1EM1A

X-ray crystal structure for human manganese superoxide dismutase, q143a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNADPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple replacements of glutamine 143 in human manganese superoxide dismutase: effects on structure, stability, and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 70
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1em1A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1em1A02
3K9SA 3CEIA 1EM1A 4GUNA 1JA8A 1PM9A 3OT7A 1XREA 3AK3A 2P4KA 2CDYA 2ADPA 1WB8A 1EN6A 1AR5A 1BT8A 1WB7A 1IDSA 5A9GA 1QNMA 4JZGA 1ZUQA 1XDCA 1N0JA 1JR9A 3AK1A 3IC9A 4FFKA 1LUVA 1AP5A 1LUWA 1MMMA 1MSDA 1GN6A 1XUQA 1EN4A 3AK2A 4E4EA 1AP6A 1VARA 2QKAA 3TJTA 1GN4A 1GN3A 2ADQB 4F6EA 1KKCA 1AR4A 1GN2A 1BSMA 1ZLZA 1IX9A 4X9QA 2AW9A 3QVNA 4C7UA 1B06A 1BS3A 1I0HA 4YIOA 1MNGA 1ZTEA 3DC6A 2GDSA 1ZSPA 3BFRA 1AVMA 3MDSA 3EVKA 1PL4A 3C3TA 1VEWA 4JZ2A 4YIPA 3DC5A 1IXBA 1D5NA 3C3SA 1SZXA 2RCVA 1EN5A 4JYYA 1XILA 1I08A 2CE4A 5AG2A 1P7GA 3KKYA 4BR6A 3RN4A 3LSUA 1MA1A 1N0NA 1Y67A 2QKCA
chains in the Genus database with same CATH superfamily
2VQEO 4G28B 4LF4B 4GUNA 4DK1A 5L3BA 3H1LH 5GW7A 1FXKC 1VIBA 4K3AA 1YF2A 1NH2B 2QWPB 5D5PA 1BHBA 5IYCO 5B1NA 4AQYO 4QGPA 1K5SA 2FMLA 2Z0AA 3I5DA 2XT9A 2YIDA 3JALA 1QR8A 5JCOA 2ARHA 1SQVH 3HKDB 3UQ8A 2ZR2A 1QLEB 4J7KA 2UXDB 1KB9F 4FLYA 5LXTA 3ZX6A 4GLXA 4B3SO 5BMVA 2KQXA 1LNQA 1VQOV 1SQGA 3CMEV 4LF9B 5IJ0B 3CRQA 3UKMA 2UXBO 5H9CA 1AP5A 1N8RW 4GX1A 3S3WA 4PI0A 2ZT9B 4DR3B 2D3OW 1I94B 3D3IA 1NTMH 1EN4A 4KHPB 2QKAA 1RPOA 4KHPO 4ZKIA 5JH7A 3QG5A 4IGGA 1F51A 1OCOC 4Q6GA 5CBFA 3E8HA 5FNVA 2P5OA 1QHTA 5GTIZ 1BS3A 4YIOA 5TISZ 3SDLA 3PN1A 2IW5A 5LGTA 3LUTB 4U3JB 4O4JA 4BIUA 1FFXA 4JGSA 4DXWA 1R6TA 3K5OA 4I4TA 4CS2A 3SGIA 1NS1A 1YVWA 2WLIA 3A0BZ 1XMQB 1VEWA 4JYAB 3D3QA 3BAAA 2NN4A 2V1DA 3HKCA 1PP9H 3HR0A 4RO2A 3FX7A 3RYFA 4X66O 1SETA 1RM1B 3RYIA 1FS0G 4RUFA 1BQ0A 2YICA 3H9VA 3FYEB 4FK5C 1KP2A 3JD3A 3K5NA 4LFCO 2X6BA 4LNUB 4TUYA 3T4DA 1XL6A 2EILC 3IJ4A 1GM8A 2OIGA 4JTDB 2MK3A 3LDEA 4WFFA 1N36O 2ATKC 2PY5A 3K04A 4OPAA 2QM7A 4L8JA 4OXSA 2ZQMA 1H2GA 2HR3A 2Q0OC 1E79G 4TV9B 3D36A 3SYQA 3SPIA 2IH1C 5BR8B 1Y74B 4UB8Z 1N32O 3I56V 3IC9A 2IJHA 3JATB 4H33A 1ZL8B 3CHXA 4I55A 4BW9A 2UUBB 4J9ZB 1AJQA 2X0LA 3JD1A 2CTPA 1FKAO 3QF7A 3K0GA 4IYHA 4O4IB 4ZI7A 2JGDA 2P90A 3BEHA 2QM8A 1I94O 3JAWA 1VF6A 5J2TA 2AW9A 4NXNO 3I55V 2BTQA 3S3XA 2Q5ZA 1OCOB 1PNKA 3UT5A 4MVQA 2P7TC 2ZIOA 3SR2C 5JJNB 1N34O 4CH6A 3C3TA 2DYSC 5GONB 3OE7G 3OEEG 3OMNB 4PA4A 3ZMVA 2UUAB 1VQ4V 1SA0B 3OUSA 5ITZB 1H8EG 4IL6Z 2R9IA 4FLWA 4UCSA 1M93A 4QE9A 1N36B 5LGNA 2CH7A 3J81N 3JAKA 4RUEA 5J2TB 4UFZA 4UVCA 3FAVA 2Q73A 2Z3YA 4G27B 3BCCH 1KYOF 5K1XA 2UXNA 3T1YB 1NTKH 1NVPD 2F66C 1TAEA 4OGQB 5DECA 3ASNB 1E1QG 2A7WA 1WB8A 4MW8A 3ETGA 2HHHB 1V54B 4O4HB 3ZCCA 3GWKC 1ZX3A 1SS3A 4AHCA 2ZDIC 1GM9A 1XI1A 4JYAO 2A0LA 1QR9A 3FB6C 5FL7G 5JQGA 2L6LA 3JAKB 1LUVA 3K03A 3W7TA 1MMMA 4OPHA 2IH3C 2PYJA 1M1KW 2OTLV 4Q20A 2YC0A 3ZRXA 1TUBA 2ZD9A 5IYZA 1EFRG 4F6EA 4UCRA 3CCLV 2WLMA 4DR6O 4DUYO 2X7RB 2XAGA 1JOYA 1K92A 4UV8A 4LF8B 4JI3O 3FYIB 2WSSG 3OW2U 5LMNB 2OCCC 1YTFB 3AG3B 5CMUA 2PYLA 1FFTB 4J80A 1BHAA 4UXNA 3H1HH 3C3SA 3BHPA 2HP8A 1I08A 2WLLA 3ZN0A 2ZE7A 2HFEC 4WFBV 1NQTA 2DWDC 3BA9A 2DJVA 4JYBA 4IYIA 1S0VA 3CCJV 1UJWB 4AILC 2EZPA 3ZMSA 5LBQA 2E76B 4ASUG 3W7SA 3O65A 4JI6O 2IU0A 1PM9A 4DR5B 2XOKG 1Q86W 2G38A 4JAAA 4DV3B 2ZIMA 2P06A 2YEVB 3HPLC 2Q6AA 4DR3O 4J10A 2WLHA 2W6IG 5E1AC 2HVJC 2A3QA 5FPRA 4BIZA 3JCZA 3D8CA 1N0JA 4XBFA 4LF6B 4LF4O 4FFKA 3WB1A 4DK0A 4LBEC 3DXRB 1F23A 5LA6B 4Z1MG 1RSOB 4XDLA 4UB6Z 1IURA 3ZRSA 4WF9V 1W59A 1NT2B 2K1EA 2CGOA 1JCHA 2EZOA 1K73W 2BE3A 5L3CA 1HNXB 4X20A 1H2NA 2YEVA 1FXKA 2LQTA 2WLIB 4B7KA 3NXSA 5CBHA 1QVFU 3B8NA 2VQEB 2PUSA 2H3OA 1SQQH 1SKVA 1M9NA 3L70H 4LFAO 4JPRA 5FLXN 4FPPA 2Q9LA 4MS2A 3QO7A 3IFXA 2HJFC 1R3JC 4UVBA 5KHKA 4MVOA 1DTOA 4B3RB 3CRRA 1WA8A 4BR6A 1QLNA 1VQPV 2WA4A 4UCTA 3CX5F 2LO1A 4R7CA 2OT5A 4DR1O 4NR1A 3L75H 1GTOA 3E8FA 4CC5A 5KMGB 4DR1B 2YI8A 1R3IC 3G80A 5C8YB 1ENVA 3EFFK 4IHJA 4DV7B 4O2AA 4FLZA 2XAHA 2ILMA 2ZCEA 4JV5B 4N21A 1YEWA 4EEQA 5DN6G 1IBKB 4X1IA 2H94A 4TV8B 1NU1H 3CXHF 1EN6A 4DV1B 1N32B 2CTWA 4X64O 4UUJC 4P2ZA 1R6NA 4F6RB 5CA1A 2JRIA 3G4SV 1Q6HA 1YITV 4LP8A 3G6EV 1K34A 4DR2O 1NZ6A 2ZXWB 2E5LO 4L87A 1BL8A 5EBLC 1M57B 5LOVA 4I9WA 4YHHO 1QVGU 2EX3A 3B8MA 2WPDG 3OM3B 1F7YA 2JGDB 4Z2WA 3VOUA 5KMGA 2BSKB 1EBOA 3RWRD 3OR6C 4UCOA 3ZMZA 4E4EA 2DMXA 1VARA 3APOA 2ADQB 4DV6O 3QTCA 2DYRB 4JI5O 5B1AC 2EIJB 5JCOC 2OWOA 5C93A 1O9GA 5LMUO 4JYCA 2JGUA 3X2QB 1IBMO 5EYPA 4NTWA 2M6YA 3OAAG 4IT5A 3ABMB 2GUZA 1SRYA 2E3CA 2GSMB 3ZHUA 1KQSU 4NTYA 1MABG 1CPYA 1XMOO 2JJ2G 5B3SB 2UU9O 3G6BA 3HKCB 2HVKC 4WBNB 4UVAA 2F4VO 4KL1A 4JI0B 1VQ8V 4YJ3A 3RYHA 4GZRB 3K9AA 2AZ2A 5L3DA 4J9YB 2R9AA 3B4SA 4DW1A 2ZM6O 2R9RB 1SQBH 4DR7B 1KECA 1W0KG 1N4CA 4X8AA 5EK0A 1DLBA 4O4HA 1XNQB 5CBGA 4FFBA 4JI8B 4DR6B 4NVPA 2CDYA 4UCUA 2LGQA 1RFYA 1PNMA 2Q7HA 1AROP 3APQA 2CAZC 1R1BA 3OTFA 3KDRA 2Z5UA 1OCCB 3W7UA 4P9PA 2RMKB 3R66A 3CMAV 5K1PA 1YJ9V 4CH3A 2W0XA 3FB8C 2AGAA 1GH6A 1FYJA 5EC1C 1V55B 2XTAA 3M99B 4FZ1A 1XMOB 4KP4A 1SQPH 2Q0AA 3DTUB 4WFAV 3L74H 1JVMA 4X1KA 3JAWB 1RSOA 4WFGA 3HB3B 1K8AW 4JASA 1KD1W 1Y4MA 3K57A 2GV9A 1TVKB 1M4UA 3G67A 5LXTB 2GTSA 3TETA 2F4VB 4TOIA 1B06A 1PV0A 1F4MA 4DV2B 1NH2D 4JI5B 4DV0O 1YZBA 1MSWD 3L9DA 4DR5O 4U7OA 3IGAC 4JAVA 3STZC 2KSDA 2XUMA 3MD0A 1WN7A 5H6QA 2JDIG 4JI7O 4LNUA 4A5UB 1VQMV 1XQ8A 3HKEB 2UUCO 3J7AU 1L1FA 5EBMC 1XMQO 4JI8O 4FVMA 1RPRA 2RCVA 3H1KH 2QTSA 2EULA 3ASOB 1GRJA 2CE4A 3KKYA 3TXSA 1WPXA 3AG2C 3FAVB 3KCYA 4R50A 4DV1O 1JFFB 3E8GA 2ZM6B 3E8BA 2ITCC 3CSXA 4UCVA 3ZMTA 3OEHG 3AG4C 1OCCC 4DV5B 2RN9A 3LSQA 3ZBHA 2Q67A 1RM1C 2E75B 1IXMA 1DF5A 4J7JA 3ICXA 3DGEA 4LWSA 5C8YA 4I55B 3L71H 2UUAO 3DSQA 1BMFG 1IBLO 3HKEA 2YDEA 3RT3C 4J11A 2EIKC 3RYIB 3MHSC 5DEDA 4TV8A 3H1IH 2MW2B 4FLUA 1XHXA 1VF6C 5LMNO 1JX9A 3SYPA 1THZA 1Q3EA 2E74B 2UXDO 1JQ0A 4QE7A 1O9HA 1KMIZ 1MSDA 1BZKA 1CP9A 3Q4HB 1G6UA 3TJTA 4CC6A 1WP8A 4J42A 1HR0O 4D6TH 4K0KB 1FPOA 1K33A 4I0XA 1G1XB 3W7XA 3CYOA 3OMIB 2UUBO 5IJ9B 2NLJC 1QU7A 3CCVV 1S5JA 4MT8A 3A0RA 3CCRV 1W0JG 4C7UA 4YY3B 1JPXA 1Y76B 1ZL8A 2EIMC 1XNRB 5LYJA 2QWNB 2QWRB 2JS5A 1MZFA 2PF4E 1K4CC 4NTXA 3VQYA 3WU2Z 2GUZB 3EVKA 1FAFA 1GO3F 4FM2A 1PPJH 2VWKA 4PA3A 1VQ9V 2WLLB 2UXCB 2C2AA 1KKDA 2OTJV 2LGWA 5IYBO 5AG2A 2A06H 2YXHA 4EFBA 3RYHB 2LW1A 2ITDC 2EIKB 2B1GA 3UT5B 4FLXA 3CEIA 4MVMA 4PA9A 4WFHA 3AG7A 3E2EA 4GCZA 5EIBC 3CJHA 2VWJA 4MTXA 4YJ2A 1GMGA 3N2KA 4NXMO 1SA0A 5ITZA 2ZE5A 5KUKA 4QNHB 2CUGA 3ABTA 2DW4A 2R70A 1OV9A 3ZRWB 5J2UA 3B40A 5HFMA 1PKXA 4DYLA 5LHGA 4W4LA 1N34B 1ZUQA 2YS8A 4JI2B 4LFBO 2K9PA 1I5XA 3R65A 5B1AB 3HKDA 1FD9A 4HZ3A 4I9QA 1XUQA 1PNLA 1VQ5V 5KA6A 2OIEA 5EZYB 2EINB 3CJHB 1RP3B 1GN4A 1LR1A 3JARA 5LP6B 3K5LA 3RBZA 4EB6B 4MTOA 1AR4A 3SJQC 3CWBH 1JMKC 2UUCB 1MG1A 1NBMG 1BSMA 5L3EA 1IX9A 4ZHQA 4HNAB 1OCRB 3CRAA 1I0HA 3ZHRA 1B3QA 3ABLC 4QJFB 1Y74A 3CE2A 2GDSA 4YJ3B 4I7ZB 3OUFA 4DV2O 2HJDA 5LGUA 3B77A 5HFLA 1NTZH 2Y69B 3K5MA 3E35A 5B1OA 1AB3A 4MW3A 5KUMA 3JASB 3SPCA 4GX2A 4JI1B 3VBBA 4U3JA 1XILA 3K79A 4MTFA 5IDJA 5H2FZ 1A32A 1QBZA 2AHZA 3ABMC 3UM7A 2Y4UA 2Q68A 3JAMN 2AHYA 1L8DA 4KFMA 1MA1A 3KG2A 2BTQB 4ZIBA 2Q7GA 1JFFA 3VQXA 3OMAB 5LHIA 2ZNIA 1R73A 3C90A 3O9OA 4DV6B 4XDJA 4YXWG 4B7EA 1Q81W 2R72A 2ZDIA 4H13B 5CB4A 2XASA 1I7FA 4X89A 1AR1B 1HR0B 2QWQB 1MZEA 3SJCC 2F23A 3CC2V 2CTQA 1QCEA 1YHQV 2YXYA 3AK2A 1V54C 3WFVA 1IZ3A 3T1HB 4O4LA 1U97A 1B6QA 4I50A 4K8ZA 3A8TA 1YXBA 1Q7YW 2HLDG 3SYCA 2VRZA 2RJZA 5LMUB 4NXNB 5JJJB 1K4DC 4BAYA 1VF5B 3SPJA 4BWAA 4FMTA 4K0KO 1SESA 2XAQA 4ZBMA 4LF7B 5IJ9A 2FKXA 1WLEA 3T2MA 1ZTEA 3DC6A 2KG7A 5DM6V 2Q7EA 2ZNJA 3E22B 4NYKA 4YHHB 1BQZA 5EC2C 2B5UA 3F7YC 2X6AA 1W2BU 2PI4A 3STLC 1XNRO 3VQWA 1L0NH 2X6CA 3LDDA 5IYDO 4LFAB 2BOBC 4FJCC 4AI8A 3EHBB 4F6RA 5CA1B 3JD0A 3JYCA 3CP1A 3HKBA 4U7NA 2YSUB 1Z5WA 4MVZA 2HEPA 5IWAB 4WCEV 3ABUA 1AI6A 1EM1A 2ODMA 1OZ0A 1UPGA 5KX5B 1JA8A 3JCUZ 4DR2B 4H37A 2YI9A 1S3JA 3OT7A 3JD4A 1FXHA 2FYUH 1HDJA 3U10A 3OTOO 1QQCA 1Z2GA 3BPZA 4H0LB 3ETQA 1WA8B 1BT8A 4O2BA 1F4NA 1YDXA 1GKFA 4CS3A 1DGSA 2FL4A 4JV5O 2EIJC 3QNEA 2F93B 3U11A 1WP7A 3ZHSA 3CCEV 4GX5A 1JR9A 1P4RA 2QTOA 4JTAB 1WNSA 2ZXWC 4TSFG 4B3TB 4R8CA 4OX9O 1XHZA 1Q5OA 3AG1B 3K06A 1YI2V 1YJNV 2LJ2A 1GN2A 4LFBB 4NB5A 3AEIA 4DV7O 3OR7C 4RQEA 2YIBD 2IJJA 3D36C 4LF8O 1KBHA 1DF4A 2RNBA 4HYOA 1ZAUA 1NKDA 4GKJO 1HWYA 1ZSPA 3BFRA 1AVMA 3BA8A 3MDSA 2P6JA 2WLJA 1SF9A 2N04A 3ZHQA 3CB2A 3SPHA 1XOUA 5KHJA 5LA6A 1CXZB 2NNUA 5H6RA 3CXCU 5B1BC 2M7WA 1UFIA 2BCCH 4IIJA 3LNNA 4J41A 3LSUA 1D5AA 1N0NA 2P4VA 3G71V 1I5YA 1COWG 1K7DA 2PZSA 4ABMA 4NXMB 1T5EA 1XREA 3L73H 5H5NA 1Y6XA 4U3FH 2WWWA 3LNMB 4X1KB 1V9PA 3BVOA 2Y4TA 2QE7G 3TK1A 1IDSA 1TVKA 1OJHA 3JARB 4PV1B 3EXAA 4DW0A 4JI6B 4D7TA 2JEUA 3BRCA 4ZI7B 4I5SA 4EKWA 4R6ZA 2WLKA 4I4TB 1G8MA 2DOSA 4KXRA 4FM0A 2LP7A 2YXLA 1HNWO 4HNAA 1VMGA 4EFEA 3T1YO 3B2EE 3ABKB 2OCHA 2Y48A 2PGGA 5BXZA 3WG7C 4YY3O 4LCUC 3H01A 4JF3A 3RYCA 5LYJB 2BTOA 4FLTA 1K9MW 4OX9B 2H8PC 4CZZA 4BIOA 4B08A 3GB7C 2W0FC 3P30A 4LF7O 3FB7C 1M56C 2GHYA 1PL4A 1SQXH 1ORQC 3ZS8C 3X2QC 2DQ0A 2UXBB 1OCZB 4TV9A 1EN5A 3SJAC 4B3RO 4DRXA 2Q4PA 1P7GA 2HHHO 3FFQA 2B9ZA 1JJ2U 5EIBD 4JI2O 4G2KA 2QM4A 4PDRA 3K9SA 1NR7A 1R3LC 1VQNV 1NI8A 3OTOB 3JSNA 4HBNA 3TXQA 1M90W 4FM1A 1YCIA 1SQFA 1AJNA 2PTMA 1Q6UA 1R6KA 3FB5C 4O4IA 1AJPA 2P4KA 5IWAO 4DV5O 4JI7B 5JWPA 1M57C 2PI5A 1N33B 3CC4V 1KU9A 2IU3A 1FOUA 3F7VC 3CCQV 4MVRA 3ABKC 3H1JH 4K35A 1TUEB 1X4TA 4LH7A 3SJBC 3CCSV 1VQLV 5EZYA 3FD9A 1Q8IA 2WLNA 4N23A 1FFXB 1JJOA 1GM7A 4KUMA 3JALB 4FFBB 3KZIZ 4JI1O 2E5LB 3ZJZA 2JVDA 1OHHG 2KG7B 4D7SA 2BSKA 4DV0B 3K08A 5D5QA 4LF5O 3ZHVA 3QVNA 1TA8A 4DUZO 1MOFA 5IJ0A 1MNGA 2AZ0A 5FPOA 3UO3A 3GWOA 4MTGA 4E2LA 1IJGA 3Q4HA 4X66B 2ZE8A 5L3FA 2YUAA 3ML0A 4MSWC 5EYPB 1Y66A 5BR8O 2F43G 1S72V 4RAIA 5LHHA 1J5EO 4YJ2B 2DE0X 1R3KC 3E89A 4YIPA 5IY5B 3ETEA 1IXBA 1D5NA 1Q43A 5L3GA 5KHHA 2CK3G 3N27A 4X1YB 2EJRA 1Q82W 2JK5C 5KX5A 5CA0B 1CEZA 2BOCC 1HNXO 1HP8A 4LF9O 4IIJB 5J2UB 4GX0A 4LH6A 1VQKV 2QKCA 5IT9N 4ZOLB 5F2VO 2DYSB 1TUBB 4NKGB 1U96A 2OCCB 4JI4O 2XAJA 5GTHZ 1BE3H 5KLVH 4BW5A 1J95A 5LP6A 1WPBA 1S5LZ 2WA3A 1OCZC 1P7BA 2RDCA 2Y0IA 5CA0A 4DV4O 3L72H 4PDMA 5A2QN 1Z5VA 2RQ6A 1HNZO 4DR4B 5BMVB 4QPJA 3N2KB 1B04A 3CPWU 1DK1A 4W4KA 3K3WA 1AP6A 5J9PC 4AQYB 3SYOA 3N2GA 1H2LA 5KAFZ 5B5EZ 4PA7A 3CC7V 4PI2A 5BY1A 5IY5C 4GKJB 2V4DA 2QA4V 4CH4A 3ZIAG 4LC1A 3MAQA 4LFCB 4UV9A 1IVSA 3A0HZ 5FNVB 2IM9A 3PJSK 2W6JG 2EJ7A 1YIJV 1WJZA 3ASOC 2P67A 3P3PA 2IJIA 1N33O 5CN0A 2DWEC 2QKSA 3OGCC 4H44B 4JZ2A 1BCCH 3AG2B 3SPGA 2QDOA 2ZR3A 3TGUH 4JYYA 3HKBB 3N2GB 3GVMA 4IHJB 4F4LA 5CB4B 2UXXA 3WB2A 1BGYH 3WB0A 4ICGA 3RN4A 4GT1A 1J5EB 5E79Z 1FXVA 2FTKA 2ZKOA 4DR7O 4CS4A 3M7MX 4QIWF 3RVZA 1VQ6V 4HAMA 5JVDB 2GBOA 4PDLA 2JEXA 4TUYB 5B1BB 3K58A 5JJEB 2Q8VA 1KP3A 5EBWC 4JI3B 2QJ1A 2ADPA 4I50B 3QO5A 1G4YB 4X88A 4JAUA 4FIPC 2CH7B 1PL0A 4QPKA 3QO8A 1KC8W 4JZGA 1XDCA 1Q90D 2N05A 3AK1A 4XDKA 2HG5C 3U0ZA 2KB1A 2LW7A 4TQDA 3IAYA 2YIBA 5JVDA 3E22A 3A2FA 5KAIZ 2XHBA 3RYCB 3W7WA 1NJIW 4MVSA 2QSAA 1IBLB 2B1IA 1NVPB 2Y0PA 3J80N 1IBKO 4LF6O 4WFEA 1S5HC 1XBLA 1ZLZA 1H5WA 1QLEC 4X9QA 2IBZH 5JQGB 2XAFA 4PELA 4LR3A 3RGBA 5JH7B 4WBNA 1GK9A 3E83A 2NR5A 1P84F 4O2AB 2EINC 3CRMA 4O4LB 4X1IB 4X65B 1GAXA 3CCMV 1K3EA 1SZXA 3T1HO 3VQVA 3JSLA 4O4JB 3JD2A 5B3SC 3OD4A 5B66Z 5LOVB 3ABLB 4X1YA 1YJWV 1S76D 2DN9A 3THOA 3AG3C 4GKKO 1M56B 4X62O 3RYFB 4DV3O 3P32A 2O57A 2JIZG 3B09A 1X59A 3RVYA 4TT3G 1XEQA 3BABA 3F5WC 2KKWA 1K5QA 3F5TA 1AI7A 4TQFA 2JJ1G 3K0DA 1AR5A 2QR4A 1FJGB 3ZMUA 1WB7A 4JI0O 2QEXV 3RFRA 4X62B 4X20B 1H8HG 3OGIB 4PD4F 4JI4B 1H2MA 1K97A 5IE9A 4P30A 1LUWA 3ZRWA 3CS5A 3NR7A 2Y69C 1SERA 2ZE6A 4TWKA 1XL4A 1JNBA 1M5IA 3K59A 2VQFB 1YSCA 1IBMB 3T1CA 1NR1A 1EZJA 1VF7A 3MHHC 4O2BB 4B3TO 3TCUA 2QGNA 3ZHTA 1VP7A 2IJKA 1AILA 2YIAA 5IYZB 1HNZB 4DR4O 2HKOA 2V7QG 4P9OA 3LDCA 1XNQO 1H2SB 1EZVH 3UO2A 2WAMA 4RQFA 4EB6A 3CD6V 3ETDA 2A9HA 5LP6C 3DXRA 2L35A 3KCXA 4ZHQB 1AI4A 3BY6A 2ZINA 4LF5B 2N74A 1TGOA 2FB5A 2Q69A 4DO2A 1OCRC 5BZBA 1FJGO 4ZOLA 2DQ3A 3AG1C 1FXKB 3LSSA 4LWSB 2VS0A 1Q6IA 2GTAA 1Y67A 2OYQA 3JASA 2CGNA 3IC7A 3ZEDA 2EBOA 2AXTZ 1SC5B 4RWUA 4GKKB 1US6A 1ROPA 3AK3A 1V55C 2P22C 3AG4B 1S77D 1URFA 2XNDG 4X64B 3ZN1A 2VQFO 1ZWIC 4B3SB 1H38A 4B3MB 2A79B 5CA3A 5A9GA 2CTRA 1QNMA 3JATA 4MVUA 4X65O 4Z1VA 2QWOB 1WAZA 5KHIA 1KUQA 1AI5A 4PA6A 4I0XB 3SYAA 3OFNG 3T4ZA 2DYRC 2UU9B 4JTCB 3ZRVA 1GN6A 4CH5A 1SZTA 2JS3A 1GN3A 2UXCO 1HW7A 1Y76A 3CRCA 4B3MO 4PHZA 4CBCA 1PD3A 2D2CB 1KKCA 3UCSC 3E86A 4J7ZA 4DRXB 4DUZB 4FZ0A 4PJ0Z 4PDVA 3P3NA 1L0LH 4DUYB 2LFSA 5GONA 1E1RG 2EIMB 2F1MA 3CCUV 5KA5A 5KHGA 1VQ7V 3DC5A 1P49A 3RW0A 3FKSG 3ASNC 5LL6Y 2LFRA 1YTFD 3M8AA 1H2KA 1D2DA 4FLVA 2EILB 2ETNA 3WG7B 4GYCB 4DV4B 4K8XA 1HNWB 2F95B
chains in the Genus database with same CATH topology
3K9SA 3CEIA 1EM1A 4GUNA 1JA8A 1PM9A 3OT7A 1XREA 3AK3A 2P4KA 2CDYA 2ADPA 1WB8A 1EN6A 1AR5A 1BT8A 3KDRA 1WB7A 1IDSA 5A9GA 1QNMA 4JZGA 1ZUQA 1XDCA 1N0JA 1JR9A 3AK1A 3IC9A 4FFKA 1LUVA 1AP5A 1LUWA 1MMMA 1MSDA 1GN6A 1XUQA 1EN4A 3AK2A 4E4EA 1AP6A 1VARA 2QKAA 3TJTA 1GN4A 1GN3A 2ADQB 4F6EA 1KKCA 1AR4A 1GN2A 1BSMA 1ZLZA 1IX9A 4X9QA 2AW9A 3QVNA 4C7UA 1B06A 1BS3A 1I0HA 4YIOA 1MNGA 1ZTEA 3DC6A 2GDSA 1ZSPA 3BFRA 1AVMA 3MDSA 3EVKA 1PL4A 3C3TA 1VEWA 4JZ2A 4YIPA 3DC5A 1IXBA 1D5NA 3C3SA 1SZXA 2RCVA 1EN5A 4JYYA 1XILA 1I08A 2CE4A 5AG2A 1P7GA 3KKYA 4BR6A 3RN4A 3LSUA 1MA1A 1N0NA 1Y67A 2QKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9S A;  3CEI A;  1EM1 A;  4GUN A;  1JA8 A;  1PM9 A;  3OT7 A;  1XRE A;  3AK3 A;  2P4K A;  2CDY A;  2ADP A;  1WB8 A;  1EN6 A;  1AR5 A;  1BT8 A;  1WB7 A;  1IDS A;  5A9G A;  1QNM A;  4JZG A;  1ZUQ A;  1XDC A;  1N0J A;  1JR9 A;  3AK1 A;  3IC9 A;  4FFK A;  1LUV A;  1AP5 A;  1LUW A;  1MMM A;  1MSD A;  1GN6 A;  1XUQ A;  1EN4 A;  3AK2 A;  4E4E A;  1AP6 A;  1VAR A;  2QKA A;  3TJT A;  1GN4 A;  1GN3 A;  2ADQ B;  4F6E A;  1KKC A;  1AR4 A;  1GN2 A;  1BSM A;  1ZLZ A;  1IX9 A;  4X9Q A;  2AW9 A;  3QVN A;  4C7U A;  1B06 A;  1BS3 A;  1I0H A;  4YIO A;  1MNG A;  1ZTE A;  3DC6 A;  2GDS A;  1ZSP A;  3BFR A;  1AVM A;  3MDS A;  3EVK A;  1PL4 A;  3C3T A;  1VEW A;  4JZ2 A;  4YIP A;  3DC5 A;  1IXB A;  1D5N A;  3C3S A;  1SZX A;  2RCV A;  1EN5 A;  4JYY A;  1XIL A;  1I08 A;  2CE4 A;  5AG2 A;  1P7G A;  3KKY A;  4BR6 A;  3RN4 A;  3LSU A;  1MA1 A;  1N0N A;  1Y67 A;  2QKC A; 
#chains in the Genus database with same CATH topology
 2VQE O;  4G28 B;  4LF4 B;  4GUN A;  4DK1 A;  5L3B A;  3H1L H;  5GW7 A;  1FXK C;  1VIB A;  4K3A A;  1YF2 A;  1NH2 B;  2QWP B;  5D5P A;  1BHB A;  5IYC O;  5B1N A;  4AQY O;  4QGP A;  1K5S A;  2FML A;  2Z0A A;  3I5D A;  2XT9 A;  2YID A;  3JAL A;  1QR8 A;  5JCO A;  2ARH A;  1SQV H;  3HKD B;  3UQ8 A;  2ZR2 A;  1QLE B;  4J7K A;  2UXD B;  1KB9 F;  4FLY A;  5LXT A;  3ZX6 A;  4GLX A;  4B3S O;  5BMV A;  2KQX A;  1LNQ A;  1VQO V;  1SQG A;  3CME V;  4LF9 B;  5IJ0 B;  3CRQ A;  3UKM A;  2UXB O;  5H9C A;  1AP5 A;  1N8R W;  4GX1 A;  3S3W A;  4PI0 A;  2ZT9 B;  4DR3 B;  2D3O W;  1I94 B;  3D3I A;  1NTM H;  1EN4 A;  4KHP B;  2QKA A;  1RPO A;  4KHP O;  4ZKI A;  5JH7 A;  3QG5 A;  4IGG A;  1F51 A;  1OCO C;  4Q6G A;  5CBF A;  3E8H A;  5FNV A;  2P5O A;  1QHT A;  5GTI Z;  1BS3 A;  4YIO A;  5TIS Z;  3SDL A;  3PN1 A;  2IW5 A;  5LGT A;  3LUT B;  4U3J B;  4O4J A;  4BIU A;  1FFX A;  4JGS A;  4DXW A;  1R6T A;  3K5O A;  4I4T A;  4CS2 A;  3SGI A;  1NS1 A;  1YVW A;  2WLI A;  3A0B Z;  1XMQ B;  1VEW A;  4JYA B;  3D3Q A;  3BAA A;  2NN4 A;  2V1D A;  3HKC A;  1PP9 H;  3HR0 A;  4RO2 A;  3FX7 A;  3RYF A;  4X66 O;  1SET A;  1RM1 B;  3RYI A;  1FS0 G;  4RUF A;  1BQ0 A;  2YIC A;  3H9V A;  3FYE B;  4FK5 C;  1KP2 A;  3JD3 A;  3K5N A;  4LFC O;  2X6B A;  4LNU B;  4TUY A;  3T4D A;  1XL6 A;  2EIL C;  3IJ4 A;  1GM8 A;  2OIG A;  4JTD B;  2MK3 A;  3LDE A;  4WFF A;  1N36 O;  2ATK C;  2PY5 A;  3K04 A;  4OPA A;  2QM7 A;  4L8J A;  4OXS A;  2ZQM A;  1H2G A;  2HR3 A;  2Q0O C;  1E79 G;  4TV9 B;  3D36 A;  3SYQ A;  3SPI A;  2IH1 C;  5BR8 B;  1Y74 B;  4UB8 Z;  1N32 O;  3I56 V;  3IC9 A;  2IJH A;  3JAT B;  4H33 A;  1ZL8 B;  3CHX A;  4I55 A;  4BW9 A;  2UUB B;  4J9Z B;  1AJQ A;  2X0L A;  3JD1 A;  2CTP A;  1FKA O;  3QF7 A;  3K0G A;  4IYH A;  4O4I B;  4ZI7 A;  2JGD A;  2P90 A;  3BEH A;  2QM8 A;  1I94 O;  3JAW A;  1VF6 A;  5J2T A;  2AW9 A;  4NXN O;  3I55 V;  2BTQ A;  3S3X A;  2Q5Z A;  1OCO B;  1PNK A;  3UT5 A;  4MVQ A;  2P7T C;  2ZIO A;  3SR2 C;  5JJN B;  1N34 O;  4CH6 A;  3C3T A;  2DYS C;  5GON B;  3OE7 G;  3OEE G;  3OMN B;  4PA4 A;  3ZMV A;  2UUA B;  1VQ4 V;  1SA0 B;  3OUS A;  5ITZ B;  1H8E G;  4IL6 Z;  2R9I A;  4FLW A;  4UCS A;  1M93 A;  4QE9 A;  1N36 B;  5LGN A;  2CH7 A;  3J81 N;  3JAK A;  4RUE A;  5J2T B;  4UFZ A;  4UVC A;  3FAV A;  2Q73 A;  2Z3Y A;  4G27 B;  3BCC H;  1KYO F;  5K1X A;  2UXN A;  3T1Y B;  1NTK H;  1NVP D;  2F66 C;  1TAE A;  4OGQ B;  5DEC A;  3ASN B;  1E1Q G;  2A7W A;  1WB8 A;  4MW8 A;  3ETG A;  2HHH B;  1V54 B;  4O4H B;  3ZCC A;  3GWK C;  1ZX3 A;  1SS3 A;  4AHC A;  2ZDI C;  1GM9 A;  1XI1 A;  4JYA O;  2A0L A;  1QR9 A;  3FB6 C;  5FL7 G;  5JQG A;  2L6L A;  3JAK B;  1LUV A;  3K03 A;  3W7T A;  1MMM A;  4OPH A;  2IH3 C;  2PYJ A;  1M1K W;  2OTL V;  4Q20 A;  2YC0 A;  3ZRX A;  1TUB A;  2ZD9 A;  5IYZ A;  1EFR G;  4F6E A;  4UCR A;  3CCL V;  2WLM A;  4DR6 O;  4DUY O;  2X7R B;  2XAG A;  1JOY A;  1K92 A;  4UV8 A;  4LF8 B;  4JI3 O;  3FYI B;  2WSS G;  3OW2 U;  5LMN B;  2OCC C;  1YTF B;  3AG3 B;  5CMU A;  2PYL A;  1FFT B;  4J80 A;  1BHA A;  4UXN A;  3H1H H;  3C3S A;  3BHP A;  2HP8 A;  1I08 A;  2WLL A;  3ZN0 A;  2ZE7 A;  2HFE C;  4WFB V;  1NQT A;  2DWD C;  3BA9 A;  2DJV A;  4JYB A;  4IYI A;  1S0V A;  3CCJ V;  1UJW B;  4AIL C;  2EZP A;  3ZMS A;  5LBQ A;  2E76 B;  4ASU G;  3W7S A;  3O65 A;  4JI6 O;  2IU0 A;  1PM9 A;  4DR5 B;  2XOK G;  1Q86 W;  2G38 A;  4JAA A;  4DV3 B;  2ZIM A;  2P06 A;  2YEV B;  3HPL C;  2Q6A A;  4DR3 O;  4J10 A;  2WLH A;  2W6I G;  5E1A C;  2HVJ C;  2A3Q A;  5FPR A;  4BIZ A;  3JCZ A;  3D8C A;  1N0J A;  4XBF A;  4LF6 B;  4LF4 O;  4FFK A;  3WB1 A;  4DK0 A;  4LBE C;  3DXR B;  1F23 A;  5LA6 B;  4Z1M G;  1RSO B;  4XDL A;  4UB6 Z;  1IUR A;  3ZRS A;  4WF9 V;  1W59 A;  1NT2 B;  2K1E A;  2CGO A;  1JCH A;  2EZO A;  1K73 W;  2BE3 A;  5L3C A;  1HNX B;  4X20 A;  1H2N A;  2YEV A;  1FXK A;  2LQT A;  2WLI B;  4B7K A;  3NXS A;  5CBH A;  1QVF U;  3B8N A;  2VQE B;  2PUS A;  2H3O A;  1SQQ H;  1SKV A;  1M9N A;  3L70 H;  4LFA O;  4JPR A;  5FLX N;  4FPP A;  2Q9L A;  4MS2 A;  3QO7 A;  3IFX A;  2HJF C;  1R3J C;  4UVB A;  5KHK A;  4MVO A;  1DTO A;  4B3R B;  3CRR A;  1WA8 A;  4BR6 A;  1QLN A;  1VQP V;  2WA4 A;  4UCT A;  3CX5 F;  2LO1 A;  4R7C A;  2OT5 A;  4DR1 O;  4NR1 A;  3L75 H;  1GTO A;  3E8F A;  4CC5 A;  5KMG B;  4DR1 B;  2YI8 A;  1R3I C;  3G80 A;  5C8Y B;  1ENV A;  3EFF K;  4IHJ A;  4DV7 B;  4O2A A;  4FLZ A;  2XAH A;  2ILM A;  2ZCE A;  4JV5 B;  4N21 A;  1YEW A;  4EEQ A;  5DN6 G;  1IBK B;  4X1I A;  2H94 A;  4TV8 B;  1NU1 H;  3CXH F;  1EN6 A;  4DV1 B;  1N32 B;  2CTW A;  4X64 O;  4UUJ C;  4P2Z A;  1R6N A;  4F6R B;  5CA1 A;  2JRI A;  3G4S V;  1Q6H A;  1YIT V;  4LP8 A;  3G6E V;  1K34 A;  4DR2 O;  1NZ6 A;  2ZXW B;  2E5L O;  4L87 A;  1BL8 A;  5EBL C;  1M57 B;  5LOV A;  4I9W A;  4YHH O;  1QVG U;  2EX3 A;  3B8M A;  2WPD G;  3OM3 B;  1F7Y A;  2JGD B;  4Z2W A;  3VOU A;  5KMG A;  2BSK B;  1EBO A;  3RWR D;  3OR6 C;  4UCO A;  3ZMZ A;  4E4E A;  2DMX A;  1VAR A;  3APO A;  2ADQ B;  4DV6 O;  3QTC A;  2DYR B;  4JI5 O;  5B1A C;  2EIJ B;  5JCO C;  2OWO A;  5C93 A;  1O9G A;  5LMU O;  4JYC A;  2JGU A;  3X2Q B;  1IBM O;  5EYP A;  4NTW A;  2M6Y A;  3OAA G;  4IT5 A;  3ABM B;  2GUZ A;  1SRY A;  2E3C A;  2GSM B;  3ZHU A;  1KQS U;  4NTY A;  1MAB G;  1CPY A;  1XMO O;  2JJ2 G;  5B3S B;  2UU9 O;  3G6B A;  3HKC B;  2HVK C;  4WBN B;  4UVA A;  2F4V O;  4KL1 A;  4JI0 B;  1VQ8 V;  4YJ3 A;  3RYH A;  4GZR B;  3K9A A;  2AZ2 A;  5L3D A;  4J9Y B;  2R9A A;  3B4S A;  4DW1 A;  2ZM6 O;  2R9R B;  1SQB H;  4DR7 B;  1KEC A;  1W0K G;  1N4C A;  4X8A A;  5EK0 A;  1DLB A;  4O4H A;  1XNQ B;  5CBG A;  4FFB A;  4JI8 B;  4DR6 B;  4NVP A;  2CDY A;  4UCU A;  2LGQ A;  1RFY A;  1PNM A;  2Q7H A;  1ARO P;  3APQ A;  2CAZ C;  1R1B A;  3OTF A;  3KDR A;  2Z5U A;  1OCC B;  3W7U A;  4P9P A;  2RMK B;  3R66 A;  3CMA V;  5K1P A;  1YJ9 V;  4CH3 A;  2W0X A;  3FB8 C;  2AGA A;  1GH6 A;  1FYJ A;  5EC1 C;  1V55 B;  2XTA A;  3M99 B;  4FZ1 A;  1XMO B;  4KP4 A;  1SQP H;  2Q0A A;  3DTU B;  4WFA V;  3L74 H;  1JVM A;  4X1K A;  3JAW B;  1RSO A;  4WFG A;  3HB3 B;  1K8A W;  4JAS A;  1KD1 W;  1Y4M A;  3K57 A;  2GV9 A;  1TVK B;  1M4U A;  3G67 A;  5LXT B;  2GTS A;  3TET A;  2F4V B;  4TOI A;  1B06 A;  1PV0 A;  1F4M A;  4DV2 B;  1NH2 D;  4JI5 B;  4DV0 O;  1YZB A;  1MSW D;  3L9D A;  4DR5 O;  4U7O A;  3IGA C;  4JAV A;  3STZ C;  2KSD A;  2XUM A;  3MD0 A;  1WN7 A;  5H6Q A;  2JDI G;  4JI7 O;  4LNU A;  4A5U B;  1VQM V;  1XQ8 A;  3HKE B;  2UUC O;  3J7A U;  1L1F A;  5EBM C;  1XMQ O;  4JI8 O;  4FVM A;  1RPR A;  2RCV A;  3H1K H;  2QTS A;  2EUL A;  3ASO B;  1GRJ A;  2CE4 A;  3KKY A;  3TXS A;  1WPX A;  3AG2 C;  3FAV B;  3KCY A;  4R50 A;  4DV1 O;  1JFF B;  3E8G A;  2ZM6 B;  3E8B A;  2ITC C;  3CSX A;  4UCV A;  3ZMT A;  3OEH G;  3AG4 C;  1OCC C;  4DV5 B;  2RN9 A;  3LSQ A;  3ZBH A;  2Q67 A;  1RM1 C;  2E75 B;  1IXM A;  1DF5 A;  4J7J A;  3ICX A;  3DGE A;  4LWS A;  5C8Y A;  4I55 B;  3L71 H;  2UUA O;  3DSQ A;  1BMF G;  1IBL O;  3HKE A;  2YDE A;  3RT3 C;  4J11 A;  2EIK C;  3RYI B;  3MHS C;  5DED A;  4TV8 A;  3H1I H;  2MW2 B;  4FLU A;  1XHX A;  1VF6 C;  5LMN O;  1JX9 A;  3SYP A;  1THZ A;  1Q3E A;  2E74 B;  2UXD O;  1JQ0 A;  4QE7 A;  1O9H A;  1KMI Z;  1MSD A;  1BZK A;  1CP9 A;  3Q4H B;  1G6U A;  3TJT A;  4CC6 A;  1WP8 A;  4J42 A;  1HR0 O;  4D6T H;  4K0K B;  1FPO A;  1K33 A;  4I0X A;  1G1X B;  3W7X A;  3CYO A;  3OMI B;  2UUB O;  5IJ9 B;  2NLJ C;  1QU7 A;  3CCV V;  1S5J A;  4MT8 A;  3A0R A;  3CCR V;  1W0J G;  4C7U A;  4YY3 B;  1JPX A;  1Y76 B;  1ZL8 A;  2EIM C;  1XNR B;  5LYJ A;  2QWN B;  2QWR B;  2JS5 A;  1MZF A;  2PF4 E;  1K4C C;  4NTX A;  3VQY A;  3WU2 Z;  2GUZ B;  3EVK A;  1FAF A;  1GO3 F;  4FM2 A;  1PPJ H;  2VWK A;  4PA3 A;  1VQ9 V;  2WLL B;  2UXC B;  2C2A A;  1KKD A;  2OTJ V;  2LGW A;  5IYB O;  5AG2 A;  2A06 H;  2YXH A;  4EFB A;  3RYH B;  2LW1 A;  2ITD C;  2EIK B;  2B1G A;  3UT5 B;  4FLX A;  3CEI A;  4MVM A;  4PA9 A;  4WFH A;  3AG7 A;  3E2E A;  4GCZ A;  5EIB C;  3CJH A;  2VWJ A;  4MTX A;  4YJ2 A;  1GMG A;  3N2K A;  4NXM O;  1SA0 A;  5ITZ A;  2ZE5 A;  5KUK A;  4QNH B;  2CUG A;  3ABT A;  2DW4 A;  2R70 A;  1OV9 A;  3ZRW B;  5J2U A;  3B40 A;  5HFM A;  1PKX A;  4DYL A;  5LHG A;  4W4L A;  1N34 B;  1ZUQ A;  2YS8 A;  4JI2 B;  4LFB O;  2K9P A;  1I5X A;  3R65 A;  5B1A B;  3HKD A;  1FD9 A;  4HZ3 A;  4I9Q A;  1XUQ A;  1PNL A;  1VQ5 V;  5KA6 A;  2OIE A;  5EZY B;  2EIN B;  3CJH B;  1RP3 B;  1GN4 A;  1LR1 A;  3JAR A;  5LP6 B;  3K5L A;  3RBZ A;  4EB6 B;  4MTO A;  1AR4 A;  3SJQ C;  3CWB H;  1JMK C;  2UUC B;  1MG1 A;  1NBM G;  1BSM A;  5L3E A;  1IX9 A;  4ZHQ A;  4HNA B;  1OCR B;  3CRA A;  1I0H A;  3ZHR A;  1B3Q A;  3ABL C;  4QJF B;  1Y74 A;  3CE2 A;  2GDS A;  4YJ3 B;  4I7Z B;  3OUF A;  4DV2 O;  2HJD A;  5LGU A;  3B77 A;  5HFL A;  1NTZ H;  2Y69 B;  3K5M A;  3E35 A;  5B1O A;  1AB3 A;  4MW3 A;  5KUM A;  3JAS B;  3SPC A;  4GX2 A;  4JI1 B;  3VBB A;  4U3J A;  1XIL A;  3K79 A;  4MTF A;  5IDJ A;  5H2F Z;  1A32 A;  1QBZ A;  2AHZ A;  3ABM C;  3UM7 A;  2Y4U A;  2Q68 A;  3JAM N;  2AHY A;  1L8D A;  4KFM A;  1MA1 A;  3KG2 A;  2BTQ B;  4ZIB A;  2Q7G A;  1JFF A;  3VQX A;  3OMA B;  5LHI A;  2ZNI A;  1R73 A;  3C90 A;  3O9O A;  4DV6 B;  4XDJ A;  4YXW G;  4B7E A;  1Q81 W;  2R72 A;  2ZDI A;  4H13 B;  5CB4 A;  2XAS A;  1I7F A;  4X89 A;  1AR1 B;  1HR0 B;  2QWQ B;  1MZE A;  3SJC C;  2F23 A;  3CC2 V;  2CTQ A;  1QCE A;  1YHQ V;  2YXY A;  3AK2 A;  1V54 C;  3WFV A;  1IZ3 A;  3T1H B;  4O4L A;  1U97 A;  1B6Q A;  4I50 A;  4K8Z A;  3A8T A;  1YXB A;  1Q7Y W;  2HLD G;  3SYC A;  2VRZ A;  2RJZ A;  5LMU B;  4NXN B;  5JJJ B;  1K4D C;  4BAY A;  1VF5 B;  3SPJ A;  4BWA A;  4FMT A;  4K0K O;  1SES A;  2XAQ A;  4ZBM A;  4LF7 B;  5IJ9 A;  2FKX A;  1WLE A;  3T2M A;  1ZTE A;  3DC6 A;  2KG7 A;  5DM6 V;  2Q7E A;  2ZNJ A;  3E22 B;  4NYK A;  4YHH B;  1BQZ A;  5EC2 C;  2B5U A;  3F7Y C;  2X6A A;  1W2B U;  2PI4 A;  3STL C;  1XNR O;  3VQW A;  1L0N H;  2X6C A;  3LDD A;  5IYD O;  4LFA B;  2BOB C;  4FJC C;  4AI8 A;  3EHB B;  4F6R A;  5CA1 B;  3JD0 A;  3JYC A;  3CP1 A;  3HKB A;  4U7N A;  2YSU B;  1Z5W A;  4MVZ A;  2HEP A;  5IWA B;  4WCE V;  3ABU A;  1AI6 A;  1EM1 A;  2ODM A;  1OZ0 A;  1UPG A;  5KX5 B;  1JA8 A;  3JCU Z;  4DR2 B;  4H37 A;  2YI9 A;  1S3J A;  3OT7 A;  3JD4 A;  1FXH A;  2FYU H;  1HDJ A;  3U10 A;  3OTO O;  1QQC A;  1Z2G A;  3BPZ A;  4H0L B;  3ETQ A;  1WA8 B;  1BT8 A;  4O2B A;  1F4N A;  1YDX A;  1GKF A;  4CS3 A;  1DGS A;  2FL4 A;  4JV5 O;  2EIJ C;  3QNE A;  2F93 B;  3U11 A;  1WP7 A;  3ZHS A;  3CCE V;  4GX5 A;  1JR9 A;  1P4R A;  2QTO A;  4JTA B;  1WNS A;  2ZXW C;  4TSF G;  4B3T B;  4R8C A;  4OX9 O;  1XHZ A;  1Q5O A;  3AG1 B;  3K06 A;  1YI2 V;  1YJN V;  2LJ2 A;  1GN2 A;  4LFB B;  4NB5 A;  3AEI A;  4DV7 O;  3OR7 C;  4RQE A;  2YIB D;  2IJJ A;  3D36 C;  4LF8 O;  1KBH A;  1DF4 A;  2RNB A;  4HYO A;  1ZAU A;  1NKD A;  4GKJ O;  1HWY A;  1ZSP A;  3BFR A;  1AVM A;  3BA8 A;  3MDS A;  2P6J A;  2WLJ A;  1SF9 A;  2N04 A;  3ZHQ A;  3CB2 A;  3SPH A;  1XOU A;  5KHJ A;  5LA6 A;  1CXZ B;  2NNU A;  5H6R A;  3CXC U;  5B1B C;  2M7W A;  1UFI A;  2BCC H;  4IIJ A;  3LNN A;  4J41 A;  3LSU A;  1D5A A;  1N0N A;  2P4V A;  3G71 V;  1I5Y A;  1COW G;  1K7D A;  2PZS A;  4ABM A;  4NXM B;  1T5E A;  1XRE A;  3L73 H;  5H5N A;  1Y6X A;  4U3F H;  2WWW A;  3LNM B;  4X1K B;  1V9P A;  3BVO A;  2Y4T A;  2QE7 G;  3TK1 A;  1IDS A;  1TVK A;  1OJH A;  3JAR B;  4PV1 B;  3EXA A;  4DW0 A;  4JI6 B;  4D7T A;  2JEU A;  3BRC A;  4ZI7 B;  4I5S A;  4EKW A;  4R6Z A;  2WLK A;  4I4T B;  1G8M A;  2DOS A;  4KXR A;  4FM0 A;  2LP7 A;  2YXL A;  1HNW O;  4HNA A;  1VMG A;  4EFE A;  3T1Y O;  3B2E E;  3ABK B;  2OCH A;  2Y48 A;  2PGG A;  5BXZ A;  3WG7 C;  4YY3 O;  4LCU C;  3H01 A;  4JF3 A;  3RYC A;  5LYJ B;  2BTO A;  4FLT A;  1K9M W;  4OX9 B;  2H8P C;  4CZZ A;  4BIO A;  4B08 A;  3GB7 C;  2W0F C;  3P30 A;  4LF7 O;  3FB7 C;  1M56 C;  2GHY A;  1PL4 A;  1SQX H;  1ORQ C;  3ZS8 C;  3X2Q C;  2DQ0 A;  2UXB B;  1OCZ B;  4TV9 A;  1EN5 A;  3SJA C;  4B3R O;  4DRX A;  2Q4P A;  1P7G A;  2HHH O;  3FFQ A;  2B9Z A;  1JJ2 U;  5EIB D;  4JI2 O;  4G2K A;  2QM4 A;  4PDR A;  3K9S A;  1NR7 A;  1R3L C;  1VQN V;  1NI8 A;  3OTO B;  3JSN A;  4HBN A;  3TXQ A;  1M90 W;  4FM1 A;  1YCI A;  1SQF A;  1AJN A;  2PTM A;  1Q6U A;  1R6K A;  3FB5 C;  4O4I A;  1AJP A;  2P4K A;  5IWA O;  4DV5 O;  4JI7 B;  5JWP A;  1M57 C;  2PI5 A;  1N33 B;  3CC4 V;  1KU9 A;  2IU3 A;  1FOU A;  3F7V C;  3CCQ V;  4MVR A;  3ABK C;  3H1J H;  4K35 A;  1TUE B;  1X4T A;  4LH7 A;  3SJB C;  3CCS V;  1VQL V;  5EZY A;  3FD9 A;  1Q8I A;  2WLN A;  4N23 A;  1FFX B;  1JJO A;  1GM7 A;  4KUM A;  3JAL B;  4FFB B;  3KZI Z;  4JI1 O;  2E5L B;  3ZJZ A;  2JVD A;  1OHH G;  2KG7 B;  4D7S A;  2BSK A;  4DV0 B;  3K08 A;  5D5Q A;  4LF5 O;  3ZHV A;  3QVN A;  1TA8 A;  4DUZ O;  1MOF A;  5IJ0 A;  1MNG A;  2AZ0 A;  5FPO A;  3UO3 A;  3GWO A;  4MTG A;  4E2L A;  1IJG A;  3Q4H A;  4X66 B;  2ZE8 A;  5L3F A;  2YUA A;  3ML0 A;  4MSW C;  5EYP B;  1Y66 A;  5BR8 O;  2F43 G;  1S72 V;  4RAI A;  5LHH A;  1J5E O;  4YJ2 B;  2DE0 X;  1R3K C;  3E89 A;  4YIP A;  5IY5 B;  3ETE A;  1IXB A;  1D5N A;  1Q43 A;  5L3G A;  5KHH A;  2CK3 G;  3N27 A;  4X1Y B;  2EJR A;  1Q82 W;  2JK5 C;  5KX5 A;  5CA0 B;  1CEZ A;  2BOC C;  1HNX O;  1HP8 A;  4LF9 O;  4IIJ B;  5J2U B;  4GX0 A;  4LH6 A;  1VQK V;  2QKC A;  5IT9 N;  4ZOL B;  5F2V O;  2DYS B;  1TUB B;  4NKG B;  1U96 A;  2OCC B;  4JI4 O;  2XAJ A;  5GTH Z;  1BE3 H;  5KLV H;  4BW5 A;  1J95 A;  5LP6 A;  1WPB A;  1S5L Z;  2WA3 A;  1OCZ C;  1P7B A;  2RDC A;  2Y0I A;  5CA0 A;  4DV4 O;  3L72 H;  4PDM A;  5A2Q N;  1Z5V A;  2RQ6 A;  1HNZ O;  4DR4 B;  5BMV B;  4QPJ A;  3N2K B;  1B04 A;  3CPW U;  1DK1 A;  4W4K A;  3K3W A;  1AP6 A;  5J9P C;  4AQY B;  3SYO A;  3N2G A;  1H2L A;  5KAF Z;  5B5E Z;  4PA7 A;  3CC7 V;  4PI2 A;  5BY1 A;  5IY5 C;  4GKJ B;  2V4D A;  2QA4 V;  4CH4 A;  3ZIA G;  4LC1 A;  3MAQ A;  4LFC B;  4UV9 A;  1IVS A;  3A0H Z;  5FNV B;  2IM9 A;  3PJS K;  2W6J G;  2EJ7 A;  1YIJ V;  1WJZ A;  3ASO C;  2P67 A;  3P3P A;  2IJI A;  1N33 O;  5CN0 A;  2DWE C;  2QKS A;  3OGC C;  4H44 B;  4JZ2 A;  1BCC H;  3AG2 B;  3SPG A;  2QDO A;  2ZR3 A;  3TGU H;  4JYY A;  3HKB B;  3N2G B;  3GVM A;  4IHJ B;  4F4L A;  5CB4 B;  2UXX A;  3WB2 A;  1BGY H;  3WB0 A;  4ICG A;  3RN4 A;  4GT1 A;  1J5E B;  5E79 Z;  1FXV A;  2FTK A;  2ZKO A;  4DR7 O;  4CS4 A;  3M7M X;  4QIW F;  3RVZ A;  1VQ6 V;  4HAM A;  5JVD B;  2GBO A;  4PDL A;  2JEX A;  4TUY B;  5B1B B;  3K58 A;  5JJE B;  2Q8V A;  1KP3 A;  5EBW C;  4JI3 B;  2QJ1 A;  2ADP A;  4I50 B;  3QO5 A;  1G4Y B;  4X88 A;  4JAU A;  4FIP C;  2CH7 B;  1PL0 A;  4QPK A;  3QO8 A;  1KC8 W;  4JZG A;  1XDC A;  1Q90 D;  2N05 A;  3AK1 A;  4XDK A;  2HG5 C;  3U0Z A;  2KB1 A;  2LW7 A;  4TQD A;  3IAY A;  2YIB A;  5JVD A;  3E22 A;  3A2F A;  5KAI Z;  2XHB A;  3RYC B;  3W7W A;  1NJI W;  4MVS A;  2QSA A;  1IBL B;  2B1I A;  1NVP B;  2Y0P A;  3J80 N;  1IBK O;  4LF6 O;  4WFE A;  1S5H C;  1XBL A;  1ZLZ A;  1H5W A;  1QLE C;  4X9Q A;  2IBZ H;  5JQG B;  2XAF A;  4PEL A;  4LR3 A;  3RGB A;  5JH7 B;  4WBN A;  1GK9 A;  3E83 A;  2NR5 A;  1P84 F;  4O2A B;  2EIN C;  3CRM A;  4O4L B;  4X1I B;  4X65 B;  1GAX A;  3CCM V;  1K3E A;  1SZX A;  3T1H O;  3VQV A;  3JSL A;  4O4J B;  3JD2 A;  5B3S C;  3OD4 A;  5B66 Z;  5LOV B;  3ABL B;  4X1Y A;  1YJW V;  1S76 D;  2DN9 A;  3THO A;  3AG3 C;  4GKK O;  1M56 B;  4X62 O;  3RYF B;  4DV3 O;  3P32 A;  2O57 A;  2JIZ G;  3B09 A;  1X59 A;  3RVY A;  4TT3 G;  1XEQ A;  3BAB A;  3F5W C;  2KKW A;  1K5Q A;  3F5T A;  1AI7 A;  4TQF A;  2JJ1 G;  3K0D A;  1AR5 A;  2QR4 A;  1FJG B;  3ZMU A;  1WB7 A;  4JI0 O;  2QEX V;  3RFR A;  4X62 B;  4X20 B;  1H8H G;  3OGI B;  4PD4 F;  4JI4 B;  1H2M A;  1K97 A;  5IE9 A;  4P30 A;  1LUW A;  3ZRW A;  3CS5 A;  3NR7 A;  2Y69 C;  1SER A;  2ZE6 A;  4TWK A;  1XL4 A;  1JNB A;  1M5I A;  3K59 A;  2VQF B;  1YSC A;  1IBM B;  3T1C A;  1NR1 A;  1EZJ A;  1VF7 A;  3MHH C;  4O2B B;  4B3T O;  3TCU A;  2QGN A;  3ZHT A;  1VP7 A;  2IJK A;  1AIL A;  2YIA A;  5IYZ B;  1HNZ B;  4DR4 O;  2HKO A;  2V7Q G;  4P9O A;  3LDC A;  1XNQ O;  1H2S B;  1EZV H;  3UO2 A;  2WAM A;  4RQF A;  4EB6 A;  3CD6 V;  3ETD A;  2A9H A;  5LP6 C;  3DXR A;  2L35 A;  3KCX A;  4ZHQ B;  1AI4 A;  3BY6 A;  2ZIN A;  4LF5 B;  2N74 A;  1TGO A;  2FB5 A;  2Q69 A;  4DO2 A;  1OCR C;  5BZB A;  1FJG O;  4ZOL A;  2DQ3 A;  3AG1 C;  1FXK B;  3LSS A;  4LWS B;  2VS0 A;  1Q6I A;  2GTA A;  1Y67 A;  2OYQ A;  3JAS A;  2CGN A;  3IC7 A;  3ZED A;  2EBO A;  2AXT Z;  1SC5 B;  4RWU A;  4GKK B;  1US6 A;  1ROP A;  3AK3 A;  1V55 C;  2P22 C;  3AG4 B;  1S77 D;  1URF A;  2XND G;  4X64 B;  3ZN1 A;  2VQF O;  1ZWI C;  4B3S B;  1H38 A;  4B3M B;  2A79 B;  5CA3 A;  5A9G A;  2CTR A;  1QNM A;  3JAT A;  4MVU A;  4X65 O;  4Z1V A;  2QWO B;  1WAZ A;  5KHI A;  1KUQ A;  1AI5 A;  4PA6 A;  4I0X B;  3SYA A;  3OFN G;  3T4Z A;  2DYR C;  2UU9 B;  4JTC B;  3ZRV A;  1GN6 A;  4CH5 A;  1SZT A;  2JS3 A;  1GN3 A;  2UXC O;  1HW7 A;  1Y76 A;  3CRC A;  4B3M O;  4PHZ A;  4CBC A;  1PD3 A;  2D2C B;  1KKC A;  3UCS C;  3E86 A;  4J7Z A;  4DRX B;  4DUZ B;  4FZ0 A;  4PJ0 Z;  4PDV A;  3P3N A;  1L0L H;  4DUY B;  2LFS A;  5GON A;  1E1R G;  2EIM B;  2F1M A;  3CCU V;  5KA5 A;  5KHG A;  1VQ7 V;  3DC5 A;  1P49 A;  3RW0 A;  3FKS G;  3ASN C;  5LL6 Y;  2LFR A;  1YTF D;  3M8A A;  1H2K A;  1D2D A;  4FLV A;  2EIL B;  2ETN A;  3WG7 B;  4GYC B;  4DV4 B;  4K8X A;  1HNW B;  2F95 B; 
#chains in the Genus database with same CATH homology
 3K9S A;  3CEI A;  1EM1 A;  4GUN A;  1JA8 A;  1PM9 A;  3OT7 A;  1XRE A;  3AK3 A;  2P4K A;  2CDY A;  2ADP A;  1WB8 A;  1EN6 A;  1AR5 A;  1BT8 A;  3KDR A;  1WB7 A;  1IDS A;  5A9G A;  1QNM A;  4JZG A;  1ZUQ A;  1XDC A;  1N0J A;  1JR9 A;  3AK1 A;  3IC9 A;  4FFK A;  1LUV A;  1AP5 A;  1LUW A;  1MMM A;  1MSD A;  1GN6 A;  1XUQ A;  1EN4 A;  3AK2 A;  4E4E A;  1AP6 A;  1VAR A;  2QKA A;  3TJT A;  1GN4 A;  1GN3 A;  2ADQ B;  4F6E A;  1KKC A;  1AR4 A;  1GN2 A;  1BSM A;  1ZLZ A;  1IX9 A;  4X9Q A;  2AW9 A;  3QVN A;  4C7U A;  1B06 A;  1BS3 A;  1I0H A;  4YIO A;  1MNG A;  1ZTE A;  3DC6 A;  2GDS A;  1ZSP A;  3BFR A;  1AVM A;  3MDS A;  3EVK A;  1PL4 A;  3C3T A;  1VEW A;  4JZ2 A;  4YIP A;  3DC5 A;  1IXB A;  1D5N A;  3C3S A;  1SZX A;  2RCV A;  1EN5 A;  4JYY A;  1XIL A;  1I08 A;  2CE4 A;  5AG2 A;  1P7G A;  3KKY A;  4BR6 A;  3RN4 A;  3LSU A;  1MA1 A;  1N0N A;  1Y67 A;  2QKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...