1EM7A

Helix variant of the b1 domain from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
b'TTYKLILNGKTLKGETTTEAVDAETAERVFKEYAKKNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
molecule tags Membrane protein
source organism Streptococcus sp.
publication title Structure of a protein G helix variant suggests the importance of helix propensity and helix dipole interactions in protein design.
pubmed rcsb
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1em7A00
2J53A 2NMQA 3FILA 1F2RC 2QSDA 1HZ5A 1K53A 2N7JA 2LHDA 2N9LA 5BMHA 2PLPA 2PTLA 1MVKA 2N9KA 5JXVA 2QMTA 1UWXA 2KQ4X 1HEZE 2OEDA 5HFYA 2GB1A 1P7EA 1IBXB 1PGBA 1QKZA 1C9FA 5HG2A 2KWDA 2KACA 2GI9A 2LHEA 1PGAA 2ZW1A 1FD6A 2IGDA 4OZAA 2IGHA 4OZBA 2I2YA 2ONQA 2RPVA 2LUMA 5HHDG 2I38A 5BMIA 3FILB 1XF5L 1FCLA 4HJGE 3UI3A 4KGRA 3MP9A 2K0PA 2EELA 5HI1A 4IKGA 4OZCA 1IGDA 4KGTA 5BMGA 1IBXA 1K50A 1Q10A 1D4BA 1F2RI 1FCCC 2ON8A 2JU6X 1PGXA 1JMLA 4D2KA 1P7FA 4KGSA 3GB1A 2PW9A 1K51A 4HKZE 1GB4A 4IOIE 1HZ6A 4MACA 2KDMA 2LGIA 3V3XA 1XCQL 4WH4A 1MPEA 2JWUA 1YNTE 1EM7A 1GB1A 1ZXHA 2KN4A 2JXTA 2RMMA 1MHXA 1MHHE 2JSVX 2J52A 2IGGA 4GLSC 1IGCA 1YMHE 1KH0A 1K52A 2JZPA 1MI0A 2ZW0A 1XCTL
chains in the Genus database with same CATH superfamily
3BWUD 4BBNF 3NJTA 3PSEB 3M3JA 5IKCM 1YOVB 3TEXA 4IWOA 1J0GA 2UWQA 4EZKA 2LRWA 3W5VB 1C4PA 5G5GA 3KYCD 5EE0A 1RWSA 3A9JB 1V80A 1H4RA 4XWTA 2OEDA 1MFWA 3PLUA 3WA0A 1UWMA 1TTNA 4YL8A 1SF0A 1D6EC 1C9FA 1WYGA 1RRBA 3R3MA 3KYDD 4MSQB 4MGKE 2DLBA 3IFWB 2KMCA 1OQRA 3KW5B 4BKSA 2KMAA 3V60A 4PYZA 3Q3MC 4WJPA 1L6VA 2MBOA 2I1KA 4P1BC 2QJLA 1VLBA 4KGRA 3ONSA 3U4EG 3ZJUA 5E6OA 1WJ6A 2MJDA 3ZDTA 2L83A 2L05A 3I57A 4WIPA 2MJEA 5AEKB 3AMZA 1HZ6A 3APDA 4ARIA 3LYYA 1QF6A 2AX5A 3P4SB 5BYRA 3AEDB 3V6CB 2OOBB 1EU3A 3MC9A 2KDEB 3L16A 1P98A 4WJNA 2J0KA 3DVGY 2SEBD 3B08A 1T0RC 2LWPA 2CKHB 2LJ5A 3VFKA 2OHFA 2N9LA 1EF1A 2QIEB 5DPRA 2ZPNA 4RGOS 1WGDA 2N9EB 3P2BA 1ZGUB 1WXAA 3L0WB 1UWXA 3W5UB 1XQQA 4W9JA 4W9FA 1E9MA 2WDRB 3VDZA 1P7EA 1D5XC 2KJRA 4RGMA 1DGJA 1V1PB 4JLCA 1YJ1A 2KFKA 4ANXA 3DOWA 2CJNA 1V5OA 3RN9C 2LHEA 4KX6B 1JWBD 2KDFB 2G4DB 3AV8A 1Q1OA 1WRDB 2XK5B 1I7HA 3NZUA 1UF0A 2YEPB 3MHZA 3DHHC 4JL9A 2RPVA 4RNAA 3R66C 4DHJD 2K3UA 1I4QA 3DPDA 2NVUI 4JWUC 3R2IA 2G9HD 1WXSA 4LDTB 2EELA 2X38A 2ZCCA 4WQMA 4DHZE 5CHFA 1IGDA 4YTMB 3N20C 4KGTA 2KX0A 3HIZA 1ROEA 1IPGA 3H1UA 3RULA 3UF8A 3VQIA 4BOSC 4KSLC 5TR5A 2TSSA 2C7NB 4HROA 4DQOC 1QT9A 4AQ7A 1TYGB 4UDUC 3NVYA 2LGDA 2GBNA 1YD8U 2ZCBA 3DBHB 1WIAA 1VZ7A 2WXOA 2RMMA 2JSVX 2G1EA 3Q3NC 3N30A 1VJKA 3CMMB 3E56A 4RF0A 4RM9A 3B2FA 3Q8AA 1KLUD 3TBLD 1WGGA 1K53A 1ZKHA 3Q8CA 1WGHA 3FKYA 4XE0A 2YEPF 2RD0A 2KDBA 4JQWC 3J9CA 1UH6A 3JW0X 5E6JA 4TSSA 1FNVA 1IYFA 4EEWA 5CTRC 1WZ3A 2C7MB 4DBGA 2IJ0A 2Z59B 2KACA 3SEBA 2BT6A 1PFDA 1QZEA 4WQOB 1E7VA 2MLBA 2C9WB 4AUQC 1K8RB 2BB6A 4E71A 2L8JA 5E6NA 4OVVA 2B3AA 3KWVA 1J7BA 3A9KB 1HTOA 1L0XB 2MEKA 2K0PA 2L00B 1E10A 2L76A 2M19A 4NNJB 1K50A 2L1AA 3L54A 4N9F4 3ZNHB 2KTFA 3KUCB 3RNFC 3LJ3A 1FIQA 1Z2MA 2KQ7A 2MRPA 2WYQA 2KDIA 1D3ZA 3NVVA 4N59A 3A1QB 3AEAB 3BIID 4HJKA 1Q5WB 5J2RA 1VD2A 1XLOA 2J4XA 4HPMB 3K9OB 1UBIA 3ML9A 4E3CA 1STEA 4ICUA 1A70A 1K52A 1MI0A 2PIAA 3DHIC 2M8SA 2NTTA 4DHJB 4HVBA 3UIOB 4IUMB 2KN5A 1WGYA 4W9KA 2YLMA 4LK0M 1HZ5A 1YX5B 3V05A 1WJNA 3ECIA 3DBRB 2D10A 4FN2A 1ZOYB 2JQRB 5C3JB 1QOGA 1JWUD 3AE6B 1BUIC 3SHQA 2BPSA 2IO0B 2V1YA 2LVPA 4X57B 5AZFA 4HPPA 2KWDA 3TEYA 2BWES 1NBFC 2Q5WD 3BY4B 4HWIB 1L6UA 1NYRA 5AUKA 1MG8A 1J19A 5D6JB 1WX7A 2BS3B 4WWOA 2PEAA 4AJWA 4KKJA 4IWQA 4W9GA 1YQ4B 4R3DA 5D94A 1T6BX 3RNCC 3V6EB 5HI1A 2E6XA 3AH7A 1Z5SB 4ZHOA 4II3B 3IAM1 1V97A 1IBXA 5C23A 1YIWA 3UQAA 3BYYB 2WXLA 3TCAA 3Q2AC 1FCCC 1TS2A 2V3NA 5DPWA 2L52A 2PVOD 1IP9A 2WQYB 4BBNC 1AW7A 4MSMB 1U4AA 1BXTA 1E8ZA 1V49A 5D7GA 1AYFA 2MA9B 4HKZE 3JVZX 1RAXA 4RFBA 3V3XA 1RYJA 3RZWC 1MPEA 3RT3B 3P42A 4DDID 2CR5A 5KHQA 3UIPB 1MHHE 1EO6A 3W1YA 1FFVA 4C00A 1YMHE 4ZYSA 2FUG1 5AZGA 2K6QA 1Y56A 3WCQA 4HLEA 4TMAB 2NMQA 1PDXA 2QEJC 3A4RA 4MJSB 2WXNA 1QQRA 1Y8RC 3GP7A 3PV1A 1DYQA 2KT7A 2CHWA 1WX9A 1D5MC 2MBHA 2WXPA 3GS2A 3VUXA 3RI7C 2JRHA 2DWQA 4N6EB 2ZVNA 2KLCA 1WGKA 5I4DA 2Y5CA 1WRIA 1SE9A 1KJTA 2JX5A 1V6EA 2BKRB 5LXHA 4MT5A 2GI9A 2NPTB 2MBBB 2JF5A 3WAPA 3T8MA 4ZRIA 4B6WA 2LFIA 3IT4B 4LNNA 3U7DA 4LNFA 4MM3A 4IC7B 2G4SA 1GC6A 1C4AA 2MCNB 2KWVB 1FCLA 4LJOB 1GAQB 3GZNI 1QLBB 1KM7A 1YX6B 4FHJA 4B0EA 2UU7A 4BKTA 4KZCA 3ZXVA 2V4LA 1C76A 4NJ7A 1F77A 1WMHA 1BT0A 2Y5BB 1D4BA 4AJYB 2REXA 5TSSA 5IP4D 2K22A 4DHZB 4EKUA 3A9KA 3TIXA 4L1BA 3BVZA 2RDHA 1TJEA 4K7WA 2JWUA 2WDTB 4KSKC 2QHOA 2WXQA 1MHXA 4OVUA 4MELA 2IGGA 2O6VB 2ZW0A 2WXJA 3VH3B 1F0ZA 2JZZA 3Q8EA 1DOXA 1XLPA 2QSDA 4G50A 3QCAA 1TGZB 3KUZA 4GB9A 1L0YB 3ZNZB 3I63C 4WAFA 3VTUA 1JWSD 4NY0A 4W9DA 1MJDA 2KQ4X 1NDDA 3PRZA 1DOIA 3MHSD 2WXHA 3APFA 3AU4A 5CHVC 1AN8A 3ETRA 2BWFA 2D2QA 1UBQA 2ZVOA 2KTRB 3H7PB 5KHOA 2WLBA 3CSFA 2LXCA 2ONQA 2L7RA 4HCPB 4EOYA 4IW0A 3R8BA 5DCNA 4GU2A 3WAOA 1V81A 2RPQA 3T3OA 3TJPA 1N61A 1TS5A 4NAWA 1C77A 2J7QB 3BYTB 4EE2A 1GNUA 1SEBD 2HTHA 2NBUA 4IG7B 3Q3JA 4G11A 4YTNB 3NZSA 5LXIB 4M8NA 2ON8A 2V4IB 2JU6X 4D2KA 1TT5B 4IM0A 1AWDA 2HE7A 4ACFA 5H92C 5H8YE 2NTSA 4WWMA 5FR6A 2JYEA 1EWCA 1QOBA 1X1MA 4IWPA 1QOAA 4K7UA 4ZOHC 1WGRA 3AECB 3RNBC 2PE9A 2N9PC 1TZ1A 2PVGC 4A8XC 2YVCA 2MW5A 2WWZA 1V8CA 2I1JA 5G5HA 1RM6C 2L3ZA 3P4PB 1UNSA 1LGRA 2AQ3B 3FILA 3EFCA 3DVGX 4XDDA 2KQSA 3HM6X 5IAAC 3SU8X 2RSUA 4GIVA 1YJJA 2A5UA 2MSED 3X23A 2PE6B 1J8CA 4DK5A 2WX0A 1FRRA 3KQ4A 3H8HA 3AE9B 4RMAA 4CQNA 1ZE3D 2ZEQA 2KO3A 3N1YC 3O65B 2LRUA 3EGRA 2FCNA 1L4ZB 4RGNA 3AN1A 3VRAB 3H7PA 3TL5A 4BKGA 2NR2A 1FMAD 3MJWA 4HKQA 2W54A 3I3TB 1OQYA 3B2GA 2BVCA 4FULA 2R2QA 3ZYYX 2LZ6A 1E6EB 1AARA 3QWZB 1GJZA 3RZFA 2ACZB 3AU5A 4NQKE 5JH5C 2W55A 2VRRB 4XX5A 5JZEB 3TEZA 3QC8B 3W9CB 4C56C 1JWMD 3RMKC 3Q69A 5LNK1 4A3OA 1S3SG 1H8CA 5E6PA 1JROA 2DHZA 1OEYJ 2DAFA 1P0RA 3W1SA 3W2DA 3E9SA 3H7SA 1ZUD2 3GB1A 1TKGA 4K3BA 3PREA 1WR6E 2KK8A 1XXGA 4HDQA 4PS3A 1SE3A 2PPHA 3ZJTA 2BYVE 2JUOA 4CHKA 2KXJA 2NS5A 3EFUA 2HJ1A 1F9JA 3DCGA 2H89B 2GMIC 1C1YB 1OEYA 2MQJA 2MH7A 3JSVB 5IO9A 2M17A 4GLSC 2FNJB 1VR9A 4XZ4A 3SDLC 1KLGD 3NS8A 1N63A 4YTPB 4DDGD 1TKEA 2WDQB 2J42A 3RNAC 3RNEC 5MPOA 1UUPA 1WMHB 2R61A 5AUIA 1VDVA 2FUHB 2QCZA 2AL3A 2V3SA 4ZRPA 3ZW3A 2V3PA 1VRAB 2QMTA 3M62B 3U8ZA 1OQQA 4AOFA 4F8CB 1HEZE 1WE6A 3IBEA 2KFJA 4P7IA 3GE8C 1LO5D 3QAQA 4A90A 2VH2A 2MWSB 5IOIA 3ZUNA 4O1NA 1B1ZA 2NPTA 2KYWA 1GUAB 3DBHI 1L2NA 3AE8B 1FNWA 2BGFA 3LXFA 3CIRB 4LDTD 2O2VA 1EU4A 1WSPA 3CF6E 2KWUB 3ZNID 1KRHA 2LGYA 4YSXB 5G2NA 1OGWA 2JT4B 4TV3A 4DWFA 1M94A 3IHPC 3UI3A 2NBWB 3UINB 3TEWA 1EWYC 3N9YC 4BKSD 3VAWA 2CHZA 2KZRA 4GMVA 3P4QB 1R4MI 1TY0A 4OVZA 4QAYA 4DXFA 1FFUA 4WAAA 3ZKJC 1T5XD 4LTUA 1YN5A 3ZXRA 3I9V1 4NZLB 2PW9A 2IYDB 2KVRA 4A20A 1GB4A 2NCNA 1LQBA 2AYOB 1UGJA 2WXFA 2FCSA 3Q3OC 1SIFA 3Q6BA 3M95A 3PT2B 4H2AA 4TQ0A 3RPFC 1YNTE 2DYBA 3LB8C 4HCNB 1XLQA 4ARCA 4YT0B 4JWSC 4AS1A 1V9JA 2LMCA 2LUEA 3WALA 3P63A 4HK2A 3L4PA 3W1SC 1E8XA 4AP4C 1SE2A 3X0WA 2JVCA 2KWCA 2INCC 4NJ6A 4KKIA 1T0QC 2D3GA 5JHAA 2XK5A 1F1HA 2FCQA 2INNE 1HQRD 2W9NA 5HFYA 1MG4A 3AEBB 1FXAA 2N4FA 1T0SC 2AWTA 3U2SC 3V61A 4B9KA 1IBXB 2KNBA 1WJUA 3OWEB 2DZMA 4FJYA 3SFEB 4FXCA 5FR3A 1ZXIA 1ET9A 2IGDA 4URKA 2FIDA 4XDCA 1N5XA 1TS3A 1TKYA 1S1QB 2N1VA 4FBJB 3PZDA 3VRBB 2MHJA 2KC2A 1JWAD 5GXGB 3HRDD 2KX3A 4M01A 4I6NB 2JXXA 2M0AA 2FIFA 3EUB2 2AQ2B 2IO3B 5BO4B 2KC1A 5EDSA 2K39A 2RDGA 1PGXA 2GBMA 1P7FA 4KGSA 4F7ZA 1BMLC 2WU5B 2MBEA 1GOZA 4FHKA 3VXWA 1KF6B 2PJHA 1GB1A 2EKEC 3B1LX 2JXTA 2E3TA 2FBWB 4ANVA 1NI3A 2KMMA 1LXDA 1E5WA 2W3SA 1IGCA 4L2YA 2SAKA 2JZPA 2ZNVB 1WE7A 4ZYNA 2XN9C 4ICVA 1I4RA 3PGEA 4ASWC 1XO3A 1RFAA 1N62A 3MJ5A 4BFRA 1ESFA 4FJVB 2XEWA 4ZRQA 4K81A 1E8WA 5FK9C 3AI5A 4JE3B 4ZDVA 1L5PA 2IO2B 2AEHA 1CQVA 2DAJA 3VTWA 3PTFC 1ZP0B 3NUHB 4A3PA 3NRZA 4WJOA 4A55A 2HJ8A 1I4PA 2WNMA 3QJZA 3L10B 1QKZA 1YJIA 2D5GA 2BS4B 2ZW1A 3RCZA 4PT5A 3HVDA 4OZBA 3ZTCA 1WR1A 3NOBA 2QDFA 4PK1A 2A4ZA 2VZKB 4GSWA 2KAJA 1G6JA 3JYUA 2CU1A 5D2MB 5D3DA 4CYEA 4MGIE 4XWWA 2BF8B 2JY6A 2MX2A 5BMGA 2WP9B 4J6IA 1ZDVA 3KWLA 1F2RI 1C4CA 3I5JC 2IY1B 3AM9A 1I35A 3C19A 4JX1C 3EECA 3AE7B 2GBKA 4S17A 3BK1A 1XCQL 5C1ZA 4GDKB 5BYSA 3MTNB 3RYTA 3BVMA 3L17A 3DQVA 4GGQA 2ZPYA 2M0XA 2N7EA 2N0SB 2D11A 2J53A 1WJ4A 2KVZA 3SFDB 2DZJA 2ZNVC 5G55A 1ZDXA 3PRPB 2N7JA 1P9DU 2K6DB 3AEGB 1P3QU 1MVKA 1C79A 4RCOA 4HRSA 3JSVA 2HTME 4N58A 4NJCA 4GXBA 4NAWB 2EMSA 3DVNV 3Q8FA 2KOXA 1PUTA 3BK2A 4CO7A 1I4GA 3NS1A 3EHVA 5JHBA 4B0MA 2V9HA 1XD3B 1ISNA 2LUMA 2I38A 2Y5PA 3AULA 1FEHA 2L0FA 1XF5L 2RDBC 2JPHA 2N1WA 4GDLA 4HJGE 1UGMA 4EUTA 3ZLZA 1JW9D 4W9HA 4JIOU 3BINA 1WXVA 4IKGA 1JRPA 4XGAB 2D3CA 4A6QA 4KIKB 3AB5A 4JPSA 5HKHA 3URYA 4KDIC 1JMLA 4RGTA 3V62A 3APCA 4IOIE 4MACA 1T3QA 5DPTA 1V1OA 3R7RA 2LGIA 2BS2B 1CMXB 3PLVA 4LJPB 2DBYA 4HDOA 1V86A 2R2OA 3QIJA 4FADA 3A4SC 3U52E 2INPE 2DNFA 4M0WB 5EE9A 3IVFA 1WF9A 5IA7A 1XCTL 4NPNA 3MC0B 1NVID 2Z8LA 3EA6A 4K1RB 3AEFB 2LASA 4K7SA 4KIKA 5T8IA 1EF5A 1WM2A 1GC7A 2K8HA 1Q0WB 1DOYA 3R7QA 1NEKB 1UELA 4L23A 3LDZE 4I6PA 3ZTDA 5L95C 2EMTA 3PPAA 4C7ZA 2GBJA 1QILA 3PHXB 1RFKA 3P1MA 3GZNB 2CJOA 3C0RB 3ZRCA 2K1FA 2KANA 3HHMA 3AE1B 3UGBB 2LVQA 4IM2A 4OZAA 4BAXA 1YQBA 3N1ZC 2N7DA 3IAS1 1SJHD 5BMIA 4A9AA 4E74A 4W9IA 1OTRB 3MP9A 1CZPA 3N3KB 2BQQA 3ML8A 5EE1A 1P1AA 3QQ8B 4P16A 1L0VB 3D32A 3O13A 3UQBA 4WURA 4DXGA 1OFFA 4P1CC 1D5ZC 1WI0A 1J7AA 3A9JA 5CHWA 1FXIA 4C4VA 1NENB 2GBRA 1HTQA 3N32A 3OAWA 2Z0EB 1EM7A 2KN4A 4NQLB 2LXAA 1T0YA 4JGHB 4YWGG 3CSTA 3PRMB 3HM3A 3PVLA 3WAMA 2DZKA 4KDLB 2KD0A 4P6VF 4IDIA 4KZ0A 4ZRJA 3DWGC 4J3OD 1WY8A 3PZ8A 2OJWA 3OJ4B 2PLPA 2QILA 2N9KA 4W9LA 3TSSA 1YQ3B 2BW2A 3PO0A 4F1SA 2WHIA 3NHEB 3EC8A 3AXCA 1VCBA 4ITKA 3OLMD 1FRDA 2L0TA 4MDKE 2J0MA 2BYEA 3QX1A 1ZPSA 3DBRI 5HG2A 1B9RA 3RNGC 1TZOA 1CK1A 1JALA 5D3IB 1F52A 1FD6A 4C4VB 4LNIA 2CHXA 1FPYA 3AE2B 4EZLA 2C60A 3NG0A 3ZVVA 4MH8A 2IBIB 4US9A 4MGZE 3DHGC 3HVZA 4WWPA 4GDLB 2CU3A 1XLNA 3QARA 4RM8A 3A33B 4TUUA 4ZRKA 2WX1A 4W9EA 2ZZPB 1JCKB 1LFDA 3SR6A 2INDC 4TKNA 2LI5A 1E90A 1YN3A 2RGFA 1ACCA 2QC8A 2MP2B 3WANA 3FAHA 1N60A 2G3QB 4WH4A 3SD5A 3PS6A 3Q8BA 3WIMA 2PMVA 1I4HA 1KH0A 3DBLB 1NI2A 2IPKD 2M56B 4K3CA 2VH1A 5AZHA 4AWJA 4FJZA 3VR9B 4BOZB 1F2RC 1V1PA 1UZXB 2LJIA 2B76B 4C80A 4EFOA 1FO4A 2PTLA 5JXVA 4Q2JA 1WH3A 2JRIB 3VTVA 1WFYA 2RR9A 3KUDB 1SBBB 2AL6A 2C7HA 3T9LA 1LM8B 2GB1A 4US8A 3VHTC 2BKFA 3S2AA 3ZDMC 1PGBA 2DX5B 3BZDB 1XT9B 2MJ3A 3RD2A 3M63B 4RH6A 1R7SA 2XBBC 4M02A 1ET6A 4MGYE 2IGHA 2BBCA 4MM3B 4GDKA 4GOCA 5HHDG 2ICIA 1EUVB 4KV2A 3NZ3A 3FILB 3TUOA 3U7ZA 1WXQA 3ZRFA 4LNOA 2GLSA 1I42A 3QHTA 4HPLB 3AE5B 5J18A 5L83A 3VVWB 2K8CA 3DDCB 4HEA1 3N1XC 2WU2B 1Q10A 3R2TA 2D3BA 3L08A 5J17A 1ENFA 2G45B 2X8XX 1ZW7A 5GMVA 4DXAB 2WXIA 4ANUA 3B9JA 2GRIA 1WM3A 3FC4A 2K5PA 3H9DA 2KHWB 4YSZB 3ABVB 1YN4A 3DWMA 2BTEA 1SB3C 2J0JA 1HA5A 2WXRA 1ZXHA 2IDYA 1E0ZA 2J52A 4FA6A 2K9XA 1SXTA 1R4MB 3K9PB 1TS4A 3Q14C 2K25A 3GOEA 3IG3A 2JYTA 2Z0DB 3ZJVA 2K8BA 4LCDE 3PZ7A 4WJQA 3VH4B 2CS4A 3KH0A 3RFZB 3H6NA 1C78A 3ALBA 2ZJDA 1RLFA 2UYZB 1N5WA 2M1MA 2IY0B 2LGSA 2PKOA 2LHDA 2VZKD 2DYOA 5BMHA 1SE4A 4G0NB 2XNAC 3NVZA 3NY5A 3DBLI 3U30A 1WX8A 2KTRA 2BYFA 1TIFA 3T3NA 2GOWA 1HE8A 4PS7A 2LGXA 3AE3B 4TQ1A 2FE8A 2MBQA 4MEMA 1FM0D 4XYCA 3C8YA 1R4NB 1KFYB 1TY2A 3P4RB 3VR8B 4NAMA 2D07B 3PHWB 4C7YA 2FAZA 2Y3AA 4W9CA 2I2YA 1A5RA 3HK0A 1UD7A 1FNUA 1WXMA 2WGSA 4M00A 1WWTA 1SGHA 2D3AA 3ENEA 3OG5A 1JQ4A 2DYMA 5FKAC 2DENB 1PYWD 4M0WA 4GN1A 3AEEB 2O6VA 4EZJA 2ASQA 4OZCA 1IUEA 3VUWA 2LD9A 4RF1A 1M4VA 2L32A 5CX3A 1C3TA 1NYQA 3CWIA 3L13A 1I4XA 3KLSX 2WXMA 4YSYB 1J7CA 3MFGA 1XEEA 2KKCA 4G3XB 2LVOA 3Q3FA 5IN7A 3HUIA 3QA8A 4II2B 2KJHB 4LNKA 1SSNA 3B0AA 1TBEA 4PYUA 2LEKA 2MP2A 3TMPB 5C2TB 1L7YA 3RUIB 3IT6B 5BYQA 3AE4B 3BVGA 2WXKA 1V2YA 2DZIA 3DVNU 4USAA 4MH0E 3ZNGC 3A1QA 2O6VD 2AQ1B 1WYWB 1N6ZA 2C5LC 4OW0A 4ANWA 2JZ3B 1KLVA 2IO1B 2JWZA 3OJ3A 4S0RA 1FXTB 5EE3A 4B95A 1V5TA 4BZAA 2IZVB 5DPSA 4HXDA 2WDVB 1VZ8A 1QOFA 1SIJA 4I6LB 1PGAA 2W3RA 2WXGA 1WZ0A 2WS3B 1R4NI 5LLIA 1L4DB 3ZO5B 3DBSA 4M8MA 4KVGB 3VUYA 4LLGM 4MJSA 2BB5A 1HXYD 2N9XA 2M4NA 3NVWA 2KLGA 4BVUC 4IM3A 4YXDB 1GPXA 2OJRA 1JRUA 3ZGZA 3MC8A 3ZQ4A 3IXSA 2HD5B 4OHJA 4FLHA 1VZ6A 3QK0A 1PQSA 2H88B 2O2VB 1E8YA 2W82A 1SJED 3KVFB 1KOTA 1K51A 2BYTA 2FCMA 2KFKB 2EKIA 2KDMA 1GG3A 2NBVB 2HDEA 4REZA 2V0GA 2KJ6A 1KTKA 1E7PB 1E7UA 3GE3C 4PS8A 4WWNA 3ZIMA 1CJEA 4XC2A 4ZHPA
chains in the Genus database with same CATH topology
4P6VF 4TMAB 4IDIA 2NMQA 3BWUD 3L4PA 1PDXA 2QEJC 1SE2A 3DWGC 2WXNA 1QQRA 3TEXA 4J3OD 3GP7A 3PZ8A 1DYQA 2PLPA 2QILA 1D5MC 2N9KA 2WXPA 3GS2A 3TSSA 1YQ3B 4KKIA 3W5VB 1C4PA 5G5GA 2BW2A 3PO0A 5EE0A 1RWSA 2DWQA 4N6EB 2INNE 1WGKA 4XWTA 5I4DA 2OEDA 1HQRD 4ITKA 2Y5CA 5HFYA 1UWMA 3AEBB 1FXAA 1WRIA 1FRDA 1SF0A 1D6EC 3U2SC 2JX5A 1IBXB 3OWEB 1ZPSA 4MT5A 3SFEB 1C9FA 4FXCA 5HG2A 2GI9A 1WYGA 1B9RA 5FR3A 1TZOA 1ZXIA 1CK1A 1JALA 5D3IB 1ET9A 1FD6A 2DLBA 2IGDA 1OQRA 2LFIA 3IT4B 4XDCA 3AE2B 1N5XA 1L6VA 1TS3A 1C4AA 1TKYA 4MH8A 4US9A 1FCLA 1GAQB 2QJLA 3HVZA 1QLBB 1VLBA 3VRBB 4KGRA 1JWAD 5GXGB 4GDLB 3U4EG 3HRDD 2CU3A 4B0EA 1XLNA 3ZJUA 1C76A 1F77A 2M0AA 1D4BA 1JCKB 2MJDA 2AQ2B 3EUB2 2L83A 3SR6A 5TSSA 3I57A 4WIPA 2RDGA 1PGXA 2MJEA 1P7FA 1YN3A 2K22A 4KGSA 1ACCA 1BMLC 3AMZA 4L1BA 2WU5B 1HZ6A 4ARIA 1GOZA 3LYYA 1QF6A 3FAHA 3BVZA 1N60A 2AX5A 3P4SB 4WH4A 5BYRA 2RDHA 1TJEA 3AEDB 3Q8BA 2JWUA 1KF6B 1EU3A 1GB1A 2JXTA 2WXQA 2E3TA 1MHXA 2FBWB 2PMVA 1NI3A 2IGGA 2KMMA 2W3SA 1IGCA 1I4HA 4L2YA 1KH0A 2SAKA 2JZPA 2IPKD 2M56B 2ZW0A 2WXJA 1F0ZA 2XN9C 1I4RA 2SEBD 1XO3A 3Q8EA 3VR9B 1DOXA 1XLPA 1N62A 1F2RC 1V1PA 2QSDA 3MJ5A 1ESFA 2LJIA 2B76B 2OHFA 4C80A 2N9LA 1FO4A 2QIEB 4ZRQA 1L0YB 2PTLA 4WAFA 5FK9C 5JXVA 4Q2JA 4RGOS 4JE3B 1L5PA 1JWSD 1UWXA 1CQVA 3W5UB 2KQ4X 1SBBB 1ZP0B 1DOIA 1E9MA 2WDRB 3NUHB 2GB1A 3NRZA 4US8A 2WXHA 1P7EA 1D5XC 4A55A 4RGMA 1DGJA 1I4PA 1V1PB 2WNMA 1PGBA 1AN8A 1QKZA 3BZDB 2CJNA 3ETRA 1YJIA 2D5GA 2LHEA 4KX6B 1JWBD 2BS4B 2ZW1A 2MJ3A 3AV8A 2WLBA 4PT5A 1I7HA 4RH6A 1R7SA 3HVDA 1ET6A 2IGHA 4OZBA 2ONQA 2BBCA 2YEPB 4MM3B 3MHZA 3R8BA 2RPVA 4RNAA 3T3OA 5HHDG 2VZKB 1N61A 1TS5A 2KAJA 2ICIA 1C77A 2K3UA 1I4QA 3FILB 3NZ3A 3BYTB 3TUOA 4JWUC 5D3DA 1WXQA 3R2IA 3U7ZA 2G9HD 4EE2A 4XWWA 2EELA 2X38A 1SEBD 3AE5B 4WQMA 1IGDA 4YTNB 4YTMB 4KGTA 4HEA1 5BMGA 2WP9B 2WU2B 1Q10A 3R2TA 1ZDVA 1ROEA 3KWLA 1F2RI 1C4CA 1ENFA 2ON8A 3AM9A 2V4IB 2WXIA 3B9JA 2JU6X 4JX1C 3VQIA 4D2KA 3AE7B 2TSSA 1AWDA 2GRIA 3FC4A 4HROA 5H8YE 5H92C 4DQOC 1QT9A 2NTSA 2K5PA 1TYGB 4UDUC 4WWMA 2JYEA 4AQ7A 3NVYA 3BK1A 1EWCA 1QOBA 4YSZB 1XCQL 3ABVB 4GDKB 1QOAA 1YN4A 3DWMA 5BYSA 2BTEA 1SB3C 4ZOHC 3AECB 1HA5A 2WXRA 1VZ7A 2WXOA 1ZXHA 2PVGC 2RMMA 2IDYA 4A8XC 1E0ZA 2JSVX 2G1EA 2J52A 3BVMA 2K9XA 1SXTA 1V8CA 5G5HA 1RM6C 1VJKA 1TS4A 3P4PB 3E56A 4RF0A 2N0SB 2JYTA 1UNSA 3B2FA 3ZJVA 2J53A 3Q8AA 3PZ7A 1KLUD 2AQ3B 3FILA 3RFZB 1C78A 3SFDB 4XDDA 1K53A 1N5WA 1ZDXA 2N7JA 2PKOA 2LHDA 2VZKD 3AEGB 3Q8CA 2DYOA 5BMHA 1SE4A 1MVKA 1C79A 4RCOA 1YJJA 2XNAC 3NVZA 4HRSA 4XE0A 2HTME 4N58A 2YEPF 1FRRA 3KQ4A 3H8HA 3AE9B 4NJCA 3T3NA 4CQNA 4NAWB 1ZE3D 3J9CA 5E6JA 3Q8FA 4TSSA 3EGRA 3AE3B 1FNVA 4TQ1A 2FE8A 1FM0D 3C8YA 1PUTA 1KFYB 1TY2A 3P4RB 2IJ0A 3VR8B 4NAMA 2KACA 1L4ZB 3BK2A 4RGNA 2BT6A 3AN1A 1PFDA 3SEBA 3VRAB 1I4GA 4C7YA 2Y3AA 1FMAD 4HKQA 2W54A 2I2YA 3NS1A 2BB6A 4B0MA 1FNUA 3B2GA 2LUMA 2I38A 3KWVA 2Y5PA 3ZYYX 1WWTA 1FEHA 1E6EB 1J7BA 1JQ4A 1XF5L 2DYMA 1L0XB 2MEKA 4HJGE 5FKAC 2ACZB 1JW9D 1PYWD 2K0PA 2W55A 4M0WA 3TEZA 1E10A 3AEEB 4IKGA 1JRPA 2M19A 4OZCA 1IUEA 3W9CB 4C56C 1K50A 2L1AA 1JWMD 3Q69A 4A6QA 3AB5A 5LNK1 4RF1A 4JPSA 1M4VA 2L32A 3URYA 1JROA 1NYQA 3CWIA 1JMLA 1FIQA 4RGTA 3W1SA 3W2DA 3E9SA 1ZUD2 3GB1A 1TKGA 1I4XA 1XXGA 2WXMA 3KLSX 3NVVA 4IOIE 1T3QA 4MACA 1J7CA 1V1OA 1XEEA 3MFGA 4N59A 2LGIA 1SE3A 3AEAB 3BIID 3ZJTA 2BS2B 3HUIA 1XLOA 2J4XA 1SSNA 2H89B 2DBYA 2LEKA 1STEA 2MH7A 4GLSC 1A70A 5C2TB 1VR9A 3U52E 1KLGD 1K52A 2INPE 1MI0A 3IT6B 1N63A 5EE9A 2PIAA 5BYQA 3AE4B 4YTPB 3BVGA 2NTTA 1XCTL 1TKEA 2WXKA 2WDQB 3MC0B 1NVID 2J42A 2Z8LA 3EA6A 3AEFB 5MPOA 5T8IA 1UUPA 4USAA 2R61A 4LK0M 1HZ5A 5AUIA 3V05A 1VDVA 1ZOYB 2AQ1B 1DOYA 2JQRB 1NEKB 4ZRPA 2V3PA 4L23A 5C3JB 4OW0A 1VRAB 2QMTA 1OQQA 1QOGA 1JWUD 1HEZE 3AE6B 1BUIC 4C7ZA 1QILA 5EE3A 1RFKA 1LO5D 4A90A 3P1MA 2WDVB 2CJOA 4O1NA 2KWDA 1VZ8A 3TEYA 1B1ZA 1QOFA 1SIJA 2WXGA 1PGAA 2W3RA 3AE1B 2WS3B 2Q5WD 3AE8B 1FNWA 1L6UA 1L4DB 1NYRA 3LXFA 4OZAA 3CIRB 5AUKA 1EU4A 1WSPA 1KRHA 2BS3B 2BB5A 4LLGM 1HXYD 3IAS1 1SJHD 3NVWA 4YSXB 4KKJA 5BMIA 4A9AA 4YXDB 1GPXA 1YQ4B 3ZGZA 4R3DA 3UI3A 3MP9A 3TEWA 1CZPA 1EWYC 1T6BX 3N9YC 5HI1A 2E6XA 3ZQ4A 3IXSA 3AH7A 5EE1A 4ZHOA 4OHJA 3IAM1 4P16A 1V97A 1IBXA 1VZ6A 3P4QB 1L0VB 2H88B 3BYYB 2WXLA 3O13A 1TY0A 4OVZA 4WURA 4DXGA 1OFFA 1FCCC 1TS2A 1D5ZC 2V3NA 2W82A 4DXFA 1FFUA 1J7AA 1SJED 2L52A 2PVOD 2WQYB 1AW7A 1BXTA 1T5XD 4LTUA 5D7GA 1YN5A 1AYFA 1FXIA 3I9V1 4NZLB 1K51A 2PW9A 4YSYB 2BYTA 4HKZE 1GB4A 1NENB 2EKIA 1UGJA 2KDMA 2WXFA 4RFBA 3V3XA 1RYJA 2HDEA 1MPEA 4H2AA 3P42A 4TQ0A 3RPFC 4REZA 1YNTE 1EM7A 2V0GA 2KN4A 3LB8C 1MHHE 1KTKA 1E7PB 1XLQA 4ARCA 4YT0B 4YWGG 4JWSC 1FFVA 1YMHE 4AS1A 4ZYSA 2LMCA 1CJEA 2FUG1 1Y56A 3WCQA 4ZHPA 3P63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J53 A;  2NMQ A;  3FIL A;  1F2R C;  2QSD A;  1HZ5 A;  1K53 A;  2N7J A;  2LHD A;  2N9L A;  5BMH A;  2PLP A;  2PTL A;  1MVK A;  2N9K A;  5JXV A;  2QMT A;  1UWX A;  2KQ4 X;  1HEZ E;  2OED A;  5HFY A;  2GB1 A;  1P7E A;  1IBX B;  1PGB A;  1QKZ A;  1C9F A;  5HG2 A;  2KWD A;  2KAC A;  2GI9 A;  2LHE A;  1PGA A;  2ZW1 A;  1FD6 A;  2IGD A;  4OZA A;  2IGH A;  4OZB A;  2I2Y A;  2ONQ A;  2RPV A;  2LUM A;  5HHD G;  2I38 A;  5BMI A;  3FIL B;  1XF5 L;  1FCL A;  4HJG E;  3UI3 A;  4KGR A;  3MP9 A;  2K0P A;  2EEL A;  5HI1 A;  4IKG A;  4OZC A;  1IGD A;  4KGT A;  5BMG A;  1IBX A;  1K50 A;  1Q10 A;  1D4B A;  1F2R I;  1FCC C;  2ON8 A;  2JU6 X;  1PGX A;  1JML A;  4D2K A;  1P7F A;  4KGS A;  3GB1 A;  2PW9 A;  1K51 A;  4HKZ E;  1GB4 A;  4IOI E;  1HZ6 A;  4MAC A;  2KDM A;  2LGI A;  3V3X A;  1XCQ L;  4WH4 A;  1MPE A;  2JWU A;  1YNT E;  1EM7 A;  1GB1 A;  1ZXH A;  2KN4 A;  2JXT A;  2RMM A;  1MHX A;  1MHH E;  2JSV X;  2J52 A;  2IGG A;  4GLS C;  1IGC A;  1YMH E;  1KH0 A;  1K52 A;  2JZP A;  1MI0 A;  2ZW0 A;  1XCT L; 
#chains in the Genus database with same CATH topology
 3BWU D;  4BBN F;  3NJT A;  3PSE B;  3M3J A;  5IKC M;  1YOV B;  3TEX A;  4IWO A;  1J0G A;  2UWQ A;  4EZK A;  2LRW A;  3W5V B;  1C4P A;  5G5G A;  3KYC D;  5EE0 A;  1RWS A;  3A9J B;  1V80 A;  1H4R A;  4XWT A;  2OED A;  1MFW A;  3PLU A;  3WA0 A;  1UWM A;  1TTN A;  4YL8 A;  1SF0 A;  1D6E C;  1C9F A;  1WYG A;  1RRB A;  3R3M A;  3KYD D;  4MSQ B;  4MGK E;  2DLB A;  3IFW B;  2KMC A;  1OQR A;  3KW5 B;  4BKS A;  2KMA A;  3V60 A;  4PYZ A;  3Q3M C;  4WJP A;  1L6V A;  2MBO A;  2I1K A;  4P1B C;  2QJL A;  1VLB A;  4KGR A;  3ONS A;  3U4E G;  3ZJU A;  5E6O A;  1WJ6 A;  2MJD A;  3ZDT A;  2L83 A;  2L05 A;  3I57 A;  4WIP A;  2MJE A;  5AEK B;  3AMZ A;  1HZ6 A;  3APD A;  4ARI A;  3LYY A;  1QF6 A;  2AX5 A;  3P4S B;  5BYR A;  3AED B;  3V6C B;  2OOB B;  1EU3 A;  3MC9 A;  2KDE B;  3L16 A;  1P98 A;  4WJN A;  2J0K A;  3DVG Y;  2SEB D;  3B08 A;  1T0R C;  2LWP A;  2CKH B;  2LJ5 A;  3VFK A;  2OHF A;  2N9L A;  1EF1 A;  2QIE B;  5DPR A;  2ZPN A;  4RGO S;  1WGD A;  2N9E B;  3P2B A;  1ZGU B;  1WXA A;  3L0W B;  1UWX A;  3W5U B;  1XQQ A;  4W9J A;  4W9F A;  1E9M A;  2WDR B;  3VDZ A;  1P7E A;  1D5X C;  2KJR A;  4RGM A;  1DGJ A;  1V1P B;  4JLC A;  1YJ1 A;  2KFK A;  4ANX A;  3DOW A;  2CJN A;  1V5O A;  3RN9 C;  2LHE A;  4KX6 B;  1JWB D;  2KDF B;  2G4D B;  3AV8 A;  1Q1O A;  1WRD B;  2XK5 B;  1I7H A;  3NZU A;  1UF0 A;  2YEP B;  3MHZ A;  3DHH C;  4JL9 A;  2RPV A;  4RNA A;  3R66 C;  4DHJ D;  2K3U A;  1I4Q A;  3DPD A;  2NVU I;  4JWU C;  3R2I A;  2G9H D;  1WXS A;  4LDT B;  2EEL A;  2X38 A;  2ZCC A;  4WQM A;  4DHZ E;  5CHF A;  1IGD A;  4YTM B;  3N20 C;  4KGT A;  2KX0 A;  3HIZ A;  1ROE A;  1IPG A;  3H1U A;  3RUL A;  3UF8 A;  3VQI A;  4BOS C;  4KSL C;  5TR5 A;  2TSS A;  2C7N B;  4HRO A;  4DQO C;  1QT9 A;  4AQ7 A;  1TYG B;  4UDU C;  3NVY A;  2LGD A;  2GBN A;  1YD8 U;  2ZCB A;  3DBH B;  1WIA A;  1VZ7 A;  2WXO A;  2RMM A;  2JSV X;  2G1E A;  3Q3N C;  3N30 A;  1VJK A;  3CMM B;  3E56 A;  4RF0 A;  4RM9 A;  3B2F A;  3Q8A A;  1KLU D;  3TBL D;  1WGG A;  1K53 A;  1ZKH A;  3Q8C A;  1WGH A;  3FKY A;  4XE0 A;  2YEP F;  2RD0 A;  2KDB A;  4JQW C;  3J9C A;  1UH6 A;  3JW0 X;  5E6J A;  4TSS A;  1FNV A;  1IYF A;  4EEW A;  5CTR C;  1WZ3 A;  2C7M B;  4DBG A;  2IJ0 A;  2Z59 B;  2KAC A;  3SEB A;  2BT6 A;  1PFD A;  1QZE A;  4WQO B;  1E7V A;  2MLB A;  2C9W B;  4AUQ C;  1K8R B;  2BB6 A;  4E71 A;  2L8J A;  5E6N A;  4OVV A;  2B3A A;  3KWV A;  1J7B A;  3A9K B;  1HTO A;  1L0X B;  2MEK A;  2K0P A;  2L00 B;  1E10 A;  2L76 A;  2M19 A;  4NNJ B;  1K50 A;  2L1A A;  3L54 A;  4N9F 4;  3ZNH B;  2KTF A;  3KUC B;  3RNF C;  3LJ3 A;  1FIQ A;  1Z2M A;  2KQ7 A;  2MRP A;  2WYQ A;  2KDI A;  1D3Z A;  3NVV A;  4N59 A;  3A1Q B;  3AEA B;  3BII D;  4HJK A;  1Q5W B;  5J2R A;  1VD2 A;  1XLO A;  2J4X A;  4HPM B;  3K9O B;  1UBI A;  3ML9 A;  4E3C A;  1STE A;  4ICU A;  1A70 A;  1K52 A;  1MI0 A;  2PIA A;  3DHI C;  2M8S A;  2NTT A;  4DHJ B;  4HVB A;  3UIO B;  4IUM B;  2KN5 A;  1WGY A;  4W9K A;  2YLM A;  4LK0 M;  1HZ5 A;  1YX5 B;  3V05 A;  1WJN A;  3ECI A;  3DBR B;  2D10 A;  4FN2 A;  1ZOY B;  2JQR B;  5C3J B;  1QOG A;  1JWU D;  3AE6 B;  1BUI C;  3SHQ A;  2BPS A;  2IO0 B;  2V1Y A;  2LVP A;  4X57 B;  5AZF A;  4HPP A;  2KWD A;  3TEY A;  2BWE S;  1NBF C;  2Q5W D;  3BY4 B;  4HWI B;  1L6U A;  1NYR A;  5AUK A;  1MG8 A;  1J19 A;  5D6J B;  1WX7 A;  2BS3 B;  4WWO A;  2PEA A;  4AJW A;  4KKJ A;  4IWQ A;  4W9G A;  1YQ4 B;  4R3D A;  5D94 A;  1T6B X;  3RNC C;  3V6E B;  5HI1 A;  2E6X A;  3AH7 A;  1Z5S B;  4ZHO A;  4II3 B;  3IAM 1;  1V97 A;  1IBX A;  5C23 A;  1YIW A;  3UQA A;  3BYY B;  2WXL A;  3TCA A;  3Q2A C;  1FCC C;  1TS2 A;  2V3N A;  5DPW A;  2L52 A;  2PVO D;  1IP9 A;  2WQY B;  4BBN C;  1AW7 A;  4MSM B;  1U4A A;  1BXT A;  1E8Z A;  1V49 A;  5D7G A;  1AYF A;  2MA9 B;  4HKZ E;  3JVZ X;  1RAX A;  4RFB A;  3V3X A;  1RYJ A;  3RZW C;  1MPE A;  3RT3 B;  3P42 A;  4DDI D;  2CR5 A;  5KHQ A;  3UIP B;  1MHH E;  1EO6 A;  3W1Y A;  1FFV A;  4C00 A;  1YMH E;  4ZYS A;  2FUG 1;  5AZG A;  2K6Q A;  1Y56 A;  3WCQ A;  4HLE A;  4TMA B;  2NMQ A;  1PDX A;  2QEJ C;  3A4R A;  4MJS B;  2WXN A;  1QQR A;  1Y8R C;  3GP7 A;  3PV1 A;  1DYQ A;  2KT7 A;  2CHW A;  1WX9 A;  1D5M C;  2MBH A;  2WXP A;  3GS2 A;  3VUX A;  3RI7 C;  2JRH A;  2DWQ A;  4N6E B;  2ZVN A;  2KLC A;  1WGK A;  5I4D A;  2Y5C A;  1WRI A;  1SE9 A;  1KJT A;  2JX5 A;  1V6E A;  2BKR B;  5LXH A;  4MT5 A;  2GI9 A;  2NPT B;  2MBB B;  2JF5 A;  3WAP A;  3T8M A;  4ZRI A;  4B6W A;  2LFI A;  3IT4 B;  4LNN A;  3U7D A;  4LNF A;  4MM3 A;  4IC7 B;  2G4S A;  1GC6 A;  1C4A A;  2MCN B;  2KWV B;  1FCL A;  4LJO B;  1GAQ B;  3GZN I;  1QLB B;  1KM7 A;  1YX6 B;  4FHJ A;  4B0E A;  2UU7 A;  4BKT A;  4KZC A;  3ZXV A;  2V4L A;  1C76 A;  4NJ7 A;  1F77 A;  1WMH A;  1BT0 A;  2Y5B B;  1D4B A;  4AJY B;  2REX A;  5TSS A;  5IP4 D;  2K22 A;  4DHZ B;  4EKU A;  3A9K A;  3TIX A;  4L1B A;  3BVZ A;  2RDH A;  1TJE A;  4K7W A;  2JWU A;  2WDT B;  4KSK C;  2QHO A;  2WXQ A;  1MHX A;  4OVU A;  4MEL A;  2IGG A;  2O6V B;  2ZW0 A;  2WXJ A;  3VH3 B;  1F0Z A;  2JZZ A;  3Q8E A;  1DOX A;  1XLP A;  2QSD A;  4G50 A;  3QCA A;  1TGZ B;  3KUZ A;  4GB9 A;  1L0Y B;  3ZNZ B;  3I63 C;  4WAF A;  3VTU A;  1JWS D;  4NY0 A;  4W9D A;  1MJD A;  2KQ4 X;  1NDD A;  3PRZ A;  1DOI A;  3MHS D;  2WXH A;  3APF A;  3AU4 A;  5CHV C;  1AN8 A;  3ETR A;  2BWF A;  2D2Q A;  1UBQ A;  2ZVO A;  2KTR B;  3H7P B;  5KHO A;  2WLB A;  3CSF A;  2LXC A;  2ONQ A;  2L7R A;  4HCP B;  4EOY A;  4IW0 A;  3R8B A;  5DCN A;  4GU2 A;  3WAO A;  1V81 A;  2RPQ A;  3T3O A;  3TJP A;  1N61 A;  1TS5 A;  4NAW A;  1C77 A;  2J7Q B;  3BYT B;  4EE2 A;  1GNU A;  1SEB D;  2HTH A;  2NBU A;  4IG7 B;  3Q3J A;  4G11 A;  4YTN B;  3NZS A;  5LXI B;  4M8N A;  2ON8 A;  2V4I B;  2JU6 X;  4D2K A;  1TT5 B;  4IM0 A;  1AWD A;  2HE7 A;  4ACF A;  5H92 C;  5H8Y E;  2NTS A;  4WWM A;  5FR6 A;  2JYE A;  1EWC A;  1QOB A;  1X1M A;  4IWP A;  1QOA A;  4K7U A;  4ZOH C;  1WGR A;  3AEC B;  3RNB C;  2PE9 A;  2N9P C;  1TZ1 A;  2PVG C;  4A8X C;  2YVC A;  2MW5 A;  2WWZ A;  1V8C A;  2I1J A;  5G5H A;  1RM6 C;  2L3Z A;  3P4P B;  1UNS A;  1LGR A;  2AQ3 B;  3FIL A;  3EFC A;  3DVG X;  4XDD A;  2KQS A;  3HM6 X;  5IAA C;  3SU8 X;  2RSU A;  4GIV A;  1YJJ A;  2A5U A;  2MSE D;  3X23 A;  2PE6 B;  1J8C A;  4DK5 A;  2WX0 A;  1FRR A;  3KQ4 A;  3H8H A;  3AE9 B;  4RMA A;  4CQN A;  1ZE3 D;  2ZEQ A;  2KO3 A;  3N1Y C;  3O65 B;  2LRU A;  3EGR A;  2FCN A;  1L4Z B;  4RGN A;  3AN1 A;  3VRA B;  3H7P A;  3TL5 A;  4BKG A;  2NR2 A;  1FMA D;  3MJW A;  4HKQ A;  2W54 A;  3I3T B;  1OQY A;  3B2G A;  2BVC A;  4FUL A;  2R2Q A;  3ZYY X;  2LZ6 A;  1E6E B;  1AAR A;  3QWZ B;  1GJZ A;  3RZF A;  2ACZ B;  3AU5 A;  4NQK E;  5JH5 C;  2W55 A;  2VRR B;  4XX5 A;  5JZE B;  3TEZ A;  3QC8 B;  3W9C B;  4C56 C;  1JWM D;  3RMK C;  3Q69 A;  5LNK 1;  4A3O A;  1S3S G;  1H8C A;  5E6P A;  1JRO A;  2DHZ A;  1OEY J;  2DAF A;  1P0R A;  3W1S A;  3W2D A;  3E9S A;  3H7S A;  1ZUD 2;  3GB1 A;  1TKG A;  4K3B A;  3PRE A;  1WR6 E;  2KK8 A;  1XXG A;  4HDQ A;  4PS3 A;  1SE3 A;  2PPH A;  3ZJT A;  2BYV E;  2JUO A;  4CHK A;  2KXJ A;  2NS5 A;  3EFU A;  2HJ1 A;  1F9J A;  3DCG A;  2H89 B;  2GMI C;  1C1Y B;  1OEY A;  2MQJ A;  2MH7 A;  3JSV B;  5IO9 A;  2M17 A;  4GLS C;  2FNJ B;  1VR9 A;  4XZ4 A;  3SDL C;  1KLG D;  3NS8 A;  1N63 A;  4YTP B;  4DDG D;  1TKE A;  2WDQ B;  2J42 A;  3RNA C;  3RNE C;  5MPO A;  1UUP A;  1WMH B;  2R61 A;  5AUI A;  1VDV A;  2FUH B;  2QCZ A;  2AL3 A;  2V3S A;  4ZRP A;  3ZW3 A;  2V3P A;  1VRA B;  2QMT A;  3M62 B;  3U8Z A;  1OQQ A;  4AOF A;  4F8C B;  1HEZ E;  1WE6 A;  3IBE A;  2KFJ A;  4P7I A;  3GE8 C;  1LO5 D;  3QAQ A;  4A90 A;  2VH2 A;  2MWS B;  5IOI A;  3ZUN A;  4O1N A;  1B1Z A;  2NPT A;  2KYW A;  1GUA B;  3DBH I;  1L2N A;  3AE8 B;  1FNW A;  2BGF A;  3LXF A;  3CIR B;  4LDT D;  2O2V A;  1EU4 A;  1WSP A;  3CF6 E;  2KWU B;  3ZNI D;  1KRH A;  2LGY A;  4YSX B;  5G2N A;  1OGW A;  2JT4 B;  4TV3 A;  4DWF A;  1M94 A;  3IHP C;  3UI3 A;  2NBW B;  3UIN B;  3TEW A;  1EWY C;  3N9Y C;  4BKS D;  3VAW A;  2CHZ A;  2KZR A;  4GMV A;  3P4Q B;  1R4M I;  1TY0 A;  4OVZ A;  4QAY A;  4DXF A;  1FFU A;  4WAA A;  3ZKJ C;  1T5X D;  4LTU A;  1YN5 A;  3ZXR A;  3I9V 1;  4NZL B;  2PW9 A;  2IYD B;  2KVR A;  4A20 A;  1GB4 A;  2NCN A;  1LQB A;  2AYO B;  1UGJ A;  2WXF A;  2FCS A;  3Q3O C;  1SIF A;  3Q6B A;  3M95 A;  3PT2 B;  4H2A A;  4TQ0 A;  3RPF C;  1YNT E;  2DYB A;  3LB8 C;  4HCN B;  1XLQ A;  4ARC A;  4YT0 B;  4JWS C;  4AS1 A;  1V9J A;  2LMC A;  2LUE A;  3WAL A;  3P63 A;  4HK2 A;  3L4P A;  3W1S C;  1E8X A;  4AP4 C;  1SE2 A;  3X0W A;  2JVC A;  2KWC A;  2INC C;  4NJ6 A;  4KKI A;  1T0Q C;  2D3G A;  5JHA A;  2XK5 A;  1F1H A;  2FCQ A;  2INN E;  1HQR D;  2W9N A;  5HFY A;  1MG4 A;  3AEB B;  1FXA A;  2N4F A;  1T0S C;  2AWT A;  3U2S C;  3V61 A;  4B9K A;  1IBX B;  2KNB A;  1WJU A;  3OWE B;  2DZM A;  4FJY A;  3SFE B;  4FXC A;  5FR3 A;  1ZXI A;  1ET9 A;  2IGD A;  4URK A;  2FID A;  4XDC A;  1N5X A;  1TS3 A;  1TKY A;  1S1Q B;  2N1V A;  4FBJ B;  3PZD A;  3VRB B;  2MHJ A;  2KC2 A;  1JWA D;  5GXG B;  3HRD D;  2KX3 A;  4M01 A;  4I6N B;  2JXX A;  2M0A A;  2FIF A;  3EUB 2;  2AQ2 B;  2IO3 B;  5BO4 B;  2KC1 A;  5EDS A;  2K39 A;  2RDG A;  1PGX A;  2GBM A;  1P7F A;  4KGS A;  4F7Z A;  1BML C;  2WU5 B;  2MBE A;  1GOZ A;  4FHK A;  3VXW A;  1KF6 B;  2PJH A;  1GB1 A;  2EKE C;  3B1L X;  2JXT A;  2E3T A;  2FBW B;  4ANV A;  1NI3 A;  2KMM A;  1LXD A;  1E5W A;  2W3S A;  1IGC A;  4L2Y A;  2SAK A;  2JZP A;  2ZNV B;  1WE7 A;  4ZYN A;  2XN9 C;  4ICV A;  1I4R A;  3PGE A;  4ASW C;  1XO3 A;  1RFA A;  1N62 A;  3MJ5 A;  4BFR A;  1ESF A;  4FJV B;  2XEW A;  4ZRQ A;  4K81 A;  1E8W A;  5FK9 C;  3AI5 A;  4JE3 B;  4ZDV A;  1L5P A;  2IO2 B;  2AEH A;  1CQV A;  2DAJ A;  3VTW A;  3PTF C;  1ZP0 B;  3NUH B;  4A3P A;  3NRZ A;  4WJO A;  4A55 A;  2HJ8 A;  1I4P A;  2WNM A;  3QJZ A;  3L10 B;  1QKZ A;  1YJI A;  2D5G A;  2BS4 B;  2ZW1 A;  3RCZ A;  4PT5 A;  3HVD A;  4OZB A;  3ZTC A;  1WR1 A;  3NOB A;  2QDF A;  4PK1 A;  2A4Z A;  2VZK B;  4GSW A;  2KAJ A;  1G6J A;  3JYU A;  2CU1 A;  5D2M B;  5D3D A;  4CYE A;  4MGI E;  4XWW A;  2BF8 B;  2JY6 A;  2MX2 A;  5BMG A;  2WP9 B;  4J6I A;  1ZDV A;  3KWL A;  1F2R I;  1C4C A;  3I5J C;  2IY1 B;  3AM9 A;  1I35 A;  3C19 A;  4JX1 C;  3EEC A;  3AE7 B;  2GBK A;  4S17 A;  3BK1 A;  1XCQ L;  5C1Z A;  4GDK B;  5BYS A;  3MTN B;  3RYT A;  3BVM A;  3L17 A;  3DQV A;  4GGQ A;  2ZPY A;  2M0X A;  2N7E A;  2N0S B;  2D11 A;  2J53 A;  1WJ4 A;  2KVZ A;  3SFD B;  2DZJ A;  2ZNV C;  5G55 A;  1ZDX A;  3PRP B;  2N7J A;  1P9D U;  2K6D B;  3AEG B;  1P3Q U;  1MVK A;  1C79 A;  4RCO A;  4HRS A;  3JSV A;  2HTM E;  4N58 A;  4NJC A;  4GXB A;  4NAW B;  2EMS A;  3DVN V;  3Q8F A;  2KOX A;  1PUT A;  3BK2 A;  4CO7 A;  1I4G A;  3NS1 A;  3EHV A;  5JHB A;  4B0M A;  2V9H A;  1XD3 B;  1ISN A;  2LUM A;  2I38 A;  2Y5P A;  3AUL A;  1FEH A;  2L0F A;  1XF5 L;  2RDB C;  2JPH A;  2N1W A;  4GDL A;  4HJG E;  1UGM A;  4EUT A;  3ZLZ A;  1JW9 D;  4W9H A;  4JIO U;  3BIN A;  1WXV A;  4IKG A;  1JRP A;  4XGA B;  2D3C A;  4A6Q A;  4KIK B;  3AB5 A;  4JPS A;  5HKH A;  3URY A;  4KDI C;  1JML A;  4RGT A;  3V62 A;  3APC A;  4IOI E;  4MAC A;  1T3Q A;  5DPT A;  1V1O A;  3R7R A;  2LGI A;  2BS2 B;  1CMX B;  3PLV A;  4LJP B;  2DBY A;  4HDO A;  1V86 A;  2R2O A;  3QIJ A;  4FAD A;  3A4S C;  3U52 E;  2INP E;  2DNF A;  4M0W B;  5EE9 A;  3IVF A;  1WF9 A;  5IA7 A;  1XCT L;  4NPN A;  3MC0 B;  1NVI D;  2Z8L A;  3EA6 A;  4K1R B;  3AEF B;  2LAS A;  4K7S A;  4KIK A;  5T8I A;  1EF5 A;  1WM2 A;  1GC7 A;  2K8H A;  1Q0W B;  1DOY A;  3R7Q A;  1NEK B;  1UEL A;  4L23 A;  3LDZ E;  4I6P A;  3ZTD A;  5L95 C;  2EMT A;  3PPA A;  4C7Z A;  2GBJ A;  1QIL A;  3PHX B;  1RFK A;  3P1M A;  3GZN B;  2CJO A;  3C0R B;  3ZRC A;  2K1F A;  2KAN A;  3HHM A;  3AE1 B;  3UGB B;  2LVQ A;  4IM2 A;  4OZA A;  4BAX A;  1YQB A;  3N1Z C;  2N7D A;  3IAS 1;  1SJH D;  5BMI A;  4A9A A;  4E74 A;  4W9I A;  1OTR B;  3MP9 A;  1CZP A;  3N3K B;  2BQQ A;  3ML8 A;  5EE1 A;  1P1A A;  3QQ8 B;  4P16 A;  1L0V B;  3D32 A;  3O13 A;  3UQB A;  4WUR A;  4DXG A;  1OFF A;  4P1C C;  1D5Z C;  1WI0 A;  1J7A A;  3A9J A;  5CHW A;  1FXI A;  4C4V A;  1NEN B;  2GBR A;  1HTQ A;  3N32 A;  3OAW A;  2Z0E B;  1EM7 A;  2KN4 A;  4NQL B;  2LXA A;  1T0Y A;  4JGH B;  4YWG G;  3CST A;  3PRM B;  3HM3 A;  3PVL A;  3WAM A;  2DZK A;  4KDL B;  2KD0 A;  4P6V F;  4IDI A;  4KZ0 A;  4ZRJ A;  3DWG C;  4J3O D;  1WY8 A;  3PZ8 A;  2OJW A;  3OJ4 B;  2PLP A;  2QIL A;  2N9K A;  4W9L A;  3TSS A;  1YQ3 B;  2BW2 A;  3PO0 A;  4F1S A;  2WHI A;  3NHE B;  3EC8 A;  3AXC A;  1VCB A;  4ITK A;  3OLM D;  1FRD A;  2L0T A;  4MDK E;  2J0M A;  2BYE A;  3QX1 A;  1ZPS A;  3DBR I;  5HG2 A;  1B9R A;  3RNG C;  1TZO A;  1CK1 A;  1JAL A;  5D3I B;  1F52 A;  1FD6 A;  4C4V B;  4LNI A;  2CHX A;  1FPY A;  3AE2 B;  4EZL A;  2C60 A;  3NG0 A;  3ZVV A;  4MH8 A;  2IBI B;  4US9 A;  4MGZ E;  3DHG C;  3HVZ A;  4WWP A;  4GDL B;  2CU3 A;  1XLN A;  3QAR A;  4RM8 A;  3A33 B;  4TUU A;  4ZRK A;  2WX1 A;  4W9E A;  2ZZP B;  1JCK B;  1LFD A;  3SR6 A;  2IND C;  4TKN A;  2LI5 A;  1E90 A;  1YN3 A;  2RGF A;  1ACC A;  2QC8 A;  2MP2 B;  3WAN A;  3FAH A;  1N60 A;  2G3Q B;  4WH4 A;  3SD5 A;  3PS6 A;  3Q8B A;  3WIM A;  2PMV A;  1I4H A;  1KH0 A;  3DBL B;  1NI2 A;  2IPK D;  2M56 B;  4K3C A;  2VH1 A;  5AZH A;  4AWJ A;  4FJZ A;  3VR9 B;  4BOZ B;  1F2R C;  1V1P A;  1UZX B;  2LJI A;  2B76 B;  4C80 A;  4EFO A;  1FO4 A;  2PTL A;  5JXV A;  4Q2J A;  1WH3 A;  2JRI B;  3VTV A;  1WFY A;  2RR9 A;  3KUD B;  1SBB B;  2AL6 A;  2C7H A;  3T9L A;  1LM8 B;  2GB1 A;  4US8 A;  3VHT C;  2BKF A;  3S2A A;  3ZDM C;  1PGB A;  2DX5 B;  3BZD B;  1XT9 B;  2MJ3 A;  3RD2 A;  3M63 B;  4RH6 A;  1R7S A;  2XBB C;  4M02 A;  1ET6 A;  4MGY E;  2IGH A;  2BBC A;  4MM3 B;  4GDK A;  4GOC A;  5HHD G;  2ICI A;  1EUV B;  4KV2 A;  3NZ3 A;  3FIL B;  3TUO A;  3U7Z A;  1WXQ A;  3ZRF A;  4LNO A;  2GLS A;  1I42 A;  3QHT A;  4HPL B;  3AE5 B;  5J18 A;  5L83 A;  3VVW B;  2K8C A;  3DDC B;  4HEA 1;  3N1X C;  2WU2 B;  1Q10 A;  3R2T A;  2D3B A;  3L08 A;  5J17 A;  1ENF A;  2G45 B;  2X8X X;  1ZW7 A;  5GMV A;  4DXA B;  2WXI A;  4ANU A;  3B9J A;  2GRI A;  1WM3 A;  3FC4 A;  2K5P A;  3H9D A;  2KHW B;  4YSZ B;  3ABV B;  1YN4 A;  3DWM A;  2BTE A;  1SB3 C;  2J0J A;  1HA5 A;  2WXR A;  1ZXH A;  2IDY A;  1E0Z A;  2J52 A;  4FA6 A;  2K9X A;  1SXT A;  1R4M B;  3K9P B;  1TS4 A;  3Q14 C;  2K25 A;  3GOE A;  3IG3 A;  2JYT A;  2Z0D B;  3ZJV A;  2K8B A;  4LCD E;  3PZ7 A;  4WJQ A;  3VH4 B;  2CS4 A;  3KH0 A;  3RFZ B;  3H6N A;  1C78 A;  3ALB A;  2ZJD A;  1RLF A;  2UYZ B;  1N5W A;  2M1M A;  2IY0 B;  2LGS A;  2PKO A;  2LHD A;  2VZK D;  2DYO A;  5BMH A;  1SE4 A;  4G0N B;  2XNA C;  3NVZ A;  3NY5 A;  3DBL I;  3U30 A;  1WX8 A;  2KTR A;  2BYF A;  1TIF A;  3T3N A;  2GOW A;  1HE8 A;  4PS7 A;  2LGX A;  3AE3 B;  4TQ1 A;  2FE8 A;  2MBQ A;  4MEM A;  1FM0 D;  4XYC A;  3C8Y A;  1R4N B;  1KFY B;  1TY2 A;  3P4R B;  3VR8 B;  4NAM A;  2D07 B;  3PHW B;  4C7Y A;  2FAZ A;  2Y3A A;  4W9C A;  2I2Y A;  1A5R A;  3HK0 A;  1UD7 A;  1FNU A;  1WXM A;  2WGS A;  4M00 A;  1WWT A;  1SGH A;  2D3A A;  3ENE A;  3OG5 A;  1JQ4 A;  2DYM A;  5FKA C;  2DEN B;  1PYW D;  4M0W A;  4GN1 A;  3AEE B;  2O6V A;  4EZJ A;  2ASQ A;  4OZC A;  1IUE A;  3VUW A;  2LD9 A;  4RF1 A;  1M4V A;  2L32 A;  5CX3 A;  1C3T A;  1NYQ A;  3CWI A;  3L13 A;  1I4X A;  3KLS X;  2WXM A;  4YSY B;  1J7C A;  3MFG A;  1XEE A;  2KKC A;  4G3X B;  2LVO A;  3Q3F A;  5IN7 A;  3HUI A;  3QA8 A;  4II2 B;  2KJH B;  4LNK A;  1SSN A;  3B0A A;  1TBE A;  4PYU A;  2LEK A;  2MP2 A;  3TMP B;  5C2T B;  1L7Y A;  3RUI B;  3IT6 B;  5BYQ A;  3AE4 B;  3BVG A;  2WXK A;  1V2Y A;  2DZI A;  3DVN U;  4USA A;  4MH0 E;  3ZNG C;  3A1Q A;  2O6V D;  2AQ1 B;  1WYW B;  1N6Z A;  2C5L C;  4OW0 A;  4ANW A;  2JZ3 B;  1KLV A;  2IO1 B;  2JWZ A;  3OJ3 A;  4S0R A;  1FXT B;  5EE3 A;  4B95 A;  1V5T A;  4BZA A;  2IZV B;  5DPS A;  4HXD A;  2WDV B;  1VZ8 A;  1QOF A;  1SIJ A;  4I6L B;  1PGA A;  2W3R A;  2WXG A;  1WZ0 A;  2WS3 B;  1R4N I;  5LLI A;  1L4D B;  3ZO5 B;  3DBS A;  4M8M A;  4KVG B;  3VUY A;  4LLG M;  4MJS A;  2BB5 A;  1HXY D;  2N9X A;  2M4N A;  3NVW A;  2KLG A;  4BVU C;  4IM3 A;  4YXD B;  1GPX A;  2OJR A;  1JRU A;  3ZGZ A;  3MC8 A;  3ZQ4 A;  3IXS A;  2HD5 B;  4OHJ A;  4FLH A;  1VZ6 A;  3QK0 A;  1PQS A;  2H88 B;  2O2V B;  1E8Y A;  2W82 A;  1SJE D;  3KVF B;  1KOT A;  1K51 A;  2BYT A;  2FCM A;  2KFK B;  2EKI A;  2KDM A;  1GG3 A;  2NBV B;  2HDE A;  4REZ A;  2V0G A;  2KJ6 A;  1KTK A;  1E7P B;  1E7U A;  3GE3 C;  4PS8 A;  4WWN A;  3ZIM A;  1CJE A;  4XC2 A;  4ZHP A; 
#chains in the Genus database with same CATH homology
 4P6V F;  4TMA B;  4IDI A;  2NMQ A;  3BWU D;  3L4P A;  1PDX A;  2QEJ C;  1SE2 A;  3DWG C;  2WXN A;  1QQR A;  3TEX A;  4J3O D;  3GP7 A;  3PZ8 A;  1DYQ A;  2PLP A;  2QIL A;  1D5M C;  2N9K A;  2WXP A;  3GS2 A;  3TSS A;  1YQ3 B;  4KKI A;  3W5V B;  1C4P A;  5G5G A;  2BW2 A;  3PO0 A;  5EE0 A;  1RWS A;  2DWQ A;  4N6E B;  2INN E;  1WGK A;  4XWT A;  5I4D A;  2OED A;  1HQR D;  4ITK A;  2Y5C A;  5HFY A;  1UWM A;  3AEB B;  1FXA A;  1WRI A;  1FRD A;  1SF0 A;  1D6E C;  3U2S C;  2JX5 A;  1IBX B;  3OWE B;  1ZPS A;  4MT5 A;  3SFE B;  1C9F A;  4FXC A;  5HG2 A;  2GI9 A;  1WYG A;  1B9R A;  5FR3 A;  1TZO A;  1ZXI A;  1CK1 A;  1JAL A;  5D3I B;  1ET9 A;  1FD6 A;  2DLB A;  2IGD A;  1OQR A;  2LFI A;  3IT4 B;  4XDC A;  3AE2 B;  1N5X A;  1L6V A;  1TS3 A;  1C4A A;  1TKY A;  4MH8 A;  4US9 A;  1FCL A;  1GAQ B;  2QJL A;  3HVZ A;  1QLB B;  1VLB A;  3VRB B;  4KGR A;  1JWA D;  5GXG B;  4GDL B;  3U4E G;  3HRD D;  2CU3 A;  4B0E A;  1XLN A;  3ZJU A;  1C76 A;  1F77 A;  2M0A A;  1D4B A;  1JCK B;  2MJD A;  2AQ2 B;  3EUB 2;  2L83 A;  3SR6 A;  5TSS A;  3I57 A;  4WIP A;  2RDG A;  1PGX A;  2MJE A;  1P7F A;  1YN3 A;  2K22 A;  4KGS A;  1ACC A;  1BML C;  3AMZ A;  4L1B A;  2WU5 B;  1HZ6 A;  4ARI A;  1GOZ A;  3LYY A;  1QF6 A;  3FAH A;  3BVZ A;  1N60 A;  2AX5 A;  3P4S B;  4WH4 A;  5BYR A;  2RDH A;  1TJE A;  3AED B;  3Q8B A;  2JWU A;  1KF6 B;  1EU3 A;  1GB1 A;  2JXT A;  2WXQ A;  2E3T A;  1MHX A;  2FBW B;  2PMV A;  1NI3 A;  2IGG A;  2KMM A;  2W3S A;  1IGC A;  1I4H A;  4L2Y A;  1KH0 A;  2SAK A;  2JZP A;  2IPK D;  2M56 B;  2ZW0 A;  2WXJ A;  1F0Z A;  2XN9 C;  1I4R A;  2SEB D;  1XO3 A;  3Q8E A;  3VR9 B;  1DOX A;  1XLP A;  1N62 A;  1F2R C;  1V1P A;  2QSD A;  3MJ5 A;  1ESF A;  2LJI A;  2B76 B;  2OHF A;  4C80 A;  2N9L A;  1FO4 A;  2QIE B;  4ZRQ A;  1L0Y B;  2PTL A;  4WAF A;  5FK9 C;  5JXV A;  4Q2J A;  4RGO S;  4JE3 B;  1L5P A;  1JWS D;  1UWX A;  1CQV A;  3W5U B;  2KQ4 X;  1SBB B;  1ZP0 B;  1DOI A;  1E9M A;  2WDR B;  3NUH B;  2GB1 A;  3NRZ A;  4US8 A;  2WXH A;  1P7E A;  1D5X C;  4A55 A;  4RGM A;  1DGJ A;  1I4P A;  1V1P B;  2WNM A;  1PGB A;  1AN8 A;  1QKZ A;  3BZD B;  2CJN A;  3ETR A;  1YJI A;  2D5G A;  2LHE A;  4KX6 B;  1JWB D;  2BS4 B;  2ZW1 A;  2MJ3 A;  3AV8 A;  2WLB A;  4PT5 A;  1I7H A;  4RH6 A;  1R7S A;  3HVD A;  1ET6 A;  2IGH A;  4OZB A;  2ONQ A;  2BBC A;  2YEP B;  4MM3 B;  3MHZ A;  3R8B A;  2RPV A;  4RNA A;  3T3O A;  5HHD G;  2VZK B;  1N61 A;  1TS5 A;  2KAJ A;  2ICI A;  1C77 A;  2K3U A;  1I4Q A;  3FIL B;  3NZ3 A;  3BYT B;  3TUO A;  4JWU C;  5D3D A;  1WXQ A;  3R2I A;  3U7Z A;  2G9H D;  4EE2 A;  4XWW A;  2EEL A;  2X38 A;  1SEB D;  3AE5 B;  4WQM A;  1IGD A;  4YTN B;  4YTM B;  4KGT A;  4HEA 1;  5BMG A;  2WP9 B;  2WU2 B;  1Q10 A;  3R2T A;  1ZDV A;  1ROE A;  3KWL A;  1F2R I;  1C4C A;  1ENF A;  2ON8 A;  3AM9 A;  2V4I B;  2WXI A;  3B9J A;  2JU6 X;  4JX1 C;  3VQI A;  4D2K A;  3AE7 B;  2TSS A;  1AWD A;  2GRI A;  3FC4 A;  4HRO A;  5H8Y E;  5H92 C;  4DQO C;  1QT9 A;  2NTS A;  2K5P A;  1TYG B;  4UDU C;  4WWM A;  2JYE A;  4AQ7 A;  3NVY A;  3BK1 A;  1EWC A;  1QOB A;  4YSZ B;  1XCQ L;  3ABV B;  4GDK B;  1QOA A;  1YN4 A;  3DWM A;  5BYS A;  2BTE A;  1SB3 C;  4ZOH C;  3AEC B;  1HA5 A;  2WXR A;  1VZ7 A;  2WXO A;  1ZXH A;  2PVG C;  2RMM A;  2IDY A;  4A8X C;  1E0Z A;  2JSV X;  2G1E A;  2J52 A;  3BVM A;  2K9X A;  1SXT A;  1V8C A;  5G5H A;  1RM6 C;  1VJK A;  1TS4 A;  3P4P B;  3E56 A;  4RF0 A;  2N0S B;  2JYT A;  1UNS A;  3B2F A;  3ZJV A;  2J53 A;  3Q8A A;  3PZ7 A;  1KLU D;  2AQ3 B;  3FIL A;  3RFZ B;  1C78 A;  3SFD B;  4XDD A;  1K53 A;  1N5W A;  1ZDX A;  2N7J A;  2PKO A;  2LHD A;  2VZK D;  3AEG B;  3Q8C A;  2DYO A;  5BMH A;  1SE4 A;  1MVK A;  1C79 A;  4RCO A;  1YJJ A;  2XNA C;  3NVZ A;  4HRS A;  4XE0 A;  2HTM E;  4N58 A;  2YEP F;  1FRR A;  3KQ4 A;  3H8H A;  3AE9 B;  4NJC A;  3T3N A;  4CQN A;  4NAW B;  1ZE3 D;  3J9C A;  5E6J A;  3Q8F A;  4TSS A;  3EGR A;  3AE3 B;  1FNV A;  4TQ1 A;  2FE8 A;  1FM0 D;  3C8Y A;  1PUT A;  1KFY B;  1TY2 A;  3P4R B;  2IJ0 A;  3VR8 B;  4NAM A;  2KAC A;  1L4Z B;  3BK2 A;  4RGN A;  2BT6 A;  3AN1 A;  1PFD A;  3SEB A;  3VRA B;  1I4G A;  4C7Y A;  2Y3A A;  1FMA D;  4HKQ A;  2W54 A;  2I2Y A;  3NS1 A;  2BB6 A;  4B0M A;  1FNU A;  3B2G A;  2LUM A;  2I38 A;  3KWV A;  2Y5P A;  3ZYY X;  1WWT A;  1FEH A;  1E6E B;  1J7B A;  1JQ4 A;  1XF5 L;  2DYM A;  1L0X B;  2MEK A;  4HJG E;  5FKA C;  2ACZ B;  1JW9 D;  1PYW D;  2K0P A;  2W55 A;  4M0W A;  3TEZ A;  1E10 A;  3AEE B;  4IKG A;  1JRP A;  2M19 A;  4OZC A;  1IUE A;  3W9C B;  4C56 C;  1K50 A;  2L1A A;  1JWM D;  3Q69 A;  4A6Q A;  3AB5 A;  5LNK 1;  4RF1 A;  4JPS A;  1M4V A;  2L32 A;  3URY A;  1JRO A;  1NYQ A;  3CWI A;  1JML A;  1FIQ A;  4RGT A;  3W1S A;  3W2D A;  3E9S A;  1ZUD 2;  3GB1 A;  1TKG A;  1I4X A;  1XXG A;  2WXM A;  3KLS X;  3NVV A;  4IOI E;  1T3Q A;  4MAC A;  1J7C A;  1V1O A;  1XEE A;  3MFG A;  4N59 A;  2LGI A;  1SE3 A;  3AEA B;  3BII D;  3ZJT A;  2BS2 B;  3HUI A;  1XLO A;  2J4X A;  1SSN A;  2H89 B;  2DBY A;  2LEK A;  1STE A;  2MH7 A;  4GLS C;  1A70 A;  5C2T B;  1VR9 A;  3U52 E;  1KLG D;  1K52 A;  2INP E;  1MI0 A;  3IT6 B;  1N63 A;  5EE9 A;  2PIA A;  5BYQ A;  3AE4 B;  4YTP B;  3BVG A;  2NTT A;  1XCT L;  1TKE A;  2WXK A;  2WDQ B;  3MC0 B;  1NVI D;  2J42 A;  2Z8L A;  3EA6 A;  3AEF B;  5MPO A;  5T8I A;  1UUP A;  4USA A;  2R61 A;  4LK0 M;  1HZ5 A;  5AUI A;  3V05 A;  1VDV A;  1ZOY B;  2AQ1 B;  1DOY A;  2JQR B;  1NEK B;  4ZRP A;  2V3P A;  4L23 A;  5C3J B;  4OW0 A;  1VRA B;  2QMT A;  1OQQ A;  1QOG A;  1JWU D;  1HEZ E;  3AE6 B;  1BUI C;  4C7Z A;  1QIL A;  5EE3 A;  1RFK A;  1LO5 D;  4A90 A;  3P1M A;  2WDV B;  2CJO A;  4O1N A;  2KWD A;  1VZ8 A;  3TEY A;  1B1Z A;  1QOF A;  1SIJ A;  2WXG A;  1PGA A;  2W3R A;  3AE1 B;  2WS3 B;  2Q5W D;  3AE8 B;  1FNW A;  1L6U A;  1L4D B;  1NYR A;  3LXF A;  4OZA A;  3CIR B;  5AUK A;  1EU4 A;  1WSP A;  1KRH A;  2BS3 B;  2BB5 A;  4LLG M;  1HXY D;  3IAS 1;  1SJH D;  3NVW A;  4YSX B;  4KKJ A;  5BMI A;  4A9A A;  4YXD B;  1GPX A;  1YQ4 B;  3ZGZ A;  4R3D A;  3UI3 A;  3MP9 A;  3TEW A;  1CZP A;  1EWY C;  1T6B X;  3N9Y C;  5HI1 A;  2E6X A;  3ZQ4 A;  3IXS A;  3AH7 A;  5EE1 A;  4ZHO A;  4OHJ A;  3IAM 1;  4P16 A;  1V97 A;  1IBX A;  1VZ6 A;  3P4Q B;  1L0V B;  2H88 B;  3BYY B;  2WXL A;  3O13 A;  1TY0 A;  4OVZ A;  4WUR A;  4DXG A;  1OFF A;  1FCC C;  1TS2 A;  1D5Z C;  2V3N A;  2W82 A;  4DXF A;  1FFU A;  1J7A A;  1SJE D;  2L52 A;  2PVO D;  2WQY B;  1AW7 A;  1BXT A;  1T5X D;  4LTU A;  5D7G A;  1YN5 A;  1AYF A;  1FXI A;  3I9V 1;  4NZL B;  1K51 A;  2PW9 A;  4YSY B;  2BYT A;  4HKZ E;  1GB4 A;  1NEN B;  2EKI A;  1UGJ A;  2KDM A;  2WXF A;  4RFB A;  3V3X A;  1RYJ A;  2HDE A;  1MPE A;  4H2A A;  3P42 A;  4TQ0 A;  3RPF C;  4REZ A;  1YNT E;  1EM7 A;  2V0G A;  2KN4 A;  3LB8 C;  1MHH E;  1KTK A;  1E7P B;  1XLQ A;  4ARC A;  4YT0 B;  4YWG G;  4JWS C;  1FFV A;  1YMH E;  4AS1 A;  4ZYS A;  2LMC A;  1CJE A;  2FUG 1;  1Y56 A;  3WCQ A;  4ZHP A;  3P63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...