1EM6A

Human liver glycogen phosphorylase a complexed with glcnac and cp-526,423
Total Genus 325
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
325
sequence length
809
structure length
787
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords LIVER GLYCOGEN PHOSPHORYLASE
total genus 325
structure length 787
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1em6A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1em6A01
1B4DA 2X0DA 3G2NA 4BQIA 2HY7A 3OTHA 4NC9A 2F3PA 2O6LA 2XCUA 4FZRA 3TOVA 1L5RA 3S28A 4X7RA 2H1FA 3NP7A 2R4UA 3VDNB 5DU2A 1FA9A 1FC0A 1BX3A 3MQFA 2QN3A 4W6QA 1C50A 4MICA 2JLBA 1C8LA 4AMGA 3BD8A 1QKJA 3E3OA 4AMBA 3DD1A 4EKYA 1GG8A 1WV1A 4RELA 2QLNA 2JZCA 4N3AA 3TAXA 2QRHA 7GPBA 1O6CA 3MS4A 4CTNA 2BFWA 2ZB2A 3T3DA 1L7XA 3MTDA 2R60A 1GGNA 2AMVA 3WC4A 4M7PA 3DDWA 2QN8A 2XA2A 2GM9A 1FU4A 3HBFA 1JIVA 1C8KA 2QRPA 3BCUA 4PQGA 1F0KA 2BGUA 4MHSA 4CDRA 2ASVA 5BNWA 3SYRA 3QHPA 3RSZA 3MS2A 3MT9A 4GZ6A 4RIIA 1P4JA 5I45A 3ZCRA 4EKEA 1NLMA 3NP9A 1L5WA 2X6RA 3NAZA 1Y6FA 3Q3HA 4NEQA 3ZCVA 1L5VA 3PE4A 4YUAA 1LWNA 2FETA 3MRXA 4F9FA 2IV3A 2GEKA 1XOIA 2BISA 4EL5A 4N39A 1Y6GA 1WUYA 1FTWA 3H4IA 3MSCA 3VUEA 3G2IA 2F3SA 2X0EA 2X0FA 1P4HA 4CTMA 9GPBA 4MI6A 4RENA 3ZCTA 3CEHA 2QLLA 1FTQA 1NZDA 1HLFA 3MRVA 5DXFA 3OTIA 3T5TA 1GPBA 2ACWA 1P4GA 3HBMA 1UZUA 1L5QA 3H4TA 3WADA 4HLNA 2F9FA 1EM6A 3Q3IA 3OKPA 4NESA 3MT8A 2FF5A 4N9WA 4EJ2A 3BD6A 6GPBA 2IW1A 1GPAA 1A8IA 2IEGA 4G2TA 4F97A 2AW3A 4HWGA 3ZCPA 2PRIA 5LQDA 3G2JA 4MHOA 2H1HA 4GPBA 2AV6A 3E3LA 1K06A 3RSCA 3EBOA 3DZCA 1AHPA 3QKWA 1FU7A 1JEJA 2PQ6A 4MRAA 1RZVA 2WTXA 2G9UA 3G2KA 5HXAA 5TMEA 3T3GA 3ZCQA 3NC4A 1H5UA 3L7CA 4GZ3A 4CTOA 4RIGA 3FROA 1PSWA 1IXYA 3MT7A 3BCRA 3CV3A 2IYAA 3OY7A 4BQFA 2YJNA 2VSYA 3G2LA 1ABBA 1L5SA 4M83A 4AY5A 3T3IA 2GPAA 4X7PA 1YGPA 4WHMA 3CX4A 1PYGA 3CEJA 3OTGA 2QN2A 1GPYA 4LEIA 3S0JA 3L7AA 4RIHA 3CEMA 2P6PA 3CUVA 1WUTA 3NCHA 1P29A 4REMA 1QM5A 3PE3A 4AN4A 1FU8A 1WW3A 3HBNA 1RRVA 1XL0A 4X6LA 4AY6A 3BD7A 3TSAA 3SYMA 2XCIA 2VCEA 5C1DA 1VGVA 4YI5A 2FFRA 1WW2A 3D0RA 1UQTA 2VSNA 3ZCUA 1UQUA 3RT1A 1PNVA 1XKXA 2QN7A 3D1JA 3COPA 3AMVA 2GT1A 1WV0A 4YI3A 3VUFA 3GPBA 2ATIA 2SKEA 3L7BA 4N3BA 1JG7A 4MI3A 2C1ZA 1M5RA 3C48A 1XV5A 1JIUA 1V4VA 2Q6VA 3T3HA 3NPAA 4RIEA 2ACVA 3IA7A 2GJ4A 2C4MA 3O3CA 1NZFA 3OT5A 5ENZA 1E1YA 1NOIA 1XC7A 1GZ5A 3OKCA 2SKCA 3MS7A 2R4TA 4RIFA 2QRMA 4FKZA 2QRQA 2IV7A 2PYDA 2G9QA 2QNBA 3OY2A 1AXRA 3OKAA 3IAAA 1Y8ZA 3D0QA 3NB0A 3DDSA 3T7DA 3CUWA 2XGOA 3L01A 4XI9A 1FS4A 3S29A 5IKPA 3E3NA 2G9VA 2R66A 3C4VA 2XA9A 1IIRA 2AZDA 3S2UA 2XGMA 2F3QA 5IKOA 5TMDA 3EBPA 5D00A 4KQ2A 1KTIA 4Z5XA 2QZSA 1P2GA 1RZUA 2QN9A 4F96A 4QLBA 2KS6A 5TVGA 4MI9A 2VG8A 4L22A 3BEOA 1Z6PA 4XIFA 2GEJA 2IUYA 3VDMA 2XA1A 4LDPA 5GPBA 3MTAA 3MRTA 5TMBA 1J39A 3CUUA 2GPNA 3UYLA 3CUYA 2ECPA 3HBJA 8GPBA 3L79A 1L6IA 1E4OA 3MTBA 4BQEA 1C3JA 2IYFA 4M60A 5D01A 1JIXA 4N3CA 1P2DA 1Z8DA 2C9ZA 4GZ5A 3C4QA 3L7DA 3RHZA 3ZCSA 1PN3A 2X6QA 3S27A 2BGTA 1NVKA 1NOJA 1GFZA 5DLDA 2IEIA 4X7MA 1NOKA 3GUHA 2F3UA 2PYIA 1XL1A 1Z6QA 4GYWA 1F6DA 2OFFA 2SKDA 2XMPA 2C1XA 3UYKA 5JTTA 3BDAA 1FTYA 4EL0A 2JJMA 4KQMA 1JG6A 2QRGA 4GYYA 2XGSA 4RBNA 1K08A 2QLMA 2G9RA 3T3EA 3BCSA 5JTUA 4WADA 1SXPA 1SXQA 3MBOA 2QN1A 3Q3EA 4WACA 1EXVA 1Z62A 3G2HA 2R68A 2PRJA 4BFCA 1YA6A 1LWOA 2GPBA 4KQ1A 1P2BA 3CUTA 3WAGA 2VCHA
chains in the Genus database with same CATH superfamily
3GROA 3CVUA 1USUA 4EB8A 3FRJA 2E0IA 3G2NA 2ZJ1A 2C7VA 3K35A 4JUDX 4P4UA 1T9DA 2Q3CA 2WHYA 3GDWA 5HOQA 1S3IA 1SXIA 3RFCA 3K5IA 2O6LA 3HPRA 3RTBA 1GA6A 2NADA 1UXOA 2PZFA 4GI3A 4KH1A 3V7WA 3ZWAA 2TMYA 3BJRA 3JD0A 4MLCA 4PSKA 5LQAA 5LDHA 4YRAA 1HDGO 3N1UA 3EFEA 4RY2A 4FQ5A 1ZZGA 3JYLA 4MPRA 4UEOA 5EXDA 3ROKA 1BVRA 2PAAA 3TSZA 4Q3OA 4BNMA 3RHFA 1C50A 1KI7A 4EPTA 3RSOA 1C4XA 1L4KA 1H65A 1KGDA 4PN3A 1C8LA 1MB9A 2RI6A 1L5LA 3MUFA 5EL0A 4GEGA 3SXJA 5KX5A 2CZQA 5G41A 1E3IA 2V4MA 2MT9A 2OQ2A 5DKFA 2NP6A 3V6LA 3HSSA 2XTJA 3THXB 3TNYA 1E89A 1DMRA 3NYRA 1BA3A 3GX1A 4YRSA 3U44B 1JVBA 1CY1A 1ONOA 4TTIA 2XZOA 4RELA 1NGSA 3Q3JB 5EP3A 2P6OA 1D2AA 2JFYA 5SY9A 4E6PA 4M9SA 3S2FA 4UE3S 2V1XA 1NJ8A 3TZKA 2VTBB 2NAFA 2Q07A 4RYLA 4NCKA 1YJQA 4A4DA 2IHJA 1NW6A 1DARA 1LPMA 2AUTA 2P90A 4MXDA 2WW8A 4V0QA 5FTKA 1PEAA 3NV7A 3KZMA 4GXRA 4D8TA 5H4GA 1RKUA 3HDYA 3IERA 4WFIA 3FYUC 5DH9A 4QXPA 4YT8A 1SA0A 2C84A 4BLSA 1WR8A 4IO0A 5KJFA 1O9HA 1WZEA 4N6NA 1MFZA 4QD3A 1UDCA 2R60A 1DKNA 3ZNOA 2AMVA 5FL7A 2QKYA 2QVXX 2CNDA 1KNXA 3E27A 3H0CA 3SQNA 1T5LA 4WN3A 3J7AC 5H1YA 1B6RA 5KMGB 4DLXA 1NBIA 2GCIA 3R0QA 3D8HA 4CLEA 2GM9A 1DKOA 1M76A 4I0WB 3WBKA 3D59A 2AUMA 2ZBPA 2WTUA 2P9HA 2EGGA 4CMBA 1JDVA 1ZY2A 2ZYTX 3B7WA 4MP6A 2PA0A 3CZ9A 3D8NA 5EYPA 1ADCA 1JIVA 3JAWB 4BMYA 6REQB 2BFDB 3EVEA 2XI4A 1VP9A 1E9SA 3GHYA 3M1IA 4AJKA 1F0KA 3MTGA 4CDGA 4DMCA 2EP7A 3O94A 2RAFA 4EF6A 2R62A 4UTVA 1GUFA 2J3EA 1TVCA 4GGOA 4MR7B 3V8VA 2O3JA 3ZIDA 1JPNA 2M98A 3VU9B 4B4UA 1VLMA 1Y8QB 2WPDD 4OXIA 2FEPA 4GX2A 5FO0A 3DPUA 2RJOA 2RGNA 4AKEA 2GZ3A 1EK6A 2C96A 2GNAA 4S1WA 2W6JA 2PRSA 2ZTVA 3EGWA 3KKQA 4RTNA 3U61B 1L4GA 3EUEA 3IULA 2COUA 3GCZA 4IFIA 2V7GA 2I65A 4R40A 1DRVA 4YCDA 2J45A 3GGJA 1GQQA 1L7PA 1T5OA 1XFAA 5JATA 2XB6A 1N2CA 4KX5A 4A0QA 3G0HA 2C1EA 3NBFA 4HS9A 4AZ0B 4CG0A 1THTA 1SKYB 5DYGA 1Y6FA 2JNWA 2CE2X 3G7NA 3HXKA 2WTEA 3K6JA 4GVPA 3ZR4B 2VZ0A 4B3XA 2DH6A 5KSYA 2Z9DA 3KR0A 4RFVA 2O0KA 5GTDA 1SUEA 5IVIA 4IFTA 1UXHA 5FJJA 5LDGA 2Y67A 5T41A 1E66A 1I7LA 2OVBA 3T35A 1E3JA 1QGDA 4DSOA 3I1YA 2O8CA 2ZRPA 3GO4A 4MYHA 2G07A 4XRGA 3E23A 3L8ZA 4PYRA 5DHTA 3THOA 1Y6GA 1CZKA 4YK7A 4F38A 5AFSA 4KIJA 5A5DA 1ZG3A 3WSTA 4XH9B 2H3EA 4CT4B 1KO7A 3FZNA 3M9WA 4P5PA 3C74A 1EGHA 2XOKD 3ZV5A 4OI4A 2H59A 1R12A 3HR4A 1KEEB 1XZHA 4MI6A 1RI4A 4UFNA 5CNIA 5MGBA 2DR3A 4RLFA 2BL4A 2NUBA 4IXWA 5B58C 3MD9A 4FFLA 4ZKEA 1P75A 3VR2A 3D8BA 2HD4A 4P3NA 5F76A 2R8BA 2NZWA 2BJWA 1LQ2A 2G06A 2AOWA 2YFHA 4H77A 2ILTA 5JDIC 1RM5A 2EKQA 4UHKA 2AJ8A 2A59A 1EFVB 4DC9A 3RUPA 2PD3A 3TTUA 5HHTA 2JLVA 3LUPA 1QG2A 3FKQA 3GRCA 2NQTA 3BKWA 4QXOA 4S12A 4H1UA 3S1AB 2WFAA 1NMQA 4IDFA 1Q2UA 3RBAA 1ENYA 4NENB 3ZBPA 2X14A 5HJ2A 1D0IA 1NQAO 1Y9ZA 4K9SA 1B26A 2XUHA 3IX7A 4Q4AA 5FAXA 4ZOQI 2AE2A 2AOTB 1Z82A 2P7IA 1SVUA 4N9WA 1I9CA 2Q5FA 1X14A 2DXIA 3WLSA 3QOXA 6GPBA 1UC9A 1P7YA 4Z1MA 4RDIA 4EELA 2VTBA 4UCFA 5HF5A 4UEQA 5FP0A 4U39A 1AK2A 3VR1A 1UDXA 3L8FA 4I8XA 1DAGA 1J24A 4MYRA 3VRHA 4DA7A 2QP3A 2FB9A 2YS7A 4KVGA 3NIGB 4AQDA 3MVEA 4TS1A 4J0EA 5P21A 4FMCF 1NVDA 2CJFA 2G88A 1IWBB 1RPTA 4L72A 1L5KA 2C42A 1ND6A 3AFNA 2XRZA 4RGBA 4R2XA 3M5WA 1VJDA 1YZNA 3PC7A 1YS9A 5AICA 4GE3A 1MW8X 3G2KA 4POOA 621PA 2VYFA 1WMEA 4QKQA 4AO7A 3MJTA 5KQLA 1QHFA 2NNWB 3EVCA 5B57C 3K73O 3JQAD 2J4DA 4Q4JB 4OQYA 4NMMA 3PR3A 2IELA 4A2WA 1E5TA 1IXYA 4IUCS 3H9UA 4CIWA 2J0UA 3H4VA 2CHEA 4QUAA 3OIWA 4TS4A 2JGJA 3UGKA 3I23A 2E48A 4KOEC 1LI7A 4CIBA 4W5OA 3RU3A 1RM3A 2HI0A 2HV8A 5E1MA 5E3IA 4C0KA 4BGDA 1GPUA 1U80A 3MWDB 4AY5A 2DHRA 1OFUA 2PKWA 4BZPA 1CNMA 1NU6A 4U7JA 1RRGA 1ZGGA 2EJTA 5C8VA 1J0CA 5K0BA 4B3FX 3TK1A 1JWBB 1U6IA 2BR5A 4MV0A 5C32A 2CLDX 5DX8A 2IY9A 1H2HA 3FPEA 4Q82A 4HKTA 5JEDA 3GIWA 1NTOA 5GVRA 2O7SA 4WNYA 2G1KA 1DCKA 4FB5A 2O8FB 3WLNA 1LPBB 1OHHD 4TTVA 1MTOA 4EA9A 4CCAA 3M3PA 2GBFA 1Z5PA 3DCNA 2J3DA 5LU9A 2HK6A 1XZNA 5I5GA 2PS0A 3ZIUA 3ZZTA 1L4HA 5GZ3A 1WIWA 6ADHA 3CRZA 4DPMA 1KJJA 2HGSA 3JQAA 4EOGA 1RWQA 3T9BA 1HDEA 1QM5A 2I87A 2JGNA 1Q21A 1M1XB 4LXHA 2PZJA 2BUBA 3TW8A 1EBUA 4YMIA 1AF4A 5CVVA 1RHRA 2YY6A 4R8KA 3KWLA 1CNFA 5F33A 4NBWA 5EHQA 1GDTA 3NYWA 4OHYA 3D8TA 1IBMB 1AIPA 1UBCA 1B2LA 3LECA 4GZMA 5I7RA 4F5EA 1SBYA 1QYIA 3GW8A 4B2PA 2MSKA 3C3BA 2DWPA 1ZUNB 2PWYA 3LQ1A 4IIJA 1N1EA 5H5JA 4MAAA 4RPCA 3OCVA 5DBFA 5C1DA 3WGMA 2R3SA 5EPOA 1C7FA 2BM9A 1ULAA 3KOXA 1KRHA 1XJWA 5GONA 2HF2A 3W8RA 1PNVA 4WN9A 1PSDA 1K7XB 1XAIA 3W2TA 1UKAA 1Z5VA 2OZEA 4FPXA 3COPA 4NU0A 4GE0A 2JG3A 1NVAA 3I1FA 2HJGA 2Y77A 3I34X 4YI3A 5KJEA 4X0EA 4LFBB 5TS2A 1HOTA 2BEVA 3BX1A 3F3SA 3A2KA 1YRLA 2BBSA 4D2IA 3LYUA 4JL8A 4JXKA 4UEWA 4CDNA 4C2UA 1Y6RA 1JG7A 4LYFA 4NPCA 1FDSA 2O5VA 2I34A 4FQ8A 4BBJA 1FP2A 2JIZA 2LR0A 4X24A 1FFBA 2QD1A 3AFIA 1IQRA 3ILSA 2W9XA 1A4XA 5HDBB 1TK3A 1U8CB 5E0OA 1R9NA 3U40A 2ABWA 3MELA 2X1LA 1WU7A 2HU7A 2I2BA 3UC9A 3EOAI 4EX6A 5HDQA 5DIZA 4V0MA 3IOBA 4MR8A 2WBLC 5HBRA 1IK6A 2AJLI 2CD9A 1ENZA 1EVYA 3GAZA 3UFXA 3HADA 4TRNA 3ACDA 1TJ3A 1IOVA 4JR1A 1IVSA 1NOIA 2D5BA 4N54A 2NO9A 1Y8QA 3W4JA 3I8XA 4HR7A 4OSPA 3H6HA 2ZWMA 4RIFA 3SAJA 4DCCA 1ZJZA 4DA8A 4W7IA 5CAEB 4D5GA 2NO0A 4OLHA 4O4LB 2IV7A 4LSGA 1HZJA 1GZHB 4G26A 3EIEA 4AN1A 4D57A 2VHWA 2GH1A 2IP4A 2I66A 2NSLA 2QNBA 3FTNA 3GJYA 3GEHA 3NR2A 1A95A 4LWPA 4JVMA 4MB2A 4KWEA 2MYTA 3E9MA 3AB8A 4DQXA 2VZLA 4V1CB 1RI2A 4W82A 4W1RA 4AYTA 4BLVA 2ORYA 3FPCA 3H2KA 4J9UE 4C6SA 4RU1A 5E4JA 1JMVA 1QO0A 3NHMA 5BV2P 5AOCA 4AI6A 1UOQA 1P72A 3AONB 1MCZA 4HMQA 2O3SA 4TKVB 5TE9A 2F4NA 4V39A 4F8YA 3RDPA 2AZDA 2I99A 5EWJA 3EIHA 3CZCA 1MC4A 4URFA 4LW8A 3L49A 4W5JA 1M8GA 4UVHA 1I2BA 4KPUA 4NWIA 3SI7A 4E5DA 1CUUA 1BD4A 4LE1A 4M6WB 1KQ3A 1WZCA 4MQEA 4B3SB 1A2BA 1HK7A 4AMZA 2UZ1A 2JVKA 1P2GA 4TKUA 4UM7A 4B85A 5A1TA 1SOWA 1MOPA 5AUPB 1CR6A 4RMIA 4DLVA 4PCLA 2GEUA 1G8GA 3WDLA 5EWJB 2JEYA 5HQ3B 2ADFA 4EA6A 1GTRA 1E2QA 1M8FA 3CJTA 1WQ4A 4FMPA 1WVIA 3GWZA 1Y7HA 3R2JA 1B8OA 1VL5A 4QOSA 2NUAA 3HY3A 4ON9A 4TSFD 1T4MA 3H5AA 2HHJA 4IDEA 5JAIA 5H3LA 2P2CA 3FPFA 1V96A 1ZQ9A 5B4TA 1SCQA 2L0XA 3TEMA 1N77A 3K1TA 3ICEA 4IHKA 4Q47A 2Y8EA 3RFVA 1ONPA 2ENUA 1US8A 1BXRA 2JAWA 3AZQA 3EHDA 4M1SA 5BVHA 3T4UA 2XTNA 5LKAA 5AJVB 1Q15A 3QSYA 4E5MA 3CUYA 1U9IC 2YYAA 3NOVA 4JEIA 4MQ5A 2DFPA 5TGTA 3UHPA 5JHGB 8GPBA 1RXYA 1Z38A 1LJ8A 2LKCA 3B3FA 3ET5A 3HVIA 3I53A 3JWPA 2ZE5A 4PHFA 1N34B 1J8FA 2XE8A 2ZCUA 3CF4G 3T7TA 3VOSA 3WLAA 1C29B 1V16B 1Z68A 2XNHA 4CNQA 5IFLA 4FI3F 3GAMA 1ZVKA 3O92A 2IYFA 1NN3A 1R0XA 3GP3A 4QJBA 4IH9A 4WTOA 5J40A 4YRCA 1KJ9A 1FJXA 2PBFA 4ZAVA 5DJ5A 1M6HA 2C4WA 3U9LA 1E98A 2GF0A 3FAKA 4F4IA 4YO8A 1SG0A 1Q5PA 4ZIRA 5EIWA 1Z8DA 2HX1A 2C9ZA 5WRFA 5I01A 1A9XA 5AVWA 4C21A 4UHFA 4CM9D 2Z95A 3MWGA 1UBTS 4LS3A 3WLHA 1YBMA 1GGKA 4HY3A 2GA9A 3HU1A 3NASA 4I81A 2QJFA 4XQGA 3RIYA 4DQLA 4Z6KA 4QXRA 1QAOA 4Y7CA 2WV7A 4PYQA 5FOUA 3ZLBA 3WICA 3IQIX 2Z43A 5LLTA 4YRLA 2PAFA 2WJZB 3LBIA 3PFBA 2O19A 2RIRA 2ARKA 2VUTA 3ENVA 3VSCA 3TW0A 2W6ZA 2QA5A 1G291 1IUPA 3H16A 3DM5A 4PZUA 5I3ZA 3ENQA 1DIRA 2A92A 3THSA 4EKGA 3GBVA 4YAWA 4YJGA 3OFND 2B1RA 2C58A 2G3YA 2JRLA 3DAYA 3LPCA 4UTRA 1DC4A 2X8JB 2Z83A 4Q4DA 3S7ZA 4ZGWA 3AQIA 5TF0A 3TRIA 4IDBA 1R8XA 2YHUA 2XUIA 4YAFA 1JG3A 4AT1A 1JTVA 3E5RA 3H8SA 2Q3HA 2ZJBA 1I3LA 4KQMA 4CIXA 5IJZA 1W5TA 3UWPA 5MN6A 1KEKA 1ISMA 3HJBA 1JV2B 1LSSA 4YRRA 3H42B 1P0CA 5HE8A 5HUJA 1AKNA 4E5PA 5ARDA 1WBDA 2W6NA 3HO8A 3EVNA 5FPPA 3ZK7A 2QG6A 1ECFA 4FDAA 5EZSA 3H84A 2YC2C 4FFSA 2O54A 4PV7A 1XXHB 3F46A 5B6PA 4QDTA 3V7NA 4M8KA 3VC1A 4B81A 4HB2A 4BGUA 2R97A 3K0AA 2VP0A 3SP1A 1TTTA 2HNKA 3E8MA 1VHDA 4C7OA 1FNMA 2C5AA 3UQYS 1SUFA 1Z62A 2WD9A 4WCDA 1KQFA 4BASA 3AH8A 4Q1FA 4LY6A 5ALJA 5K7SA 2A1TS 3G85A 1XMPA 4M55A 4UVIA 4BFCA 4EO4A 2QGZA 4F2HA 5JRZA 1U2EA 1CZRA 4KMOA 4CEHB 2YJTD 4FJ0A 1H69A 1R0CA 2AG5A 2AYZA 2C9CA 4WBSA 1NFFA 5FOQA 2AIRA 1JR3D 4C2AA 4FZJA 2SECE 3JD2A 1CF2O 4U7TB 5H3HA 1ZI6A 2WI8A 3WLLA 4LY3A 4JP5A 2VEDA 1WMDA 4OG2A 3GJ7A 2EBFX 2R6ZA 3TOVA 1K4YA 4Q9LA 4Z51A 2KI5A 5EMNA 1QZXA 5IASA 3V1LA 3I5AA 2V3VA 3EVTA 3PHJA 1W8IA 2ZT5A 4URYR 1DGQA 3H8WA 1X7WA 2H16A 4F4HA 3LX6A 5A6SA 1P1IA 1KSJA 1Q44A 1X7XA 5EIBC 3U49A 5KNBA 2AN3A 3U4CA 3DQZA 5I3CA 3QMVA 4RPIA 1X8KA 3NGXA 4KLCA 2QX9A 3U6BA 3EWAA 3AVWA 3PHCA 1E60A 3G3EA 2IDKA 1DXQA 3WAJA 4AQ7A 1B8UA 5CIWA 1QKJA 1R18A 2B5WA 3CRNA 5A9TA 2EW8A 5LDDC 1YOBA 3DB2A 5HP4A 2M6KA 5C1OA 4FIDA 4HUJA 1WXHA 5CRIA 1LDGA 1N3IA 2O2XA 2D8MA 2XUOA 2WQ6A 3UUFA 4NE7A 1KZ7B 1E3LA 2QM0A 3EH1A 1H2ZA 4G25A 4KPUB 5HTOA 1NRXA 3B89A 3MS4A 2G71A 3NIWA 2GK4A 2DP4E 4OBEA 5BYBA 4FCTA 2B21A 3G0DA 3P5BA 3I37X 3D3EA 4MIOA 1IN8A 8LDHA 1N1GA 2ZUBA 5D85A 3SS9X 4BLRA 3HJGA 3RSFA 4BP1A 4V1CI 2PLWA 3QE3A 4ZI7A 2AI2A 1MB2A 4AULA 3A6PC 4Y9DA 1ZWLA 5LYYA 1IOWA 2C7GA 4LMAA 4WY5A 3NBZC 4QHSA 4LAFA 3RVNA 3UEOA 4PZDA 2BMDA 3B7GA 2XJ4A 4FE3A 4H7IA 1RLJA 1V3QE 1VPEA 3R5HA 4DPLA 1ZJYA 4OJMX 4YJKA 5G4LA 3T0IA 5KAMA 4RGYA 5TXGA 4Z3DA 5EHZA 5LYJF 2ZVJA 1JMYA 4IHJB 2QK4A 5FKJA 4CL0A 2ZK7A 1A04A 4BMVA 2R8XA 3RC2A 3KT6A 4AS2A 2IXAA 2JGAA 3KR2A 1ZVQA 4MWCA 5DDIP 4YYEA 3WJAA 1JKFA 4BXOA 1FX1A 2GNOA 1RXEA 3TJZA 3UKDA 4B73A 1PBTA 4HZUA 1G0OA 4H2DA 5IXJA 3BC1A 2ACKA 1KBQA 1H2WA 1RJEA 2PM8A 1HBJA 1PT9A 1Z88A 4QPJC 5CX1B 5EKDA 3RSZA 3HBAA 3KALA 2A67A 5TQJA 4YP1A 2ZSIA 5JXJA 4NG5A 4FHEA 3D6FA 4GZ6A 3S1SA 3PFHA 2XMCA 4PBTA 2P1RA 4AP9A 1RM4A 1GLVA 3V2HA 2ZR0A 4G0MA 3IQHX 4KFRA 5IJ0A 1VXOA 3G9QA 1O8CA 5KTNA 3GDFA 1V5GA 4EI9A 5B3JA 5GINE 4H35A 1W85A 1HTTA 4LJSA 2ZPAA 5EJ5A 5A1JA 1Y1PA 3I0ZA 3QMPA 3UAOA 2BISA 3I83A 3ANSA 4A0HA 1HTWA 1U02A 1V95A 3H9JA 4AWXA 2FWJA 2CV1A 1MLDA 1ZUWA 4Z4GA 3VNAA 5IVPA 1MRZA 4RDXA 1OROA 4C78A 4G5HA 3L07A 3VR6A 2H0RA 2I2DA 5FWYB 2C3OA 1G7RA 2Q4TA 4L8GA 4BZQA 3RGWS 3A05A 4K9RA 5ELXA 2BTOA 4J7UA 4BJ3A 5T8KC 4EB6A 1RWKA 2OYSA 3OZSA 5EMKA 2ETXA 3WQBA 4BRZA 4CTMA 1AMNA 1DEKA 5ALWA 5C1BA 2LIVA 2CSUA 1PG2A 2UVPA 3VNBA 3VZBA 3ZCTA 4EHDA 2W6OA 1E0KA 3GVCA 5M29A 4LDAA 4WKPA 4YJ2B 3TTWA 3LFTA 3TE6A 3R6TA 5EGSA 4O2LA 5H02A 2NU7B 2FUG6 3JARB 3U1TA 4ENPA 4QT4A 3Q2KA 1YRYE 1W88B 4KTVE 3ZI0A 1XTTA 1NU8A 4ZT5A 2GBCA 1DFHA 1T9CA 3MAJA 2X8JA 2II6A 4W99A 1M2VB 3K0EA 1SB8A 2NW6A 1TPYA 1KOFA 2LXNA 2A1UA 1XTVA 2VTVA 2Z09A 3HA5A 3HZRA 3SSAA 3TVYA 1SPXA 3FI0A 3NDPA 4OHOA 3SFZA 3ERCA 5LFAA 2BLLA 3L8YA 4F56A 4KXQA 2HYIC 2A14A 3U5TA 2F9FA 3ULKA 3O93A 4MW7A 5SV2A 1SKQA 2VJMB 1VRVA 5TC4A 5CB6A 2Y0EA 2OK8A 5I7FA 1OH6A 2I3DA 4OHRA 2CXXA 2FP4B 4E31A 4U3JA 1NHWA 2R1TB 1KMCA 3OZBA 1TMKA 5KSZA 1CRPA 4JT4A 4U6SA 1QK4A 1MQSA 5CM8B 3E7PA 3ANYB 4EJ2A 4GT1A 1T9GS 3QKRB 3HKDB 4ETIA 1NXQA 2GYUA 2WM8A 5MGNA 3CR7A 3GAFA 3WKEA 4JXZA 4KE7A 2D0IA 1DS6A 3JZDA 3OOWA 3PXUA 2C3PA 2X2EA 4MKFA 5LMZA 1GA4A 5BUQA 3VAAA 1AK9A 1QZZA 2IYYA 2WNSA 3HCNA 4XLLA 4P5DA 3E3LA 1TI7A 5A3VA 7YASA 4ZV7A 3RSCA 5IK2D 2B61A 2ZE6A 3EDMA 3AR4A 2YJGA 3MBIA 2GHQA 4IOJA 4FCWA 1FRFS 2QW8A 2HUPA 4GPAA 1FU7A 1U2DA 2EZ9A 3CQ9A 4NCXA 3N05A 4LGYA 2UU9B 3M6LA 2CLOB 1QGAA 4WY8A 3N8GA 2AFVA 1Z13A 4S35A 4HGQA 3VR4A 3N76A 4FCCA 5FR1A 3VVMA 3WG9A 2OBMA 2PUBA 5EMHA 5LQRA 4KQJA 1GPJA 2A7XA 1RAIA 1GTMA 1V4BA 3MG9A 1GR0A 2Z2IA 3H18A 3PCXA 3PI7A 1Y1KE 1TUEA 3SJ7A 2O8CB 1CZHA 2H07A 3NCTA 1VYHA 4YNBA 1B0ZA 4MDFA 2AG6A 3NMUF 4FSHA 1RCTE 4DGSA 2IYAA 4KV7A 3L6RA 4YQZA 4B3DA 4BQFA 4Z1OA 1UJ2A 5K5EA 4KNWA 4M88A 4TV8A 1R6AA 1L5SA 3CIFA 5D5PA 4ZA2A 2ZRJA 3HR7A 1XZKA 4X1KA 4HDNA 3F73A 2QHXA 2YXBA 3LKZA 3URKA 5FLXA 1N33B 1E0AA 4XGQA 2ONCA 2BGKA 4UM8B 4XB2A 4BVGA 4QBIA 5JAMA 5JY1A 1EX7A 1R9JA 2Y0CA 3JVEA 8ADHA 1E3DA 2F6RA 2W2KB 3HBLA 1Y0BA 2XUKA 5GOTA 4K6HA 3PUKA 4UREA 5D2CA 4YV7A 1QIKA 2YFQA 3QX9A 3ZVKA 1GZUA 4A23A 2QVGA 3AERA 1EVZA 4IPTA 3W05A 1TW3A 3W77A 1U4OA 3OE7D 4KIWA 1FXWF 2J9YB 3EASA 1HURA 2R8EA 4KUHA 3W1EA 3EPRA 4F1WA 1J1UA 3WBFA 4DZRA 2MJLA 5AUOB 2OKGA 1QE0A 1WBJB 5BWLA 4BPBA 3WISA 3T34A 4QBTA 3H5LA 4FW9A 3MC1A 3T7JA 3K9CA 3L4BA 3X2EA 4CMIA 4ZCSA 4GZLA 1K6EA 3NX4A 3BWBA 1GYPA 3RLFA 2RH4A 1VCOA 4EYOA 2PKQP 1T36A 2BE7A 3KSRA 3IEUA 2XIJA 2COEA 3EIXA 3D6HA 3GC6A 3D43A 1ZRHA 2NT3A 4C7VA 1ZNQO 1KQGA 3NVMB 4BNJA 3PQ5A 4YMHA 5E9QA 3KE9A 2Q5OA 3AKYA 5EZ6B 1XD8A 1DAMA 1LTHR 4FYWA 3CRMA 1UQTA 5I8WA 2ATCA 1PNTA 4O08A 1XQYA 2ODPA 4L4XA 1VE7A 1XKXA 4IFBA 3CVVA 3D1JA 3QFSA 4MLZA 1NLUA 3ZQUA 4DV2B 3ZGZA 1UIRA 1PQWA 4PGHA 3TLZA 2ODEA 4KQCA 2I3ZA 2B34A 2YFYA 3PD7A 4FR0A 4DBLE 2BI4A 4G0NA 4BNDA 3GGGA 3RREA 1F4LA 2FFAA 2I33A 1OYVA 2LIPA 3B6IA 3A11A 3ANMA 4N3BA 3VHLB 4D9HA 3ITKA 1M5RA 3JQBC 1EQAA 1WP4A 3MTEA 4K28A 3AJ8A 3QE4A 1H94A 1H05A 2GD2A 4BWVA 2YHIA 4R6XA 3NTVA 4EMTA 1AU9A 1B41A 4Z7QB 4EUFA 5IEBA 2V4UA 1J09A 4J0GA 2VK2A 2J31A 4CIYA 1L3IA 4TTSA 2EKPA 4ND5A 4WX2B 1NZFA 5FPQA 2OM2A 4EZEA 4L5JA 3U7IA 3QLUA 3KFVA 1PK7A 4G5OA 1E2HA 2BEUA 3CXRA 4GKAA 4K46A 2DSNA 1EESA 1Z6GA 1XQWA 2XWJI 3I2JA 1BRMA 5JH7F 3SJUA 4GDFA 1TDJA 1NY6A 2A9FA 1GDHA 2GA8A 3B3AA 3GXOA 3IAHA 3IGFA 3TD2A 3TZCA 3B8EA 4YPFA 1PFVA 4N3GA 2MHCA 4J0CA 3C3PA 3NW9A 3BE8A 4I1RA 5LOVA 1GKYA 1JYSA 1JAYA 2IXGA 2RHGB 2VUIB 3LDAA 4AMUA 3TQHA 3PGKA 1ORDA 1X1RA 3M4ZA 4NULA 4ZARA 3S4YA 4EA8A 1VJRA 3B5IA 4B31A 2CHQA 2Z2KA 1P7WA 2BHNA 5JOQA 3M4YA 2PH7A 4D99A 2IHTA 2HCBA 3MJSA 3IR6A 3KTOA 1V7CA 1V6CA 2NSHA 2EZUA 5DNDA 4IUBS 3RAJA 1JHOA 2FN3A 3TAHA 1T3SA 4OJQA 1KEUA 5C51B 1YI1A 2XD9A 1D6SA 1XVTA 3PFWO 3KCQA 4I3FA 1GYQA 3NETA 3LT1A 1LRJA 3BJZA 1XRQA 4I3GA 1AUVA 3VDXA 1JEAA 4A6EA 3L1HA 4CKEA 2F3QA 3B13B 1HZZC 3OICA 1EX6A 3EFOB 1L8AA 3USZA 3TZEA 2ZB3A 2XWQA 1OZFA 3HJAA 5CA0B 1ISJA 4Z5XA 1D1PA 1AZLA 1NN1A 4MVJD 2GVDC 1L4EA 3ETGA 1JA1A 4KIFA 4Q37A 5FNVB 5CH3A 1Z22A 3BQMB 4L1KA 1NBHA 1Z5UA 5I6DA 5DNCA 1OWOA 1KMNA 3IKJA 2RCYA 4MI1A 3TZ6A 4Q4CA 3I39X 3GFFA 1DJNA 1FFDA 3AESA 4L22A 1KRXA 2W93A 3OCCA 4ZYZA 2RHCA 1FNBA 3DDOA 4YDRA 4D8VA 1FFGA 4LBVA 1H2BA 1UZNA 5CLQA 4F8EA 5BW4A 4DQDA 2EW1A 4LOLA 2C94A 3KAQA 5CHYA 4DR3B 1O6ZA 1RP7A 1NYTA 3O7MA 1ODCA 3ONDA 4E94A 1RTKA 1Z35A 3G79A 5GOZA 2KLHA 3HXLA 3ZS8A 4WCFB 3WK7A 2IHNA 2FRVA 2YYSA 1ECJA 3I6QA 4DKXA 5F7OA 5MF6A 1QDUA 4E0BA 5A62A 2QR2A 1HY3A 5SY4A 2AW5A 1CP2A 1S02A 1U81A 4PRYA 1NW9B 2BCJQ 2EERA 2PJZA 3D3NA 3ONWA 2ECPA 2FCAA 2O2EA 2PJUA 3ESAA 4G1MB 2NXEA 4MQLA 5K0ZA 4CKZA 3DOCA 1RXVA 1J4AA 4UHDA 5JXIA 2WIGA 3L4BC 4IHQA 2W6MA 2IZ1A 4LZLA 3NJ8A 4S1TA 2OWDA 4XPZA 3ABSB 1C3JA 1P4RA 3FDZA 1O97C 2CL0X 3P97A 5GJCA 4A2QA 2Z2JA 3OPXA 2CFTA 1QPGA 3DNMA 3NFRA 1ZMTA 4EW3A 4N12A 1AGYA 3DMYA 3QFCA 1E7YA 2J4FA 1NBWB 4GSYA 2W43A 3CLTC 3LL4A 4XVHA 3OH8A 5C7OO 2AKEA 2W6IA 4N3CA 5BSUA 2BFCA 4YRZA 1ZP6A 4NBKA 4CR6A 2XOKA 2XZLA 3EF0A 3LCCA 4D9NA 2GGSA 1BRTA 2YXNA 1ULBA 4O8ZA 1MOSA 2WUFA 3C7KA 1U0TA 3PFKA 5E6UB 3RTAA 3VTKA 1CK4A 3D4IA 4UOZA 5KYYA 3DE5X 3NONA 1W1WA 1XZEA 1DKQA 3AJAA 4OX9Y 2C83A 3WL5A 2O8DA 1QCZA 4KNVA 3CIOA 3TTVA 3ITDA 4K2AA 4S2UA 1SA0B 3CVYA 5CDFA 3SR3A 3BKXA 4BOYA 2V9ZA 4LV8B 1IEVA 4PSAA 4X7MA 5EZYB 3TRHA 3WLFA 4BFLA 4CMGA 2C99A 4XSGA 5ITVA 1HNZB 3KZOA 2FZEA 2QX4A 1YUBA 2F1IA 3A7DA 1NUAA 3FWNA 2VPWA 1TVKB 4PC1A 4OQMA 2OGSA 3C7AA 2RI1A 3Q0TA 2GKGA 2AN9A 3D3QA 3KWFA 4LHVA 3VV2A 5BSVA 4PS0A 4Q1CA 3C3CA 1FTYA 5DNWA 1F51E 2WIKA 1W0CA 4D46A 2VDOB 2ZIAA 4FLMA 1KFEB 5CA1F 4YDQA 3E3MA 3L06A 1TTPB 4JJ4A 4PXAA 3FZEA 4L15A 4R54A 4XR9A 1XK6A 1R9GA 4Y6QA 2YZ2A 3FB4A 3BCSA 3ZY6A 4E4RA 3PA8A 4YMTA 2BKVA 2QROA 2CKMA 4NV1A 4RH0A 2O0LA 4JLPA 5BNFA 4A36A 1FZQA 4BAZA 4I4CA 5BQ5A 1MN6A 1EG7A 3FG9A 1J9EA 3AO0B 3COYA 4IEFB 2BEWB 3GUCA 5CDYA 3COVA 2G5PA 4J2OA 2PZMA 3C3XA 3B9PA 3EVZA 2HJVA 4KBYA 1QYRA 4I8IA 1P62B 3LXMA 4FWIB 2X9LA 5D1NA 5ITWA 3IP1A 3UAVA 1YVRA 3D8RA 1VCMA 4MPTA 2QXTA 3CUTA 4C20A 3WAGA 1QFJA 2F59A 5L45A 1ZIDA 2D2FA 3PRKE 2I67A 3I6IA 4YBRA 1TGVA 2YOGA 5FNVA 2Q3EA 3SE0A 1HG1A 3HXPA 4OV6B 1UINA 3KJHA 4R98A 3V33A 1FCJA 5AKZA 2GD0A 5B12A 3P2YA 3V2UA 4X7RA 5C2JB 5H70A 5LM3A 2GCGA 3ZGOA 3BSYA 5FWAA 3F2VA 2BBWA 3T7AA 1NP3A 1EFLA 2BDUA 3C43A 1A0OA 1J00A 5BSRA 4YAIA 3NHBA 3DOEA 4GM4A 3KYCA 5DO9A 3BPSA 4YJ2F 4MUYA 1EA5A 2QU8A 4N8EA 5TARA 3USES 3JY6A 3W2GA 4G97A 3HXTA 5KTKA 3BD8A 2I6FA 2FWRA 4Z0PA 5K0LA 1TF2A 2NU8A 3AF1A 4RTPA 2XYRA 1SXJE 1Y33E 2QUKA 4HWSA 1KOLA 1T8TA 2AFIB 2E4YA 4H0CA 2V8OA 4NBSA 1MG0A 2JFHA 5EMJA 4OKIA 3W6ZA 2QD3A 3GLIA 5AJWA 2IA5A 5KX5F 4Q4HA 5T4BA 1KMHA 1SVSA 3AR8A 4AXBA 1OD6A 3TAXA 4XJTA 4ENQA 4NX2A 3MJFA 3EJWA 1FSPA 2YWGA 4YONB 4WXEA 2J33A 2KW5A 3O8RA 3IXQA 3I28A 1JEQA 1LC0A 1QONA 5GM1A 3MWYW 1O97D 3KT3A 1AY0A 1GTZA 2WSYB 1MHPA 2IHBA 1J0EA 1DOZA 5F5NA 3M33A 1L7XA 3T3DA 4FGSA 1EWVA 3QJ5A 2FQQA 521PA 4K03A 4OOEA 3ESRA 1TYCA 2XNJA 5EMMA 2VJYA 1VHTA 1BGWA 3UTCA 1P91A 2XA2A 3OP1A 1N5MA 2J30A 2VT2A 5SZKB 1ODLA 1EHCA 1X86B 4OH7A 1J49A 4HXGA 4L50A 2E4XA 3ROGA 1P9WA 1XRLA 3CNOA 3KETA 1T4GA 1BXGB 1EDEA 2QTTA 3PLRA 1XRNA 4PAMA 2A3NA 2PD6A 3UW1A 7AT1A 4WLNA 1R0SA 4OMUA 3S44A 4D9EA 1G8YA 3KPVA 5AK6A 1QOQB 3C8ZA 1R10A 3FWZA 4UBKA 2R1VA 2C2GA 3ON5A 1QGOA 2QTVA 5JSHA 1UBFA 2XQIA 1JEYA 4L8WB 1NPDA 4AJ1A 3ZZNA 3AVOA 2CYCA 5TT0A 3HCBA 2EP5A 4MSUA 2XVYA 4W8GA 1DKLA 2VRWA 2ZRDA 3ECAA 3EY4A 2OQVA 3DL4A 1MC8A 5L3QA 2EX4A 2Q4DA 4CHTA 5HEKA 1AN0A 1D7OA 2QM8A 3LLMA 4QXAA 1VIVA 1BOFA 2MMGA 1W4ZA 4ASUA 1OH5A 2HRDA 3RV4A 1QVZA 2X5KO 1LWNA 1BXKA 2PUVA 5T7BA 1L7EA 3HQ4O 3KQQA 4P81A 1XMSA 4CEJB 1TA9A 4OPMA 1L4FA 5CURA 2QBYB 3BEDA 3M34A 1R2QA 2FPPB 2ZREA 2OV8A 4HQFA 4QEKA 3GJQA 1Z17A 4YLYA 4B4WA 4JT8A 5L6LB 3DTNA 4OHXA 5KNLA 3OBBA 1K3FA 2JK0A 1OXBB 3C7TA 1II9A 1MX3A 1QOZA 1TOAA 4MA0A 3LBHA 3VUEA 3WTCA 4EY4A 1Y3HA 3G2IA 4J0QA 4MQEB 1QFSA 3SLRA 4YCJA 1L7VC 2JCBA 5K8IA 3B48A 3B1JA 5CW1A 1G3UA 4RENA 5AI6A 1NL3A 3TPZA 3CEHA 3DLTA 3VX4A 3GRKA 4DDHA 3JQPA 2FRDC 1SO8A 2XLBA 4HEJA 4U4AA 1VDZA 2J3JA 4HQ0A 1XMXA 2BEWA 2FSFA 1SQ5A 2X41A 4U5QA 5FA6A 1Z33A 2DU8A 1SHZA 2PMKA 1KDVA 4HH0A 4PY2A 3Q0IA 1X9IA 3ROEA 5EJ6A 3OTIA 5ALVA 2JFBA 3DE0X 3PJGA 4HXEB 4WZZA 2H9AA 2BGRA 4BV8A 4F7WA 3W6NA 3NHRA 1TQ4A 4C4SA 4EQZA 1JHQA 2G6BA 3TQCA 2VJOA 3EWIA 3OSZA 2J3MA 1FE8A 1GKUB 4HLNA 5HA5A 2H4XA 3ECCA 3TIVA 4YUXA 4OU5A 4XCQA 4YB8A 2UUBB 2BV3A 3SSOA 1J8DA 3Q3GE 3H11B 1HX7A 5JI2E 1BDMA 1ONSA 3A1WA 3QBEA 3PX2A 4N5IX 3FZQA 3LLSA 4DWOA 4XKJA 5E0KB 3GA5A 5CMLA 3VKVA 3SS8A 3MJEA 3O38A 4I4NA 3GVXA 2JI7A 3CZQA 4LYJA 4DMLA 5H68A 3R9XB 4BO5A 1ZM3A 3DR5A 3NBKA 4FYHA 1Y9JA 4YAEA 3UCFA 1NR1A 3SC4A 1YQWA 3ZW9A 2WIBA 4P2BA 3K8OE 2I7TA 3NXSA 1I6LA 1YOVB 4F1KA 2FQWA 2VQEB 3OZRA 1FVFA 4DPKA 3IP5A 3EC2A 4Z9YA 3GG9A 4P4TA 3E3AA 4YACA 2P5TB 2X22A 1SHTX 1P2VA 3DZCA 5JW6A 3D02A 4OHMA 3BSWA 3U80A 1PAUA 4OUKX 2VP6A 4QPPA 3SQOA 1QRAA 1U98A 2IRWA 5THXA 1SKBA 3HYNA 5C34B 1VPWA 3PNLA 3CSDA 4O4HF 4CUJA 5KX5B 5LPNA 3ZLUA 2DSTA 1V25A 3FMIA 5DRYA 3EC1A 1C7JA 1MENA 2FMFA 3EULA 4JENA 3SKXA 4DARA 5ICSA 3C98A 4TKZA 1NBMD 5JPIA 3FZGA 5ALUA 3NJRA 4KXNA 5IHXA 2WAXA 1L7QA 4L27A 1JJAA 1TZ2A 2QLJA 1EJ6A 3D3JA 2HPAA 4Q5IA 1SUWA 3M7IA 5J3JA 1GFIA 1TA0A 4M4SA 5JFOA 3KUDA 3GJRA 2EEPA 3H7AA 4HN9A 1F7VA 2UUAB 1KR2A 4D8YA 1MDBA 4U02A 4LGCA 4CM9A 3CJRA 3UV6A 4UAGA 4P5EA 2X0RA 1A7UA 3A58B 4Z9FA 1Q1BA 4HQLA 1XDDA 4NSNA 3C4JA 3ID6C 4ATNA 4PRKA 5CP8A 3T3IA 2D59A 3T1NA 3DONA 2PZGA 3V4VB 1JQ5A 4X7PA 1ITZA 1HKUA 3DDHA 1ZM2A 2EQ5A 3OU7A 1C3VA 3OE5A 4LZWA 3GJ4A 5TGZA 4A15A 2AYYA 2VNAA 2W7TA 2JL1A 3I32A 4HC4A 3U7RA 4CG1A 1QQTA 4MK4A 2E89A 2C88A 1I14A 4RCVA 1US8B 1PYGA 3TDKA 3BIFA 1MB0A 2QN2A 3OQJA 4QNMA 1S96A 2VQFB 5IYZF 3K5HA 3K8ZA 2UYGA 3MGCA 2VHJA 4NXNB 2C8LA 1XHLA 1MX5A 4J2TA 4PO3X 3B52X 4R1PA 1DX9A 2CVOA 2ZDGA 2YV4A 4LXTA 3T52A 1WUTA 2O57A 5DMHA 2XNKA 4AZ3B 2HCFA 2Z2XA 5DM70 4A6DA 3IH5A 3NHZA 5IAOA 4DR7B 3D7MA 1A88A 1NRWA 1HEUA 1NQ5A 5AK3A 3D6MA 5FF9A 2HPHA 3AP1A 1PIWA 4RSMA 1I4OA 4LG1A 2E5WA 3KB6A 4E3WA 3DVAA 2XT9A 2XCRB 3ICWA 4GPTA 4MKHA 3ZXUB 1LFAA 3HGQA 4L85A 3P7MA 1FX0B 1AV6A 1QAMA 2B1QA 4LOKA 1MBZA 4AX4A 3F1KA 1Z16A 1GV1A 2A5YB 3KSBC 1OXVA 2H5EA 4U7DA 5JJ5A 4MUNA 3IHWA 2REBA 3I64A 1X39A 3KWMA 2QN6A 3PC6A 4G0PA 4HX9A 4IG4A 3RI3A 5C1PA 4RTKA 4LCEA 1B73A 4LI3X 3SXUB 5KPDA 5CDFE 2GAOA 4MVJP 2B20A 2EFEB 1I7PA 1YS1X 2PL1A 3BIWA 3RYTC 3VR3D 1D1QA 3PDIA 2E4VA 5ETJA 4EDFA 1T2VA 2UUOA 1S9DA 4LBWA 3AMVA 3K0AB 4DBZA 2G77B 4QJ3A 4NNJA 2YMPA 2AFHA 3P2OA 3AHFA 5JNTA 2EG5A 4EG4A 2PR2A 4JL5A 4PBSA 2CVZA 3OFNA 3QKTA 3S0JA 3EUWA 4DLLA 3K1AA 5ES3A 4L5BA 2WAYA 1U0JA 2H2AA 3Q7IA 4Q3AA 4B35A 3AB7A 2ZVQX 2QAGC 1BWQA 2WWGA 1KYYA 4RPJA 5JNUA 3H99A 2Q6VA 3ZHOA 4HFNA 1V1MA 2WZCA 5J43A 1PZEA 1JDTA 1X7DA 2XYGA 4ZQGA 2V7WA 1J25A 3FOCA 4KK4A 3QVWA 3AIOA 5IWAB 1XTZA 2ACVA 1TU4A 2QUJA 4U2GA 3HRIA 2VJAA 1ISSA 4ALNA 4MS1B 3WL8A 1EIZA 5TQ2A 3LXUX 5K3FA 1XC7A 1ZK3A 1QVAA 3VXKA 2G40A 4BO1A 3BRWA 3T3MB 3QX8A 4MWDA 3ICCA 2ZYIA 4FBMA 4QIHA 2QRMA 4QLOA 3P45A 2ZXUA 2WQZA 2IS2A 3VZQA 2OOSA 3RWMB 1EP3B 2IGTA 2ESRA 1B3RA 1CT9A 1EUDA 3A6EA 2OWEA 2YKGA 2IS4A 4HZIA 1U63A 5JMPA 5EP4A 2FLKA 2B1JA 1J8VA 3IQZA 3KYDA 2AL7A 4ZWNA 5DN6D 4B7ZA 1L5MA 1DWUA 1RAEA 2XMDA 3T7DA 3PIRA 1MGPA 1QC5A 4H6XA 4QUIA 4F12A 5IPFA 1EA7A 1PR9A 3QBTA 4JROA 5CLIA 5B7NA 3WX0A 2NZ2A 4CT0A 4YUZA 5C5IA 4MX8A 3VZPA 2IHVA 2ZYSA 2QUZA 3SIXA 4MUKA 3EISA 3KJGA 4LYHA 4FU0A 4NOKA 4RD6A 4TLBA 3C97A 5ESWA 3RIXA 4BKOA 3LWBA 3V32A 1INLA 3KJFA 4RDHA 5FI1B 3QVLA 5CGQB 3D7LA 2XGMA 3TKYA 1VCNA 1BJRE 3PFGA 3AIKA 3K0FA 4HZUB 2UYQA 5IKOA 4Q7EA 4V2UA 2H7YA 2PA3A 2CHVA 1OX4A 1WZIA 2IYEA 3DZJA 3JQ8B 1QNFA 4FLFA 4OFXA 2VYVA 5A4JA 1AHHA 1N0HA 2QZSA 4F96A 221PA 3NUGA 4QYXA 3T0GA 3FCEA 4G37A 1OLUB 4FJ1A 4C4OA 5C4GB 1GNVA 4OP3A 1N5IA 3QMMA 2OFXA 3B60A 4V24A 1D2HA 3KOMA 5CXXA 1U3WA 2JKZA 3HUFA 1N7IA 1J0AA 4EHIA 4RS4A 5DRTA 3AEKB 2H85A 3JQDA 3O4IA 3I01M 5F2OA 2R6AA 5BN3A 2GJSA 5BN4A 3HCOA 3OEWA 4EF4A 3KQNA 2DY1A 4B8ZA 1ZH2A 3KAJA 4ZXFA 1JKJA 4JT2A 4L4ZA 3OA2A 4CKYA 2GN6A 2G17A 4KR7A 1FRVA 1H1LB 2EJCA 2BHRA 2WKWA 2ZIZA 5DFAA 1K7SN 2RMKA 3FE2A 1GAXA 2CNWD 3IQFA 1P18A 4N5HX 1W29A 3TNFA 5H9VA 1QIDA 1Q57A 4US0R 3IB6A 1HORA 1PP4A 1TYAE 2ECQA 1F06A 1VG9B 4JC8A 2ECOA 2DFNA 4Z86A 3SEZA 4F2DA 1GG5A 1PGQA 2F90A 4IOLA 2C29D 4QARA 4XQ9A 3DWFA 1PQ4A 3PWKA 4LQLA 2WT8A 5IZCC 2ODAA 1Q1NA 1UJMA 4PGAA 1F2TA 3KL2A 3MMSA 1RLMA 2WWHA 2H8KA 1U0NA 1ZCBA 5AYVA 5IBQA 3WFZA 1WW8A 4JP1A 5A5VA 2WPNA 2XF8A 3AUSA 2GEDA 2OXIA 1E3MA 1IWOA 3A9SA 1N2EA 1BVUA 2AOXA 2IXDA 1YV9A 1C3OA 2C0CA 2HMSA 4GZ5A 5MHTA 2O1WA 4R81A 5DP2A 4XYGA 3ZJVA 2FPGA 1BCSB 1QWOA 5KQGA 1QGYA 2HAEA 3DKPA 4UBOA 1AO3A 2ZBRA 1T9HA 3LW7A 2GJ8A 2J32A 5BRAA 4KO1S 4B4OA 2V03A 5F51A 4B44A 4YDHB 1K92A 2FUG1 2R6CA 4RKYA 4AM8A 5K03A 1GGFA 4XYMA 1Q0PA 4EVSA 1FRNA 4FTWA 2R6JA 4G6ZA 1EFPB 1OLXA 1CRWG 3C3YA 1USKA 3DDNA 3MAAC 1NOKA 2ES4A 3PC8C 5AHKA 3KKMA 1Z6QA 3FRHA 2NIPA 1C7QA 1QPBA 3CLSD 3AR5A 4UM9D 4BRUA 5LZ4A 3FNIA 5TJHA 3IAXA 3QQ5A 4LDNA 4KWIA 3C6ZA 1U9YA 1L3BA 3EG9B 5K0FA 1QE3A 4UUPA 5EPUA 4GPIB 1Q1QA 2XRMA 2YWHA 4A91A 2QTAA 5B6JA 1BH6A 3OQBA 2IYNA 2JLQA 3T7IA 3DZKA 1OR8A 3WLTA 4EHFA 5JQGA 2H1CA 2KSQA 3DBVO 4NQRA 4OHKA 4X92A 5AVKA 1T5DX 5AW2A 5CG1A 4QA9A 3ROXA 4WI1A 1N2BA 4LKOA 3R7LA 3WK5A 1E1QA 3X2SA 1SB9A 4EGAA 3HKEB 2I4TA 3GCGA 2A9PA 1NDUA 2WA1A 3BJMA 2C95A 3W34A 2G83A 4C4TA 1XVAA 4F21A 1XU9A 2R1TA 3HCFA 3MOIA 1QYVA 3Q8WA 2BGWA 2A5LA 1UP6A 3P9CA 3Q85A 4JQSA 4IIEA 4PFSA 3SHOA 4GKKB 4P3PA 5DYYA 4CUZA 1JMKC 2I4OA 4EFLA 3JQFA 2Q7XA 2Q21A 3HJFA 1ML4A 3CR8A 2QN1A 1V35A 5U4QA 1VMDA 4CKXA 2AD1A 3RS5A 2E3JA 1R6TA 5DM4A 3QY0A 3W5JA 4P31A 2FWNA 2OA0A 4MZXA 4DNPA 2WJPA 3PEWA 3SYTA 4U1RA 1D0SA 4X1KB 3O9VA 4YIHA 2OOKA 3EPPA 4PPQA 3IEMA 1KFBB 4FW8A 5M34A 1IULA 3OQMA 1XEAA 1BDHA 4N5LA 5G1OA 3RO7A 4A2CA 2JJ8A 3RBVA 4N48A 2UYHA 3FDIA 3OF3A 3C3JA 3ORHA 4OU4A 3RODA 4M49A 1NVWQ 5IARA 4IVQA 3SHFA 4NC9A 2BZ0A 2Z5LA 1W8DA 2GVNA 2HADA 2YS6A 5ILGA 5K3EA 1D3AA 4KV9A 2FQYA 5AM0A 1C30B 5EQDA 3PX7A 3PEYA 1P2TA 1EM8A 4WZBA 4HLDA 1J99A 2R2AA 3NP7A 1C5KA 2WD7A 4Q6WA 2ZUTA 3F2IA 4YJ3B 1DC7A 1Z0IA 1FA9A 5B3JC 3JD3A 1BX3A 1NBMA 2FPOA 4PQYA 2V54A 2W2LA 4OMDA 4X1OA 4A0FA 1Z29A 4MICA 1GGHA 1PF7E 1Q3HA 5D8DA 2QQGA 5AKHA 5DHSA 4ZOBA 1V8FA 1XCBA 2AJBA 2OZLA 1JHPA 1FP1D 4JLWA 2AZXA 2W2MA 2OMKA 1N6IA 1M34B 1Q6ZA 3FNQA 3B2EA 2PUDA 2BI8A 4O1HA 1C4WA 3EFHA 3T7RA 1V1RA 5CDGA 1IXSB 1NQUA 5T3UA 3F98A 4UZSA 1QE5A 3SBXA 4R71A 2EFDB 1NNUA 4E32A 4BVEA 2XODA 3IVCA 2QTMA 1JPUA 2QQFA 4WOJA 3TIXB 1ZEJA 1TFRA 2H11A 1NLYA 3O3NB 3ZE0B 1H5QA 3GT4A 4KPGA 1FDVA 2ZB2A 5CTJA 4BFXA 4TV8F 1QVRA 1PFWA 1D1TA 1O94D 4RACA 2O05A 1V1RB 2PKQO 4W63A 1GGNA 3TFWA 2OBNA 1QR6A 3P96A 2JH3A 4UTXA 1WZUA 4CM7A 3WC4A 3AKDA 1XCJA 1WPQA 4AKSA 5KMGA 1XMOB 3HU2A 2JANA 4MW1A 2HJ9A 1H3FA 2W5UA 1MUUA 4HJXA 3THRA 5HKAA 1YBVA 2BTEA 4Z7NB 4LN1A 2CD7A 1EUZA 1YZYA 2PT9A 3SZLA 4EYSA 2C5BA 2FK8A 4ARCA 5FUWA 5LXTB 1TW2A 3BE5A 3V8QA 2B6NA 2O48X 1WDKA 2OY0A 2O2DA 1I5OA 4FI3C 5EHNA 4DUPA 2D5IA 3FUUA 1C9YA 2ZBEA 5FFMA 4D4HA 2QZJA 5ER9A 2RK4A 4O6VA 4PYLA 4WINA 1QIJA 3CLSC 3KOOA 1QIGA 3U44A 1TL7C 4EW2A 3ZQ6A 3U3XA 4GVLA 3ZGYA 2FCRA 4B46A 2HIHA 2UV8A 2ZULA 5LCXA 1KMHB 2N9UA 3BSSA 3PC4A 1TF5A 3W5UA 1I36A 4IR7A 4UD6A 3K9BA 1UT5A 2ZVPX 4M1QA 1DTWB 1Y4AE 3NP9A 4QOIA 5B4VA 1E2JA 2OO7A 3U3ZA 3Q3VA 3WRYA 4AZSA 4DUGA 4LI0A 5FFFA 4TV8B 1Q6YA 5HUQA 1JT2A 3AEKA 3TYXA 1X1BA 3DCYA 3GJTA 3PE4A 3FYUA 1WEHA 2XCQA 5JXWA 2JFPA 4CODB 5FH9A 4LK3A 2D4HA 1IPEA 3BTSA 3K0KA 4MCAA 3TL2A 4ZZ3A 2P9GA 4CMAA 5BN5B 4RZSA 1IH8A 3KYCB 3W9SA 3AHEA 4NFYA 3ZWBA 3SJCA 4GG1A 1PZHA 1SOMA 2P62A 4HQRA 3X44A 3GLTA 4BU1A 5AVRA 3ZD6A 1HOXA 1U90A 2KE5A 2UKDA 3HB5X 4N0MA 5EXPA 2O8BA 2YC4C 1IE3A 5F5XA 4MS4A 1OVMA 5LZ7A 3S1LA 3A37A 5H16A 3IUEA 3P9IA 5D6OA 3RVOA 3OX2A 1BVHA 1FUUA 4CM3A 2W6JD 5HF8A 2FGJA 3F0TA 2QLLA 1HYQA 1Z5ZA 3IRVA 4FYYA 1N3YA 1YD7A 2YMMA 3LCRA 4S1NA 1DG1G 3IO3A 4MWEA 4PSUA 4UMVA 5CT6A 3WLMA 5A2QA 3II6X 5J4LA 1QIFA 1A8QA 5JSQA 1KWGA 4WNCA 1Y6JA 2RGCA 4ZI7F 1KK2A 4DA9A 1W35A 4NBTA 3IE1A 3KXDA 3TEFA 1WQ1R 3WYBA 1FLAA 3L1VA 2IY8A 1L7OA 4CPDA 1V2HE 1IUOA 1P4GA 3FWYA 1KAEA 3QKRA 4H31A 4GR4A 1A4IA 3PNPA 2RGYA 1CVLA 2VA8A 5CFOA 2R86A 1REQA 4KEAA 3GLHA 2G5TA 3JYPA 1XJCA 1IY8A 4EJSA 1G7SA 2PPVA 4WD3A 3TPCA 5ALXA 4BVHA 4DMMA 1H23A 2WHXA 4RA9A 1Z39A 5JS1A 1IN6A 2HDOA 2L69A 4WEQA 1L5GB 1D6MA 2ROQA 3O1LA 4UW9A 3ZU4A 4HRXA 4GOMD 4C4RA 5IXYA 2R00A 3KWJA 2AJTA 4L95C 2FF5A 3BGSA 4LHEA 2IPLA 2CDAA 3GOHA 4ER0A 1CYEA 2YFKA 1W1IA 3JZAA 4YJ3F 2AR9A 1E3QA 2LVBA 4RMJA 2WWVD 4B3HA 4ZN6A 2MIIA 2YDYA 2JLUA 3ZHZA 3EMDA 1ETUA 5KYGA 3MSXA 4I99A 5AJXA 4XLZA 3FWHA 3G2JA 5AI0A 4WLEA 5CBPB 2Q5LA 4M0UA 5DW3A 5E6SB 5C7LO 3IBCA 3IUNA 5LA6A 3TMKA 3ND8A 3GLGB 1N2ZA 1HQYE 2Y92A 2E4ZA 3EC7A 5CDSA 1ISFA 4XGIA 3CF6R 3KEGA 2CCKA 2HJWA 4K9LA 5FADA 2XOXA 3G82C 3B70A 3SDZA 1P5HA 3V8MA 5I9BA 2DBRA 2AWNA 1K86A 2QUAA 1Y4DE 3O7WA 4QM7A 4FYMA 2RGGA 3I9MA 3I4FA 4D1YA 3A2MA 4MRAA 1FSSA 1K3UB 2G1AA 2CE7A 2G9UA 2LBPA 3IPAA 3KPYA 4FYKA 1Y8AA 4YJFB 2I6UA 4PTYA 1KHHA 2WM9B 2Y1GA 2AG0A 3DUFA 3BWMA 3KQWA 1K5DA 4DANA 2MTBA 3W2IA 4EI8A 1ODTC 2BH2A 4D8XA 3K6RA 5HKLA 4UXHA 4HDSB 3KEOA 3HKCB 3BCRA 1ZMOA 2CYAA 3ZQ4A 4W6ZA 2A5DA 3AOEC 3BFXA 4HWRA 5U9CA 2VSYA 1J22A 3AV3A 3NQ41 1MJHA 1AX9A 1MKYA 4U0KA 3RJMA 4DTIA 3LP5A 2WVAA 1V39A 2EYQA 1U3VA 4IOKA 4UFPA 3L7JA 4OI1A 1CQZA 4ER5A 5KQPA 1N2HA 2RHRA 1PTKA 1XLTA 1GQYA 1BE6A 4KHPB 4YRFA 5IAEA 3GBPA 1RJGA 2GBPA 3I12A 1OH8A 1OY1A 3WGIA 2DPYA 4YQFA 5KTRA 5TQ0B 3VC7A 3ETEA 1QGUA 3W90A 1ORWA 4TXNA 1CQJB 3FGZA 4DOMA 4MUEA 1ISIA 2GM5A 2HEIA 3CH5A 4FGWA 5AP9A 4C0QC 1PJ2A 3AVTA 1GO2A 5AJTA 4PEVA 2AFIA 4UU8A 4H3HB 3U81A 3PRHA 3IAS1 2RJ3A 3LLVA 5AW4A 4P32A 1Q16A 1X8XA 4AN4A 3KV1A 1WHSA 3CKKA 2J67A 1T43A 4PE5B 3STXA 4U2CA 3HB0A 1XEXA 2GUGA 4ISBA 4WBNB 3LQKA 3LL7A 3H2IA 4EYGA 4WT7A 4C43A 4LF9B 3ZHTA 2PX4A 3SZRA 1KI6B 4N7JA 1U28A 2DTDA 4KQGA 5ELLA 1V8PA 1G66A 5JD6A 2XMSA 1KZYC 3OU6A 4JMPA 4BVFA 1IY9A 4KDCA 4GNKA 4XWOA 1QZ3A 1TC2A 2PS3A 1XEFA 3OBIA 4B79A 1RFLA 1PRYA 2VLIA 3N2GA 1ZLXA 2GT1A 1UANA 3B85A 3PDHA 4MQBA 4MRSA 1LBEA 5FPSA 4IZIA 4H1VA 4Z7OB 3A3KA 2PT7A 4ZAZA 3ZHSA 2PKEA 2JD0A 1E4YA 1DCFA 2J9XB 4RM3A 3OMXA 5LN1A 5GQSA 3DAPA 3CLTD 4NBRA 4B4VA 3ZDYB 4D43A 1OREA 5J47A 1Q3TA 4B5KA 3MJDA 4URHA 4AVYA 4F1JA 4QUGA 1II8B 3A2LA 3PDJA 1W47A 1LBIA 1G2OA 5IKMA 3C45A 1LRLA 3JRWA 4IOMA 1CC1S 5K8UA 4KIGA 3RSGA 5LOVB 3N9IA 3EQ9A 1SCUA 4IMIB 4FT4A 3CVOA 5GZ1A 3T5PA 1OH7A 3BXOA 4HPWA 4RJJA 2R7LA 1ZFNA 2RHLA 1WY5A 2VRCA 4ZANA 5TV2A 1H4SA 3MS7A 2I4MA 2FHSA 4MKIA 4RHYA 3VNQA 4ZAFA 2F2TA 3VYWA 3WTBA 1WXFA 3FCXA 5CH8A 2EL9A 2WYWA 2XWPA 3R3HA 1SCDA 1M1NA 1IBCA 1FFSA 2QV0A 3RK0A 2CMDA 1H0KA 3PKZA 4BQQA 1EHYA 1YZGA 2ZIWB 3U3MA 2GNPA 1CJVC 2YZNA 3K0CA 3SS7X 4G5QA 2ZRAA 5TMEA 4OXRA 1MEEA 2XWBF 4PSDA 1Y8ZA 2WUEA 3BMQA 3FPHA 5KB3A 1LGYA 4DR6B 4ISCA 5BR7A 4OQQA 4P36A 2JFWA 1S8OA 4LJ6A 4WUTA 3SLGA 4Z7JA 3DE1X 1T13A 3GA7A 2PUWA 3WQRA 3IUBA 2Q5CA 1Z47A 4NMHA 1X92A 3UMRA 5EXEA 4C7JA 1YR1A 1F8FA 3FJ1A 4JUFA 1ECBA 5HCUA 4DMFA 4NE2A 2E6KA 5J4HA 1DCTA 1JQJC 1E9CA 1XTKA 5FIUA 4BLUA 4QGAA 2YWCA 3OJCA 4LHYA 1MJGA 1OV4A 5JS8A 3PL1A 5IAKA 3QKSB 3HNRA 3KYJB 3ZDFA 2FK7A 5CLJA 4N9QA 4FZ5A 4IIJB 1ID1A 3DMFA 3OJFA 2NUTA 1RWNA 2QTFA 2IU3A 3AF2A 5DHAA 3RUFA 3SMQA 4NEGA 2PR7A 4R01A 1MIOA 1U2GA 2WAAA 4K9OA 2P11A 2HC9A 3K4QA 5ALRA 2Y05A 4GOKA 2Y6UA 3C8HA 5H81A 5TS3A 4GKBA 3FLEA 3AILA 3AU8A 2ZYUX 1I5RA 4NH4A 3BZBA 3GI1A 4XIFA 2OFWA 2NO6A 1T2CA 3PZBA 1AKYA 3NATA 2WB2A 3FUXA 2ZJAA 3MYRA 3P8ZA 3VR5A 2DY0A 2QTGA 3FSEA 4MKXA 3UNXA 2EYUA 1CJTC 2JCYA 2CMHA 2WR8A 4RHFA 1XVIA 4CKBA 1RYEA 3ELDA 2Q3MA 3T7KA 2XA1A 5CFZA 1CJKC 2W48A 1MJGM 4B2LA 4EO7A 5GPBA 5BSWA 1JE1A 5F98A 2OG1A 2OE2A 1NUSA 3ELYA 4I5GA 2YUIA 4FOPA 2YVUA 1UBEA 4A2PA 4G86A 3PE6A 2DPXA 2N0SA 4JB8A 5AJUA 4ZQEA 5EXTA 4ZI5A 4DCGA 1IL0A 4QBKA 3AETA 4DJ5X 3W5BA 1MO2A 2W4QA 3UFXB 4HTAA 2J7KA 1L1QA 3W4KA 3WY9A 1Y9EA 3O2SB 4NBVA 2KWIA 3KB1A 4B74A 1DADA 2QSJA 1ECLA 2BEJA 3BMOA 4DS3A 4F7DA 3G2PA 1Y80A 1LW6E 2XMZA 3KPUA 5DW0A 2LUOA 1XKTA 5A05A 3UAYA 5C31A 3KELA 5K6AA 4DUGD 4DNFA 4FEAA 2PUFA 3ONFA 5IDVA 3KFLA 1IJBA 1B43A 3DMTA 4G5SA 1OVGA 3CXUA 1JFVA 4M0FA 3U31A 121PA 4YR7A 2BUAA 1EP1B 4UJ3A 4E1VA 1M2GA 2GDJA 3VAZA 3PHGA 3N3AC 1ZD2P 2BJVA 1E2IA 5JDCC 1CIPA 4HB0A 4BU0A 2EFGA 3D4LA 3EOZA 3M49A 1DEHA 1EB8A 2GM3A 1SU7A 2AEMA 4GUAA 5FOTA 5FR2A 1YA4A 3M4XA 4CFZA 1FSFA 4LNUB 4ZYVA 4OXKA 4TLMB 5E9AA 4UDOA 3M2TA 4IQ8A 3GLUA 5BQFA 3TR0A 1AGPA 2JK1A 2P0EA 1X0VA 1WRBA 2PZBA 3GUHA 1OXTA 1SUDA 1DVRA 3HU5A 2QORA 2WP0A 5JFTA 5ANRB 3E03A 4CN9A 2PUJA 3QKIA 3R6WA 2NYRA 2SKDA 3SGLA 5IDXA 3RADC 5JYEA 1X0XA 1B14A 3IODA 1D8AA 2H5IA 5IAJA 3IP8A 4EL0A 2DECA 1FVOA 2JI6A 3BG5A 3GFPA 2JJMA 1JQKA 3L8DA 3NBUA 3LK7A 3IP7A 3OZAA 4RK4A 4XM1A 5K0JA 1JG6A 1UJ5A 4GYYA 5EZ5A 1T2DA 1WA5A 2BRUA 3C70A 2VDKB 2BZGA 4CQLB 3UFBA 1FTNA 2NZUG 5H83A 3WL7A 1KDOA 3T4XA 1KKUA 3LK6A 4RY8A 2QIOA 2QWXA 3LPMA 1LQUA 2IVZA 1T2AA 2PXAA 3FNHA 4FUQA 2DOKA 1FNCA 1DIAA 4CYMA 1ZC4A 4M21A 1EFVA 4TMZA 4ZGGA 3A1SA 2ZFUA 3R44A 5EWMA 1T4BA 2A9JA 4PM4A 2W2XA 1UK8A 5IDYA 3RJ9A 2Q1YA 2F00A 3PCTA 2MWMA 3F49S 5B1DA 1EXVA 3OZDA 2HXSA 3D5EA 4WPGA 4X84A 4YP5A 4BFSA 5EJ8A 1CXZA 4MUIA 1LWOA 3R9WA 4XAQA 1UFVA 3DLIA 3IP9A 3T7CA 3WGHA 2LTAA 1P2BA 3K5WA 3M4JA 1Y7LA 2QE7D 1A4UA 1GVHA 2JLYA 1T4CA 1U7UA 5DN9A 3CPEA 3KXIA 3MGKA 5F78A 4YT4A 4HNUA 3IE0A 4IWXA 4FS3A 3KM0A 1QRUA 1R0KA 2HY7A 2PGJA 2QZPA 4JP2A 3FPLA 3RYFA 1KO8A 2J0SA 2HTEA 3VVBA 2QTZA 4DR1B 2YV5A 1S01A 2NU8B 2AWOA 2QM3A 2QV7A 4HQKA 4IUDS 4JBYA 2IZOA 3G89A 1JHRA 2CLMB 1KPGA 5KTSA 3PDUA 4U6NA 2H1FA 4JI5B 1JUDA 3O74A 2G7ZA 3ELBA 4EEZA 3AL0C 4RDCA 4AMYA 1XQ9A 2J5QA 2I6SA 3MWKA 5HKBA 2GARA 3KJEA 2H65A 4W6QA 3SZGA 4F3KA 2DPMA 1P6XA 3N86A 4Q9JA 1ODJA 1IAQA 2IZ5A 2G0AA 2YWDA 4RHCA 1PWZA 1HI9A 4I5FA 4TPKA 3G88A 3IUMA 4HJRA 2RKWA 2VQDA 1PD1A 4OUDB 3EGCA 1VI6A 5AM1A 1LLQA 1AQLA 3HHPA 2F3RA 3HPQA 1CUSA 1GG8A 3OOEA 3P2MA 1P0QA 2BEVB 2RAUA 4GGMX 1MXFA 3H2JA 3MXOA 4V02A 3GEMA 2QLNA 4PLHA 3QVJA 2V6BA 4D0LB 4F60A 4F4FA 2AVNA 1GNSA 4DIOA 2H1WA 3LNCA 1LW7A 1YIOA 3MCAA 5D5HA 4EHJA 1XZGA 1H1DA 3LBNA 5AVZA 5IVKA 1RQ7A 1O6CA 1OUMA 1YRHA 3KJNA 3MJRA 3W5CA 4YBZA 4H60A 3ZHBA 1YDFA 1ORTA 3CNBA 1A8PA 2PLNA 3MNFA 3E1GA 3VTAA 1A9XB 1K7FB 1PJTA 3N0RA 1S8AA 2Y9MB 2F67A 1CDEA 2JCXA 1TEHA 4PO8A 3W9BA 2QSUA 4OK3A 3EA5A 1UMKA 1XK7A 1W93A 4YREA 2Q29A 2OQIA 4YMWA 4TYWA 4RK0A 2GZDA 2W2TA 3HG7A 3H5VA 1FK8A 2ADMA 3KOWA 3UJAA 3OE1A 4R5MA 3L6BA 1K0UA 1RIIA 1EUYA 2V6JA 3ZV6A 2PKCA 2WT4A 1MAWA 1DQYA 2YJZA 4UEKA 4DA0A 4DN6A 1XN1A 3VBCA 1RJWA 3Q9SA 3UGJA 2CB9A 1NUHA 1WXGA 4GO1A 3LO8A 2Q0QA 4BIMA 1R88A 5GAJA 2Q8PA 3BA1A 4AD8A 2AFHE 1PEYA 2GN4A 1I32A 4EHKA 1K6JA 3GYGA 1VJTA 1Y7IA 3G68A 5HM8A 4DILA 4CGZA 2V7PA 4ND1A 4NP6A 4JLBA 2NUTB 2V7QA 1WXDA 3IFSA 1I2CA 4TM7A 3UG7A 3T94A 4K26A 1Q0TA 4Y6GB 1SZDA 4B6OA 4D4LA 2PSSA 4DG9A 4JGIA 4LZJA 2ZRFA 1TU0A 1OHHA 6Q21A 4RKFA 3FBWA 5AXCA 2QGNA 2X58A 1HMYA 2VYNA 2XADA 4OQFA 3N5KA 4K6OA 1U31A 1SVMA 3IT3A 3Q15C 1UBLS 4MUMA 3S7TA 2OKCA 1JQLB 4HLCA 4EYQA 3R09A 3WZ2A 5EP2A 2BIFA 2IY7A 2A8YA 3NI2A 4YJ3A 4Q7QA 4KRYA 1EB9A 3C87A 1W85B 5DSXA 3F8SA 2H4HA 5K01A 2FYTA 1GTVA 2JBAB 3T7EA 1IJFA 1X7XB 1XRJA 3QE2A 1O1YA 5IT5A 3R7WA 2GD1O 3DPIA 1SRQA 4IDNA 2DBQA 1XXHE 1M2OA 2XQKA 3KR1A 5KZMB 1H8ED 1RRPA 3H4IA 3I4CA 1DCMA 4NJMA 1EWKA 3U3RA 2FZKA 5GJBA 3QVVA 1HL7A 2VP3A 1L4LA 5AR1A 4D0GA 1NM5C 1NPTO 1X9GA 4TL9A 4ZTBA 1I7DA 1SZPA 3SZOA 1JSXA 4RV5A 3T9AA 2GWHA 2IX9A 9GPBA 5KYUB 1QQBA 1HE1C 2QAIA 3IJ5A 4PGFA 3WGLA 3IMEA 5A0FA 3CZ5A 2O59A 1NX6A 5AK5A 2ZWAA 3WFIA 3HE3A 2NU7A 3JARA 4IGEA 1JI0A 2X9GA 1L3CA 1UMBB 4JA0A 2HEGA 3W5HA 1GTL1 1VA5A 1XCPA 5DTIA 4ANFA 3I4LA 3HCAA 1FW6A 5I7VA 4D97A 4C3UA 3B6JA 2R7NA 3F3YA 3S70A 3FOZA 3KK0A 3E9QA 1PGPA 4QWMA 3A27A 4EG8A 4IZHA 1NIJA 1W0KA 2HIAA 3BHMA 3X1ZA 5KTOA 2VBIA 2A1IA 2IXEA 1X7HA 2FF7A 5DM0A 2QR3A 3GG2A 1DP4A 3DTVB 4MPJA 3QXJA 4QC2A 4TRJA 3C39A 4LE2A 5J9FA 3WRXC 4NESA 1T2NA 4PYJA 5K6AC 3U09A 3O4VA 4EHNA 2QXUA 1FMCA 3R8CA 1LLUA 4NU8X 4C5AA 4YMSA 4EGQA 2JGLA 2AZTA 3IAS6 2K6GA 1NSTA 2A0YA 1P74A 4IS2A 1WF6A 3HY6A 2X19A 4XUEA 1JN0A 1YI8A 3IA2A 3B8HA 4ZVVA 4YY3B 5CIYA 1LTKA 4BO3A 1WUHS 4B3RB 1BN6A 4MHOA 2H1HA 3NXKA 2B0CA 2CCJA 3O9MA 4A73A 4DF3A 1OXUA 3K32A 3RFXA 1G8AA 4MVJM 3R0ZA 2E4UA 2J5KA 2M6RA 2I6GA 4I36A 5KQMA 2OXRA 2CF5A 2Y0BA 2ZUVA 4D98A 3KSDO 2H7XA 3WKBA 1MC5A 1DRWA 4HNAA 3MT0A 5EG5A 5G3ZA 4MMYB 3T0FA 5JZSA 3LT4A 1EJ0A 4CKCB 1W0JA 1E4EB 2BFOA 5T4EA 3W6PA 3IPRA 3ZHYA 5AIAA 2JEZA 1WBBA 1F7UA 4UOQA 3LC2O 1Z7GA 2CWWA 1DQSA 1Z5OA 2CLIB 2JF0A 2OD9A 2Z9BA 2B6HA 3B5EA 3NOOA 3FY4A 3NT4A 3PXXA 3ROQA 2MSEB 2LKDA 5J63A 2WZQA 3L7CA 10MHA 2K2WA 1N6LA 1NMXA 5ALOA 1RLTA 3UC5A 3EMKA 3UMCA 3RS0A 4G0UA 2PT5A 4CF7A 2EEZA 2UZIR 3ACBA 4EY8A 4UBIA 3PA6A 1ZISA 2BMFA 1XAJA 3LJKA 1PQPA 1WULS 3KUKA 5CFPA 1UXGA 1KJWA 2VC2B 2J3KA 4M83A 1J9GA 2BCEA 1ZM4A 2HU5A 3QWBA 4OHFA 3EG9A 3PT9A 1XTBA 3STTA 1JXMA 1F20A 2QGFA 3F7TA 4ECEA 3AM1A 2MR6A 2P30A 4M9XA 2I1QA 1YGPA 2JCSA 5KKCA 5BPHA 2WJ4A 4K1XA 1E5DA 1A1SA 2E49A 2WJAA 5J5CA 2FSVA 5ABPA 4B82A 1NNLA 1T2FA 1YR7A 2QMYA 4JLVA 3VYTB 5LP6A 4B83A 3D7SA 4U8HA 3F71A 2PNJA 4MKRA 5E2AA 5FUMA 1ZINA 1X13A 2Q3LA 2ZQZA 3CX6A 3IOEA 1B8PA 4O29A 4TMFA 1QFXA 5CYPA 5DOZA 5F7XA 4QDXA 3DXFA 5FD8A 1VHQA 2R2GA 4X95A 1CEEA 4PO9A 1RYDA 3T61A 5IMSA 2VJMA 2RHHA 3DYVA 3SICE 1Z2CA 5KOYA 3UOWA 5H82A 3TD6A 1YB5A 3N8HA 3HV2A 1RRVA 1XYGA 4MVYA 5TX7A 1Z74A 3KAKA 1XCOA 1GILA 4CL2A 4NCAA 1V3VA 5GONF 4AY6A 3SYLA 4S24A 3TE7A 2VAWA 2XD4A 3TSAA 2YCBA 1SKAA 2X0JA 4HVLA 3VZDA 4EG0A 5K0EA 1LNZA 3NTXA 2HYDA 4IQGA 4M2LA 4JUAA 3AZPA 2VYVD 4CV2A 3LE8A 2D06A 3UAXA 4OKNA 1GU1A 4Y1FA 1NJ5A 3ZCUA 4EH1A 3ER9A 2RJNA 2WJ3A 2SNIE 1U2ZA 3BOSA 4KX3A 4MGEA 5AKIA 4MVXA 5T6BA 3WMXA 3GJ5A 2WU4A 1LSJA 3L7OA 1MMFB 3VUFA 1DQRA 3GPBA 4MVJF 4DQKA 2Q4BA 4OJTA 3P4YA 4Q18A 2INGX 4TVOA 1GSOA 1GADO 2GN0A 4JDUA 2BDEA 3QYFA 1XRPA 1EGQA 5E1BA 2WILA 4GNRA 4IRMA 3RK1A 4ZOAA 2WWYA 4LJRA 1YBFA 1V6AA 3FWPA 1K8YB 4LKRA 1QS0B 1LZKA 4PNZA 2O3TA 3L4JA 1VYUA 3UMYA 5BMVF 2GN9A 3AUFA 3OC0A 4MYTA 3U9TA 2DEUA 1U94A 1NF3A 2HBYA 3PPIA 5GM2A 1P81A 1A9QA 1UXIA 4PZYA 2P3SA 4U7WA 4DMRA 3UK6A 1EGAA 1KZ6A 3FKJA 4G07A 2IKQA 1GZ5A 3UH1A 4UUOA 1K6XA 1LI5A 2WFZA 4X6UA 5CXUA 2D6FA 4QEZA 1VL1A 1Y3DE 2VDLB 3B1XA 3AF5A 1WCIA 3RFFA 4BNHA 4FDTA 1TTQB 1P5FA 2G8LA 4IDGA 3B38A 2JS7A 5KYVA 4B6JA 4MO9A 4FILA 3SF8A 5HWSA 1I1QB 5I4CA 1T8YA 4QPNA 3AHCA 2B7LA 1ID8A 2VQSA 3DNFA 1MB4A 5LBIA 1PWXA 2NVUA 2LCQA 4AP5A 4D81A 4H1HA 1J2JA 5EE5B 2NM0A 3ABRB 2FOXA 3UGQA 3NB0A 1RWPA 3NHLA 3W3AA 3BZWA 4BP3A 1JDJA 1E4EA 1BKDR 1V5IA 4OGKA 4DDUA 1LVHA 1THZA 7REQA 3L01A 4RTJA 3CX3A 3CMMA 2QMEA 3ZNPA 3E3NA 2N3ZA 3ROPA 2H1OA 1XLVA 5JUWA 2NO7A 4PWYA 4E7PA 3OTWA 1J6UA 2C9YA 5DLEA 3DZFA 5CBKA 2VP4A 3KLBA 2HA6A 4MWZA 5AVYA 5JHHB 3IJRA 1SHJA 1N92A 2IIQA 3A1DA 5FWXA 2P6MA 2PD4A 2ODWA 3EBPA 1MHTA 5JAOA 5B2EA 3STUA 5JANA 4MQFA 2G9ZA 3B6EA 3PXBA 2PL3A 4JXXA 2BFNA 3PHHA 2C31A 1HSZA 1NV8A 4R31A 3IS3A 5BUZA 3CF2A 1C7ZA 1WUJS 1D1SA 2P0AA 4LRYA 2JGIA 1SXJD 4ZPXA 1ZD8A 2IP2A 5JZ9A 3ABZA 2OYCA 8AT1A 3L0IB 1B16A 1ADGA 1KI4A 1LBTA 1NXPA 2O23A 3O3OB 1NMSA 2YWEA 4KBFA 3UB3A 2NTEA 1W7AA 3S8YA 4IO1A 4C1NA 1HRKA 1J90A 3OT4A 1L7AA 3OG9A 2GBIA 1TAQA 1QHGA 1PWHA 4UTOA 4UBJA 4IV0A 5AVUA 2Y99A 4Z4FA 4B3GA 3VKHA 3JQQA 4OBBA 3PQFA 5CCDA 2F9MA 2R7KA 1MV8A 4JI1B 4BNTA 1D5CA 1U99A 3EXG2 1LPAB 1L5ZA 3GJ6A 4MV8A 3IVGA 4TTRA 3ZW8A 5F21A 3NTOA 3PDWA 2NPIA 2RCNA 4P92A 3BGVA 1MQAA 3WSWA 4F3RA 1PFQA 4MS4B 3HCPA 1YJXA 3FFTA 1NAIA 1OKKA 1S2LA 1QLWA 2ZB8A 3A9CA 5SY6A 3U19A 4IWNA 4LBZA 4WZAE 1J5XA 3OZXA 2P9EA 2VPYA 4PFKA 3SM3A 3ZDZB 3EODA 1FLVA 2EX0A 3GHHA 3N07A 4DJDC 5HNKA 1VJ5A 1GLNA 2C2HA 2NYVA 2RGNC 5J2UA 4M60A 2Z3WA 3UK0A 3W2EA 1R0RE 2WYIA 3EVDA 2I6TA 2ATEA 4TQUS 5CDUA 5LMNB 3B78A 2OXCA 3EHEA 1Q7RA 2LCIA 4O2BF 5KNBH 2ZW9A 3B7PA 3HFJA 3I04A 1YFJA 4EGFA 1G2PA 4JL6A 2C2WA 1I4TD 3MCUA 5EJGA 2BE9A 4ND7A