1EM6A

Human liver glycogen phosphorylase a complexed with glcnac and cp-526,423
Total Genus 325
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
325
sequence length
809
structure length
787
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIVER GLYCOGEN PHOSPHORYLASE
publication title Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 325
structure length 787
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1em6A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1em6A01
3MTBA 4QLBA 1C8LA 5BNWA 2F3PA 2KS6A 3MSCA 2FF5A 4NESA 4RIIA 3SYMA 2JJMA 4FZRA 5LQDA 1PSWA 1IIRA 2PQ6A 2QRMA 1WUYA 3TSAA 3ZCTA 1P4HA 3H4IA 1QM5A 3G2NA 2X0EA 1NZFA 1PNVA 2PYDA 4Z5XA 4PQGA 4CTNA 2G9UA 2XGSA 2WTXA 4RBNA 1F0KA 2ATIA 1NOIA 2QN3A 1C8KA 5HXAA 1P2GA 3HBJA 4GZ5A 1AHPA 3S0JA 2OFFA 3OTIA 2X6RA 4L22A 3VDNB 2IUYA 2XGOA 3S27A 3UYLA 3ZCUA 2XA2A 2XCUA 3BCRA 3BCUA 3WAGA 2IEGA 4HLNA 4MHSA 4CDRA 3MRTA 3BEOA 4AN4A 1L6IA 4GZ6A 3T3GA 1O6CA 2SKEA 3CEMA 3L79A 4RIGA 2H1HA 3AMVA 3T5TA 1RZVA 2F3SA 3MRVA 3O3CA 2AZDA 3CV3A 2C4MA 3HBFA 5ENZA 1P2DA 1JEJA 1SXQA 2BISA 2R60A 3BCSA 4M7PA 2FFRA 2XGMA 3CUVA 2ACVA 4CTMA 8GPBA 1M5RA 1FA9A 1JIUA 2JLBA 4N9WA 4RENA 3BD6A 2G9QA 4HWGA 4X7RA 3RSCA 3OY2A 4X7MA 3NPAA 3DD1A 4MRAA 3NB0A 3GPBA 3MT7A 9GPBA 5TVGA 1XL1A 5DXFA 1ABBA 1KTIA 3C4QA 1FU8A 2YJNA 4F9FA 2QRPA 2O6LA 3CUWA 4BQEA 1FTWA 3ZCPA 1FTYA 1GPAA 3EBOA 4YI5A 2G9RA 1P29A 1RRVA 1E1YA 3E3OA 3CEJA 2GPBA 1WW3A 3MS7A 1Y6GA 2AV6A 2HY7A 4RIEA 4YI3A 2PRIA 4EL5A 4N3CA 2BGTA 4KQ1A 5GPBA 2X0FA 3OT5A 4AY6A 4WADA 1K06A 1VGVA 3L7BA 4X7PA 3CEHA 3OKCA 4W6QA 3S28A 4BQFA 1K08A 2IEIA 3ZCRA 2ACWA 2F3QA 1FU4A 3TAXA 3MS4A 2R68A 3RT1A 2JZCA 1RZUA 2QLNA 1BX3A 3UYKA 5I45A 3CUUA 2XMPA 2ECPA 3NCHA 4EL0A 2VSYA 3COPA 2VG8A 2Q6VA 3VUEA 4EKYA 3NP7A 3CX4A 1XL0A 2R4UA 2QLMA 4MI9A 2F9FA 4EKEA 4XI9A 1AXRA 4MICA 2IW1A 7GPBA 1P4GA 1GG8A 1SXPA 2GEKA 1GZ5A 3MRXA 4WHMA 4X6LA 2C1ZA 3NP9A 1YGPA 3G2IA 1A8IA 2R4TA 3D1JA 1GPBA 3VDMA 3PE4A 1P4JA 2IV3A 1H5UA 3BDAA 4WACA 3RSZA 4MI3A 5TMDA 2VCHA 3QHPA 1XOIA 1GPYA 2AMVA 4KQ2A 3D0QA 3OY7A 3Q3IA 3MS2A 4G2TA 4EJ2A 1PN3A 1FS4A 1NVKA 3OTGA 4M60A 3NC4A 1Z62A 2X0DA 5C1DA 3Q3HA 2XA9A 4YUAA 3C4VA 4N3BA 3L01A 3ZCSA 1PYGA 2QRGA 2XCIA 4M83A 3DDSA 5JTTA 2X6QA 1FTQA 4FKZA 1XV5A 4CTOA 2GM9A 2QRHA 3EBPA 1WV0A 1F6DA 4AY5A 1UQUA 1Z8DA 2SKCA 2GT1A 3NAZA 3L7DA 1GGNA 2GPNA 3SYRA 1FU7A 2QN9A 2IV7A 2QN1A 4RIHA 3IAAA 3L7AA 2H1FA 3S2UA 4F97A 1WV1A 2C1XA 6GPBA 2VSNA 4NC9A 3ZCQA 4BQIA 5DU2A 1LWOA 1L5WA 3G2JA 2VCEA 3T7DA 2XA1A 2QN8A 3VUFA 4F96A 3D0RA 3GUHA 3ZCVA 3OKPA 1WUTA 3CUYA 4REMA 1UQTA 1LWNA 3MT8A 3T3DA 1L7XA 3BD7A 1B4DA 3G2LA 2P6PA 1JG6A 3IA7A 1IXYA 1QKJA 3TOVA 2QNBA 3G2KA 4AMGA 3L7CA 2GJ4A 4MHOA 4GPBA 3MQFA 4N3AA 1P2BA 3Q3EA 4KQMA 3WC4A 3G2HA 2IYFA 3T3EA 5TMBA 5D00A 1XKXA 1C50A 2GPAA 2C9ZA 1Z6PA 3OTHA 4LDPA 3DDWA 3HBNA 4RIFA 3MT9A 4N39A 1UZUA 2QN2A 3S29A 1XC7A 2QZSA 2ASVA 1WW2A 4AMBA 3HBMA 3MTAA 3DZCA 2GEJA 2QN7A 1L5VA 2BGUA 2PYIA 1EM6A 4NEQA 4BFCA 2PRJA 4RELA 2SKDA 1NZDA 1NOJA 1Z6QA 5D01A 1E4OA 1NOKA 1V4VA 2QLLA 1EXVA 5JTUA 3T3HA 1L5QA 2IYAA 1L5SA 1NLMA 5DLDA 4GYWA 3WADA 3E3NA 4GZ3A 1HLFA 3MTDA 1L5RA 2R66A 3C48A 1Y8ZA 3MBOA 4LEIA 5IKPA 2AW3A 2QRQA 3CUTA 1FC0A 1Y6FA 1C3JA 1JG7A 4GYYA 4XIFA 1YA6A 3RHZA 2BFWA 3OKAA 3BD8A 4MI6A 3QKWA 3FROA 1GFZA 3PE3A 1JIXA 2ZB2A 1JIVA 1J39A 2FETA 5TMEA 3T3IA 3E3LA 2F3UA 2G9VA 5IKOA 3H4TA
chains in the Genus database with same CATH superfamily
1Z28A 4C0KA 4EENA 4HFRA 3KWLA 4I8DA 4KE8A 2QTRA 2H9YA 3SZLA 4QUHA 4JYZA 5F35A 2B8JA 4JI1B 2V1XA 5H70A 3AIMA 1MMFB 3AYZB 3OQIB 2Z3ZA 5FNVA 5IK2A 2FLWA 1EGQA 3D02A 1CERA 5AH0A 2ZDQA 3ADDA 3K73O 4TYQA 4JK3A 2WB2A 3IODA 1C1YA 2XXBA 3WWCA 1APBA 3U4QA 1ZVVA 4CM4B 2Y1WA 4TLCA 3SK0A 1C9EA 3A4VA 2PS0A 1RWOA 5LP6B 2XBMA 1O0BA 2C4HA 2O5CA 2EFEB 4ZARA 2RBKA 4N5DA 3MNFA 2PU5A 1JHYA 3ONWA 3FBGA 4RK4A 5HIMA 3EVGA 1NVVQ 2R8ZA 3JALA 3FWHA 3MWLA 3WQQA 1M72A 2H2DA 1MW8X 2BSAA 2C58A 5KOHA 5LA6A 1Y82A 3ZNOA 3X44A 2CYAA 3AHFA 3IUMA 5EVJA 3TL3A 1VRVA 4LK2A 2I3GA 4NBWA 3EDOA 3DDOA 3WR5A 4I9UA 4X93A 1CUWA 1F0KA 1YBFA 3ZPXA 2IS4A 1GLVA 3NANA 4QUGA 2QP4A 1YDGA 3EDYA 3GOQA 3KYIB 2WV9A 2VYVD 3TRHA 5DVZA 5AM0A 3GXOA 1QK4A 4P4TA 1YQXA 4AQDA 5KWEA 5JISA 5ILOA 4NLLA 3MJDA 1EHIA 5IBPA 1TFUA 2D74A 2P9QA 5K3CA 4AMUA 3DGFC 3EQZA 4MV3A 2BGGA 5AW7A 2WWIA 3BMXA 2TMKA 3A0UA 2FQQA 2WF7A 1T5DX 2VUIB 4MUNA 5DBIA 3BMNB 1FDSA 1DQPA 1WXXA 2PSHA 3MM4A 4INZA 3VR2D 4EO9A 3JARA 2X9LA 4ES6A 4XYBA 4D6XA 2REQA 5CEJA 1RJFA 2WM9B 2I4LA 5DHTA 2ISQA 2Q3CA 2X5JO 3EQ8A 4N5MA 1ZMRA 5GZ3A 3WNZA 2BJWA 4DBLC 2P1ZA 3W3AA 4V2IA 4DIKA 3Q85A 2K5UA 4C20A 1LRLA 2FZCA 3F1KA 4F5DA 4DKJA 4LV8B 5EEGA 5JVDA 5IYZF 5BSWA 1FNNA 3EXAA 1AQ6A 2LP4Y 4YBZA 1II8A 1TEHA 3K1TA 5AKHA 5JDCA 1D6JA 2R5NA 4EG3A 3C0KA 3KB2A 1WB4A 3DV0A 4XIGS 4TYMA 2EKQA 3VXKA 2BM0A 2FFHA 1KXZA 4XE5A 4UZFA 3FFAA 3OJCA 2ZG6A 4LXTA 3G1TA 3R6DA 4QAJA 4ABYA 2BISA 1JXMA 1DAPA 1POWA 1T6NA 1ZQ1A 2PLFA 1Z5PA 3I9V1 4XGQA 1XAIA 4X7BA 3SMQA 4YXFA 1H2EA 2QN6A 3IAS1 5DWDA 2WKPA 2TMGA 3L6OO 4HQOA 2HB6A 3ENZA 4H7PA 3OCVA 2JIZD 2R0QC 8GPBA 4G86A 4KXYA 4F4DA 4X9XA 3JASB 3UCFA 2NZVG 3LAWA 5JO9A 4D25A 1EBUA 1X80A 3K1JA 3QA9A 4L27A 4R2WA 4JJEA 3RUAA 1Z22A 1W5SA 1U28A 5CX1A 1E7MA 1T0BA 2G9QA 3KTOA 3K0FA 4ZZ2A 5ILGA 3EOZA 1H1LA 1W2HA 5F7ZA 2AMYA 4UMVA 5I9BA 5BVHA 1JLKA 3IAFA 5LXTA 5JNWA 4DDUA 3A6PC 4IDDA 3NYRA 4P31A 3U3KA 1ADGA 1E20A 1DVRA 1I13A 2FZEA 1UPTA 1W19A 4TUYF 5T6BA 4YJHB 3ZW9A 1A9TA 1P9LA 4I4CA 5K6RA 5T6MA 2QDKA 4TMYA 3OU7A 3OO0A 1XKLA 2GPTA 3NKLA 2G40A 1JJBA 4R7GA 4B3GA 2QR2A 4WK6A 1K2WA 1K75A 2QD2A 2QRPA 9ATCA 5I47A 1TO6A 2ZEJA 4JJKA 1OGYA 2B8EA 3M33A 2WWTA 4B82A 2YHSA 1YR1A 1CU1A 1VKJA 3D8NA 3QU2A 2DWOA 2HBRA 3KB8A 1CB0A 1SC6A 5JCJD 2XRMA 1RLUA 2MINA 4CKYA 2PMBA 5HIAA 3ND5A 2HXSA 2GJSA 3CEJA 4AO6A 1WR8A 1Z4IA 5LQKA 1L4EA 4R4JA 3FLAA 2HGSA 4GMGA 1QLHA 4FFBA 1VI2A 2W2MA 3EXG1 3FMGA 5AP9A 4EARA 2AV6A 4DRXA 1ZH2A 4CMIA 4IXDA 5ESXA 4U5QA 4YRBA 1CJVC 3D4OA 3LVQE 4JQCA 1J24A 3A6KA 3NRCA 3W5DA 1EWQA 2CK3A 4F5EA 3SFZA 1CUFA 1OWNA 3TEJA 4ZI7F 1TIKA 3FUWA 1BH6A 1QXSA 1SHUX 2PV7A 1PQPA 3A2LA 4IHKA 4KZKA 5C4MA 5I7HA 2PTGA 1EPUA 5K6AC 4I1PA 4R2MA 2ZLBA 4B3HA 3DDCA 1REQA 5FUXA 1LRKA 1IONA 5IDWA 2W6OA 1WY5A 2E4AA 3KOYA 5AJZA 1F17A 2C20A 1D2RA 1OLXA 1OD6A 3IPAA 3GT7A 4U39A 4G5FA 5EPUA 5AYVA 2NUAB 4PHCA 1KBQA 4DV4B 1YRHA 2OG1A 1LY1A 1Y8CA 1TRHA 3K1YA 3SYKA 3IOCA 2BJHA 2HJSA 5DSTA 2V98A 4FCVA 2HF7A 4D43A 1M1XB 4ZXPA 1X2BA 3OE4A 4OU4A 4KQXA 1DUSA 3TAXA 4RL4A 1Y7HA 4XVHA 3IQZA 4Q4DA 1HT0A 2JZCA 4JP3A 4ZI3A 1F7VA 3H1AA 4N18A 1CS4C 5DX0A 1UFQA 5DSXA 4B35A 2XVMA 4EPWA 2PMEA 4Q1DA 4AJKA 4YRLA 3K8OE 4QL3A 4DE5A 2GHQA 1VBNA 2PJZA 5KWVA 2HQRA 4N76A 2ONKA 2XMCA 4MV5A 1P5HA 3TGLA 3BICA 3ZWVA 3W77A 3GUYA 4YV2A 1C3OA 1YVEI 2KX7A 3WTBA 4WGFA 1E3QA 3ISTA 3RM3A 2C5GA 3SIXA 3TNYA 4CM5A 2B0JA 4TKLA 3W3ZB 1FSSA 1D04A 1M75A 2FMHA 5ALJA 5BSFA 4D8XA 1NMEA 4I50F 4R6XA 3UT5B 1IUOA 1GZ5A 4P82A 3T34A 5L3SB 1QYDA 5CM2Z 3G8YA 3PEUA 3URKA 1AKWA 4KO1S 4UBJA 3B6KA 3ZQKA 2CNOA 2ENWA 2EBUA 2WIGA 2XE8A 3O3NB 3PXEA 4JP8A 4PTLA 4MW7A 3WDMA 3IPRA 3DTVB 1LUAA 3PC8C 3ZD8A 2A94A 1F9AA 1A2OA 1N5OX 2C9OA 5DI9A 1SA0A 3V8MA 3ETHA 1WDWB 2ZT8A 5KMGB 3KUKA 2GARA 1G6HA 2I91A 2RSLA 5A04A 1DO8A 3BDAA 3IAHA 4DLSA 3BWVA 4F71A 1GNPA 5JBQA 1J8DA 1EWVA 3I0ZA 5KC8A 1O94A 2ZYUX 2VWPA 2A14A 4FCTA 4R01A 1Q0PA 2BH9A 4XUDA 4I6GA 2O0JA 3X0DA 2N3ZA 2B35A 5BQOA 4RKRA 1BYUA 4AIIA 1XN1A 5CW1A 4YCSA 3J80A 2XTJA 1MEEA 3L5KA 1YS7A 5KTOA 3QKRA 3B5EA 1PJCA 5A7GA 1EAMA 2XB8A 4B85A 4DQVA 3HV2A 4JJIA 1Z62A 2IX9A 4I8IA 4R1TA 2C96A 1NI5A 3TBFA 4KBFA 1HTBA 1MORA 3D6NB 4ND8A 1G8HA 4KLNA 3FY4A 2DBRA 3DG9A 3PEFA 2HTFA 3KOZA 4CIVA 4UTNA 4MV8A 3EF0A 3GQBB 1U9IC 2PWAA 3KZNA 4CMBA 1QJ4A 2H2FA 4N3BA 3PFKA 2AFHE 2F1JA 1NXWA 1ZR4A 1FSPA 1YIDA 4H3HB 2I67A 3CYFA 4R05A 1E58A 4ZOLB 1O9HA 4RMIA 3WYGA 1A77A 1P31A 5SYNA 3WGLA 1EK0A 2Z30A 1GSHA 1YL7A 3F73A 1QDLB 1LEHA 4JT8A 5KYTA 1HNWB 1T5LA 3U19A 1G7SA 1FUYB 1LC3A 1KZ6A 4ZT2A 3D6FA 1VMAA 2MJLA 1FS5A 5JCXA 3CO5A 1PDWA 2SKCA 2HBZA 3AV0B 4F7DA 3IEVA 4Y9DA 5LMZA 2QMYA 4ER7A 1NVBA 1Q3HA 1C14A 1WPRA 2R3SA 3MOSA 2JGKA 2OKCA 2AMJA 1RVDA 4H35A 3RFUA 5ADWA 5JNLA 3ZG6A 4X1OA 3LGXA 2WKSA 3EMKA 1D4ZA 4PQFA 3KJGA 1DRJA 1C7QA 1XYYA 4KWEA 4EY3A 1CF9A 1J4AA 1IZ0A 1T0IA 4IH4A 4W1SA 5EHIA 5FWXA 5D86A 2M6SA 2JS7A 3AWIA 3S99A 3C1OA 4IFEA 4M9CA 5K3BA 4JI7B 5TJHA 3PUWA 3DNFA 3EDCA 1ZSYA 2P90A 3R2JA 3MIZA 4MO2A 1CZHA 3AP2A 4IIJB 1KZ7B 2QQFA 1R0RE 1LWOA 3D7MA 1E4VA 1CP2A 1RM0A 2DT8A 4LPKA 3GDWA 2QAGA 5F3DA 4JBNA 2AN9A 3ZIAA 5IXJA 3RLFA 4LF9B 2XA1A 4O4LF 3INTA 2YWHA 3LCMA 1X77A 2H0AA 1IFXA 3VUFA 1A1VA 1OV6A 3NX4A 3B8HA 3KOXA 1FYEA 4LJYA 1Q3TA 1W85A 2QYOA 4OXIA 5CH8A 4ZRMA 3EFOA 1PZHA 1MVNA 2CJXA 2ZRBA 4BKUA 2OCKA 3DLPX 5CB8A 1DTEA 4K40A 2JFZA 1TZCA 3DC7A 2JCXA 2JFXA 1E3WA 4R3NA 3CS3A 3S1AA 4PC6A 4ZDKA 1QU2A 2DFVA 3USES 1V37A 1E92A 5C9ZA 3N0XA 3K70D 2IVFA 4I1RA 2F17A 4D3SA 1WWKA 3QVVA 1V8OA 4M0EA 4NSNA 1EFPA 3RIYA 1DAGA 3FW1A 1GU1A 1V1MA 2GAOA 2Q2NA 3IOMA 4JQOA 4L51A 3DVLA 1GQYA 2WAMA 4EBFA 1ULUA 2YXEA 2W6ID 3GA5A 4Z4HA 1LSUA 4AMGA 1C0KA 4UU0A 5D87A 2FW8A 1Q1NA 2Q07A 4JXJA 4N41A 4POOA 3GI1A 1U7ZA 2IOFA 5HUJA 5JH7B 1VJDA 1WW8A 5FFFA 2PR7A 3GGDA 4G4SO 5IVHA 1TJ4A 4PS0A 3VU9A 3Q3EA 3WK8A 2W42A 1RSZA 3NHKA 2H17A 3A32A 1WULS 3UICA 4OH7A 5M04A 4NS1A 2BR5A 2G0TA 5AK5A 1O95D 4IG9A 2Y1GA 2BMEA 2OSBA 5D00A 3BUSA 4LE0A 1C50A 1QP4A 1S2DA 2LE0A 1HNNA 4P6VF 1MC1A 2YIDA 3PITA 4U7PB 1N7JA 3DULA 4C7VA 5E6SB 4HS9A 2J3KA 4N39A 5HS4A 5BQ3A 1Z6GA 2ID7A 3F1LA 2VHEA 3DHWC 1JEQB 5GV7A 2ASVA 5TT0A 4EKDA 3ZIUA 4P54A 1Z26A 4V38A 3O2SB 4ZJUA 2O8CB 4EW6A 4I8XA 4M6WA 5JJ5A 1H4QA 3URMA 3Q11A 5KX5B 1FX0B 2XRYA 4Q93A 1YR2A 1US8A 2J7KA 4NWIA 1A5ZA 3K4HA 4FNAA 3EH1A 3DO5A 1XXLA 2RHOA 3GELA 3HQ4O 4MUMA 4AW9A 2IH4A 3HB9A 4X44A 2BFMA 1DJLA 1OUMA 4NF2A 4U7HA 1ZD4A 2SKDA 4V0OA 5AM1A 4LN1A 2IUUA 3V3KA 4E7PA 2W6PA 4G6ZA 3H9CA 1XEAA 3NGXA 1E1CA 4TMVA 4BFSA 2P4UA 3LT2A 3G0HA 1TMOA 2BF7A 3LS2A 1W5FA 4INAA 1UK7A 4WW0A 2GRUA 1M8KA 1OOEA 5EE1A 3ZWPA 3HKCB 3OC0A 4NBUA 2DPMA 4CJXA 4GYWA 1KNXA 4GM0A 2NO1A 3Q2IA 3T5BA 4H0CA 3RSOA 4RZ2A 3ZBUA 4ZCRA 4PC1A 1NQVA 5AVUA 2BEJA 5H80A 1HI9A 4FMPA 2V7BA 4W5NA 1PWYE 3VPGA 3WK4A 4ZGGA 2R6DA 3WQSB 1DS6A 1J9EA 1TF7A 3WNDA 3TTTA 3DBVO 1YZ3A 3PC2A 3TUJC 2G8NA 4LNAA 1YQGA 4BLVA 1GFIA 1IBMB 3ZE9A 5LOVB 2X5NA 3JR3A 2RH9B 2AFIE 4KDEA 3SQNA 2E18A 5JD6A 4ICIA 3RT7A 2EERA 4OQFA 3OQPA 1UBTS 1NVXQ 2QRQA 5AVKA 4KACA 5ALTA 1UFVA 3G9UA 3H11A 3ZY2A 2IXGA 4FLMA 4IAOA 4MVJH 1A8HA 4TWAA 2AI1A 1BG6A 3CMCO 4CQLA 2XT9A 4EY6A 4F4UA 4OX9B 2XNKA 1ZXBA 2PJDA 3UWDA 1ZNQO 2AZMA 3GLIA 4AY2A 4UHEA 4NZ9A 4EATA 1KRWA 1XROA 2GN2A 2OTCA 3FI0A 4F04A 5FXMA 2E87A 3EGDA 1Q20A 3LY7A 4P58A 2WJPA 4EAQA 5TY0A 3DBHA 4OUDA 1MB0A 4BNJA 1N2EA 2EVWX 1BDJA 3JQBA 4S1VA 4QUEA 5IM5A 4Z3OA 3ZHVA 4CIAA 3T61A 1GPJA 3KAQA 1HG0A 1T1RA 2I54A 4FQ5A 1P3JA 4UBOA 3QWIA 3S2IA 4IGFA 1J09A 5DRYA 5DBEX 1C8LA 2C9BA 1JLLA 1I1HA 5DN9A 4Z0HO 2JLWA 1KAQA 3RVRA 1RWNA 2O7NA 5IEJA 2FWAA 4IJMA 4XGIA 1HDCA 3H6KA 1JDVA 5BWOA 4H59A 5KJ6A 3NHLA 1OPRA 1SD2A 3VR3D 3VX4A 3K9HA 4PO3X 3OZVA 4BVJA 1W75A 3U3XA 1E59A 3CY6A 3WWZA 4W5TA 1CF2O 1OI2A 1F5SA 5KNLA 4HXFB 4KI0A 3KQLA 4IOLA 1O03A 4H4DA 2E55A 2GTHA 3QWAA 3EXIB 1IL0A 4YBRA 3ZCTA 3CF0A 5CT9A 4D99A 4C6TB 2RH5A 4OU5A 5A6SA 4N82A 2G4VA 4WN3A 3H5WA 1IQPA 1J56A 1SULA 1WSWA 2YYZA 4KYTA 4BMCA 6LDHA 2IIPA 2QXYA 1N7IA 2H1RA 5KVQA 5LU8A 3PNOA 1R50A 4JLNA 3BWEA 4TLAA 4LZLA 3F6YA 1DJOA 4OK3A 3ZR4B 5BUZA 1VHQA 3GARA 1SUSA 1YONA 3K9NA 4HKTA 5DNAA 2RKBA 3KQKA 4H08A 3RV3A 1F7UA 3H1PA 4E33A 4Y6SA 1K6JA 4F38A 4NE2A 1LTQA 2OFFA 1DBRA 4B4VA 1YZKA 2NSJA 3GLHB 1K6EA 4GU5A 1N6HA 2VRBA 2PZMA 3D6JA 1YQEA 5C18A 5BR8B 2ACKA 3IR6A 4J0GA 3S27A 4K87A 4YAOA 3RIEA 2HJHA 2JHPA 2AG8A 4LPSA 3TLMA 1TA4A 1B8PA 3G3EA 3OQNA 5DYYA 3WAGA 2BLLA 1FBTA 2RB4A 3C98A 3NATA 2XUFA 2CZGA 1RAIA 3OI7A 3OQ1A 4R9SA 3QBVA 3WIDA 1A82A 1HF3A 5JCOA 4JB0A 4OKIA 2YWDA 3TKAA 2IHBA 3PHJA 3BK2A 4MHSA 1O58A 2W70A 5TV2A 4V1CI 1L4LA 3DVRX 4R8RA 3TRFA 3IKTA 4ALMA 4DEVA 5BNIA 2DHRA 2YZKA 1ZNWA 4AP5A 1RPAA 3TJZA 2R87A 3P8ZA 2YJ6A 4DLPA 1J1ZA 4FT2A 2XWPA 1VLHA 3ZY3A 1CBUA 3KJFA 2H9IA 4N54A 1JVBA 3G13A 4ASUD 4UEOA 4G5SA 3HJHA 3OEEA 3A3PA 3KSAC 1EVLA 4PGMA 2Y2UA 3RYHB 4RIGA 2Q3EA 1U7XA 5H9VA 4Z4GA 4X6XA 4PX5A 2AJ8A 1UEIA 3RBVA 4F5ZA 1E8DA 4QTZA 2WY2D 4C0QC 4MDHA 2XECA 1RZVA 3HXTA 2HQOA 3FRHA 4D7AA 1NRWA 5A9RA 3U6KA 4KV9A 3JSAA 4HDRA 4J4BA 4U2EA 3L84A 4PVCA 4G1EB 4RMHA 1R15A 2Z1MA 3H7AA 3KB6A 5EXEA 4C04A 1I51A 2FXIA 3BFPA 4TTTS 2W90A 4DJTA 4QNMA 3GFVA 5ECYA 1E9AA 3SDBA 2R2AA 1URPA 2GZ2A 2EKZA 5YASA 4MS1B 2CL7X 1LSOA 3QF4A 1YCGA 2VJDA 3LW8A 1IEQA 3Q2KA 1IWOA 4HYQA 4IILA 3NMUF 4R0VA 2JGNA 5TPZD 4A9AA 2B25A 1W4LA 1XVUA 3P4UA 3GYGA 1RQPA 2VEDA 2NTYC 1UR5A 2ZBPA 4PC3A 1Q17A 3H2BA 4C2BA 2WOJA 1G5RA 4DRYA 3L9XA 1E94E 1NM5C 4JL8A 1SXHA 1VBFA 2AYZA 2OO5C 3OF2A 4M54A 1QCDA 3RRMA 4CLOB 4M9RA 3H84A 1G63A 3Q7EA 4UBIA 5FIUA 4H77A 2E0IA 1JQEA 2HH9A 2OVFA 5FUWA 4CFZA 5KJ1A 3GROA 5ESRA 3HV0A 2DQKA 1A9SA 2QDXA 3T1TA 2I87A 2IYNA 3Q0TA 2W6JA 4WLOA 1JF8A 4R1SA 5FV4A 1A1SA 1NASA 1NMQA 2P5UA 5AXBA 4DY4A 5B1IA 1XXHE 1V43A 3A36A 4X85A 3U39A 1OFVA 3FHOA 2WJJA 5DGXA 5LWHA 2AEMA 5EZYB 4BCDA 4V3BA 4D44A 4JDPA 1NGSA 1VA4A 1GQRA 2YJNA 4WOJA 4HD8A 5GP1A 5JZVA 3FYSA 3LQQA 3EFBA 4IJQA 3LDHA 3PD1A 3QELB 4CL2A 5I7EA 5IVDA 3T1OA 1MABA 2DJIA 1Q91A 3KLNA 4Q4JB 1HRDA 4BNMA 2GD0A 3UNXA 5J9FA 2KW5A 2XYHA 3QPWA 4I66A 1ZCJA 3ROPA 2NQ8A 3AFIA 2ZBEA 2NU9A 3RF6A 4KLZA 3PGXA 1MO5A 2G9RA 5E9JA 1UWCA 3ENQA 3QY0A 1BHO1 1Z6YA 2KQUA 2VAMA 4IOKA 1CEXA 4RA6B 3KEFA 4TVOA 4PIMA 3GCZA 2Z4TA 3PPWA 4P83A 3JQGA 3O7WA 2Q0QA 3DYBA 4AUEA 5A9SA 3CONA 1E4YA 4IIYA 2PUAA 1UXOA 4HLCA 5I7FA 4ARAA 4GX2A 3LT1A 4L0MA 1NKTA 2R44A 3RG2A 5EGSA 5EMJA 2V3VA 2I6XA 2AFHB 3B52X 4OLBA 4UUNA 1H6AA 4ILEA 1QPGA 4FMBB 4D8YA 4EUFA 1LV7A 2CZQA 2YDYA 4R3WA 1SHJA 2P5YA 1C9MA 1VGVA 4OHCA 4RZSA 5DTQA 1PO7A 3F98A 3UJPA 1XVLA 2OCYC 3EQ6A 3IIMA 4ROTA 5FQOA 4ZVPA 1V11A 2OD7A 1PP4A 2QY6A 3OTWA 1Y37A 5AVWA 1RXEA 3TDNA 2VR1A 1U1DA 1XAJA 2EW2A 2Y6UA 4ND3A 2TYSB 1NJ1A 4LMRA 2HYDA 2CLCX 1ESMA 1DLIA 1P45A 1RAHA 1Z5ZA 2BCGY 3QVSA 4D96A 4S05A 4RQUA 4OGWA 5HE9A 4RPCA 3M6MD 4FUQA 5EWLB 3F3MA 1RRGA 3GJQA 4GWGA 2JGJA 2JIMA 2IZ5A 3B1YA 5DI3B 5E7IA 4X64B 3UMGA 5CA0F 2NIPA 1AE1A 5FHRA 5LQMA 1C41A 1V8DA 1UKEA 3HKBA 2OO7A 3LHSA 1CY6A 1Z35A 1OPXA 2EZ9A 2ZCVA 3P0RA 3U1BA 1L5KA 3K31A 3LXUX 5IKMA 2OV6A 4MVYA 1FPMA 1KY2A 5EUCA 4HK4A 4NICA 2CXHA 4OSPA 1QRDA 2HI0A 5KYNA 5DEOA 1Q15A 4AY3A 1YHNA 2QZ4A 3LA6A 1J7KA 2AJDA 4UE2A 2F9FA 4XI9A 4HB2A 3W7BA 5AUPB 1V35A 5B1YA 4TLBA 4Q7EA 5D3MA 1QVZA 3WX0A 3JQRA 4NK4A 4TX1A 3RYFB 1TW2A 3HP7A 5FOSA 4NZPA 4XUEA 1RJDA 1GOTA 2A3NA 2X1HA 5ALQA 4PPQA 4ENVA 2NGRA 3PKIA 2QTLA 1GNTA 3T9BA 3W2HA 3GGJA 1E1KA 1BA2A 2GEKA 3PUHA 2DECA 1WUHS 3FX2A 4ZVVA 1GSIA 3N8HA 3EGEA 4KQWA 1RPTA 3VPAA 3SF8B 4IF4A 2JIBA 1O0SA 2QV0A 3CT6A 4ACAA 4BO9A 1JR2A 2UZIR 2ZI5A 4FZVA 1FYVA 4DXHA 3MHTA 4TXMA 1V4BA 3G1UA 4MVXA 4UD2A 3ZVRA 4BIMA 4LXGA 3ZJVA 3QFSA 4W5HA 3U6BA 1HDOA 3FUCA 2COEA 2X77A 4KPGA 3WZLA 2I62A 5CRIA 4C5AA 4DR5B 2C54A 3LQ4A 4I46A 4OIFA 8OHMA 5CFOA 3Q8KA 4XPZA 4A0RA 3ICPA 1W4CA 4MI3A 5FOVA 1Q1QA 3O83A 3IRUA 3EGXA 3LUGA 3DC2A 3PRKE 4K6MA 4A2QA 2X5KO 4M0PA 1H5QA 1YR9A 3D0QA 5KTSA 2I5PO 3M9XA 4KI7A 2VK1A 4Q9IA 2HJRA 4LI3X 4PPYA 4ZI5A 1ODKA 1NYTA 2JBWA 2Z57A 3CURA 3D4PA 2CUNA 3DOJA 4R1UA 3ROQA 3V8VA 3GVHA 4AYXA 4DTCA 2TSYB 3TEFA 4F7WA 3KV1A 2JLZA 1AV7A 3WGVA 3AVQA 3I6YA 3QENA 1X7XA 4N65A 4CLRB 4CHTA 2HQBA 3CH6A 1KY4A 2E4VA 2CUTA 3M6FA 4GQBA 2B4KA 5FAXA 1EU1A 1E2UA 1SXJE 1O6FA 1J2UA 1SEPA 4FGLA 1J9ZA 2BE9A 3Q8MA 4HEHA 3USCS 3JZFA 4PZ0A 4EELA 4TVBA 3L01A 5KWIA 3NHPA 1IHDA 1GN9A 4CCYA 1F4VA 4KU4A 4B71A 3LC2O 5M29A 1FOEB 2AEFA 4UDYX 3WWDA 4UHHA 2VSFA 3FKJA 3WAKA 1GTSA 1ECFA 4Z4QA 3T5MA 3GV0A 4LX0A 4NIMA 4B87A 3QVGA 3D3JA 1W5AA 3KHKA 3NDRA 2B83A 2OY0A 2WZBA 3EIFA 4NYMR 4NFSA 4PZPA 3HRHA 3VC3A 2M9MA 3LDUA 1KK1A 4WD3A 4BNTA 4HDNA 4ZHSA 3K9QO 2JRCA 1E4EB 1FRNA 1RRMA 3CRZA 3WV5A 3FGOA 2FQYA 3W6UA 1WSDA 5AW5A 4DIMA 1P62B 1YVPA 2VPIA 4PONA 1SVWA 5DX1A 1BYIA 1M1ZA 1G4HA 3KVNA 4QAQA 1T8YA 5CDTA 2D54A 4QGGA 2IQIA 2P11A 3CMMA 1DPGA 4AG3A 3ZCUA 1D09A 1V6AA 3K09A 4ZGBA 2I6GA 1YU6A 1OTHA 2XCLA 4OSOA 3WIEA 1V9SA 4BVGA 5IJWA 1WV1A 4LYJA 3WLFA 2QA5A 3A3OA 2QSJA 2QPOA 1RMYA 1G6Q1 3IGFA 3WB0A 2PA0A 2PZ8A 3RS7A 1I2BA 1XRLA 3A11A 3WDKA 3U7GA 1MAHA 4QJ4A 1L1EA 4BX8A 3C3EA 1XO1A 1GVNB 4OAPA 4I1OA 2F1HA 3SPXA 2VCEA 1BGVA 1IEXA 4DQKA 1FDOA 2I3ZA 3DYIA 3P45A 3V4SA 1LW6E 4Q4CA 3N53A 1ZU4A 3LOUA 3DT8A 4HAWA 4QG3A 3R3SA 1ZD1A 4PCLA 3JD4A 2B61A 3OKPA 4RXTA 5EQTA 1K89A 3C85A 4F2GA 1LWNA 2JG3A 3AZOA 1XRNA 3CW9A 4XEUA 1NMYA 2VDKB 1P74A 4UFNA 3O6VA 1V5EA 4GOKA 4AJPA 3IAUA 4K6HA 1TPZA 1PT6A 3NHRA 5F7OA 1Z2EA 2G25A 3X1MA 1T36B 4DT1B 4IS2A 5K0TA 3O8CA 1L7XA 1AV6A 1AQYA 3BD7A 1S2LA 1FRVA 1TRKA 2CXSA 2X5XA 4BNHA 5A3JA 3E48A 4H0FA 3VHXB 1O3YA 2H59A 4HDCA 4HNVA 4HNAA 1RQLA 1VG9B 4Q34A 1FPQA 2VHXA 2OMEA 4MRMB 3TNDA 3WKBA 3OZCA 3DB2A 2LNDA 1PVVA 4F3KA 4EFMA 2W48A 4IX1A 4P3PA 2AA3A 2G04A 3KSUA 3R3WA 4RD3A 4HMOA 2I78A 3HXOA 3CEPB 3LU1A 4U3JA 1W4AA 2ZBGA 1HYQA 5EHGA 3LY5A 4NH4A 1QHXA 5F2OA 4TQAA 2NTVA 3PQEA 1QOZA 1AS3A 2HPZA 2NXCA 3JAKA 1K86A 4J1TC 5KNCD 4RZIA 5KI6A 3O8DA 4HVLA 4UTRA 3B1XA 3NHMA 3UUFA 4OGFA 1JLMA 2H8KA 4OHFA 5K8UA 3AR9A 2VXYA 2L17A 1OFIA 3ADCA 2EFDB 4Q24A 3X1ZA 1RJ9A 2YICA 3VNAA 2WI8A 4PNHA 2F43A 1NP3A 4MA0A 3BORA 4E2WA 4EF5A 1RYDA 2HJVA 5FOUA 3OU2A 3WGIA 2H63A 2XKKA 4GXRA 3M5PA 3PG5A 5I9SA 4DG9A 5AW8A 2L42A 4KIUA 4MKIA 4RAOA 1QH9A 1KYXA 2WYUA 2BBSA 3D8RA 1U5BA 1R0YA 4JLSA 3V8QA 5A7HA 1WF3A 2ZE7A 4P80A 1TEZA 4NENB 1AKTA 1J42A 2YZMA 2JGDB 1AGXA 3BXFA 4WNYA 5FUBA 4LS3A 3VOTA 5JQGA 3A2KA 2V7PA 1PQWA 4R8KA 5EPOA 4XA8A 1RLOA 4ZZIA 1SCKA 4Y67A 1ZRSA 4J75A 2W6CX 2AJBA 1MPXA 2P78A 2QX7A 4BY9E 1TAUA 1RE1A 2NV0A 1NZJA 1CRWG 1EI9A 3KKMA 3KXDA 4JYCA 2QLLA 5KYKA 1TKRA 2GXAA 2UV8A 1ISHA 2P62A 3LSTA 4ERXA 3OQ6A 2C5AA 3GD5A 2YUIA 4TROA 3DVAA 4KK4A 4XQEA 1Y8RB 4LF5B 3MFQA 4U7DA 4Q01A 3THSA 4IDCA 4DR3B 3FB1A 3LXRA 3R8FA 2H1IA 4IZIA 4J0QA 4W9NC 5IXYA 4EMSA 2C4UA 3K2IA 3FI9A 4K6GA 3QEKA 2H2GA 3KJXA 3K0SA 4R9VA 2HEIA 3DAGA 4EYGA 3UMMA 4FHFA 4EP1A 4B45A 3WLEA 1W36C 1VRWA 5H5JA 2NM0A 3LYAA 3U3MA 2P5TB 4EF4A 5KUTA 5J2UB 4RVCA 3AFNA 1JXOA 3UV6A 4GYYA 3N75A 4LZPA 5DT2A 2FMKA 3C24A 4RVDA 5FB3A 3CZMA 4TYPA 5TE9A 5JEDA 4MVJI 3DUFA 5ELLA 2ZJ5A 4RF2A 1DG1G 1BC5A 1ZOSA 1SOVA 2NO6A 3C8UA 3HDTA 1Z0JA 3MZ0A 4WXHA 4B0PA 1M6HA 3P2JA 2ZB2A 5TVKA 4TQGA 2PSEA 3ADOA 4NU8X 2X0KA 2Y1KA 1DEAA 2VIIA 1IG0A 3UM9A 1EHYA 1H65A 1VG0B 3GZTB 2CSUA 2GASA 4JHXA 4FW8A 2FQWA 2IPOA 3KKPA 3D3QA 3IEPA 3V4OA 1V47A 1G59A 4M88A 1JFLA 3FYDA 3VKGA 4NJMA 4C0JA 1U2PA 3RSQA 3RVJA 2A33A 2YN2A 1MT3A 1IUKA 4ZQIA 3IVRA 2PL5A 2POCA 1GKYA 2Q29A 1ENOA 1ZSNA 4FHGA 4RIIA 2D1FA 3NXKA 4ZQGA 3VC7A 2OBFA 3TLCA 1R6UA 3KOMA 1KERA 4R5HA 3WRXA 1E77A 3NALA 4ARUA 3ST7A 5KNBA 4FYHA 3CKLA 1SVSA 2W2NA 3W8RA 4FYKA 3I01A 2FPGA 3V7NA 1I2ZA 3QFTA 4FWIB 1V16B 4WA7A 5FJJA 3V2UA 3WLJA 5JPDA 2VN8A 4CYMA 5T4EA 5B5SA 3U4IA 3LKDA 2J4DA 1XQWA 2A6PA 4IIVA 5D6OA 4NJEB 5HJ5A 2QSUA 4J43A 3UPUA 1HTWA 1BXRB 3IT0A 3VO2A 1RWBA 3OCUA 5SZKB 2V6JA 4PQGA 1Y6QA 1IATA 1IOZA 2Z4RA 4RPHA 3K0BA 3CLRD 4X92A 2W8BB 3FLBA 4AMBA 4L1KA 4DGSA 5CT4A 5KJCA 1OYWA 3O1HB 4H3SA 2HO4A 3HBLA 4PPGA 4PYKA 3GCXA 3GFSA 2QX8A 3LQ2A 3A1TA 3ANLA 4C7OB 3NEJA 4OHRA 2O4UX 4G9GA 3V97A 1XQ1A 5JANA 3FAZA 1MBZA 2YY7A 4HBZA 3AEQB 4AN0A 1DIAA 3NRJA 4GOLD 5HF9A 3JPWA 4II7A 2X3FA 5CFQA 2VP4A 3SGLA 1M6NA 3DHEA 2EWMA 4GS5A 1XZQA 2DG2A 1T9BA 2GWRA 4HDAA 5LB2A 1CQWA 3LP6A 2O14A 1GPWB 3BL5A 3FR7A 3LT5A 2XA2A 2OV4A 3QKIA 3ZE0B 5IP5A 3DHNA 2J9ZB 4W5QA 1JAHA 4A6PA 4DLWA 2JNWA 1CUCA 5L4LA 2XQKA 5DOVA 5ER6A 4YRNA 4Z53A 2WMNB 1NG1A 1P72A 4P4LA 4RVFA 3LUJA 3BSYA 4UNQA 2N0SA 4QYTA 1J8FA 3EIXA 5JSQA 1XTRA 3MUNA 3NEAA 4M37A 3BM5A 3FZQA 2PFGA 2X8JB 4WQMA 5CNKA 3KL4A 3B82A 4G9EA 4M1MA 1E63A 5ALNA 3QEMA 2PKYX 2CWWA 1RYFA 4A15A 3VX3A 2FUEA 1IBRA 5DCYA 1V7CA 1AT1A 1KBOA 1JEAA 5JAUA 1D8TA 3DBRA 3MAGA 1Q77A 3CR8A 1FNMA 1ZN2A 5DM0A 4QXQA 4EEZA 4BQNA 1R12A 1B7GO 2YQ5A 4FDTA 1JIQA 1HDXA 1VIVA 2VSQA 2Z58A 3AEUB 2HSDA 4HDSA 1X8KA 3TWOA 1I0LA 1EG7A 4UVHA 5LVAA 4RGVA 1UANA 2QB5A 4XR9A 5HRUA 1NJ2A 4MIEA 2C7OA 1W0CA 3SJUA 3WNBA 4DJ5X 1CDDA 1GCOA 1XMSA 2IHKA 3GWZA 2BEVB 2V54A 2IEYA 1JEJA 2XVYA 5FI3A 3C74A 4MLPA 4URYR 2GGSA 5D5QA 4FD2A 5GOZA 5G2OA 3IQFA 1CR0A 4NE7A 3CT4A 2FFRA 2WDPA 1NW9B 3EG5A 1WP4A 2XNSA 3AVPA 3RRBA 5ED4A 1RFLA 4LBYA 5AVVA 4QRDA 3SQMA 1ZR2A 3LF1A 1A97A 3HO8A 2IKSA 4UCWA 1CVIA 3KPUA 4UU7A 2ACVA 4D1YA 2B5VA 4L8GA 4YMVA 2QVCA 1MX1A 1JDTA 5IC4A 1KQPA 2VPZA 3BOSA 3LYUA 4B83A 4DA9A 3REFA 1E2DA 4B3RB 1ZN9A 3RSHA 4CUKA 4RH0A 1F8GA 3QTLA 4GAEA 4X8HA 5FBVB 1XWFA 3OM0A 4KAXA 5KB3A 2C88A 4CM9D 4W7SA 1H2XA 5KNDD 5A3VA 3AHDA 3GLFA 4JLJA 2GILA 2IU4A 4DNFA 4Q6BA 4J91A 4WZAE 4X1YA 3I1JA 1N8TA 2X42A 3QVXA 3UGKA 3BGVA 4D56A 3DQZA 2Q3HA 1AKVA 4EI7A 3NDBB 3SSAA 3EWAA 1TUGA 4L2IB 3JU3A 4ZYXA 1I6MA 2WYIA 1M7GA 1ABBA 2J4FA 3UO8B 4WRRA 4E22A 2GCNA 1QC5B 1P1IA 2BEKA 4FI3C 4D9BA 5HDQA 2GCOB 4Z9AA 2NYAA 5A4DA 4ZCPA 4NQRA 1ZMBA 2ZJ6A 3RVQA 1UDBA 3HSSA 2J9FB 4QRIA 4D02A 4BQEA 1VI6A 1FTWA 1YB6A 5EZ6B 1Y7PA 1Z74A 3DMGA 4CGYA 2Y99A 4OYRA 2Y93A 1KFJB 1ONOA 1V7ZA 1FYXA 1TM5E 3OC6A 4A0SA 3KD2A 4XLTA 5LNK6 4Q37A 1GPH1 2ZKIA 4YRCA 3KZVA 4D3XA 4YAEA 2BSXA 4IZ6A 4Q02A 1FDWA 2V7QA 1X7YA 4G0QA 2AF4C 3PL5A 3AHEA 3T0FA 3V7YA 4GD3Q 1I7PA 4ZIRB 4QUKA 1RYBA 1CV2A 1N1DA 2YXPX 4JFRA 1V4NA 4OHMA 2ZJYA 3N3AC 3L0BA 4O4JF 4TZKA 3SZMA 1ZEMA 3AJAA 1ISJA 5CCBA 1SXJB 2A0KA 1D8AA 3UATA 5JYCA 1UMCB 4HXGA 4E5MA 1EAYA 5JS8A 4N3CA 5K7SA 1SGWA 3HU2A 4KQ9A 1V71A 1X3LA 4HZUB 1HV8A 1JIKA 2JGIA 2PWZA 2GESA 3HDHA 4G25A 1R0BA 5GY7A 3RQIA 5JSUA 1PEDA 2FPPA 3Q88A 1ECPA 3DW3X 4NYJR 5B3JC 3FYTA 4MZXA 3BZBA 4DLNA 1VPLA 4DLZA 1DWUA 2RE8A 4Y2UA 1E6MA 3O26A 4RKEA 1DKRA 1Z88A 3CZ9A 2BGNA 3AR3A 1XCPA 1EQUA 221PA 2I6TA 4D9FA 4H1TA 3P0IA 3PUZA 1CDOA 1YS2X 3AHHA 2ZRAA 1LVHA 3ORHA 1ST3A 5E6UA 3ZCRA 2I6SA 1OU0A 2XMRA 3NXSA 1E32A 3GAMA 3PV0A 3D4LA 4OKNA 5HM6A 4US2R 2UYGA 4KB5A 5AM5A 4TLEA 5ESDA 5IASA 2O0KA 1XPJA 1KXJA 1QDUA 2WSSD 3ZV6A 3RVBA 2FZGA 3KWJA 1M8FA 1Y1KE 4PYIA 5AK0A 4ZRDA 3FKQA 4KL8S 1VMDA 3ZDZB 2WTEA 3VUEA 2CE2X 2I22A 2IV2X 3V4FA 1XMPA 1DQNA 2WAOA 1R4NA 1ZITA 2VRWA 3DMTA 3IJ5A 1K92A 4FSXA 5B6PA 3KUCA 4F06A 2QIOA 3DWGA 2QLMA 2ZE6A 3UG6A 2DH6A 2BV3A 5C0OE 4PCAA 4WBXC 5I8PA 4K6OA 5KOHB 5LA6B 3ZOKA 3QV1A 1MP0A 1GGFA 2IW1A 3Q8XB 4O29A 4C01A 2PUCA 4IDAA 4CUZA 4BEVA 5U9CA 4KGVA 1D6SA 2R8YA 4TXLA 4DWOA 1NUPA 3UXEA 1UBEA 1CY7A 2HU8A 5B4UA 2HPHA 2D7DA 1NU6A 4WMLA 3QVKA 1PNTA 3IELA 2C2WA 3K2EA 3ZHRA 1BFUA 4DQ0A 1YGPA 1Q12A 1NBEA 3LK6A 4ZAVA 3JTEA 3O90A 4G0UA 3HA7A 1EP9A 3MGKA 4IW3B 2ZRGA 1CDZA 1R0KA 2O8DA 4OMCA 3LOPA 1V41E 1USKA 4LTDA 5ALWA 3TOSA 2ET6A 2D4HA 4Q3LA 4U2KA 1WVGA 3DFKA 2R65A 3PC3A 1QTNA 4IINA 3TQSA 1O0CA 5A2QA 4BNXA 3FD8A 2Q7OE 2HX1A 3HUTA 4FI3F 3SDZA 3JARB 3TOZA 2Q50A 1BJTA 4MVJF 4IRXA 1TYEB 4JJGA 1SU7A 4AX4A 1ZVKA 4KCGA 1Y4ZA 1YJ5A 1HDEA 3DXZA 1NPTO 4ECEA 2EFJA 3EPJA 4O2BF 1PGQA 1KZGB 2V7XA 5FI0B 1NW6A 1WVMA 5C3MA 2M6LA 2PE5A 4BVFA 4WKBA 4YP9A 2A5LA 3SYTA 1M34A 2HDOA 1M74A 2IF0A 3DTTA 1XZ8A 3N1UA 1WY7A 4L75A 1F8XA 1TVCA 1U4NA 2WT4A 3KO8A 4QEDA 5D5HA 2X0DA 4RJLA 2NPOA 3K5HA 1JHAA 1C8BA 2FMXA 2OCBA 3CNHA 1C9KA 3A9WA 1EDBA 4DC1A 5JZBA 1KDPA 1N2OA 1KC1A 1QQBA 3VRHA 4EEXA 4RLSA 3EZLA 3DV0B 1V1RA 1XJCA 2WVHA 3AERA 2BMDA 3L9WA 4GHWA 4CQMD 1EP2B 2EL9A 1KDYA 4Z6KA 2AB0A 1WQ1R 4LF7B 1RWMA 1JU9A 1W2GA 2CYBA 2QRGA 4AK9A 1GUFA 3E81A 4U7FA 4BMDA 1RC8A 1Z29A 3DDSA 1UXJA 3PCXA 2EF0A 4K2AA 1JHUA 3DM5A 2YJ4A 3IUBA 3GH1A 5GGXA 3UKJA 2YR0A 3GLIB 3AFHA 1LPNA 3HC7A 3MWEA 4BNYA 3DOCA 4MDEA 1DEHA 3PFHA 4QQKA 5LBTA 2H7YA 3OZXA 2Y92A 4J3NA 1MNQA 2OOKA 4R8VA 2JCVA 3IIJA 3HKDA 4KRXA 4Q12A 5ALEA 1YV9A 4LOLA 1T4CA 2QF7A 3HVUA 3A6DA 1FXSA 5DHAA 3TRIA 1OWPA 3T5AA 2V96A 4DWWA 3B6MA 3PX3A 2QBYA 4UVIA 4YLYA 1BNCA 1D2NA 2BFBA 3E7PA 4BS9A 2H7XA 4Q3OA 3CPEA 1AQJA 4DLBA 1RE0A 3HXPA 3FSJX 2PKQP 1U8EA 1H1LB 2Y1DA 5CIYA 3M49A 1PR2A 5LXTB 5BVHB 5EQFA 2CNNA 4A27A 4UBKA 2G6TA 1A72A 3IQIX 1MAUA 2IODA 1NQ5A 2HC9A 2OAQ1 3U3JA 5MN4A 2P9CA 3H99A 5IM4F 2ZT6A 4B43A 3VJKA 3R7SA 1L5WA 2HMVA 5JASA 3TZKA 3EDMA 4AP9A 1IOLA 4RS3A 2HKIA 5E4FA 1WLSA 1JHMA 3GT0A 1TUIA 1HQYE 1U2RA 2W7TA 4MV7A 1NPDA 5IYZA 5KS2A 3SQWA 1M83A 2JFNA 4ZDWA 2GBCA 1BXZA 3KJIA 3KYDB 4ZAGA 4OBBA 4RVHA 5DP2A 721PA 4W63A 1W1IA 1CT9A 2ZYVX 3ZX4A 1KSHA 2E37A 5ICGA 5J47A 3NCTA 3SD7A 1OLSB 4E2FA 3U9TA 5AFSA 5JY1A 2R751 1E8NA 2MINB 3EDRA 2HWWA 5KEIA 4D0SA 3IP1A 5EMNA 4AUKA 3GNTA 2XEDA 4G67A 4BRWA 4MVJD 2XBUA 5C8ZA 1Y8QA 4H16A 1S8NA 5AJUA 4AM8A 3RFTA 4KIFA 1GXSA 2NXWA 3DDUA 4ZXFA 3X43A 4QARA 2OXCA 1QMPA 3CLHA 9MHTA 5AKEA 2FUKA 2CL6X 3NBQA 2HF2A 4EG5A 1Y80A 1U0JA 2I6FA 2QW1A 3RNOA 3KJNA 1W25A 2I4TA 1REQB 2OECA 3MAJA 2UXCB 5MN5A 1HXHA 3U3ZA 3N6RA 4JLAA 1OLXB 3AGPA 3SM9A 2FWJA 4MWSA 2GZ3A 4PZCA 4UXJA 3HADA 2H52A 3I58A 4IDPA 3NHZA 3SXPA 4RVNA 3ZWQA 3F90A 1SELA 1WUKS 2OPBA 4PWZA 3G2HA 4G0YA 3U4AA 4MGEA 1JX6A 2ZDHA 5KSWB 2ZRLA 3NNDA 4R2LA 5B53A 5T8KC 3OCWA 3CLSD 4D81A 3L43A 4LDPA 3NTOA 3OOSA 2C7VA 2R6FA 2IITA 4Q4AA 3F49S 4B3BA 1RAEA 2ZANA 4EMBA 3FWNA 2UZ1A 4TUYA 4XRGA 4IR7A 1ZGBA 3EMVA 1SPBS 4OGGA 2QN2A 5FPHA 3MCWA 4O08A 5CEEA 4ZWNA 1WNFA 2JAWA 4KXWA 4FB4A 1DBSA 3MHPA 2RJNA 1MJGM 1R1DA 2B94A 2G9ZA 4IYJA 4PGFA 1F1BA 1VP9A 2FOXA 3MTAA 4YX9A 1L7BA 2QQ0A 3AY6A 4FGWA 3RT9A 3PUYA 4HRVA 3PC7A 1BU8A 2AC4A 3WIBA 1VZ3A 4FDVA 3SHWA 2ZIXA 3G02A 4MP6A 1C3OB 3PICA 4A5SA 4YECA 4BGVA 4BFCA 3JAWA 3EFHA 1T9GR 4PSUA 1XMOB 2E49A 1IC6A 1Z6QA 1FFXA 1SQFA 2QJTA 3QKUA 3I4CA 4GUAA 1ZUHA 5HCNA 1FP6A 4YLEA 4LI0A 5K3DA 3BRWA 4KMOA 1YB7A 2PIAA 2QZZA 1JLSA 2HFKA 1P0CA 4QT0A 4QSHA 4YT5A 3H1TA 3O38A 4KR9A 4ARZB 5L6MB 1VHJA 4RQBA 1UJMA 4M21A 4TQUS 1XQXA 1SK9A 4BV2A 5JFGA 1ZUNA 4W6ZA 5H8WA 4ZI7A 4CWAA 1CUUA 2UYHA 5BNTA 1RM4A 4OQDA 1SA0B 2QNRA 4Y0AA 3EHEA 1TYBE 2XGGA 1NNUA 4H18A 5GZ6A 4C1BA 2CNLA 2YRXA 3IR5A 4HAUA 4OAOA 3NRBA 3TVTA 3FYHA 4Q21A 4HWRA 1X1SA 3Q87B 1ZGZA 2XVZA 3QOFA 1SQGA 3C8DA 4ZREA 5H1YA 3NOVA 1W73A 3W9UA 1ZJWA 4OB7A 3IXLA 3OKAA 3ABRB 1XEFA 1Y4DE 4AZSA 4ENWA 4DR2B 3FROA 1NP6A 2E4UA 1H3NA 4MULA 2FCRA 3L6CA 1YACA 1QUEA 3VSBA 1DTWA 2J3QA 4IXMA 4F3NA 3IURA 3STYA 5C5EA 2ATXA 2CXQA 2G9VA 3EC1A 2ZQYA 4G1UC 5DNVA 2MCFA 5L4NA 3HN7A 4MR8B 4ND8B 2ISSD 3CW8X 2GA9A 3IJRA 4YCMA 1C2YA 3I45A 4MV9A 4DC9A 5I7RA 5JZSA 2Z2KA 5IANA 4FMDF 3WRVA 4GI1A 3INGA 4IDGA 1HPLA 3LT0A 5BSVA 2ST1A 1KFCB 1A8SA 4HH3C 3PENA 2ZR9A 2QTFA 1A7KA 1AKEA 4MV1A 3L49A 5GONB 3GRYA 4HNGA 1L7NA 4B6SA 1OX4B 3G9ZA 1U1FA 4IH1A 2ILTA 1ZC4A 5LQDA 3PSHA 3OEWA 3QFFA 4MVJM 1Y4AE 1NT4A 1KKMA 2YWXA 4I50A 1GAWA 3E1GA 3ECCA 1H2ZA 1L4GA 4KRGA 2BHTA 2HA2A 5MDHA 5KTMA 1ISRA 1MFPA 5EJ7A 1I1QB 1PNVA 1G2IA 2QMOA 1PL7A 5IFLA 2JATA 4KTVE 2HSZA 3FZGA 2ISCA 3RGWS 1MV8A 1I7LA 3SE7A 1E64A 3AM5A 3THRA 3GCGA 1F0YA 2VTBA 3CGWA 1OXBB 2AR9A 4KUEA 1E62A 3BXXA 1QYRA 3BHIA 3TL2A 1PL0A 5FBQB 2GKSA 3H2IA 4HTAA 4P3YA 4CCWA 3ICQB 2FN8A 5HXAA 3RJZA 2YYYA 2ENUA 2CVZA 4GE3A 2PRYA 1J2JA 4EYOA 5G0WA 3W5UA 1XCOA 4FZ5A 1T4GA 4UATA 4RZHA 1RWVA 3RS5A 3COJA 2BGMA 3MLBA 4JLVA 5DW0A 2OCXA 1GT6A 5EZQA 5FBWB 3T9EA 3OTIA 2OUKA 4XB6B 2RK3A 4BX0A 4M98A 4XQCA 4V2UA 1BCRA 4JIMA 4UM7A 1S3SA 3TTVA 2GFIA 4BB9A 5B7QA 4RJIA 2B36A 3NPMA 1XF9A 4GVXA 2Q99A 1MGOA 1L9XA 4JLBA 2W6IA 7REQA 4W4TA 3VPXA 5HZMA 3ZVLA 4K8RB 3WYEA 5F9FA 4R8MA 4L50A 2YMPA 2Q5HA 4POAA 4ALNA 4FYIA 4BZPA 4J90A 1GRQA 1XZPA 1W85B 5EJ4A 2IPXA 1U7PA 3OMLA 1NKSA 3MUOA 3P32A 3GN1A 4UMDA 4RJJA 2ODAA 2FEWB 3L0PA 4TTAA 4B7XA 4EJ0A 1HFWA 2F67A 4N0MA 4Y2VA 5HQTA 3G1WA 2OVBA 4MR9A 3GFOA 2WTAA 1XPUA 5D3KA 1CRLA 3WWPA 3T7IA 2YXLA 3BZUA 2O5EA 3P9SA 2KYRA 4QQNA 3GPCA 1EFPB 3LWZA 4ZV4A 1USVA 2XYRA 2ZM6B 1V1MB 1CSEE 1SUDA 4M9QA 3PI6A 5K03A 2AZDA 1R5BA 2YQZA 1CE8B 3EIUA 2OHXA 3BJIC 1Y1SA 3LC0A 3QFHA 1MH9A 2XCTB 4QXMA 3NAMA 1PL8A 3F4LA 4H60A 4Y1RA 5G1PA 1M6EX 3MILA 3NWJA 2TMYA 2REXB 3WO1A 1X8XA 2IS6A 3ILVA 2VUHB 2UUCB 3QU7A 1KMCA 2HLHA 1JEDA 2PZLA 4KJZA 4PLGA 2WHXA 3GG2A 3H5LA 1LFAA 3WGZA 3I8SA 1AUOA 2ZQZA 3II6X 1O96A 3V4VB 3E9CA 4MIYA 4X1IB 4ZT7A 5FTLA 5CVCA 2HA0A 2CCJA 5IT9A 5E8JA 2E9SA 4MVJP 1Z6ZA 3PQ5A 3QSYA 3DBIA 1NVUQ 2VI5A 4MQFA 3S81A 3ICOA 2GHRA 4MNTA 1B42A 1L4HA 1NKVA 1PJLA 2ONCA 1SY7A 2ADOA 3K72B 2C9YA 3REGA 4G0VA 1T1EA 5K8CA 5BWMA 3EEBA 3IFSA 1TTQB 3Q6NA 421PA 1TLTA 5B6IA 5LQRA 2VAXA 1H94A 4KRFA 4FZJA 2V9PA 2GSDA 4FR0A 3V1NA 3QK7A 2PGAA 4M6WB 2O7VA 4RY8A 2XB9A 3CNQS 2WAAA 3EMDA 3PUXA 3AY0A 4RFVA 3RKRA 2QGFA 2Q5QA 4YXWA 9GPBA 4BNDA 2NO4A 2H18A 4GC5A 3QW2A 4J3JA 4LHZA 1SZJG 1UXHA 2CKDA 1UEJA 2WJHA 2XMGA 3O9VA 3PFIA 3PRHA 5FWYB 1U8ZA 4EA7A 2QJOA 3ZGVA 4GP9A 2YJZA 3H9EO 4OFXA 5L40A 2EWVA 1E1CB 5KPDA 1HKHA 2D0OB 1FLAA 4NBTA 3A2NA 3V6LA 3OIGA 2VHZA 1PR5A 3PC8A 4XTRA 4GEGA 1PWHA 1YIOA 4HP8A 3U13A 3K0AA 2H4WA 2GNOA 1K5PA 1ZGGA 1ZIYA 2G63A 2CLKB 4ESEA 3PF9A 1V0JA 2WEKA 3ABOB 4E03A 1NUHA 3DDZX 1SQSA 4J2HA 4C07A 1EUYA 2DKNA 2HHLA 3BIFA 1VJTA 1D2CA 1E1YA 5AM4A 2R1UA 4K5QA 1V39A 3RVKA 3DO6A 2P9ZA 3TZQA 1GFSA 3PA6A 3U3RA 3UJ6A 1LZLA 1I6LA 3R5TA 1FJGB 3HTXA 4PQRA 3MMSA 3SEQA 2DQZA 3GZ4A 1PZEA 4ENPA 3QUSA 3DZDA 5ICCA 1GL6A 1OZHA 3D2LA 3D7RA 5HBGA 1Z37A 3TGPA 4I0WB 3H11B 1OA0A 2WIDA 3AO0B 1JN0A 5D7NA 2WUVA 5GM1A 2CSXA 1WBBA 2AC7A 3VR3A 5BN5B 3B7WA 3FNEA 4CQLB 2PLWA 4DLKA 4EHHA 3I34X 2H4HA 4X45A 1KO4A 4EWLA 4DCGA 1V3TA 1WEKA 1XALA 2IEDA 3VNRA 4JKYA 4JYBA 2CDRA 3EGDB 4M1WA 1OZ0A 1XSEA 4DKXA 4RLQA 4OUDB 4HJRA 1K6MA 4B34A 4BX3A 3R9IA 2G9NA 5J4KA 4TM8A 4PXAA 1FTNA 4AI6A 3T7SA 2D7JA 3NTUA 5C5CA 5HP4A 5HMMA 1SD1A 3MJTA 1EM8A 1RC0A 2IXAA 4XVCA 3U7HB 3SHFA 1H4TA 1BX0A 3UENA 5JQWA 5SYMA 3LC7O 1T24A 1QS0A 2ZSDA 4HF7A 4B6OA 3W8NA 4C22A 2VOJA 1JYSA 1LJ8A 4WEQA 3U5TA 1GILA 2QU8A 1H8EA 3QPDA 4B40A 3IAXA 3RIXA 2BKUA 2BP7A 4XYGA 4B8YA 4HYYA 3GA0A 4REOA 4H17A 3LQYA 1QCCA 1G21E 2AHOA 2ZJ4A 4KYVA 4YQZA 3NHUA 4NBNA 1PS8A 4M38A 4TTPA 2X9NA 3PHBE 1U8CB 3VPBA 1FL9A 4DY6A 1Y3IA 2AOWA 1IDOA 3QNMA 2R4UA 3Q1LA 3VYWA 3AJRA 4RTSA 1PS0A 1YBAA 1ZJJA 1TX4B 2P5SA 4WN9B 1DDIA 2QROA 1D7AA 1OBFO 3RSFA 1AQLA 4D3YA 3QX9A 1IM2A 4GXQA 4HQFA 2BR3A 4O0MA 2IY9A 3GLUA 3N6VA 2OYCA 2A1UB 4LZAA 1ZUIA 4IBOA 3E5MA 4NONA 1BS9A 3OM1A 4V24A 4DCOA 1IN5A 3UGJA 1Q16A 1PEKE 2XE4A 4HUQA 3IO3A 1CUJA 1WMSA 4DNQA 3M5CA 4ANFA 5GADl 3LJKA 4RQTA 4ASUA 2PR2A 4DLUA 4WA8A 3WWOA 2IC5A 3NHBA 5BSMA 5EKXA 1NXOA 3J81k 3NYWA 4NS4A 4DIUA 4HTFA 4FTWA 4PQYA 1C9NA 3R3ZA 4R6WA 1C0IA 2CV2A 4NCAA 1U0BB 3FSGA 4EGFA 5BV1A 2Q2WA 3E5RA 1N5JA 1NHGA 1D2EA 4MIOA 2OHFA 4QDJA 4TLLB 5GINE 3J81A 4CR8A 2HT1A 1GTG1 1OC2A 3TQQA 1TF5A 4KNWA 3MB8A 4MVJG 5JFOA 2X1VA 3MSXA 5ARDA 4JB2A 2E4XA 2AOUB 1FZQA 3MS2A 1I4LD 1Y3DE 1N2GA 3GFFA 5DZSA 3NKVA 4O2AF 3IAM1 5BV0A 1ADYA 1NVKA 1JKFA 4L73A 5CITA 2EWWA 3OM9A 2H2AA 4PYLA 4UAGA 4RA9A 1NSTA 3ZVMA 2QRLA 5TPZA 3TDKA 4WK0B 4I9FA 1SBHA 2M2IA 3W2FA 8LDHA 1K97A 4ADSG 1FMTA 2VPWA 1U7OA 5IVKA 3A25A 2ERXA 3FCUB 4GKVA 2DRIA 5BP7A 3TIGA 3NU1A 1II9A 3FHCB 1PYGA 3FDZA 5CBPB 2XCIA 1I6KA 4E31A 2FSIA 3R1IA 1K3UB 2X6QA 3PR1A 2X13A 4LHWA 1FTQA 3TL6A 2JZOA 5KKNB 2QY9A 1UP7A 3G9TA 2EP8A 4UMEA 4Q7JB 4OXKA 2KB0A 3QF4B 2VDNB 4JS0A 5FCDA 4EG0A 4JCCA 4AY5A 2H85A 1AKQA 1N2XA 2GLXA 3HJTA 3TZ6A 2ZSEA 1IK6A 1DAIA 3JYPA 5B30A 1FNBA 1X1CA 3IHTA 1WABA 3X1KA 3BHMA 3WWEA 4RFLA 5KQLA 3SYRA 2EKDA 1W8IA 2AL7A 2XYVA 1GL7A 4L72A 4R9UC 4Y6OA 1ZHHA 5CYOA 1VPTA 4AUNA 4PYRA 1IOVA 2ZWAA 4BEWA 3D8UA 4KAJA 1E3JA 1OYOA 3P0JA 4L02A 3WJAA 4MCHA 1YO6A 1DU4A 1ZU5A 1DBIA 3MXTA 5H4HA 1KIFA 1RBZA 1G8GA 3AILA 1B0ZA 5G02A 5JIBA 4FOLA 1ZM9A 3MQ2A 3FSRA 4RK0A 4OI1A 1JHDA 2WG1A 4BQIA 1FRQA 1U81A 4NZMA 4F45A 3ROMA 4BN4A 2OV1A 2P3QA 3ZBTA 2F1IA 2BELA 3A3NA 2R00A 2GN6A 2J6CA 1P5FA 2DFLA 2IPAB 3C39A 3TE7A 2ECOA 4INPA 1TYZA 2P9FA 4MRVA 1N3IA 5P21A 1MABB 3OCCA 3QVJA 1BVUA 2WMYA 4BRUA 5CK5A 4GGOA 2H1CA 5CX4A 4DJFC 1XNQB 2NTEA 2P30A 2OYRA 5EE5B 1PJTA 2DLNA 2NZUG 4L3OA 1CZUA 1XZDA 1PLKA 3ELYA 4X63A 4HMQA 3YASA 4ZMBA 2ZFUA 3S2GA 2LTAA 3VR6H 1DX6A 2Y76A 3DEFA 3QBDA 3QLUC 4O5AA 3VJLA 2N1MA 2HDNB 1JE0A 2QENA 3TQOA 2B2XA 1P33A 3PFNA 2IYVA 3JQGB 4RETA 5A9SB 2G5GX 3CR3C 2VK8A 3NQ41 1G20A 4OLJA 3DWIA 5HR5A 5IHXA 2F3TA 5CPBA 2R5FA 3AR5A 3HYSA 4FXOA 4V39A 1GAXA 3HEMA 1N5RA 2EFCB 2NTJA 2QSYA 4WCFB 1YZVA 2V6MA 2AGVA 2ZBRA 3C43A 1G8JA 3HNOA 2VHTA 4OJTA 4DTIA 1U2ZA 1WO8A 3C5CA 3DFIA 4YVFA 3V2GA 2OHJA 3MN1A 2X19A 2ZZKA 1JJVA 2ZSKA 4MHOA 4R81A 2Q6LA 3JQ6A 1QWOA 2HRBA 2X0JA 2V6GA 3O1JC 4M36A 3PQ8A 4XGNA 1AQIA 4XSGA 1F8FA 3LYHA 1M6WA 3PT9A 1BMDA 2HADA 3IQDB 1OBOA 4TV8B 1GV1A 3L4JA 1S8FA 2IYFA 2Z98A 1FMFA 4Q7MB 5E4YA 5LQCA 3V42A 4AWAA 2CF6A 1XU7A 2Y4NA 2Z43A 3ONEA 5KAPA 3BJZA 2F9MA 3NWEA 4TT8A 4V0QA 5DHQA 1CY2A 4RIFA 3HKBB 3MT9A 3HM2A 5KQPA 4YJ2F 1T26A 3CEAA 1GA4A 2C97A 5FD8A 5L3QA 2ODWA 1UZUA 3QXSA 3S29A 3K70C 2GVZC 4L16A 2O1EA 3QE3A 1VXRA 4WCDA 5CIWA 1L5YA 4FYMA 4UUBA 4XDGA 4KYUA 2AG6A 4UE6A 1OBHA 3CUEF 4QM7A 1Z07A 1RW4A 1Z18A 2NU7B 3GLTA 2NAFA 1BKDR 4ZO4A 4DBZA 1G98A 5LJIA 1EM6A 3HNRA 3ZQ6A 3HDQA 1G66A 1J00A 1IJKA 1D6NA 2FPIB 3I4LA 2ZRNA 1FS6A 1QAQA 1UOOA 2EOAA 2WHQA 1PW7A 3PPVA 5D3MB 1DDOA 3OPYB 1OT3A 2QU7A 3WGMA 3X2SA 5C7IO 4B2PA 1VE3A 4BOYA 1NOKA 2MSCB 3QPVA 2W2VA 1DT5A 2FWNA 3W90A 2IOYA 3ON5A 2I2FA 4ZHQB 1XZIA 1KI9A 1UQRA 5ED0A 3BFXA 4BGEA 1V9CA 3D5QA 3GLFE 3LE8A 1LPAB 4YT2A 2PXHA 1E9VA 5IVPA 1E9CA 3G7NA 1CQIB 3ASZA 4DSUA 3L06A 3PDWA 2V7EA 1YTUA 4OYHA 5JXHA 4XW2A 1U0RA 2WC1A 2CMKA 2VLBA 4KQCA 4YPFA 4FR5A 1RQ2A 3MCVA 4GE0A 1GPDG 3CFYA 1K7FB 2F90A 4B6EA 1AY0A 1VIAA 3L7MA 3BJRA 2DTXA 4FS8A 5FRDA 3PX7A 4JJAA 3V7WA 3FGNA 1TCBA 3AF1A 4CDMA 1NSFA 1V3VA 1WRBA 2QQEA 4FN4A 2VJLA 4I9GA 4L8VA 1WXEA 4ZC8A 3SQDA 4YRRA 1NUTA 2H16A 2GEVA 2H2IA 4ZYWA 2FKNA 1KI6A 3W0LB 1S89A 3M6VA 4NV3A 2XUGA 3P9RA 4W5JA 3P94A 2FEXA 1HFJA 3RWMB 1E9BA 1W35A 3D2CA 2DSTA 2YY6A 3KT6A 4Q15A 1NVAA 2UUOA 2JKYA 2XSZD 5DKFA 3OCYA 5LQJA 1YI8A 5CA0A 3AUAA 2NZWA 1HETA 5DB4A 2F3UA 4OG2A 1I2DA 2R1VB 3KT3A 3REOA 3TSCA 4QFCA 1DOZA 1ZOIA 2JFOA 4H3KB 4AG6A 2Q3BA 3C1TA 1KFEB 3UK2A 3G7UA 5HKKD 4DR6B 2NYUA 4GLLA 4OREX 7ABPA 2G36A 1IYZA 2AK3A 2JARA 4CM3A 1BW9A 4MAAA 2Q3JA 3OF3A 2QL5A 1J8VA 5HIJA 3F96A 3WGUA 5IG2A 5DGDA 3OHSX 3OJEA 1JWAB 2PH7A 2X40A 4CCYB 5EXTA 2WQ6A 5DCUA 2CEAA 2WPDA 1TQHA 1R9NA 2YXBA 2ZI6A 3O21A 4LOKA 5FPPA 3T94A 1L4NA 4BNVA 4G0WA 5KKCA 1DJMA 3SEAA 2QL6A 4JI0B 4KVZA 5ALFA 2PQ6A 2WWXA 5E7QA 4QKQA 1SCNE 3I2GA 2M6RA 3D54D 3Q8LA 1EK1A 3KTAA 1KEWA 2OO5A 4HDNB 2PK3A 1RRKA 4G5QA 4RWZA 1PJRA 3AHIA 1QM5A 2XIJA 2YDXA 2C8LA 4LYHA 4BEJA 3GLGA 3RROA 5K4HA 4N0PA 1WG8A 3T35A 2GZSA 2PBLA 3ASVA 4UM9D 1QRRA 2EZUA 4FB5A 3D1LA 3T8YA 2ZREA 5JHGB 1UKAA 3UMRA 4C21A 1CR6A 1UIRA 1NN5A 5C1OA 2XW6A 1F2UA 1XCLA 5EN4A 5GVSA 3U81A 3X1XA 2R8EA 5B1SA 3RS2A 2RKOA 1TPYA 2UXDB 4PYNA 4HSGA 1O77A 1SFRA 2D5LA 3EUAA 4DCPA 1TUBA 2IK8A 2PLRA 4JUIA 3V8BA 2P7IA 4YMSA 3N5CA 4LY6A 2ZUVA 4AX8A 1N36B 1SXIA 2DE0X 4NATA 1KI3A 2HXGA 4KE6A 1AN0A 1DEKA 2X6RA 5TS3A 1SIOA 1B2RA 2R62A 4MK4A 4MUFA 3VDNB 3WBFA 5I4KA 1NBOA 3BH0A 1C9YA 2WWWA 5KU1A 4MUJA 3FNIA 1XMJA 3BCUA 2Z8XA 1FF9A 1Z8HA 4IKEA 5AVQA 4ESVA 4JITA 4LMBA 1IMOA 1F3LA 2OK8A 1SBCA 5T7BA 3R7WA 1CR2A 5M5BA 2YS7A 3L07A 3IA2A 4WZBA 3O4JA 4JQYA 1WTAA 2FWMX 1H8HD 1QZ3A 3G82C 2YASA 3OP1A 4NL4H 5DHPA 5DPMA 2YV2A 4RD0A 5LP6C 2ORIA 2X3UA 1XU4A 3OZEA 4OHBA 2J33A 1WL8A 3Q6IA 4KR2A 1OT5A 1NE7A 1Z4OA 2PX6A 2QWXA 3LDGA 4AN4A 2Z5FA 4E51A 1JJIA 4TV9A 4GZ6A 4R1MA 1XEXA 1ZICA 2W6QA 3MWGA 1VM6A 1GO2A 1OH6A 2HQ1A 4MCIA 5D2CA 3NYIA 5C8XA 1U02A 1V7PC 4O1MA 1P8JA 1Q11A 1YHYA 4P8RA 3OQOA 4RVOA 4RF5A 4E08A 1U1CA 2O2XA 4B4OA 3HS3A 4CMGA 3M1IA 1X0VA 2ZI7A 1E89A 1LK7A 1U0NA 1L4UA 2GI4A 3BK1A 3R4VA 1Z2AA 4NOJA 4OQMA 5CA1F 3VR5A 5FR2A 2OCLA 2EQBA 3HBFA 4GNKA 2O54A 3F97A 2XUDA 1CR4A 4YP1A 3IAEA 3IEUA 1HWYA 4U5XA 4EHBA 5KWJA 1EE9A 1NJFA 2OZKA 1M34E 2ODBA 3HUDA 3AVYA 1VL8A 3JAKB 1KL7A 3RSLA 4EVIA 1KKUA 1Z39A 3H5VA 1N32B 4LZZA 2GX6A 4ER3A 4JX8A 5BSKA 2IE8A 3PJGA 3T7EA 3WLKX 2PTHA 2BKEA 3IDOA 3LCUA 5JPIA 3HG7A 5ESWA 4NXNB 4P7KA 2X4DA 3LQFA 3ESDA 3U7QA 1GGEA 4DMRA 2J3IA 1RJ9B 1A2KC 1XTVA 2FN3A 3ACCA 3B1FA 4UUAA 1IHXA 1TA9A 3KAPA 1NJ6A 1P1BA 1MTZA 2AOXA 3L0CA 4U7GA 1T2NA 2WIJA 2PGDA 1VLQA 4G97A 3IPYA 3RSCA 3RLIA 3H2SA 1M0WA 1E7RA 3IBGA 1EQ2A 3L7IA 3B38A 1U5BB 5GM2A 1JT9A 5I01A 1C30B 5TEWA 1MZPA 1HYGA 3FJYA 2QQGA 4YDRA 3U49A 4V1CA 4BLWA 4F72A 1JDPA 3KKKA 5A4MS 4K3VA 2VYND 1CUVA 3P9IA 4NAHA 4UQPA 5JQGB 3PJFA 3WISA 4XCXA 4BE9A 1AU9A 4PNEA 1O4WA 2N1BA 2VF8A 4G2NA 5EP2A 2GETA 3FZNA 1M6VB 3AWDA 1E6WA 5ALOA 3GX1A 3ZJTA 1V26A 2VNJA 3FPAA 3TMYA 1PJ8A 2JRLA 3JD0A 3BHJA 4LYEA 5IBRA 3W4KA 2QX9A 1NT2A 2PGJA 2GAIA 2FLVA 5AUOB 2ZCJA 1M8JA 3MMNA 3NM5A 1Y5NA 4GSLA 2JFPA 5MFPA 3RADC 4J1QA 1Z6XA 2W58A 4WOPA 1JSCA 3OESA 1P29A 4FD3A 1OW3B 4YO7A 3JVEA 3S1SA 5C2JB 2X1LA 2C5SA 4KPYA 3IPXA 4LDNA 4F92B 1G38A 4AC9A 3DL7A 1FK8A 1YJQA 4JJZA 4GYJA 4PAOA 3CVXA 3MYRA 2YNMC 1N34B 3JQ9A 3GJSA 5JROA 3CJRA 1KEEA 1Y6GA 3VHQA 5C5DA 1I3KA 2PRIA 2YWCA 3SX4A 2A1IA 5F7JA 3THYB 1MENA 1Y1QA 1LZKA 1OR8A 3U9SA 1U2QA 2FOLA 5DGIA 3P2IA 3SICE 4H0NA 3OT5A 3DUFB 3HU1A 2XITA 5DLYA 5I6DA 3GEDA 4IMPA 5CFLA 1HE1C 3W5AA 2Y27A 4X7PA 3ZGZA 1YCDA 2GKOA 2IYSA 1PV1A 4R8SA 3M5DA 5A5DA 1Z33A 1A5AB 4ER6A 3N2GB 3CVWA 4ZTUB 1VDZA 4E2YA 1EG2A 4Y9TA 5IPFA 2XZOA 1TGVA 5I7OA 4BQFA 3VGJA 3C3MA 1DX9A 1JQKA 1VL5A 4WFKA 3ZHCA 3KHSA 1A7JA 2PT6A 5TEVA 1QG2A 2V4ZA 1ENPA 3L6RA 3I9MA 4LC0A 1JBEA 2QTAA 2ZUUA 2UYYA 2B4YA 2GEUA 3EIOA 4UXHA 1XCJA 4FYXA 2ODNA 5BN3A 1DC3A 2O2JA 3DONA 2HCRA 2V5UA 3A9CA 5ALKA 3ROXA 1JB9A 2XMPA 2PUBA 4H6VA 3IP6A 2WU1A 4UCFA 3AH8A 3GH3A 3T4EA 4PICA 4AFNA 2VDQB 2RGBA 2WJAA 2JGFA 5F2KA 2Q27A 3C6KA 3KQWA 4F0JA 3K8ZA 1CZKA 1XL0A 1KA9H 1YZNA 4QSMA 4YUWA 4W1PA 5FWDA 5LSAA 2A78A 2XUHA 5I8ZA 1HYHA 3GMTA 1NLFA 3P9QA 1A50B 3UJDA 2AQKA 1AZWA 2RGNA 2GBLC 1EB8A 1VLVA 1X92A 2PL1A 3IQEA 5BSUA 5FORA 1PVOA 4FINA 2MHCA 2OV8A 1IMJA 4XWWA 4FFNA 2H3HA 4C7XA 3OCJA 1K9SA 1QB8A 3MRXA 4L7VA 4HY3A 2JJ2A 3ZXYA 2VH1A 3RJ5A 3ZWYA 4YRPA 4B80A 2AWNA 3VO9A 2YVUA 2BFAA 5AHOA 1TT7A 3G2IA 2ODEA 3G17A 4P08A 4TKUA 4E15A 1EWRA 1JJ7A 4YRAA 4US0R 5FTJA 3OQMA 4S1TA 1OCEA 4BP9A 3IPLA 1K7YA 4N47A 1CRZA 2FK7A 4AMVA 4KO2S 3N0TA 3R7DA 1MH1A 4B4DA 1Q7TA 4H7JA 4ROSA 4WACA 4XRRA 4M99A 2BBTA 3RSZA 4A6XA 3WK5A 2J45A 1N0WA 3ZS9A 5CB0A 5HKAA 4CEJB 4DDVA 1DKPA 2VCHA 5B6JA 3K32A 3C7KA 5E6RA 4FQ8A 1JL3A 1T5OA 4PFJA 1CJCA 5JOQA 1E3MA 2GF2A 3Q3IA 4RD6A 3GW8A 1XWWA 1IZ7A 1LNSA 2R7KA 5CH5A 5HBRA 3W9YA 1COWD 3QEMB 5LBUA 2YZ7A 3M6AA 3SQXA 3FNRA 1N0IA 1BA3A 1XNRB 1U1IA 3G23A 2I80A 1T4BA 4RABA 5CLLA 4HNSA 1DINA 1YAJA 2CNDA 4L6AA 4MQUA 4GLJA 4XWYA 5K0SA 2PJRA 3DBRB 1JFFA 2I4NA 3PWTA 3WFIA 2XA9A 2YVKA 3VHLB 1HURA 1JG1A 3NIGB 2WSYB 3VNUA 4HDSB 3LVBA 4QJIA 4DBLE 1CJKC 1YOVA 3R8CA 1ESDA 1P2TA 4NBSA 4NZYA 2P1RA 4OL9A 1YRYE 4YIKA 5I7SA 2DFDA 3HCBA 3MA0A 3WGNA 2TECE 4CM9A 3MCZA 5KNDA 1NXTA 1WU8A 4RHCA 4J1TA 5CFZA 3BXEA 3UOAB 2A84A 4KGXA 1J90A 4B6JA 1WETA 1U4SA 4M53A 1R64A 1BEUB 1YE3A 4RGBA 2QVXX 3Q10A 1V6CA 3GZJA 3MG9A 3SSMA 1GR1A 3T06B 1TZKA 3KDPA 1GZVA 2GM9A 2J3HA 4HWSA 2QXTA 4WLUA 5BUQA 5FUVA 1VSUA 4ENQA 1XUOA 4I36A 1TLLA 3VSEA 5JWRA 1Z8DA 3WO0A 2VNIA 3AFGA 1ZMTA 3KDAA 2YOHA 3GDOA 3RRJA 1M1NB 1YUMA 2XWSA 3OE7D 5HVNA 2XCRB 1GGNA 2VP3A 3LLSA 1WMFA 2IQ5A 4YMGA 1FU7A 4DEYA 3ENNA 2BF4A 3ZY4A 4F6LA 3IUNA 3MD0A 3IVXA 2OXEA 1KQGA 1MJFA 1Z06A 2AVNA 2Z9BA 4JJ7A 4RPIA 3I23A 2JLYA 1SZPA 2VLIA 2VOEA 3AK4A 4URFA 4BCCA 3ZXUB 2PZKA 4NNOA 3ET5A 5K05A 3FTPA 4K28A 3W79A 4J0IA 4XKJA 1CRQA 1RYHA 1N0HA 4E09A 2IP2A 3BDIA 3KSDO 1HMYA 1Z73A 3CF2A 4B3IA 5A06A 4N4AA 5DNEA 4GPZA 5LD2B 3FVVA 1BFKA 4ZO7A 4C3VA 1OFUA 2V7UA 1B0UA 4F4IA 1T9DA 3FOZA 2AZXA 2GNPA 3AINA 4EGQA 5C53B 1DEOA 3BB4A 1R18A 4U8GA 4F96A 3AJEA 3BKWA 4GWLA 3OHPA 4N3GA 2NLOA 3WB9A 1A71A 3QUBA 5CMLA 2YWRA 4Y8VA 2E4ZA 2AKEA 1FMJA 5EAIA 1KGDA 3UWOA 1T13A 2PUDA 1Y7TA 1CS0A 1W0KD 5K8TA 5KYYA 1J06A 3IL2A 1CPYA 1X7YB 1GDDA 2CUZA 4CF5A 4IHAA 4PPFA 2A9OA 3TIIA 4FGJA 1FLNA 2C29D 3QRWA 2I76A 3BILA 4C0LA 1TYAE 2BFFB 1G18A 2EYQA 3RKSA 5IFKA 3ZLTA 2SCUB 4EVSA 1NI4B 3ELWA 2WIKA 3MELA 4CV0A 4PG4A 2WSSA 3LPAA 4PVDA 1N2BA 2O7RA 3CVJA 3F6SA 3X2EA 2V6BA 3BC1A 4XTCS 2FPPB 1BMFA 1G8YA 3V1LA 2ADMA 2FZVA 2ZK7A 4PLWA 5G1NA 3HPQA 5SY9A 4N3AA 2QD1A 3DZHA 4HWPA 4JENA 3G9QA 3UMJA 2NVUA 3BE8A 4DR4B 4QUIA 1J0CA 3MWFA 1ONPA 2V59A 4XEHA 2XB2A 3O8OA 3KFXA 1BHQ1 5DWQA 2G1UA 1L7PA 4WXMA 5E6UB 4AKEA 1H3EA 2VC2B 3MOGA 5FO0A 1I2AA 5FUMA 3JRXA 1G0NA 3CX3A 1R9JA 1XHEA 2PKCA 2VJCA 4YQYA 3AY7A 5BQ5A 1TYCA 2HK8A 1MA3A 4Y2GA 1W88A 2IYXA 4GR4A 2I2CA 4EQZA 1CUSA 2O3TA 2VP5A 2EATA 2GM3A 3K16A 4V0LA 4AYWA 2GB4A 5HILA 5E9QA 2YHIA 1ORIA 2PT5A 4EJSA 3BWMA 4D3ZA 3HBMA 1BVHA 4HX5A 1YQ9A 1QPZA 2NAPA 1VCIA 2QN7A 1PT7A 1L5VA 1Z5NA 3M0EA 3KBBA 3N8IA 3NIFB 5ENDA 4DMGA 2X2OA 1Z3CA 1O94D 4BKMA