1EM6A

Human liver glycogen phosphorylase a complexed with glcnac and cp-526,423
Total Genus 325
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
325
sequence length
809
structure length
787
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIVER GLYCOGEN PHOSPHORYLASE
publication title Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 325
structure length 787
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1em6A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1em6A01
2KS6A 3OKAA 4RIEA 4WACA 4M83A 2PYIA 9GPBA 3ZCRA 3Q3EA 2C4MA 1UZUA 3AMVA 3L7DA 4NC9A 2BGTA 3MS7A 1F6DA 1BX3A 1NLMA 3GUHA 1NOKA 3HBMA 4MI6A 1E1YA 1WV0A 4YI5A 3MS4A 3NP7A 1P4GA 3ZCTA 5TMEA 2IYAA 1FTYA 3VDNB 2G9UA 3S0JA 2QN9A 2PRJA 2ASVA 1PYGA 3OT5A 3RT1A 4AN4A 2X0FA 1JG6A 3IAAA 2QN3A 2QLLA 3TAXA 1RZUA 2XCIA 4GYYA 1L5SA 2IEIA 2IV7A 5JTTA 1UQTA 3T3GA 1C8LA 4X7RA 2GM9A 4M60A 4AMGA 1B4DA 1K06A 4GPBA 1P4JA 2SKDA 5TVGA 1C50A 2VSNA 1YA6A 4W6QA 3QHPA 3CV3A 1GPBA 2SKEA 3OKPA 3MT8A 2R60A 2PYDA 4GZ5A 1NOIA 4WADA 1SXQA 2IUYA 4X7PA 2GEJA 3WAGA 1J39A 2AZDA 2F9FA 3BDAA 1L5RA 1JG7A 3MT9A 3G2IA 5DLDA 1P2GA 2VCHA 3H4IA 4CTMA 2XA9A 3SYRA 2QNBA 4EKEA 1PSWA 2WTXA 4BQIA 1LWOA 2QRQA 2IYFA 1VGVA 2GEKA 2F3UA 1P2DA 3OTHA 2FETA 3CUTA 2H1FA 1GGNA 3EBOA 3D1JA 3CUVA 1Z62A 5BNWA 2F3SA 2IV3A 3MTBA 4X7MA 1JIXA 3UYKA 3MRXA 4CTOA 2JJMA 4MI9A 4RIGA 1PNVA 3OY7A 4M7PA 1EXVA 3GPBA 3ZCPA 3CEHA 4HWGA 1GFZA 4HLNA 2SKCA 3G2JA 2VSYA 4BQFA 3OTIA 3WADA 3BCSA 4EL0A 2G9QA 3SYMA 1RRVA 1IIRA 4Z5XA 1AXRA 4RIHA 2QZSA 2AV6A 3CEJA 2XGSA 2GT1A 3E3OA 2G9VA 4F9FA 1O6CA 1WUYA 1NZDA 1XV5A 4AMBA 2O6LA 2P6PA 3S2UA 5LQDA 4GYWA 2F3PA 4G2TA 5I45A 2F3QA 2FF5A 1L7XA 2XA1A 3G2LA 3G2KA 4N3BA 3NAZA 3L7AA 2GJ4A 1WW2A 3ZCVA 3G2HA 3OY2A 1FU4A 4MI3A 1Y8ZA 3DDWA 4N3AA 3H4TA 3NCHA 4RIFA 1F0KA 3UYLA 5TMBA 8GPBA 2XA2A 3C48A 1GPYA 2QRHA 6GPBA 2GPAA 1EM6A 4CTNA 1NZFA 5GPBA 1JIUA 2R66A 3T3DA 4EKYA 1XKXA 1L5VA 3E3LA 4AY5A 1GG8A 3HBNA 3BD8A 1P2BA 3BCUA 1E4OA 4L22A 1FU7A 4NESA 3ZCQA 1C3JA 4F97A 2X0EA 3L79A 1L5QA 4KQ1A 1A8IA 1C8KA 3RHZA 2H1HA 3BD6A 3CUUA 4GZ6A 1UQUA 4CDRA 4MICA 3HBFA 2PQ6A 2FFRA 4X6LA 3MTAA 5ENZA 3MSCA 3NC4A 3VUFA 3OTGA 3HBJA 3S28A 3MRTA 2R4UA 1RZVA 4RELA 2X6RA 1XL0A 1SXPA 3L7BA 3NPAA 1XL1A 3CUYA 4BQEA 4QLBA 2R68A 3NB0A 7GPBA 3G2NA 4N39A 4YI3A 3T5TA 3PE3A 3CEMA 3Q3HA 1M5RA 2AW3A 4YUAA 4MHSA 2Q6VA 4N3CA 1ABBA 3L7CA 1WV1A 3D0RA 2QRGA 5JTUA 1WW3A 3MQFA 1LWNA 2BFWA 3Q3IA 2ACVA 1Y6FA 4RBNA 3WC4A 4NEQA 1V4VA 4AY6A 1GZ5A 2BISA 1FTWA 3S27A 2ZB2A 1P4HA 1K08A 2QN1A 2QRMA 1FTQA 3T3EA 3DD1A 4FKZA 2C1ZA 5DU2A 2QRPA 4WHMA 1FC0A 3C4QA 1P29A 1GPAA 2XMPA 2C1XA 3TSAA 1Z6PA 2ACWA 2QN8A 3VDMA 2OFFA 2QN2A 2X0DA 3EBPA 1WUTA 3DDSA 1XC7A 1KTIA 4MRAA 1Z8DA 3BEOA 3CX4A 2QLNA 3BD7A 4MHOA 1FU8A 4XIFA 3MTDA 1Y6GA 3RSZA 3T3HA 4KQMA 3T3IA 3COPA 4FZRA 1L6IA 4N9WA 5DXFA 1AHPA 2IEGA 3D0QA 2AMVA 2PRIA 3TOVA 1PN3A 3IA7A 1XOIA 3ZCSA 2JZCA 4BFCA 5IKPA 2X6QA 2VG8A 4RENA 3S29A 2QN7A 2R4TA 3MS2A 4REMA 2QLMA 4EL5A 1JEJA 1HLFA 4PQGA 2ATIA 3C4VA 4GZ3A 3MRVA 3FROA 3O3CA 2XGMA 2ECPA 3DZCA 4KQ2A 1QM5A 2GPNA 2GPBA 4EJ2A 3L01A 1YGPA 1L5WA 3MBOA 5C1DA 3T7DA 5TMDA 2G9RA 1FA9A 1H5UA 1Z6QA 4LEIA 3QKWA 3PE4A 1QKJA 2YJNA 1NVKA 5D00A 4RIIA 3OKCA 3ZCUA 3E3NA 2BGUA 2JLBA 3BCRA 1IXYA 5HXAA 3RSCA 3VUEA 2HY7A 2XCUA 4XI9A 3NP9A 5D01A 5IKOA 2XGOA 2C9ZA 1FS4A 3CUWA 4F96A 4LDPA 1JIVA 2IW1A 2VCEA 1NOJA 3MT7A
chains in the Genus database with same CATH superfamily
2OXTA 1LF5A 2VIIA 4PFKA 4QGGA 2PLWA 2Z5VA 4NMMA 2XCSB 1XU9A 3A7DA 1QGYA 3JD3A 1KNXA 1PK8A 4BMPB 4EUFA 2PZMA 1Z8HA 3KOWA 2IWHA 3TPZA 3UA4A 5B12A 2KW5A 3BH0A 1FTNA 4FC7A 5F78A 4D9KA 4F3TA 5LPNA 4D99A 4NYMQ 5CA0F 1N2HA 2JI6A 3FZQA 3GW8A 3EISA 4M8NE 3KZCA 1BA3A 2ZRLA 2UZ0A 3BOSA 3KYIB 3V4ZA 2B8EA 4TZTA 3Q9NA 1ZUNB 2WVAA 2ZXEA 3IRVA 5I48A 3HTXA 2EBHX 1YUMA 2JGIA 3A14A 2P2YA 1Z7EA 5THQA 3TE6A 1EVLA 1T6NA 1XRPA 2L17A 4LY6A 4RVCA 3FSGD 1L1QA 1XU7A 1ZONA 1V4BA 4J29A 3TIVA 3ZWPA 2JAOA 3UENA 2PCJA 2WAXA 3EDRA 1GCUA 3DQZA 3AF3A 3R0VA 1NP7A 2H7XA 2PGIA 4DLPA 2QZJA 1FE8A 2ZAIA 2DUNA 2W6CX 3BMXA 5AW5A 1T9BA 1XCLA 4QULA 1USKA 2FCAA 5FX2A 5IJ9B 1ISPA 4P1ZA 5DYNA 3T35A 1U7UA 5LFAA 4GM0A 1XAGA 2KQUA 5I9TA 3TUJC 5EJ6A 4QASA 5CXUA 3KG2A 1H8HD 3MAAC 1KEWA 2D2VA 5L8VA 2XCIA 4N0EA 4PAWA 5FR1A 4NRDA 3MJRA 3F5SA 221PA 3ELWA 1UQTA 4ZZ2A 1JSCA 3WOHA 2XRZA 1Q0QA 2IHYA 4EMTA 2XT6A 3K2BA 4ZVNA 4FE4A 3R7AA 1EA7A 4KJZA 3VDRA 4EUHA 4C1NA 3PNSA 2UUBB 4OX9Y 2XKBA 3TVDA 4JIGA 2CYCA 4DHWA 1WULS 2P41A 3S6JA 2NTVA 3HKEB 1ESEA 1RYDA 1NMQA 1ZD9A 4I4TF 1G19A 1LPOA 1P77A 1H8EA 3TVYA 4K2HA 3GJSA 3I8OA 4WVFA 1Z07A 2Q8QA 3EULA 1NSTA 2O1EA 3HVHA 1NONA 1G9XA 1SC3A 4U9HS 4NH4A 4BGUA 1HE8B 2VNIA 4FCCA 3OPQA 1LLUA 1L4UA 4FUTA 2ZYAA 3EPHA 2HPZA 4KX3A 1VFNA 1WXQA 4QOJA 5JAOA 3I9NA 1MG5A 2FSHA 4MWEA 3EGEA 3E5RA 4FFRA 1DIBA 1M2GA 4EPXA 1JIJA 1YIDA 3ZU4A 3Q9LA 4ZPXA 3U62A 2VTBA 2NU7B 1UP7A 2NAPA 4OBWA 4OJNA 5F2OA 2OE2A 4C4PA 4KN5A 4R68A 1ZN7A 1USWA 4ABTA 1CBUA 4ZCQA 3LQFA 4EK9A 4CEIA 1AZSC 1LVHA 4O4IF 3LDGA 1N2IA 2UDPA 2YJ6A 3DEHA 5H3LA 2F4VB 1NVFA 4J2OA 5EJGA 4HO1X 2B7BA 1JDUA 3WGJA 2J0UA 1VP9A 4CUZA 2XUGA 2XNCA 4EKEA 1PX0A 1DV2A 3VPXA 3JQAB 4KACA 1G8MA 5EKTA 2CXUA 2F6RA 3OQOA 4IQ4A 5ALYA 2BE7A 1MT3A 2GPSA 2I8CA 3F46A 4GI7A 4K5QA 3AUXA 3EE6A 5FNVA 4WCVA 5CEEA 1EXWA 2RC6A 1BNCA 3G0HA 3EARA 4M76B 4QTYA 3AEYA 2CGEA 3U6KA 3RK0A 5FA8A 4HBGA 4JU8A 4MQ4A 4NAVA 3LKDA 4YJ3B 3ZDEA 3KQNA 4B75A 2IU3A 5J5CA 1RPTA 3AFOA 3C8MA 2EW1A 1LPAB 3IUSA 3IVMA 3ORQA 4FNAA 3LBFA 4L5BA 1J7KA 4P38A 3HRKA 2OBLA 3VPAA 4AD8A 5JNSA 5F51A 5LWQA 3PIRA 3GJ3A 2PD4A 4MVJG 3C7DB 4NMWA 3HYSA 1DI0A 2W2LA 4WCFB 1ONOA 3ZYCA 2OMKA 2VT6A 3KXPA 3MGKA 4UNQA 3GG2A 1VKZA 3RFFA 4JLMA 3T95A 1DRUA 1M9NA 1QZZA 1ISSA 3AZQA 5CUQA 1FYVA 1RWVA 1DQNA 4MTLA 2WJZB 2G9ZA 3PUHA 1X77A 3BL5A 1P60A 2VL7A 1NVMB 5KNDA 1XTJA 3UGTA 2OHOA 4PXAA 4TTVA 3DR3A 3CH7A 1IQ0A 2NPOA 3Q40A 4ZVMA 2DC1A 4GRAA 5BYBA 4BBAA 4D41A 1BU8A 4DMRA 4YQZA 3EPPA 1P5RA 3K70B 4O2BB 2FGKA 1P7ZA 3AUJB 4WLFA 5JAPA 4TYNA 5T7BA 4BQFA 3CNQS 3THOA 2FUEA 3AFMA 3VVMA 4COOA 3E35A 4LHWA 2BM1A 5JCOA 4DCMA 1RMQA 4MYTA 4PY2A 2ZAMA 3D6HA 2B98A 4IF6A 4LZJA 5DBOA 2QVYX 2PL5A 4JDUA 3HV0A 5EKDA 3VZBA 2Y05A 2XZOA 3B52X 4Z5XA 1MA3A 1GRRA 3W5JA 1QKIA 1TL7C 5TPZA 2W6IA 4QDUA 2P78A 4BIMA 1EP2B 5I9SA 1KJQA 1XRMA 1W0KD 2O0JA 1HFEL 3GU3A 3BA6A 4ZO4A 3IAM6 1EFVB 3EVFA 4QU0A 2OA0A 5TF4A 5A5DA 4V1CI 1H9CA 4CMGA 5M2QA 3R3SA 2AR0A 4ZVSA 1YB1A 3ICPA 4ML3A 4Z1MD 3AG5A 1C9MA 2AN9A 3CH5A 3JRXA 2HRRA 3QMWA 2EWMA 1XV5A 3QLUA 1GHTA 5CK4A 3RGWS 1LA2A 1WNFA 1YL5A 2ZYGA 2Z9CA 4CKCA 3BWMA 3GR6A 4IHJA 2C5LA 3FA2A 3G5UA 5SYAA 2AOUA 4LVUA 2RCNA 1B6SA 1TI7A 1WB4A 5GONA 1H6DA 2FH5B 4P98A 1UFQA 3IIIA 1NXXA 3FPSA 4JUIA 1DBWA 1RHJA 1QORA 3PD0A 4LOHA 4PU0A 1FMCA 1O3YA 4B8WA 4EW3A 4H35A 3GOQA 5CVJA 2YDYA 4QGHA 3L1UA 5A0VA 4UTVA 1Y8ZA 3BZWA 3I42A 4UCQA 4ER3A 1HY3A 1M1YA 2A9RA 3KVNA 3WTCA 3PX2A 1KY4A 2D5LA 4BWFB 2I4MA 1UIMA 1RRMA 5LP6C 2D2EA 2M9MA 3I09A 5LP6F 1R6VA 3RABA 3JVUA 1D6JA 4L27A 3UYLA 2IEDA 1IPFA 1COWD 1Y81A 2F64A 2RAVA 2XA2A 3QEOA 4OEHA 2QUKA 5AJUA 4ESOA 1EGHA 1VPVA 1K5GA 4FYXA 1BX1A 1T3ZA 3FSRA 4M3NA 1B3BA 1UPTA 1KZ6A 2VXBA 4M9ZA 4POAA 3PBKA 4XASA 3IESA 3CT6A 4NWIA 2QY9A 3ZIAD 3D8NA 3IDZA 1XMVA 1Y80A 4E3WA 4LK3A 4LYYA 4WRRA 2VFAA 4HDNA 2H54A 4QFCA 3V4OA 3U44B 2QQGA 4YRAA 1JKJA 2ZR7A 1N2CB 3LXMA 4QPJC 4TZ0A 2V7GA 3NWJA 1U2ZA 2NVUB 3ACDA 3OQJA 3WGHA 3O1IC 1XZNA 4G1CA 5AK4A 2VJQA 1POXA 5TB5A 3T1QA 4HVAA 1JP7A 4MPTA 4GI5A 4P4UA 1IJKA 3C3EA 3E22B 4Q03A 2VZ9A 1Z2NX 3QVUA 2CF6A 4QFMA 2IUEA 4R98A 5H9VA 1U8FO 3TWOA 1GAEO 1EUZA 3K0CA 1AKQA 5D1HA 5EC8A 3KQUA 3K8ZA 2CJWB 2K5UA 1HYGA 3AU8A 4GZ6A 2PR2A 1ZK3A 3KU1A 3FSEA 3KKOA 5YASA 5AOAA 1JB1A 2VI5A 4E4TA 2BFFA 4LZLA 1YQUA 4YMIA 5EESA 3LO8A 1ODLA 2Q3CA 4W8GA 3FPEA 2BHSA 1GGEA 1W49A 1CPYA 3L4SO 2W2TA 1DAMA 3S70A 4ZCIA 2NVBA 3PUJA 4C7JA 4N6OA 4TTIA 4PPQA 3EWSA 4MXDA 1PJQA 1IN8A 4MP3A 1VJ5A 2JRCA 1II8A 3ANSA 4RQTA 4QYSA 3RUEA 3FRJA 5CLJA 3NPAA 4YNBA 2XBLA 3TCXB 3BWVA 1QRSA 1GNPA 4P83A 2EWVA 3G2MA 2PKQO 2H85A 4RV9A 3HG7A 3R9WA 4RADA 2P90A 5HJ7A 1H66A 2GKOA 4FW8A 3O8OA 1EZ4A 1Q91A 3K9WA 5TJHA 1GWNA 1KS9A 3I9OA 4AIIA 5KJ6A 1YWGO 2EARA 2XNSA 3CB2A 4FYKA 5KNBD 2H65A 4RTPA 1NDUA 4EJFA 5ABPA 4N01A 2ZSBA 3E7DA 3Q2OA 2AWOA 4UNPA 5H82A 5KYUA 3N2NA 3U3DA 4BX0A 5JTUA 1M2OA 3T9DA 2HRZA 1YZVA 5TF0A 5I3ZA 1TZBA 4HMQA 5CX4A 3MQFA 4YCLA 3R8XA 3E8SA 4IWXA 1IEWA 4CIVA 4GSKA 1YQQA 1KOFA 1MGOA 2ZPAA 5AI6A 1N25A 2QYSA 4KE9A 1EZ1A 4WVLA 4DUYB 3WC4A 4CTJA 1LVUA 2OZVA 4YAKA 1L8LA 1DPGA 2QPTA 3L43A 1LH0A 2R9VA 1DBIA 3AY3A 5I7EA 2REXB 2WINI 2Z0MA 2FPIB 4HGPA 1RACA 4JBXA 4PZZA 4QDZA 1PUIA 5AM1A 2Z56A 3K4HA 4NCNA 4PLFA 3LQRA 4XUDA 1VPLA 4U39A 2WE7A 2I2XB 2ZR9A 2B61A 4FYPA 3NS7A 1OTXA 4Q4CA 5JDIC 3L7KA 2CXRA 4O25A 1LCIA 4Y6LA 2C9BA 2XUAA 3KXDA 3H86A 2WWFA 3TLAA 1RXVA 3QHQA 3HZRA 3I6MA 4BNLA 3S2FA 3OP4A 1NR7A 4X62B 5IAJA 2O8DA 4WY8A 2R44A 3PGA1 1W35A 2WU4A 4PGHA 4ZCTA 3VYTB 5J4HA 1XTIA 4YN3A 5BR1A 2FXIA 2L69A 3FOEC 5EJAA 3ZIDA 1OI4A 1TW3A 7REQB 2ZQYA 4EY5A 3ICWA 4F2DA 1TM3E 4F4CA 5FUWA 4KO4S 1Q19A 4CQMA 4Z4FA 5JI3E 3W90A 4P80A 2QN6A 3LNTA 4DA8A 1HEUA 1TVCA 1A77A 1X7ZB 4DXDA 1U7XA 2NACA 1Z5OA 1XZJA 3Q3VA 2HXYA 1V5WA 1Y5NA 3UXMA 3ESDA 4FMBB 4LGYA 4QDJA 2HT1A 5JCZA 2I4IA 3HDYA 3D1LA 8ABPA 5H0IA 2WIAA 5JDCA 5K05A 1CRLA 4BFLA 2HPHA 5CB6A 3VYVA 4LVCA 4DY6A 5AI0A 2CFRA 3ZD9A 4TOIA 4ZGBA 1P2TA 2C58A 3M5CA 3VKFA 4OTZA 3M9WA 1IONA 5HKBA 1MNQA 1EWRA 1X7GA 1GZUA 4KQCA 3GFBA 4I8IA 5GOTA 4ISCA 4CT5A 1DAEA 4XYEA 3HH8A 3DZBA 3JD1A 3BXEA 1LV7A 3RH0A 1LBEA 4H3KB 1GU1A 3QPWA 4DTIA 5EMHA 4AJHA 3AR3A 1AGXA 2MMCA 3VPCA 3QU2A 1RLMA 3TOSA 3P71T 2X6TA 8MHTA 2I2BA 4KQJA 5CVVA 1O87A 3EIXA 1YS1X 4Q4JB 5CYFA 1OT5A 1OVMA 4BAZA 1O94A 1JHOA 1WKBA 3AIOA 1E3EA 4L2IB 2VDPB 4DUZB 1PNOA 2TMYA 1JLKA 1EGMB 4CIWA 1V26A 4ITVA 2J3QA 4AAYA 1ZGZA 1THMA 4UQOA 3C3AA 5A4IS 2ATIA 2IE0A 1G3MA 3URKA 2NVOA 5KYYA 3OZGA 2II6A 3MCZA 3IAS6 5HFNA 2YZNA 1L9KA 4RY0A 3V7YA 4JI8B 4HNUA 1ID1A 2AHRA 4RVHA 3IULA 1DCTA 5IUKC 1AHIA 3D4PA 3T7RA 3DZCA 1RLJA 4EO4A 4U2CA 3VU1A 1SCKA 2C54A 1NPDA 1CJSA 1DO0A 1Y1QA 3AR6A 3CZRA 3E3MA 3G9UA 1O7JA 5JWOA 1L5WA 5IZ4A 2CLEB 2IPMA 3L6BA 2ZS7A 3TTUA 2HWWA 3E1KA 1KVRA 2UYHA 3CURA 4ZI5A 1M6VA 2IPAB 4H17A 1LSUA 3FNHA 4ITRC 4JBLA 4K6CA 2FP4B 4N0QA 3OZUA 5T6MA 3RS3A 1SUEA 1PJLA 3GAZA 4OP2A 4KDFA 4X0EA 4C4YA 4XARA 1E3WB 1TF2A 2HIMA 3AIIA 1I1QB 3O47A 1EQ2A 3WAKA 3NDRA 4OMDA 3IP8A 4IY1A 5D00A 2LTAA 4HN4B 5DN9A 5DWDA 4H7HA 3TRHA 3BSSA 4CMJA 5A3JA 5IABA 4W9NC 1HE2A 3L8HA 2O8NA 4B9EA 4ZYXA 3ROZA 3SICE 2NZWA 4HYTA 3E3NA 3PTLA 1QIIA 3F9CA 1HNXB 5HZMA 1SBZA 1YRBA 4DIUA 2A5DA 3CONA 3F8WA 1YE8A 2HWYA 3OCJA 2DM6A 2M98A 4FGWA 4PRYA 5ERYA 3W6ZA 2JHGA 4BUCA 1GZ7A 2AC7A 1E1RD 1O97C 1Y9JA 2E1PA 2XMRA 3C6YA 3ELUA 2ERYA 1IHDA 2PBFA 3DTNA 1EDBA 1ZLYA 4OI1A 4E4YA 3N2GA 4AKEA 1ISIA 4ZO6A 3K6SB 2GYUA 4JJ6A 5JBIA 4B09A 4PLYA 5JMWA 5FI5A 4NZMA 5CCEA 1NOJA 821PA 4RETA 2BSXA 4MB0A 1WXGA 1IVYA 2HQOA 3LP5A 4GKVA 5E6SB 3PICA 4BE9A 4B2YA 4OAOA 2DT8A 2JI8A 3CPHA 4I3GA 5A5GA 2MR5A 3Q3EA 1N5OX 1XGKA 3DF7A 4FEYA 3T7TA 1Y6QA 3ZE1B 5IJZA 1M34A 2IP2A 3AO0B 1XLTA 3JQQA 2IV2X 3TBKA 3UHPA 4DT1B 1AG9A 1M1XB 1NMXA 3R5TA 2PQ0A 2COKA 2OORC 2IDMA 1YVEI 1X8LA 2ZBGA 2BM8A 4MCJA 3EWAA 5ESDA 2QU7A 3KE9A 4AP5A 1KSFX 3DWFA 1P2FA 1B93A 2OZKA 2ZZKA 4D9IA 3NIGB 4ZHSA 4L50A 3FY4A 3FNIA 4YBZA 5JLJA 3PVSA 4PXYA 3GUVA 2NSDA 3DF9A 1XHEA 4BNIA 1CYDA 3V4VB 4CM4B 1KSJA 2IYVA 4HVTA 1IUKA 2A9FA 4EHNA 4N8EA 2VPTA 3E61A 3C74A 4ARIA 4Z99A 1VLVA 2QN9A 1LBSA 2ASVA 3L7IA 3KKLA 1AGRA 4JJ4A 5DCUA 3SDSA 3ZBTA 4DMFA 2WP8J 2JRLA 4B3CA 1KI8A 2I1WA 3AI1A 5I01A 2C7BA 1Q84A 4Q37A 4IKOA 5E2AA 3T9BA 1EI9A 4Q4AA 1ACJA 2AG1A 4HFRA 1UAGA 4ZP1A 3IJ5A 4CVNA 5A1TA 4AO8A 2IH4A 4ZHQF 4R31A 3IPCA 2R87A 2I2FA 1M1UA 1W4BA 2WKWA 4TLDA 3T3GA 1C8LA 1JR2A 4QZVA 4GUDA 2V7UA 4E15A 1JHXA 3ZDYB 2PQ2A 4UE2A 3S2ZA 1GVHA 3W9BA 3M6AA 2AKAB 1NVEA 2GERA 3EVCA 4JLBA 4PS0A 3T0FA 3QF4B 4YALA 4BTLA 1XPOA 4MWTA 4RY9A 2DBRA 2HU8A 2A14A 4O4JF 3RVDA 2Q3BA 4W6QA 5A7HA 2UYGA 1UKVY 2ZRFA 4RFSA 3MM4A 2XQGA 5K99A 4YAIA 1P8AA 1UPXA 3FPBA 4PR3A 4UASA 1WBDA 2J6BA 4Y6QA 3DLTA 2XAUA 1QC5A 1T8RA 3G1WA 5CFZA 5K7SA 5MFZA 4OHYA 1SUFA 2DVMA 2AI3A 2AJTA 2PH5A 3PHCA 4QOIA 4WDRA 1E9AA 3ZWXA 2R6FA 1RKUA 4BKMA 2FFQA 3A3YA 4G0WA 4GL4A 1U0JA 3NX4A 3AOGA 3IUEA 4AJ4A 1ULBA 1XEXA 4JVMA 1SURA 3G2QA 4S3MA 4C89A 3CN7A 4OHBA 4HB0A 2NSHA 2WDZA 1JGTA 4I14A 3M5DA 5TQ2B 3SS9X 4XQCA 4I3HA 3RRNA 4ZMRA 2IHUA 1GXSA 1D0VA 2H7VA 3H4IA 5EHGA 4CTMA 1UANA 4E5YA 5K0GA 1VG0B 4UC0A 5AQEA 5L4NA 1JQKA 3SYRA 1L5FA 2QNBA 3Q85A 4R9RA 4MVJF 1HQKA 2PFSA 5BWCA 1EM8B 1T3GA 4BVBA 1IXZA 1AX9A 3KWJA 1ZDMA 4MMXB 3U4HA 1CR0A 3HUUA 4QYIB 4BCCA 4OQYA 5CD1A 3OT1B 4DOMA 4AI6A 2NYVA 2V9ZA 3BKWA 2ZTMA 3MQ4A 4Q1AA 3LPAA 1CEEA 1F3LA 4IIJA 1RIIA 2BR3A 3RVOA 4GI2A 3TAUA 1V11B 4D4IA 3N39C 3O8DA 4G1FA 2Q7DA 5HUQA 3N5KA 4LX8A 4CJXA 4PINA 1MJFA 4I4IA 1Y4ZA 2OB2A 4QOHA 1RTTA 1OB2A 3NMUF 4XQ0A 2P9ZA 2BAGA 3KOUA 3PL5A 3RC2A 2KPOA 2D74A 4CW7A 1FP2A 1GZHB 3P32A 3DMNA 4FT4A 2OWEA 5K0JA 4P53A 1WTCA 3K9LA 4DJTA 1U7WA 5EGSA 5J2UA 3G8DA 1IZZA 1ZGHA 2ZJ5A 3B1VA 3O9MA 4HQOA 4MA0A 5C31A 2F8LA 3QOYA 3UWPA 2ODNA 4P4GA 2NUPA 2D5AA 1CJTC 3L4BA 2LW7A 4BVLA 1Z56C 2IZ6A 2JFGA 4UMDA 3MAJA 5F2EA 3ZY4A 1PGOA 2QTVA 2RGEA 3PI6A 1AA9A 1L1RA 1KDPA 3MWEA 4HWGA 1C7QA 5TNXA 1ZJWA 2HK8A 3NC0C 1V5FA 1KEVA 5JRDS 4DG5A 2AFVA 2QR3A 3P4XA 1FRZA 3EIWA 2I4LA 3K8YA 5ALMA 3F9RA 4TXMA 2CSUA 2OP0A 3WADA 1KYTA 1C3XA 3S2SA 3V8VA 2JW5A 4BNYA 3KQHA 1M54A 1CUVA 3E18A 5GV7A 4O33A 3MINB 1IIRA 3OLCX 3A37A 3FOBA 2GCEA 3FPAA 5B1DA 2I6TA 2QZSA 3QENA 3NQ41 4QVGA 2PTHA 2CFTA 1J0EA 4HEQA 4OM8A 3WB2A 3NWPA 1YZLA 1SXGA 3U4CA 5I4CA 1YOVB 1BCRA 5IUJC 4ZC1A 2IHJA 3NAMA 2YWXA 1UP4A 1A9SA 3RS2A 3DZ8A 1DX9A 1W1IA 2PLAA 2YWDA 1P7VA 2W2KB 5EKSA 2WTUA 1GV0A 1YS9A 1PBTA 1ZLXA 2Y2VA 4CLHA 2LPMA 4YXFA 2HGSA 1KYZA 2JJ8A 3DA8A 3FDIA 5DLQC 3BXHA 3DD5A 4BVAA 2PKRA 3NGLA 1J22A 2F3QA 2XMZA 1CDEA 2OB1A 3LQKA 4JT2A 3OJFA 5G0TA 3NAZA 6YASA 2VLIA 1IU9A 2W37A 4NBUA 1D2MA 1ZJYA 4Y1EA 4YT5A 5FADA 5JROA 5DVZA 2BFCA 5E0KB 4CLOB 5B4TA 5AO9A 2INGX 3ISVA 4N3AA 2O23A 2O5CA 4G63A 3BL8A 3IIJA 1MXFA 1JNXX 2QD5A 1QAMA 2C4NA 2DBYA 3A6GA 3BK2A 3C3KA 3LCRA 1SKYB 4FFPA 4TM7A 4ZALA 3WKAA 4AZ0A 4LXHA 4TWBA 3PD1A 4DDTA 3H3XA 4UUBA 1CTQA 1UBHS 1GTL1 2PO7A 4IIHA 4J0EA 4A4DA 2XQFA 3TS1A 5KSYA 2CL6X 1KDYA 4E3ZA 1WPRA 1VSBA 4EY4A 4RMIA 5JJIA 2AE2A 4B4DA 5DF1A 2PGNA 4N40A 3VFDA 5JD6A 4BBPA 2PL1A 2I9KA 2PR7A 2PMCA 3CLRC 4RVSA 1JIUA 1FEZA 1R0CA 4GPEA 1BQ3A 3JWPA 3T06B 1DTEA 1WJGA 4INPA 1Z4PX 1VL5A 1T4GA 2PV7A 4IICA 4J03A 3RD5A 1NJ1A 2V58A 1E6KA 3P52A 2DWOA 2JKVA 2WWVD 1EX7A 5A4MS 2PS0A 4YJFB 2YZGA 3WLFA 5KJFA 5EIXA 1ESDA 2Z1DA 5A3QA 2X14A 3ZY6A 2IZ0A 1UOEA 2R5NA 3RYIA 5BWOA 3BRSA 4LMAA 4QT0A 2G70A 2G67A 3PDWA 3WDSA 3BSWA 4K81B 2JH9A 1A8IA 4UDOA 2ASEA 1L3CA 3NH9A 5G0UA 4K46A 3LF1A 4PM4A 3V2HA 4NX2A 9LDTA 3THRA 4J0KA 2FI1A 2V1XA 4YQFA 3I61A 3VU0A 3O5AA 2HFJA 4KGVA 1GN8A 2I67A 2O0HA 3F5FA 1WABA 2PZKA 1G2OA 5JHHB 3UUFA 1L5NA 5DBHX 2VK1A 2Z9BA 1ZCBA 4HQKA 2FOLA 4XM2A 3HRHA 4FCWA 2JGLA 3TQCA 2VF2A 4FHFA 3DE2X 3F6EX 3KIPA 3QRWA 5EWMA 3VR6H 3R9XB 1U7OA 1XG5A 2ORVA 5BOSB 5DT9A 2LCIA 3DFUA 3QX9A 4UPVA 1EFAA 1E2GA 1OLUB 5B57C 2ZIWB 2MINB 1JE0A 1Y34E 1DC5A 2GLTA 2WQZA 4GR4A 3R8CA 4MW1A 5ICMA 3WB1A 1JXOA 2FWRA 2PLFA 3CZMA 1TZJA 4KPUA 1N5LA 1XTRA 4IJQA 1CLEA 2CW5A 2ANBA 3CSSA 3H2JA 4XQ9A 1IXKA 2V6JA 1U3CA 4YO8A 4EY3A 1RKQA 4OGLA 4ZXPA 3SJ7A 2F1JA 4B4KA 2PFGA 2OO5C 4J7UA 2PX6A 3NB0A 5CT9A 1O96B 2OCGA 3SF8B 3F8TA 1Z0UA 1OIVA 2N9UA 3KOOA 4ZYLA 1N1MA 4XJTA 4Z9YA 2PT5A 2I66A 3UICA 3T61A 1C9KA 3ZDFA 1GL7A 3KEGA 5KNDH 3K73O 1A5ZA 3B13B 4NMHA 1SQ6A 1NPTO 3CVXA 5F76A 1QAOA 3VYSB 4G5RA 4Q9JA 1QQ5A 1DTWB 5AHRA 1UXIA 5JARA 3NEJA 1X9GA 4R81A 2XAAA 3CH4B 3DR5A 5LBIA 3ZE2B 1EB8A 2WT8A 3H4VA 3J81k 2GS9A 3V48A 1J07A 2OD7A 2OZLA 4NZ9A 1ELOA 3IQIX 2J33A 4C43A 4YJHA 5J5AA 5LSAA 2TS1A 4AZ3A 2Z8ZA 1A8UA 1Y6ZA 5F2KA 1VJGA 5TGZA 4ZV9A 5EAIA 3O3MB 4KR6A 3S7ZA 1GSOA 3TX2A 3ABZA 1CNFA 1C1DB 1HO3A 4X94A 4O2RA 1P81A 1EHIA 4QBIA 4IXWA 3ONEA 1R6BX 1ZBDA 4UJ3A 3VH3A 5C8YF 2J8ZA 3NHRA 1OXUA 3C7CB 4UMVA 5KJEA 3PGVA 2VT7A 2ZBEA 4R01A 4B32A 4Q7MB 3LY9A 4YRZA 2CDAA 3AR4A 1NVVR 2ONZA 3WE7A 4DR6B 4C0SA 3L18A 5FL7A 4X6XA 4DR7B 4F4IA 1W47A 2QRMA 1GZDA 2QDKA 1ENPA 4NARA 1DQSA 2PU7A 5BN5B 2I71A 3REQA 1Y7PA 2QZZA 1SQSA 2Y1DA 4J76A 3PC8C 4Q48A 1SG0A 1RC8A 4PHTA 1GU0A 3IBGA 2FSFA 4QDTA 4PZ9A 3T1YB 4TL6A 3SY8A 1J0DA 5I9IA 5CG2A 4G0ZA 4QXMA 2ISQA 4URUR 4IYRA 3UH0A 1OB5A 4JLAA 4OXKA 1XF1A 4S1WA 2GSWA 1PL7A 2VK8A 4KMOA 1NLFA 3IJRA 2Q1YA 2ZOSA 3P0FA 3SSNA 4LF7B 4UTZA 1DAKA 1TC2A 2R6CA 3IQXA 1N3LA 1GFWA 3GZNB 4ITUA 5C1OA 3H9CA 5LKRA 4K9MA 2PUJA 2ZJ2A 4KGDA 3CCFA 3EPJA 2FFAA 4W6ZA 4R83A 4XYMA 2QLNA 1TEVA 5EYPA 3RSHA 3I52A 4V1CA 5I7VA 3CNHA 4B34A 4X97A 1FU8A 4UFPA 1NYTA 4TV9F 1EXMA 2WWWA 1A9YA 3FX2A 3HXMA 3NTOA 2BFDA 4I5EA 3ZW7A 5LMCA 2HJ9A 2UVPA 5EOVA 5HHTA 4C08A 2NU6B 4EUSA 4M2LA 1XMPA 2DHRA 3COPA 3AF6A 1U04A 1U0RA 1G4AE 2Q28A 3NHYA 1UQRA 4ZQFA 3W3ZB 4EI9A 5I8WA 3VTFA 2F62A 5TQVA 1YRLA 1L4HA 4AWAA 4LCJA 2VJBA 4GR9A 1A82A 1BE6A 1X8KA 5DNEA 1CX9B 4M9UA 3VVLA 3TI7A 2FLVA 1MGPA 1JBEA 2BFPA 2FMKA 2HNAA 2JIBA 2WM8A 3M1LA 3T5MA 4TL7A 3W78A 4BN4A 3BHMA 2XCRB 1IWOA 1I51A 3P9PA 2AF3C 5CFMA 2J1LA 4DCOA 1JJBA 2Q62A 3H75A 4GUAA 5SY6A 1EH5A 1I32A 3IHLA 3VU8A 2H5JA 3FNGA 1T0BA 2RKWA 3QBEA 1QIJA 1Y42X 2V0NA 2YJ4A 3R09A 4MVXA 5DASA 5CFPA 4RSMA 1JHUA 1XZEA 3CMMA 2VUUA 1HDZA 2ZCVA 3DMYA 3E0XA 4GT1A 4HS9A 5DI3A 3ZH9B 1NNEA 3HR7A 4FOPA 4ZGGA 3LHIA 5HKOA 1KE1A 4EL5A 4EA7A 3PUYA 3OCVA 2XTZA 1XMOB 2IP1A 1JMVA 1X1AA 3I6ZA 2CXSA 3I9MA 3MGGA 3OT4A 2G8NA 3PFBA 4ND7A 1LVGA 4ILKA 4NMLA 2ZVJA 4UBKA 4QBTA 4FWIB 1VPTA 1GNVA 2HIGA 1W4LA 2GNOA 2ZUVA 4EM6A 3W2IA 4EFLA 1HLGA 2XNJA 5CEFA 1KDTA 4A1FA 4LJ5A 2VYCA 1Y63A 1B00A 2Y93A 2EL7A 3GCZA 4U3JA 3I9JA 4URXR 2HBYA 1FYDA 3DBHB 5DYYA 1NJGA 5KOHA 2DP4E 1CUYA 3DPIA 4QBKA 3H11A 3CFYA 2OY0A 4DR4B 2QD4A 1SHTX 3DB1A 3QPVA 2C9CA 5JSYA 4Z7NB 1F20A 3GVIA 2L2QA 3VGPA 4B80A 1BW9A 1C2TA 5CAEA 1ZK4A 2PA3A 5EPUA 3HA2A 4GWGA 1KNQA 2Q6OA 2HV9A 3H2KA 3GCWA 3M6WA 4Q9IA 4FNMA 4BX9A 2FCRA 1D2CA 2LRHA 3RAFC 1KZ9A 1Z2DA 2NO0A 3JQFA 4M9CA 1T2AA 2EKQA 1FYWA 5BYJA 3ZEAA 3BGWA 2CDRA 3CEAA 4JDPA 4BRWA 4D81A 3L93A 3JS5A 3NNNA 1S5PA 3P2EA 1A7AA 1O97D 1UC5B 2FPPB 4LQLA 1D09A 1NM5A 1V16A 1OASA 3IUMA 1R0YA 4GQAA 1XMQB 1KMMA 4HEHA 2O2DA 3CG4A 2BGUA 2D3TA 3BCRA 3DMHA 4OUDB 4DQLA 4JP1A 2QSYA 4FE7A 3W77A 4JKIA 4RLSA 1Z06A 3EQ8A 1N7IA 1TNDA 5AXDA 4CEHB 2MSNA 2JAUA 4CLEA 4FFSA 2J3HA 1ZR4A 3EXEA 3PWSA 3AKCA 1N5RA 2VRCA 3FLEA 3N8KA 3G17A 1AN0A 1E1CA 2BW0A 4X8LA 4Z7QB 1RWPA 2VBGA 4D46A 5GJVC 2QTHA 4U2GA 1JF8A 1F2TB 3SC2B 5AOBA 1L4FA 1XXHE 4KB5A 4KK4A 1Z47A 3TSCA 1ZW1A 1XEWX 4M83A 3UWSA 3O4GA 2WKQA 4W82A 5EWLA 1TIBA 2R6DA 2QL5A 4NDZA 1T0UA 4NC9A 5BWBA 3HS3A 3KQPA 2BGTA 4HG2A 5DBIA 3TLGB 2QVGA 5BVHB 1NE2A 1KH2A 4EQ6A 5KDOA 3A4IA 1PR3A 2AYXA 4Q1FA 4XX0A 4YJ2A 1P80A 5FLYA 3M6IA 3IALA 4O3MA 4MWGA 1D2EA 4U6QA 4Q3KA 5IN5A 3ZVLA 1QFYA 3CZ5A 3K6KA 3PQ6A 1ZH0A 3Q5EA 4ND4A 5CCBA 1SELA 1M8JA 3VZSA 4TT3D 4P3YA 3IMFA 5BSRA 2J5BA 5G4KB 4JR1A 5CX1B 2IYYA 3DPSA 2JGDA 1IOVA 3DE0X 4G0PA 1XTZA 1FTYA 3ND8A 2DFVA 4HDKA 4YYZA 2RSLA 2ZUBA 2MMGA 3E23A 5AVJA 5I5GA 3MXOA 1NSYA 1XR3A 1T0HB 1FNNA 2EQ5A 4W8HA 2X2EA 3WGQA 1W9HA 2GRUA 2V74B 3GBVA 4LVNA 1PYGA 3WGZA 3BL6A 4GECA 3WRWA 2HQBA 2X19A 2IIPA 3D64A 2H5EA 4IIUA 4OFBA 4P0TA 4Q05A 5L9AA 1Y7HA 4JVLA 4RA9A 5SICE 1DX4A 4BNJA 2QLLA 5BN1A 1PUXA 1KYVA 4WI1A 2E5WA 3IMCA 4I5IA 1JXQA 4CLXA 5LD2B 5JG7A 2IV7A 5LWHA 3H9JA 2EV9A 4YH1A 3UT5A 3P9YA 3GLRA 5AJXA 5AP9A 1FFEA 3OFKA 1L1EA 2YZ2A 1P61B 3QNUA 5AI9A 1U5BB 2P27A 1SGWA 4UEJA 2PN1A 3IP7A 4N49A 4RMJA 5BXYA 4PG7A 2VDLB 4Q16A 4N41A 3P9SA 5TVGA 3UHJA 2JIQA 1RZRA 3FHLA 3VAAA 2N3ZA 1L9XA 2B1GA 2B6HA 3LKBA 5DNCA 1ZJZA 5U1PA 5CMLA 1E2PA 1UMCB 2Q2VA 3QVGA 3K92A 4FYVA 4JEUA 3EWIA 1GPJA 3PDIA 1VBKA 4Q0MA 5EWJA 3U7HB 4U6NA 1LFAA 3V2GA 3R3UA 2GASA 2WIFA 2ZM6B 4PYNA 1JJAA 3SM9A 3PKZA 3LUCA 1FDTA 2W6PA 1NQVA 3CUEF 1GO2A 3QWIA 4GLOA 2H63A 4HDRB 4FDUA 2YUIA 3EXIB 3AHHA 3DGEC 4YROA 1XZFA 5TC4A 4NQRA 4Q1EA 1T9CA 1YFZA 1YMVA 2KM1A 3B8HA 1K7CA 4O4LF 4KWCA 1W87A 1UK6A 2VCHA 1INLA 1RS0A 3BB3A 3T5GA 1PFWA 2BMDA 1UT8A 2BUAA 1NTRA 2H6EA 3PJGA 5FT9A 4EI7A 1GM5A 5JPIA 1Q2XA 3FCUB 3W2GA 2Z6QA 1UXOA 4LTDA 4JQZA 3N2KA 2DZDA 1CUFA 3OZIA 1NBAA 2CVOA 2I03A 1GSIA 3KEMA 1C7EA 3MG9A 1JYSA 1LRKA 4X8HA 2V4UA 4DDHA 4DFDA 5JXWA 5KNCH 1QKKA 2NGRA 4PHHA 4EBFA 4GX0A 4JA2A 3H6GA 1T6ZA 3ZWYA 5I4KA 3ESYA 1DFIA 2EDAA 1YRAA 2SCUB 3GRZA 3A4MA 4GP6A 2Q07A 4LWOA 1XZQA 2MSLA 4ALMA 3TECE 3JD2A 2F43A 1M72A 4OX9B 4QVKA 3AV0B 2HU2A 2LV8A 3UO8B 4DLAA 1LLFA 4DSNA 2GILA 1I4WA 3O92A 3P0JA 1T34A 3GEGA 3GROA 3IKLA 1C0PA 1QIEA 3SC6A 1HT0A 4Z3OA 2CL7X 1NW4A 3ZVKA 3H05A 1WKVA 3ICOA 1PR1A 4L5CA 1G41A 1BJKA 1Q15A 4B6OA 3O8BA 4CKEA 1G4HA 5E7MA 2QQ5A 5SV2A 3WB9A 3U1VA 1XZHA 2V54A 1ESMA 1I6LA 4R7ZA 4L3OA 2WR8A 1YQ9A 4BX3A 1P2VA 1YJQA 1Z22A 3B1WA 4QPPA 3VZDA 2JFVA 4Z4HA 4K6FA 2C9MA 1GNSA 4PWYA 5M04A 2IEBA 4L0DA 3VXKA 1DEKA 2AWNA 1PNQA 4P3XA 3QEJA 3TZHA 3QFRA 5FA5A 4BFSA 2GX6A 1SO8A 1TMYA 1IE3A 2MSWA 4J0GA 1KDZA 2RHJA 5BSUA 3U39A 3HWRA 4XAQA 4YJKA 3AI7A 2IXAA 3G5MA 4H4EA 1TU0A 4KN6A 1TK3A 2O1WA 4HLQB 4HNRA 6REQA 3UJ7A 2H4FA 4WA7A 1F2DA 1XVVA 2RGNA 2OQIA 3W8FA 1WXXA 5CB4A 1KGDA 3OX4A 1XKQA 1N8NA 3ANLA 1EWYA 3SIRA 3UJ8A 5BV2P 1BVUA 2P6MA 4I0WB 4GX5A 1D04A 4YAGA 2E5FA 4U5QA 3WRXC 5E3IA 4F72A 1EUYA 1LBHA 1T1JA 1I5RA 3FGOA 1KTVA 1AXRA 3H2ZA 1H0HA 1CXZA 1NA5A 2HADA 3NM6B 4PNHA 3RWOA 3FETA 4AY4A 2Q0QA 4XA8A 4EYKA 3HJCA 3IAEA 2ZZMA 4C3ZA 1G1MA 3SM3A 2ETXA 2MYTA 2Y2UA 2IITA 3E3OA 2HIHA 2PGXA 4RESA 3RBZA 1P45A 4IKPA 1CB7A 3GLIB 1RYHA 2WFLB 1G64A 3NHSA 3RU2A 1WUYA 3THWA 2X8LA 2NP6A 1WCIA 2AMJA 3HE3A 2D4AA 1GUBA 3KDPA 2WF5A 4PX3A 4RF2A 5BNZA 2FV8A 2I6QA 4EYSA 5C7IO 4WZBB 5G3YA 2Z2YA 3WHLA 2F3PA 1LZKA 4RD1A 5DLPA 1K7YA 1KOLA 3UQYS 1UK7A 1SD1A 3HL0A 4EG6A 5AVQA 5JCPA 1L7XA 3G2LA 4BC0A 4M38A 3DJFA 4PHFA 4ZI7A 2A0YA 5T4BA 2GJ4A 4PZCA 4NFYA 1QO7A 2GKGA 5HK8A 4EVIA 1X9IA 5JC8A 3PLAE 2DU8A 3P7MA 2XRFA 2NXJA 1C4OA 2QRZA 2WSBA 4I46A 1Z15A 1R12A 2QL7A 1I3MA 1PEKE 3M7IA 3OZCA 3R6LA 4Y2GA 3TCKA 1S8FA 2UYQA 1T9AA 2P2NA 1QIFA 4M0LA 4NU5A 4PZAA 3SJBA 2JFHA 3FHTA 3I28A 3CLRD 3PJDA 1S2MA 4KXUA 1U3DA 1YB7A 1K3UB 2H57A 2X5OA 4JT8A 4BP1A 2PL3A 1EFUA 5G1PA 1PQUA 1T4DA 2Y1WA 2QRJA 1DQRA 2I34A 3H5LA 4GI3A 4JCCA 4ZAVA 2E55A 1GGMA 3V4FA 3WBFA 2CBXA 3DP7A 2GXAA 4BEJA 2JA2A 1RYNA 1OGYA 1KI3A 1XWIA 4CTNA 3FAKA 4RY8A 1Z37A 1BJRE 3TVTA 4TRRA 3QW2A 4R7GA 4EKYA 1W2HA 4OKSA 3VKGA 3WLHA 3QEMB 4ZCSA 5AMXA 4F9GA 2FFBA 5I7SA 2Z08A 3OA2A 3AJDA 4PE5B 4NZYA 5EN4A 1J4AA 4YPOA 2PV0A 3KYBA 1HC7A 4PSKA 3FKSA 3FYCA 3GMSA 3LYLA 3Q15C 4NJMB 1JILA 5EJMA 1AMUA 2YYZA 4BLVA 1Q1BA 1FU7A 2WSYB 1HXHA 2W2XA 3DH0A 3ZXXA 1A9XA 1R0XA 4KQ1A 4PO8A 3CBGA 4RL6A 1D9ZA 1ORVA 1G7RA 1VL2A 2XWBF 3HDVA 4G89A 2REBA 3EAGA 1DFHA 2DBZA 2F3TA 5TQ0A 4UHCA 3WKEA 3WQSB 5HX7A 3E58A 4LF9B 1R8SA 1ODKA 2RI6A 1MHTA 4MYUA 4NECA 5A06A 4YAUA 3KNZA 3PGKA 2RIRA 3O2SB 5B7GA 1BXKA 3CW2A 2B37A 3VQTA 1EDEA 4NBNA 3KKEA 1VC2A 3UJ9A 4C14A 3L7JA 3HCAA 4YC7A 3Q9UA 4J94A 4A0HA 1YAJA 1OX4A 3CHYA 3D2AA 3T0IA 1YVRA 2KLBA 4AG5A 1E5XA 1RZVA 1D2RA 2CBGA 4I7EA 1I0ZA 1TM4E 5CFOA 5JPCA 3ESRA 2FN8A 3WJ7A 2IYRA 4HLDA 1T9GS 4KFTA 3RSSA 4P4SB 4D9JA 2CEAA 3SPXA 2A9JA 3H97A 1Z74A 4IVPA 1VJCA 1HFWA 3OD5A 2DHQA 3X2SA 3KUUA 5BMOA 1YOBA 2JCBA 1GT6A 2PX3A 1QMGA 1Z2EA 1FS5A 3MPOA 2B1IA 1JJFA 4N39A 4DSOA 2GD1O 3PCRB 2Q49A 1DKLA 3CCCA 4W5HA 4AS1A 1CP2A 3NHBA 4B6QA 1I2ZA 1K5DA 2C99A 4WEOA 5E6UB 4B6FA 1SG9A 1GDTA 4MHSA 2YWHA 1QIKA 4FK8A 4J7AA 5DNDA 2GBCA 3KVYA 3CVOA 4ADSG 5LQUA 4OHWA 2C61A 4EVRA 4H1VA 3PFKA 3SCZA 4KN8A 1TJPB 3RK4A 5AVRA 1ESZA 4KFRA 1XPJA 4H7JA 4KKXB 3GD7A 2X4IA 3PF9A 5IJWA 1R2QA 2BFWA 1GNQA 1KZYC 2QSZA 2VEDA 1MZPA 3PR3A 4YWJA 1K75A 1LSSA 3A6LA 2XT9A 5DN6A 5FWDA 1JWLA 1SPXA 3E5HA 3EVGA 4J49A 4NDNE 4Q24A 1GZ5A 1AD2A 3OLXA 4H0CA 3RJ9A 2HYIC 1KJNA 4C01A 4CNQA 3CWQA 1W76A 5BYKA 3TOCA 5ESXA 1SKMA 3QBDA 2CE2X 2UYCA 3GNSA 1J8DA 1IM8A 4ID3A 4RVNA 1Q7GA 4YUXA 3OZXA 2PUTA 1Y3CE 1P0QA 2WVHA 2XNDD 2OVBA 4Q47A 4M1SA 4M88A 4YQYA 2AG6A 1FFHA 1T1RA 3A32A 4M55A 3PXBA 4RMNA 1FX0B 4YVFA 2QRPA 1XAJA 4FGUA 1CR2A 2FPLA 2IF2A 3NYWA 3PVCA 1GPAA 3IERA 1K63A 3N8IA 4AYXA 4BQNA 2AN3A 4DLUA 3OU6A 1CE8B 2C1XA 3FHCB 3I37X 4OAPA 4WESA 2RG7A 1XNRB 4M46A 5J2TF 4RZ2A 4LSGA 5KQMA 5FUMA 2IRWA 5ESWA 2O8VA 3M6VA 2ZRCA 5E8RA 3VH4A 4MDEA 1DJMA 1VJ1A 4ZARA 3EBPA 2OBBA 4G97A 1D1QA 4LV8B 2BMVA 4KQGA 3ZWQA 1LJUA 4Y6RA 3HDJA 1VLHA 4Z7JA 1DP4A 4AKSA 2HD4A 2EWWA 1YZHA 1JFFA 3CLUC 4FX2A 5HIMA 4NAHA 4P3OA 3TXAA 1KJZA 2HTEA 1TW2A 1UXJA 4EECA 2HKIA 3DEZA 4DUPA 3CKYA 1YO6A 4LQDA 5EMLA 3OWOA 1FXSA 2ZJYA 3FYHA 3B7WA 1QF6A 3LRTA 5IJ0A 1DELA 1EAYA 1V96A 4F9TA 4B3SB 4UEQA 2EGHA 2OGWA 4KVAA 1UBFA 4YR7A 1A4IA 1TVKA 2JCGA 1Q95A 1YJ8A 2AN5A 1Z6GA 2XSZD 3B9QA 4M0UA 3THXB 4R0VA 2QBYA 2GZHA 5CBPB 3AVTA 3PHJA 3DHNA 3A2MA 3CVUA 1PRYA 3ZCSA 2D8MA 2C0CA 3HY6A 4DF3A 1VRCA 4Q00A 4YCSA 1EUQA 5JMPA 1T5LA 4J3FA 1H93A 4LZOA 3K3PA 1HQCA 1QIGA 2WFMA 3WNVA 5SZJA 3SYTA 2JJ1A 2XMGA 4NIMA 5GGYA 1I3KA 3KYJB 1C5KA 1HBJA 4M1YA 1CUGA 4X84A 3B38A 1BHSA 1DE0A 2A3RA 2CXPA 3UV7A 1C1HA 5D3MB 1YCGA 1KP2A 3B60A 1G5FA 4TVBA 4HX2A 4ZOLF 2JJ2A 2GBLA 4PSVA 2HUNA 4S1OA 1NVVQ 4U6SA 2AX4A 2XGMA 3AUYA 3TBHA 3LIIA 3UMSA 3D5TA 4NPCA 1WB5A 4R8MA 4OIFA 5LXTB 4L95C 5J3JA 1W36B 5D3KA 1QIMA 5D5HA 4J1TA 3WWDA 4F4FA 1BHO1 2GPNA 4GVPA 1NRWA 3SSOA 1A4RA 4JXKA 5AKLA 1CJVC 2XWJI 3PENA 5F77A 4D26A 4AN0A 1E3IA 2WU8A 2GD0A 4C30A 3HXQA 5FAKA 1V7ZA 2X9QA 2Y4OA 4LXXA 2ZSKA 2CYBA 1VB5A 5G40A 4YPVA 4WLOA 4V0QA 1VMDA 3R1IA 1NXSA 4NI5A 4QEZA 4QTUB 4D6XA 5ARBA 4Z9FA 1RRGA 5LZ4A 1OC4A 4ZO7A 2IYOA 4I4CA 1Z0IA 4JOSA 3V4LA 3W8NA 4G0QA 2XB8A 1E7MA 4CL2A 4A92A 5B37A 1SBCA 1QH1A 1Z45A 3S1AB 2R8YA 4RKEA 1QE5A 2I8AA 4LY9A 3DT8A 3TEMA 3RWMB 1H2RS 1R0ZA 2ADOA 2VT3A 1ORIA 2EJUA 3QXJA 3DZDA 3IR6A 3HR4A 1GPNA 1AKRA 3CJTA 3AG6A 1EHYA 4JI2B 3W7BA 1WCXA 1WPXA 3DWIA 4MVJP 4X20A 4CN9A 1X7WB 4G5XA 5IXSA 1HE5A 3QX7A 1QJ4A 1TUIA 3NASA 4TL8A 2VR1A 4V0NA 3VYUB 3QNMA 5B2FA 1NR5A 3WGIA 2RKOA 2VQSA 2CHGA 3CX6A 1AKMA 1VL1A 1IZ9A 1GFIA 1P1IA 3HZZA 2AFHB 4RY2A 1NN3A 4L4ZA 2HI0A 1D7OA 3AHFA 4R5HA 8ADHA 3MD9A 3RASA 3IP3A 1GFSA 3V2IA 4D02A 5TS2A 4ZPJA 4GGPA 1KK2A 2HSDA 4HN2A 1EUDA 3FOFC 2BEVA 4WD3A 2HT6A 4Q12A 1UBMS 4AZWA 2W6JA 2XB2A 1I7DA 1RPJA 4BMNA 4WK0B 1NOKA 1Z25A 2NN3C 4MI6A 3TGLA 3LDHA 1QYXA 3A1CA 4JITA 1N75A 2GD2A 3OCYA 5FWYB 1QHFA 1E6MA 4M9RA 4NZNA 3VJLA 3ZCXA 1V2HE 4ZREA 5JMTA 3AVVA 4OHCA 3QPAA 3WJ2A 5LQCA 3BF8A 3D1VA 4YWHA 4JT9A 1WLYA 2JHPA 3LWNA 4CM7A 1SBHA 2G5GX 2YVAA 4KI0A 3PNBA 3D4IA 4LHXA 1B0PA 5I8PA 1PZGA 4I8XA 4RJ2A 5ANRB 2Y0EA 3EC7A 4XGRA 2H4WA 3W5BA 3G79A 2O3SA 4RO0A 1TKBA 1SU4A 4PQEA 1YL7A 3OICA 3KT0A 4X91A 4YAOA 3ZJVA 1QF9A 1JKFA 3IV6A 2HNKA 3C1AA 1KU0A 3C3CA 3ADOA 4AYWA 5BMVA 1OLSB 3OQVA 3A6FA 4FR0A 4J0QA 4KHZA 2BT4A 2FLWA 2POCA 4HL6A 4E31A 4ZOQI 1NRJB 1E2BA 4EA8A 2YWFA 1IOZA 3U7GA 3F3SA 3AHDA 3OCWA 4IVNA 4PANA 1SUIA 4D4MA 3K9NA 1BD4A 3EA0A 3BMOA 2J3EA 1L4KA 1OUMA 2O8BB 3EEIA 3V1MA 1E62A 2JGJA 4Y9TA 2IIBA 2PIDA 1E2NA 1YBFA 2PZBA 4HWRA 5T8KA 5BN3A 2VQFB 5FO0A 1WO8A 3AR8A 1AQUA 1UM9B 4FGKA 5FR2A 1R7RA 4U7TB 4E14A 1LF0A 2NIPA 5G0VA 2XI4A 3RAEC 3WQHA 3FDXA 3DDNA 1J8YF 2G28A 2ZSAA 3UJHA 1SOMA 3EGOA 5AM3A 2QAGC 2NSYA 4MAAA 4DLNA 2AS0A 3RSOA 5GOZA 4DJ5X 2IKSA 4BU1A 1TCVA 1MJHA 1C29B 2FOXA 1VIYA 1G18A 1U9ZA 3QIAA 2EKLA 2ZJ8A 2CLCX 2ZBFA 3ETJA 4EFNA 4E5VA 1G7TA 2I22A 3OTWA 3WSWA 5E7JA 4EUEA 3EVAA 4C7XA 3ISJA 2AZDA 2MWMA 2D06A 5K5EA 2Q99A 1VXOA 4LNUA 1VIVA 3KHKA 5ES3A 1DZ3A 2J4FA 8ATCA 3BDAA 2HF8A 4AULA 1XXHA 1CDZA 1U0FA 1UWLA 3G2IA 3MLEA 2WA2A 4KOEC 1HE4A 4F7DA 1BKSB 4Y0NA 2JD1A 2I3GA 8OHMA 1E0AA 2BD0A 4HI0E 2R7MA 4X8OA 5F2NA 3T9EA 1IPEA 1NJFA 1PW5A 2CHUA 3MMNA 4IPTA 3KQOA 4LRXA 2OECA 3LC0A 2DMRA 3P5BA 1S9HA 2BONA 2VZ8A 4JODA 3EGCA 4RHFA 1HZZC 2DB3A 5CPFA 4C7KA 4U2KA 3CTMA 1I6KA 1U0BB 3SHOA 4DMLA 1I7QB 1KVSA 2X5JO 5A3VA 4R1LA 3E9QA 4DNPA 4KPEC 4L3VA 1WX1A 1U6KA 2CFOA 2MT9A 4LPSA 4PLGA 4RSGA 4WZAE 4RKWA 4RAOA 3P2OA 2FWJA 4YAFA 4F6RB 1JU3A 1T4CA 3WLSA 4K86A 1VLZA 3U26A 3EEBA 4PR0A 4KYVA 3RS9A 1Y3BE 3S5UA 1XFAA 1W5FA 2CC2A 3K1TA 1D5CA 2FETA 2YIMA 3OIUA 4Y18A 1I4LD 1X87A 3RHFA 4OFZA 4RABA 1U5AA 4KAFA 1QGUB 1E2HA 2DFDA 1UPCA 2R48A 1UMBA 4FMDB 5COAA 5KTOA 1G59A 2O8EA 3TW4A 2RGBA 1DAFA 4BVKA 2WKPA 1AGNA 5ICGA 3L6EA 1NULA 4R2WA 1U3VA 3N6RA 1I7SB 2WSSA 4EENA 1WSBA 4DKJA 3FVTA 1JTEA 1I1HA 1R16A 2WWXA 4NU8X 3KFVA 3TSZA 5JS8A 5IFLA 3L0ZA 2PBZA 3C6QA 2GEFA 4HZUB 1GRCA 1UZMA 3M33A 4LGCA 3LCUA 4ZRNA 5HMLA 4ARZA 1HOXA 2R1TA 3SVTA 2FQXA 1CUDA 3HKBB 4TXLA 2GTPA 3O2JA 3ROTA 1DKQA 3ME5A 1QANA 3L4JA 1R50A 4BASA 5CRIA 3WV4A 2C20A 1B8UA 1RLTA 1ENOA 1G3QA 1XROA 2QZ9A 3NYIA 4LGVA 2PLNA 1S3FA 2X2PA 1G3UA 1VTKA 3CWCA 3DZJA 521PA 1RAHA 2P9JA 4HJRA 4ER7A 3ZWWA 4EUNA 4DV5B 3AESB 2JLQA 1ZOSA 4XPIB 3HLTA 2QS9A 5I8ZA 2EZ8A 4UUAA 1UM8A 1JEQB 3E2MA 4YASA 3AF0A 2UXCB 3DC7A 4ZWNA 2AYYA 1PZXA 1W29A 2OK7A 3VPHA 4JWTA 1RQGA 4YCDA 4EHJA 1CY4A 3LTNC 2IHVA 5EP3A 3CZ9A 1FUKA 3CVYA 1EIZA 1GUZA 4G8BA 1S02A 1V6CA 2QNRA 4WASA 1BDIA 4B33A 1DQPA 2EKPA 1RBYA 4TSFD 1KAEA 4CFSA 3C3BA 1R9MA 2ZRIA 4QWWA 3PJRA 4BQOA 1CZLA 2OUKA 1NZDA 3D2LA 2W93A 4R1PA 1JH9A 2OL4A 1EU1A 2R79A 3KAPA 4OU5A 3B3JA 3SFVA 2VO1A 1I4OA 2R7NA 5THKA 3V1KA 1SOAA 2XQJA 3AXTA 1SM4A 2ZIXB 4ZRDA 2TMGA 4KO1S 3JALA 2UZ3A 2JASA 4MO2A 2DAPA 4YQEA 1ISGA 3JZAA 3OY2A 1Y6JA 1IZ8A 1MOZA 3ZDCA 2WWTA 1W88A 4RH3A 4IQ8A 1E98A 5FJIA 1Y89A 2BEUB 1QB8A 3NIDB 3QKIA 3QPDA 2Q6LA 2BKUA 3RYFB 4C4ZA 4X3CA 1QYIA 5K0SA 4JYZA 4MK4A 1YB4A 2UXDB 1GDHA 3VNAA 4F1WA 6NULA 4L74A 5JALA 1WQ1R 1P7CA 2DKNA 2DRIA 4MITA 2Q3HA 5AH0A 1CQJB 2VKTA 1L7RA 2GPAA 2MOKA 2O3UA 1EM6A 5FWXA 5KWSA 2ZRQA 2EFHB 1AXGA 3ILYA 4CCYA 1NZFA 1LNQA 4MQEA 2CKMA 4K9SA 1OMOA 5AI5A 4CL0A 3M1YA 1QNFA 3GFSA 4MNTA 1YD7A 1KVTA 2OC4A 3HBNA 5TXGA 4RDXA 3J80A 3BWDD 4S0ZA 3ANTA 1ORHA 3DKVA 1P3JA 3EGXB 3QY9A 4D2IA 4U7GA 1U8UA 2BGKA 4L22A 3TOZA 3UNXA 1KK0A 3MWLA 2B78A 4UHKA 4D5GA 3FSJX 3W5DA 4KITB 3FSGA 2CLDX 3HCFA 1DXQA 1Z75A 1P0PA 4IRXA 4Q3LA 1U9IC 1F12A 4YRRA 1JLRA 2WMYA 3AL0C 2YHBA 1XWWA 2F1KA 2PKYX 1GUDA 2C7QA 5ILGA 3CUUA 2XF2A 5G1OA 2EJTA 1AQ6A 1PLJA 2ZATA 1G8YA 2JK0A 4WAUA 2VVTA 3PPWA 4YMGA 1SXJA 3U4IA 3ZBPA 4DNFA 1DBQA 3TSYA 1NUTA 5JOQA 1WCWA 3D6NB 5H4HA 4Q5IA 1BMFD 4OG2A 3OMWA 1H8HA 5LQAA 2Q21A 2IHNA 3BRQA 4OHOA 3U37A 3WA7A 3MHPA 1UPFA 3ZHRA 4Z4QA 2FMUA 1G3IA 3CNOA 5EVJA 3GWZA 3A9TA 2AFIE 4LJ4A 4EKGA 5EHZA 1JLMA 1LDYA 2E18A 2PKCA 3ZOKA 2ZEJA 4JVSB 4Q4HB 8LDHA 1N6KA 2VA9A 2Z04A 4KNWA 3RWBA 4BQEA 3AVYA 1KZHA 2ID8A 4OA5A 4G36A 4HUJA 1SWWA 4G6ZA 4JXXA 2FZ4A 4BLTA 5CA1B 5K0TA 2VWQA 3KM0A 3ONVA 1NDQA 4KFSA 1E5LA 3SIXA 2PH3A 4HPWA 4YI3A 5L45A 4INJA 2LCQA 1JHYA 4YIHA 3PFGA 3DMTA 1C9NA 3DE6X 3JZIA 4LGMA 4G07A 1NW7A 1SHLA 3L9WA 4MH0R 1A4UA 5B1YA 5KBYA 3AWDA 4X41A 4L0QA 1NBIA 2WZQA 5LDDC 3HY4A 3LT4A 4QUBA 4F5ZA 2GJKA 4UMEA 4E4RA 4H0FA 3F1KA 5M29A 5AVOA 2QG9A 5CFNA 2EJBA 4C4SA 1FYXA 5JSZB 1DG1G 4CGYA 1CHDA 4RFLA 1FMFA 4BS9A 1DADA 2V7VA 3CM0A 1HQYE 1OHHD 2VP6A 4K87A 5DJ5A 3EC2A 2BHRA 4QE3A 5KYWB 2WD9A 3D31A 3U5TA 4E6EA 3GA7A 4BMDA 1T35A 4MV0A 4TX1A 4I50B 4KUEA 3EIEA 1Y4UA 1U8TA 4BPBA 4PCLA 1GL3A 3LUDA 2OLKA 3QYAA 4ZT4A 5FLKA 4UXJA 4ZVRA 3DUWA 3U16A 2GDZA 1QG6A 3KXKA 3QUTA 3PPXA 1U2SA 1JIQA 1TK2A 2ODEA 4ZCMA 1KMHA 4O0MA 2BTQA 1XZ8A 2QTBA 2PSJA 3DBLA 4JBGA 4X54A 2EIXA 2PQMA 3B36A 3JQ9C 3UJBA 3ZV4A 3EFHA 3FW1A 2WUVA 4KSCA 2WMDA 4JLNA 4KZPA 1F0PA 4X5OA 2IS6A 3I64A 3QOXA 4B40A 4B46A 4CQLA 2PUWA 5I7HA 4YBRA 2VBFA 5MN4A 3UWKA 3QITA 5IKEA 1P5JA 5L3SA 6CHYA 1L7QA 4G1EB 2ZYDA 4LSWA 3KEQA 1ADBA 4IDEA 2W6MA 4MARA 5ECDA 4DLBA 1QIHA 3PUZA 1TZKA 1VRVA 5EIWA 2ECKA 4OYYA 4W9RA 5JSFA 1KTIA 4MLCA 3CO5A 3WZ2A 3BEOA 3PA6A 3PYLA 2WAMA 3V8QA 3ECAA 1GSHA 1ZPDA 1FVHA 4N4AA 1WHSA 4XTRA 4IDHA 3RSZA 2IY7A 3NBKA 3QI7A 2BWJA 4OBBA 2OP1A 3EXG2 2IKQA 2A1IA 3CRNA 4FZRA 3NBAA 4TKUA 5D7NA 5B7NA 5AKGA 2PL9A 1EX6A 1U4NA 3KLPX 2JCVA 1P31A 4ENWA 5EIFA 1SHZA 1G8SA 2HX1A 3IUPA 4TS9A 3CY6A 5JD5A 5HA5A 4GBGA 4JP5A 1NI4A 1F06A 1PYDA 1PJBA 1VE1A 1W0KA 1V1JA 2FPOA 4DDUA 2GJAA 4UNIA 4YV7A 4JXZA 4P31A 1FTGA 2F1RA 2WM3A 2X6QA 4F60A 4I9GA 1H0SA 4RS4A 3VTKA 3A27A 4DM3A 3GL9A 1U31A 2NXNA 3MELA 3QFSA 4S35A 1YA4A 5DEIA 4HLUC 1KWGA 1N2ZA 1SWVA 4LECA 3ROEA 2E37A 4YRBA 4QFDA 1RI3A 1ZM9A 4LC1A 5KSZA 2BBSA 2ROQA 4CV3A 1ZXBA 2R62A 1SQFA 1HLFA 2XE7A 4PQGA 5JNUA 5JW6A 4DV4B 1V71A 1VGQA 3S2GA 4QOEA 2I87A 3CMCO 3EQ7A 1E79A 3CLKA 1NN1A 2QENA 3C4VA 4HRXA 4LE1A 2CJPA 2XEXA 5AJVB 1T0IA 2GAIA 4RZ3A 4DJEC 3E03A 1IZ7A 1JDSA 4LMPA 2JIOA 1UKCA 4O2AF 4UM7A 5ILQA 1E4YA 1P9LA 3B5EA 3KB6A 5ELXA 4RD4A 4GEKA 4BRSA 1WDLA 2XXAB 1CCWA 3DM9B 3IP6A 1LK7A 3MYYA 2VF8A 5K3SA 3UTDA 4BB0A 3L82B 4DZZA 1COWA 5MDHA 7YASA 3QLVC 3USZA 1JR6A 2GBGA 4ZFNA 2A4MA 4P2BA 4KR9A 2VDKB 3DVRX 4MA5A 1GA6A 4MQUA 1E0DA 4YR9A 2DFNA 2GN8A 1C3LA 4PG8A 4Y2TA 3TRFA 2C5FA 5C9ZA 1GNTA 3A1UA 3KLMX 2J9RA 4KWTA 4NYIR 5AESA 2FSVA 3R3YA 1Y9EA 3G89A 4YCAA 3ZIAA 5KX5F 3R5KA 4D8VA 3QUBA 1HNZB 1R64A 5G1NA 3DLHA 2GH1A 2WT9A 2O54A 2X2OA 2B69A 2AR9A 4LHYA 3EODA 5DOVA 2YZMA 4QHTA 3U7IA 2G7ZA 3QBVA 1WY5A 5T4HA 2DUMA 3EXHA 3TLEA 1EFHA 5DK6A 3GFTA 3KSMA 1FSGA 4RIIA 1SHUX 3F6CA 1XRJA 2JEOA 3PFNA 3T54A 1C0EA 4CE6A 1BA2A 3WISA 2R1VA 1UOQA 3L0OA 4EAAA 2GR9A 4EHAA 4LNHA 1K27A 3ADKA 1YZFA 1UIRA 3KE8A 3U4DA 3EZ2A 1RHQA 3W5VA 4Y98A 5IKOA 1TCCA 4JUDX 5CJ2A 1Y8AA 5C81A 1WE2A 3ZKWB 3U60B 4D4HA 5FBRB 4F96A 1X94A 5FI1B 3RAPR 1TUBA 5DW3A 2LR0A 3TQRA 2V3CC 1JHAA 4I1YA 2A1UA 3U7QB 3KHUA 5K3AA 2XUOA 2CZQA 2DGDA 2MHCA 2O06A 5FUYA 3TQIA 1KJIA 1U8XX 5AVXA 1QU2A 3WMGA 1A1SA 1C3EA 2GHRA 2C7GA 2Q4TA 2WHPB 3A9VA 4J1QA 3DE1X 4YUVA 3VNQA 1V48A 4S2EA 5AK5A 1F6DA 2OILA 1SUCA 1RYFA 4MSUA 2VN8A 3V46A 3N8NA 4TLLB 2AXNA 2EC5A 1N4AA 3MWDB 1IZ0A 3KQTA 3LXRA 2H9YA 3OUZA 4DEVA 1JU4A 3TR6A 3UEOA 1OGJA 1ZVVA 3HN2A 3SQOA 2HJGA 3W5UA 1F9EA 1WV0A 5J23A 4NHOA 1PO7A 4EFMA 3GRYA 2PUVA 3EOZA 2Y6UA 4IR7A 3QGMA 5KNBA 1Y1PA 1OV6A 3BHJA 3KZXA 4E5NA 3ZLVA 2CMGA 5LYJB 2CFIA 1B6TA 1VBMA 3DVSX 3NIFB 3QVKA 4IJVA 4MR9A 5T6BA 5B2EA 4IL5A 3SJAA 5LD2C 3IPRA 2ZDHA 1L7MA 2GK7A 2IEAA 1XNGA 1XZBA 2ORYA 1NFQA 2AJ8A 2PRJA 3D6MA 1HFKA 3LCVB 4GSLA 2ZE8A 4K9NA 4A10A 4RTSA 1FDVA 1D2GA 2Y68A 3KTDA 3L8GA 1I30A 1VA5A 2FTKE 2VJOA 3BYZA 2DTDA 3JWJA 4GOJA 3R7WA 3PTAA 4L76A 4QM6A 5K3FA 4ZTUB 1XKTA 1SC4A 1ZNXA 3IDSA 1DUSA 3T0GA 4BO3A 4PRKA 3FNRA 2BFBA 2FPKA 3KHSA 2A8YA 3JQBA 3DNFA 3HB4X 1H2WA 4LF5B 2BY4A 1F2UA 2IYUA 1RADA 1E4EA 2FU5C 2DWQA 1TO2E 2AUMA 2HHAA 4RQUA 4LZAA 2SKDA 5LZ7A 3IV9A 5C5DA 3FCAA 3VX4A 4DLKA 3UJ6A 3TFOA 3QU7A 3IP9A 3L1IA 1YZTA 1SC6A 5KKAA 1GPBA 4W5JA 4HZGA 3PXCX 2CEKA 3W4IA 5T57A 3UH1A 4BNDB 1PEAA 1C30A 2W11A 2XUDA 2YHAA 1NOIA 1WSAA 2PCLA 3G82C 4UTNA 2GK6A 5KHLB 4E22A 1H22A 2X8AA 4TZKA 1KQFA 2VCYA 2GK3A 4FMCF 3GJQA 3A4VA 5BP7A 4FNOA 2RB5A 1J23A 3IOYA 4QTTB 4ZEWA 5C51B 1K0UA 1L5HA 1L5RA 4C3VA 3VVCA 1BU5A 1NXOA 2ZFUA 2BFOA 4P9NA 3WQBA 6Q21A 4F3YA 2OCLA 2Q0HA 3GEPA 4C4AA 3K05A 5CJPA 4RQAA 2P2LA 3QPBA 4A6DA 3NAGA 3UUGA 4BUJA 4R8SA 4BEBA 4R6WA 4E1BA 1O5TA 4GPIB 2CNBA 3K16A 3NIBA 3KAJA 1NMEA 3QH4A 5C34B 5JFTA 5F12A 4FHDA 2PNJA 1P7WA 1CQIA 3H83A 4NV0A 3N75A 2IOQA 5F9MA 2P68A 2AI2A 4N9QA 5KC8A 3WWPA 1LI4A 1PSWA 1U5CA 2JEZA 2OG1A 3AX6A 1B43A 1QGDA 3DCIA 4OYLA 2P9YA 4PSDA 4TTJA 3K15A 5T41A 4BWYA 3QX8A 3PRYA 2H8KA 2Y1OA 3BXZA 1SCUA 3H17A 3JATB 4G5OA 1AB6A 4MVJI 4C5CA 5B58C 2YHIB 3SF0A 3IELA 3JQ6A 1R18A 1EE1A 2ZU6A 2GZMA 1RT9A 1T9GR 1E18A 4RPGA 3L0YA 3ZV5A 4EO9A 3I9FA 2CNDA 3QZUA 4FSDA 4FHCA 1HG0A 1KA9H 1E3LA 2WWYA 3AWIA 1CB0A 4ZODA 2B8WA 5E38A 3M1AA 2G17A 4UDYX 4B3RB 2RH8A 2MYUA 1M2VA 1DG9A 1G42A 2ZYTX 1VQ1A 2F3SA 3WV5A 3M4YA 2NO9A 4E7PA 3PNYA 2ZJ3A 3F0TA 4WJLA 1VPEA 1TC1A 1SRRA 4IGAA 2ZKLA 4GOXA 1DAHA 1UJNA 1GTJ1 2X1LA 4JUAA 1CY8A 1TYAE 5GZ1A 5CITA 1FFXB 1QG2A 3RJTA 5C4IA 1EFPB 1R4NA 3O0DA 1CLUA 3MBIA 1W581 2CHFA 2WDPA 3M82A 3GYBA 5KMGB 4LJRA 1QHHB 5A2GA 5L95A 2P8SA 3M4JA 1T36A 1YASA 4CMBA 1GA1A 4ZDIA 3N59A 2IH2A 3LQ1A 3FYUC 4FILA 5JVDB 2ZUSA 5BSVA 2Z6UA 3B6JA 3OHMA 4IIGA 3BHNA 1DX6A 4ZVKA 1VG1A 3EUAA 1WXDA 3LKVA 3F5DA 1UJCA 3TUZC 1N9KA 1YU6A 1MQAA 2J9YB 2V4ZA 2WD7A 4C6TA 1N5IA 3BWCA 1AN9A 1RRVA 1YB6A 2EAUA 4ZK2A 4PZYA 1DV1A 1SZPA 4QELA 1D0IA 1H6CA 3FPGA 1VJ0A 3K0FA 1ST2A 3HWSA 2VTKA 4PFJA 4U2EA 4WFJA 1KIMA 3HJRA 4H6WA 4UTOA 4N6NA 1RYMA 2O7VA 1R9NA 4DILA 3QVSA 1PT5A 2ORIA 4OI0A 3ETHA 3P27A 4ZT5A 1L5YA 4XR4A 3V55A 1DNPA 3NONA 1EBBA 1VLQA 4S12A 4LYJA 4HVLA 1TA0A 1UBNA 2HMSA 4M0EA 4LJ8A 3TL6A 4N5NA 4EB6B 4LYFA 4ROSA 3G49A 1ZVMA 4X8MA 5FAXA 1XB2A 3HGMA 2VDOB 2O4UX 2PMBA 4NBVA 1I10A 1UBKS 2FF5A 3G2KA 1H2FA 1T9KA 4IHQA 2WICA 3KB8A 4TVOA 4E6PA 2KBEA 2P11A 1FU4A 1GLNA 2Y0DA 5GWXA 2IEZA 2XMBA 1E1RA 3DAOA 3QKSA 1FUEA 4XCVA 1B7GO 4WZAA 2DSTA 3FUUA 1B15A 1NASA 3ON5A 3W8RA 5LOVF 1T0JB 2C82A 1TLFA 1VG8A 5AVYA 3REFA 2HTFA 5TVKA 5IBCA 4MVJE 3FPJA 4MW6A 4D92A 1GPWB 2XKAA 4GXTA 3NLLA 2WF8A 3C48A 3V1LA 2VUTA 3E7PA 1U8CB 3K1JA 1O57A 3GZ4A 3BXGA 2OFXA 2UVQA 3LLUA 3MCVA 2PFKA 4HDMA 4Q4LA 3MMSA 3ZXIA 2YCLA 1IJEA 1H2YA 2O2SA 4RCYA 3TB6A 1WY7A 3W6PA 2WJIA 3IMEA 3TBFA 2O0KA 1XDDA 3PXEA 4GOOD 4EHBA 3I1IA 5AJWA 4S04A 2CNWA 4GNRA 4CQNA 2AYZA 1R1DA 1AGYA 1E99A 1S4MA 4J0IA 4DYDA 3GLFB 2XDQA 3VYRB 2D1TA 1UJ5A 2IVZA 3ZDBA 1W85A 3ZCQA 1Z4JA 1HETA 4RH1A 3L79A 4WBNA 4WGGA 2Y9MB 4REQA 2LGJA 3D54D 5JQWA 2Z1MA 1H9BA 5IT9A 4ZEVA 3OA0A 1XCOA 3AILA 2C2OA 4JLDA 5HJEA 2EKZA 3MWKA 3IXQA 1WLSA 4CDRA 3U1TA 4MICA 2I5PO 3EZFA 5JANA 1FDOA 1O6BA 1HWYA 2FFRA 1Y7IA 1E3TA 4JZYA 1EINA 2C00A 1ADFA 3K72B 3NC4A 3AP3A 4QBFA 4U7HA 3WL6A 4NCXA 4PPNA 4PWZA 4L6IA 3F7NA 4JH0A 4Z0TA 5FPKA 5F7XA 1DIRA 1UPBA 4GMGA 1UZLA 2FEXA 2NT3A 2QGFA 1PZFA 2YN0A 3QF7A 3BFJA 5H81A 3UPUA 1JAIA 1Q44A 1J49A 2P2ZA 3WNDA 1AQNA 4KXWA 3CF4A 1JHRA 3BFVA 2YOGA 5LA6A 4BE4A 1KFKB 2QVXX 3M6MD 2EYUA 4FU0A 4I6GA 3OBBA 3ILVA 3R20A 4Y30A 2R68A 4I9NA 4ZO9A 5K9ZA 3DE4X 2I3BA 2QY6A 2G6BA 3G88A 4V0SA 4PN3A 4YS6A 1PK9A 4M22A 4RA6B 1MH1A 4D3SA 5JECA 1TJ3A 1Q0HA 2ZE7A 3GJ0A 3QJGA 1Y33E 1AF4A 2ZRAA 3LP6A 3NU1A 4O4IA 4FOTA 1EMDA 3UAWA 1FXWA 1Z2CA 1U7ZA 3TSOA 1J8FA 1DVRA 2RH9B 2ZIVB 3DM5A 4DRYA 2WTEA 3DAGA 4RZUA 1X1SA 4RV5A 1HKUA 3HEAA 1WXIA 4D45A 3Q7RA 1IMOA 3WGGA 4DG8A 2LDXA 2ZBQA 5K0LA 1M67A 2W71A 5BNTA 2X8JB 4BVHA 2MSEB 3JPWA 5KVAA 1B8PA 1XTUA 1XEWY 1RMYA 2ACVA 3FGZA 1CRQA 1Z39A 3QLEA 4P82A 3LU1A 4P35A 2AZTA 2E48A 3LUPA 4PIPA 1DO8A 2FX5A 2NZ2A 3U6BA 2BFEB 2BMJA 3OTQA 3ZU3A 3ZK9A 1S8NA 4HNAA 1RQ7A 2WY2D 1V2GA 3SBEA 1JAXA 1XYVA 2R97A 3GRAA 3WNCA 3G7UA 3RFVA 1SA0A 5JSHA 2RHOA 3OMLA 4C0JA 1TADA 3GUYA 4DWVA 4AXBA 1V25A 1Y5MA 4JI0B 1WD7A 1Z12A 2O7QA 2XOKD 1NVAA 4KO2S 1FTQA 3ADCA 3DEYX 4LKOA 5H02A 4K26A 3CNLA 1RJDA 3ZQKA 3RS5A 4GRIA 3WDKA 4EARA 4P08A 1REQA 3TN7A 3OEEA 3U19A 1WEKA 2BFDB 2K2WA 3ACBA 3CLVA 1YDEA 1CY7A 2VHXA 1N6IA 2MDTA 5CYOA 1AA6A 3GH3A 4YCMA 2G04A 3C4JA 3ZWKA 4RVGA 3LRPA 1IVNA 4MUYA 2J32A 4QO8A 3AJRA 5C5IA 2NP7A 2HJVA 2AX3A 5EXEA 3DHWC 1ECJA 1PR5A 1SOUA 2XUZA 3AOEA 5GJWC 1V1MA 1I80A 1UEIA 3OMXA 1NG9A 4GG1A 4MLPA 5CA0B 2FWIA 3P19A 1XC7A 5ALNA 3B3FA 2GZ1A 4PAQA 3EDMA 5E1BA 1OOEA 5KTPA 1CS4C 4MHOA 1KEKA 2JD0A 1Q1QA 4JLUA 3W9SA 1Q1NA 5JJKA 1MO2A 2FWPA 4TPKA 3P26A 5EHQA 5TLSA 3BGVA 5BQPA 2GCOA 4GAEA 1FRFS 3OUTA 4HEJA 4V02A 4EBBA 4PFSA 2ZSJA 3T3IA 5BO5A 4JY7A 3TQQA 2XIJA 3WGUA 1DWUA 1P33A 4EZEA 4MKZA 2B3TA 3AL2A 3E84A 4L15A 3EJWA 4XVQA 1Z68A 1AHPA 2ZG6A 3O95A 2I1QA 3VR3A 5I7RA 3D0QA 4YCNA 4II2A 1DFGA 3JASB 2QUAA 4WFKA 1Q92A 4YDHB 5EP2A 4YP7A 3UFXA 1JZQA 3FYTA 3TOVA 1PT8A 2DKOA 2D5CA 2NUBA 3KEFA 4IMRA 4QFBA 4D3ZA 1HDOA 1YS7A 1IBCA 2GETA 2AW5A 4E2FA 2HH9A 3GJ5A 4W8OA 1XDUA 2H7YA 2M6LA 4AMYA 5DV9A 5BSTA 3NATA 1Q6ZA 2PRYA 2ZRHA 2HDHA 5IM4A 2WJHA 4JK3A 2HREA 3ROGA 1SCAA 1G17A 1T1SA 2GN6A 2Q6TA 4N8DA 1SCIA 4XIYA 4XVHA 3VC7A 3VPDA 2IOHA 4FLFA 4NTZA 3RKRA 4IVQA 4YRNA 3O1JC 5ISMA 1JEJA 4G01B 1UMDB 3VOSA 4YCCA 2DLCX 3FOCA 1KH3A 1R9GA 2JHAA 1X80A 2LIVA 2W6OA 3ROMA 5KOYA 4I4TB 2R6HA 1QQTA 2CK3D 3BC1A 4XOIA 5JZMA 2A0XA 1WPGA 2HCBA 2J9XB 2R85A 5JXIA 3JYHA 1NUHA 1KVUA 4FJ1A 3DXFA 4BWVA 2KE5A 13PKA 4D57A 1JKMA 2QM3A 4WW0A 1EFRD 5B5SA 1ZUD1 3CC8A 2BEWA 1GKKA 2J3DA 1ZD4A 2JZOA 1XDZA 2NXEA 3BJZA 2IXBA 3AQ4A 1NRXA 1CRZA 3G6KA 4DLVA 1Y5IA 1HSOA 3MBOA 2X1MA 5TMDA 2FEPA 3AEQA 1Y8QB 1CR6A 3FVRA 1EDOA 1E3DA 4P86A 1M5UA 4BCDA 4YMTA 2G7MC 4CEJB 2CXQA 4KTVE 4PN7A 5HS4A 4Z9BA 1TCUA 1NW5A 3EMVA 3OC6A 3P2KA 1W8DA 4TGLA 1U80A 4PC6A 3ZHCA 2DETA 2QLBA 1EVYA 2A5LA 2NZ8A 4Y2SA 1F3OA 1XTSA 4CV2A 4ZOBA 1FNMA 3AEKA 1WU8A 1N3IA 2NX2A 2W2NA 3FYSA 4TWAA 3RUHA 5KTTA 1QO0D 1SVMA 1JBKA 1PE0A 1ZI9A 5B3KA 1DGQA 1KERA 4OA8A 3L0PA 1J06A 1XI2A 5DHTA 5DO9A 4URZR 1RWBA 2QR5A 5DHSA 4PCUA 5DCLA 1IXYA 1ZNYA 4FIZA 1AUVA 5BQFA 5HXAA 4JQSA 2C1EA 5K4HA