 2L6BA 3P2BA 3U64A 3FEXA 4DX5D 4GTSA 4TXRA 4ME2A 5AAOA 4XE0A 3Q79A 4ANVA 5ENQD 4EHMA 4L2LA 3SNXA 2OCCE 5CRVA 3QAQA 3CLJA 3UTMA 3FUNA 3L08A 5ANRA 4JC8A 2IOSA 3TGOA 5DIZA 4AVXA 3TWVA 2I6HA 1IHBA 3E37A 4FHJA 2XQ0A 4UI9K 2P2CP 3FTSA 3ZEFA 4O60A 4P29A 1RW2A 1UN9A 3UKUG 1HS6A 1AWCB 3FHEA 3DPDA 3HXDA 1HG5A 3DEPA 4TUMA 4N39A 4QQIA 4Y6CA 2MOWA 2LAHA 3DRAA 5D66A 1HF8A 2KBXA 3D9MA 4HQDA 4U96D 2PM7A 2R03A 3RRMB 4CEMA 3ABLE 4PH4B 3CQCB 5HS0A 3CK7A 3RAUA 3LVQE 2IONA 3SHFA 4G2VA 1KT0A 4JHKA 4V3IA 2WM9A 3KSQA 3DSTA 2RFAA 5AQ9A 3OAWA 4K5BA 3CGHA 3CSFA 3MA5A 4I9CA 3PNLB 4GB9A 1E8ZA 3LDZA 3CHOA 3E33A 4FULA 2J49A 2CG3A 3AS5A 2NC9A 4TUUA 1EYHA 3FTYA 3UQ3A 1UJJA 2PQRA 2EILE 3HXEA 3D9JA 3W9GA 4G8LA 4BT8A 2VSOE 3ENEA 4LEUA 4MRUA 4I43A 2KCLA 3SFYA 3CEQA 3DSXA 4ILIA 4FP7A 5BXUA 4K0RA 3FU3A 3I3NA 1N54A 4FA6A 1SZ9A 4BTBA 3FP3A 4BSZB 5T4YA 2Y0BG 3UM2A 1PAQA 4OAUC 1EDUA 4JA9A 5BW8C 3PDNA 4EBAA 3APDA 5LCWC 4C0MA 1IKND 3T8MA 3TWXA 4F53A 2WVIA 4ABNA 3JUEA 4GTVA 5IY5E 1V55E 3R9AB 4GZ6A 1XNFA 1QNFA 2F37A 2WXGA 4HS2A 3E4BA 4HI8A 4KVOA 3D9PA 1MX4A 4Q69A 4DLQA 3ZYMA 4G1TA 3MX3A 4DX6D 4Q96A 1TNOA 3ZUVB 2IO3C 2XZTG 3E32A 4DX7D 2JABA 3B7RL 5G55A 5LX8A 1OWNA 4YVOA 3UINC 2LO6A 2ZU6B 2QC9A 4EZJA 4RVBA 5FZRA 5KJMA 3SGHA 2WQ6A 2XPYA 1YA0A 4ATZD 1FCHA 4KVMA 3TG4A 5HI7A 4EQFA 4DJAA 3LKUA 3L17A 2XGSA 3IHYA 5AENA 2VSXE 4MS6A 1U2VG 2V8SE 4JB8P 4XX5A 5A6CA 4BY6A 1A17A 2P9KG 4IYPA 4NIKA 3JYSA 2ETAA 5JHBA 2CHZA 3D9NA 3RO3A 1UG3A 4U7EB 3B7TA 1MQSA 1HG2A 1RZ4A 3KD7A 3T8KA 3AG1E 3QC1A 2WB2A 1ZBPA 1A5EA 2FULA 2CHWA 1YCSB 5EX0A 3FTUA 1W3BA 5AQ7A 1PY1A 3FTZA 4DRXE 1FVHA 3SFXA 1QQEA 3ZXPA 1N4RA 4JZYA 3U3WA 2GRRB 3DBSA 4HLLA 4F3VA 3FUIA 2J07A 3PZ2A 3APFA 4EPZA 1H19A 2LNIA 3NBNB 3HXFA 4XKBA 3LY7A 4U8YD 2XPZA 4FU3A 3B7SA 4LRZA 3Q5MA 5FIOA 3CVQA 3VLDA 3ZFWA 5AIJA 3PREA 4N5CA 3Q73A 3V31A 5T8IA 3C3OA 2XS1A 3DSUA 3DXMG 1MJ0A 2HYZA 4FLHA 5G05C 4BFRA 3E34A 3D9OA 4B93B 5A7DB 4MKTA 2DBAA 3G2UA 3VLFA 2VSYA 2V5QC 3G2WA 1NL4A 4ANXA 2IQCA 4AM9A 3NB2A 4FJZA 1OWOA 3CVVA 3IV0A 5FINA 2Y4UA 4BWRA 1TYQG 2FF4A 1TN7A 2I9CA 2YHCA 2CG2A 3Q9NC 1LF8A 3SZ7A 3IBEA 2QFCA 3PS6A 4HOUA 3FDHA 1JCSA 3SY2A 2WXRA 1U3CA 3BEEA 3AJIA 3Q15A 1HZ4A 4GA2A 1SA4A 2WXJA 2DYRE 1L5JA 2AWIA 3F6QA 3U4TA 3LJ3A 3ZXSA 5EYLA 4F1SA 4JVSA 4E6HA 1JCQA 1IQRA 5AQBA 2XEEA 3LY9A 1OY3D 1K1BA 4UWKA 1H2UA 4DK5A 3QDNA 3ZKJA 2R17C 4WWNA 1KZPA 5BPPA 1OWMA 1U3DA 1NI1A 2WXHA 3EIJA 3HYMB 4G26A 3EDTB 4A55A 4WUYA 3APCA 4UWHA 3U9WA 3HG0D 5EIBE 2KZTB 2H6GA 3ONKA 1H0AA 3TWTA 4RQIA 2I2OA 3HIZA 1DNPA 2ETBA 5FQ7A 4JW1A 3QWVA 3QJZA 1ZU2A 4AJWA 2C0MA 5JJ7A 2F8YA 4YDYA 2KCKA 5C2YA 5JA4D 4CZ2D 1H6KA 3JQ0A 3EIQC 3CHRA 2GGFA 3CVLA 3LJNA 3ZYQA 4HLEA 3ABME 3CVPA 1E8WA 3PE3A 4A3VA 5J08A 3HXCA 3RU0A 3MV3B 1UOHA 2RG8A 4GZCA 4UWLA 2OVBA 3ML9A 4CT4A 4NRHB 1TNUA 5AYWD 4JHJA 3CK8A 1N11A 1N0RA 4FC8A 2XRYA 4CT0A 3SF4A 2WXFA 2R02A 4A1GA 4OYSA 4Y6WA 5KNHD 2WMNA 5FQ8A 2XGOA 1LD7A 3CHQA 3ABKE 5CBOA 2J08A 2NXPA 4I1OB 1TJFA 4YNDA 3FH5A 3KAEA 4WNGA 2XPIA 3TWWA 4XEIG 4HOQA 2VGEA 4U0UA 3PUKA 3C3QA 1NP7A 3EHRA 2YHEA 3CIAA 3O4ZA 2HM8A 2DZNA 3EU5A 4BSXA 3CR3A 2BEDA 4YDOA 2ZGDA 3GW4A 4XI9A 2IEJA 1Y8MA 1OT8A 3MZLB 4HI9A 5FQ6A 4KXKB 3AG3E 3P1UA 3C98A 5KJNA 4L7TA 3HRAA 2CFUA 3RSEG 4WAFA 5ANLA 3NZSA 4LCTA 2GW1A 4GTQA 3SQVA 4A1SA 1O1TA 2DIWA 1Q2ZA 3AS4A 4N5QA 2Y3AA 1JWFA 5BV1A 5H7PA 3R7QA 4ZFHA 1BI8B 3D9IA 4LG6A 1MX6A 4HRMB 4UQYA 4K5CA 4ANWA 3JXJA 3TWRA 2VJ8A 1TJCA 3SD5A 3V2XA 2F8XK 4KZ0A 3MKQA 4LNBA 4XKCA 1SW6A 5KJKA 5D0QD 5EILA 3FTXA 4C0EA 2AVPA 3HVEA 3QKYA 4HVBA 4GAAA 3HHMA 4L9PA 3TJPA 4UUCA 2LAIA 3CKBA 3LXUX 3G2TA 4GPMA 3AAAC 3TG5A 3GZ2A 2HO1A 1IHGA 2LUHA 4AXHA 4O1OA 3QNKA 3FUFA 4WWPA 4ANUA 5CCMA 2CHXA 2RFMA 3CKCA 3ZYKA 2WMOA 1D9SA 1UJKA 3CHSA 4LERA 3CV0A 2J4BA 3FH7A 2CFZA 2OOEA 2AXVA 1VDYA 1TNZA 4IN3B 2MHKA 3FUDA 3C72A 3HDXA 5CBNA 3FUMA 4G25A 4OVVA 5JHAA 5CEAA 4N2SA 4RG9A 3TL5A 3RJVA 2PNNA 3O48A 5B1BE 3L22A 2E2EA 3HXBA 2IOLA 3RKVA 3BG1B 2L0IA 2PQNA 4I2ZA 1P5QA 1Z5SC 3JQ1A 1TN8A 2FBNA 1N94A 2IFUA 2R2LA 5BNWA 2WXNA 4M7CA 3CQGB 3FFLA 3NF1A 2X6KA 5BT1A 4U04A 5HKPA 4ILHB 3VLEA 4GTPA 2X38A 4XIFA 4B0ZA 3CVYA 1FPPA 2VGYA 2DZOA 5EIDA 3UIOC 4U63A 3IEGA 2Y1LE 2Y4TA 1N95A 3UX4A 4JL0A 5EYPF 2L0TB 1KLXA 1JUQA 1BLXB 2EINE 4WNEA 3B7UX 1N52A 5ENTD 4B94A 5AJDA 1N4SA 1H6OA 5LCWJ 2YNQA 2KCVA 3ASHA 1HO8A 2AJAA 2EIJE 4CDMA 4DI4A 4GCOA 5AN8A 3EU9A 2EIKE 4I9EA 4CRWA 3LVRE 5FZQA 4NQ0A 1KPSB 4G23A 4KMOA 3GYZA 3IXEA 2FI7A 4H7XA 3RO2A 4DX1A 3PZ1A 1NA0A
chains in the Genus database with same CATH topology
3EIJA 3L08A 5ANRA 4JC8A 5M72A 3OTNA 2IOSA 1OWLA 3TGOA 4J8DA 2BF0X 5DIZA 1WAO1 3HYMB 4AVXA 4GPKA 2JEKA 3EDTB 4G26A 4A55A 2I6HA 4UQXA 4WUYA 4PDXA 3APCA 4FHJA 4GYWA 4UWHA 3U9WA 3NQPA 5E76A 2XQ0A 4UI9K 2KZTB 3ASGA 3FTSA 3ZEFA 3U66A 3ONKA 1H0AA 3CK9A 4P29A 1UN9A 1E8YA 3OXFA 3FTWA 1HS6A 4IRUA 1E7UA 3FHEA 1MHQA 3DPDA 4D10C 5JJ6A 2I2OA 3HIZA 4NURA 1HG5A 4QFVA 1DNPA 4AY6A 3ZIMA 5FQ7A 4JW1A 4GYYA 4N39A 4Y6CA 5ARFA 2MOWA 3S2AA 3QB2A 3QWVA 3QJZA 1ZU2A 2LAHA 2C0MA 4AJWA 5JJ7A 3PE4A 3S7FA 4HOTA 1X5BA 2PZIA 2IU1A 2KCKA 1HF8A 3OXLA 2AW6A 5C2YA 3TAXA 3D9MA 2QY7A 3PRZA 1H6KA 4PUCA 3JQ0A 5J90A 3EIQC 3CHRA 3ZW3A 3QWWA 4FHKA 2PM7A 5C1DA 3I5PA 2GGFA 1E7VA 3CVLA 4U0SA 3RRMB 4CEMA 5LP0A 3ZYQA 4PH4B 4HLEA 3CQCB 3CVPA 1E8WA 3CK7A 5HQ8A 3PE3A 4R7LA 3LVQE 2IONA 4A3VA 3SHFA 4G2VA 4L2YA 1KT0A 5J08A 1EF1C 1KT1A 4JHKA 4V3IA 2J9QA 4UWFA 2WM9A 3FULA 3LEWA 3RU0A 3MV3B 3OAWA 4N3BA 3CGHA 3CSFA 2J4DA 3MA5A 1S0PA 3CVNA 4I9CA 2RG8A 4J8SA 4GZCA 4UWLA 3PNLB 4GB9A 1E8ZA 2OVBA 3LDZA 3ML9A 3CHOA 4CT4A 5FWQA 4FULA 4NRHB 2XEVA 4U07A 2J49A 4C9BB 5AYWD 4JHJA 2CG3A 2UY1A 3UT7A 1H2VC 3CK8A 5ARGA 3AS5A 2NC9A 4TUUA 1EYHA 3GZ1A 2KM4A 5LFAA 3SFZA 4FJYA 4FC8A 3FTYA 3UQ3A 1UJJA 2PQRA 2XRYA 4CT0A 2DCPA 3BG0B 3D9JA 5KCMA 3SF4A 3CHPA 2WXFA 4APOA 2L6JA 3QK0A 3G2VA 4A1GA 4OYSA 4FADA 2WXPA 4IULA 4BT8A 4Y6WA 5FQ4A 3URZA 4URKA 2WMNA 2VSOE 3ENEA 5FQ8A 2M63A 4LEUA 2XGOA 1E90A 3KEZA 4MRUA 4Q94A 4W9RA 2X6FA 3Q47B 3FU6A 3CHQA 4I43A 2KCLA 4BX8A 3CEQA 4ILIA 3MGBA 3PEUB 4KZCA 2J08A 4FP7A 3FH8A 1WM5A 2NXPA 4GZ3A 3FU3A 3I3NA 4I1OB 4K0RA 1TJFA 2YINA 1FVFA 1N54A 4XI0A 5KJLA 4YNDA 4GMLA 1SZ9A 4FA6A 1PC2A 2WXOA 4BTBA 2R59A 3FH5A 3KAEA 3Q4AB 2RD0A 3FP3A 3MKQB 4WNGA 3FUKA 3ZHEB 1NZNA 3MYVA 3SI5A 4J0UA 2XPIA 4HXIA 1SQMA 5T4YA 2UY1B 3LYAA 4BX9A 4HOQA 4U0UA 1PAQA 4ILGA 3PUKA 3PZDA 3EHNA 3PUJA 4JEHA 2WXKA 1EDUA 4G11A 4UI9J 4JA9A 3FEYA 1NP7A 3MCXA 5BW8C 3PDNA 4TV3A 1HE8A 4EBAA 1Z3XA 2YHEA 4GMJA 1HH8A 5LOZA 4KT6B 3APDA 3CIAA 3O4ZA 5LCWC 4C0MA 1OWPA 4I1MA 2HR2A 2HM8A 3T8MA 2WXQA 4F53A 3ESKA 2WVIA 3FU0A 4CGVA 4ABNA 4BSXA 3PH0C 3CR3A 1ELRA 4PS3A 2JLBA 2UWJG 1HFAA 2VYIA 2X6IA 4ACLA 1HU3A 3GW4A 3R9AB 4GZ6A 5CMWA 1XNFA 4XI9A 1QNFA 2WXGA 4HS2A 3D3MA 4NACA 1Y8MA 3E4BA 3MZLB 4KVOA 5FQ6A 3D9PA 4Q69A 4XZ4A 4DLQA 3UMVA 4WNFA 3ZYMA 4G1TA 3MX3A 2ONDA 3HVEB 3L13A 3Q49B 4KXKB 4Q96A 5FT9A 2AXUA 3P1UA 5G04J 2XHEA 2X6HA 3B13A 4JEUA 3C98A 2VGXB 4M3OA 5KJNA 1WY6A 4L7TA 3FU5A 1Z3YA 3CSTA 4L1BA 2PL2A 3I4RB 2CFUA 3B7RL 1DVPA 2ILRA 4UWGA 4WAFA 1OWNA 5ANLA 3NZSA 5G55A 5LX8A 1B89A 4PS7A 4LCTA 5CHEE 3VTXA 4YVOA 2GW1A 4A1SA 2FO7A 4MLPA 3RRNB 2XGMA 2LO6A 2DIWA 1UW4B 2WQHA 3AS4A 4CCAA 3CHMA 4CGWA 2ZU6B 4EZJA 3UT8A 1ELWA 4RVBA 4UQZA 3D9KA 2WPVA 2Y3AA 4U0ZA 5FZRA 2I1JA 1JWFA 1NA3A 5KJMA 5BV1A 3L6AA 3ML8A 3OXGA 3SGHA 4DI3A 2XPYA 2WQ6A 1YA0A 1ELKA 1FCHA 3L54A 4KVMA 5EDSA 3ZYLA 3LS8A 4GCNA 5FZSA 3FUEA 5HI7A 3R7QA 3TG4A 4EQFA 5BUZA 4LUNU 3D9IA 4O6FA 4UQYA 4ANWA 4DJAA 3QARA 3LKUA 3L16A 3L17A 3PVLA 2XGSA 3IHYA 5AENA 2VSXE 3D9LA 1UN8A 2VJ8A 1TJCA 2I1KA 4MS6A 2VSNA 4WNDA 2V8SE 2E0IA 3SD5A 4J8FA 3MEKA 2Q7FA 4XX5A 4KZ0A 3ZHEA 4JA7A 3T5VA 5A6CA 3MKQA 4BY6A 4AP2A 1A17A 4IYPA 4ATGA 5E75A 4XKCA 3JYSA 5KJKA 2KC7A 5D0QD 5JHBA 2CHZA 3FTXA 4CDRA 5FJYA 4ACKA 2BTDA 4G24A 2VGXA 3D9NA 3JUIA 4GA0A 3RO3A 4B8AA 4C0EA 2AVPA 1UG3A 4I6GA 3B7TA 1SZAA 4YVQC 1MQSA 1HG2A 3HVEA 3SBSA 3KD7A 3QKYA 4HVBA 3NZUA 3ONLA 4WWOA 3LCAA 4GAAA 3QC1A 3ZN3A 3CVWA 4DPRA 1XGWA 3HHMA 3LY8A 3PEVB 2X3MA 3TJPA 2WB2A 2YQ8A 4HORA 1ZBPA 2LAIA 3CKBA 3LXUX 4I6JA 2X6JA 2FEZA 2FULA 4AY5A 2CHWA 3G2TA 5EX0A 3FTUA 1W3BA 3VTYA 5EX3A 4RG6A 3ASDA 1PY1A 4A3TA 3TG5A 3FTZA 3GZ2A 2HO1A 4J8EA 4K03A 1FVHA 2P58C 3QOUA 3UT4A 2BUGA 4F7AA 1IHGA 4AXHA 5EKQD 3EHMA 3R7RA 1QQEA 4AV7A 3QNKA 4N3AA 2OVFA 3K9IA 3FUFA 4WWPA 3I4GA 4JXTA 4JZYA 3WXXA 4ANUA 5CCMA 2CHXA 4FLBA 3AS8A 3CKCA 3ZYKA 2C2LA 3MV2B 3U3WA 2WMOA 3DBSA 1UJKA 5ENNA 4HOSA 4F3VA 1OUVA 3CHSA 2XCBA 3FUIA 4LERA 3CV0A 2J07A 2J4BA 3APFA 4HFGA 3FH7A 1H19A 3SBTB 4EPZA 2LNIA 1GW6A 2XCCA 3JCKC 2CFZA 2WQ7A 2OOEA 4XKBA 2AXVA 2IF4A 3LY7A 4RSYA 1VDYA 4APFA 4IN3B 1QZ2A 2VTBB 2MHKA 3FUDA 3HDXA 2XPZA 2LSUA 3RRUA 4FU3A 5G05J 3ZGQA 3QWPA 4CDNA 3FUMA 4G25A 4OVVA 4L23A 3ASFA 4U8HA 5JHAA 3IKOB 3B7SA 4N2SA 1HXIA 4LRZA 4RG9A 3Q5MA 3TL5A 3RJVA 3CVQA 4PS8A 3VLDA 1BPOA 3ZFWA 3ZPJA 2LSVA 2V4LA 5AIJA 2J09A 2GRMA 2KZTA 3S7JA 1H2TC 3O48A 4I17A 2A5UA 3PREA 3L22A 2E2EA 3GZSA 2IOLA 2WXMA 4J6IA 4N5CA 3RKVA 3BG1B 2WXIA 4AEZC 2L0IA 5T8IA 2PQNA 4I2ZA 1P5QA 2OV8A 4GZDA 4JHRA 3JQ1A 5CCLA 1TEZA 2HYZA 2PM6A 2VQ2A 2FBNA 4FLHA 2IFUA 2WXLA 1JPLA 5G05C 5G2NA 4BTAA 2L9BA 5BNWA 4BFRA 3TXMA 2WXNA 4GA1A 3D9OA 5A7DB 3N71A 1JWGA 3CQGB 3FFLA 5DBKA 4MKTA 2NSZA 3NF1A 1Y6IA 2DBAA 2X6KA 3G2UA 3VLFA 3ZVVA 2VSYA 2EQXA 2R5SA 5BT1A 4U04A 2IJGX 3G2WA 4GYOA 3ULQA 2XRZA 3ESLA 4ILHB 3VLEA 4ANXA 2IQCA 3LPZA 2A4ZA 4AM9A 4BT9A 5A23A 2GRLA 1Z6TA 3IHVA 3MKRA 4FJZA 1OWOA 4EZKA 4KBQA 3FUHA 3CVVA 1IYGA 3IV0A 2X38A 4AOFA 4B89A 4XIFA 3FY4A 4B0ZA 3CVYA 3MJWA 2VGYA 4I1AA 5AJLA 4JPSA 2Y4UA 3RK6A 4BWRA 4U63A 3IEGA 2MRIA 2FF4A 2Y4TA 4EBAG 3UX4A 2I9CA 2YHCA 3FUJA 2CG2A 1NA0A 1LF8A 1EPUA 4JL0A 2L0TB 4EZLA 1KLXA 3SZ7A 3IBEA 3EJNA 4OVUA 5T3RA 3ZRHA 4AIFA 1JUQA 2QFCA 3PS6A 4HOUA 3FDHA 3PNTB 4GZ5A 2KATA 4WNEA 4B8CB 3B7UX 5D0OD 4GU5A 4N2QA 1N52A 3TXNA 3UUXA 2WXRA 1U3CA 3S7DA 1E8XA 4EECA 5CMYA 1IQUA 4E85A 2V5FA 3FTVA 4B94A 5AJDA 5G04C 3RIBA 2AXZA 3FWVA 3BEEA 2V0PA 3AU5A 1HZ4A 3Q15A 5LCWJ 4N3CA 4GA2A 1INZA 2YNQA 2VTBA 2WXJA 4H7YA 3G2SA 2KCVA 3ASHA 5JJTA 1HO8A 1L5JA 1HX8A 2AWIA 4I2WA 4DI4A 4CDMA 3UPVA 4GCOA 3P2BA 3U64A 3CVUA 3U4TA 3FEXA 4I9EA 4CRWA 4TRQA 4ME2A 3LJ3A 3ZXSA 3LVRE 4F1SA 4JVSA 4E6HA 1E96B 4XE0A 5FZQA 3S7BA 4NQ0A 4ANVA 4I6EA 1IQRA 3KS2A 4G23A 4KMOA 3GYZA 3LY9A 4UWKA 1H2UA 3QDNA 2FI7A 4L2LA 3T5XA 3SNXA 4DK5A 2R17C 4H7XA 4KYOB 5FTPA 2C0LA 3QAQA 4WWNA 3CLJA 3CVXA 3RO2A 4DLOA 5BPPA 1OWMA 1U3DA 4UI9C 3FUNA 3AU4A 2WXHA 5BV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PC2 A;  4BTB A;  3Q4A B;  3KAE A;  5M72 A;  3FP3 A;  3JYS A;  4JHR A;  2KC7 A;  4WNG A;  3ZHE B;  5KJK A;  1NZN A;  5D0Q D;  4J8D A;  5DIZ A;  2HYZ A;  1WAO 1;  3HYM B;  5CCL A;  4J0U A;  2XPI A;  2VQ2 A;  2FBN A;  3EDT B;  2IFU A;  2I6H A;  4G26 A;  4UQX A;  4WUY A;  5FJY A;  2UY1 B;  3LYA A;  4G24 A;  2VGX A;  4GA0 A;  5G05 C;  4GA1 A;  4HOQ A;  3RO3 A;  4U0U A;  5A7D B;  3N71 A;  5DBK A;  2AVP A;  3FFL A;  4UI9 K;  3NF1 A;  3ASG A;  2DBA A;  4UI9 J;  4JA9 A;  4YVQ C;  5BW8 C;  3PDN A;  3KD7 A;  3CK9 A;  3QKY A;  3OXF A;  2VSY A;  1HH8 A;  2R5S A;  3LCA A;  5BT1 A;  4U04 A;  4GYO A;  5JJ6 A;  3ZN3 A;  3ULQ A;  5LCW C;  3LY8 A;  2HR2 A;  4AY6 A;  2YQ8 A;  3LPZ A;  4BT9 A;  4AM9 A;  3ESK A;  4HOR A;  4CGV A;  4ABN A;  3MKR A;  4N39 A;  1ZBP A;  4GYY A;  4KBQ A;  1ELR A;  4Y6C A;  2JLB A;  5ARF A;  5BNW A;  3CKB A;  2UWJ G;  1IYG A;  3QWV A;  2VYI A;  4XIF A;  1ZU2 A;  2FEZ A;  2C0M A;  4AY5 A;  5JJ7 A;  3PE4 A;  3S7F A;  4HOT A;  3GW4 A;  2VGY A;  4GZ6 A;  4I1A A;  2PZI A;  1W3B A;  2Y4U A;  1XNF A;  2KCK A;  4XI9 A;  5EX3 A;  3IEG A;  4RG6 A;  3ASD A;  3VTY A;  4BWR A;  3OXL A;  3TAX A;  2FF4 A;  2Y4T A;  1Y8M A;  3E4B A;  3TG5 A;  3GZ2 A;  2HO1 A;  4J8E A;  3TGO A;  3QOU A;  2P58 C;  3QWW A;  4I2Z A;  2BUG A;  2YHC A;  1IHG A;  5C1D A;  3CVL A;  4U0S A;  4WNF A;  1NA0 A;  4G1T A;  5EKQ D;  4JL0 A;  2OND A;  3Q49 B;  4KXK B;  5FT9 A;  1QQE A;  3CVP A;  3CK7 A;  4N3A A;  1KLX A;  3SZ7 A;  3PE3 A;  5HQ8 A;  3K9I A;  5G04 J;  3R9A B;  4AIF A;  2QFC A;  4G2V A;  1KT0 A;  4HOU A;  3WXX A;  4BTA A;  5CCM A;  1KT1 A;  2VGX B;  2J9Q A;  3AS8 A;  4GZ5 A;  2KAT A;  3CKC A;  3RU0 A;  4WNE A;  5KJN A;  3MV3 B;  5EX0 A;  2C2L A;  3MV2 B;  5D0O D;  2PL2 A;  3U3W A;  4N2Q A;  4N3B A;  4HOS A;  3UUX A;  4F3V A;  1OUV A;  3S7D A;  3MA5 A;  1B89 A;  2XCB A;  5CHE E;  3CVN A;  4I9C A;  3CV0 A;  4YVO A;  2GW1 A;  3VTX A;  4A1S A;  2V5F A;  2FO7 A;  2LNI A;  4B94 A;  2XCC A;  2XGM A;  5G04 C;  3RIB A;  2WQH A;  3AS4 A;  2OOE A;  3BEE A;  3FWV A;  2IF4 A;  3LY7 A;  4NRH B;  4CGW A;  3Q15 A;  1HZ4 A;  2XEV A;  4IN3 B;  4U07 A;  1QZ2 A;  4N3C A;  5AYW D;  4GA2 A;  1ELW A;  2UY1 A;  5LCW J;  2MHK A;  4UQZ A;  2WPV A;  4H7Y A;  4U0Z A;  2KCV A;  3ASH A;  3CK8 A;  3AS5 A;  5ARG A;  2NC9 A;  5FZR A;  5JJT A;  1NA3 A;  5KJM A;  2LSU A;  3GZ1 A;  5G05 J;  4I2W A;  3ZGQ A;  3QWP A;  3UPV A;  3OXG A;  4G25 A;  3UQ3 A;  3ASF A;  2PQR A;  4GCO A;  1YA0 A;  1FCH A;  3SF4 A;  4GCN A;  3TG4 A;  5FZS A;  5HI7 A;  3U4T A;  4APO A;  1HXI A;  4RG9 A;  4EQF A;  4N2S A;  2L6J A;  3Q5M A;  4I9E A;  3RJV A;  4O6F A;  3CVQ A;  4UQY A;  4BT8 A;  3ZFW A;  3ZPJ A;  4ME2 A;  4Y6W A;  3URZ A;  2LSV A;  4GPK A;  3LKU A;  4CDR A;  1E96 B;  2XGS A;  5FZQ A;  3S7B A;  4LEU A;  2XGO A;  4NQ0 A;  3S7J A;  3O48 A;  3KS2 A;  4G23 A;  1TJC A;  4I17 A;  4W9R A;  2VSN A;  3Q47 B;  3GYZ A;  3LY9 A;  4WND A;  2E2E A;  3QDN A;  2FI7 A;  4J8F A;  2KCL A;  3MEK A;  3CEQ A;  4H7X A;  2Q7F A;  4KYO B;  2C0L A;  5FTP A;  4N5C A;  3RKV A;  3RO2 A;  3ZHE A;  1WM5 A;  4JA7 A;  4GZ3 A;  5A6C A;  4XI0 A;  4UI9 C;  5KJL A;  4YND A;  2PQN A;  1A17 A;  4GYW A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 1S70 B;  3OTN A;  2OEW A;  4J8D A;  2BF0 X;  1WAO 1;  3DSS A;  2JEK A;  1S64 A;  1OCZ E;  3KEA A;  3NQP A;  5E76 A;  3ASG A;  3J5P A;  3CK9 A;  4U95 D;  3FTW A;  3Q78 A;  5ENP D;  2FO1 E;  1MHQ A;  4D10 C;  5JJ6 A;  3V79 K;  4TXP A;  4QFV A;  3NOC D;  4GYY A;  5ARF A;  3S2A A;  3QB2 A;  5CRU A;  4HRN A;  1QBQ A;  4HOT A;  3PE4 A;  1X5B A;  1N0Q A;  2PZI A;  2AW6 A;  3TAX A;  4PUC A;  3QWW A;  1ZB1 A;  5C1D A;  3I5P A;  1E7V A;  4U0S A;  5HQ8 A;  4OAV B;  4R7L A;  3UIP C;  1DC2 A;  4L2Y A;  1EF1 C;  1KT1 A;  2J9Q A;  3FUL A;  4Z68 A;  4N3B A;  3Q7F A;  1S0P A;  3CVN A;  4J8S A;  3SO8 A;  4CYM D;  1MYO A;  1O1R A;  3ISM C;  3TWQ A;  2XEV A;  2Y69 E;  1OXJ A;  3UT7 A;  1H2V C;  3DWL G;  5ARG A;  2H6F A;  3BG0 B;  5KCM A;  2GRP B;  3CHP A;  4APO A;  2L6J A;  3G2V A;  4IUL A;  5FQ4 A;  4URK A;  2X6F A;  3Q47 B;  3FU6 A;  3PEU B;  4KZC A;  1FT2 A;  3FH8 A;  1WM5 A;  4TRQ A;  4GZ3 A;  1FVF A;  1PC2 A;  2WXO A;  5B1A E;  2R59 A;  2RD0 A;  3MKQ B;  2F0Y A;  3ZHE B;  1NZN A;  3SI5 A;  4J0U A;  5ENS D;  1SQM A;  1D8D A;  4BX9 A;  3TWS A;  3PUJ A;  4JEH A;  2WXK A;  4UI9 J;  3FEY A;  3MCX A;  4GTT A;  4TV3 A;  3V2O A;  1HE8 A;  5EN5 D;  5ENR D;  4GMJ A;  3Q9U C;  5LOZ A;  2BKK B;  1K1A A;  4KT6 B;  5HRY A;  1OWP A;  4I1M A;  2HR2 A;  2WXQ A;  3ESK A;  3FU0 A;  4CGV A;  5KBA A;  1OCR E;  1ELR A;  2JLB A;  2UWJ G;  2X6I A;  1HU3 A;  2QYU A;  3D3M A;  4NAC A;  3KSL A;  3UM1 A;  1DCQ A;  4XZ4 A;  3Q7A A;  3UMV A;  2XEH A;  3Q49 B;  5FT9 A;  3L13 A;  1BU9 A;  5B3S E;  2AXU A;  2XHE A;  4JEU A;  2VGX B;  4M3O A;  1Z3Y A;  4L1B A;  3C5R A;  4UWG A;  1B89 A;  4PS7 A;  5CHE E;  3VTX A;  4MLP A;  2XGM A;  4F6R D;  1UW4 B;  3UM0 A;  2ZGG A;  3CHM A;  4CGW A;  1ELW A;  4UQZ A;  3D9K A;  1NA3 A;  1O5M A;  3L54 A;  3DPY A;  3ZYL A;  3LS8 A;  1D8E A;  3FUE A;  2EIM E;  4LUN U;  4O6F A;  3PVL A;  2XEN A;  3D9L A;  1UN8 A;  2I1K A;  2VSN A;  2E0I A;  1JCR A;  3AG2 E;  2NYJ A;  3MEK A;  1OCO E;  2Q7F A;  3ZHE A;  4JA7 A;  4AP2 A;  3B95 A;  4ATG A;  5E75 A;  4GTR A;  2MYO A;  3B7B A;  1SVX A;  4CDR A;  4G24 A;  4GA0 A;  1N9A A;  4J8Y A;  4WWO A;  3ZN3 A;  1XGW A;  3PEV B;  3PZ3 A;  4O1P A;  4HOR A;  3UKR G;  4I6J A;  2X6J A;  2FEZ A;  3VTY A;  2GRN B;  5EX3 A;  3ASD A;  1IXV A;  3QOU A;  3R7R A;  4N3A A;  4JXT A;  3WXX A;  3AS8 A;  1OCC E;  1BI7 B;  4C48 B;  2P9L G;  2XCB A;  1GW6 A;  2XCC A;  3JCK C;  2V4H C;  3BU8 A;  4RSY A;  1QZ2 A;  2LSU A;  3RRU A;  4ZHB A;  4MBG A;  3ZGQ A;  4CDN A;  4U8H A;  4L23 A;  3NAW A;  3ULE G;  1HXI A;  5CEC B;  4PS8 A;  2LSV A;  2V4L A;  4DUI A;  2GRM A;  2HE0 A;  5KNG A;  4YDW A;  4I17 A;  2A5U A;  5ENO D;  3GZS A;  2WXM A;  2OEV A;  4JHR A;  5D2M C;  5CCL A;  5G2N A;  3TXM A;  1MZC A;  5DBK A;  2NSZ A;  1Y6I A;  1N4Q A;  2LXL A;  3X2Q E;  3WG7 E;  2IJG X;  4GYO A;  3ULQ A;  2XRZ A;  3ESL A;  5CER B;  5A23 A;  3MKR A;  4KBQ A;  1IYG A;  4AOF A;  4HB5 A;  4I1A A;  3RK6 A;  2MRI A;  4EBA G;  1NFI E;  3FUJ A;  1EPU A;  4EZL A;  4OVU A;  3PNT B;  4GZ5 A;  2GRQ B;  2QYJ A;  4N2Q A;  5BXO A;  3UUX A;  3S7D A;  4EEC A;  1IQU A;  3FTV A;  2LXM A;  5G04 C;  3FWV A;  1K8K G;  2P9N G;  4H7Y A;  2H6I A;  5KWD A;  1HX8 A;  3UPV A;  3W9F A;  3CVU A;  1LD8 A;  5JMN D;  1E96 B;  3S7B A;  1WG0 A;  4I6E A;  3KS2 A;  3T5X A;  4GTO A;  5FTP A;  4KYO B;  2C0L A;  3CVX A;  4DLO A;  1TNB A;  4UI9 C;  3AU4 A;  3I4R B;  4GYW A;  5BV0 A;  4RLY A;  3C3R A;  5M72 A;  1OWL A;  4GPK A;  5AAR A;  4UQX A;  4PDX A;  2ZIS A;  2ZXW E;  3U66 A;  1E8Y A;  3OXF A;  4IRU A;  1E7U A;  3EHQ A;  3PZ4 A;  4NUR A;  4AY6 A;  3ZIM A;  3ASO E;  3DSW A;  1YMP A;  3S7F A;  2IU1 A;  4X8Q A;  3OXL A;  2QY7 A;  3PRZ A;  5J90 A;  3ZW3 A;  4FHK A;  4BEP A;  1MX2 A;  2B0O E;  5LP0 A;  4G8K A;  4LNG A;  1S63 A;  2B6C A;  1TNY A;  4UWF A;  3LEW A;  3R9M A;  2J4D A;  2RKK A;  5FWQ A;  4U07 A;  4C9B B;  4TXQ A;  2UY1 A;  3GZ1 A;  2KM4 A;  5LFA A;  3SFZ A;  4FJY A;  1V54 E;  2DCP A;  4HBD A;  3QK0 A;  4J7W A;  4FAD A;  2WXP A;  2KXP C;  3URZ A;  2M63 A;  1E90 A;  2DWZ A;  3KEZ A;  4Q94 A;  4W9R A;  1K3Z D;  4BX8 A;  3MGB A;  2J8S D;  4U8V D;  3ULY A;  4XI0 A;  2YIN A;  1YYH A;  2IO2 C;  5KJL A;  4GML A;  3TWU A;  4DX2 A;  3Q4A B;  3FUK A;  3MYV A;  4HXI A;  2UY1 B;  3E30 A;  3LYA A;  4ILG A;  3PZD A;  3EHN A;  3NOG D;  1H6P A;  4G11 A;  4GMR A;  1Z3X A;  5AQA A;  1HH8 A;  4HRL A;  2P9I G;  1TN6 A;  3PH0 C;  4PS3 A;  2P9U G;  1HFA A;  2VYI A;  4ACL A;  5CMW A;  2GRO B;  2IY0 C;  1WDY A;  4A63 B;  4WNF A;  2OND A;  3HVE B;  1TR4 A;  5G04 J;  2X6H A;  3BUA A;  3DEO A;  4BES A;  3B13 A;  1AP7 A;  1WY6 A;  3FU5 A;  3CST A;  2PL2 A;  1DVP A;  2ILR A;  1QYM A;  4BET A;  2FO7 A;  3RRN B;  3T9K A;  4JD2 G;  2WQH A;  3ZU7 B;  4CCA A;  3UT8 A;  2WPV A;  4U0Z A;  2I1J A;  3L6A A;  3ML8 A;  3OXG A;  4DI3 A;  2BKG A;  1ELK A;  5EDS A;  4GCN A;  5FZS A;  5BUZ A;  3DSV A;  3QAR A;  3L16 A;  4WND A;  4J8F A;  1KZO A;  1DCE A;  4LSZ E;  3L9T A;  3T5V A;  2KC7 A;  1FT1 A;  2ZIR A;  2DYS E;  5FJY A;  4ACK A;  2BTD A;  2VGX A;  3JUI A;  3ZNG A;  4B8A A;  4I6G A;  1SZA A;  4YVQ C;  3SBS A;  3NZU A;  3ONL A;  3LCA A;  3CVW A;  4DPR A;  4GTM A;  3LY8 A;  2X3M A;  2YQ8 A;  3BQO A;  1BD8 A;  4HNA D;  4AY5 A;  3UXG A;  4RG6 A;  4A3T A;  3ASN E;  4K03 A;  4J8E A;  1O1S A;  2P58 C;  3UT4 A;  2BUG A;  4F7A A;  5EKQ D;  3EHM A;  4LNU D;  4AV7 A;  2XZD G;  2OVF A;  2XS8 A;  3K9I A;  3I4G A;  4FLB A;  3AG4 E;  2C2L A;  3MV2 B;  5ENN A;  4HOS A;  1OUV A;  4HFG A;  3SBT B;  2WQ7 A;  2IF4 A;  4APF A;  2VTB B;  5G05 J;  3QWP A;  3ASF A;  3IKO B;  1BPO A;  3ZPJ A;  2J09 A;  4K5A B;  2KZT A;  3Q75 A;  3S7J A;  1H2T C;  3EUV A;  2ETC A;  4J6I A;  2P9S G;  3L82 A;  2WXI A;  4AEZ C;  5ITZ F;  3UI2 A;  5CED B;  2OV8 A;  4GZD A;  1TEZ A;  2PM6 A;  2VQ2 A;  4BTA A;  2WXL A;  1JPL A;  2L9B A;  2H6H A;  4GA1 A;  3N71 A;  1JWG A;  3ZVV A;  3UM3 A;  2P9P G;  2EQX A;  2R5S A;  4YDE A;  3DXK G;  1X81 A;  2A4Z A;  3LPZ A;  4BT9 A;  2A5E A;  2GRL A;  1Z6T A;  3IHV A;  4EZK A;  3FUH A;  3J5Q B;  1SA5 A;  4B89 A;  3FY4 A;  1N4P A;  3MJW A;  5AJL A;  4JPS A;  1LTX A;  3EJN A;  5T3R A;  1G3N B;  3V30 A;  3ZRH A;  4AIF A;  2DVW A;  2KAT A;  2QZA A;  4B8C B;  5D0O D;  4GU5 A;  3TXN A;  1E8X A;  5CMY A;  3D9H A;  4E85 A;  2V5F A;  4F1P A;  3RIB A;  2AXZ A;  4BER A;  2V0P A;  3JXI A;  3AU5 A;  4N3C A;  1INZ A;  2VTB A;  3G2S A;  5JJT A;  2R05 A;  4I2W A;  2L6B A;  3P2B A;  3U64 A;  3FEX A;  4DX5 D;  4GTS A;  4TXR A;  4ME2 A;  5AAO A;  4XE0 A;  3Q79 A;  4ANV A;  5ENQ D;  4EHM A;  4L2L A;  3SNX A;  2OCC E;  5CRV A;  3QAQ A;  3CLJ A;  3UTM A;  3FUN A;  3L08 A;  5ANR A;  4JC8 A;  2IOS A;  3TGO A;  5DIZ A;  4AVX A;  3TWV A;  2I6H A;  1IHB A;  3E37 A;  4FHJ A;  2XQ0 A;  4UI9 K;  2P2C P;  3FTS A;  3ZEF A;  4O60 A;  4P29 A;  1RW2 A;  1UN9 A;  3UKU G;  1HS6 A;  1AWC B;  3FHE A;  3DPD A;  3HXD A;  1HG5 A;  3DEP A;  4TUM A;  4N39 A;  4QQI A;  4Y6C A;  2MOW A;  2LAH A;  3DRA A;  5D66 A;  1HF8 A;  2KBX A;  3D9M A;  4HQD A;  4U96 D;  2PM7 A;  2R03 A;  3RRM B;  4CEM A;  3ABL E;  4PH4 B;  3CQC B;  5HS0 A;  3CK7 A;  3RAU A;  3LVQ E;  2ION A;  3SHF A;  4G2V A;  1KT0 A;  4JHK A;  4V3I A;  2WM9 A;  3KSQ A;  3DST A;  2RFA A;  5AQ9 A;  3OAW A;  4K5B A;  3CGH A;  3CSF A;  3MA5 A;  4I9C A;  3PNL B;  4GB9 A;  1E8Z A;  3LDZ A;  3CHO A;  3E33 A;  4FUL A;  2J49 A;  2CG3 A;  3AS5 A;  2NC9 A;  4TUU A;  1EYH A;  3FTY A;  3UQ3 A;  1UJJ A;  2PQR A;  2EIL E;  3HXE A;  3D9J A;  3W9G A;  4G8L A;  4BT8 A;  2VSO E;  3ENE A;  4LEU A;  4MRU A;  4I43 A;  2KCL A;  3SFY A;  3CEQ A;  3DSX A;  4ILI A;  4FP7 A;  5BXU A;  4K0R A;  3FU3 A;  3I3N A;  1N54 A;  4FA6 A;  1SZ9 A;  4BTB A;  3FP3 A;  4BSZ B;  5T4Y A;  2Y0B G;  3UM2 A;  1PAQ A;  4OAU C;  1EDU A;  4JA9 A;  5BW8 C;  3PDN A;  4EBA A;  3APD A;  5LCW C;  4C0M A;  1IKN D;  3T8M A;  3TWX A;  4F53 A;  2WVI A;  4ABN A;  3JUE A;  4GTV A;  5IY5 E;  1V55 E;  3R9A B;  4GZ6 A;  1XNF A;  1QNF A;  2F37 A;  2WXG A;  4HS2 A;  3E4B A;  4HI8 A;  4KVO A;  3D9P A;  1MX4 A;  4Q69 A;  4DLQ A;  3ZYM A;  4G1T A;  3MX3 A;  4DX6 D;  4Q96 A;  1TNO A;  3ZUV B;  2IO3 C;  2XZT G;  3E32 A;  4DX7 D;  2JAB A;  3B7R L;  5G55 A;  5LX8 A;  1OWN A;  4YVO A;  3UIN C;  2LO6 A;  2ZU6 B;  2QC9 A;  4EZJ A;  4RVB A;  5FZR A;  5KJM A;  3SGH A;  2WQ6 A;  2XPY A;  1YA0 A;  4ATZ D;  1FCH A;  4KVM A;  3TG4 A;  5HI7 A;  4EQF A;  4DJA A;  3LKU A;  3L17 A;  2XGS A;  3IHY A;  5AEN A;  2VSX E;  4MS6 A;  1U2V G;  2V8S E;  4JB8 P;  4XX5 A;  5A6C A;  4BY6 A;  1A17 A;  2P9K G;  4IYP A;  4NIK A;  3JYS A;  2ETA A;  5JHB A;  2CHZ A;  3D9N A;  3RO3 A;  1UG3 A;  4U7E B;  3B7T A;  1MQS A;  1HG2 A;  1RZ4 A;  3KD7 A;  3T8K A;  3AG1 E;  3QC1 A;  2WB2 A;  1ZBP A;  1A5E A;  2FUL A;  2CHW A;  1YCS B;  5EX0 A;  3FTU A;  1W3B A;  5AQ7 A;  1PY1 A;  3FTZ A;  4DRX E;  1FVH A;  3SFX A;  1QQE A;  3ZXP A;  1N4R A;  4JZY A;  3U3W A;  2GRR B;  3DBS A;  4HLL A;  4F3V A;  3FUI A;  2J07 A;  3PZ2 A;  3APF A;  4EPZ A;  1H19 A;  2LNI A;  3NBN B;  3HXF A;  4XKB A;  3LY7 A;  4U8Y D;  2XPZ A;  4FU3 A;  3B7S A;  4LRZ A;  3Q5M A;  5FIO A;  3CVQ A;  3VLD A;  3ZFW A;  5AIJ A;  3PRE A;  4N5C A;  3Q73 A;  3V31 A;  5T8I A;  3C3O A;  2XS1 A;  3DSU A;  3DXM G;  1MJ0 A;  2HYZ A;  4FLH A;  5G05 C;  4BFR A;  3E34 A;  3D9O A;  4B93 B;  5A7D B;  4MKT A;  2DBA A;  3G2U A;  3VLF A;  2VSY A;  2V5Q C;  3G2W A;  1NL4 A;  4ANX A;  2IQC A;  4AM9 A;  3NB2 A;  4FJZ A;  1OWO A;  3CVV A;  3IV0 A;  5FIN A;  2Y4U A;  4BWR A;  1TYQ G;  2FF4 A;  1TN7 A;  2I9C A;  2YHC A;  2CG2 A;  3Q9N C;  1LF8 A;  3SZ7 A;  3IBE A;  2QFC A;  3PS6 A;  4HOU A;  3FDH A;  1JCS A;  3SY2 A;  2WXR A;  1U3C A;  3BEE A;  3AJI A;  3Q15 A;  1HZ4 A;  4GA2 A;  1SA4 A;  2WXJ A;  2DYR E;  1L5J A;  2AWI A;  3F6Q A;  3U4T A;  3LJ3 A;  3ZXS A;  5EYL A;  4F1S A;  4JVS A;  4E6H A;  1JCQ A;  1IQR A;  5AQB A;  2XEE A;  3LY9 A;  1OY3 D;  1K1B A;  4UWK A;  1H2U A;  4DK5 A;  3QDN A;  3ZKJ A;  2R17 C;  4WWN A;  1KZP A;  5BPP A;  1OWM A;  1U3D A;  1NI1 A;  2WXH A;  3EIJ A;  3HYM B;  4G26 A;  3EDT B;  4A55 A;  4WUY A;  3APC A;  4UWH A;  3U9W A;  3HG0 D;  5EIB E;  2KZT B;  2H6G A;  3ONK A;  1H0A A;  3TWT A;  4RQI A;  2I2O A;  3HIZ A;  1DNP A;  2ETB A;  5FQ7 A;  4JW1 A;  3QWV A;  3QJZ A;  1ZU2 A;  4AJW A;  2C0M A;  5JJ7 A;  2F8Y A;  4YDY A;  2KCK A;  5C2Y A;  5JA4 D;  4CZ2 D;  1H6K A;  3JQ0 A;  3EIQ C;  3CHR A;  2GGF A;  3CVL A;  3LJN A;  3ZYQ A;  4HLE A;  3ABM E;  3CVP A;  1E8W A;  3PE3 A;  4A3V A;  5J08 A;  3HXC A;  3RU0 A;  3MV3 B;  1UOH A;  2RG8 A;  4GZC A;  4UWL A;  2OVB A;  3ML9 A;  4CT4 A;  4NRH B;  1TNU A;  5AYW D;  4JHJ A;  3CK8 A;  1N11 A;  1N0R A;  4FC8 A;  2XRY A;  4CT0 A;  3SF4 A;  2WXF A;  2R02 A;  4A1G A;  4OYS A;  4Y6W A;  5KNH D;  2WMN A;  5FQ8 A;  2XGO A;  1LD7 A;  3CHQ A;  3ABK E;  5CBO A;  2J08 A;  2NXP A;  4I1O B;  1TJF A;  4YND A;  3FH5 A;  3KAE A;  4WNG A;  2XPI A;  3TWW A;  4XEI G;  4HOQ A;  2VGE A;  4U0U A;  3PUK A;  3C3Q A;  1NP7 A;  3EHR A;  2YHE A;  3CIA A;  3O4Z A;  2HM8 A;  2DZN A;  3EU5 A;  4BSX A;  3CR3 A;  2BED A;  4YDO A;  2ZGD A;  3GW4 A;  4XI9 A;  2IEJ A;  1Y8M A;  1OT8 A;  3MZL B;  4HI9 A;  5FQ6 A;  4KXK B;  3AG3 E;  3P1U A;  3C98 A;  5KJN A;  4L7T A;  3HRA A;  2CFU A;  3RSE G;  4WAF A;  5ANL A;  3NZS A;  4LCT A;  2GW1 A;  4GTQ A;  3SQV A;  4A1S A;  1O1T A;  2DIW A;  1Q2Z A;  3AS4 A;  4N5Q A;  2Y3A A;  1JWF A;  5BV1 A;  5H7P A;  3R7Q A;  4ZFH A;  1BI8 B;  3D9I A;  4LG6 A;  1MX6 A;  4HRM B;  4UQY A;  4K5C A;  4ANW A;  3JXJ A;  3TWR A;  2VJ8 A;  1TJC A;  3SD5 A;  3V2X A;  2F8X K;  4KZ0 A;  3MKQ A;  4LNB A;  4XKC A;  1SW6 A;  5KJK A;  5D0Q D;  5EIL A;  3FTX A;  4C0E A;  2AVP A;  3HVE A;  3QKY A;  4HVB A;  4GAA A;  3HHM A;  4L9P A;  3TJP A;  4UUC A;  2LAI A;  3CKB A;  3LXU X;  3G2T A;  4GPM A;  3AAA C;  3TG5 A;  3GZ2 A;  2HO1 A;  1IHG A;  2LUH A;  4AXH A;  4O1O A;  3QNK A;  3FUF A;  4WWP A;  4ANU A;  5CCM A;  2CHX A;  2RFM A;  3CKC A;  3ZYK A;  2WMO A;  1D9S A;  1UJK A;  3CHS A;  4LER A;  3CV0 A;  2J4B A;  3FH7 A;  2CFZ A;  2OOE A;  2AXV A;  1VDY A;  1TNZ A;  4IN3 B;  2MHK A;  3FUD A;  3C72 A;  3HDX A;  5CBN A;  3FUM A;  4G25 A;  4OVV A;  5JHA A;  5CEA A;  4N2S A;  4RG9 A;  3TL5 A;  3RJV A;  2PNN A;  3O48 A;  5B1B E;  3L22 A;  2E2E A;  3HXB A;  2IOL A;  3RKV A;  3BG1 B;  2L0I A;  2PQN A;  4I2Z A;  1P5Q A;  1Z5S C;  3JQ1 A;  1TN8 A;  2FBN A;  1N94 A;  2IFU A;  2R2L A;  5BNW A;  2WXN A;  4M7C A;  3CQG B;  3FFL A;  3NF1 A;  2X6K A;  5BT1 A;  4U04 A;  5HKP A;  4ILH B;  3VLE A;  4GTP A;  2X38 A;  4XIF A;  4B0Z A;  3CVY A;  1FPP A;  2VGY A;  2DZO A;  5EID A;  3UIO C;  4U63 A;  3IEG A;  2Y1L E;  2Y4T A;  1N95 A;  3UX4 A;  4JL0 A;  5EYP F;  2L0T B;  1KLX A;  1JUQ A;  1BLX B;  2EIN E;  4WNE A;  3B7U X;  1N52 A;  5ENT D;  4B94 A;  5AJD A;  1N4S A;  1H6O A;  5LCW J;  2YNQ A;  2KCV A;  3ASH A;  1HO8 A;  2AJA A;  2EIJ E;  4CDM A;  4DI4 A;  4GCO A;  5AN8 A;  3EU9 A;  2EIK E;  4I9E A;  4CRW A;  3LVR E;  5FZQ A;  4NQ0 A;  1KPS B;  4G23 A;  4KMO A;  3GYZ A;  3IXE A;  2FI7 A;  4H7X A;  3RO2 A;  4DX1 A;  3PZ1 A;  1NA0 A; 
#chains in the Genus database with same CATH homology
 3EIJ A;  3L08 A;  5ANR A;  4JC8 A;  5M72 A;  3OTN A;  2IOS A;  1OWL A;  3TGO A;  4J8D A;  2BF0 X;  5DIZ A;  1WAO 1;  3HYM B;  4AVX A;  4GPK A;  2JEK A;  3EDT B;  4G26 A;  4A55 A;  2I6H A;  4UQX A;  4WUY A;  4PDX A;  3APC A;  4FHJ A;  4GYW A;  4UWH A;  3U9W A;  3NQP A;  5E76 A;  2XQ0 A;  4UI9 K;  2KZT B;  3ASG A;  3FTS A;  3ZEF A;  3U66 A;  3ONK A;  1H0A A;  3CK9 A;  4P29 A;  1UN9 A;  1E8Y A;  3OXF A;  3FTW A;  1HS6 A;  4IRU A;  1E7U A;  3FHE A;  1MHQ A;  3DPD A;  4D10 C;  5JJ6 A;  2I2O A;  3HIZ A;  4NUR A;  1HG5 A;  4QFV A;  1DNP A;  4AY6 A;  3ZIM A;  5FQ7 A;  4JW1 A;  4GYY A;  4N39 A;  4Y6C A;  5ARF A;  2MOW A;  3S2A A;  3QB2 A;  3QWV A;  3QJZ A;  1ZU2 A;  2LAH A;  2C0M A;  4AJW A;  5JJ7 A;  3PE4 A;  3S7F A;  4HOT A;  1X5B A;  2PZI A;  2IU1 A;  2KCK A;  1HF8 A;  3OXL A;  2AW6 A;  5C2Y A;  3TAX A;  3D9M A;  2QY7 A;  3PRZ A;  1H6K A;  4PUC A;  3JQ0 A;  5J90 A;  3EIQ C;  3CHR A;  3ZW3 A;  3QWW A;  4FHK A;  2PM7 A;  5C1D A;  3I5P A;  2GGF A;  1E7V A;  3CVL A;  4U0S A;  3RRM B;  4CEM A;  5LP0 A;  3ZYQ A;  4PH4 B;  4HLE A;  3CQC B;  3CVP A;  1E8W A;  3CK7 A;  5HQ8 A;  3PE3 A;  4R7L A;  3LVQ E;  2ION A;  4A3V A;  3SHF A;  4G2V A;  4L2Y A;  1KT0 A;  5J08 A;  1EF1 C;  1KT1 A;  4JHK A;  4V3I A;  2J9Q A;  4UWF A;  2WM9 A;  3FUL A;  3LEW A;  3RU0 A;  3MV3 B;  3OAW A;  4N3B A;  3CGH A;  3CSF A;  2J4D A;  3MA5 A;  1S0P A;  3CVN A;  4I9C A;  2RG8 A;  4J8S A;  4GZC A;  4UWL A;  3PNL B;  4GB9 A;  1E8Z A;  2OVB A;  3LDZ A;  3ML9 A;  3CHO A;  4CT4 A;  5FWQ A;  4FUL A;  4NRH B;  2XEV A;  4U07 A;  2J49 A;  4C9B B;  5AYW D;  4JHJ A;  2CG3 A;  2UY1 A;  3UT7 A;  1H2V C;  3CK8 A;  5ARG A;  3AS5 A;  2NC9 A;  4TUU A;  1EYH A;  3GZ1 A;  2KM4 A;  5LFA A;  3SFZ A;  4FJY A;  4FC8 A;  3FTY A;  3UQ3 A;  1UJJ A;  2PQR A;  2XRY A;  4CT0 A;  2DCP A;  3BG0 B;  3D9J A;  5KCM A;  3SF4 A;  3CHP A;  2WXF A;  4APO A;  2L6J A;  3QK0 A;  3G2V A;  4A1G A;  4OYS A;  4FAD A;  2WXP A;  4IUL A;  4BT8 A;  4Y6W A;  5FQ4 A;  3URZ A;  4URK A;  2WMN A;  2VSO E;  3ENE A;  5FQ8 A;  2M63 A;  4LEU A;  2XGO A;  1E90 A;  3KEZ A;  4MRU A;  4Q94 A;  4W9R A;  2X6F A;  3Q47 B;  3FU6 A;  3CHQ A;  4I43 A;  2KCL A;  4BX8 A;  3CEQ A;  4ILI A;  3MGB A;  3PEU B;  4KZC A;  2J08 A;  4FP7 A;  3FH8 A;  1WM5 A;  2NXP A;  4GZ3 A;  3FU3 A;  3I3N A;  4I1O B;  4K0R A;  1TJF A;  2YIN A;  1FVF A;  1N54 A;  4XI0 A;  5KJL A;  4YND A;  4GML A;  1SZ9 A;  4FA6 A;  1PC2 A;  2WXO A;  4BTB A;  2R59 A;  3FH5 A;  3KAE A;  3Q4A B;  2RD0 A;  3FP3 A;  3MKQ B;  4WNG A;  3FUK A;  3ZHE B;  1NZN A;  3MYV A;  3SI5 A;  4J0U A;  2XPI A;  4HXI A;  1SQM A;  5T4Y A;  2UY1 B;  3LYA A;  4BX9 A;  4HOQ A;  4U0U A;  1PAQ A;  4ILG A;  3PUK A;  3PZD A;  3EHN A;  3PUJ A;  4JEH A;  2WXK A;  1EDU A;  4G11 A;  4UI9 J;  4JA9 A;  3FEY A;  1NP7 A;  3MCX A;  5BW8 C;  3PDN A;  4TV3 A;  1HE8 A;  4EBA A;  1Z3X A;  2YHE A;  4GMJ A;  1HH8 A;  5LOZ A;  4KT6 B;  3APD A;  3CIA A;  3O4Z A;  5LCW C;  4C0M A;  1OWP A;  4I1M A;  2HR2 A;  2HM8 A;  3T8M A;  2WXQ A;  4F53 A;  3ESK A;  2WVI A;  3FU0 A;  4CGV A;  4ABN A;  4BSX A;  3PH0 C;  3CR3 A;  1ELR A;  4PS3 A;  2JLB A;  2UWJ G;  1HFA A;  2VYI A;  2X6I A;  4ACL A;  1HU3 A;  3GW4 A;  3R9A B;  4GZ6 A;  5CMW A;  1XNF A;  4XI9 A;  1QNF A;  2WXG A;  4HS2 A;  3D3M A;  4NAC A;  1Y8M A;  3E4B A;  3MZL B;  4KVO A;  5FQ6 A;  3D9P A;  4Q69 A;  4XZ4 A;  4DLQ A;  3UMV A;  4WNF A;  3ZYM A;  4G1T A;  3MX3 A;  2OND A;  3HVE B;  3L13 A;  3Q49 B;  4KXK B;  4Q96 A;  5FT9 A;  2AXU A;  3P1U A;  5G04 J;  2XHE A;  2X6H A;  3B13 A;  4JEU A;  3C98 A;  2VGX B;  4M3O A;  5KJN A;  1WY6 A;  4L7T A;  3FU5 A;  1Z3Y A;  3CST A;  4L1B A;  2PL2 A;  3I4R B;  2CFU A;  3B7R L;  1DVP A;  2ILR A;  4UWG A;  4WAF A;  1OWN A;  5ANL A;  3NZS A;  5G55 A;  5LX8 A;  1B89 A;  4PS7 A;  4LCT A;  5CHE E;  3VTX A;  4YVO A;  2GW1 A;  4A1S A;  2FO7 A;  4MLP A;  3RRN B;  2XGM A;  2LO6 A;  2DIW A;  1UW4 B;  2WQH A;  3AS4 A;  4CCA A;  3CHM A;  4CGW A;  2ZU6 B;  4EZJ A;  3UT8 A;  1ELW A;  4RVB A;  4UQZ A;  3D9K A;  2WPV A;  2Y3A A;  4U0Z A;  5FZR A;  2I1J A;  1JWF A;  1NA3 A;  5KJM A;  5BV1 A;  3L6A A;  3ML8 A;  3OXG A;  3SGH A;  4DI3 A;  2XPY A;  2WQ6 A;  1YA0 A;  1ELK A;  1FCH A;  3L54 A;  4KVM A;  5EDS A;  3ZYL A;  3LS8 A;  4GCN A;  5FZS A;  3FUE A;  5HI7 A;  3R7Q A;  3TG4 A;  4EQF A;  5BUZ A;  4LUN U;  3D9I A;  4O6F A;  4UQY A;  4ANW A;  4DJA A;  3QAR A;  3LKU A;  3L16 A;  3L17 A;  3PVL A;  2XGS A;  3IHY A;  5AEN A;  2VSX E;  3D9L A;  1UN8 A;  2VJ8 A;  1TJC A;  2I1K A;  4MS6 A;  2VSN A;  4WND A;  2V8S E;  2E0I A;  3SD5 A;  4J8F A;  3MEK A;  2Q7F A;  4XX5 A;  4KZ0 A;  3ZHE A;  4JA7 A;  3T5V A;  5A6C A;  3MKQ A;  4BY6 A;  4AP2 A;  1A17 A;  4IYP A;  4ATG A;  5E75 A;  4XKC A;  3JYS A;  5KJK A;  2KC7 A;  5D0Q D;  5JHB A;  2CHZ A;  3FTX A;  4CDR A;  5FJY A;  4ACK A;  2BTD A;  4G24 A;  2VGX A;  3D9N A;  3JUI A;  4GA0 A;  3RO3 A;  4B8A A;  4C0E A;  2AVP A;  1UG3 A;  4I6G A;  3B7T A;  1SZA A;  4YVQ C;  1MQS A;  1HG2 A;  3HVE A;  3SBS A;  3KD7 A;  3QKY A;  4HVB A;  3NZU A;  3ONL A;  4WWO A;  3LCA A;  4GAA A;  3QC1 A;  3ZN3 A;  3CVW A;  4DPR A;  1XGW A;  3HHM A;  3LY8 A;  3PEV B;  2X3M A;  3TJP A;  2WB2 A;  2YQ8 A;  4HOR A;  1ZBP A;  2LAI A;  3CKB A;  3LXU X;  4I6J A;  2X6J A;  2FEZ A;  2FUL A;  4AY5 A;  2CHW A;  3G2T A;  5EX0 A;  3FTU A;  1W3B A;  3VTY A;  5EX3 A;  4RG6 A;  3ASD A;  1PY1 A;  4A3T A;  3TG5 A;  3FTZ A;  3GZ2 A;  2HO1 A;  4J8E A;  4K03 A;  1FVH A;  2P58 C;  3QOU A;  3UT4 A;  2BUG A;  4F7A A;  1IHG A;  4AXH A;  5EKQ D;  3EHM A;  3R7R A;  1QQE A;  4AV7 A;  3QNK A;  4N3A A;  2OVF A;  3K9I A;  3FUF A;  4WWP A;  3I4G A;  4JXT A;  4JZY A;  3WXX A;  4ANU A;  5CCM A;  2CHX A;  4FLB A;  3AS8 A;  3CKC A;  3ZYK A;  2C2L A;  3MV2 B;  3U3W A;  2WMO A;  3DBS A;  1UJK A;  5ENN A;  4HOS A;  4F3V A;  1OUV A;  3CHS A;  2XCB A;  3FUI A;  4LER A;  3CV0 A;  2J07 A;  2J4B A;  3APF A;  4HFG A;  3FH7 A;  1H19 A;  3SBT B;  4EPZ A;  2LNI A;  1GW6 A;  2XCC A;  3JCK C;  2CFZ A;  2WQ7 A;  2OOE A;  4XKB A;  2AXV A;  2IF4 A;  3LY7 A;  4RSY A;  1VDY A;  4APF A;  4IN3 B;  1QZ2 A;  2VTB B;  2MHK A;  3FUD A;  3HDX A;  2XPZ A;  2LSU A;  3RRU A;  4FU3 A;  5G05 J;  3ZGQ A;  3QWP A;  4CDN A;  3FUM A;  4G25 A;  4OVV A;  4L23 A;  3ASF A;  4U8H A;  5JHA A;  3IKO B;  3B7S A;  4N2S A;  1HXI A;  4LRZ A;  4RG9 A;  3Q5M A;  3TL5 A;  3RJV A;  3CVQ A;  4PS8 A;  3VLD A;  1BPO A;  3ZFW A;  3ZPJ A;  2LSV A;  2V4L A;  5AIJ A;  2J09 A;  2GRM A;  2KZT A;  3S7J A;  1H2T C;  3O48 A;  4I17 A;  2A5U A;  3PRE A;  3L22 A;  2E2E A;  3GZS A;  2IOL A;  2WXM A;  4J6I A;  4N5C A;  3RKV A;  3BG1 B;  2WXI A;  4AEZ C;  2L0I A;  5T8I A;  2PQN A;  4I2Z A;  1P5Q A;  2OV8 A;  4GZD A;  4JHR A;  3JQ1 A;  5CCL A;  1TEZ A;  2HYZ A;  2PM6 A;  2VQ2 A;  2FBN A;  4FLH A;  2IFU A;  2WXL A;  1JPL A;  5G05 C;  5G2N A;  4BTA A;  2L9B A;  5BNW A;  4BFR A;  3TXM A;  2WXN A;  4GA1 A;  3D9O A;  5A7D B;  3N71 A;  1JWG A;  3CQG B;  3FFL A;  5DBK A;  4MKT A;  2NSZ A;  3NF1 A;  1Y6I A;  2DBA A;  2X6K A;  3G2U A;  3VLF A;  3ZVV A;  2VSY A;  2EQX A;  2R5S A;  5BT1 A;  4U04 A;  2IJG X;  3G2W A;  4GYO A;  3ULQ A;  2XRZ A;  3ESL A;  4ILH B;  3VLE A;  4ANX A;  2IQC A;  3LPZ A;  2A4Z A;  4AM9 A;  4BT9 A;  5A23 A;  2GRL A;  1Z6T A;  3IHV A;  3MKR A;  4FJZ A;  1OWO A;  4EZK A;  4KBQ A;  3FUH A;  3CVV A;  1IYG A;  3IV0 A;  2X38 A;  4AOF A;  4B89 A;  4XIF A;  3FY4 A;  4B0Z A;  3CVY A;  3MJW A;  2VGY A;  4I1A A;  5AJL A;  4JPS A;  2Y4U A;  3RK6 A;  4BWR A;  4U63 A;  3IEG A;  2MRI A;  2FF4 A;  2Y4T A;  4EBA G;  3UX4 A;  2I9C A;  2YHC A;  3FUJ A;  2CG2 A;  1NA0 A;  1LF8 A;  1EPU A;  4JL0 A;  2L0T B;  4EZL A;  1KLX A;  3SZ7 A;  3IBE A;  3EJN A;  4OVU A;  5T3R A;  3ZRH A;  4AIF A;  1JUQ A;  2QFC A;  3PS6 A;  4HOU A;  3FDH A;  3PNT B;  4GZ5 A;  2KAT A;  4WNE A;  4B8C B;  3B7U X;  5D0O D;  4GU5 A;  4N2Q A;  1N52 A;  3TXN A;  3UUX A;  2WXR A;  1U3C A;  3S7D A;  1E8X A;  4EEC A;  5CMY A;  1IQU A;  4E85 A;  2V5F A;  3FTV A;  4B94 A;  5AJD A;  5G04 C;  3RIB A;  2AXZ A;  3FWV A;  3BEE A;  2V0P A;  3AU5 A;  1HZ4 A;  3Q15 A;  5LCW J;  4N3C A;  4GA2 A;  1INZ A;  2YNQ A;  2VTB A;  2WXJ A;  4H7Y A;  3G2S A;  2KCV A;  3ASH A;  5JJT A;  1HO8 A;  1L5J A;  1HX8 A;  2AWI A;  4I2W A;  4DI4 A;  4CDM A;  3UPV A;  4GCO A;  3P2B A;  3U64 A;  3CVU A;  3U4T A;  3FEX A;  4I9E A;  4CRW A;  4TRQ A;  4ME2 A;  3LJ3 A;  3ZXS A;  3LVR E;  4F1S A;  4JVS A;  4E6H A;  1E96 B;  4XE0 A;  5FZQ A;  3S7B A;  4NQ0 A;  4ANV A;  4I6E A;  1IQR A;  3KS2 A;  4G23 A;  4KMO A;  3GYZ A;  3LY9 A;  4UWK A;  1H2U A;  3QDN A;  2FI7 A;  4L2L A;  3T5X A;  3SNX A;  4DK5 A;  2R17 C;  4H7X A;  4KYO B;  5FTP A;  2C0L A;  3QAQ A;  4WWN A;  3CLJ A;  3CVX A;  3RO2 A;  4DLO A;  5BPP A;  1OWM A;  1U3D A;  4UI9 C;  3FUN A;  3AU4 A;  2WXH A;  5BV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...