1EM7A

Helix variant of the b1 domain from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
TTYKLILNGKTLKGETTTEAVDAETAERVFKEYAKKNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Structure of a protein G helix variant suggests the importance of helix propensity and helix dipole interactions in protein design.
pubmed rcsb
source organism Streptococcus sp.
molecule tags Membrane protein
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1em7A00
2I2YA 1D4BA 2LGIA 2N9LA 1FCCC 1HZ5A 5HHDG 1C9FA 1PGAA 1EM7A 1XCTL 3FILA 4OZAA 5HG2A 1ZXHA 1HZ6A 2KN4A 1IGDA 2RPVA 2IGDA 1JMLA 3GB1A 2QMTA 1IGCA 4OZCA 1P7EA 2JZPA 1MI0A 2OEDA 1K53A 5JXVA 2N9KA 4KGRA 1K51A 4OZBA 1YMHE 1FCLA 2JSVX 4KGSA 1F2RC 4GLSC 1GB4A 1IBXB 2NMQA 1F2RI 1KH0A 2GB1A 2RMMA 4KGTA 2QSDA 3MP9A 1Q10A 2J53A 2IGHA 5HFYA 2K0PA 1MVKA 1XF5L 4WH4A 4HKZE 1MHXA 1QKZA 2EELA 1HEZE 1UWXA 4MACA 2LHDA 5HI1A 2KQ4X 4HJGE 2JU6X 3V3XA 2LUMA 2PTLA 1K52A 1GB1A 4IKGA 2N7JA 1YNTE 1K50A 1P7FA 1XCQL 2ON8A 3FILB 1PGBA 2ONQA 1IBXA 2I38A 4IOIE 4D2KA 5BMHA 2KDMA 2LHEA 2ZW1A 5BMIA 1MPEA 2J52A 2KACA 5BMGA 2JWUA 1FD6A 3UI3A 2PLPA 2PW9A 2GI9A 1PGXA 2KWDA 2ZW0A 2JXTA 1MHHE 2IGGA
chains in the Genus database with same CATH superfamily
2G3QB 4RM8A 3N20C 5AUIA 4WURA 1D4BA 3RNFC 1FMAD 1ESFA 1HZ5A 2L3ZA 5J2RA 3KUCB 3NVWA 2D3AA 4TMAB 3RUIB 1Y56A 2NR2A 1PGAA 4PYZA 1XCTL 3NHEB 4OVZA 4TKNA 1SE4A 4IC7B 1SIFA 4AP4C 2WXJA 3P42A 1YX5B 2GBNA 1SF0A 1HA5A 3N3KB 4O1NA 2QMTA 4WWNA 2G1EA 3S2AA 4JL9A 4W9FA 3I9V1 4A8XC 1SE2A 4MEMA 1QQRA 3Q3OC 2N0SB 4XX5A 3VFKA 5C2TB 3KYDD 2N9KA 2KX3A 3P4RB 1TKYA 2W9NA 1GB4A 1BT0A 4N58A 4KGTA 2BYVE 1IP9A 5LLIA 3MP9A 1YN5A 2KFKB 5HFYA 1UH6A 3VQIA 2FUHB 1D5XC 2BS3B 1E5WA 2L32A 2Q5WD 3KLSX 2IO0B 4W9IA 1TS5A 1E8XA 3R3MA 2QHOA 3AEGB 1NYQA 3WANA 1E6EB 2Z0DB 4S0RA 2Z59B 2DYOA 3N30A 3A4RA 2ONQA 4EZJA 1KM7A 2N9XA 1AW7A 1C4PA 3WAOA 2N1WA 1JRPA 4KV2A 4ARCA 4YL8A 2MHJA 3ZRCA 2LVQA 2WDTB 3N32A 2VH1A 3RNCC 3Q69A 3QX1A 3BVGA 3R7QA 1WXAA 3IT6B 2IYDB 5C23A 2IGGA 4EE2A 2FCSA 4EEWA 2QCZA 1SEBD 1FIQA 1N62A 5CX3A 2Y5BB 2OOBB 2DZJA 1A5RA 3T8MA 3NVZA 1UGJA 1Q5WB 4GU2A 2LVOA 3MHSD 1S3SG 1I4RA 3DBHI 1NEKB 2RPVA 3RNAC 3R8BA 2HTHA 3VTVA 4HXDA 3AMZA 1AN8A 4XE0A 1M4VA 2BWFA 2MCNB 2WDVB 1MJDA 4P7IA 3AU5A 4GDLA 1RAXA 4BOZB 2IBIB 4IW0A 1Q1OA 1WMHB 2JSVX 4FJYA 2NMQA 4XYCA 3WIMA 3ZUNA 3SFDB 1JROA 2WXHA 3I57A 3QQ8B 4ZRJA 4LNIA 2L0TA 3QK0A 1ZDVA 1FO4A 1ZP0B 2K5PA 1YJIA 3R66C 3IAM1 1EWCA 1LGRA 2FCQA 3K9OB 1C4CA 1NVID 3PTFC 4YSXB 3T3NA 2L76A 3B1LX 4G50A 2IY1B 2IO1B 3P4PB 4ZYSA 5IKCM 3Q2AC 1MPEA 2MSED 3UI3A 2PLPA 2BS4B 3KWVA 2PW9A 2RDBC 2K8CA 1KF6B 4B9KA 2LXAA 2H89B 5EE3A 3SEBA 2E6XA 2Y5PA 1EF1A 5IP4D 2JUOA 2LGXA 2INPE 3GS2A 3L4PA 3ABVB 3L10B 2WGSA 4LNKA 3VHTC 4N59A 4PYUA 4KKJA 4M0WA 1LM8B 4NJ7A 5LXIB 1WXQA 3U8ZA 1GC6A 2NTSA 3VDZA 4ACFA 2RR9A 4HJKA 4MM3A 3ZNGC 1D3ZA 3ZRFA 2N7EA 4DHJB 1IGCA 1YJJA 2JXXA 2FNJB 3B2GA 2D3BA 5G5GA 3DBRB 4RNAA 2N9PC 3VTWA 4NZLB 2KC1A 1L2NA 2JVCA 1K53A 3AN1A 4KZCA 1TGZB 5JXVA 2FCMA 1GNUA 2JZ3B 3W1SA 1FCLA 1IBXB 1VZ8A 1QOAA 2WXPA 1I4HA 1NDDA 1WXMA 4EFOA 4M01A 3AEBB 4C4VA 1WGYA 3AE5B 1H4RA 3ONSA 1C3TA 4FADA 1MHXA 2ZNVB 2WU5B 3AEDB 3PHXB 1N60A 2L52A 2PTLA 1J19A 2NS5A 2W3SA 1ENFA 3VRBB 2PE9A 4J6IA 2FUG1 3VH4B 2H88B 2WQYB 2ZEQA 3Q8FA 1IYFA 4ZDVA 2JY6A 2GBKA 2KQSA 2WWZA 2BS2B 3NRZA 3EFUA 2GI9A 4C4VB 4MT5A 4LDTD 2KDFB 3BWUD 2WX0A 2HE7A 1J0GA 2W82A 3LXFA 2XK5B 4IM2A 1C4AA 4RGNA 4CO7A 3J9CA 4C80A 1SSNA 2QILA 5HHDG 4KIKB 2KJRA 1SGHA 2FBWB 1AWDA 1WGDA 3HRDD 4NAWB 5G2NA 3ZXRA 4JWSC 1PQSA 1NYRA 1XLQA 3AV8A 1WZ0A 2INCC 2LGYA 3U30A 2MQJA 1T0RC 3KH0A 2K3UA 4ANVA 2LFIA 3H7PA 1EU4A 1I7HA 1WJNA 2MJEA 4JPSA 1E0ZA 1I4PA 3AE4B 3PT2B 2CS4A 5EDSA 2NBUA 3U2SC 3Q8AA 1WX8A 4EOYA 3T3OA 1AYFA 4BVUC 2IPKD 3QA8A 3DWMA 2VZKD 3KVFB 3TBLD 1GC7A 3KYCD 3NG0A 5JHAA 2VRRB 3P4SB 4C56C 4JQWC 1ET6A 3DOWA 1Z5SB 2M0AA 2LUEA 3B2FA 3Q14C 3DVGY 1WM2A 1UF0A 1WGHA 2MP2A 3AB5A 1WFYA 3GZNB 4IOIE 4KSLC 4BKSA 2KO3A 3DDCB 1F52A 2A4ZA 3AEEB 4KDIC 2KACA 2WXMA 4DHZB 5BO4B 1FD6A 3QAQA 3TEXA 3AECB 2SEBD 4II2B 2OJRA 3A9KA 1QILA 1V80A 1U4AA 1SJED 1LXDA 2LVPA 1GOZA 1VZ6A 2JZZA 5HG2A 2MBBB 4PS3A 2LGDA 1FNVA 3JYUA 1SE9A 1T0QC 4REZA 2REXA 2KFJA 2M17A 2M8SA 2ACZB 2KWCA 4PS8A 2KANA 2LD9A 4RGTA 2OEDA 2DZMA 3DCGA 1MFWA 2TSSA 3AEFB 4C7ZA 4PT5A 3DPDA 3DHGC 2KYWA 1L0VB 3HUIA 3ETRA 1F2RC 1RLFA 1V1PA 2KC2A 4GOCA 2KDBA 2HDEA 1WZ3A 2KVZA 1HTOA 4S17A 2KVRA 3ENEA 4RF0A 3UQAA 4DDGD 1ZE3D 1ZOYB 2JQRB 1UBIA 1CZPA 1QKZA 3RNGC 1HEZE 3JSVA 3MHZA 5D6JB 3OJ3A 3DVGX 1I42A 2AX5A 4CYEA 4LCDE 1OTRB 1OEYJ 2WXLA 2D07B 4LNFA 2DNFA 2WX1A 1YNTE 1H8CA 3GE3C 1J8CA 3I5JC 1K50A 1IPGA 3RNBC 1RFAA 2IDYA 2BGFA 4C7YA 4RGOS 4D2KA 3IAS1 2DWQA 4K7UA 2JX5A 4C00A 5EE9A 3RPFC 1LQBA 3A9JA 1J7BA 2QIEB 1V5TA 2KMCA 2D2QA 1YN4A 3E56A 2L0FA 2V3SA 5TR5A 2BB5A 3TSSA 1C78A 3QHTA 3NZ3A 2FE8A 2FIDA 1TKGA 1TY0A 2WDRB 4P6VF 1VDVA 2XN9C 5IAAC 2MBQA 4JWUC 4AUQC 3L13A 2HD5B 1JMLA 1WJUA 5BYRA 3GB1A 3E9SA 1YD8U 2O6VA 4N6EB 3VR8B 1DGJA 1P7EA 4JLCA 4K81A 1C77A 5FK9C 2NPTA 1JCKB 1NI3A 1C79A 4NPNA 2O2VA 4ANUA 2D3GA 3ZJUA 3V05A 3ECIA 3DQVA 4WWMA 4HDQA 4ANXA 3IFWB 2NBWB 2ZVOA 1F77A 5AEKB 1Q10A 4LJOB 4MELA 3AE1B 3BYYB 4FJVB 5EE0A 4EZLA 4FJZA 5E6OA 3ZJVA 3RULA 1T0YA 2EELA 2M19A 1HE8A 1IUEA 2KD0A 4MGZE 1JWBD 3PVLA 4L1BA 4P16A 4A6QA 4XWWA 3EC8A 3UF8A 1JQ4A 1FRRA 1P1AA 4BKGA 3H7SA 2I1JA 3DHHC 5BMHA 4NNJB 4LNNA 4DXAB 1L0XB 4AS1A 2WYQA 2X38A 4UDUC 1WYWB 2QDFA 1JALA 1YOVB 3AU4A 3CF6E 2FIFA 1TS4A 1VZ7A 2K9XA 1WE7A 2AQ3B 2KLCA 2LEKA 4W9EA 1I35A 3P4QB 3EFCA 3MJ5A 1QOFA 4II3B 1Z2MA 4KKIA 1WIAA 3MC9A 3W2DA 2GMIC 1ZPSA 5T8IA 1HXYD 4URKA 3ZGZA 4GXBA 3AE2B 5TSSA 1IGDA 2BKRB 4KSKC 4ASWC 5CTRC 4DBGA 2LI5A 2N9EB 1YQ4B 5AZGA 2UYZB 2WDQB 4WJNA 3AH7A 4LK0M 4MSMB 3LB8C 2NBVB 2V9HA 3AI5A 2DZKA 3DBLI 2WLBA 1UD7A 2KLGA 4RCOA 1KH0A 1EF5A 3ZJTA 2GBJA 1WY8A 1VCBA 1E10A 4IWQA 3IHPC 1FXTB 2IJ0A 3ML9A 3TIXA 1NENB 2ZPYA 2LHDA 3SDLC 1R4NB 5H92C 4X57B 3ZXVA 2WXNA 1WF9A 1FRDA 2MJDA 1K52A 1YX6B 2WXQA 2PKOA 2V4LA 3FAHA 2G9HD 1V8CA 5G55A 3ZNHB 1RRBA 3O13A 4FHKA 4RMAA 3GP7A 4KX6B 4DHJD 2JT4B 1RYJA 2BF8B 2AL6A 1L5PA 3L08A 2KWDA 2ZW0A 2KWVB 4BBNF 4KVGB 4HKQA 2RD0A 3VH3B 3M63B 4GDLB 4W9DA 5JH5C 2OJWA 2J42A 4FXCA 2AQ2B 3BK1A 3RN9C 4CHKA 1I4XA 1QF6A 1CJEA 2KN4A 3PRPB 5AZFA 1E9MA 1TKEA 1ZKHA 4RM9A 3PZ7A 2BBCA 4WJQA 2K1FA 3LYYA 1WGGA 1N6ZA 2I1KA 1TIFA 2AWTA 3OWEB 3EUB2 1SIJA 2INNE 2MX2A 1MI0A 4ZOHC 4YT0B 2BVCA 2K25A 5I4DA 3UINB 3C8YA 2KZRA 3QARA 4A9AA 4AQ7A 4NQLB 4OZBA 3SR6A 5AUKA 1TZ1A 1TYGB 1KFYB 1KRHA 2M0XA 2JYEA 1A70A 3RZFA 2YVCA 1T3QA 5HI1A 1N5XA 1UUPA 4F7ZA 2KT7A 2WU2B 1NI2A 3IBEA 4P1BC 4BBNC 2Y5CA 3N1XC 4L23A 1TT5B 2WHIA 1WJ6A 4FA6A 4JGHB 4M0WB 2G4SA 4M8NA 4ZYNA 1UELA 2EMSA 4GB9A 4DXFA 3H6NA 4FLHA 4NJ6A 1E8ZA 1WX7A 2WXFA 1FNUA 2M1MA 3H1UA 2PIAA 4MM3B 1SBBB 1OQQA 3M3JA 5IO9A 4GDKA 1WR6E 1YN3A 2WXIA 3AE6B 2LZ6A 2PEAA 3MFGA 1PUTA 4MJSA 4FN2A 3W5VB 5DPSA 5E6NA 1WGRA 4OZAA 3VUWA 4WQOB 3PV1A 4ZRKA 1KLGD 3RZWC 2WXKA 2K8BA 3ZQ4A 3QWZB 1SB3C 3NOBA 2FCNA 2D10A 5D3DA 3PRZA 3RT3B 4NJCA 3BK2A 1CK1A 3Q8EA 1F1HA 2ICIA 4FBJB 1VLBA 5FKAC 2GOWA 4ITKA 1YMHE 1TY2A 2L05A 2C7NB 4GLSC 3AXCA 2BQQA 2RMMA 1N5WA 4K3BA 1V86A 1WXVA 4DK5A 2WXRA 2K0PA 1JWUD 1WYGA 3C19A 3NZUA 4HJGE 1ROEA 4ARIA 1I4GA 3ZKJC 3WAMA 2PE6B 4AOFA 4A3PA 4BAXA 1V97A 3PPAA 2BYTA 1XQQA 3TEYA 4TV3A 1SJHD 3Q3FA 3U4EG 2DYMA 1QT9A 3TEZA 4HCPB 1EO6A 3GZNI 4IG7B 3ZNID 3EHVA 3OAWA 3ZLZA 2RSUA 1PGXA 2BB6A 4PK1A 4JX1C 3ZDTA 3OLMD 3AEAB 3H7PB 1V49A 3OJ4B 1D5MC 1T0SC 2R61A 1G6JA 1L6UA 3PZ8A 2JF5A 2G45B 2RPQA 4WJOA 3BZDB 2K22A 4M02A 5IN7A 1UBQA 1YQBA 3OG5A 5CHFA 1ZXHA 2BYEA 4HWIB 2CJOA 1E7UA 2LRUA 5J17A 1JRUA 3L17A 3K9PB 4G11A 3KQ4A 5DPWA 3PREA 1SXTA 3N9YC 3W1YA 4A90A 3PSEB 3HVZA 1ZXIA 4BOSC 1P0RA 2CKHB 3W1SC 2KJHB 2D11A 1X1MA 4HEA1 4KGRA 1WXSA 1F0ZA 3EGRA 5GMVA 4MH0E 4NAMA 2MP2B 3ZTCA 3IT4B 2EKEC 2KDEB 3LJ3A 3PZDA 2J53A 1PYWD 1V6EA 3APFA 1E7PB 1WR1A 4XZ4A 2KTRA 1XEEA 3D32A 5D2MB 1Q0WB 1ZDXA 3DHIC 4MACA 2DHZA 2W54A 1ZGUB 3A9KB 1TS2A 3VR9B 4JE3B 3A1QA 3NUHB 1OQRA 4W9JA 3MJWA 4MGIE 4RFBA 4NQKE 4E3CA 3VUYA 1GAQB 3V6CB 2I38A 2XBBC 2K8HA 1DYQA 2JWUA 2IO2B 2W55A 1FXAA 3APDA 3VAWA 2CU1A 2JPHA 1WWTA 4PS7A 5KHOA 2W3RA 4G0NB 3VRAB 3TUOA 1FCCC 1XT9B 2BWES 3WA0A 3MC0B 3BVMA 3ZDMC 1V1PB 1EM7A 1WI0A 3FILA 2CJNA 4WWPA 3Q3NC 3X0WA 5CHVC 3ZVVA 3VUXA 4Q2JA 2XEWA 1RM6C 1BUIC 5L95C 1WRDB 3JSVB 1EWYC 4I6LB 3V60A 1XLNA 3A4SC 2J7QB 3IVFA 4OHJA 3NS1A 5LXHA 4E74A 2MLBA 3ML8A 1R7SA 3RYTA 3RMKC 1UNSA 2IO3B 3N1ZC 1VJKA 2NCNA 1VRAB 4J3OD 2QSDA 3Q8BA 2ZJDA 2IGHA 3JW0X 1GUAB 1E8YA 3A9JB 3AULA 3TJPA 2DENB 1KLVA 1VD2A 4HKZE 4XC2A 3U52E 4JIOU 5EE1A 1DOYA 2JYTA 2JU6X 4DWFA 2R2OA 1J7CA 3RFZB 1GB1A 2ZCBA 4K7SA 4W9LA 2KMMA 4MSQB 4H2AA 4B6WA 1Y8RC 3KUZA 1R4MB 2DBYA 2X8XX 3QC8B 1I4QA 1WM3A 3URYA 4YSZB 2AL3A 4FULA 2PJHA 2DZIA 4LTUA 3PLVA 2LHEA 1GPXA 2KFKA 3NZSA 5DCNA 2K6QA 4KZ0A 3SD5A 2ZZPB 2O6VB 2LRWA 2V3NA 3EECA 3C0RB 1XLPA 3DVNV 2JWZA 2KHWB 2LJIA 2NPTB 3AM9A 4YXDB 2I2YA 2LGIA 5BYQA 3PS6A 1KTKA 2O2VB 3Q6BA 2L83A 1FEHA 5E6JA 2B3AA 1GJZA 3WCQA 2HTME 1C9FA 4HRSA 4WJPA 1CMXB 2IZVB 4DHZE 2MEKA 5C3JB 4GIVA 4GN1A 1MG4A 2EKIA 1N61A 3RNEC 4GMVA 3W9CB 5DPTA 3P63A 4AJYB 2Z8LA 2D3CA 2MBHA 3PHWB 1ZUD2 2KTFA 3VTUA 5GXGB 4B0MA 1XLOA 3BVZA 4A55A 3L0WB 2GB1A 2MRPA 3ZIMA 1BXTA 2C7MB 3AE9B 4YWGG 3NS8A 4EUTA 5BYSA 4B95A 2J0MA 2MA9B 1C76A 4K1RB 1BMLC 3V3XA 2LUMA 4EZKA 3KWLA 1R4NI 1UZXB 1JWMD 2L8JA 3BYTB 1WMHA 1NBFC 1QZEA 1C1YB 4I6PA 3U7DA 2NVUI 2CHZA 1DOIA 3A33B 5IA7A 2BKFA 1MHHE 2JXTA 2ZVNA 3CSTA 4WAFA 4LLGM 3UIOB 1ACCA 1V9JA 1WH3A 4EKUA 5E6PA 5FR6A 3DBLB 3O65B 2N4FA 3DBHB 4E71A 3AE3B 1HZ6A 1VR9A 4LJPB 2FAZA 2IGDA 5D3IB 2WP9B 3DWGC 3P2BA 5D94A 2G4DB 3T9LA 2C5LC 1AARA 3UQBA 2JZPA 1GG3A 4GSWA 2K6DB 4F1SA 4LNOA 3ZYYX 4KDLB 3M95A 3MTNB 3L54A 1ZW7A 2E3TA 4A3OA 1TTNA 2BW2A 2XNAC 3ALBA 4HVBA 2DYBA 3FKYA 4XDDA 3QJZA 1D6EC 2L00B 4RH6A 2MW5A 1MVKA 4NY0A 1RWSA 2PPHA 1XF5L 2KN5A 1DOXA 2MBEA 4CQNA 4M00A 4BZAA 2NTTA 2D5GA 3TMPB 3DBRI 1F9JA 1QOBA 4W9CA 4N9F4 4K7WA 2JRIB 3KW5B 3ZW3A 1P7FA 2L1AA 5JZEB 5HKHA 4MGKE 2MWSB 2C9WB 1IBXA 1KOTA 2J0JA 1RFKA 2DAJA 4BKTA 1KLUD 4WQMA 3TEWA 2PMVA 1WE6A 2WXGA 4RF1A 3PO0A 5J18A 2SAKA 1J7AA 4YTPB 3HIZA 2QC8A 4TUUA 1PFDA 4WWOA 2RDHA 3HM3A 2N1VA 3H9DA 1STEA 2CU3A 3IXSA 2KX0A 5IOIA 1WGKA 2GLSA 1V1OA 4IDIA 1FM0D 3CMMB 1TS3A 1JWAD 3TL5A 4YTMB 2BPSA 2CHXA 1WSPA 2ZCCA 4OZCA 5MPOA 3GOEA 4QAYA 1TBEA 3R2IA 1TJEA 3IG3A 3Q3MC 4MH8A 1FNWA 2GRIA 3PRMB 2XK5A 1K51A 1UGMA 1YJ1A 3FC4A 3CIRB 4KGSA 4ZHOA 1F2RI 1K8RB 4KIKA 2PVOD 1PDXA 1XD3B 2V3PA 3UIPB 4NAWA 2ASQA 1D5ZC 1QLBB 1WRIA 1P98A 4GDKB 3AE8B 4W9GA 3BINA 3CWIA 1FFVA 2AEHA 2JRHA 3I3TB 3LDZE 2KAJA 5KHQA 3Q3JA 4MJSB 4BFRA 4IKGA 3SFEB 2N7JA 1HTQA 3SU8X 1FFUA 3M62B 4IWPA 1P3QU 5FR3A 5C1ZA 4HCNB 1WJ4A 2C7HA 4ZRIA 1FXIA 1L0YB 3BIID 1OQYA 4IM0A 1OEYA 1SE3A 4HK2A 2DX5B 2A5UA 2KNBA 2WNMA 5BMGA 4ZHPA 2UWQA 1JWSD 2OHFA 2DLBA 3EA6A 3BY4B 4IWOA 3PGEA 3W5UB 4ICUA 1KJTA 1M94A 4DDID 4HPPA 3VVWB 1B9RA 2C60A 1EUVB 3HK0A 2KOXA 3TCAA 4BKSD 2LGSA 1L4ZB 2KWUB 2YEPB 4HPLB 4ZRPA 3H8HA 1E8WA 1E7VA 5D7GA 2QJLA 5JHBA 2GBRA 3V6EB 2M4NA 3GE8C 2KMAA 4YTNB 5LNK1 2J4XA 4LDTB 3WAPA 5DPRA 4I6NB 2Y3AA 2V4IB 4MGYE 4OVVA 3ZTDA 2BT6A 5L83A 3U7ZA 2BYFA 2K39A 4RGMA 1L4DB 3ZNZB 3DBSA 3NVVA 1V5OA 4AWJA 4GGQA 1OFFA 4WAAA 1XO3A 1S1QB 3NVYA 2AQ1B 1YIWA 3JVZX 2MH7A 4ZRQA 2WS3B 2ZNVC 4WIPA 1FPYA 2ZPNA 2V0GA 1XXGA 3P1MA 1P9DU 2KJ6A 3V61A 3APCA 2ON8A 1PGBA 2AYOB 4R3DA 3QIJA 2LASA 4M8MA 4TSSA 2LMCA 2YEPF 4OW0A 2RGFA 4US9A 4DQOC 2RDGA 1L6VA 1WX9A 4AJWA 4P1CC 3WALA 2MJ3A 2INDC 3R2TA 2VZKB 3DVNU 4HPMB 2B76B 3UGBB 5H8YE 4OVUA 1CQVA 3HM6X 1QOGA 4XWTA 2CHWA 4A20A 2N9LA 2LXCA 2HJ1A 3SHQA 4ICVA 3V62A 2LWPA 2V1YA 3B08A 3I63C 3NJTA 2KDIA 2EMTA 4B0EA 2LJ5A 3B0AA 3RCZA 1JW9D 3AE7B 3MC8A 4K3CA 1EU3A 2KTRB 3RD2A 4IUMB 2PVGC 2CR5A 1LO5D 1B1ZA 2J0KA 4TQ1A 4ANWA 1UWMA 3L16A 1HQRD 2KKCA 3A1QB 4W9HA 2YLMA 4G3XB 4TQ0A 2MBOA 4DXGA 4L2YA 2N7DA 2HJ8A 4IM3A 4US8A 1OGWA 1MG8A 3KUDB 1N63A 2IY0B 4USAA 2M56B 1T5XD 3ZO5B 3N1YC 4HROA 1ISNA 2O6VD 4HDOA 5AZHA 2WXOA 4HLEA 1V2YA 4WH4A 1V81A 3R7RA 1UWXA 2Z0EB 2KQ4X 3PLUA 3RI7C 1L7YA 1T6BX 3VXWA 4XGAB 2R2QA 1LFDA 4YSYB 1XCQL 3FILB 3NY5A 2DAFA 2KQ7A 3QCAA 2BTEA 2L7RA 2KK8A 2KXJA 1R4MI 2KDMA 5G5HA 1ET9A 2ZW1A 4MDKE 2UU7A 3CSFA 5CHWA 4FHJA 1E90A 5BMIA 2J52A 4W9KA 3X23A 1YQ3B 1TZOA 3Q8CA 4XDCA 2VH2A 3HVDA 3HHMA 4F8CB 2GBMA 2QEJC 3B9JA
chains in the Genus database with same CATH topology
2SEBD 4WAFA 2WXIA 5AUIA 3AE6B 4WURA 1D4BA 1FMAD 4LLGM 1ESFA 3MFGA 1HZ5A 1QILA 1ACCA 1PUTA 3NVWA 4TMAB 3W5VB 1Y56A 1SJED 1PGAA 1GOZA 1VZ6A 1XCTL 4OVZA 4OZAA 5HG2A 1SE4A 3AE3B 1HZ6A 1VR9A 1KLGD 2WXKA 2WXJA 3ZQ4A 3P42A 1SB3C 2IGDA 5D3IB 5D3DA 1FNVA 1SF0A 1HA5A 2WP9B 3DWGC 4NJCA 3BK2A 4O1NA 2QMTA 4REZA 2G1EA 1CK1A 3Q8EA 2ACZB 2ICIA 2JZPA 3I9V1 4RGTA 4A8XC 1SE2A 1VLBA 3ZYYX 2OEDA 5FKAC 1QQRA 2N0SB 2TSSA 4ITKA 3AEFB 2E3TA 2N9KA 5C2TB 3P4RB 4C7ZA 4PT5A 1YMHE 1TY2A 1L0VB 3HUIA 1TKYA 2BW2A 3ETRA 2XNAC 1F2RC 4GLSC 1V1PA 1GB4A 4N58A 4KGTA 2RMMA 1N5WA 2HDEA 4XDDA 3MP9A 1YN5A 4RF0A 1D6EC 2WXRA 4RH6A 1ZE3D 5HFYA 2K0PA 1MVKA 1ZOYB 1RWSA 3VQIA 1D5XC 2BS3B 1JWUD 1XF5L 2JQRB 1WYGA 2L32A 1DOXA 2Q5WD 3KLSX 1CZPA 4CQNA 1QKZA 1HEZE 3MHZA 2NTTA 4HJGE 1ROEA 1TS5A 2D5GA 4ARIA 1I4GA 2AX5A 3AEGB 1QOBA 1NYQA 2WXLA 1V97A 1E6EB 2BYTA 1YNTE 1K50A 1P7FA 2DYOA 2L1AA 3TEYA 1SJHD 2IDYA 2ONQA 1AW7A 4C7YA 1C4PA 1IBXA 3U4EG 4RGOS 1JRPA 4D2KA 2DYMA 1RFKA 4ARCA 3IAS1 2DWQA 1QT9A 2JX5A 5EE9A 1KLUD 3TEZA 3RPFC 4WQMA 3TEWA 1J7BA 3Q69A 2PMVA 2QIEB 3BVGA 2WXGA 1PGXA 2BB6A 4JX1C 4RF1A 3PO0A 3IT6B 1YN4A 2IGGA 2SAKA 3AEAB 3E56A 1J7AA 4YTPB 4EE2A 1D5MC 1SEBD 1FIQA 1PFDA 1N62A 2BB5A 3TSSA 1C78A 2R61A 3NZ3A 2RDHA 2FE8A 1L6UA 3PZ8A 3NVZA 1TKGA 1TY0A 2WDRB 4P6VF 3BZDB 1UGJA 2K22A 1VDVA 2XN9C 1STEA 2CU3A 1ZXHA 3IXSA 2CJOA 1I4RA 1WGKA 1NEKB 2RPVA 1V1OA 4JWUC 4IDIA 1FM0D 1JMLA 5BYRA 3R8BA 3GB1A 1TS3A 1JWAD 4YTMB 3E9SA 3KQ4A 1SXTA 3AMZA 1WSPA 3N9YC 4N6EB 3VR8B 4OZCA 1DGJA 5MPOA 4A90A 1P7EA 1AN8A 3R2IA 1TJEA 3HVZA 1C77A 1ZXIA 5FK9C 4XE0A 1JCKB 1M4VA 1NI3A 4MH8A 1FNWA 1C79A 2GRIA 2WDVB 4HEA1 4KGRA 1K51A 1F0ZA 3FC4A 3B9JA 3EGRA 4NAMA 3CIRB 2JSVX 4KGSA 3ZJUA 3V05A 4ZHOA 4WWMA 3IT4B 1F2RI 2NMQA 3SFDB 1JROA 1F77A 2PVOD 1PDXA 2V3PA 2WXHA 1Q10A 2J53A 3I57A 1PYWD 3AE1B 3BYYB 1E7PB 5EE0A 1D5ZC 1QLBB 1XEEA 1WRIA 3ZJVA 1ZDXA 1ZDVA 1FO4A 4GDKB 2EELA 1ZP0B 2K5PA 2M19A 3AE8B 4MACA 1IUEA 2W54A 1JWBD 1YJIA 3CWIA 3IAM1 1EWCA 1FFVA 4L1BA 1TS2A 4P16A 3VR9B 4JE3B 2KAJA 3NUHB 4A6QA 1C4CA 1OQRA 4IKGA 3SFEB 4XWWA 2N7JA 4RFBA 1NVID 4YSXB 1FFUA 1JQ4A 3T3NA 1FRRA 5FR3A 1GAQB 2I38A 1FXIA 1L0YB 3BIID 3P4PB 5BMHA 4ZYSA 1DYQA 1SE3A 1L0XB 4AS1A 2X38A 1MPEA 4UDUC 2WNMA 1JALA 5BMGA 4ZHPA 2JWUA 1TS4A 1VZ7A 2PLPA 1FXAA 2W55A 3UI3A 2BS4B 3KWVA 2PW9A 1JWSD 2K9XA 2OHFA 2LEKA 2AQ3B 1KF6B 2DLBA 3EA6A 1WWTA 3P4QB 2H89B 5EE3A 3SEBA 3W5UB 3MJ5A 1QOFA 2W3RA 2E6XA 2Y5PA 3VRAB 3TUOA 1FCCC 2INPE 3GS2A 3ABVB 3L4PA 4KKIA 1B9RA 4N59A 3MC0B 4KKJA 3BVMA 4M0WA 1V1PB 3W2DA 1EM7A 3FILA 1ZPSA 2CJNA 1HXYD 5T8IA 1L4ZB 4Q2JA 3ZGZA 1RM6C 3AE2B 5TSSA 1BUIC 1IGDA 1WXQA 2YEPB 2NTSA 4ZRPA 3H8HA 5D7GA 2QJLA 1EWYC 1IGCA 1YJJA 3B2GA 1YQ4B 5G5GA 4RNAA 1XLNA 4YTNB 5LNK1 2J4XA 2WDQB 4NZLB 4OHJA 1K53A 3NS1A 3AH7A 3AN1A 4LK0M 5JXVA 3LB8C 1R7SA 3W1SA 2Y3AA 2V4IB 1FCLA 1UNSA 1VJKA 2WLBA 2BT6A 3U7ZA 1IBXB 1VRAB 1VZ8A 4RCOA 1KH0A 3ZJTA 1QOAA 4J3OD 4RGMA 1L4DB 2WXPA 1I4HA 2QSDA 3Q8BA 3NVVA 2IGHA 1E10A 3AEBB 3AE5B 1OFFA 2IJ0A 1XO3A 4HKZE 3NVYA 1NENB 3U52E 1MHXA 5EE1A 1DOYA 2AQ1B 2LHDA 2WU5B 2JYTA 3AEDB 5H92C 2JU6X 1N60A 2L52A 2PTLA 2MH7A 2WXNA 4ZRQA 2WS3B 1J7CA 4WIPA 2W3SA 1FRDA 2MJDA 3RFZB 1ENFA 1K52A 3VRBB 1GB1A 2WXQA 2PKOA 2V0GA 1XXGA 2FUG1 3P1MA 2H88B 2WQYB 2KMMA 4H2AA 3Q8FA 3FAHA 2G9HD 2ON8A 1V8CA 1PGBA 2DBYA 1I4QA 4R3DA 3URYA 4YSZB 4TSSA 4LTUA 2LMCA 2YEPF 3O13A 4OW0A 2LHEA 4US9A 4DQOC 1GPXA 2BS2B 2RDGA 3NRZA 1L6VA 3GP7A 4KX6B 1RYJA 2MJ3A 2GI9A 3R2TA 1L5PA 2VZKB 2KWDA 2ZW0A 2V3NA 4MT5A 2B76B 5H8YE 3BWUD 1XLPA 1CQVA 2LJIA 3AM9A 1QOGA 2W82A 4XWTA 4YXDB 2I2YA 4HKQA 2LGIA 3LXFA 2N9LA 5BYQA 1KTKA 1C4AA 4RGNA 2L83A 1FEHA 3J9CA 4GDLB 5E6JA 4C80A 1SSNA 2QILA 5HHDG 3WCQA 2HTME 1C9FA 2J42A 4FXCA 4HRSA 2AQ2B 3BK1A 1I4XA 1QF6A 4B0EA 1CJEA 2KN4A 2FBWB 1AWDA 4NAWB 1JW9D 2MEKA 3HRDD 3AE7B 5C3JB 1E9MA 1TKEA 3PZ7A 2BBCA 1EU3A 4JWSC 2EKIA 1NYRA 1N61A 3LYYA 1XLQA 3AV8A 2PVGC 3OWEB 3EUB2 3W9CB 1SIJA 2INNE 1LO5D 1B1ZA 3P63A 2K3UA 1MI0A 4TQ1A 2Z8LA 4ZOHC 4YT0B 1UWMA 2LFIA 1HQRD 5I4DA 1EU4A 1ZUD2 4TQ0A 1I7HA 3C8YA 4A9AA 4AQ7A 4OZBA 3SR6A 4L2YA 4DXGA 5AUKA 5GXGB 4B0MA 2MJEA 1XLOA 3BVZA 4US8A 4A55A 4JPSA 1E0ZA 1I4PA 1TYGB 3AE4B 1KFYB 2GB1A 1N63A 3U2SC 4USAA 2M56B 1T5XD 3Q8AA 3T3OA 1AYFA 1KRHA 4HROA 2JYEA 1BXTA 3AE9B 2IPKD 4YWGG 5BYSA 3DWMA 1A70A 2VZKD 2WXOA 1C76A 4WH4A 1T3QA 1UWXA 5HI1A 1N5XA 1UUPA 3P4SB 1BMLC 2KQ4X 4C56C 3V3XA 2LUMA 1ET6A 2WU2B 3KWLA 1T6BX 2Y5CA 4L23A 2M0AA 3B2FA 4YSYB 1XCQL 1JWMD 3BYTB 3FILB 3AB5A 2BTEA 4IOIE 4DXFA 2KDMA 5G5HA 1ET9A 2WXFA 2ZW1A 1FNUA 5BMIA 1DOIA 2J52A 3AEEB 2PIAA 2KACA 2WXMA 4MM3B 1FD6A 1SBBB 1YQ3B 1OQQA 1TZOA 3TEXA 3Q8CA 3AECB 4XDCA 3HVDA 2JXTA 2QEJC 1MHHE 1YN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2Y A;  1D4B A;  2LGI A;  2N9L A;  1FCC C;  1HZ5 A;  5HHD G;  1C9F A;  1PGA A;  1EM7 A;  1XCT L;  3FIL A;  4OZA A;  5HG2 A;  1ZXH A;  1HZ6 A;  2KN4 A;  1IGD A;  2RPV A;  2IGD A;  1JML A;  3GB1 A;  2QMT A;  1IGC A;  4OZC A;  1P7E A;  2JZP A;  1MI0 A;  2OED A;  1K53 A;  5JXV A;  2N9K A;  4KGR A;  1K51 A;  4OZB A;  1YMH E;  1FCL A;  2JSV X;  4KGS A;  1F2R C;  4GLS C;  1GB4 A;  1IBX B;  2NMQ A;  1F2R I;  1KH0 A;  2GB1 A;  2RMM A;  4KGT A;  2QSD A;  3MP9 A;  1Q10 A;  2J53 A;  2IGH A;  5HFY A;  2K0P A;  1MVK A;  1XF5 L;  4WH4 A;  4HKZ E;  1MHX A;  1QKZ A;  2EEL A;  1HEZ E;  1UWX A;  4MAC A;  2LHD A;  5HI1 A;  2KQ4 X;  4HJG E;  2JU6 X;  3V3X A;  2LUM A;  2PTL A;  1K52 A;  1GB1 A;  4IKG A;  2N7J A;  1YNT E;  1K50 A;  1P7F A;  1XCQ L;  2ON8 A;  3FIL B;  1PGB A;  2ONQ A;  1IBX A;  2I38 A;  4IOI E;  4D2K A;  5BMH A;  2KDM A;  2LHE A;  2ZW1 A;  5BMI A;  1MPE A;  2J52 A;  2KAC A;  5BMG A;  2JWU A;  1FD6 A;  3UI3 A;  2PLP A;  2PW9 A;  2GI9 A;  1PGX A;  2KWD A;  2ZW0 A;  2JXT A;  1MHH E;  2IGG A; 
#chains in the Genus database with same CATH topology
 2G3Q B;  4RM8 A;  3N20 C;  5AUI A;  4WUR A;  1D4B A;  3RNF C;  1FMA D;  1ESF A;  1HZ5 A;  2L3Z A;  5J2R A;  3KUC B;  3NVW A;  2D3A A;  4TMA B;  3RUI B;  1Y56 A;  2NR2 A;  1PGA A;  4PYZ A;  1XCT L;  3NHE B;  4OVZ A;  4TKN A;  1SE4 A;  4IC7 B;  1SIF A;  4AP4 C;  2WXJ A;  3P42 A;  1YX5 B;  2GBN A;  1SF0 A;  1HA5 A;  3N3K B;  4O1N A;  2QMT A;  4WWN A;  2G1E A;  3S2A A;  4JL9 A;  4W9F A;  3I9V 1;  4A8X C;  1SE2 A;  4MEM A;  1QQR A;  3Q3O C;  2N0S B;  4XX5 A;  3VFK A;  5C2T B;  3KYD D;  2N9K A;  2KX3 A;  3P4R B;  1TKY A;  2W9N A;  1GB4 A;  1BT0 A;  4N58 A;  4KGT A;  2BYV E;  1IP9 A;  5LLI A;  3MP9 A;  1YN5 A;  2KFK B;  5HFY A;  1UH6 A;  3VQI A;  2FUH B;  1D5X C;  2BS3 B;  1E5W A;  2L32 A;  2Q5W D;  3KLS X;  2IO0 B;  4W9I A;  1TS5 A;  1E8X A;  3R3M A;  2QHO A;  3AEG B;  1NYQ A;  3WAN A;  1E6E B;  2Z0D B;  4S0R A;  2Z59 B;  2DYO A;  3N30 A;  3A4R A;  2ONQ A;  4EZJ A;  1KM7 A;  2N9X A;  1AW7 A;  1C4P A;  3WAO A;  2N1W A;  1JRP A;  4KV2 A;  4ARC A;  4YL8 A;  2MHJ A;  3ZRC A;  2LVQ A;  2WDT B;  3N32 A;  2VH1 A;  3RNC C;  3Q69 A;  3QX1 A;  3BVG A;  3R7Q A;  1WXA A;  3IT6 B;  2IYD B;  5C23 A;  2IGG A;  4EE2 A;  2FCS A;  4EEW A;  2QCZ A;  1SEB D;  1FIQ A;  1N62 A;  5CX3 A;  2Y5B B;  2OOB B;  2DZJ A;  1A5R A;  3T8M A;  3NVZ A;  1UGJ A;  1Q5W B;  4GU2 A;  2LVO A;  3MHS D;  1S3S G;  1I4R A;  3DBH I;  1NEK B;  2RPV A;  3RNA C;  3R8B A;  2HTH A;  3VTV A;  4HXD A;  3AMZ A;  1AN8 A;  4XE0 A;  1M4V A;  2BWF A;  2MCN B;  2WDV B;  1MJD A;  4P7I A;  3AU5 A;  4GDL A;  1RAX A;  4BOZ B;  2IBI B;  4IW0 A;  1Q1O A;  1WMH B;  2JSV X;  4FJY A;  2NMQ A;  4XYC A;  3WIM A;  3ZUN A;  3SFD B;  1JRO A;  2WXH A;  3I57 A;  3QQ8 B;  4ZRJ A;  4LNI A;  2L0T A;  3QK0 A;  1ZDV A;  1FO4 A;  1ZP0 B;  2K5P A;  1YJI A;  3R66 C;  3IAM 1;  1EWC A;  1LGR A;  2FCQ A;  3K9O B;  1C4C A;  1NVI D;  3PTF C;  4YSX B;  3T3N A;  2L76 A;  3B1L X;  4G50 A;  2IY1 B;  2IO1 B;  3P4P B;  4ZYS A;  5IKC M;  3Q2A C;  1MPE A;  2MSE D;  3UI3 A;  2PLP A;  2BS4 B;  3KWV A;  2PW9 A;  2RDB C;  2K8C A;  1KF6 B;  4B9K A;  2LXA A;  2H89 B;  5EE3 A;  3SEB A;  2E6X A;  2Y5P A;  1EF1 A;  5IP4 D;  2JUO A;  2LGX A;  2INP E;  3GS2 A;  3L4P A;  3ABV B;  3L10 B;  2WGS A;  4LNK A;  3VHT C;  4N59 A;  4PYU A;  4KKJ A;  4M0W A;  1LM8 B;  4NJ7 A;  5LXI B;  1WXQ A;  3U8Z A;  1GC6 A;  2NTS A;  3VDZ A;  4ACF A;  2RR9 A;  4HJK A;  4MM3 A;  3ZNG C;  1D3Z A;  3ZRF A;  2N7E A;  4DHJ B;  1IGC A;  1YJJ A;  2JXX A;  2FNJ B;  3B2G A;  2D3B A;  5G5G A;  3DBR B;  4RNA A;  2N9P C;  3VTW A;  4NZL B;  2KC1 A;  1L2N A;  2JVC A;  1K53 A;  3AN1 A;  4KZC A;  1TGZ B;  5JXV A;  2FCM A;  1GNU A;  2JZ3 B;  3W1S A;  1FCL A;  1IBX B;  1VZ8 A;  1QOA A;  2WXP A;  1I4H A;  1NDD A;  1WXM A;  4EFO A;  4M01 A;  3AEB B;  4C4V A;  1WGY A;  3AE5 B;  1H4R A;  3ONS A;  1C3T A;  4FAD A;  1MHX A;  2ZNV B;  2WU5 B;  3AED B;  3PHX B;  1N60 A;  2L52 A;  2PTL A;  1J19 A;  2NS5 A;  2W3S A;  1ENF A;  3VRB B;  2PE9 A;  4J6I A;  2FUG 1;  3VH4 B;  2H88 B;  2WQY B;  2ZEQ A;  3Q8F A;  1IYF A;  4ZDV A;  2JY6 A;  2GBK A;  2KQS A;  2WWZ A;  2BS2 B;  3NRZ A;  3EFU A;  2GI9 A;  4C4V B;  4MT5 A;  4LDT D;  2KDF B;  3BWU D;  2WX0 A;  2HE7 A;  1J0G A;  2W82 A;  3LXF A;  2XK5 B;  4IM2 A;  1C4A A;  4RGN A;  4CO7 A;  3J9C A;  4C80 A;  1SSN A;  2QIL A;  5HHD G;  4KIK B;  2KJR A;  1SGH A;  2FBW B;  1AWD A;  1WGD A;  3HRD D;  4NAW B;  5G2N A;  3ZXR A;  4JWS C;  1PQS A;  1NYR A;  1XLQ A;  3AV8 A;  1WZ0 A;  2INC C;  2LGY A;  3U30 A;  2MQJ A;  1T0R C;  3KH0 A;  2K3U A;  4ANV A;  2LFI A;  3H7P A;  1EU4 A;  1I7H A;  1WJN A;  2MJE A;  4JPS A;  1E0Z A;  1I4P A;  3AE4 B;  3PT2 B;  2CS4 A;  5EDS A;  2NBU A;  3U2S C;  3Q8A A;  1WX8 A;  4EOY A;  3T3O A;  1AYF A;  4BVU C;  2IPK D;  3QA8 A;  3DWM A;  2VZK D;  3KVF B;  3TBL D;  1GC7 A;  3KYC D;  3NG0 A;  5JHA A;  2VRR B;  3P4S B;  4C56 C;  4JQW C;  1ET6 A;  3DOW A;  1Z5S B;  2M0A A;  2LUE A;  3B2F A;  3Q14 C;  3DVG Y;  1WM2 A;  1UF0 A;  1WGH A;  2MP2 A;  3AB5 A;  1WFY A;  3GZN B;  4IOI E;  4KSL C;  4BKS A;  2KO3 A;  3DDC B;  1F52 A;  2A4Z A;  3AEE B;  4KDI C;  2KAC A;  2WXM A;  4DHZ B;  5BO4 B;  1FD6 A;  3QAQ A;  3TEX A;  3AEC B;  2SEB D;  4II2 B;  2OJR A;  3A9K A;  1QIL A;  1V80 A;  1U4A A;  1SJE D;  1LXD A;  2LVP A;  1GOZ A;  1VZ6 A;  2JZZ A;  5HG2 A;  2MBB B;  4PS3 A;  2LGD A;  1FNV A;  3JYU A;  1SE9 A;  1T0Q C;  4REZ A;  2REX A;  2KFJ A;  2M17 A;  2M8S A;  2ACZ B;  2KWC A;  4PS8 A;  2KAN A;  2LD9 A;  4RGT A;  2OED A;  2DZM A;  3DCG A;  1MFW A;  2TSS A;  3AEF B;  4C7Z A;  4PT5 A;  3DPD A;  3DHG C;  2KYW A;  1L0V B;  3HUI A;  3ETR A;  1F2R C;  1RLF A;  1V1P A;  2KC2 A;  4GOC A;  2KDB A;  2HDE A;  1WZ3 A;  2KVZ A;  1HTO A;  4S17 A;  2KVR A;  3ENE A;  4RF0 A;  3UQA A;  4DDG D;  1ZE3 D;  1ZOY B;  2JQR B;  1UBI A;  1CZP A;  1QKZ A;  3RNG C;  1HEZ E;  3JSV A;  3MHZ A;  5D6J B;  3OJ3 A;  3DVG X;  1I42 A;  2AX5 A;  4CYE A;  4LCD E;  1OTR B;  1OEY J;  2WXL A;  2D07 B;  4LNF A;  2DNF A;  2WX1 A;  1YNT E;  1H8C A;  3GE3 C;  1J8C A;  3I5J C;  1K50 A;  1IPG A;  3RNB C;  1RFA A;  2IDY A;  2BGF A;  4C7Y A;  4RGO S;  4D2K A;  3IAS 1;  2DWQ A;  4K7U A;  2JX5 A;  4C00 A;  5EE9 A;  3RPF C;  1LQB A;  3A9J A;  1J7B A;  2QIE B;  1V5T A;  2KMC A;  2D2Q A;  1YN4 A;  3E56 A;  2L0F A;  2V3S A;  5TR5 A;  2BB5 A;  3TSS A;  1C78 A;  3QHT A;  3NZ3 A;  2FE8 A;  2FID A;  1TKG A;  1TY0 A;  2WDR B;  4P6V F;  1VDV A;  2XN9 C;  5IAA C;  2MBQ A;  4JWU C;  4AUQ C;  3L13 A;  2HD5 B;  1JML A;  1WJU A;  5BYR A;  3GB1 A;  3E9S A;  1YD8 U;  2O6V A;  4N6E B;  3VR8 B;  1DGJ A;  1P7E A;  4JLC A;  4K81 A;  1C77 A;  5FK9 C;  2NPT A;  1JCK B;  1NI3 A;  1C79 A;  4NPN A;  2O2V A;  4ANU A;  2D3G A;  3ZJU A;  3V05 A;  3ECI A;  3DQV A;  4WWM A;  4HDQ A;  4ANX A;  3IFW B;  2NBW B;  2ZVO A;  1F77 A;  5AEK B;  1Q10 A;  4LJO B;  4MEL A;  3AE1 B;  3BYY B;  4FJV B;  5EE0 A;  4EZL A;  4FJZ A;  5E6O A;  3ZJV A;  3RUL A;  1T0Y A;  2EEL A;  2M19 A;  1HE8 A;  1IUE A;  2KD0 A;  4MGZ E;  1JWB D;  3PVL A;  4L1B A;  4P16 A;  4A6Q A;  4XWW A;  3EC8 A;  3UF8 A;  1JQ4 A;  1FRR A;  1P1A A;  4BKG A;  3H7S A;  2I1J A;  3DHH C;  5BMH A;  4NNJ B;  4LNN A;  4DXA B;  1L0X B;  4AS1 A;  2WYQ A;  2X38 A;  4UDU C;  1WYW B;  2QDF A;  1JAL A;  1YOV B;  3AU4 A;  3CF6 E;  2FIF A;  1TS4 A;  1VZ7 A;  2K9X A;  1WE7 A;  2AQ3 B;  2KLC A;  2LEK A;  4W9E A;  1I35 A;  3P4Q B;  3EFC A;  3MJ5 A;  1QOF A;  4II3 B;  1Z2M A;  4KKI A;  1WIA A;  3MC9 A;  3W2D A;  2GMI C;  1ZPS A;  5T8I A;  1HXY D;  4URK A;  3ZGZ A;  4GXB A;  3AE2 B;  5TSS A;  1IGD A;  2BKR B;  4KSK C;  4ASW C;  5CTR C;  4DBG A;  2LI5 A;  2N9E B;  1YQ4 B;  5AZG A;  2UYZ B;  2WDQ B;  4WJN A;  3AH7 A;  4LK0 M;  4MSM B;  3LB8 C;  2NBV B;  2V9H A;  3AI5 A;  2DZK A;  3DBL I;  2WLB A;  1UD7 A;  2KLG A;  4RCO A;  1KH0 A;  1EF5 A;  3ZJT A;  2GBJ A;  1WY8 A;  1VCB A;  1E10 A;  4IWQ A;  3IHP C;  1FXT B;  2IJ0 A;  3ML9 A;  3TIX A;  1NEN B;  2ZPY A;  2LHD A;  3SDL C;  1R4N B;  5H92 C;  4X57 B;  3ZXV A;  2WXN A;  1WF9 A;  1FRD A;  2MJD A;  1K52 A;  1YX6 B;  2WXQ A;  2PKO A;  2V4L A;  3FAH A;  2G9H D;  1V8C A;  5G55 A;  3ZNH B;  1RRB A;  3O13 A;  4FHK A;  4RMA A;  3GP7 A;  4KX6 B;  4DHJ D;  2JT4 B;  1RYJ A;  2BF8 B;  2AL6 A;  1L5P A;  3L08 A;  2KWD A;  2ZW0 A;  2KWV B;  4BBN F;  4KVG B;  4HKQ A;  2RD0 A;  3VH3 B;  3M63 B;  4GDL B;  4W9D A;  5JH5 C;  2OJW A;  2J42 A;  4FXC A;  2AQ2 B;  3BK1 A;  3RN9 C;  4CHK A;  1I4X A;  1QF6 A;  1CJE A;  2KN4 A;  3PRP B;  5AZF A;  1E9M A;  1TKE A;  1ZKH A;  4RM9 A;  3PZ7 A;  2BBC A;  4WJQ A;  2K1F A;  3LYY A;  1WGG A;  1N6Z A;  2I1K A;  1TIF A;  2AWT A;  3OWE B;  3EUB 2;  1SIJ A;  2INN E;  2MX2 A;  1MI0 A;  4ZOH C;  4YT0 B;  2BVC A;  2K25 A;  5I4D A;  3UIN B;  3C8Y A;  2KZR A;  3QAR A;  4A9A A;  4AQ7 A;  4NQL B;  4OZB A;  3SR6 A;  5AUK A;  1TZ1 A;  1TYG B;  1KFY B;  1KRH A;  2M0X A;  2JYE A;  1A70 A;  3RZF A;  2YVC A;  1T3Q A;  5HI1 A;  1N5X A;  1UUP A;  4F7Z A;  2KT7 A;  2WU2 B;  1NI2 A;  3IBE A;  4P1B C;  4BBN C;  2Y5C A;  3N1X C;  4L23 A;  1TT5 B;  2WHI A;  1WJ6 A;  4FA6 A;  4JGH B;  4M0W B;  2G4S A;  4M8N A;  4ZYN A;  1UEL A;  2EMS A;  4GB9 A;  4DXF A;  3H6N A;  4FLH A;  4NJ6 A;  1E8Z A;  1WX7 A;  2WXF A;  1FNU A;  2M1M A;  3H1U A;  2PIA A;  4MM3 B;  1SBB B;  1OQQ A;  3M3J A;  5IO9 A;  4GDK A;  1WR6 E;  1YN3 A;  2WXI A;  3AE6 B;  2LZ6 A;  2PEA A;  3MFG A;  1PUT A;  4MJS A;  4FN2 A;  3W5V B;  5DPS A;  5E6N A;  1WGR A;  4OZA A;  3VUW A;  4WQO B;  3PV1 A;  4ZRK A;  1KLG D;  3RZW C;  2WXK A;  2K8B A;  3ZQ4 A;  3QWZ B;  1SB3 C;  3NOB A;  2FCN A;  2D10 A;  5D3D A;  3PRZ A;  3RT3 B;  4NJC A;  3BK2 A;  1CK1 A;  3Q8E A;  1F1H A;  2ICI A;  4FBJ B;  1VLB A;  5FKA C;  2GOW A;  4ITK A;  1YMH E;  1TY2 A;  2L05 A;  2C7N B;  4GLS C;  3AXC A;  2BQQ A;  2RMM A;  1N5W A;  4K3B A;  1V86 A;  1WXV A;  4DK5 A;  2WXR A;  2K0P A;  1JWU D;  1WYG A;  3C19 A;  3NZU A;  4HJG E;  1ROE A;  4ARI A;  1I4G A;  3ZKJ C;  3WAM A;  2PE6 B;  4AOF A;  4A3P A;  4BAX A;  1V97 A;  3PPA A;  2BYT A;  1XQQ A;  3TEY A;  4TV3 A;  1SJH D;  3Q3F A;  3U4E G;  2DYM A;  1QT9 A;  3TEZ A;  4HCP B;  1EO6 A;  3GZN I;  4IG7 B;  3ZNI D;  3EHV A;  3OAW A;  3ZLZ A;  2RSU A;  1PGX A;  2BB6 A;  4PK1 A;  4JX1 C;  3ZDT A;  3OLM D;  3AEA B;  3H7P B;  1V49 A;  3OJ4 B;  1D5M C;  1T0S C;  2R61 A;  1G6J A;  1L6U A;  3PZ8 A;  2JF5 A;  2G45 B;  2RPQ A;  4WJO A;  3BZD B;  2K22 A;  4M02 A;  5IN7 A;  1UBQ A;  1YQB A;  3OG5 A;  5CHF A;  1ZXH A;  2BYE A;  4HWI B;  2CJO A;  1E7U A;  2LRU A;  5J17 A;  1JRU A;  3L17 A;  3K9P B;  4G11 A;  3KQ4 A;  5DPW A;  3PRE A;  1SXT A;  3N9Y C;  3W1Y A;  4A90 A;  3PSE B;  3HVZ A;  1ZXI A;  4BOS C;  1P0R A;  2CKH B;  3W1S C;  2KJH B;  2D11 A;  1X1M A;  4HEA 1;  4KGR A;  1WXS A;  1F0Z A;  3EGR A;  5GMV A;  4MH0 E;  4NAM A;  2MP2 B;  3ZTC A;  3IT4 B;  2EKE C;  2KDE B;  3LJ3 A;  3PZD A;  2J53 A;  1PYW D;  1V6E A;  3APF A;  1E7P B;  1WR1 A;  4XZ4 A;  2KTR A;  1XEE A;  3D32 A;  5D2M B;  1Q0W B;  1ZDX A;  3DHI C;  4MAC A;  2DHZ A;  2W54 A;  1ZGU B;  3A9K B;  1TS2 A;  3VR9 B;  4JE3 B;  3A1Q A;  3NUH B;  1OQR A;  4W9J A;  3MJW A;  4MGI E;  4RFB A;  4NQK E;  4E3C A;  3VUY A;  1GAQ B;  3V6C B;  2I38 A;  2XBB C;  2K8H A;  1DYQ A;  2JWU A;  2IO2 B;  2W55 A;  1FXA A;  3APD A;  3VAW A;  2CU1 A;  2JPH A;  1WWT A;  4PS7 A;  5KHO A;  2W3R A;  4G0N B;  3VRA B;  3TUO A;  1FCC C;  1XT9 B;  2BWE S;  3WA0 A;  3MC0 B;  3BVM A;  3ZDM C;  1V1P B;  1EM7 A;  1WI0 A;  3FIL A;  2CJN A;  4WWP A;  3Q3N C;  3X0W A;  5CHV C;  3ZVV A;  3VUX A;  4Q2J A;  2XEW A;  1RM6 C;  1BUI C;  5L95 C;  1WRD B;  3JSV B;  1EWY C;  4I6L B;  3V60 A;  1XLN A;  3A4S C;  2J7Q B;  3IVF A;  4OHJ A;  3NS1 A;  5LXH A;  4E74 A;  2MLB A;  3ML8 A;  1R7S A;  3RYT A;  3RMK C;  1UNS A;  2IO3 B;  3N1Z C;  1VJK A;  2NCN A;  1VRA B;  4J3O D;  2QSD A;  3Q8B A;  2ZJD A;  2IGH A;  3JW0 X;  1GUA B;  1E8Y A;  3A9J B;  3AUL A;  3TJP A;  2DEN B;  1KLV A;  1VD2 A;  4HKZ E;  4XC2 A;  3U52 E;  4JIO U;  5EE1 A;  1DOY A;  2JYT A;  2JU6 X;  4DWF A;  2R2O A;  1J7C A;  3RFZ B;  1GB1 A;  2ZCB A;  4K7S A;  4W9L A;  2KMM A;  4MSQ B;  4H2A A;  4B6W A;  1Y8R C;  3KUZ A;  1R4M B;  2DBY A;  2X8X X;  3QC8 B;  1I4Q A;  1WM3 A;  3URY A;  4YSZ B;  2AL3 A;  4FUL A;  2PJH A;  2DZI A;  4LTU A;  3PLV A;  2LHE A;  1GPX A;  2KFK A;  3NZS A;  5DCN A;  2K6Q A;  4KZ0 A;  3SD5 A;  2ZZP B;  2O6V B;  2LRW A;  2V3N A;  3EEC A;  3C0R B;  1XLP A;  3DVN V;  2JWZ A;  2KHW B;  2LJI A;  2NPT B;  3AM9 A;  4YXD B;  2I2Y A;  2LGI A;  5BYQ A;  3PS6 A;  1KTK A;  2O2V B;  3Q6B A;  2L83 A;  1FEH A;  5E6J A;  2B3A A;  1GJZ A;  3WCQ A;  2HTM E;  1C9F A;  4HRS A;  4WJP A;  1CMX B;  2IZV B;  4DHZ E;  2MEK A;  5C3J B;  4GIV A;  4GN1 A;  1MG4 A;  2EKI A;  1N61 A;  3RNE C;  4GMV A;  3W9C B;  5DPT A;  3P63 A;  4AJY B;  2Z8L A;  2D3C A;  2MBH A;  3PHW B;  1ZUD 2;  2KTF A;  3VTU A;  5GXG B;  4B0M A;  1XLO A;  3BVZ A;  4A55 A;  3L0W B;  2GB1 A;  2MRP A;  3ZIM A;  1BXT A;  2C7M B;  3AE9 B;  4YWG G;  3NS8 A;  4EUT A;  5BYS A;  4B95 A;  2J0M A;  2MA9 B;  1C76 A;  4K1R B;  1BML C;  3V3X A;  2LUM A;  4EZK A;  3KWL A;  1R4N I;  1UZX B;  1JWM D;  2L8J A;  3BYT B;  1WMH A;  1NBF C;  1QZE A;  1C1Y B;  4I6P A;  3U7D A;  2NVU I;  2CHZ A;  1DOI A;  3A33 B;  5IA7 A;  2BKF A;  1MHH E;  2JXT A;  2ZVN A;  3CST A;  4WAF A;  4LLG M;  3UIO B;  1ACC A;  1V9J A;  1WH3 A;  4EKU A;  5E6P A;  5FR6 A;  3DBL B;  3O65 B;  2N4F A;  3DBH B;  4E71 A;  3AE3 B;  1HZ6 A;  1VR9 A;  4LJP B;  2FAZ A;  2IGD A;  5D3I B;  2WP9 B;  3DWG C;  3P2B A;  5D94 A;  2G4D B;  3T9L A;  2C5L C;  1AAR A;  3UQB A;  2JZP A;  1GG3 A;  4GSW A;  2K6D B;  4F1S A;  4LNO A;  3ZYY X;  4KDL B;  3M95 A;  3MTN B;  3L54 A;  1ZW7 A;  2E3T A;  4A3O A;  1TTN A;  2BW2 A;  2XNA C;  3ALB A;  4HVB A;  2DYB A;  3FKY A;  4XDD A;  3QJZ A;  1D6E C;  2L00 B;  4RH6 A;  2MW5 A;  1MVK A;  4NY0 A;  1RWS A;  2PPH A;  1XF5 L;  2KN5 A;  1DOX A;  2MBE A;  4CQN A;  4M00 A;  4BZA A;  2NTT A;  2D5G A;  3TMP B;  3DBR I;  1F9J A;  1QOB A;  4W9C A;  4N9F 4;  4K7W A;  2JRI B;  3KW5 B;  3ZW3 A;  1P7F A;  2L1A A;  5JZE B;  5HKH A;  4MGK E;  2MWS B;  2C9W B;  1IBX A;  1KOT A;  2J0J A;  1RFK A;  2DAJ A;  4BKT A;  1KLU D;  4WQM A;  3TEW A;  2PMV A;  1WE6 A;  2WXG A;  4RF1 A;  3PO0 A;  5J18 A;  2SAK A;  1J7A A;  4YTP B;  3HIZ A;  2QC8 A;  4TUU A;  1PFD A;  4WWO A;  2RDH A;  3HM3 A;  2N1V A;  3H9D A;  1STE A;  2CU3 A;  3IXS A;  2KX0 A;  5IOI A;  1WGK A;  2GLS A;  1V1O A;  4IDI A;  1FM0 D;  3CMM B;  1TS3 A;  1JWA D;  3TL5 A;  4YTM B;  2BPS A;  2CHX A;  1WSP A;  2ZCC A;  4OZC A;  5MPO A;  3GOE A;  4QAY A;  1TBE A;  3R2I A;  1TJE A;  3IG3 A;  3Q3M C;  4MH8 A;  1FNW A;  2GRI A;  3PRM B;  2XK5 A;  1K51 A;  1UGM A;  1YJ1 A;  3FC4 A;  3CIR B;  4KGS A;  4ZHO A;  1F2R I;  1K8R B;  4KIK A;  2PVO D;  1PDX A;  1XD3 B;  2V3P A;  3UIP B;  4NAW A;  2ASQ A;  1D5Z C;  1QLB B;  1WRI A;  1P98 A;  4GDK B;  3AE8 B;  4W9G A;  3BIN A;  3CWI A;  1FFV A;  2AEH A;  2JRH A;  3I3T B;  3LDZ E;  2KAJ A;  5KHQ A;  3Q3J A;  4MJS B;  4BFR A;  4IKG A;  3SFE B;  2N7J A;  1HTQ A;  3SU8 X;  1FFU A;  3M62 B;  4IWP A;  1P3Q U;  5FR3 A;  5C1Z A;  4HCN B;  1WJ4 A;  2C7H A;  4ZRI A;  1FXI A;  1L0Y B;  3BII D;  1OQY A;  4IM0 A;  1OEY A;  1SE3 A;  4HK2 A;  2DX5 B;  2A5U A;  2KNB A;  2WNM A;  5BMG A;  4ZHP A;  2UWQ A;  1JWS D;  2OHF A;  2DLB A;  3EA6 A;  3BY4 B;  4IWO A;  3PGE A;  3W5U B;  4ICU A;  1KJT A;  1M94 A;  4DDI D;  4HPP A;  3VVW B;  1B9R A;  2C60 A;  1EUV B;  3HK0 A;  2KOX A;  3TCA A;  4BKS D;  2LGS A;  1L4Z B;  2KWU B;  2YEP B;  4HPL B;  4ZRP A;  3H8H A;  1E8W A;  1E7V A;  5D7G A;  2QJL A;  5JHB A;  2GBR A;  3V6E B;  2M4N A;  3GE8 C;  2KMA A;  4YTN B;  5LNK 1;  2J4X A;  4LDT B;  3WAP A;  5DPR A;  4I6N B;  2Y3A A;  2V4I B;  4MGY E;  4OVV A;  3ZTD A;  2BT6 A;  5L83 A;  3U7Z A;  2BYF A;  2K39 A;  4RGM A;  1L4D B;  3ZNZ B;  3DBS A;  3NVV A;  1V5O A;  4AWJ A;  4GGQ A;  1OFF A;  4WAA A;  1XO3 A;  1S1Q B;  3NVY A;  2AQ1 B;  1YIW A;  3JVZ X;  2MH7 A;  4ZRQ A;  2WS3 B;  2ZNV C;  4WIP A;  1FPY A;  2ZPN A;  2V0G A;  1XXG A;  3P1M A;  1P9D U;  2KJ6 A;  3V61 A;  3APC A;  2ON8 A;  1PGB A;  2AYO B;  4R3D A;  3QIJ A;  2LAS A;  4M8M A;  4TSS A;  2LMC A;  2YEP F;  4OW0 A;  2RGF A;  4US9 A;  4DQO C;  2RDG A;  1L6V A;  1WX9 A;  4AJW A;  4P1C C;  3WAL A;  2MJ3 A;  2IND C;  3R2T A;  2VZK B;  3DVN U;  4HPM B;  2B76 B;  3UGB B;  5H8Y E;  4OVU A;  1CQV A;  3HM6 X;  1QOG A;  4XWT A;  2CHW A;  4A20 A;  2N9L A;  2LXC A;  2HJ1 A;  3SHQ A;  4ICV A;  3V62 A;  2LWP A;  2V1Y A;  3B08 A;  3I63 C;  3NJT A;  2KDI A;  2EMT A;  4B0E A;  2LJ5 A;  3B0A A;  3RCZ A;  1JW9 D;  3AE7 B;  3MC8 A;  4K3C A;  1EU3 A;  2KTR B;  3RD2 A;  4IUM B;  2PVG C;  2CR5 A;  1LO5 D;  1B1Z A;  2J0K A;  4TQ1 A;  4ANW A;  1UWM A;  3L16 A;  1HQR D;  2KKC A;  3A1Q B;  4W9H A;  2YLM A;  4G3X B;  4TQ0 A;  2MBO A;  4DXG A;  4L2Y A;  2N7D A;  2HJ8 A;  4IM3 A;  4US8 A;  1OGW A;  1MG8 A;  3KUD B;  1N63 A;  2IY0 B;  4USA A;  2M56 B;  1T5X D;  3ZO5 B;  3N1Y C;  4HRO A;  1ISN A;  2O6V D;  4HDO A;  5AZH A;  2WXO A;  4HLE A;  1V2Y A;  4WH4 A;  1V81 A;  3R7R A;  1UWX A;  2Z0E B;  2KQ4 X;  3PLU A;  3RI7 C;  1L7Y A;  1T6B X;  3VXW A;  4XGA B;  2R2Q A;  1LFD A;  4YSY B;  1XCQ L;  3FIL B;  3NY5 A;  2DAF A;  2KQ7 A;  3QCA A;  2BTE A;  2L7R A;  2KK8 A;  2KXJ A;  1R4M I;  2KDM A;  5G5H A;  1ET9 A;  2ZW1 A;  4MDK E;  2UU7 A;  3CSF A;  5CHW A;  4FHJ A;  1E90 A;  5BMI A;  2J52 A;  4W9K A;  3X23 A;  1YQ3 B;  1TZO A;  3Q8C A;  4XDC A;  2VH2 A;  3HVD A;  3HHM A;  4F8C B;  2GBM A;  2QEJ C;  3B9J A; 
#chains in the Genus database with same CATH homology
 2SEB D;  4WAF A;  2WXI A;  5AUI A;  3AE6 B;  4WUR A;  1D4B A;  1FMA D;  4LLG M;  1ESF A;  3MFG A;  1HZ5 A;  1QIL A;  1ACC A;  1PUT A;  3NVW A;  4TMA B;  3W5V B;  1Y56 A;  1SJE D;  1PGA A;  1GOZ A;  1VZ6 A;  1XCT L;  4OVZ A;  4OZA A;  5HG2 A;  1SE4 A;  3AE3 B;  1HZ6 A;  1VR9 A;  1KLG D;  2WXK A;  2WXJ A;  3ZQ4 A;  3P42 A;  1SB3 C;  2IGD A;  5D3I B;  5D3D A;  1FNV A;  1SF0 A;  1HA5 A;  2WP9 B;  3DWG C;  4NJC A;  3BK2 A;  4O1N A;  2QMT A;  4REZ A;  2G1E A;  1CK1 A;  3Q8E A;  2ACZ B;  2ICI A;  2JZP A;  3I9V 1;  4RGT A;  4A8X C;  1SE2 A;  1VLB A;  3ZYY X;  2OED A;  5FKA C;  1QQR A;  2N0S B;  2TSS A;  4ITK A;  3AEF B;  2E3T A;  2N9K A;  5C2T B;  3P4R B;  4C7Z A;  4PT5 A;  1YMH E;  1TY2 A;  1L0V B;  3HUI A;  1TKY A;  2BW2 A;  3ETR A;  2XNA C;  1F2R C;  4GLS C;  1V1P A;  1GB4 A;  4N58 A;  4KGT A;  2RMM A;  1N5W A;  2HDE A;  4XDD A;  3MP9 A;  1YN5 A;  4RF0 A;  1D6E C;  2WXR A;  4RH6 A;  1ZE3 D;  5HFY A;  2K0P A;  1MVK A;  1ZOY B;  1RWS A;  3VQI A;  1D5X C;  2BS3 B;  1JWU D;  1XF5 L;  2JQR B;  1WYG A;  2L32 A;  1DOX A;  2Q5W D;  3KLS X;  1CZP A;  4CQN A;  1QKZ A;  1HEZ E;  3MHZ A;  2NTT A;  4HJG E;  1ROE A;  1TS5 A;  2D5G A;  4ARI A;  1I4G A;  2AX5 A;  3AEG B;  1QOB A;  1NYQ A;  2WXL A;  1V97 A;  1E6E B;  2BYT A;  1YNT E;  1K50 A;  1P7F A;  2DYO A;  2L1A A;  3TEY A;  1SJH D;  2IDY A;  2ONQ A;  1AW7 A;  4C7Y A;  1C4P A;  1IBX A;  3U4E G;  4RGO S;  1JRP A;  4D2K A;  2DYM A;  1RFK A;  4ARC A;  3IAS 1;  2DWQ A;  1QT9 A;  2JX5 A;  5EE9 A;  1KLU D;  3TEZ A;  3RPF C;  4WQM A;  3TEW A;  1J7B A;  3Q69 A;  2PMV A;  2QIE B;  3BVG A;  2WXG A;  1PGX A;  2BB6 A;  4JX1 C;  4RF1 A;  3PO0 A;  3IT6 B;  1YN4 A;  2IGG A;  2SAK A;  3AEA B;  3E56 A;  1J7A A;  4YTP B;  4EE2 A;  1D5M C;  1SEB D;  1FIQ A;  1PFD A;  1N62 A;  2BB5 A;  3TSS A;  1C78 A;  2R61 A;  3NZ3 A;  2RDH A;  2FE8 A;  1L6U A;  3PZ8 A;  3NVZ A;  1TKG A;  1TY0 A;  2WDR B;  4P6V F;  3BZD B;  1UGJ A;  2K22 A;  1VDV A;  2XN9 C;  1STE A;  2CU3 A;  1ZXH A;  3IXS A;  2CJO A;  1I4R A;  1WGK A;  1NEK B;  2RPV A;  1V1O A;  4JWU C;  4IDI A;  1FM0 D;  1JML A;  5BYR A;  3R8B A;  3GB1 A;  1TS3 A;  1JWA D;  4YTM B;  3E9S A;  3KQ4 A;  1SXT A;  3AMZ A;  1WSP A;  3N9Y C;  4N6E B;  3VR8 B;  4OZC A;  1DGJ A;  5MPO A;  4A90 A;  1P7E A;  1AN8 A;  3R2I A;  1TJE A;  3HVZ A;  1C77 A;  1ZXI A;  5FK9 C;  4XE0 A;  1JCK B;  1M4V A;  1NI3 A;  4MH8 A;  1FNW A;  1C79 A;  2GRI A;  2WDV B;  4HEA 1;  4KGR A;  1K51 A;  1F0Z A;  3FC4 A;  3B9J A;  3EGR A;  4NAM A;  3CIR B;  2JSV X;  4KGS A;  3ZJU A;  3V05 A;  4ZHO A;  4WWM A;  3IT4 B;  1F2R I;  2NMQ A;  3SFD B;  1JRO A;  1F77 A;  2PVO D;  1PDX A;  2V3P A;  2WXH A;  1Q10 A;  2J53 A;  3I57 A;  1PYW D;  3AE1 B;  3BYY B;  1E7P B;  5EE0 A;  1D5Z C;  1QLB B;  1XEE A;  1WRI A;  3ZJV A;  1ZDX A;  1ZDV A;  1FO4 A;  4GDK B;  2EEL A;  1ZP0 B;  2K5P A;  2M19 A;  3AE8 B;  4MAC A;  1IUE A;  2W54 A;  1JWB D;  1YJI A;  3CWI A;  3IAM 1;  1EWC A;  1FFV A;  4L1B A;  1TS2 A;  4P16 A;  3VR9 B;  4JE3 B;  2KAJ A;  3NUH B;  4A6Q A;  1C4C A;  1OQR A;  4IKG A;  3SFE B;  4XWW A;  2N7J A;  4RFB A;  1NVI D;  4YSX B;  1FFU A;  1JQ4 A;  3T3N A;  1FRR A;  5FR3 A;  1GAQ B;  2I38 A;  1FXI A;  1L0Y B;  3BII D;  3P4P B;  5BMH A;  4ZYS A;  1DYQ A;  1SE3 A;  1L0X B;  4AS1 A;  2X38 A;  1MPE A;  4UDU C;  2WNM A;  1JAL A;  5BMG A;  4ZHP A;  2JWU A;  1TS4 A;  1VZ7 A;  2PLP A;  1FXA A;  2W55 A;  3UI3 A;  2BS4 B;  3KWV A;  2PW9 A;  1JWS D;  2K9X A;  2OHF A;  2LEK A;  2AQ3 B;  1KF6 B;  2DLB A;  3EA6 A;  1WWT A;  3P4Q B;  2H89 B;  5EE3 A;  3SEB A;  3W5U B;  3MJ5 A;  1QOF A;  2W3R A;  2E6X A;  2Y5P A;  3VRA B;  3TUO A;  1FCC C;  2INP E;  3GS2 A;  3ABV B;  3L4P A;  4KKI A;  1B9R A;  4N59 A;  3MC0 B;  4KKJ A;  3BVM A;  4M0W A;  1V1P B;  3W2D A;  1EM7 A;  3FIL A;  1ZPS A;  2CJN A;  1HXY D;  5T8I A;  1L4Z B;  4Q2J A;  3ZGZ A;  1RM6 C;  3AE2 B;  5TSS A;  1BUI C;  1IGD A;  1WXQ A;  2YEP B;  2NTS A;  4ZRP A;  3H8H A;  5D7G A;  2QJL A;  1EWY C;  1IGC A;  1YJJ A;  3B2G A;  1YQ4 B;  5G5G A;  4RNA A;  1XLN A;  4YTN B;  5LNK 1;  2J4X A;  2WDQ B;  4NZL B;  4OHJ A;  1K53 A;  3NS1 A;  3AH7 A;  3AN1 A;  4LK0 M;  5JXV A;  3LB8 C;  1R7S A;  3W1S A;  2Y3A A;  2V4I B;  1FCL A;  1UNS A;  1VJK A;  2WLB A;  2BT6 A;  3U7Z A;  1IBX B;  1VRA B;  1VZ8 A;  4RCO A;  1KH0 A;  3ZJT A;  1QOA A;  4J3O D;  4RGM A;  1L4D B;  2WXP A;  1I4H A;  2QSD A;  3Q8B A;  3NVV A;  2IGH A;  1E10 A;  3AEB B;  3AE5 B;  1OFF A;  2IJ0 A;  1XO3 A;  4HKZ E;  3NVY A;  1NEN B;  3U52 E;  1MHX A;  5EE1 A;  1DOY A;  2AQ1 B;  2LHD A;  2WU5 B;  2JYT A;  3AED B;  5H92 C;  2JU6 X;  1N60 A;  2L52 A;  2PTL A;  2MH7 A;  2WXN A;  4ZRQ A;  2WS3 B;  1J7C A;  4WIP A;  2W3S A;  1FRD A;  2MJD A;  3RFZ B;  1ENF A;  1K52 A;  3VRB B;  1GB1 A;  2WXQ A;  2PKO A;  2V0G A;  1XXG A;  2FUG 1;  3P1M A;  2H88 B;  2WQY B;  2KMM A;  4H2A A;  3Q8F A;  3FAH A;  2G9H D;  2ON8 A;  1V8C A;  1PGB A;  2DBY A;  1I4Q A;  4R3D A;  3URY A;  4YSZ B;  4TSS A;  4LTU A;  2LMC A;  2YEP F;  3O13 A;  4OW0 A;  2LHE A;  4US9 A;  4DQO C;  1GPX A;  2BS2 B;  2RDG A;  3NRZ A;  1L6V A;  3GP7 A;  4KX6 B;  1RYJ A;  2MJ3 A;  2GI9 A;  3R2T A;  1L5P A;  2VZK B;  2KWD A;  2ZW0 A;  2V3N A;  4MT5 A;  2B76 B;  5H8Y E;  3BWU D;  1XLP A;  1CQV A;  2LJI A;  3AM9 A;  1QOG A;  2W82 A;  4XWT A;  4YXD B;  2I2Y A;  4HKQ A;  2LGI A;  3LXF A;  2N9L A;  5BYQ A;  1KTK A;  1C4A A;  4RGN A;  2L83 A;  1FEH A;  3J9C A;  4GDL B;  5E6J A;  4C80 A;  1SSN A;  2QIL A;  5HHD G;  3WCQ A;  2HTM E;  1C9F A;  2J42 A;  4FXC A;  4HRS A;  2AQ2 B;  3BK1 A;  1I4X A;  1QF6 A;  4B0E A;  1CJE A;  2KN4 A;  2FBW B;  1AWD A;  4NAW B;  1JW9 D;  2MEK A;  3HRD D;  3AE7 B;  5C3J B;  1E9M A;  1TKE A;  3PZ7 A;  2BBC A;  1EU3 A;  4JWS C;  2EKI A;  1NYR A;  1N61 A;  3LYY A;  1XLQ A;  3AV8 A;  2PVG C;  3OWE B;  3EUB 2;  3W9C B;  1SIJ A;  2INN E;  1LO5 D;  1B1Z A;  3P63 A;  2K3U A;  1MI0 A;  4TQ1 A;  2Z8L A;  4ZOH C;  4YT0 B;  1UWM A;  2LFI A;  1HQR D;  5I4D A;  1EU4 A;  1ZUD 2;  4TQ0 A;  1I7H A;  3C8Y A;  4A9A A;  4AQ7 A;  4OZB A;  3SR6 A;  4L2Y A;  4DXG A;  5AUK A;  5GXG B;  4B0M A;  2MJE A;  1XLO A;  3BVZ A;  4US8 A;  4A55 A;  4JPS A;  1E0Z A;  1I4P A;  1TYG B;  3AE4 B;  1KFY B;  2GB1 A;  1N63 A;  3U2S C;  4USA A;  2M56 B;  1T5X D;  3Q8A A;  3T3O A;  1AYF A;  1KRH A;  4HRO A;  2JYE A;  1BXT A;  3AE9 B;  2IPK D;  4YWG G;  5BYS A;  3DWM A;  1A70 A;  2VZK D;  2WXO A;  1C76 A;  4WH4 A;  1T3Q A;  1UWX A;  5HI1 A;  1N5X A;  1UUP A;  3P4S B;  1BML C;  2KQ4 X;  4C56 C;  3V3X A;  2LUM A;  1ET6 A;  2WU2 B;  3KWL A;  1T6B X;  2Y5C A;  4L23 A;  2M0A A;  3B2F A;  4YSY B;  1XCQ L;  1JWM D;  3BYT B;  3FIL B;  3AB5 A;  2BTE A;  4IOI E;  4DXF A;  2KDM A;  5G5H A;  1ET9 A;  2WXF A;  2ZW1 A;  1FNU A;  5BMI A;  1DOI A;  2J52 A;  3AEE B;  2PIA A;  2KAC A;  2WXM A;  4MM3 B;  1FD6 A;  1SBB B;  1YQ3 B;  1OQQ A;  1TZO A;  3TEX A;  3Q8C A;  3AEC B;  4XDC A;  3HVD A;  2JXT A;  2QEJ C;  1MHH E;  1YN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...