1EM1A

X-ray crystal structure for human manganese superoxide dismutase, q143a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNADPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Multiple replacements of glutamine 143 in human manganese superoxide dismutase: effects on structure, stability, and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 70
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1em1A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1em1A02
4YIPA 1QNMA 1MMMA 1WB8A 1XILA 1GN4A 4C7UA 1BT8A 1XDCA 1GN3A 1VARA 1IXBA 1MNGA 1VEWA 1AP5A 1EM1A 3EVKA 2QKCA 4E4EA 2QKAA 2ADPA 1AR5A 1AR4A 1MA1A 1I0HA 2P4KA 1LUVA 1BS3A 2CE4A 3MDSA 4JZGA 1MSDA 4GUNA 2CDYA 3TJTA 3LSUA 1AVMA 1PM9A 1JA8A 1XREA 3QVNA 1EN4A 1EN6A 1D5NA 1N0JA 1BSMA 3K9SA 5AG2A 4JZ2A 4YIOA 4F6EA 3BFRA 3AK3A 2RCVA 5A9GA 3DC5A 1LUWA 1GN6A 4X9QA 1I08A 1IX9A 3C3TA 2AW9A 1GN2A 3CEIA 1AP6A 3AK2A 1IDSA 3IC9A 3RN4A 4JYYA 1ZLZA 1ZUQA 3C3SA 1XUQA 1ZSPA 1ZTEA 1EN5A 1N0NA 1KKCA 4FFKA 2GDSA 1Y67A 1SZXA 2ADQB 1P7GA 3KKYA 3OT7A 1WB7A 4BR6A 1B06A 1JR9A 3AK1A 3DC6A 1PL4A
chains in the Genus database with same CATH superfamily
4KUMA 3SJCC 4Z1VA 2MK3A 1I94O 2GTAA 5LMNO 1IBLO 3C90A 2FMLA 2Q73A 3SDLA 4X88A 3RT3C 4CH6A 3OUFA 4TT3G 2CGOA 1TVKB 3K03A 5JVDA 4PDMA 1VF6C 3JALB 2QKAA 2X6BA 1B3QA 3H1HH 2ZIOA 1S5HC 1LR1A 3E89A 1US6A 2OIGA 3JASA 1G4YB 4JI6B 2AZ0A 3MDSA 2LGQA 1AJNA 1VP7A 1DK1A 3ZEDA 2Q8VA 3TJTA 3HKDB 1FYJA 2FTKA 4QE9A 5B1AC 2UUCO 4IIJA 4PELA 4W4KA 4X1IB 3BA9A 4IHJA 4GX5A 2WA3A 2ZE6A 2UXDB 3NXSA 1L1FA 4TOIA 3U11A 1IBMO 5CB4A 3BA8A 1AI6A 4I4TB 4WFBV 4QNHB 4OXSA 1I08A 2Q0OC 3I55V 4R50A 1XOUA 1M90W 3KCYA 3QNEA 3WG7C 2OCCB 1Q6UA 3JYCA 4DV5B 1OCRC 1HNZB 2DOSA 2DWDC 1RPRA 2WWWA 3AG3B 3DXRA 3I56V 2FYUH 3EFFK 4ZI7B 1S0VA 2IBZH 4D7SA 1Q6HA 4LFCO 3B8NA 3CSXA 4I5SA 2X6AA 4DR4O 5CB4B 3LDCA 2P67A 5KAIZ 5B1OA 4I9WA 3OT7A 2QEXV 2OTLV 1F4MA 3CCVV 3SPGA 4FLVA 4LH6A 2WLHA 2IJJA 1XDCA 5IE9A 1IVSA 4UVCA 5L3BA 2UXBO 1P49A 2BOCC 4J7JA 3G4SV 3QO7A 1QCEA 3EVKA 4YJ2A 2RNBA 4XDLA 1Y6XA 5BR8B 1H38A 2A06H 2O57A 3UT5A 2HR3A 5GONB 5KLVH 3ASNB 5CMUA 1X59A 2Z0AA 4TV8A 2VWJA 2QJ1A 5IWAO 1K92A 5KX5A 1XHZA 4DV4O 1AI7A 1V54B 3MHSC 3W7TA 4JI2O 1FPOA 2RDCA 1URFA 2EILC 3P3NA 2IJHA 1RFYA 4JV5O 3UT5B 1XNRB 5EIBD 3AG2C 2NLJC 5EZYB 4DV1O 4TV8B 3SJQC 2IH3C 5B1BB 3L72H 5A9GA 1YVWA 1U97A 3ICXA 1KD1W 3FYEB 4UVAA 3ZX6A 5KX5B 1AJPA 5BXZA 1VF6A 1N34B 4MVZA 2PGGA 2NNUA 3CYOA 3ZN1A 2JS3A 3OGIB 3L74H 3KDRA 1ORQC 4LP8A 3K08A 3L70H 3OMIB 3JD1A 3JAWB 1ZTEA 4JF3A 4MVUA 1BHBA 4MSWC 1FS0G 5LGNA 4G27B 3RYHA 3CWBH 4MVMA 1GM9A 3CMAV 4OPHA 4Z2WA 2E5LB 1TA8A 2Q6AA 3D3IA 2D2CB 1PV0A 2PF4E 2EZPA 4Q6GA 4YHHO 5B3SC 3UKMA 4DV2B 4FM1A 4R8CA 2X7RB 1S5LZ 1TGOA 4GKJB 4UB8Z 3OR7C 2B1GA 3JARB 2ETNA 2GBOA 4MVOA 4ZOLA 4KHPO 2JEUA 3CRRA 3U10A 4U7OA 3HKCA 1XNQB 2JEXA 1GKFA 3K04A 1SA0A 4X64B 1E1QG 2DYSC 4PV1B 1TUEB 3UCSC 3FAVB 2XT9A 3I5DA 4TUYA 1WNSA 2W6JG 4I0XB 1DF5A 4H0LB 2DW4A 2WSSG 5BMVB 4ZIBA 3K5MA 1TUBA 1EN6A 3K58A 1F7YA 2ZNJA 5EBWC 3HKCB 1NU1H 1BSMA 3K9SA 3PJSK 3WG7B 2VS0A 2ZT9B 4PDLA 1VQMV 5D5PA 3ZRWB 4DR7B 1N33B 3ZMVA 5KUMA 4BIOA 2UUBO 3ZMSA 4FMTA 4LF6O 1OCZB 4I50B 1MG1A 4TUYB 3ETQA 4P9PA 5IJ0B 5DM6V 1BCCH 3CXHF 4JI0B 1IURA 4FK5C 2HJDA 2GUZB 1KU9A 2LO1A 1N36O 3JCUZ 1Y66A 2HEPA 2VQFO 4X20A 1NQTA 4DR2B 5KHGA 4JASA 2Q5ZA 3K9AA 3C3SA 3H1LH 2WLKA 2CAZC 2UXNA 2F93B 2DYRC 3DC6A 4B3RO 1R3JC 3LDEA 3OE7G 2EULA 4N23A 4JI4B 1SRYA 1HWYA 5JCOC 4DUYO 2WLMA 4JYBA 2XTAA 4LNUB 4WFGA 1R6NA 1IBKB 3J7AU 2QGNA 3CCRV 1VQLV 4DXWA 5KMGB 2JRIA 4FM0A 3SYOA 2E74B 2VRZA 2MW2B 4JI7O 1AILA 2QM8A 1RM1B 3OTOO 2R9AA 3CCMV 5CA3A 1FFTB 5K1PA 3L73H 3WU2Z 3JAKB 4K0KB 3LSQA 3UO3A 4X62B 1MSDA 2KB1A 1RSOA 2XAFA 3AG2B 1DTOA 4JI8B 3SYCA 3W7UA 3THOA 2LW1A 2YDEA 3QO8A 4DV0B 4DR5O 2A7WA 2YXHA 4KFMA 2HVKC 3RYIB 3F5TA 2QWNB 4O2AA 4AHCA 5KHKA 1KP3A 2VQEB 4GKKB 3G67A 4NKGB 3OMAB 3IJ4A 5EBLC 1VQKV 3AK3A 2RCVA 1RSOB 3K06A 4XDKA 5JJEB 4RUFA 1HNWO 4GX1A 4X9QA 1K5QA 2HLDG 2BOBC 1AP6A 3B09A 3ZRSA 5B3SB 4QE7A 2QKSA 1V9PA 2R9RB 4E2LA 1ZLZA 2C2AA 1OZ0A 4FPPA 1SQQH 4A5UB 1YITV 2PI4A 1Y4MA 3E8BA 5LA6B 2ZM6O 2YS8A 1G1XB 4GT1A 1WAZA 4YXWG 1OHHG 4JI3O 3OUSA 3MAQA 2GSMB 4J11A 4U3FH 4TQDA 3ETGA 3SR2C 3GB7C 1M93A 4CH5A 5B66Z 1H2NA 3EXAA 3CJHA 3VQVA 4I9QA 2A0LA 1SQVH 3ZIAG 1QLNA 4QGPA 1LNQA 3BPZA 1DF4A 5LMNB 3AG4B 4FFBA 4YJ3B 2OCCC 2UUAB 1I0HA 4B3TB 1LUVA 1BS3A 1GK9A 3AG3C 1F23A 4DV3O 4K35A 1SETA 1HR0B 4K8ZA 2UXXA 4X66B 3T1YB 1P7BA 1PM9A 3GWKC 2V7QG 1N8RW 1GH6A 3BABA 1HNXO 4NXMO 1Q7YW 3TETA 1DLBA 2ZXWB 4DV6B 2XHBA 3ZMTA 2JJ1G 1H2MA 1YTFD 4ZHQA 5JCOA 3BFRA 4EFBA 3LUTB 4X65B 1BGYH 5LHIA 3K5NA 5IJ9A 2JGDA 3B77A 1Y76A 1NR7A 2Q68A 1MABG 3HB3B 3VQWA 1IBMB 3VBBA 5C93A 1XBLA 2ZDIC 3ASNC 1Q90D 2AHYA 1S76D 3IC9A 3RN4A 4FLZA 3TK1A 2P06A 5LL6Y 3SJBC 2UXCB 1XMOB 4O4LB 1NH2B 1SZXA 1V54C 3CMEV 2YICA 4CBCA 2F4VO 1H2KA 2W6IG 2ZE5A 4UCUA 1WLEA 2PTMA 5C8YB 1CP9A 4LF5B 5LHHA 2OWOA 1YJWV 4J9YB 2N05A 2QWQB 4LFAO 1PD3A 3ETDA 2R9IA 1K9MW 1HW7A 3AEIA 4LFBO 3JALA 2UU9O 1O9HA 1OCOB 1I5XA 4L87A 2ITCC 3TGUH 3CRCA 3WB2A 1EBOA 1GRJA 4PJ0Z 1IZ3A 2WLLB 4JYAO 4PA6A 2BE3A 2DWEC 2JGUA 5L3CA 1GO3F 4F4LA 4GUNA 1VQNV 5JJNB 2IM9A 1NZ6A 1AVMA 3HKDA 1U96A 3F7YC 1FAFA 2OTJV 2HHHO 4J7KA 4X1IA 3OTFA 1COWG 2RQ6A 4H37A 4JPRA 1FOUA 1Q43A 4LC1A 3NR7A 1R3KC 1FJGO 1W0KG 2WLJA 4W4LA 4PA9A 3AG1B 4LWSB 1FD9A 4H13B 2YEVB 4EKWA 4UCOA 4RAIA 4I4TA 4OPAA 3BY6A 3DC5A 3SJAC 4MW3A 4NXNB 4JV5B 2PYLA 4Q20A 3JATA 4DV1B 4UB6Z 4JI5B 5CBHA 1K73W 5H6QA 2AW9A 2CK3G 2K9PA 2L35A 1BQZA 1QQCA 3KZIZ 4ZI7A 4DR3O 3ZHVA 1R3IC 3R66A 2HJFC 4CS4A 3G6BA 1PL4A 2DE0X 5F2VO 3JATB 1JVMA 1XILA 3IAYA 2N74A 1S3JA 3SPJA 4XBFA 4ASUG 1SKVA 1PP9H 1OCZC 2XOKG 4DR6O 1YI2V 3ABKB 2PUSA 1ROPA 1MNGA 1VEWA 1YIJV 1L8DA 2XNDG 2QKCA 3KCXA 3HKEA 2EIKB 2Y69B 1VQ5V 2PYJA 3CCLV 1M56B 4HNAB 1QBZA 1AR4A 4P9OA 4LF9O 1W2BU 1K4CC 3M8AA 4AQYO 2H3OA 2ZDIA 4PA4A 5GONA 4TQFA 1AROP 2G38A 1VF7A 4X1YB 1MZFA 4QIWF 2H8PC 5KHHA 4ZKIA 1AB3A 4OX9B 1SERA 4RQFA 3HKEB 2KG7B 5AG2A 1JJ2U 1K3EA 3H9VA 3ETEA 4D6TH 4UUJC 5EZYA 4DR1B 3SPIA 4Z1MG 3CHXA 1I5YA 3OR6C 1K97A 3R65A 1GN6A 1K5SA 4FM2A 1RM1C 2Q7GA 3UM7A 3OM3B 2XAHA 1JOYA 1GTOA 3B4SA 5ITZB 2JJ2G 3JAWA 1VIBA 2QDOA 2QWRB 1EN5A 1RPOA 3D8CA 1EZVH 5EC2C 4JI6O 2GDSA 3LDDA 2LGWA 3T4DA 5J2UA 5EYPB 2A9HA 1UPGA 2JDIG 3LSSA 2OT5A 2QTOA 1Z5VA 4DYLA 4D7TA 3E8HA 3CXCU 2F43G 3STZC 2LW7A 3JARA 1S77D 2XASA 1IXBA 5LP6B 3LNNA 2LP7A 1WPXA 2P6JA 1EM1A 5IYCO 1AR1B 2UXDO 5J2UB 2LJ2A 1VQ4V 1Z5WA 5EK0A 1XI1A 3CB2A 1EFRG 1QHTA 1J5EB 4UVBA 1VQ7V 4FLXA 4JZGA 3FAVA 1SQFA 2AGAA 2YIAA 2P4VA 4IT5A 4O4IB 4DV5O 4I0XA 2ODMA 3GWOA 5BMVA 4PHZA 2ARHA 5IDJA 1N32B 1FFXA 1D5NA 1KB9F 5LGUA 2KQXA 4CS2A 1KKDA 3W7WA 1NBMG 3ZRWA 3ZRVA 2Z5UA 3K0GA 4LF8B 4I50A 4MVSA 4JI1B 3N2KB 2BCCH 1KUQA 5IJ0A 1NVPD 1R1BA 2ZR2A 4UV8A 2KSDA 3AG4C 1SC5B 2JVDA 3T4ZA 4QPJA 1FFXB 2GUZA 4DV7B 2JS5A 4N21A 3OFNG 1VQ9V 1IDSA 2QE7G 3K79A 1KBHA 3P3PA 3ZMUA 3CS5A 2ZE8A 1NT2B 4DW1A 3E22B 1Q8IA 1QVFU 5L3GA 4FFKA 2F95B 1NKDA 2CUGA 3E86A 5FNVB 1SQBH 3AK1A 4OGQB 2XAQA 4CC6A 2ZXWC 3T1HO 1GN4A 2ZM6B 1N4CA 4YY3B 1JFFB 4RO2A 4JI3B 2AZ2A 2N04A 4LNUA 2L6LA 4U3JA 1JCHA 5KMGA 2IU3A 4EB6B 4LR3A 4UV9A 4WBNB 1XNRO 4G2KA 2ZD9A 5EC1C 3QTCA 4B3MB 1D5AA 4ICGA 2IJKA 5LOVB 2Y4TA 2NN4A 5H5NA 2YIDA 4O2BB 1YXBA 4IYIA 4RUEA 3OMNB 3MD0A 3JAKA 1N34O 2BSKB 2DN9A 1BZKA 3TXQA 4P30A 4U3JB 4LBEC 1R73A 4WCEV 3JSNA 1Y74B 3W7XA 4ZBMA 3H1IH 1XL6A 3QVNA 3VQXA 2XUMA 3RYIA 5KHIA 3E8GA 3FYIB 2GHYA 1QR8A 4J42A 4JZ2A 1H2SB 1XMQB 4HYOA 4UCSA 1W0JG 3HKBA 5KUKA 3JAMN 2ZINA 3CRMA 1K33A 4DV2O 3D36C 4GKJO 3VQYA 2FKXA 1NI8A 1OCOC 1H5WA 3G6EV 1M1KW 5IYZB 4I55B 1HP8A 1SQGA 1UJWB 1NTMH 1OJHA 4DK1A 4J7ZA 1KYOF 1XNQO 1ZUQA 3H1KH 3RYFB 1CEZA 3HPLC 4R7CA 3HKBB 2PY5A 4JTCB 5LA6A 1Q82W 1XHXA 1WB7A 4BR6A 2Y4UA 1WA8A 3CPWU 1MMMA 4UCVA 4MVRA 5LMUB 4B3SO 2P5OA 2QWPB 3AG1C 5L3DA 4UCRA 4X8AA 4LF4O 1Q81W 1D2DA 4X1KB 4HAMA 3CC7V 4DUZB 1N33O 4DR7O 4RQEA 2M6YA 1AP5A 2PI5A 4YJ3A 1M4UA 3FKSG 1IXMA 1WA8B 2YI9A 1MA1A 3BRCA 4LFAB 2EINB 4G28B 5FPOA 4J80A 3N2GB 3UO2A 3J81N 3B8MA 2CE4A 4NTWA 3X2QC 3H01A 2UU9B 4QPKA 1VQ6V 3ASOC 3IGAC 2CDYA 2ILMA 3OEHG 4FVMA 4DR2O 4IYHA 1I94B 1IBLB 3WFVA 5LYJB 1F4NA 3M99B 5GW7A 2WLIB 3K3WA 2CH7B 2OYQA 3ABKC 4WFAV 2R72A 4BAYA 1AI5A 2EJ7A 4JI4O 2EIKC 2Y69C 1M56C 3ABTA 4NTYA 1IBKO 3C3TA 4PI2A 2HVJC 1H2GA 2Z3YA 2HFEC 1ZSPA 3LNMB 2UUCB 4PDRA 2CTRA 1KKCA 4O4LA 4TSFG 3CD6V 1Y67A 1ZL8B 4MS2A 2ZQMA 1QLEC 5IY5B 4JYCA 4X62O 4DR3B 1KMIZ 1G6UA 2FL4A 3CCQV 1P84F 3O9OA 1QNMA 4DV0O 1R6TA 4H44B 5C8YA 4FLTA 4RWUA 4DK0A 5FL7G 2QTSA 3ZS8C 1K34A 4UXNA 2VQEO 4GKKO 4BIZA 2IJIA 3A0RA 3D36A 1WJZA 4NTXA 1ZWIC 4DW0A 4PA7A 3ZHUA 4LFCB 4DR4B 2IH1C 4FZ1A 5IYDO 2WLLA 3ZN0A 2Q4PA 2ZNIA 2WPDG 2XAJA 4GZRB 1I7FA 5E79Z 4WFEA 2F1MA 1XREA 5BY1A 3A2FA 3CRQA 5JQGB 2RN9A 3JCZA 3ZRXA 5JH7B 2UXBB 2DMXA 1M57B 1PPJH 1QU7A 5E1AC 5L3FA 5CN0A 5FLXN 4YIOA 4LWSA 5LP6C 1OCCB 2YEVA 4MTGA 4X89A 1QVGU 1M5IA 1KQSU 3CE2A 2DJVA 3OAAG 3OW2U 5GTIZ 2W0XA 1FKAO 1ZX3A 1V55B 2FB5A 5IWAB 3TCUA 1L0LH 4TWKA 1KC8W 3A0HZ 4DV4B 4JYYA 2HKOA 2X0LA 4MTOA 2UUAO 1XUQA 4JI2B 4B3TO 4KP4A 4JAVA 4TV9A 1Z2GA 1T5EA 3KG2A 3SGIA 3S3WA 1HR0O 3RYCB 2B5UA 2V4DA 1NTZH 2Q7HA 3L75H 4YIPA 4X66O 2ZKOA 2P7TC 3SPHA 3T1YO 4NYKA 4CH3A 4C7UA 1UFIA 1EZJA 1MZEA 1PNMA 1WP7A 1SQXH 1VARA 3X2QB 3E8FA 2IU0A 1H8HG 2EJRA 2AXTZ 3ASOB 4DV6O 1B04A 4TV9B 2EZOA 3CX5F 2YI8A 1XL4A 2EBOA 5JVDB 4X65O 5H2FZ 1YTFB 4HNAA 5B5EZ 2H94A 2P4KA 5JJJB 3JASB 3T1CA 4X1YA 2KKWA 4GX0A 1E1RG 1VQOV 3PN1A 1JX9A 2Y48A 4GCZA 3K57A 4NVPA 4FZ0A 4YHHB 2Q7EA 4FLWA 2ATKC 3FFQA 3SPCA 4FLYA 4PD4F 2KG7A 2UXCO 4IIJB 3FB7C 3ABMB 1XMOO 3M7MX 3VOUA 4HZ3A 4FIPC 1O9GA 2HG5C 3RVZA 1PNKA 4IHJB 2Y0IA 4KHPB 2EIJB 4KL1A 4F6EA 4JGSA 1NJIW 5CBFA 3P30A 4LF5O 1BL8A 1LUWA 4B08A 4FLUA 1QLEB 5EIBC 1JNBA 1GMGA 2RJZA 4LF7O 4HBNA 3J80N 1CXZB 3B40A 3AK2A 5JWPA 5ITZA 3DXRB 2PZSA 2YUAA 3A0BZ 2VWKA 3CC4V 2IW5A 2P22C 1Q5OA 5HFMA 3DTUB 2YC0A 1SS3A 1H8EG 5DEDA 2ADQB 3Q4HA 4IGGA 1BE3H 5EYPA 1B06A 2UUBB 2QM7A 3JD2A 4LF6B 1P4RA 1JQ0A 3CCUV 2B9ZA 2E75B 2K1EA 1S5JA 1X4TA 2NR5A 4JAUA 1GN3A 1PKXA 3OEEG 5LP6A 3ABUA 5CA0A 3JD0A 4EEQA 1PNLA 1KP2A 3T1HB 1N36B 1GM8A 2EIMB 4J41A 2OCHA 3S3XA 1R6KA 3Q4HB 4YJ2B 2VQFB 1SZTA 2JK5C 2ADPA 3FX7A 4O4HA 1KECA 1YHQV 1K4DC 1VQ8V 1XEQA 3T2MA 2LQTA 4NXNO 4JI5O 3K5LA 3G71V 4O4IA 2Y0PA 5CA0B 1S72V 1M9NA 4B3RB 5HFLA 4JTDB 3ZHQA 1JA8A 3F7VC 3O65A 4DUYB 4O4HB 5J2TA 1SQPH 5EBMC 4L8JA 3DSQA 4BIUA 5H9CA 3ABLC 2ZR3A 4AILC 4JI7B 2GV9A 2EX3A 2ZE7A 4CC5A 3SYQA 3OTOB 3STLC 3N2KA 5LBQA 3U0ZA 2DQ0A 1HNZO 3FB6C 3L9DA 3CRAA 3JD3A 2R70A 2YXYA 1IX9A 5KHJA 2EINC 3RGBA 5J2TB 1W59A 4DR5B 3E35A 5IT9N 3E22A 3ZMZA 3OD4A 4K3AA 4B7KA 3AG7A 1GAXA 1VF5B 3RYHB 5DECA 5L3EA 1YEWA 5FNVA 1JR9A 3RFRA 4DRXA 4PDVA 5B1AB 3RBZA 2ITDC 1OV9A 3TXSA 1ZAUA 5TISZ 1WB8A 1FXHA 1Q86W 4OX9O 3BHPA 3BAAA 1WP8A 1JFFA 1HNWB 2D3OW 4CZZA 2CTPA 2LFSA 4H33A 2QR4A 3L71H 5BR8O 4UCTA 1BMFG 4EB6A 2ZCEA 4ZOLB 4WBNA 3IC7A 3JSLA 5LOVA 4F6RA 4B3SB 2E76B 1TAEA 4DR1O 4LF4B 4DRXB 3K59A 1SA0B 4O2BA 4J10A 1OCRB 5D5QA 3BCCH 2XAGA 2BSKA 1NR1A 2A79B 2Q0AA 1Y74A 2JIZG 2CGNA 4MTFA 5IY5C 2YXLA 1EN4A 1TUBB 1SF9A 4F6RB 5BZBA 1SESA 2CTQA 1YZBA 1JPXA 3G80A 3CCEV 4AI8A 2W0FC 3CC2V 2QSAA 1K7DA 2Q67A 4K8XA 3CCJV 3OGCC 5KAFZ 1HDJA 3QO5A 1JMKC 4DV3B 4JTAB 1WN7A 1YCIA 3B2EE 4I55A 5IYZA 2CTWA 1Q3EA 4P2ZA 1GN2A 3CEIA 1J95A 5DN6G 4X20B 3RYFA 4CS3A 1J5EO 1HNXB 2E5LO 2LFRA 4NXMB 1N0NA 1FXKC 4GX2A 3HR0A 3FB8C 4NB5A 3H1JH 3RWRD 1BQ0A 4J9ZB 1YJ9V 2QWOB 2YSUB 3SYAA 1M57C 3MHHC 2EILB 4WF9V 1N32O 4BW9A 1BT8A 5LXTA 1YF2A 3N27A 1OCCC 2WA4A 4B7EA 4XDJA 4X1KA 4X64O 4PI0A 4EFEA 3JD4A 4LF8O 2M7WA 2P90A 1AR5A 1V55C 4JI1O 1WPBA 1NH2D 1B6QA 3ZHRA 3DGEA 3N2GA 3RVYA 1YDXA 1NVPB 3EHBB 5LXTB 3ABLB 3FD9A 5LHGA 4DV7O 1K8AW 5J9PC 2F4VB 1JJOA 1DGSA 2ZIMA 2WAMA 2V1DA 3W7SA 1ENVA 5LYJA 1N0JA 1THZA 4UFZA 4O2AB 1G8MA 3K5OA 5H6RA 2WLIA 4FJCC 2BTQA 4JI0O 4LFBB 1QR9A 1XQ8A 2CH7A 1MSWD 3K0DA 1MOFA 4U7NA 2E3CA 5LGTA 3A8TA 4NR1A 5CBGA 4YY3O 1AJQA 3WB1A 4MTXA 4JYAB 2WLNA 4PA3A 2GTSA 4KXRA 3SYPA 2YIBD 3QF7A 3BEHA 4B3MO 2DYSB 1H2LA 2BTQB 2HHHB 3CP1A 3F5WC 3ML0A 4IL6Z 1ZL8A 5B1NA 4JAAA 1FJGB 1P7GA 3ABMC 4GYCB 2BTOA 2HP8A 4MW8A 3E83A 2F23A 3UQ8A 2EIJC 3APOA 1IJGA 3CJHB 3E2EA 3APQA 2Q9LA 3BVOA 3ZJZA 3ZHSA 1AI4A 4QJFB 1XMQO 4WFHA 2X6CA 4E4EA 4K0KO 4LCUC 4FFBB 1Q6IA 4JI8O 4MT8A 1CPYA 4BWAA 5KA6A 5KA5A 4WFFA 1PL0A 3GVMA 2AHZA 1RP3B 1BHAA 1FXKA 2Q69A 2RMKB 3P32A 1VQPV 3CCSV 4O4JA 3LSUA 3D3QA 1YJNV 1YSCA 2A3QA 1FXVA 4R6ZA 3ZCCA 5JQGA 1VMGA 2DYRB 4LH7A 5JH7A 4DR6B 5K1XA 4CH4A 5CA1A 1E79G 5FPRA 4ABMA 3QG5A 2DQ3A 4ZHQB 2QA4V 3ZHTA 3IFXA 3WB0A 4GLXA 4LF9B 5LMUO 2YIBA 1FXKB 1GM7A 2B1IA 2EIMC 4O4JB 5IJ9B 4AQYB 1NTKH 2JGDB 1Y76B 2F66C 1R3LC 5GTHZ 4DUZO 4BW5A 5IYBO 5CA1B 1NS1A 4I7ZB 1F51A 2OIEA 5B1BC 4LF7B 2QM4A 3FB5C 5A2QN 1A32A 1TVKA 3KKYA 4DO2A 3RYCA 4MVQA 1L0NH 3RW0A 3ZBHA
chains in the Genus database with same CATH topology
4YIPA 1QNMA 1MMMA 1WB8A 1XILA 1GN4A 4C7UA 1BT8A 1XDCA 1GN3A 1VARA 1IXBA 1MNGA 1VEWA 1AP5A 1EM1A 3EVKA 2QKCA 4E4EA 2QKAA 2ADPA 1AR5A 1AR4A 1MA1A 1I0HA 2P4KA 1LUVA 1BS3A 2CE4A 3MDSA 4JZGA 1MSDA 4GUNA 2CDYA 3TJTA 3LSUA 1AVMA 1PM9A 1JA8A 1XREA 3QVNA 1EN4A 1EN6A 1D5NA 1N0JA 1BSMA 3K9SA 5AG2A 4JZ2A 4YIOA 4F6EA 3BFRA 3AK3A 2RCVA 5A9GA 3DC5A 1LUWA 1GN6A 4X9QA 1I08A 1IX9A 3C3TA 2AW9A 1GN2A 3CEIA 1AP6A 3AK2A 1IDSA 3KDRA 3IC9A 3RN4A 4JYYA 1ZLZA 1ZUQA 3C3SA 1XUQA 1ZSPA 1ZTEA 1EN5A 1N0NA 1KKCA 4FFKA 2GDSA 1Y67A 1SZXA 2ADQB 1P7GA 3KKYA 3OT7A 1WB7A 4BR6A 1B06A 1JR9A 3AK1A 3DC6A 1PL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIP A;  1QNM A;  1MMM A;  1WB8 A;  1XIL A;  1GN4 A;  4C7U A;  1BT8 A;  1XDC A;  1GN3 A;  1VAR A;  1IXB A;  1MNG A;  1VEW A;  1AP5 A;  1EM1 A;  3EVK A;  2QKC A;  4E4E A;  2QKA A;  2ADP A;  1AR5 A;  1AR4 A;  1MA1 A;  1I0H A;  2P4K A;  1LUV A;  1BS3 A;  2CE4 A;  3MDS A;  4JZG A;  1MSD A;  4GUN A;  2CDY A;  3TJT A;  3LSU A;  1AVM A;  1PM9 A;  1JA8 A;  1XRE A;  3QVN A;  1EN4 A;  1EN6 A;  1D5N A;  1N0J A;  1BSM A;  3K9S A;  5AG2 A;  4JZ2 A;  4YIO A;  4F6E A;  3BFR A;  3AK3 A;  2RCV A;  5A9G A;  3DC5 A;  1LUW A;  1GN6 A;  4X9Q A;  1I08 A;  1IX9 A;  3C3T A;  2AW9 A;  1GN2 A;  3CEI A;  1AP6 A;  3AK2 A;  1IDS A;  3IC9 A;  3RN4 A;  4JYY A;  1ZLZ A;  1ZUQ A;  3C3S A;  1XUQ A;  1ZSP A;  1ZTE A;  1EN5 A;  1N0N A;  1KKC A;  4FFK A;  2GDS A;  1Y67 A;  1SZX A;  2ADQ B;  1P7G A;  3KKY A;  3OT7 A;  1WB7 A;  4BR6 A;  1B06 A;  1JR9 A;  3AK1 A;  3DC6 A;  1PL4 A; 
#chains in the Genus database with same CATH topology
 4KUM A;  3SJC C;  4Z1V A;  2MK3 A;  1I94 O;  2GTA A;  5LMN O;  1IBL O;  3C90 A;  2FML A;  2Q73 A;  3SDL A;  4X88 A;  3RT3 C;  4CH6 A;  3OUF A;  4TT3 G;  2CGO A;  1TVK B;  3K03 A;  5JVD A;  4PDM A;  1VF6 C;  3JAL B;  2QKA A;  2X6B A;  1B3Q A;  3H1H H;  2ZIO A;  1S5H C;  1LR1 A;  3E89 A;  1US6 A;  2OIG A;  3JAS A;  1G4Y B;  4JI6 B;  2AZ0 A;  3MDS A;  2LGQ A;  1AJN A;  1VP7 A;  1DK1 A;  3ZED A;  2Q8V A;  3TJT A;  3HKD B;  1FYJ A;  2FTK A;  4QE9 A;  5B1A C;  2UUC O;  4IIJ A;  4PEL A;  4W4K A;  4X1I B;  3BA9 A;  4IHJ A;  4GX5 A;  2WA3 A;  2ZE6 A;  2UXD B;  3NXS A;  1L1F A;  4TOI A;  3U11 A;  1IBM O;  5CB4 A;  3BA8 A;  1AI6 A;  4I4T B;  4WFB V;  4QNH B;  4OXS A;  1I08 A;  2Q0O C;  3I55 V;  4R50 A;  1XOU A;  1M90 W;  3KCY A;  3QNE A;  3WG7 C;  2OCC B;  1Q6U A;  3JYC A;  4DV5 B;  1OCR C;  1HNZ B;  2DOS A;  2DWD C;  1RPR A;  2WWW A;  3AG3 B;  3DXR A;  3I56 V;  2FYU H;  3EFF K;  4ZI7 B;  1S0V A;  2IBZ H;  4D7S A;  1Q6H A;  4LFC O;  3B8N A;  3CSX A;  4I5S A;  2X6A A;  4DR4 O;  5CB4 B;  3LDC A;  2P67 A;  5KAI Z;  5B1O A;  4I9W A;  3OT7 A;  2QEX V;  2OTL V;  1F4M A;  3CCV V;  3SPG A;  4FLV A;  4LH6 A;  2WLH A;  2IJJ A;  1XDC A;  5IE9 A;  1IVS A;  4UVC A;  5L3B A;  2UXB O;  1P49 A;  2BOC C;  4J7J A;  3G4S V;  3QO7 A;  1QCE A;  3EVK A;  4YJ2 A;  2RNB A;  4XDL A;  1Y6X A;  5BR8 B;  1H38 A;  2A06 H;  2O57 A;  3UT5 A;  2HR3 A;  5GON B;  5KLV H;  3ASN B;  5CMU A;  1X59 A;  2Z0A A;  4TV8 A;  2VWJ A;  2QJ1 A;  5IWA O;  1K92 A;  5KX5 A;  1XHZ A;  4DV4 O;  1AI7 A;  1V54 B;  3MHS C;  3W7T A;  4JI2 O;  1FPO A;  2RDC A;  1URF A;  2EIL C;  3P3N A;  2IJH A;  1RFY A;  4JV5 O;  3UT5 B;  1XNR B;  5EIB D;  3AG2 C;  2NLJ C;  5EZY B;  4DV1 O;  4TV8 B;  3SJQ C;  2IH3 C;  5B1B B;  3L72 H;  5A9G A;  1YVW A;  1U97 A;  3ICX A;  1KD1 W;  3FYE B;  4UVA A;  3ZX6 A;  5KX5 B;  1AJP A;  5BXZ A;  1VF6 A;  1N34 B;  4MVZ A;  2PGG A;  2NNU A;  3CYO A;  3ZN1 A;  2JS3 A;  3OGI B;  3L74 H;  3KDR A;  1ORQ C;  4LP8 A;  3K08 A;  3L70 H;  3OMI B;  3JD1 A;  3JAW B;  1ZTE A;  4JF3 A;  4MVU A;  1BHB A;  4MSW C;  1FS0 G;  5LGN A;  4G27 B;  3RYH A;  3CWB H;  4MVM A;  1GM9 A;  3CMA V;  4OPH A;  4Z2W A;  2E5L B;  1TA8 A;  2Q6A A;  3D3I A;  2D2C B;  1PV0 A;  2PF4 E;  2EZP A;  4Q6G A;  4YHH O;  5B3S C;  3UKM A;  4DV2 B;  4FM1 A;  4R8C A;  2X7R B;  1S5L Z;  1TGO A;  4GKJ B;  4UB8 Z;  3OR7 C;  2B1G A;  3JAR B;  2ETN A;  2GBO A;  4MVO A;  4ZOL A;  4KHP O;  2JEU A;  3CRR A;  3U10 A;  4U7O A;  3HKC A;  1XNQ B;  2JEX A;  1GKF A;  3K04 A;  1SA0 A;  4X64 B;  1E1Q G;  2DYS C;  4PV1 B;  1TUE B;  3UCS C;  3FAV B;  2XT9 A;  3I5D A;  4TUY A;  1WNS A;  2W6J G;  4I0X B;  1DF5 A;  4H0L B;  2DW4 A;  2WSS G;  5BMV B;  4ZIB A;  3K5M A;  1TUB A;  1EN6 A;  3K58 A;  1F7Y A;  2ZNJ A;  5EBW C;  3HKC B;  1NU1 H;  1BSM A;  3K9S A;  3PJS K;  3WG7 B;  2VS0 A;  2ZT9 B;  4PDL A;  1VQM V;  5D5P A;  3ZRW B;  4DR7 B;  1N33 B;  3ZMV A;  5KUM A;  4BIO A;  2UUB O;  3ZMS A;  4FMT A;  4LF6 O;  1OCZ B;  4I50 B;  1MG1 A;  4TUY B;  3ETQ A;  4P9P A;  5IJ0 B;  5DM6 V;  1BCC H;  3CXH F;  4JI0 B;  1IUR A;  4FK5 C;  2HJD A;  2GUZ B;  1KU9 A;  2LO1 A;  1N36 O;  3JCU Z;  1Y66 A;  2HEP A;  2VQF O;  4X20 A;  1NQT A;  4DR2 B;  5KHG A;  4JAS A;  2Q5Z A;  3K9A A;  3C3S A;  3H1L H;  2WLK A;  2CAZ C;  2UXN A;  2F93 B;  2DYR C;  3DC6 A;  4B3R O;  1R3J C;  3LDE A;  3OE7 G;  2EUL A;  4N23 A;  4JI4 B;  1SRY A;  1HWY A;  5JCO C;  4DUY O;  2WLM A;  4JYB A;  2XTA A;  4LNU B;  4WFG A;  1R6N A;  1IBK B;  3J7A U;  2QGN A;  3CCR V;  1VQL V;  4DXW A;  5KMG B;  2JRI A;  4FM0 A;  3SYO A;  2E74 B;  2VRZ A;  2MW2 B;  4JI7 O;  1AIL A;  2QM8 A;  1RM1 B;  3OTO O;  2R9A A;  3CCM V;  5CA3 A;  1FFT B;  5K1P A;  3L73 H;  3WU2 Z;  3JAK B;  4K0K B;  3LSQ A;  3UO3 A;  4X62 B;  1MSD A;  2KB1 A;  1RSO A;  2XAF A;  3AG2 B;  1DTO A;  4JI8 B;  3SYC A;  3W7U A;  3THO A;  2LW1 A;  2YDE A;  3QO8 A;  4DV0 B;  4DR5 O;  2A7W A;  2YXH A;  4KFM A;  2HVK C;  3RYI B;  3F5T A;  2QWN B;  4O2A A;  4AHC A;  5KHK A;  1KP3 A;  2VQE B;  4GKK B;  3G67 A;  4NKG B;  3OMA B;  3IJ4 A;  5EBL C;  1VQK V;  3AK3 A;  2RCV A;  1RSO B;  3K06 A;  4XDK A;  5JJE B;  4RUF A;  1HNW O;  4GX1 A;  4X9Q A;  1K5Q A;  2HLD G;  2BOB C;  1AP6 A;  3B09 A;  3ZRS A;  5B3S B;  4QE7 A;  2QKS A;  1V9P A;  2R9R B;  4E2L A;  1ZLZ A;  2C2A A;  1OZ0 A;  4FPP A;  1SQQ H;  4A5U B;  1YIT V;  2PI4 A;  1Y4M A;  3E8B A;  5LA6 B;  2ZM6 O;  2YS8 A;  1G1X B;  4GT1 A;  1WAZ A;  4YXW G;  1OHH G;  4JI3 O;  3OUS A;  3MAQ A;  2GSM B;  4J11 A;  4U3F H;  4TQD A;  3ETG A;  3SR2 C;  3GB7 C;  1M93 A;  4CH5 A;  5B66 Z;  1H2N A;  3EXA A;  3CJH A;  3VQV A;  4I9Q A;  2A0L A;  1SQV H;  3ZIA G;  1QLN A;  4QGP A;  1LNQ A;  3BPZ A;  1DF4 A;  5LMN B;  3AG4 B;  4FFB A;  4YJ3 B;  2OCC C;  2UUA B;  1I0H A;  4B3T B;  1LUV A;  1BS3 A;  1GK9 A;  3AG3 C;  1F23 A;  4DV3 O;  4K35 A;  1SET A;  1HR0 B;  4K8Z A;  2UXX A;  4X66 B;  3T1Y B;  1P7B A;  1PM9 A;  3GWK C;  2V7Q G;  1N8R W;  1GH6 A;  3BAB A;  1HNX O;  4NXM O;  1Q7Y W;  3TET A;  1DLB A;  2ZXW B;  4DV6 B;  2XHB A;  3ZMT A;  2JJ1 G;  1H2M A;  1YTF D;  4ZHQ A;  5JCO A;  3BFR A;  4EFB A;  3LUT B;  4X65 B;  1BGY H;  5LHI A;  3K5N A;  5IJ9 A;  2JGD A;  3B77 A;  1Y76 A;  1NR7 A;  2Q68 A;  1MAB G;  3HB3 B;  3VQW A;  1IBM B;  3VBB A;  5C93 A;  1XBL A;  2ZDI C;  3ASN C;  1Q90 D;  2AHY A;  1S76 D;  3IC9 A;  3RN4 A;  4FLZ A;  3TK1 A;  2P06 A;  5LL6 Y;  3SJB C;  2UXC B;  1XMO B;  4O4L B;  1NH2 B;  1SZX A;  1V54 C;  3CME V;  2YIC A;  4CBC A;  2F4V O;  1H2K A;  2W6I G;  2ZE5 A;  4UCU A;  1WLE A;  2PTM A;  5C8Y B;  1CP9 A;  4LF5 B;  5LHH A;  2OWO A;  1YJW V;  4J9Y B;  2N05 A;  2QWQ B;  4LFA O;  1PD3 A;  3ETD A;  2R9I A;  1K9M W;  1HW7 A;  3AEI A;  4LFB O;  3JAL A;  2UU9 O;  1O9H A;  1OCO B;  1I5X A;  4L87 A;  2ITC C;  3TGU H;  3CRC A;  3WB2 A;  1EBO A;  1GRJ A;  4PJ0 Z;  1IZ3 A;  2WLL B;  4JYA O;  4PA6 A;  2BE3 A;  2DWE C;  2JGU A;  5L3C A;  1GO3 F;  4F4L A;  4GUN A;  1VQN V;  5JJN B;  2IM9 A;  1NZ6 A;  1AVM A;  3HKD A;  1U96 A;  3F7Y C;  1FAF A;  2OTJ V;  2HHH O;  4J7K A;  4X1I A;  3OTF A;  1COW G;  2RQ6 A;  4H37 A;  4JPR A;  1FOU A;  1Q43 A;  4LC1 A;  3NR7 A;  1R3K C;  1FJG O;  1W0K G;  2WLJ A;  4W4L A;  4PA9 A;  3AG1 B;  4LWS B;  1FD9 A;  4H13 B;  2YEV B;  4EKW A;  4UCO A;  4RAI A;  4I4T A;  4OPA A;  3BY6 A;  3DC5 A;  3SJA C;  4MW3 A;  4NXN B;  4JV5 B;  2PYL A;  4Q20 A;  3JAT A;  4DV1 B;  4UB6 Z;  4JI5 B;  5CBH A;  1K73 W;  5H6Q A;  2AW9 A;  2CK3 G;  2K9P A;  2L35 A;  1BQZ A;  1QQC A;  3KZI Z;  4ZI7 A;  4DR3 O;  3ZHV A;  1R3I C;  3R66 A;  2HJF C;  4CS4 A;  3G6B A;  1PL4 A;  2DE0 X;  5F2V O;  3JAT B;  1JVM A;  1XIL A;  3IAY A;  2N74 A;  1S3J A;  3SPJ A;  4XBF A;  4ASU G;  1SKV A;  1PP9 H;  1OCZ C;  2XOK G;  4DR6 O;  1YI2 V;  3ABK B;  2PUS A;  1ROP A;  1MNG A;  1VEW A;  1YIJ V;  1L8D A;  2XND G;  2QKC A;  3KCX A;  3HKE A;  2EIK B;  2Y69 B;  1VQ5 V;  2PYJ A;  3CCL V;  1M56 B;  4HNA B;  1QBZ A;  1AR4 A;  4P9O A;  4LF9 O;  1W2B U;  1K4C C;  3M8A A;  4AQY O;  2H3O A;  2ZDI A;  4PA4 A;  5GON A;  4TQF A;  1ARO P;  2G38 A;  1VF7 A;  4X1Y B;  1MZF A;  4QIW F;  2H8P C;  5KHH A;  4ZKI A;  1AB3 A;  4OX9 B;  1SER A;  4RQF A;  3HKE B;  2KG7 B;  5AG2 A;  1JJ2 U;  1K3E A;  3H9V A;  3ETE A;  4D6T H;  4UUJ C;  5EZY A;  4DR1 B;  3SPI A;  4Z1M G;  3CHX A;  1I5Y A;  3OR6 C;  1K97 A;  3R65 A;  1GN6 A;  1K5S A;  4FM2 A;  1RM1 C;  2Q7G A;  3UM7 A;  3OM3 B;  2XAH A;  1JOY A;  1GTO A;  3B4S A;  5ITZ B;  2JJ2 G;  3JAW A;  1VIB A;  2QDO A;  2QWR B;  1EN5 A;  1RPO A;  3D8C A;  1EZV H;  5EC2 C;  4JI6 O;  2GDS A;  3LDD A;  2LGW A;  3T4D A;  5J2U A;  5EYP B;  2A9H A;  1UPG A;  2JDI G;  3LSS A;  2OT5 A;  2QTO A;  1Z5V A;  4DYL A;  4D7T A;  3E8H A;  3CXC U;  2F43 G;  3STZ C;  2LW7 A;  3JAR A;  1S77 D;  2XAS A;  1IXB A;  5LP6 B;  3LNN A;  2LP7 A;  1WPX A;  2P6J A;  1EM1 A;  5IYC O;  1AR1 B;  2UXD O;  5J2U B;  2LJ2 A;  1VQ4 V;  1Z5W A;  5EK0 A;  1XI1 A;  3CB2 A;  1EFR G;  1QHT A;  1J5E B;  4UVB A;  1VQ7 V;  4FLX A;  4JZG A;  3FAV A;  1SQF A;  2AGA A;  2YIA A;  2P4V A;  4IT5 A;  4O4I B;  4DV5 O;  4I0X A;  2ODM A;  3GWO A;  5BMV A;  4PHZ A;  2ARH A;  5IDJ A;  1N32 B;  1FFX A;  1D5N A;  1KB9 F;  5LGU A;  2KQX A;  4CS2 A;  1KKD A;  3W7W A;  1NBM G;  3ZRW A;  3ZRV A;  2Z5U A;  3K0G A;  4LF8 B;  4I50 A;  4MVS A;  4JI1 B;  3N2K B;  2BCC H;  1KUQ A;  5IJ0 A;  1NVP D;  1R1B A;  2ZR2 A;  4UV8 A;  2KSD A;  3AG4 C;  1SC5 B;  2JVD A;  3T4Z A;  4QPJ A;  1FFX B;  2GUZ A;  4DV7 B;  2JS5 A;  4N21 A;  3OFN G;  1VQ9 V;  1IDS A;  2QE7 G;  3K79 A;  1KBH A;  3P3P A;  3ZMU A;  3CS5 A;  2ZE8 A;  1NT2 B;  4DW1 A;  3E22 B;  1Q8I A;  1QVF U;  5L3G A;  4FFK A;  2F95 B;  1NKD A;  2CUG A;  3E86 A;  5FNV B;  1SQB H;  3AK1 A;  4OGQ B;  2XAQ A;  4CC6 A;  2ZXW C;  3T1H O;  1GN4 A;  2ZM6 B;  1N4C A;  4YY3 B;  1JFF B;  4RO2 A;  4JI3 B;  2AZ2 A;  2N04 A;  4LNU A;  2L6L A;  4U3J A;  1JCH A;  5KMG A;  2IU3 A;  4EB6 B;  4LR3 A;  4UV9 A;  4WBN B;  1XNR O;  4G2K A;  2ZD9 A;  5EC1 C;  3QTC A;  4B3M B;  1D5A A;  4ICG A;  2IJK A;  5LOV B;  2Y4T A;  2NN4 A;  5H5N A;  2YID A;  4O2B B;  1YXB A;  4IYI A;  4RUE A;  3OMN B;  3MD0 A;  3JAK A;  1N34 O;  2BSK B;  2DN9 A;  1BZK A;  3TXQ A;  4P30 A;  4U3J B;  4LBE C;  1R73 A;  4WCE V;  3JSN A;  1Y74 B;  3W7X A;  4ZBM A;  3H1I H;  1XL6 A;  3QVN A;  3VQX A;  2XUM A;  3RYI A;  5KHI A;  3E8G A;  3FYI B;  2GHY A;  1QR8 A;  4J42 A;  4JZ2 A;  1H2S B;  1XMQ B;  4HYO A;  4UCS A;  1W0J G;  3HKB A;  5KUK A;  3JAM N;  2ZIN A;  3CRM A;  1K33 A;  4DV2 O;  3D36 C;  4GKJ O;  3VQY A;  2FKX A;  1NI8 A;  1OCO C;  1H5W A;  3G6E V;  1M1K W;  5IYZ B;  4I55 B;  1HP8 A;  1SQG A;  1UJW B;  1NTM H;  1OJH A;  4DK1 A;  4J7Z A;  1KYO F;  1XNQ O;  1ZUQ A;  3H1K H;  3RYF B;  1CEZ A;  3HPL C;  4R7C A;  3HKB B;  2PY5 A;  4JTC B;  5LA6 A;  1Q82 W;  1XHX A;  1WB7 A;  4BR6 A;  2Y4U A;  1WA8 A;  3CPW U;  1MMM A;  4UCV A;  4MVR A;  5LMU B;  4B3S O;  2P5O A;  2QWP B;  3AG1 C;  5L3D A;  4UCR A;  4X8A A;  4LF4 O;  1Q81 W;  1D2D A;  4X1K B;  4HAM A;  3CC7 V;  4DUZ B;  1N33 O;  4DR7 O;  4RQE A;  2M6Y A;  1AP5 A;  2PI5 A;  4YJ3 A;  1M4U A;  3FKS G;  1IXM A;  1WA8 B;  2YI9 A;  1MA1 A;  3BRC A;  4LFA B;  2EIN B;  4G28 B;  5FPO A;  4J80 A;  3N2G B;  3UO2 A;  3J81 N;  3B8M A;  2CE4 A;  4NTW A;  3X2Q C;  3H01 A;  2UU9 B;  4QPK A;  1VQ6 V;  3ASO C;  3IGA C;  2CDY A;  2ILM A;  3OEH G;  4FVM A;  4DR2 O;  4IYH A;  1I94 B;  1IBL B;  3WFV A;  5LYJ B;  1F4N A;  3M99 B;  5GW7 A;  2WLI B;  3K3W A;  2CH7 B;  2OYQ A;  3ABK C;  4WFA V;  2R72 A;  4BAY A;  1AI5 A;  2EJ7 A;  4JI4 O;  2EIK C;  2Y69 C;  1M56 C;  3ABT A;  4NTY A;  1IBK O;  3C3T A;  4PI2 A;  2HVJ C;  1H2G A;  2Z3Y A;  2HFE C;  1ZSP A;  3LNM B;  2UUC B;  4PDR A;  2CTR A;  1KKC A;  4O4L A;  4TSF G;  3CD6 V;  1Y67 A;  1ZL8 B;  4MS2 A;  2ZQM A;  1QLE C;  5IY5 B;  4JYC A;  4X62 O;  4DR3 B;  1KMI Z;  1G6U A;  2FL4 A;  3CCQ V;  1P84 F;  3O9O A;  1QNM A;  4DV0 O;  1R6T A;  4H44 B;  5C8Y A;  4FLT A;  4RWU A;  4DK0 A;  5FL7 G;  2QTS A;  3ZS8 C;  1K34 A;  4UXN A;  2VQE O;  4GKK O;  4BIZ A;  2IJI A;  3A0R A;  3D36 A;  1WJZ A;  4NTX A;  1ZWI C;  4DW0 A;  4PA7 A;  3ZHU A;  4LFC B;  4DR4 B;  2IH1 C;  4FZ1 A;  5IYD O;  2WLL A;  3ZN0 A;  2Q4P A;  2ZNI A;  2WPD G;  2XAJ A;  4GZR B;  1I7F A;  5E79 Z;  4WFE A;  2F1M A;  1XRE A;  5BY1 A;  3A2F A;  3CRQ A;  5JQG B;  2RN9 A;  3JCZ A;  3ZRX A;  5JH7 B;  2UXB B;  2DMX A;  1M57 B;  1PPJ H;  1QU7 A;  5E1A C;  5L3F A;  5CN0 A;  5FLX N;  4YIO A;  4LWS A;  5LP6 C;  1OCC B;  2YEV A;  4MTG A;  4X89 A;  1QVG U;  1M5I A;  1KQS U;  3CE2 A;  2DJV A;  3OAA G;  3OW2 U;  5GTI Z;  2W0X A;  1FKA O;  1ZX3 A;  1V55 B;  2FB5 A;  5IWA B;  3TCU A;  1L0L H;  4TWK A;  1KC8 W;  3A0H Z;  4DV4 B;  4JYY A;  2HKO A;  2X0L A;  4MTO A;  2UUA O;  1XUQ A;  4JI2 B;  4B3T O;  4KP4 A;  4JAV A;  4TV9 A;  1Z2G A;  1T5E A;  3KG2 A;  3SGI A;  3S3W A;  1HR0 O;  3RYC B;  2B5U A;  2V4D A;  1NTZ H;  2Q7H A;  3L75 H;  4YIP A;  4X66 O;  2ZKO A;  2P7T C;  3SPH A;  3T1Y O;  4NYK A;  4CH3 A;  4C7U A;  1UFI A;  1EZJ A;  1MZE A;  1PNM A;  1WP7 A;  1SQX H;  1VAR A;  3X2Q B;  3E8F A;  2IU0 A;  1H8H G;  2EJR A;  2AXT Z;  3ASO B;  4DV6 O;  1B04 A;  4TV9 B;  2EZO A;  3CX5 F;  2YI8 A;  1XL4 A;  2EBO A;  5JVD B;  4X65 O;  5H2F Z;  1YTF B;  4HNA A;  5B5E Z;  2H94 A;  2P4K A;  5JJJ B;  3JAS B;  3T1C A;  4X1Y A;  2KKW A;  4GX0 A;  1E1R G;  1VQO V;  3PN1 A;  1JX9 A;  2Y48 A;  4GCZ A;  3K57 A;  4NVP A;  4FZ0 A;  4YHH B;  2Q7E A;  4FLW A;  2ATK C;  3FFQ A;  3SPC A;  4FLY A;  4PD4 F;  2KG7 A;  2UXC O;  4IIJ B;  3FB7 C;  3ABM B;  1XMO O;  3M7M X;  3VOU A;  4HZ3 A;  4FIP C;  1O9G A;  2HG5 C;  3RVZ A;  1PNK A;  4IHJ B;  2Y0I A;  4KHP B;  2EIJ B;  4KL1 A;  4F6E A;  4JGS A;  1NJI W;  5CBF A;  3P30 A;  4LF5 O;  1BL8 A;  1LUW A;  4B08 A;  4FLU A;  1QLE B;  5EIB C;  1JNB A;  1GMG A;  2RJZ A;  4LF7 O;  4HBN A;  3J80 N;  1CXZ B;  3B40 A;  3AK2 A;  5JWP A;  5ITZ A;  3DXR B;  2PZS A;  2YUA A;  3A0B Z;  2VWK A;  3CC4 V;  2IW5 A;  2P22 C;  1Q5O A;  5HFM A;  3DTU B;  2YC0 A;  1SS3 A;  1H8E G;  5DED A;  2ADQ B;  3Q4H A;  4IGG A;  1BE3 H;  5EYP A;  1B06 A;  2UUB B;  2QM7 A;  3JD2 A;  4LF6 B;  1P4R A;  1JQ0 A;  3CCU V;  2B9Z A;  2E75 B;  2K1E A;  1S5J A;  1X4T A;  2NR5 A;  4JAU A;  1GN3 A;  1PKX A;  3OEE G;  5LP6 A;  3ABU A;  5CA0 A;  3JD0 A;  4EEQ A;  1PNL A;  1KP2 A;  3T1H B;  1N36 B;  1GM8 A;  2EIM B;  4J41 A;  2OCH A;  3S3X A;  1R6K A;  3Q4H B;  4YJ2 B;  2VQF B;  1SZT A;  2JK5 C;  2ADP A;  3FX7 A;  4O4H A;  1KEC A;  1YHQ V;  1K4D C;  1VQ8 V;  1XEQ A;  3T2M A;  2LQT A;  4NXN O;  4JI5 O;  3K5L A;  3G71 V;  4O4I A;  2Y0P A;  5CA0 B;  1S72 V;  1M9N A;  4B3R B;  5HFL A;  4JTD B;  3ZHQ A;  1JA8 A;  3F7V C;  3O65 A;  4DUY B;  4O4H B;  5J2T A;  1SQP H;  5EBM C;  4L8J A;  3DSQ A;  4BIU A;  5H9C A;  3ABL C;  2ZR3 A;  4AIL C;  4JI7 B;  2GV9 A;  2EX3 A;  2ZE7 A;  4CC5 A;  3SYQ A;  3OTO B;  3STL C;  3N2K A;  5LBQ A;  3U0Z A;  2DQ0 A;  1HNZ O;  3FB6 C;  3L9D A;  3CRA A;  3JD3 A;  2R70 A;  2YXY A;  1IX9 A;  5KHJ A;  2EIN C;  3RGB A;  5J2T B;  1W59 A;  4DR5 B;  3E35 A;  5IT9 N;  3E22 A;  3ZMZ A;  3OD4 A;  4K3A A;  4B7K A;  3AG7 A;  1GAX A;  1VF5 B;  3RYH B;  5DEC A;  5L3E A;  1YEW A;  5FNV A;  1JR9 A;  3RFR A;  4DRX A;  4PDV A;  5B1A B;  3RBZ A;  2ITD C;  1OV9 A;  3TXS A;  1ZAU A;  5TIS Z;  1WB8 A;  1FXH A;  1Q86 W;  4OX9 O;  3BHP A;  3BAA A;  1WP8 A;  1JFF A;  1HNW B;  2D3O W;  4CZZ A;  2CTP A;  2LFS A;  4H33 A;  2QR4 A;  3L71 H;  5BR8 O;  4UCT A;  1BMF G;  4EB6 A;  2ZCE A;  4ZOL B;  4WBN A;  3IC7 A;  3JSL A;  5LOV A;  4F6R A;  4B3S B;  2E76 B;  1TAE A;  4DR1 O;  4LF4 B;  4DRX B;  3K59 A;  1SA0 B;  4O2B A;  4J10 A;  1OCR B;  5D5Q A;  3BCC H;  2XAG A;  2BSK A;  1NR1 A;  2A79 B;  2Q0A A;  1Y74 A;  2JIZ G;  2CGN A;  4MTF A;  5IY5 C;  2YXL A;  1EN4 A;  1TUB B;  1SF9 A;  4F6R B;  5BZB A;  1SES A;  2CTQ A;  1YZB A;  1JPX A;  3G80 A;  3CCE V;  4AI8 A;  2W0F C;  3CC2 V;  2QSA A;  1K7D A;  2Q67 A;  4K8X A;  3CCJ V;  3OGC C;  5KAF Z;  1HDJ A;  3QO5 A;  1JMK C;  4DV3 B;  4JTA B;  1WN7 A;  1YCI A;  3B2E E;  4I55 A;  5IYZ A;  2CTW A;  1Q3E A;  4P2Z A;  1GN2 A;  3CEI A;  1J95 A;  5DN6 G;  4X20 B;  3RYF A;  4CS3 A;  1J5E O;  1HNX B;  2E5L O;  2LFR A;  4NXM B;  1N0N A;  1FXK C;  4GX2 A;  3HR0 A;  3FB8 C;  4NB5 A;  3H1J H;  3RWR D;  1BQ0 A;  4J9Z B;  1YJ9 V;  2QWO B;  2YSU B;  3SYA A;  1M57 C;  3MHH C;  2EIL B;  4WF9 V;  1N32 O;  4BW9 A;  1BT8 A;  5LXT A;  1YF2 A;  3N27 A;  1OCC C;  2WA4 A;  4B7E A;  4XDJ A;  4X1K A;  4X64 O;  4PI0 A;  4EFE A;  3JD4 A;  4LF8 O;  2M7W A;  2P90 A;  1AR5 A;  1V55 C;  4JI1 O;  1WPB A;  1NH2 D;  1B6Q A;  3ZHR A;  3DGE A;  3N2G A;  3RVY A;  1YDX A;  1NVP B;  3EHB B;  5LXT B;  3ABL B;  3FD9 A;  5LHG A;  4DV7 O;  1K8A W;  5J9P C;  2F4V B;  1JJO A;  1DGS A;  2ZIM A;  2WAM A;  2V1D A;  3W7S A;  1ENV A;  5LYJ A;  1N0J A;  1THZ A;  4UFZ A;  4O2A B;  1G8M A;  3K5O A;  5H6R A;  2WLI A;  4FJC C;  2BTQ A;  4JI0 O;  4LFB B;  1QR9 A;  1XQ8 A;  2CH7 A;  1MSW D;  3K0D A;  1MOF A;  4U7N A;  2E3C A;  5LGT A;  3A8T A;  4NR1 A;  5CBG A;  4YY3 O;  1AJQ A;  3WB1 A;  4MTX A;  4JYA B;  2WLN A;  4PA3 A;  2GTS A;  4KXR A;  3SYP A;  2YIB D;  3QF7 A;  3BEH A;  4B3M O;  2DYS B;  1H2L A;  2BTQ B;  2HHH B;  3CP1 A;  3F5W C;  3ML0 A;  4IL6 Z;  1ZL8 A;  5B1N A;  4JAA A;  1FJG B;  1P7G A;  3ABM C;  4GYC B;  2BTO A;  2HP8 A;  4MW8 A;  3E83 A;  2F23 A;  3UQ8 A;  2EIJ C;  3APO A;  1IJG A;  3CJH B;  3E2E A;  3APQ A;  2Q9L A;  3BVO A;  3ZJZ A;  3ZHS A;  1AI4 A;  4QJF B;  1XMQ O;  4WFH A;  2X6C A;  4E4E A;  4K0K O;  4LCU C;  4FFB B;  1Q6I A;  4JI8 O;  4MT8 A;  1CPY A;  4BWA A;  5KA6 A;  5KA5 A;  4WFF A;  1PL0 A;  3GVM A;  2AHZ A;  1RP3 B;  1BHA A;  1FXK A;  2Q69 A;  2RMK B;  3P32 A;  1VQP V;  3CCS V;  4O4J A;  3LSU A;  3D3Q A;  1YJN V;  1YSC A;  2A3Q A;  1FXV A;  4R6Z A;  3ZCC A;  5JQG A;  1VMG A;  2DYR B;  4LH7 A;  5JH7 A;  4DR6 B;  5K1X A;  4CH4 A;  5CA1 A;  1E79 G;  5FPR A;  4ABM A;  3QG5 A;  2DQ3 A;  4ZHQ B;  2QA4 V;  3ZHT A;  3IFX A;  3WB0 A;  4GLX A;  4LF9 B;  5LMU O;  2YIB A;  1FXK B;  1GM7 A;  2B1I A;  2EIM C;  4O4J B;  5IJ9 B;  4AQY B;  1NTK H;  2JGD B;  1Y76 B;  2F66 C;  1R3L C;  5GTH Z;  4DUZ O;  4BW5 A;  5IYB O;  5CA1 B;  1NS1 A;  4I7Z B;  1F51 A;  2OIE A;  5B1B C;  4LF7 B;  2QM4 A;  3FB5 C;  5A2Q N;  1A32 A;  1TVK A;  3KKY A;  4DO2 A;  3RYC A;  4MVQ A;  1L0N H;  3RW0 A;  3ZBH A; 
#chains in the Genus database with same CATH homology
 4YIP A;  1QNM A;  1MMM A;  1WB8 A;  1XIL A;  1GN4 A;  4C7U A;  1BT8 A;  1XDC A;  1GN3 A;  1VAR A;  1IXB A;  1MNG A;  1VEW A;  1AP5 A;  1EM1 A;  3EVK A;  2QKC A;  4E4E A;  2QKA A;  2ADP A;  1AR5 A;  1AR4 A;  1MA1 A;  1I0H A;  2P4K A;  1LUV A;  1BS3 A;  2CE4 A;  3MDS A;  4JZG A;  1MSD A;  4GUN A;  2CDY A;  3TJT A;  3LSU A;  1AVM A;  1PM9 A;  1JA8 A;  1XRE A;  3QVN A;  1EN4 A;  1EN6 A;  1D5N A;  1N0J A;  1BSM A;  3K9S A;  5AG2 A;  4JZ2 A;  4YIO A;  4F6E A;  3BFR A;  3AK3 A;  2RCV A;  5A9G A;  3DC5 A;  1LUW A;  1GN6 A;  4X9Q A;  1I08 A;  1IX9 A;  3C3T A;  2AW9 A;  1GN2 A;  3CEI A;  1AP6 A;  3AK2 A;  1IDS A;  3KDR A;  3IC9 A;  3RN4 A;  4JYY A;  1ZLZ A;  1ZUQ A;  3C3S A;  1XUQ A;  1ZSP A;  1ZTE A;  1EN5 A;  1N0N A;  1KKC A;  4FFK A;  2GDS A;  1Y67 A;  1SZX A;  2ADQ B;  1P7G A;  3KKY A;  3OT7 A;  1WB7 A;  4BR6 A;  1B06 A;  1JR9 A;  3AK1 A;  3DC6 A;  1PL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...