1EM1A

X-ray crystal structure for human manganese superoxide dismutase, q143a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNADPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Multiple replacements of glutamine 143 in human manganese superoxide dismutase: effects on structure, stability, and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 70
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1em1A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1em1A02
3QVNA 1IDSA 1VARA 3DC6A 1AR5A 2AW9A 4GUNA 1JA8A 1MA1A 1AVMA 3EVKA 2CDYA 1AR4A 1MNGA 3CEIA 4YIPA 3BFRA 3C3SA 1BSMA 4E4EA 3C3TA 1BS3A 2P4KA 1N0NA 1WB7A 1KKCA 1Y67A 4YIOA 1LUWA 3OT7A 1GN4A 3AK2A 4BR6A 2ADQB 4JYYA 1XILA 1P7GA 2GDSA 1SZXA 4JZ2A 5AG2A 1XREA 1ZUQA 4JZGA 5A9GA 1EN6A 1GN6A 3AK3A 2ADPA 1WB8A 1PM9A 1ZLZA 1AP6A 1LUVA 1GN3A 2QKCA 1MMMA 1EM1A 1QNMA 3IC9A 3LSUA 1ZSPA 1I08A 4X9QA 3K9SA 1EN4A 4FFKA 4C7UA 1EN5A 1IX9A 1XDCA 1GN2A 1IXBA 3KKYA 2CE4A 3DC5A 1BT8A 1D5NA 1XUQA 1AP5A 3RN4A 1PL4A 3MDSA 3TJTA 1JR9A 2QKAA 3AK1A 2RCVA 1ZTEA 1N0JA 4F6EA 1VEWA 1I0HA 1B06A 1MSDA
chains in the Genus database with same CATH superfamily
2YSUB 1UJWB 4UVBA 1CP9A 4JTDB 3ZRVA 1HP8A 2H3OA 1XNQO 4WFHA 1NI8A 4B3SO 4DUZO 4CC5A 4LFAB 3CCLV 3RWRD 3JAKB 3P32A 1NU1H 3ETDA 4DR4B 1Y74B 5B1OA 4CS3A 1IBLO 5J9PC 2GTAA 2OCCB 2Q68A 5C8YA 2EIJB 5EYPA 1FS0G 3MHHC 1OCZB 4I9QA 1FKAO 3UT5A 1SZTA 2ZE8A 3AG3B 1VQLV 3I5DA 4LF9B 4X62O 3FX7A 3ABKC 2DWDC 1HW7A 5LA6A 2JJ2G 2LW1A 1HNWB 1YI2V 4XDKA 4AQYB 3T4DA 1IBKO 1S5LZ 2WLNA 5EC1C 4WFAV 2EIMB 3TXQA 1VQ8V 4XDJA 2HKOA 4JI0O 4CZZA 5LMNO 1XNRO 1BHAA 3E89A 4DR3B 4PHZA 1BE3H 3CXCU 2V7QG 3ABUA 1QQCA 1IXBA 2OIGA 2CE4A 2PI4A 3MHSC 2QEXV 4NTWA 2H94A 1H2KA 1MZFA 1FFTB 1FPOA 5EBLC 1PNMA 2Y69C 5JQGB 4PA4A 5EBWC 2HJFC 3UT5B 4BW9A 5LHHA 4O4LB 1RP3B 1KECA 5H6RA 2EZPA 2KG7B 4I55B 1IJGA 1FD9A 4K0KO 4B3MB 5FPRA 5DN6G 4KHPO 4FM1A 3H9VA 4RQFA 3A0HZ 4X88A 4MVUA 4G28B 1KKCA 4P30A 3RFRA 2VWKA 3H01A 1JMKC 1DK1A 3B09A 4DR6B 5BMVB 2LFSA 4J9ZB 2IU3A 2WLJA 1YJWV 2YXHA 2ITDC 1YDXA 2Q0AA 2OCCC 1X4TA 2F1MA 4I0XA 2EIJC 2WSSG 1OCZC 2WLIA 3ASNB 2YIAA 1GN6A 4LFAO 2GUZA 3ZCCA 3AG3C 4FFBA 4DR4O 3GB7C 3J80N 2UXNA 3HKDB 1SESA 2UU9O 2BSKB 1YF2A 2Z5UA 4RAIA 4DV5O 1Q86W 3LSUA 4ICGA 3ICXA 3K9SA 1WA8A 5IYBO 5LOVB 4FLUA 4P2ZA 5E79Z 4F6RB 5CMUA 4QNHB 2EIMC 3K0GA 5L3BA 4HAMA 2D2CB 1HNWO 2WLKA 4AQYO 2GSMB 2GBOA 2ZE5A 1H2LA 1M93A 2WPDG 1ZTEA 3HKBA 2P4VA 5EZYA 1VEWA 2FL4A 1IDSA 3ZN0A 4NVPA 3ZEDA 4GX2A 1EBOA 3M8AA 3RT3C 3ZX6A 1TUEB 3AG1B 1YCIA 2YEVA 4J11A 4EFEA 1FOUA 2B1GA 3EHBB 1H2NA 1AR4A 4I4TB 4B08A 3CEIA 4WBNB 1RSOA 3D8CA 2N05A 1AJPA 1FXHA 3K58A 1VMGA 4PDRA 2M6YA 2EX3A 3C90A 3KCXA 2Y4UA 5L3CA 1TVKB 3ML0A 3K04A 4DRXA 1Q5OA 1K92A 1OV9A 3OGCC 1QVGU 4JZ2A 4UCTA 4HBNA 2WA3A 3L9DA 4B3MO 4JV5O 4UXNA 4QPKA 3D3IA 3GWOA 3IFXA 1HR0B 1VIBA 4DR6O 5IDJA 1S5JA 1QU7A 3ASNC 4JYAB 1I08A 1BGYH 5EZYB 4KL1A 5JVDA 4C7UA 4UVCA 2JJ1G 4JI8B 4X64B 3M99B 4H0LB 3ZMZA 1GN2A 4D7TA 5F2VO 1L0NH 4ZHQA 2QDOA 1N8RW 1D2DA 2NLJC 1KU9A 3N27A 3CYOA 2K9PA 5B5EZ 2X7RB 1S0VA 2CK3G 3RYHB 3CRMA 2YDEA 4X1YA 3QTCA 5IJ9B 1PNLA 2XTAA 2YS8A 3JD2A 3OTOB 3HKEB 5IYZA 1XHXA 1THZA 4DV1B 2CTWA 3K06A 3G80A 3AG1C 4AI8A 2AZ2A 2IH3C 1H2SB 3JATB 4IIJA 5H6QA 3FB7C 2ILMA 4JYYA 3FB6C 5GTHZ 5LMUB 3ETGA 3R65A 3OM3B 3KDRA 4PDLA 2Q7HA 1XL4A 3PJSK 2Q67A 1JOYA 2HR3A 1FJGB 4JAUA 4WFEA 4TOIA 4GX1A 1IBMO 1S76D 4JYBA 4TWKA 4EEQA 2OTLV 1EM1A 5CA1A 4Z1VA 2ZIMA 3CP1A 1JQ0A 3ZMVA 4F4LA 2ZD9A 5LGNA 4LP8A 5TISZ 2HHHO 2MK3A 3BA8A 3OMIB 2X6BA 1LR1A 2UXDB 5JCOA 4HZ3A 4LF6O 4RO2A 3CC7V 3RW0A 3ETQA 5HFMA 1Q90D 1WLEA 1YITV 3CC2V 3HB3B 1H38A 4DR7B 2JVDA 1PL4A 1K4DC 1R3IC 4MVQA 1M9NA 4TSFG 1YVWA 3JAWB 3B40A 4JYAO 2N74A 1PL0A 5B1BB 2PTMA 2XT9A 3J81N 4JI8O 2CAZC 4X64O 1P49A 4CS2A 4B3SB 3E8FA 3SYOA 2W0FC 4FMTA 4CH6A 4DV6B 1IBLB 4JASA 3QF7A 1VQ4V 1BZKA 4LNUA 4YIOA 3SJCC 4FLWA 2FKXA 2Y0PA 1N36O 2OWOA 1NZ6A 3DGEA 3ABMB 1YEWA 3NR7A 3E2EA 3FB5C 4X62B 4MVMA 2F23A 4X20B 4LWSB 1KP2A 5LL6Y 4YXWG 1ENVA 1COWG 4FZ1A 1S72V 3D3QA 3OTOO 3QO5A 3VQYA 2E5LB 2IJHA 2F43G 1WB8A 3ABKB 4DV1O 1SQQH 4QE7A 1ZLZA 4FPPA 1DTOA 1YTFD 2X6CA 3CRRA 5KHHA 4FLYA 2ZR2A 1ZSPA 4ASUG 1ZL8B 4CH3A 3D36C 5LMUO 1TAEA 1SQBH 4ZKIA 2CTQA 5IJ0A 3KCYA 2E74B 1SRYA 4JPRA 4JTAB 1XDCA 1K4CC 4DW0A 1QR9A 4OXSA 3RVYA 3P30A 5A2QN 1FJGO 4IYIA 3SJBC 2QA4V 1FAFA 1JR9A 1OCOB 2Q73A 5C93A 1Q81W 4LNUB 1GTOA 5LHGA 3F5TA 4NXMB 3OD4A 4YJ2B 4OPAA 4QE9A 5KMGB 1K97A 1Q6IA 2W6JG 1T5EA 3I55V 4K0KB 2CH7A 4J9YB 2Y4TA 4J7ZA 1MOFA 1FXKA 4KHPB 4H33A 1AVMA 2UXDO 2P06A 5FNVA 4Q20A 4Z2WA 4GLXA 1Q6HA 1VQKV 2QWQB 1BL8A 5B1BC 5BXZA 3CCMV 4DR7O 2QM4A 2QM8A 2OIEA 3ZMUA 2DQ3A 4G2KA 1L8DA 1Y67A 1JFFA 1QVFU 1RPRA 3OT7A 5K1PA 4BIZA 3Q4HA 1GN4A 1K33A 4LBEC 3SYPA 1W2BU 2GDSA 1TGOA 2Q8VA 2QWRB 4N21A 2Z3YA 4B7EA 5A9GA 4BW5A 4DV6O 3ABMC 1FXVA 2A7WA 2UU9B 4YJ3B 4UCVA 2JGUA 5BY1A 4DV5B 1UPGA 4KXRA 4YHHO 2XAJA 1QR8A 4LC1A 1QNMA 4MVSA 3IC9A 4H13B 5JCOC 2WAMA 4MVZA 3CSXA 4OX9O 2F93B 2QR4A 2XAGA 4LH6A 2CH7B 4MW3A 2GHYA 2EJRA 3H1HH 1NR7A 4QIWF 4JI7B 1SKVA 3JD4A 2E5LO 5FNVB 3EXAA 4PA7A 3MDSA 4HNAA 4MVOA 2RJZA 5H5NA 2R72A 2PI5A 2LGWA 2JIZG 2RCVA 4DV0O 3CE2A 1DF5A 4E2LA 1I0HA 1EZVH 1P84F 2Q4PA 5LXTA 2DYRB 1VQMV 1BQZA 2XHBA 5J2TA 4O2AA 2VS0A 3FAVA 1OCOC 1SS3A 3RYCA 1F23A 4GUNA 3NXSA 3EVKA 1VQ7V 2JEXA 2HLDG 2WWWA 4YIPA 1XMQO 1I7FA 4J80A 5C8YB 5EYPB 1O9GA 1NJIW 2JRIA 2LFRA 3SPCA 1LUWA 4JI4B 3N2KA 3SR2C 4NXMO 5LYJA 4JTCB 4BR6A 1R73A 3ZHSA 1AR1B 3G71V 2QJ1A 4FVMA 4MS2A 2L6LA 4JAAA 5LA6B 1XREA 3AG7A 3JASA 1S5HC 2EULA 5KX5A 3W7SA 3MD0A 1HDJA 4JV5B 5KHJA 2YICA 1MSWD 1NQTA 1MABG 2R9IA 4TV8A 1N32B 2L35A 3SJAC 4U7OA 3S3WA 1PPJH 4JI5B 1Q3EA 1Z5VA 4Q6GA 1VP7A 4HNAB 4OPHA 3CCVV 5CB4A 2HVJC 1GN3A 2GTSA 3U0ZA 5LP6A 3E22A 1OCCB 1YHQV 1JVMA 1B3QA 5LGUA 4D7SA 5LXTB 1AB3A 1IXMA 4X1KA 2CUGA 2B9ZA 3HPLC 5KA6A 3LNMB 5J2TB 1NT2B 1JNBA 2Q7GA 4D6TH 3SYQA 1AI7A 1AI6A 1OCRB 3KZIZ 1Q8IA 3H1KH 1KMIZ 2F4VB 2P6JA 1JJOA 2PYLA 2UUAB 3IAYA 1M90W 4GZRB 2XAHA 2VQEB 4LF8B 3U10A 3BPZA 3CJHA 4RUEA 2ETNA 1EZJA 3E86A 4PD4F 3SPGA 5LYJB 1WPXA 1VARA 4X1IA 4XBFA 3RYIA 3ZJZA 4OGQB 1G4YB 2JEUA 3SGIA 1NH2B 4L8JA 4DK0A 3ZIAG 4JI7O 3B4SA 1H5WA 4DW1A 5IY5B 3OEHG 4MSWC 2DYRC 4TQFA 1NTKH 3CRCA 4TV8B 4MT8A 3CPWU 2HVKC 1HWYA 5KUKA 4U3JA 4X66B 1E1QG 5CB4B 5LP6B 3CRQA 2ZKOA 1XEQA 3WU2Z 1R3KC 2DJVA 2OCHA 1YJ9V 3WB2A 4I0XB 3CHXA 4X1KB 3ZHRA 5GW7A 1NS1A 4GX0A 4B3RO 2WLIB 4H37A 2QWNB 1J5EB 4K8XA 1Y4MA 5J2UA 2GUZB 2Q69A 4MVRA 2H8PC 3TXSA 1CXZB 4FFBB 3AK3A 4AHCA 1QLEB 2IJKA 1IBMB 2D3OW 2QGNA 2E3CA 3BABA 3LNNA 1GH6A 1AI5A 1GK9A 3VQVA 3BAAA 4JI4O 2YIBA 1WA8B 2HHHB 2ZM6O 2M7WA 4Z1MG 3K5LA 1N33B 1IZ3A 4JI2O 1CPYA 4LF6B 2Q7EA 5K1XA 1IX9A 2RDCA 1OCCC 3OMAB 1A32A 1N32O 1AP5A 3E8HA 4TV9A 3W7TA 2P7TC 4JI5O 1KB9F 3HKBB 3STZC 3O65A 4EB6A 4GCZA 1K3EA 1OCRC 3AG4B 2IBZH 4IHJA 2VQFB 4KP4A 4RWUA 4FZ0A 2QSAA 2E76B 2YEVB 1U97A 1IURA 5FPOA 5LGTA 1SC5B 1JA8A 3VOUA 1AROP 1RSOB 1XQ8A 1PD3A 1AILA 2F4VO 3RBZA 3OW2U 2P90A 1AI4A 3OR6C 1N4CA 4NR1A 1WP7A 2UUAO 1N36B 4K35A 2P4KA 4MTXA 4FM0A 4I9WA 3DTUB 2R9RB 4HYOA 1PKXA 2VQEO 1BQ0A 4LF8O 2EILB 4H44B 5B66Z 1P7BA 3WG7B 4DRXB 5IY5C 1G1XB 5E1AC 4W4KA 1QHTA 2AHZA 4B7KA 3TETA 2B1IA 3K5NA 5BR8B 1GM8A 4DV3O 5LP6C 3UCSC 1VF5B 4O4HA 4ABMA 1WNSA 3E8GA 2ZT9B 4X89A 1K34A 1W0KG 4DYLA 3OR7C 1ZAUA 2HP8A 3L74H 2A9HA 3UM7A 2EBOA 3IJ4A 2LQTA 2QKSA 3OTFA 4X66O 1Y76A 1X59A 4R8CA 2XASA 2Q0OC 5JVDB 3ZRXA 3T1YB 1SQVH 4CH5A 1QLEC 5JWPA 4IHJB 4UB8Z 2AXTZ 4UCUA 2YI8A 3FB8C 2PGGA 4RQEA 4LCUC 3GWKC 1SQGA 3K57A 1J5EO 4EKWA 2CGOA 3K59A 4L87A 4ZHQB 1SQXH 5GONA 2DWEC 5CA3A 2BCCH 1L0LH 4J7JA 3CX5F 1VF6A 1O9HA 3JALA 3L73H 3ZHTA 3SYCA 3K08A 2LP7A 2XAQA 4EFBA 1MSDA 3B8MA 4X1YB 2G38A 4O4IA 1N33O 2JGDA 3JD1A 1DGSA 3CCRV 5KHGA 4DR2O 1M57B 5H2FZ 4K8ZA 2Q5ZA 1MA1A 4MW8A 1NTZH 2LW7A 3AG4C 4JGSA 5IYZB 2LJ2A 1K9MW 2O57A 2QTOA 1N0NA 3F5WC 1N34O 3RYFA 5KA5A 2KSDA 4IIJB 1FYJA 3CWBH 1VQ9V 3AK2A 2VQFO 1L1FA 4O2BA 3OMNB 3G4SV 1F51A 1ORQC 1SZXA 4GT1A 2WLLA 3F7VC 2EILC 3ASOB 1S3JA 2DW4A 3WG7C 1JCHA 1DLBA 3BEHA 1B04A 1OZ0A 4I5SA 4YHHB 5H9CA 1KP3A 4LH7A 1Q6UA 5CBHA 3JARA 3HKCA 2W0XA 2FYUH 2X6AA 5CA1B 1AP6A 5BZBA 2QKCA 3SJQC 4U3FH 1MMMA 2Q9LA 3T1HO 4OX9B 3CCSV 4O4JA 3I56V 4DK1A 3B77A 3QO8A 3L75H 4JYCA 2KB1A 2JGDB 3CMAV 1I94B 5BR8O 3DC5A 4FK5C 4CC6A 3UO2A 4DV7B 1KKDA 3FKSG 1NKDA 2A79B 3TCUA 2XOKG 2IM9A 3K9AA 4DV0B 1UFIA 1URFA 4MTOA 3ZHQA 2ZDIA 1K5QA 1H8HG 2QWPB 4DR1O 2ZXWB 4TT3G 1KQSU 3T1YO 1B6QA 2KQXA 5IWAB 4DV4O 4B3TO 4ZI7A 5CBGA 3WB0A 2QE7G 5IYDO 4FLXA 4DV2B 1XMQB 3QG5A 2AHYA 2UXCO 2EZOA 4LF5B 2ZINA 2HFEC 4PA9A 3E83A 1IVSA 1GRJA 1AJNA 4FLVA 4NTXA 5IYCO 5EIBC 1D5AA 1Y74A 2UXXA 1M57C 3MAQA 3HKCB 3LUTB 3FYEB 1KUQA 2ADQB 2E75B 3A2FA 3QNEA 1TUBA 1G6UA 2OYQA 4MTFA 3K5MA 3W7XA 3APQA 2R70A 1M56B 3ZHUA 1RPOA 3SPJA 4JI6B 4LFBB 2P67A 2XNDG 4A5UB 5D5PA 3T2MA 1E1RG 4X65B 1LUVA 3ASOC 4GX5A 5DECA 2NR5A 3F7YC 2JS3A 5JJEB 5IJ0B 3LDCA 3E35A 3P3NA 4FLTA 2PZSA 1EN5A 1GM9A 4ZI7B 4JI3B 3KKYA 1VF6C 3JSLA 1S77D 1US6A 1PP9H 1AJQA 4NXNO 2CTRA 3RN4A 1Q43A 2DE0X 3TJTA 4BAYA 5GTIZ 2JK5C 3BVOA 3OGIB 1B06A 5JQGA 5ITZA 1R6NA 3VQWA 3DC6A 2PYJA 1YIJV 3P3PA 4W4LA 3G6BA 1TUBB 4O4LA 1FXKB 4GKKO 1I94O 4I55A 2KG7A 2P5OA 3R66A 1WAZA 2ZXWC 3ZBHA 5CBFA 1OHHG 1SQPH 4DV7O 2GV9A 2ZIOA 3BFRA 1V9PA 1JFFB 1WJZA 2EJ7A 3Q4HB 1R6KA 3ABTA 1NTMH 1GO3F 1QLNA 2OT5A 1OJHA 1F4NA 4FJCC 1XOUA 5BMVA 2AGAA 1V55B 4B3RB 5IWAO 3STLC 3TGUH 2K1EA 3W7UA 3U11A 3UKMA 4DV2O 1ZUQA 3K79A 4LF5O 1JX9A 4JZGA 2EINB 2ATKC 3J7AU 3OAAG 2UXBO 2RNBA 1Z5WA 2F66C 4YY3O 3CCEV 1M56C 1VQOV 3K3WA 3HKDA 2ZM6B 3K03A 4PJ0Z 2R9AA 1H8EG 2A0LA 2BSKA 3WFVA 2XAFA 5KAIZ 4JI2B 2BOBC 4PDMA 4P9OA 2FMLA 5ITZB 1JJ2U 2DQ0A 1NH2D 5LOVA 2ITCC 1Q7YW 4F6RA 2ZDIC 5CN0A 3FFQA 2IU0A 3W7WA 1XUQA 4JI6O 4XDLA 4LFBO 5KLVH 4DUYB 4DO2A 2WLHA 2QM7A 4X65O 2RMKB 3AK1A 3PN1A 2P22C 4PI0A 4FIPC 2IJIA 2HJDA 3BRCA 4GYCB 4O2AB 4FLZA 2JS5A 2A3QA 3FAVB 4TUYA 5EK0A 3RYCB 1VQPV 3ABLB 3LSQA 2HG5C 4JI3O 2AW9A 4CH4A 3N2GA 5L3GA 2BTOA 2HEPA 1NVPD 5JJNB 1KD1W 5B1AB 4I4TA 4UFZA 2ZR3A 3CRAA 4WBNA 4NB5A 4MTGA 3APOA 1FXKC 3N2KB 2IW5A 4U7NA 1SF9A 2ZQMA 2KKWA 4ZIBA 5B1NA 2LO1A 1TVKA 4PI2A 5KX5B 3JASB 1R1BA 5HFLA 1H2GA 4DV3B 1V54B 3CCQV 1ROPA 1R3JC 1ZX3A 3ZRSA 3OUSA 4LF9O 3B8NA 2WA4A 1F4MA 2ADPA 2W6IG 4JI1B 3ZHVA 1V55C 2DMXA 1E79G 3H1JH 5L3EA 2IH1C 1Z2GA 3LDEA 2FTKA 3KG2A 4G27B 4GKJB 3E22B 3CC4V 4R50A 5KHIA 4P9PA 2EIKB 2NNUA 3K0DA 2YXYA 1JPXA 1XL6A 2EINC 1EN4A 3AG2B 4LF4B 4TUYB 1M5IA 2PUSA 4DR3O 5FLXN 2UUBB 1NVPB 3VBBA 4AILC 3N2GB 4X8AA 3BHPA 1GKFA 3OFNG 2B5UA 3LDDA 3BCCH 4UUJC 3CJHB 2YIBD 2RQ6A 3BY6A 5CA0A 3AEIA 1VQ5V 4X1IB 2XUMA 3X2QB 1FFXA 2VRZA 3RYIB 4KUMA 4DR2B 3S3XA 3RYHA 2YUAA 2ODMA 1HNXB 3JYCA 4UCOA 1SQFA 1MG1A 5IE9A 3ZS8C 5IJ9A 2MW2B 4LR3A 2Y0IA 1MNGA 4DUYO 3C3SA 4LFCB 1BSMA 1N34B 3HKEA 4J42A 3FD9A 4U3JB 1BS3A 1Q82W 4ZOLA 2UUCB 1WB7A 3RGBA 2F95B 3ABLC 1VQNV 1SETA 1K73W 3JATA 3SPHA 1XILA 4BIUA 3L71H 2YXLA 5B1AC 4J10A 4N23A 1XMOB 5J2UB 2V4DA 2ZE7A 5KUMA 3JD0A 1Y66A 1RM1B 4UCSA 1EN6A 3EFFK 1PM9A 5L3DA 1MZEA 1BHBA 2ARHA 3D36A 3T1HB 1KBHA 3QO7A 1V54C 1KC8W 4LF7B 4WCEV 3CMEV 2VWJA 4JAVA 3SYAA 1NR1A 1I5XA 3ETEA 4FFKA 5CA0B 5IT9N 4UVAA 5EIBD 1FFXB 1HNZB 3ZRWA 3CXHF 3JD3A 2AZ0A 4DR5B 2EIKC 4IGGA 2QTSA 1D5NA 4QPJA 2V1DA 4TV9B 1PV0A 4JI1O 1K8AW 3AG2C 1GMGA 4ZBMA 5EC2C 4DR1B 4GKJO 1BMFG 2DYSB 4EB6B 2YIDA 4UV9A 4ZOLB 1J95A 1N0JA 4F6EA 4KFMA 2CGNA 5LHIA 4DV4B 3JAWA 4B3TB 2DN9A 1YZBA 4WFGA 1QCEA 4LF4O 4CBCA 2UXCB 2Z0AA 2FB5A 2UUBO 1YXBA 1M4UA 4CS4A 2CDYA 1K5SA 3JCZA 3X2QC 3E8BA 3JSNA 4PELA 3C3TA 1I5YA 4UB6Z 4PA3A 2N04A 1VF7A 3LSSA 1YJNV 2BTQA 2LGQA 4BWAA 1TA8A 3M7MX 4DXWA 1P7GA 5JH7A 3L70H 5B3SB 3G67A 1HNXO 1XI1A 1VQ6V 3ZRWB 4X20A 2RN9A 3A0BZ 5AG2A 4LWSA 5DEDA 3JCUZ 1GM7A 4O4HB 3ZMSA 3G6EV 4NTYA 1YSCA 4NYKA 4LFCO 1M1KW 4PA6A 4TQDA 4I50A 3UQ8A 2UUCO 4R6ZA 1Y76B 3A0RA 3CB2A 4PDVA 5D5QA 1RM1C 4X9QA 3RVZA 1LNQA 1HR0O 1PNKA 4IT5A 5EBMC 1ZL8A 1XMOO 4J41A 1DF4A 4IL6Z 4J7KA 1XNQB 1WP8A 4NXNB 5GONB 3IC7A 4BIOA 3A8TA 2YC0A 4DUZB 1XBLA 1SA0A 2NN4A 5L3FA 2Y48A 2A06H 3JALB 3CCUV 4LF7O 2QKAA 3IGAC 4O4IB 4R7CA 3SDLA 2BOCC 3QVNA 2BTQB 3BA9A 3T1CA 4GKKB 4YJ2A 1HNZO 1R3LC 2PF4E 4QJFB 5KMGA 2CTPA 5JH7B 3H1LH 1WN7A 2DYSC 1AR5A 3CD6V 4DR5O 1H2MA 2QWOB 1XHZA 1SERA 2Q6AA 2PY5A 3DXRA 4E4EA 4NKGB 1IBKB 4UV8A 4WFFA 2DOSA 3RYFB 2JDIG 5FL7G 3ZN1A 4I50B 1EFRG 1W0JG 3CS5A 3OE7G 2ZNJA 3DSQA 3OUFA 3K5OA 1F7YA 2C2AA 4O2BB 3UO3A 5KAFZ 4JI0B 2WLLB 5LMNB 1XNRB 4IYHA 3H1IH 1ZWIC 1Y6XA 2UXBB 4FM2A 4PV1B 1GAXA 1U96A 2IJJA 3TK1A 3ZMTA 1P4RA 2BE3A 3JAKA 3THOA 3OEEG 4YY3B 1RFYA 3JARB 5B3SC 2YI9A 4K3AA 1G8MA 1SA0B 2ZCEA 3L72H 1K7DA 4I7ZB 1WPBA 4YJ3A 2WLMA 3FYIB 4WF9V 1R6TA 4O4JB 4WFBV 1BCCH 2ZE6A 1W59A 2OTJV 5KHKA 4JF3A 2ZNIA 3HR0A 3JAMN 3GVMA 1NBMG 1KYOF 3O9OA 3T4ZA 5DM6V 2Y69B 3SPIA 1BT8A 4UCRA 1QBZA 3DXRB 4RUFA 3VQXA 1CEZA 2X0LA 3WB1A 5LBQA 4QGPA 3CCJV 5JJJB 1YTFB 3B2EE
chains in the Genus database with same CATH topology
3QVNA 1IDSA 1VARA 3DC6A 1AR5A 2AW9A 4GUNA 1JA8A 1MA1A 1AVMA 3EVKA 2CDYA 1AR4A 1MNGA 3CEIA 4YIPA 3BFRA 3C3SA 1BSMA 4E4EA 3C3TA 1BS3A 2P4KA 1N0NA 1WB7A 1KKCA 1Y67A 4YIOA 1LUWA 3OT7A 1GN4A 3AK2A 4BR6A 2ADQB 4JYYA 1XILA 1P7GA 2GDSA 1SZXA 4JZ2A 5AG2A 3KDRA 1XREA 1ZUQA 4JZGA 5A9GA 1EN6A 1GN6A 3AK3A 2ADPA 1WB8A 1PM9A 1ZLZA 1AP6A 1LUVA 1GN3A 2QKCA 1MMMA 1EM1A 1QNMA 3IC9A 3LSUA 1ZSPA 1I08A 4X9QA 3K9SA 1EN4A 4FFKA 4C7UA 1EN5A 1IX9A 1XDCA 1GN2A 1IXBA 3KKYA 2CE4A 3DC5A 1BT8A 1D5NA 1XUQA 1AP5A 3RN4A 1PL4A 3MDSA 3TJTA 1JR9A 2QKAA 3AK1A 2RCVA 1ZTEA 1N0JA 4F6EA 1VEWA 1I0HA 1B06A 1MSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVN A;  1IDS A;  1VAR A;  3DC6 A;  1AR5 A;  2AW9 A;  4GUN A;  1JA8 A;  1MA1 A;  1AVM A;  3EVK A;  2CDY A;  1AR4 A;  1MNG A;  3CEI A;  4YIP A;  3BFR A;  3C3S A;  1BSM A;  4E4E A;  3C3T A;  1BS3 A;  2P4K A;  1N0N A;  1WB7 A;  1KKC A;  1Y67 A;  4YIO A;  1LUW A;  3OT7 A;  1GN4 A;  3AK2 A;  4BR6 A;  2ADQ B;  4JYY A;  1XIL A;  1P7G A;  2GDS A;  1SZX A;  4JZ2 A;  5AG2 A;  1XRE A;  1ZUQ A;  4JZG A;  5A9G A;  1EN6 A;  1GN6 A;  3AK3 A;  2ADP A;  1WB8 A;  1PM9 A;  1ZLZ A;  1AP6 A;  1LUV A;  1GN3 A;  2QKC A;  1MMM A;  1EM1 A;  1QNM A;  3IC9 A;  3LSU A;  1ZSP A;  1I08 A;  4X9Q A;  3K9S A;  1EN4 A;  4FFK A;  4C7U A;  1EN5 A;  1IX9 A;  1XDC A;  1GN2 A;  1IXB A;  3KKY A;  2CE4 A;  3DC5 A;  1BT8 A;  1D5N A;  1XUQ A;  1AP5 A;  3RN4 A;  1PL4 A;  3MDS A;  3TJT A;  1JR9 A;  2QKA A;  3AK1 A;  2RCV A;  1ZTE A;  1N0J A;  4F6E A;  1VEW A;  1I0H A;  1B06 A;  1MSD A; 
#chains in the Genus database with same CATH topology
 2YSU B;  1UJW B;  4UVB A;  1CP9 A;  4JTD B;  3ZRV A;  1HP8 A;  2H3O A;  1XNQ O;  4WFH A;  1NI8 A;  4B3S O;  4DUZ O;  4CC5 A;  4LFA B;  3CCL V;  3RWR D;  3JAK B;  3P32 A;  1NU1 H;  3ETD A;  4DR4 B;  1Y74 B;  5B1O A;  4CS3 A;  1IBL O;  5J9P C;  2GTA A;  2OCC B;  2Q68 A;  5C8Y A;  2EIJ B;  5EYP A;  1FS0 G;  3MHH C;  1OCZ B;  4I9Q A;  1FKA O;  3UT5 A;  1SZT A;  2ZE8 A;  3AG3 B;  1VQL V;  3I5D A;  4LF9 B;  4X62 O;  3FX7 A;  3ABK C;  2DWD C;  1HW7 A;  5LA6 A;  2JJ2 G;  2LW1 A;  1HNW B;  1YI2 V;  4XDK A;  4AQY B;  3T4D A;  1IBK O;  1S5L Z;  2WLN A;  5EC1 C;  4WFA V;  2EIM B;  3TXQ A;  1VQ8 V;  4XDJ A;  2HKO A;  4JI0 O;  4CZZ A;  5LMN O;  1XNR O;  1BHA A;  3E89 A;  4DR3 B;  4PHZ A;  1BE3 H;  3CXC U;  2V7Q G;  3ABU A;  1QQC A;  1IXB A;  2OIG A;  2CE4 A;  2PI4 A;  3MHS C;  2QEX V;  4NTW A;  2H94 A;  1H2K A;  1MZF A;  1FFT B;  1FPO A;  5EBL C;  1PNM A;  2Y69 C;  5JQG B;  4PA4 A;  5EBW C;  2HJF C;  3UT5 B;  4BW9 A;  5LHH A;  4O4L B;  1RP3 B;  1KEC A;  5H6R A;  2EZP A;  2KG7 B;  4I55 B;  1IJG A;  1FD9 A;  4K0K O;  4B3M B;  5FPR A;  5DN6 G;  4KHP O;  4FM1 A;  3H9V A;  4RQF A;  3A0H Z;  4X88 A;  4MVU A;  4G28 B;  1KKC A;  4P30 A;  3RFR A;  2VWK A;  3H01 A;  1JMK C;  1DK1 A;  3B09 A;  4DR6 B;  5BMV B;  2LFS A;  4J9Z B;  2IU3 A;  2WLJ A;  1YJW V;  2YXH A;  2ITD C;  1YDX A;  2Q0A A;  2OCC C;  1X4T A;  2F1M A;  4I0X A;  2EIJ C;  2WSS G;  1OCZ C;  2WLI A;  3ASN B;  2YIA A;  1GN6 A;  4LFA O;  2GUZ A;  3ZCC A;  3AG3 C;  4FFB A;  4DR4 O;  3GB7 C;  3J80 N;  2UXN A;  3HKD B;  1SES A;  2UU9 O;  2BSK B;  1YF2 A;  2Z5U A;  4RAI A;  4DV5 O;  1Q86 W;  3LSU A;  4ICG A;  3ICX A;  3K9S A;  1WA8 A;  5IYB O;  5LOV B;  4FLU A;  4P2Z A;  5E79 Z;  4F6R B;  5CMU A;  4QNH B;  2EIM C;  3K0G A;  5L3B A;  4HAM A;  2D2C B;  1HNW O;  2WLK A;  4AQY O;  2GSM B;  2GBO A;  2ZE5 A;  1H2L A;  1M93 A;  2WPD G;  1ZTE A;  3HKB A;  2P4V A;  5EZY A;  1VEW A;  2FL4 A;  1IDS A;  3ZN0 A;  4NVP A;  3ZED A;  4GX2 A;  1EBO A;  3M8A A;  3RT3 C;  3ZX6 A;  1TUE B;  3AG1 B;  1YCI A;  2YEV A;  4J11 A;  4EFE A;  1FOU A;  2B1G A;  3EHB B;  1H2N A;  1AR4 A;  4I4T B;  4B08 A;  3CEI A;  4WBN B;  1RSO A;  3D8C A;  2N05 A;  1AJP A;  1FXH A;  3K58 A;  1VMG A;  4PDR A;  2M6Y A;  2EX3 A;  3C90 A;  3KCX A;  2Y4U A;  5L3C A;  1TVK B;  3ML0 A;  3K04 A;  4DRX A;  1Q5O A;  1K92 A;  1OV9 A;  3OGC C;  1QVG U;  4JZ2 A;  4UCT A;  4HBN A;  2WA3 A;  3L9D A;  4B3M O;  4JV5 O;  4UXN A;  4QPK A;  3D3I A;  3GWO A;  3IFX A;  1HR0 B;  1VIB A;  4DR6 O;  5IDJ A;  1S5J A;  1QU7 A;  3ASN C;  4JYA B;  1I08 A;  1BGY H;  5EZY B;  4KL1 A;  5JVD A;  4C7U A;  4UVC A;  2JJ1 G;  4JI8 B;  4X64 B;  3M99 B;  4H0L B;  3ZMZ A;  1GN2 A;  4D7T A;  5F2V O;  1L0N H;  4ZHQ A;  2QDO A;  1N8R W;  1D2D A;  2NLJ C;  1KU9 A;  3N27 A;  3CYO A;  2K9P A;  5B5E Z;  2X7R B;  1S0V A;  2CK3 G;  3RYH B;  3CRM A;  2YDE A;  4X1Y A;  3QTC A;  5IJ9 B;  1PNL A;  2XTA A;  2YS8 A;  3JD2 A;  3OTO B;  3HKE B;  5IYZ A;  1XHX A;  1THZ A;  4DV1 B;  2CTW A;  3K06 A;  3G80 A;  3AG1 C;  4AI8 A;  2AZ2 A;  2IH3 C;  1H2S B;  3JAT B;  4IIJ A;  5H6Q A;  3FB7 C;  2ILM A;  4JYY A;  3FB6 C;  5GTH Z;  5LMU B;  3ETG A;  3R65 A;  3OM3 B;  3KDR A;  4PDL A;  2Q7H A;  1XL4 A;  3PJS K;  2Q67 A;  1JOY A;  2HR3 A;  1FJG B;  4JAU A;  4WFE A;  4TOI A;  4GX1 A;  1IBM O;  1S76 D;  4JYB A;  4TWK A;  4EEQ A;  2OTL V;  1EM1 A;  5CA1 A;  4Z1V A;  2ZIM A;  3CP1 A;  1JQ0 A;  3ZMV A;  4F4L A;  2ZD9 A;  5LGN A;  4LP8 A;  5TIS Z;  2HHH O;  2MK3 A;  3BA8 A;  3OMI B;  2X6B A;  1LR1 A;  2UXD B;  5JCO A;  4HZ3 A;  4LF6 O;  4RO2 A;  3CC7 V;  3RW0 A;  3ETQ A;  5HFM A;  1Q90 D;  1WLE A;  1YIT V;  3CC2 V;  3HB3 B;  1H38 A;  4DR7 B;  2JVD A;  1PL4 A;  1K4D C;  1R3I C;  4MVQ A;  1M9N A;  4TSF G;  1YVW A;  3JAW B;  3B40 A;  4JYA O;  2N74 A;  1PL0 A;  5B1B B;  2PTM A;  2XT9 A;  3J81 N;  4JI8 O;  2CAZ C;  4X64 O;  1P49 A;  4CS2 A;  4B3S B;  3E8F A;  3SYO A;  2W0F C;  4FMT A;  4CH6 A;  4DV6 B;  1IBL B;  4JAS A;  3QF7 A;  1VQ4 V;  1BZK A;  4LNU A;  4YIO A;  3SJC C;  4FLW A;  2FKX A;  2Y0P A;  1N36 O;  2OWO A;  1NZ6 A;  3DGE A;  3ABM B;  1YEW A;  3NR7 A;  3E2E A;  3FB5 C;  4X62 B;  4MVM A;  2F23 A;  4X20 B;  4LWS B;  1KP2 A;  5LL6 Y;  4YXW G;  1ENV A;  1COW G;  4FZ1 A;  1S72 V;  3D3Q A;  3OTO O;  3QO5 A;  3VQY A;  2E5L B;  2IJH A;  2F43 G;  1WB8 A;  3ABK B;  4DV1 O;  1SQQ H;  4QE7 A;  1ZLZ A;  4FPP A;  1DTO A;  1YTF D;  2X6C A;  3CRR A;  5KHH A;  4FLY A;  2ZR2 A;  1ZSP A;  4ASU G;  1ZL8 B;  4CH3 A;  3D36 C;  5LMU O;  1TAE A;  1SQB H;  4ZKI A;  2CTQ A;  5IJ0 A;  3KCY A;  2E74 B;  1SRY A;  4JPR A;  4JTA B;  1XDC A;  1K4C C;  4DW0 A;  1QR9 A;  4OXS A;  3RVY A;  3P30 A;  5A2Q N;  1FJG O;  4IYI A;  3SJB C;  2QA4 V;  1FAF A;  1JR9 A;  1OCO B;  2Q73 A;  5C93 A;  1Q81 W;  4LNU B;  1GTO A;  5LHG A;  3F5T A;  4NXM B;  3OD4 A;  4YJ2 B;  4OPA A;  4QE9 A;  5KMG B;  1K97 A;  1Q6I A;  2W6J G;  1T5E A;  3I55 V;  4K0K B;  2CH7 A;  4J9Y B;  2Y4T A;  4J7Z A;  1MOF A;  1FXK A;  4KHP B;  4H33 A;  1AVM A;  2UXD O;  2P06 A;  5FNV A;  4Q20 A;  4Z2W A;  4GLX A;  1Q6H A;  1VQK V;  2QWQ B;  1BL8 A;  5B1B C;  5BXZ A;  3CCM V;  4DR7 O;  2QM4 A;  2QM8 A;  2OIE A;  3ZMU A;  2DQ3 A;  4G2K A;  1L8D A;  1Y67 A;  1JFF A;  1QVF U;  1RPR A;  3OT7 A;  5K1P A;  4BIZ A;  3Q4H A;  1GN4 A;  1K33 A;  4LBE C;  3SYP A;  1W2B U;  2GDS A;  1TGO A;  2Q8V A;  2QWR B;  4N21 A;  2Z3Y A;  4B7E A;  5A9G A;  4BW5 A;  4DV6 O;  3ABM C;  1FXV A;  2A7W A;  2UU9 B;  4YJ3 B;  4UCV A;  2JGU A;  5BY1 A;  4DV5 B;  1UPG A;  4KXR A;  4YHH O;  2XAJ A;  1QR8 A;  4LC1 A;  1QNM A;  4MVS A;  3IC9 A;  4H13 B;  5JCO C;  2WAM A;  4MVZ A;  3CSX A;  4OX9 O;  2F93 B;  2QR4 A;  2XAG A;  4LH6 A;  2CH7 B;  4MW3 A;  2GHY A;  2EJR A;  3H1H H;  1NR7 A;  4QIW F;  4JI7 B;  1SKV A;  3JD4 A;  2E5L O;  5FNV B;  3EXA A;  4PA7 A;  3MDS A;  4HNA A;  4MVO A;  2RJZ A;  5H5N A;  2R72 A;  2PI5 A;  2LGW A;  2JIZ G;  2RCV A;  4DV0 O;  3CE2 A;  1DF5 A;  4E2L A;  1I0H A;  1EZV H;  1P84 F;  2Q4P A;  5LXT A;  2DYR B;  1VQM V;  1BQZ A;  2XHB A;  5J2T A;  4O2A A;  2VS0 A;  3FAV A;  1OCO C;  1SS3 A;  3RYC A;  1F23 A;  4GUN A;  3NXS A;  3EVK A;  1VQ7 V;  2JEX A;  2HLD G;  2WWW A;  4YIP A;  1XMQ O;  1I7F A;  4J80 A;  5C8Y B;  5EYP B;  1O9G A;  1NJI W;  2JRI A;  2LFR A;  3SPC A;  1LUW A;  4JI4 B;  3N2K A;  3SR2 C;  4NXM O;  5LYJ A;  4JTC B;  4BR6 A;  1R73 A;  3ZHS A;  1AR1 B;  3G71 V;  2QJ1 A;  4FVM A;  4MS2 A;  2L6L A;  4JAA A;  5LA6 B;  1XRE A;  3AG7 A;  3JAS A;  1S5H C;  2EUL A;  5KX5 A;  3W7S A;  3MD0 A;  1HDJ A;  4JV5 B;  5KHJ A;  2YIC A;  1MSW D;  1NQT A;  1MAB G;  2R9I A;  4TV8 A;  1N32 B;  2L35 A;  3SJA C;  4U7O A;  3S3W A;  1PPJ H;  4JI5 B;  1Q3E A;  1Z5V A;  4Q6G A;  1VP7 A;  4HNA B;  4OPH A;  3CCV V;  5CB4 A;  2HVJ C;  1GN3 A;  2GTS A;  3U0Z A;  5LP6 A;  3E22 A;  1OCC B;  1YHQ V;  1JVM A;  1B3Q A;  5LGU A;  4D7S A;  5LXT B;  1AB3 A;  1IXM A;  4X1K A;  2CUG A;  2B9Z A;  3HPL C;  5KA6 A;  3LNM B;  5J2T B;  1NT2 B;  1JNB A;  2Q7G A;  4D6T H;  3SYQ A;  1AI7 A;  1AI6 A;  1OCR B;  3KZI Z;  1Q8I A;  3H1K H;  1KMI Z;  2F4V B;  2P6J A;  1JJO A;  2PYL A;  2UUA B;  3IAY A;  1M90 W;  4GZR B;  2XAH A;  2VQE B;  4LF8 B;  3U10 A;  3BPZ A;  3CJH A;  4RUE A;  2ETN A;  1EZJ A;  3E86 A;  4PD4 F;  3SPG A;  5LYJ B;  1WPX A;  1VAR A;  4X1I A;  4XBF A;  3RYI A;  3ZJZ A;  4OGQ B;  1G4Y B;  2JEU A;  3SGI A;  1NH2 B;  4L8J A;  4DK0 A;  3ZIA G;  4JI7 O;  3B4S A;  1H5W A;  4DW1 A;  5IY5 B;  3OEH G;  4MSW C;  2DYR C;  4TQF A;  1NTK H;  3CRC A;  4TV8 B;  4MT8 A;  3CPW U;  2HVK C;  1HWY A;  5KUK A;  4U3J A;  4X66 B;  1E1Q G;  5CB4 B;  5LP6 B;  3CRQ A;  2ZKO A;  1XEQ A;  3WU2 Z;  1R3K C;  2DJV A;  2OCH A;  1YJ9 V;  3WB2 A;  4I0X B;  3CHX A;  4X1K B;  3ZHR A;  5GW7 A;  1NS1 A;  4GX0 A;  4B3R O;  2WLI B;  4H37 A;  2QWN B;  1J5E B;  4K8X A;  1Y4M A;  5J2U A;  2GUZ B;  2Q69 A;  4MVR A;  2H8P C;  3TXS A;  1CXZ B;  4FFB B;  3AK3 A;  4AHC A;  1QLE B;  2IJK A;  1IBM B;  2D3O W;  2QGN A;  2E3C A;  3BAB A;  3LNN A;  1GH6 A;  1AI5 A;  1GK9 A;  3VQV A;  3BAA A;  4JI4 O;  2YIB A;  1WA8 B;  2HHH B;  2ZM6 O;  2M7W A;  4Z1M G;  3K5L A;  1N33 B;  1IZ3 A;  4JI2 O;  1CPY A;  4LF6 B;  2Q7E A;  5K1X A;  1IX9 A;  2RDC A;  1OCC C;  3OMA B;  1A32 A;  1N32 O;  1AP5 A;  3E8H A;  4TV9 A;  3W7T A;  2P7T C;  4JI5 O;  1KB9 F;  3HKB B;  3STZ C;  3O65 A;  4EB6 A;  4GCZ A;  1K3E A;  1OCR C;  3AG4 B;  2IBZ H;  4IHJ A;  2VQF B;  4KP4 A;  4RWU A;  4FZ0 A;  2QSA A;  2E76 B;  2YEV B;  1U97 A;  1IUR A;  5FPO A;  5LGT A;  1SC5 B;  1JA8 A;  3VOU A;  1ARO P;  1RSO B;  1XQ8 A;  1PD3 A;  1AIL A;  2F4V O;  3RBZ A;  3OW2 U;  2P90 A;  1AI4 A;  3OR6 C;  1N4C A;  4NR1 A;  1WP7 A;  2UUA O;  1N36 B;  4K35 A;  2P4K A;  4MTX A;  4FM0 A;  4I9W A;  3DTU B;  2R9R B;  4HYO A;  1PKX A;  2VQE O;  1BQ0 A;  4LF8 O;  2EIL B;  4H44 B;  5B66 Z;  1P7B A;  3WG7 B;  4DRX B;  5IY5 C;  1G1X B;  5E1A C;  4W4K A;  1QHT A;  2AHZ A;  4B7K A;  3TET A;  2B1I A;  3K5N A;  5BR8 B;  1GM8 A;  4DV3 O;  5LP6 C;  3UCS C;  1VF5 B;  4O4H A;  4ABM A;  1WNS A;  3E8G A;  2ZT9 B;  4X89 A;  1K34 A;  1W0K G;  4DYL A;  3OR7 C;  1ZAU A;  2HP8 A;  3L74 H;  2A9H A;  3UM7 A;  2EBO A;  3IJ4 A;  2LQT A;  2QKS A;  3OTF A;  4X66 O;  1Y76 A;  1X59 A;  4R8C A;  2XAS A;  2Q0O C;  5JVD B;  3ZRX A;  3T1Y B;  1SQV H;  4CH5 A;  1QLE C;  5JWP A;  4IHJ B;  4UB8 Z;  2AXT Z;  4UCU A;  2YI8 A;  3FB8 C;  2PGG A;  4RQE A;  4LCU C;  3GWK C;  1SQG A;  3K57 A;  1J5E O;  4EKW A;  2CGO A;  3K59 A;  4L87 A;  4ZHQ B;  1SQX H;  5GON A;  2DWE C;  5CA3 A;  2BCC H;  1L0L H;  4J7J A;  3CX5 F;  1VF6 A;  1O9H A;  3JAL A;  3L73 H;  3ZHT A;  3SYC A;  3K08 A;  2LP7 A;  2XAQ A;  4EFB A;  1MSD A;  3B8M A;  4X1Y B;  2G38 A;  4O4I A;  1N33 O;  2JGD A;  3JD1 A;  1DGS A;  3CCR V;  5KHG A;  4DR2 O;  1M57 B;  5H2F Z;  4K8Z A;  2Q5Z A;  1MA1 A;  4MW8 A;  1NTZ H;  2LW7 A;  3AG4 C;  4JGS A;  5IYZ B;  2LJ2 A;  1K9M W;  2O57 A;  2QTO A;  1N0N A;  3F5W C;  1N34 O;  3RYF A;  5KA5 A;  2KSD A;  4IIJ B;  1FYJ A;  3CWB H;  1VQ9 V;  3AK2 A;  2VQF O;  1L1F A;  4O2B A;  3OMN B;  3G4S V;  1F51 A;  1ORQ C;  1SZX A;  4GT1 A;  2WLL A;  3F7V C;  2EIL C;  3ASO B;  1S3J A;  2DW4 A;  3WG7 C;  1JCH A;  1DLB A;  3BEH A;  1B04 A;  1OZ0 A;  4I5S A;  4YHH B;  5H9C A;  1KP3 A;  4LH7 A;  1Q6U A;  5CBH A;  3JAR A;  3HKC A;  2W0X A;  2FYU H;  2X6A A;  5CA1 B;  1AP6 A;  5BZB A;  2QKC A;  3SJQ C;  4U3F H;  1MMM A;  2Q9L A;  3T1H O;  4OX9 B;  3CCS V;  4O4J A;  3I56 V;  4DK1 A;  3B77 A;  3QO8 A;  3L75 H;  4JYC A;  2KB1 A;  2JGD B;  3CMA V;  1I94 B;  5BR8 O;  3DC5 A;  4FK5 C;  4CC6 A;  3UO2 A;  4DV7 B;  1KKD A;  3FKS G;  1NKD A;  2A79 B;  3TCU A;  2XOK G;  2IM9 A;  3K9A A;  4DV0 B;  1UFI A;  1URF A;  4MTO A;  3ZHQ A;  2ZDI A;  1K5Q A;  1H8H G;  2QWP B;  4DR1 O;  2ZXW B;  4TT3 G;  1KQS U;  3T1Y O;  1B6Q A;  2KQX A;  5IWA B;  4DV4 O;  4B3T O;  4ZI7 A;  5CBG A;  3WB0 A;  2QE7 G;  5IYD O;  4FLX A;  4DV2 B;  1XMQ B;  3QG5 A;  2AHY A;  2UXC O;  2EZO A;  4LF5 B;  2ZIN A;  2HFE C;  4PA9 A;  3E83 A;  1IVS A;  1GRJ A;  1AJN A;  4FLV A;  4NTX A;  5IYC O;  5EIB C;  1D5A A;  1Y74 A;  2UXX A;  1M57 C;  3MAQ A;  3HKC B;  3LUT B;  3FYE B;  1KUQ A;  2ADQ B;  2E75 B;  3A2F A;  3QNE A;  1TUB A;  1G6U A;  2OYQ A;  4MTF A;  3K5M A;  3W7X A;  3APQ A;  2R70 A;  1M56 B;  3ZHU A;  1RPO A;  3SPJ A;  4JI6 B;  4LFB B;  2P67 A;  2XND G;  4A5U B;  5D5P A;  3T2M A;  1E1R G;  4X65 B;  1LUV A;  3ASO C;  4GX5 A;  5DEC A;  2NR5 A;  3F7Y C;  2JS3 A;  5JJE B;  5IJ0 B;  3LDC A;  3E35 A;  3P3N A;  4FLT A;  2PZS A;  1EN5 A;  1GM9 A;  4ZI7 B;  4JI3 B;  3KKY A;  1VF6 C;  3JSL A;  1S77 D;  1US6 A;  1PP9 H;  1AJQ A;  4NXN O;  2CTR A;  3RN4 A;  1Q43 A;  2DE0 X;  3TJT A;  4BAY A;  5GTI Z;  2JK5 C;  3BVO A;  3OGI B;  1B06 A;  5JQG A;  5ITZ A;  1R6N A;  3VQW A;  3DC6 A;  2PYJ A;  1YIJ V;  3P3P A;  4W4L A;  3G6B A;  1TUB B;  4O4L A;  1FXK B;  4GKK O;  1I94 O;  4I55 A;  2KG7 A;  2P5O A;  3R66 A;  1WAZ A;  2ZXW C;  3ZBH A;  5CBF A;  1OHH G;  1SQP H;  4DV7 O;  2GV9 A;  2ZIO A;  3BFR A;  1V9P A;  1JFF B;  1WJZ A;  2EJ7 A;  3Q4H B;  1R6K A;  3ABT A;  1NTM H;  1GO3 F;  1QLN A;  2OT5 A;  1OJH A;  1F4N A;  4FJC C;  1XOU A;  5BMV A;  2AGA A;  1V55 B;  4B3R B;  5IWA O;  3STL C;  3TGU H;  2K1E A;  3W7U A;  3U11 A;  3UKM A;  4DV2 O;  1ZUQ A;  3K79 A;  4LF5 O;  1JX9 A;  4JZG A;  2EIN B;  2ATK C;  3J7A U;  3OAA G;  2UXB O;  2RNB A;  1Z5W A;  2F66 C;  4YY3 O;  3CCE V;  1M56 C;  1VQO V;  3K3W A;  3HKD A;  2ZM6 B;  3K03 A;  4PJ0 Z;  2R9A A;  1H8E G;  2A0L A;  2BSK A;  3WFV A;  2XAF A;  5KAI Z;  4JI2 B;  2BOB C;  4PDM A;  4P9O A;  2FML A;  5ITZ B;  1JJ2 U;  2DQ0 A;  1NH2 D;  5LOV A;  2ITC C;  1Q7Y W;  4F6R A;  2ZDI C;  5CN0 A;  3FFQ A;  2IU0 A;  3W7W A;  1XUQ A;  4JI6 O;  4XDL A;  4LFB O;  5KLV H;  4DUY B;  4DO2 A;  2WLH A;  2QM7 A;  4X65 O;  2RMK B;  3AK1 A;  3PN1 A;  2P22 C;  4PI0 A;  4FIP C;  2IJI A;  2HJD A;  3BRC A;  4GYC B;  4O2A B;  4FLZ A;  2JS5 A;  2A3Q A;  3FAV B;  4TUY A;  5EK0 A;  3RYC B;  1VQP V;  3ABL B;  3LSQ A;  2HG5 C;  4JI3 O;  2AW9 A;  4CH4 A;  3N2G A;  5L3G A;  2BTO A;  2HEP A;  1NVP D;  5JJN B;  1KD1 W;  5B1A B;  4I4T A;  4UFZ A;  2ZR3 A;  3CRA A;  4WBN A;  4NB5 A;  4MTG A;  3APO A;  1FXK C;  3N2K B;  2IW5 A;  4U7N A;  1SF9 A;  2ZQM A;  2KKW A;  4ZIB A;  5B1N A;  2LO1 A;  1TVK A;  4PI2 A;  5KX5 B;  3JAS B;  1R1B A;  5HFL A;  1H2G A;  4DV3 B;  1V54 B;  3CCQ V;  1ROP A;  1R3J C;  1ZX3 A;  3ZRS A;  3OUS A;  4LF9 O;  3B8N A;  2WA4 A;  1F4M A;  2ADP A;  2W6I G;  4JI1 B;  3ZHV A;  1V55 C;  2DMX A;  1E79 G;  3H1J H;  5L3E A;  2IH1 C;  1Z2G A;  3LDE A;  2FTK A;  3KG2 A;  4G27 B;  4GKJ B;  3E22 B;  3CC4 V;  4R50 A;  5KHI A;  4P9P A;  2EIK B;  2NNU A;  3K0D A;  2YXY A;  1JPX A;  1XL6 A;  2EIN C;  1EN4 A;  3AG2 B;  4LF4 B;  4TUY B;  1M5I A;  2PUS A;  4DR3 O;  5FLX N;  2UUB B;  1NVP B;  3VBB A;  4AIL C;  3N2G B;  4X8A A;  3BHP A;  1GKF A;  3OFN G;  2B5U A;  3LDD A;  3BCC H;  4UUJ C;  3CJH B;  2YIB D;  2RQ6 A;  3BY6 A;  5CA0 A;  3AEI A;  1VQ5 V;  4X1I B;  2XUM A;  3X2Q B;  1FFX A;  2VRZ A;  3RYI B;  4KUM A;  4DR2 B;  3S3X A;  3RYH A;  2YUA A;  2ODM A;  1HNX B;  3JYC A;  4UCO A;  1SQF A;  1MG1 A;  5IE9 A;  3ZS8 C;  5IJ9 A;  2MW2 B;  4LR3 A;  2Y0I A;  1MNG A;  4DUY O;  3C3S A;  4LFC B;  1BSM A;  1N34 B;  3HKE A;  4J42 A;  3FD9 A;  4U3J B;  1BS3 A;  1Q82 W;  4ZOL A;  2UUC B;  1WB7 A;  3RGB A;  2F95 B;  3ABL C;  1VQN V;  1SET A;  1K73 W;  3JAT A;  3SPH A;  1XIL A;  4BIU A;  3L71 H;  2YXL A;  5B1A C;  4J10 A;  4N23 A;  1XMO B;  5J2U B;  2V4D A;  2ZE7 A;  5KUM A;  3JD0 A;  1Y66 A;  1RM1 B;  4UCS A;  1EN6 A;  3EFF K;  1PM9 A;  5L3D A;  1MZE A;  1BHB A;  2ARH A;  3D36 A;  3T1H B;  1KBH A;  3QO7 A;  1V54 C;  1KC8 W;  4LF7 B;  4WCE V;  3CME V;  2VWJ A;  4JAV A;  3SYA A;  1NR1 A;  1I5X A;  3ETE A;  4FFK A;  5CA0 B;  5IT9 N;  4UVA A;  5EIB D;  1FFX B;  1HNZ B;  3ZRW A;  3CXH F;  3JD3 A;  2AZ0 A;  4DR5 B;  2EIK C;  4IGG A;  2QTS A;  1D5N A;  4QPJ A;  2V1D A;  4TV9 B;  1PV0 A;  4JI1 O;  1K8A W;  3AG2 C;  1GMG A;  4ZBM A;  5EC2 C;  4DR1 B;  4GKJ O;  1BMF G;  2DYS B;  4EB6 B;  2YID A;  4UV9 A;  4ZOL B;  1J95 A;  1N0J A;  4F6E A;  4KFM A;  2CGN A;  5LHI A;  4DV4 B;  3JAW A;  4B3T B;  2DN9 A;  1YZB A;  4WFG A;  1QCE A;  4LF4 O;  4CBC A;  2UXC B;  2Z0A A;  2FB5 A;  2UUB O;  1YXB A;  1M4U A;  4CS4 A;  2CDY A;  1K5S A;  3JCZ A;  3X2Q C;  3E8B A;  3JSN A;  4PEL A;  3C3T A;  1I5Y A;  4UB6 Z;  4PA3 A;  2N04 A;  1VF7 A;  3LSS A;  1YJN V;  2BTQ A;  2LGQ A;  4BWA A;  1TA8 A;  3M7M X;  4DXW A;  1P7G A;  5JH7 A;  3L70 H;  5B3S B;  3G67 A;  1HNX O;  1XI1 A;  1VQ6 V;  3ZRW B;  4X20 A;  2RN9 A;  3A0B Z;  5AG2 A;  4LWS A;  5DED A;  3JCU Z;  1GM7 A;  4O4H B;  3ZMS A;  3G6E V;  4NTY A;  1YSC A;  4NYK A;  4LFC O;  1M1K W;  4PA6 A;  4TQD A;  4I50 A;  3UQ8 A;  2UUC O;  4R6Z A;  1Y76 B;  3A0R A;  3CB2 A;  4PDV A;  5D5Q A;  1RM1 C;  4X9Q A;  3RVZ A;  1LNQ A;  1HR0 O;  1PNK A;  4IT5 A;  5EBM C;  1ZL8 A;  1XMO O;  4J41 A;  1DF4 A;  4IL6 Z;  4J7K A;  1XNQ B;  1WP8 A;  4NXN B;  5GON B;  3IC7 A;  4BIO A;  3A8T A;  2YC0 A;  4DUZ B;  1XBL A;  1SA0 A;  2NN4 A;  5L3F A;  2Y48 A;  2A06 H;  3JAL B;  3CCU V;  4LF7 O;  2QKA A;  3IGA C;  4O4I B;  4R7C A;  3SDL A;  2BOC C;  3QVN A;  2BTQ B;  3BA9 A;  3T1C A;  4GKK B;  4YJ2 A;  1HNZ O;  1R3L C;  2PF4 E;  4QJF B;  5KMG A;  2CTP A;  5JH7 B;  3H1L H;  1WN7 A;  2DYS C;  1AR5 A;  3CD6 V;  4DR5 O;  1H2M A;  2QWO B;  1XHZ A;  1SER A;  2Q6A A;  2PY5 A;  3DXR A;  4E4E A;  4NKG B;  1IBK B;  4UV8 A;  4WFF A;  2DOS A;  3RYF B;  2JDI G;  5FL7 G;  3ZN1 A;  4I50 B;  1EFR G;  1W0J G;  3CS5 A;  3OE7 G;  2ZNJ A;  3DSQ A;  3OUF A;  3K5O A;  1F7Y A;  2C2A A;  4O2B B;  3UO3 A;  5KAF Z;  4JI0 B;  2WLL B;  5LMN B;  1XNR B;  4IYH A;  3H1I H;  1ZWI C;  1Y6X A;  2UXB B;  4FM2 A;  4PV1 B;  1GAX A;  1U96 A;  2IJJ A;  3TK1 A;  3ZMT A;  1P4R A;  2BE3 A;  3JAK A;  3THO A;  3OEE G;  4YY3 B;  1RFY A;  3JAR B;  5B3S C;  2YI9 A;  4K3A A;  1G8M A;  1SA0 B;  2ZCE A;  3L72 H;  1K7D A;  4I7Z B;  1WPB A;  4YJ3 A;  2WLM A;  3FYI B;  4WF9 V;  1R6T A;  4O4J B;  4WFB V;  1BCC H;  2ZE6 A;  1W59 A;  2OTJ V;  5KHK A;  4JF3 A;  2ZNI A;  3HR0 A;  3JAM N;  3GVM A;  1NBM G;  1KYO F;  3O9O A;  3T4Z A;  5DM6 V;  2Y69 B;  3SPI A;  1BT8 A;  4UCR A;  1QBZ A;  3DXR B;  4RUF A;  3VQX A;  1CEZ A;  2X0L A;  3WB1 A;  5LBQ A;  4QGP A;  3CCJ V;  5JJJ B;  1YTF B;  3B2E E; 
#chains in the Genus database with same CATH homology
 3QVN A;  1IDS A;  1VAR A;  3DC6 A;  1AR5 A;  2AW9 A;  4GUN A;  1JA8 A;  1MA1 A;  1AVM A;  3EVK A;  2CDY A;  1AR4 A;  1MNG A;  3CEI A;  4YIP A;  3BFR A;  3C3S A;  1BSM A;  4E4E A;  3C3T A;  1BS3 A;  2P4K A;  1N0N A;  1WB7 A;  1KKC A;  1Y67 A;  4YIO A;  1LUW A;  3OT7 A;  1GN4 A;  3AK2 A;  4BR6 A;  2ADQ B;  4JYY A;  1XIL A;  1P7G A;  2GDS A;  1SZX A;  4JZ2 A;  5AG2 A;  3KDR A;  1XRE A;  1ZUQ A;  4JZG A;  5A9G A;  1EN6 A;  1GN6 A;  3AK3 A;  2ADP A;  1WB8 A;  1PM9 A;  1ZLZ A;  1AP6 A;  1LUV A;  1GN3 A;  2QKC A;  1MMM A;  1EM1 A;  1QNM A;  3IC9 A;  3LSU A;  1ZSP A;  1I08 A;  4X9Q A;  3K9S A;  1EN4 A;  4FFK A;  4C7U A;  1EN5 A;  1IX9 A;  1XDC A;  1GN2 A;  1IXB A;  3KKY A;  2CE4 A;  3DC5 A;  1BT8 A;  1D5N A;  1XUQ A;  1AP5 A;  3RN4 A;  1PL4 A;  3MDS A;  3TJT A;  1JR9 A;  2QKA A;  3AK1 A;  2RCV A;  1ZTE A;  1N0J A;  4F6E A;  1VEW A;  1I0H A;  1B06 A;  1MSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...