1EM7A

Helix variant of the b1 domain from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
TTYKLILNGKTLKGETTTEAVDAETAERVFKEYAKKNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein G helix variant suggests the importance of helix propensity and helix dipole interactions in protein design.
pubmed rcsb
source organism Streptococcus sp.
molecule tags Membrane protein
molecule keywords PROTEIN G
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1em7A00
2OEDA 4GLSC 1XCQL 2QSDA 3FILA 1KH0A 1PGAA 1XCTL 1HZ5A 2ONQA 1IGDA 5HFYA 1GB1A 1K50A 1IGCA 4IOIE 2JWUA 1C9FA 1FCCC 2ZW0A 2ON8A 4KGSA 1P7FA 1MPEA 1QKZA 1ZXHA 1D4BA 3GB1A 2N9LA 2KACA 2LHDA 1MVKA 4HJGE 3UI3A 2LHEA 1HZ6A 3FILB 2KWDA 2LUMA 4KGRA 2J52A 4WH4A 2K0PA 5BMHA 1F2RI 1K53A 5HHDG 5HG2A 2RMMA 2EELA 2NMQA 4OZCA 2ZW1A 5JXVA 1F2RC 1PGBA 2JU6X 4D2KA 1HEZE 1IBXA 3MP9A 2KDMA 1FD6A 2IGDA 1P7EA 2RPVA 2PTLA 4HKZE 2QMTA 2IGHA 2J53A 3V3XA 2N9KA 4MACA 5BMIA 1EM7A 1K52A 1GB4A 2JZPA 2I2YA 2PW9A 1Q10A 2JXTA 2KQ4X 4OZBA 2JSVX 1MHXA 1JMLA 1PGXA 1K51A 1YMHE 5HI1A 1IBXB 2GI9A 2KN4A 5BMGA 1MHHE 4IKGA 1YNTE 4OZAA 2IGGA 1MI0A 1UWXA 2N7JA 2LGIA 1FCLA 4KGTA 2PLPA 2I38A 1XF5L 2GB1A
chains in the Genus database with same CATH superfamily
4BBNC 2OEDA 4XDCA 3SR6A 1XCQL 1BMLC 1XCTL 3ZLZA 3RCZA 4K3CA 3BIID 2JYEA 4XGAB 1Q1OA 4W9LA 2XNAC 1N5XA 4HPMB 4BAXA 1N60A 2MBHA 3WAMA 1IGCA 3PRZA 4IUMB 1C9FA 5EDSA 2ZW0A 1TYGB 1UF0A 1EWCA 3OLMD 4KGSA 3JSVA 1A70A 1KTKA 4KSKC 2KK8A 3RMKC 3PV1A 2WWZA 2CHZA 2V1YA 1SB3C 4MELA 2M1MA 4NJ7A 2D3CA 1JALA 4NAWB 5HG2A 4TV3A 4JWUC 2ZW1A 2PE9A 3NVZA 1YQBA 2Q5WD 2J42A 4L23A 4GIVA 2FBWB 4P7IA 2LD9A 2N9KA 3A4RA 3AE9B 4A9AA 2KWUB 3AH7A 4NY0A 2BT6A 3R8BA 2KQSA 3P42A 1SE3A 3L08A 1YN5A 3OJ3A 2YLMA 2MJDA 2V3SA 1BT0A 3KWLA 4IKGA 2L76A 2KAJA 4LJPB 4US8A 4XZ4A 4MSMB 2V4LA 2K9XA 2WXMA 4DHZB 3I57A 2MHJA 3KWVA 1XO3A 4ACFA 3ZXRA 1YJIA 3SEBA 2LXAA 2D07B 1RRBA 2KVRA 1VLBA 3P4SB 3RZWC 3FILA 5KHQA 2V3NA 4EZKA 1M4VA 3IBEA 2GBRA 2Y5CA 3X0WA 1AW7A 2ZCBA 1VRAB 2JWUA 1QZEA 5FK9C 4YL8A 1T0SC 2ON8A 3EFCA 3APDA 3SFDB 3UINB 1XD3B 5J18A 4KDLB 4RM9A 2C9WB 4RGOS 1C77A 1LM8B 4WWOA 4AQ7A 2KKCA 2Z0DB 3WANA 1H8CA 3VTUA 4M02A 4P6VF 4M0WB 1GOZA 3Q8AA 1XLPA 1TS4A 5FKAC 2ZPNA 3AXCA 3VXWA 4JWSC 1WGDA 2AQ1B 4PS7A 3DBLB 4LNIA 1HA5A 4BKGA 3R66C 3P4RB 3LB8C 4PYUA 1K8RB 2LVQA 2MJEA 4MT5A 1WY8A 3QIJA 2MBQA 2HJ8A 2JQRB 2KTRA 3H8HA 4DXGA 1V9JA 2BGFA 2DYBA 1V97A 3DHIC 3M63B 1IUEA 1J7AA 3GZNI 3S2AA 3DBHI 4C7ZA 4HRSA 2M17A 4F8CB 2XBBC 4LNNA 2CJNA 2DYOA 2MX2A 3X23A 1ET9A 3HVDA 4AJYB 2LRUA 1F0ZA 4JGHB 4M00A 2LGSA 4CHKA 5BYRA 2PE6B 3IAM1 2SEBD 2RD0A 2BYFA 3HM6X 2RPQA 3PRMB 2KC1A 3GP7A 4GGQA 4IOIE 5J2RA 3I3TB 3Q3OC 1WX9A 2ZJDA 3VTWA 4BOZB 1KLUD 1GJZA 3CF6E 3NVVA 1C76A 3QK0A 1WGGA 3CSTA 4HROA 4WIPA 5D7GA 4WH4A 5G5HA 3DPDA 3IFWB 3BK2A 1P3QU 5D94A 1WJ4A 3V6CB 3PPAA 1WR1A 2WQYB 5D6JB 3FC4A 1E9MA 3BY4B 3IT4B 1JWBD 1WI0A 2QMTA 1NYQA 1J19A 1R7SA 3L54A 1KJTA 1TBEA 2JXXA 1TT5B 1T6BX 4KSLC 4DHJB 2I2YA 3V62A 3PRPB 1JWUD 4XDDA 4I6NB 2JSVX 2MLBA 4LK0M 2RR9A 1K51A 2JT4B 2HDEA 3L13A 2C5LC 3K9OB 1JCKB 3J9CA 4BOSC 3KYCD 4HDQA 4N6EB 2D2QA 4G3XB 1STEA 1I4PA 3AE7B 3NRZA 3NZUA 4R3DA 2W54A 3OAWA 3B1LX 3ZIMA 2L32A 2GBJA 1JQ4A 2WLBA 1HXYD 1ACCA 2KT7A 5CX3A 1TS3A 1UBIA 2ONQA 3JW0X 2RDHA 2NS5A 3A1QB 2JY6A 3QC8B 4E71A 1X1MA 2DNFA 2MBBB 3AU4A 3PGEA 2MP2B 3DHHC 2KQ7A 4FA6A 3BWUD 3TIXA 5CHWA 1F52A 2WX0A 1ZXHA 2CU1A 2DZKA 1UNSA 3AE4B 1D4BA 4EFOA 4K7WA 3C19A 2WDVB 2LHEA 1N63A 5GXGB 4MH8A 4KGRA 3TEWA 1GPXA 1NBFC 3ZTCA 1UWMA 1SJHD 2Y3AA 5H92C 4IG7B 3Q8EA 3IVFA 4IWOA 3RNBC 5DPRA 2LGYA 1TKYA 3WAPA 2Z0EB 2J0JA 3B2FA 2KWCA 2XK5B 2CR5A 2BWES 3C8YA 2KFKA 3O65B 1FNWA 4GDLA 4AWJA 2Z59B 5DPSA 4WJPA 1I7HA 3AN1A 3BVMA 2L00B 4B0EA 5LXHA 4JX1C 1CZPA 4K1RB 2BTEA 3AEFB 3T8MA 1QT9A 1Q10A 3L0WB 2FUHB 2FIDA 4KV2A 5BO4B 3BZDB 5BMGA 1EUVB 1FNUA 4CYEA 2YVCA 2SAKA 3AE3B 1U4AA 2WXHA 2WDQB 2UYZB 4PT5A 1LFDA 4AOFA 3CIRB 1P9DU 4L1BA 2DENB 3V60A 3U8ZA 1MJDA 4B0MA 1HTQA 3GOEA 1ZXIA 2DWQA 3MHZA 3VHTC 3UF8A 2BKRB 1YD8U 3EHVA 4LLGM 4XC2A 2L7RA 1V2YA 4XYCA 3W5VB 1WGRA 4MM3A 4ASWC 1JROA 3JVZX 3PSEB 4ZOHC 2WXFA 4W9KA 4HLEA 1RFAA 3L16A 4HJGE 1V81A 2RSUA 2J52A 1E8ZA 2KMCA 1GNUA 3LXFA 3L10B 2K0PA 1OQRA 3MC0B 3ZW3A 2ZNVB 1K53A 1JRUA 2KNBA 4MM3B 4DBGA 4RGNA 1F2RC 3PHWB 3HM3A 4D2KA 1QF6A 1HEZE 1I4GA 3Q14C 3KW5B 3Q6BA 2O2VA 4LCDE 2PTLA 2BWFA 2WXGA 1L0YB 3Q3MC 3H1UA 2R61A 1YQ4B 2L05A 3B9JA 3Q8BA 3BINA 2MEKA 1MHXA 1E8YA 2LVOA 1UUPA 2IPKD 4DHJD 3EFUA 1P1AA 4LTUA 4RNAA 3IT6B 1I4HA 3WALA 3DVGY 3DBHB 1VDVA 2V9HA 4RF0A 1BXTA 4S0RA 2O2VB 4HXDA 3NHEB 1C4PA 4OVZA 3AE5B 1WF9A 1HTOA 3ABVB 5C1ZA 2JZ3B 3ALBA 3P4PB 4J6IA 1RLFA 1TKGA 3B2GA 3KYDD 3KLSX 4US9A 2I1JA 1M94A 1XLQA 4WWPA 1PGAA 4UDUC 2CS4A 4W9IA 3N30A 2FCQA 4KIKB 2QCZA 3DBRI 1FO4A 4DXFA 3DVNV 1WJUA 2HJ1A 3DQVA 4A20A 1F77A 3V6EB 2WGSA 2JX5A 4ICUA 5FR6A 2X38A 1YJJA 4BBNF 4RF1A 2LGDA 4WQMA 3FILB 1WFYA 2KWDA 1SE2A 3ZJTA 1MG4A 2FCNA 2H89B 5JH5C 3PHXB 1R4NI 1WMHA 2C7HA 3H7SA 3P63A 4KIKA 4A6QA 2KLCA 3EUB2 3CMMB 4P1CC 3KUZA 1ZE3D 4IWQA 3HRDD 2LJIA 3QX1A 2INPE 2LI5A 4C00A 1T5XD 2IGHA 3P2BA 1K52A 2G45B 2INNE 1GB4A 4ZRIA 2HD5B 2W55A 3EA6A 4DDID 3AMZA 3HVZA 2JXTA 1V49A 4AJWA 1E5WA 2WXRA 2GI9A 2EKEC 2H88B 4C56C 2KMAA 4KKIA 2JRIB 1L2NA 1CK1A 2JZZA 4O1NA 2LGXA 3TL5A 3RD2A 3RPFC 2INDC 5HKHA 2WS3B 1E7PB 5E6NA 1E90A 3DBRB 2IJ0A 1C79A 1XEEA 3PS6A 3ZYYX 2O6VB 1SSNA 2QILA 1N62A 2WXLA 4II2B 3U2SC 4ZRKA 3I63C 2WP9B 2OJWA 4WURA 2DZMA 1QOFA 3RULA 3ZKJC 3ZRFA 3R7QA 2PEAA 2NPTA 2LEKA 3A33B 5D3IB 4IDIA 3AV8A 2LUEA 4NAMA 1ESFA 2ZEQA 3SFEB 3KQ4A 3HUIA 2WXKA 1HQRD 4LDTB 4KDIC 2ASQA 5IP4D 2GRIA 2GBKA 4W9EA 1XLOA 4PYZA 2EELA 3RNFC 2MW5A 3V61A 2TSSA 3MJWA 2OHFA 4FHJA 4I6LB 4RMAA 1WX7A 4DQOC 3DBLI 2IY0B 1I42A 2NPTB 1WWTA 2R2OA 4ZRJA 1E10A 1KF6B 3NS1A 4M01A 4OHJA 2BBCA 3HIZA 5LNK1 2JZPA 3AEGB 1E7VA 2KQ4X 3H9DA 2IBIB 1KRHA 2JPHA 2FUG1 1GG3A 4E3CA 1DYQA 2O6VA 3U7DA 1ZDVA 4ANWA 2NR2A 2EMSA 4URKA 2NTTA 3R7RA 3Q2AC 2K25A 1FPYA 1V1OA 3VH3B 1JW9D 5IO9A 3AB5A 3VRAB 4REZA 2AWTA 5IOIA 2AQ2B 1JRPA 2IO3B 4GB9A 5G5GA 2MA9B 5IAAC 2N4FA 4WJQA 4GOCA 5T8IA 3APCA 3KUDB 5HFYA 2C7MB 1MG8A 3A4SC 1EO6A 1TZ1A 4CQNA 2NBVB 2A5UA 1Z2MA 1JWAD 1N61A 4TMAB 3OWEB 3AI5A 1FRDA 1FCCC 2L0TA 2ZCCA 3SHQA 2K8CA 1WM2A 5AEKB 4PS8A 4FULA 1I35A 1WE6A 3WIMA 1PFDA 4A55A 1YIWA 2B3AA 4XWTA 2LUMA 4FJYA 1WZ0A 4PK1A 1L6VA 5AZFA 3Q8CA 2D3BA 4C80A 2LFIA 3R3MA 4NAWA 4KX6B 3AE1B 1RAXA 4XX5A 4ICVA 4W9DA 2ZNVC 4LJOB 2PPHA 4HKZE 3A1QA 2J53A 5EE9A 2MWSB 1L4ZB 3IXSA 1D6EC 1ZDXA 2MP2A 4RFBA 1DGJA 4JLCA 1T0QC 3TJPA 1PGXA 3ETRA 2WU2B 2NBWB 2KFJA 3NG0A 3NS8A 1FNVA 2BKFA 1R4MI 2J4XA 1WXMA 2OOBB 3ZNZB 5EE0A 2MH7A 1BUIC 2JUOA 4DXAB 1VCBA 2KDFB 4FADA 4KZCA 2PLPA 3D32A 1E8WA 2G4DB 4YTMB 4DWFA 1NI3A 5H8YE 4GLSC 4GXBA 3Q3FA 3MTNB 4FXCA 1ZUD2 2KX3A 4A3PA 4HJKA 4IC7B 4DHZE 2C60A 2WX1A 3SD5A 4RH6A 1YQ3B 4MSQB 3T3OA 4MGKE 4ZDVA 3QAQA 3AE2B 3DDCB 1WZ3A 1I4XA 4M8NA 1NYRA 2BB6A 3R2IA 4X57B 3UIPB 5C23A 5IA7A 3VQIA 2DZJA 3N1ZC 5CTRC 3ONSA 1WXVA 1OEYA 3UGBB 3ZXVA 2FAZA 1V1PB 3M95A 5JXVA 1ET6A 1UGJA 2HE7A 2KTFA 4Q2JA 4ZHPA 2CJOA 2L0FA 3MP9A 5MPOA 3BVZA 1TKEA 2AQ3B 3RNGC 1P7EA 1KLVA 2FNJB 2WXPA 3DHGC 2D3AA 4HPPA 4JL9A 4K3BA 3NJTA 1Q0WB 2J0MA 4S17A 3RNAC 3N1XC 1WJNA 2KN4A 2KN5A 4LDTD 1VZ6A 3AE8B 4OVVA 2K8HA 4CO7A 2IZVB 4AUQC 2NBUA 5E6PA 5E6OA 1J0GA 3P1MA 1OFFA 3T9LA 1WXQA 3W2DA 3AULA 4I6PA 1FXAA 4WJOA 2OJRA 3ZJUA 2CHXA 2XN9C 2VH2A 1Y56A 1Y8RC 1FM0D 3N3KB 3PZDA 2GB1A 2QHOA 1WR6E 5AUIA 3RFZB 1ZW7A 3H7PA 3KUCB 4C7YA 1GAQB 5BYQA 3LYYA 2KMMA 4EZJA 2G3QB 4IM0A 5LXIB 2D11A 4F1SA 1SIJA 2EKIA 4MGYE 2VRRB 4YSYB 3JSVB 1RM6C 3ZTDA 4C4VA 2MSED 2ICIA 3ML8A 2AEHA 3GB1A 1YX5B 4FJZA 4GDKB 1TY2A 1C78A 1HZ6A 4NNJB 2V3PA 2LWPA 4FHKA 1F2RI 3RNCC 4ANVA 2PVGC 3IHPC 3RUIB 1SXTA 2K22A 4GSWA 1TGZB 3TMPB 3TEZA 4W9FA 3H6NA 3M62B 2WXJA 2XEWA 3K9PB 1PUTA 2M4NA 3NUHB 1FD6A 2K6QA 3DWGC 1LO5D 4BKSD 2MBEA 4ZYNA 5BMIA 1EM7A 2KANA 4NQLB 2LASA 3BYYB 4IWPA 4W9CA 2V4IB 4GN1A 4YTPB 5LLIA 3URYA 2LZ6A 3C0RB 3EC8A 2W9NA 5G2NA 3H7PB 1PQSA 3QARA 2BVCA 4TSSA 2Y5BB 3N9YC 3DVGX 1LGRA 1PDXA 3VRBB 1R4NB 3NZSA 1WMHB 4KGTA 2QIEB 1TIFA 1EF1A 3VUYA 1V86A 3LJ3A 2PMVA 5AZHA 4YSZB 2NCNA 3U52E 1YN4A 2AL3A 3CWIA 4K7UA 2KXJA 2LXCA 4RM8A 3BYTB 4HCPB 2JRHA 3ML9A 5DCNA 4HPLB 1GB1A 3O13A 1FFVA 3N20C 3U7ZA 4HCNB 1KLGD 1KFYB 1UZXB 2W82A 4HKQA 3TBLD 3SU8X 5KHOA 1GC6A 2R2QA 3A9KA 2N1VA 2XK5A 4MH0E 1MPEA 1WE7A 3ZUNA 3MC9A 1DOYA 2KDEB 2N9XA 3N1YC 4OW0A 3QA8A 1DOXA 2BYVE 5G55A 3MJ5A 4MJSB 2LMCA 3PREA 4HWIB 3EECA 2KVZA 5HHDG 1F1HA 4FN2A 2A4ZA 4GU2A 4M0WA 3MFGA 1QOAA 1UD7A 4JE3B 5CHVC 3VDZA 2JWZA 5CHFA 1FXTB 2G1EA 3ZVVA 2I1KA 2KFKB 1SF0A 1E7UA 2D10A 5D3DA 2DHZA 3AM9A 3B08A 3TSSA 1FRRA 2DBYA 2PW9A 2GOWA 3GS2A 3E9SA 3U30A 4PS3A 2K5PA 2VZKD 3WCQA 4JPSA 4OVUA 3WA0A 1IBXB 3N32A 1G6JA 3GE3C 3RI7C 3W1YA 3RT3B 2VH1A 1EU3A 1LQBA 2IO1B 2PKOA 5JHAA 2IY1B 3Q3NC 4DDGD 2BQQA 2AL6A 1VD2A 2C7NB 1FCLA 3T3NA 1VZ7A 3AEEB 3VVWB 4IM2A 2WXQA 3VTVA 1IP9A 4EZLA 1KH0A 2UU7A 1QQRA 3NZ3A 1OGWA 1IGDA 1EWYC 2QJLA 3A9JB 3ZNID 3B0AA 1D5MC 2L3ZA 2CU3A 3NOBA 2CKHB 4MJSA 1CJEA 3TUOA 4QAYA 4ITKA 3Q69A 4N58A 3Q3JA 3VFKA 3HHMA 4WWMA 2KOXA 2WYQA 4ARCA 4KKJA 3U4EG 2J7QB 2BS3B 2LVPA 3IAS1 3NVYA 2D5GA 2GLSA 1ISNA 2N9LA 3PLVA 2LHDA 3UIOB 1MVKA 2J0KA 4W9GA 1D5XC 1F9JA 4BKSA 2JYTA 1OQYA 5BMHA 2ACZB 3R2TA 1XXGA 2RMMA 1WXAA 3ZNGC 2IO0B 3W5UB 2N9EB 2AX5A 1V1PA 2WHIA 1IBXA 1L4DB 4G11A 2DAJA 2WNMA 1XLNA 2ZVNA 3ECIA 5JHBA 2LRWA 3GZNB 2E3TA 1VZ8A 1V5OA 2NTSA 2KX0A 3ZRCA 1L0XB 2N7EA 1KOTA 3ZDMC 1PYWD 4RGMA 1XQQA 1V80A 1E6EB 4AS1A 3LDZE 3HK0A 2FE8A 2HTHA 4OZAA 2L8JA 1AN8A 1FFUA 3L17A 2KJ6A 2MQJA 4E74A 2BYEA 1UELA 3OG5A 3I5JC 2JVCA 1TS5A 1YOVB 1WJ6A 4YXDB 1TY0A 1HZ5A 3IG3A 4YT0B 2M56B 3I9V1 2WXNA 4WAFA 2M0AA 4A8XC 3ZNHB 4L2YA 1S3SG 1ZGUB 3KH0A 1K50A 3FAHA 2KTRB 3RZFA 3ZO5B 1B9RA 4XWWA 2RGFA 3DOWA 1V5TA 2DZIA 1V6EA 2KHWB 3AU5A 3E56A 1WIAA 1FIQA 3QQ8B 4HDOA 4BKTA 3NVWA 2QDFA 1VJKA 2IYDB 3AEBB 4EE2A 3QCAA 1NENB 4M8MA 2N9PC 4WAAA 1FXIA 1QOGA 4C4VB 4LNFA 3DCGA 4TQ1A 4IM3A 2M19A 2W3RA 3ZDTA 1NDDA 1C4AA 1QOBA 1AYFA 4AP4C 2AYOB 2REXA 4MACA 3VAWA 3FKYA 1OQQA 5TSSA 4BFRA 4W9JA 4ZRPA 3W1SA 3ZQ4A 2KO3A 3CSFA 4P16A 1L0VB 1P98A 5HI1A 3TEYA 1XT9B 3UQBA 2BS2B 1MHHE 4HEA1 3W9CB 1WGYA 1WX8A 1OEYJ 2X8XX 1I4QA 1UWXA 1RYJA 3RYTA 3PVLA 1SE4A 3P4QB 4TQ0A 1Z5SB 1ZP0B 1WGHA 4YSXB 1NEKB 1KM7A 2MJ3A 1E0ZA 1ENFA 3APFA 1OTRB 1N6ZA 3OJ4B 1WRDB 3PLUA 3UQAA 2ZZPB 1YX6B 1YN3A 4HVBA 5TR5A 2D3GA 3TEXA 4N9F4 1SIFA 2EMTA 4WWNA 1TZOA 3L4PA 1P7FA 3A9KB 2N7DA 4FJVB 2KACA 5IN7A 4ZRQA 2QEJC 1AARA 1B1ZA 3VUWA 1ZKHA 1D5ZC 2PJHA 2GMIC 1E8XA 1QILA 1DOIA 1UBQA 1CMXB 1JWSD 2IO2B 4WQOB 3V05A 2KD0A 5IKCM 1L6UA 2K6DB 1ROEA 1C4CA 3DVNU 3DBSA 3BVGA 3AEDB 1N5WA 4EKUA 1Q5WB 2NVUI 2M8SA 1GC7A 1RWSA 1WRIA 1D3ZA 1TJEA 3VH4B 1L5PA 4FBJB 1T3QA 4NJCA 4G0NB 3VR9B 1SGHA 2YEPF 1TTNA 4EOYA 4YTNB 2IGGA 1MI0A 1NVID 2N7JA 1LXDA 2V0GA 4WJNA 2PVOD 2PIAA 4W9HA 2BW2A 5FR3A 5L83A 3MHSD 2QSDA 2FIFA 3GE8C 3QHTA 4MDKE 4NZLB 5EE3A 4DK5A 2W3SA 3NY5A 2Y5PA 4TKNA 2E6XA 5GMVA 4USAA 5JZEB 1EU4A 3PT2B 4BVUC 4EUTA 2K3UA 2G4SA 1QKZA 2HTME 2KYWA 2KC2A 2WDTB 4ZYSA 2WXIA 2WDRB 5BYSA 3UI3A 3ZJVA 4NQKE 2DLBA 4MGIE 2ZPYA 1SJED 2GBMA 4J3OD 4OZCA 2QC8A 1JWMD 2JU6X 1WH3A 2FCSA 3SDLC 2KDIA 4NJ6A 2N1WA 2YEPB 4MGZE 3PO0A 4G50A 3AECB 1C3TA 1SEBD 5EE1A 1V8CA 2RPVA 3RN9C 5I4DA 4XE0A 2WXOA 4EEWA 1WYWB 3V3XA 2KJRA 2N0SB 4ANXA 2K8BA 1GUAB 1FEHA 2MBOA 4II3B 1IPGA 1C1YB 1YMHE 1H4RA 2DYMA 2GBNA 4GMVA 1MFWA 1A5RA 1R4MB 2RDBC 4K81A 1VR9A 1WYGA 3VR8B 1YNTE 3M3JA 4ARIA 1HE8A 2KWVB 4HK2A 1QLBB 5E6JA 2WU5B 4JIOU 3QJZA 1J7CA 4H2AA 3MC8A 2KLGA 4A90A 1I4RA 3AEAB 5DPWA 1RFKA 4B95A 2MRPA 1T0RC 2JF5A 2ZVOA 2UWQA 3ENEA 1WGKA 2KZRA 2RDGA 3Q8FA 1IYFA 4B6WA 4KZ0A 1AWDA 1J7BA 2INCC 5D2MB 3DWMA 1UGMA 1J8CA 4GDLB 4F7ZA 1ZPSA 2KDBA 1S1QB 2K1FA 2K39A 3KVFB 2Z8LA 4KVGB 4ANUA 4NPNA 4TUUA 4MEMA 3A9JA 1ZOYB 2BB5A 1YJ1A 2M0XA 4RGTA 4B9KA 4LNOA 5DPTA 2G9HD 1SBBB 2NMQA 1CQVA 1WM3A 2BF8B 2KJHB 5AUKA 1PGBA 1EF5A 4BZAA 2L1AA 2BPSA 3W1SC 2KDMA 2IGDA 4N59A 4K7SA 4A3OA 1SE9A 3PTFC 5J17A 2CHWA 2FCMA 5L95C 5AZGA 4P1BC 1T0YA 4FLHA 3JYUA 1WSPA 2DX5B 1TS2A 1NI2A 2MCNB 2DAFA 5C2TB 3ZGZA 4OZBA 1UH6A 1JMLA 3AE6B 3WAOA 4ZHOA 1P0RA 3EGRA 2IDYA 3PZ8A 3QWZB 4IW0A 1L7YA 3BK1A 1WXSA 2L83A 2BYTA 4GDKA 3PZ7A 4JQWC 2B76B 2LJ5A 2O6VD 2L52A 4LNKA 2BS4B 3RNEC 2VZKB 2LGIA 1FMAD 4RCOA 2I38A 3TCAA 5C3JB 1XF5L 3VUXA 4YWGG
chains in the Genus database with same CATH topology
1NI3A 5H8YE 2OEDA 4GLSC 4XDCA 3SR6A 1XCQL 1BMLC 1TY0A 4B0MA 1XCTL 1ZXIA 2DWQA 3MHZA 1HZ5A 4FXCA 1ZUD2 3BIID 4LLGM 4YT0B 2M56B 2JYEA 3I9V1 2WXNA 4WAFA 2M0AA 4A8XC 4L2YA 3W5VB 2XNAC 1JROA 1N5XA 4RH6A 1K50A 1N60A 1YQ3B 3FAHA 1IGCA 3T3OA 1C9FA 2ZW0A 1TYGB 1B9RA 1EWCA 4XWWA 3AE2B 4KGSA 1I4XA 1NYRA 2BB6A 3R2IA 4ZOHC 1A70A 2WXFA 1KTKA 3E56A 4HJGE 1FIQA 3VQIA 1SB3C 2J52A 3NVWA 3LXFA 2K0PA 1OQRA 1VJKA 3MC0B 1K53A 1JALA 4NAWB 3AEBB 5HG2A 4EE2A 4MM3B 4JWUC 1NENB 1V1PB 2ZW1A 5JXVA 1ET6A 1F2RC 1UGJA 4RGNA 3NVZA 4Q2JA 4ZHPA 2CJOA 1FXIA 1QOGA 4D2KA 1QF6A 1HEZE 2Q5WD 2J42A 3MP9A 5MPOA 4TQ1A 1I4GA 3BVZA 2M19A 1TKEA 2AQ3B 4L23A 2W3RA 1P7EA 1C4AA 1QOBA 2PTLA 1AYFA 2FBWB 2WXGA 2WXPA 2N9KA 4MACA 1OQQA 1L0YB 5TSSA 2R61A 1YQ4B 3AE9B 3B9JA 3Q8BA 4A9AA 3AH7A 2BT6A 2MEKA 4ZRPA 3W1SA 3ZQ4A 3R8BA 1MHXA 3P42A 4P16A 1SE3A 1L0VB 1UUPA 2IPKD 5HI1A 3TEYA 1YN5A 4LTUA 4RNAA 3IT6B 2KN4A 1I4HA 2MJDA 2BS2B 1MHHE 1VZ6A 3KWLA 4HEA1 3AE8B 4IKGA 1VDVA 2KAJA 3W9CB 4US8A 4RF0A 1BXTA 1I4QA 1UWXA 2K9XA 3P1MA 4YXDB 1OFFA 2WXMA 1WXQA 3W2DA 1C4PA 4OVZA 1RYJA 3AE5B 3I57A 1FXAA 3ZJUA 3KWVA 3ABVB 2XN9C 1XO3A 1Y56A 3P4PB 1YJIA 1SE4A 1TKGA 3B2GA 1FM0D 3P4QB 3SEBA 4TQ0A 3KLSX 4US9A 2GB1A 1ZP0B 1VLBA 3P4SB 4YSXB 1XLQA 3FILA 5AUIA 3RFZB 1NEKB 2MJ3A 1PGAA 2V3NA 1E0ZA 1M4VA 4C7YA 1GAQB 1ENFA 5BYQA 4UDUC 2Y5CA 3LYYA 2KMMA 1AW7A 1VRAB 1SIJA 2EKIA 1FO4A 2JWUA 1YN3A 5FK9C 4YSYB 4DXFA 3TEXA 1RM6C 1F77A 2ON8A 1TZOA 3SFDB 2JX5A 3L4PA 1P7FA 2ICIA 2X38A 1YJJA 3GB1A 2KACA 4ZRQA 2QEJC 4RF1A 4GDKB 1TY2A 4RGOS 1B1ZA 1C78A 1HZ6A 3FILB 1C77A 4WQMA 2KWDA 1SE2A 3ZJTA 1D5ZC 2V3PA 4AQ7A 2H89B 1F2RI 1QILA 4P6VF 1DOIA 1GOZA 2PVGC 3Q8AA 1XLPA 1TS4A 5FKAC 1JWSD 1SXTA 3P63A 2K22A 4JWSC 3V05A 2AQ1B 4A6QA 3TEZA 1L6UA 1ROEA 1HA5A 1C4CA 2WXJA 3EUB2 1PUTA 3NUHB 1ZE3D 1FD6A 3DWGC 3BVGA 3P4RB 1LO5D 3HRDD 3LB8C 3AEDB 2LJIA 1N5WA 2INPE 1T5XD 2IGHA 2MJEA 5BMIA 1RWSA 1EM7A 1K52A 4MT5A 2INNE 1GB4A 1WRIA 2JQRB 2W55A 3EA6A 3H8HA 1TJEA 1L5PA 3AMZA 1T3QA 3BYYB 2JXTA 3HVZA 4DXGA 4NJCA 2V4IB 3VR9B 1V97A 2WXRA 2YEPF 4YTPB 3URYA 2GI9A 2H88B 4C56C 1IUEA 1J7AA 4KKIA 4C7ZA 1CK1A 4HRSA 4O1NA 4YTNB 2IGGA 3RPFC 1MI0A 4TSSA 1NVID 3N9YC 2CJNA 1PDXA 2DYOA 2N7JA 2WS3B 3VRBB 2V0GA 1E7PB 1ET9A 2PVOD 2IJ0A 3HVDA 4KGTA 2QIEB 2PIAA 1F0ZA 2PMVA 1C79A 1XEEA 4YSZB 2BW2A 3U52E 3ZYYX 5FR3A 1YN4A 3CWIA 2QSDA 5BYRA 1SSNA 3BYTB 3IAM1 4NZLB 5EE3A 2QILA 1N62A 1GB1A 2SEBD 2WXLA 3O13A 1FFVA 3U2SC 3U7ZA 2W3SA 1KLGD 2Y5PA 1KFYB 2WP9B 2E6XA 4WURA 4USAA 2W82A 4HKQA 3GP7A 4IOIE 1EU4A 1QOFA 2K3UA 2LEKA 5D3IB 4IDIA 1MPEA 1QKZA 3AV8A 1KLUD 2HTME 1ESFA 4NAMA 1DOYA 4ZYSA 3NVVA 2WXIA 3SFEB 2WDRB 1C76A 3KQ4A 4OW0A 3UI3A 3HUIA 5BYSA 2WXKA 1HQRD 4HROA 4WIPA 5D7GA 1DOXA 3ZJVA 3MJ5A 4WH4A 2DLBA 2LMCA 5G5HA 2GRIA 1SJED 3BK2A 5HHDG 1XLOA 2EELA 4J3OD 4OZCA 2TSSA 2OHFA 4M0WA 4DQOC 1JWMD 2JU6X 3MFGA 2WQYB 1QOAA 3FC4A 2YEPB 4JE3B 1E9MA 1WWTA 3PO0A 3AECB 1SEBD 5EE1A 1V8CA 2RPVA 2G1EA 1E10A 3IT4B 1JWBD 5I4DA 1SF0A 4XE0A 1KF6B 2WXOA 3NS1A 2QMTA 1NYQA 4OHJA 3V3XA 2BBCA 5D3DA 3AM9A 1R7SA 2N0SB 3TSSA 1FRRA 5LNK1 2DBYA 2JZPA 2I2YA 1T6BX 2PW9A 3AEGB 1FEHA 3E9SA 3GS2A 1JWUD 2KQ4X 4XDDA 2JSVX 4LK0M 2K5PA 2VZKD 1KRHA 1K51A 3WCQA 2FUG1 1YMHE 4YTMB 2HDEA 4JPSA 1IBXB 2DYMA 1JCKB 3J9CA 1DYQA 1VR9A 1WYGA 4N6EB 3VR8B 1YNTE 1STEA 1ZDVA 1EU3A 1I4PA 2PKOA 4ARIA 3AE7B 2NTTA 3NRZA 4R3DA 1QLBB 5E6JA 2WU5B 1V1OA 1J7CA 1JW9D 1FCLA 2W54A 4H2AA 3T3NA 1VZ7A 2L32A 3AB5A 4A90A 3AEEB 3VRAB 1I4RA 3AEAB 4REZA 1JQ4A 2WLBA 1RFKA 1HXYD 2AQ2B 1JRPA 2WXQA 1ACCA 1TS3A 5G5GA 1KH0A 2ONQA 1QQRA 3NZ3A 5T8IA 2RDHA 1IGDA 1EWYC 2QJLA 5HFYA 1WGKA 1D5MC 2RDGA 3Q8FA 2CU3A 4CQNA 3TUOA 1CJEA 4ITKA 1JWAD 1N61A 3Q69A 4N58A 4TMAB 3OWEB 4WWMA 1FRDA 1AWDA 1FCCC 4ARCA 1J7BA 4KKJA 3U4EG 3DWMA 3BWUD 4GDLB 2BS3B 1ZPSA 3IAS1 3NVYA 1ZXHA 2D5GA 1UNSA 3AE4B 1D4BA 2N9LA 2LHDA 1MVKA 1PFDA 4A55A 2WDVB 2LHEA 1D5XC 2Z8LA 1N63A 5GXGB 2JYTA 4MH8A 4XWTA 2LUMA 4KGRA 3TEWA 1GPXA 1ZOYB 5BMHA 2BB5A 4RGTA 1UWMA 1SJHD 2ACZB 2Y3AA 5H92C 1L6VA 3R2TA 2G9HD 3Q8CA 1SBBB 1XXGA 2RMMA 3Q8EA 4C80A 2LFIA 2NMQA 1CQVA 1TKYA 3W5UB 5AUKA 1PGBA 3B2FA 2AX5A 4KX6B 3AE1B 1V1PA 1IBXA 3C8YA 1L4DB 1FNWA 2L1AA 2WNMA 1XLNA 2KDMA 2IGDA 4N59A 4HKZE 1I7HA 3AN1A 3BVMA 2J53A 5EE9A 2E3TA 4B0EA 1L4ZB 3IXSA 4JX1C 1CZPA 1VZ8A 2BTEA 1D6EC 3AEFB 1WSPA 1QT9A 1TS2A 1Q10A 2NTSA 1ZDXA 4RFBA 5C2TB 1DGJA 3ZGZA 4OZBA 1L0XB 1JMLA 1PGXA 3ETRA 1PYWD 2WU2B 3AE6B 4RGMA 4ZHOA 3EGRA 2IDYA 3PZ8A 3BZDB 5BMGA 1FNUA 1E6EB 4AS1A 2SAKA 3BK1A 2L83A 1FNVA 2BYTA 3AE3B 2FE8A 3PZ7A 4OZAA 2J4XA 2B76B 1AN8A 2WXHA 5EE0A 1FFUA 2L52A 2MH7A 1BUIC 2BS4B 2WDQB 2VZKB 4PT5A 2LGIA 1FMAD 2PLPA 3CIRB 4RCOA 2I38A 1TS5A 5C3JB 1XF5L 4L1BA 4YWGG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OED A;  4GLS C;  1XCQ L;  2QSD A;  3FIL A;  1KH0 A;  1PGA A;  1XCT L;  1HZ5 A;  2ONQ A;  1IGD A;  5HFY A;  1GB1 A;  1K50 A;  1IGC A;  4IOI E;  2JWU A;  1C9F A;  1FCC C;  2ZW0 A;  2ON8 A;  4KGS A;  1P7F A;  1MPE A;  1QKZ A;  1ZXH A;  1D4B A;  3GB1 A;  2N9L A;  2KAC A;  2LHD A;  1MVK A;  4HJG E;  3UI3 A;  2LHE A;  1HZ6 A;  3FIL B;  2KWD A;  2LUM A;  4KGR A;  2J52 A;  4WH4 A;  2K0P A;  5BMH A;  1F2R I;  1K53 A;  5HHD G;  5HG2 A;  2RMM A;  2EEL A;  2NMQ A;  4OZC A;  2ZW1 A;  5JXV A;  1F2R C;  1PGB A;  2JU6 X;  4D2K A;  1HEZ E;  1IBX A;  3MP9 A;  2KDM A;  1FD6 A;  2IGD A;  1P7E A;  2RPV A;  2PTL A;  4HKZ E;  2QMT A;  2IGH A;  2J53 A;  3V3X A;  2N9K A;  4MAC A;  5BMI A;  1EM7 A;  1K52 A;  1GB4 A;  2JZP A;  2I2Y A;  2PW9 A;  1Q10 A;  2JXT A;  2KQ4 X;  4OZB A;  2JSV X;  1MHX A;  1JML A;  1PGX A;  1K51 A;  1YMH E;  5HI1 A;  1IBX B;  2GI9 A;  2KN4 A;  5BMG A;  1MHH E;  4IKG A;  1YNT E;  4OZA A;  2IGG A;  1MI0 A;  1UWX A;  2N7J A;  2LGI A;  1FCL A;  4KGT A;  2PLP A;  2I38 A;  1XF5 L;  2GB1 A; 
#chains in the Genus database with same CATH topology
 4BBN C;  2OED A;  4XDC A;  3SR6 A;  1XCQ L;  1BML C;  1XCT L;  3ZLZ A;  3RCZ A;  4K3C A;  3BII D;  2JYE A;  4XGA B;  1Q1O A;  4W9L A;  2XNA C;  1N5X A;  4HPM B;  4BAX A;  1N60 A;  2MBH A;  3WAM A;  1IGC A;  3PRZ A;  4IUM B;  1C9F A;  5EDS A;  2ZW0 A;  1TYG B;  1UF0 A;  1EWC A;  3OLM D;  4KGS A;  3JSV A;  1A70 A;  1KTK A;  4KSK C;  2KK8 A;  3RMK C;  3PV1 A;  2WWZ A;  2CHZ A;  2V1Y A;  1SB3 C;  4MEL A;  2M1M A;  4NJ7 A;  2D3C A;  1JAL A;  4NAW B;  5HG2 A;  4TV3 A;  4JWU C;  2ZW1 A;  2PE9 A;  3NVZ A;  1YQB A;  2Q5W D;  2J42 A;  4L23 A;  4GIV A;  2FBW B;  4P7I A;  2LD9 A;  2N9K A;  3A4R A;  3AE9 B;  4A9A A;  2KWU B;  3AH7 A;  4NY0 A;  2BT6 A;  3R8B A;  2KQS A;  3P42 A;  1SE3 A;  3L08 A;  1YN5 A;  3OJ3 A;  2YLM A;  2MJD A;  2V3S A;  1BT0 A;  3KWL A;  4IKG A;  2L76 A;  2KAJ A;  4LJP B;  4US8 A;  4XZ4 A;  4MSM B;  2V4L A;  2K9X A;  2WXM A;  4DHZ B;  3I57 A;  2MHJ A;  3KWV A;  1XO3 A;  4ACF A;  3ZXR A;  1YJI A;  3SEB A;  2LXA A;  2D07 B;  1RRB A;  2KVR A;  1VLB A;  3P4S B;  3RZW C;  3FIL A;  5KHQ A;  2V3N A;  4EZK A;  1M4V A;  3IBE A;  2GBR A;  2Y5C A;  3X0W A;  1AW7 A;  2ZCB A;  1VRA B;  2JWU A;  1QZE A;  5FK9 C;  4YL8 A;  1T0S C;  2ON8 A;  3EFC A;  3APD A;  3SFD B;  3UIN B;  1XD3 B;  5J18 A;  4KDL B;  4RM9 A;  2C9W B;  4RGO S;  1C77 A;  1LM8 B;  4WWO A;  4AQ7 A;  2KKC A;  2Z0D B;  3WAN A;  1H8C A;  3VTU A;  4M02 A;  4P6V F;  4M0W B;  1GOZ A;  3Q8A A;  1XLP A;  1TS4 A;  5FKA C;  2ZPN A;  3AXC A;  3VXW A;  4JWS C;  1WGD A;  2AQ1 B;  4PS7 A;  3DBL B;  4LNI A;  1HA5 A;  4BKG A;  3R66 C;  3P4R B;  3LB8 C;  4PYU A;  1K8R B;  2LVQ A;  2MJE A;  4MT5 A;  1WY8 A;  3QIJ A;  2MBQ A;  2HJ8 A;  2JQR B;  2KTR A;  3H8H A;  4DXG A;  1V9J A;  2BGF A;  2DYB A;  1V97 A;  3DHI C;  3M63 B;  1IUE A;  1J7A A;  3GZN I;  3S2A A;  3DBH I;  4C7Z A;  4HRS A;  2M17 A;  4F8C B;  2XBB C;  4LNN A;  2CJN A;  2DYO A;  2MX2 A;  3X23 A;  1ET9 A;  3HVD A;  4AJY B;  2LRU A;  1F0Z A;  4JGH B;  4M00 A;  2LGS A;  4CHK A;  5BYR A;  2PE6 B;  3IAM 1;  2SEB D;  2RD0 A;  2BYF A;  3HM6 X;  2RPQ A;  3PRM B;  2KC1 A;  3GP7 A;  4GGQ A;  4IOI E;  5J2R A;  3I3T B;  3Q3O C;  1WX9 A;  2ZJD A;  3VTW A;  4BOZ B;  1KLU D;  1GJZ A;  3CF6 E;  3NVV A;  1C76 A;  3QK0 A;  1WGG A;  3CST A;  4HRO A;  4WIP A;  5D7G A;  4WH4 A;  5G5H A;  3DPD A;  3IFW B;  3BK2 A;  1P3Q U;  5D94 A;  1WJ4 A;  3V6C B;  3PPA A;  1WR1 A;  2WQY B;  5D6J B;  3FC4 A;  1E9M A;  3BY4 B;  3IT4 B;  1JWB D;  1WI0 A;  2QMT A;  1NYQ A;  1J19 A;  1R7S A;  3L54 A;  1KJT A;  1TBE A;  2JXX A;  1TT5 B;  1T6B X;  4KSL C;  4DHJ B;  2I2Y A;  3V62 A;  3PRP B;  1JWU D;  4XDD A;  4I6N B;  2JSV X;  2MLB A;  4LK0 M;  2RR9 A;  1K51 A;  2JT4 B;  2HDE A;  3L13 A;  2C5L C;  3K9O B;  1JCK B;  3J9C A;  4BOS C;  3KYC D;  4HDQ A;  4N6E B;  2D2Q A;  4G3X B;  1STE A;  1I4P A;  3AE7 B;  3NRZ A;  3NZU A;  4R3D A;  2W54 A;  3OAW A;  3B1L X;  3ZIM A;  2L32 A;  2GBJ A;  1JQ4 A;  2WLB A;  1HXY D;  1ACC A;  2KT7 A;  5CX3 A;  1TS3 A;  1UBI A;  2ONQ A;  3JW0 X;  2RDH A;  2NS5 A;  3A1Q B;  2JY6 A;  3QC8 B;  4E71 A;  1X1M A;  2DNF A;  2MBB B;  3AU4 A;  3PGE A;  2MP2 B;  3DHH C;  2KQ7 A;  4FA6 A;  3BWU D;  3TIX A;  5CHW A;  1F52 A;  2WX0 A;  1ZXH A;  2CU1 A;  2DZK A;  1UNS A;  3AE4 B;  1D4B A;  4EFO A;  4K7W A;  3C19 A;  2WDV B;  2LHE A;  1N63 A;  5GXG B;  4MH8 A;  4KGR A;  3TEW A;  1GPX A;  1NBF C;  3ZTC A;  1UWM A;  1SJH D;  2Y3A A;  5H92 C;  4IG7 B;  3Q8E A;  3IVF A;  4IWO A;  3RNB C;  5DPR A;  2LGY A;  1TKY A;  3WAP A;  2Z0E B;  2J0J A;  3B2F A;  2KWC A;  2XK5 B;  2CR5 A;  2BWE S;  3C8Y A;  2KFK A;  3O65 B;  1FNW A;  4GDL A;  4AWJ A;  2Z59 B;  5DPS A;  4WJP A;  1I7H A;  3AN1 A;  3BVM A;  2L00 B;  4B0E A;  5LXH A;  4JX1 C;  1CZP A;  4K1R B;  2BTE A;  3AEF B;  3T8M A;  1QT9 A;  1Q10 A;  3L0W B;  2FUH B;  2FID A;  4KV2 A;  5BO4 B;  3BZD B;  5BMG A;  1EUV B;  1FNU A;  4CYE A;  2YVC A;  2SAK A;  3AE3 B;  1U4A A;  2WXH A;  2WDQ B;  2UYZ B;  4PT5 A;  1LFD A;  4AOF A;  3CIR B;  1P9D U;  4L1B A;  2DEN B;  3V60 A;  3U8Z A;  1MJD A;  4B0M A;  1HTQ A;  3GOE A;  1ZXI A;  2DWQ A;  3MHZ A;  3VHT C;  3UF8 A;  2BKR B;  1YD8 U;  3EHV A;  4LLG M;  4XC2 A;  2L7R A;  1V2Y A;  4XYC A;  3W5V B;  1WGR A;  4MM3 A;  4ASW C;  1JRO A;  3JVZ X;  3PSE B;  4ZOH C;  2WXF A;  4W9K A;  4HLE A;  1RFA A;  3L16 A;  4HJG E;  1V81 A;  2RSU A;  2J52 A;  1E8Z A;  2KMC A;  1GNU A;  3LXF A;  3L10 B;  2K0P A;  1OQR A;  3MC0 B;  3ZW3 A;  2ZNV B;  1K53 A;  1JRU A;  2KNB A;  4MM3 B;  4DBG A;  4RGN A;  1F2R C;  3PHW B;  3HM3 A;  4D2K A;  1QF6 A;  1HEZ E;  1I4G A;  3Q14 C;  3KW5 B;  3Q6B A;  2O2V A;  4LCD E;  2PTL A;  2BWF A;  2WXG A;  1L0Y B;  3Q3M C;  3H1U A;  2R61 A;  1YQ4 B;  2L05 A;  3B9J A;  3Q8B A;  3BIN A;  2MEK A;  1MHX A;  1E8Y A;  2LVO A;  1UUP A;  2IPK D;  4DHJ D;  3EFU A;  1P1A A;  4LTU A;  4RNA A;  3IT6 B;  1I4H A;  3WAL A;  3DVG Y;  3DBH B;  1VDV A;  2V9H A;  4RF0 A;  1BXT A;  4S0R A;  2O2V B;  4HXD A;  3NHE B;  1C4P A;  4OVZ A;  3AE5 B;  1WF9 A;  1HTO A;  3ABV B;  5C1Z A;  2JZ3 B;  3ALB A;  3P4P B;  4J6I A;  1RLF A;  1TKG A;  3B2G A;  3KYD D;  3KLS X;  4US9 A;  2I1J A;  1M94 A;  1XLQ A;  4WWP A;  1PGA A;  4UDU C;  2CS4 A;  4W9I A;  3N30 A;  2FCQ A;  4KIK B;  2QCZ A;  3DBR I;  1FO4 A;  4DXF A;  3DVN V;  1WJU A;  2HJ1 A;  3DQV A;  4A20 A;  1F77 A;  3V6E B;  2WGS A;  2JX5 A;  4ICU A;  5FR6 A;  2X38 A;  1YJJ A;  4BBN F;  4RF1 A;  2LGD A;  4WQM A;  3FIL B;  1WFY A;  2KWD A;  1SE2 A;  3ZJT A;  1MG4 A;  2FCN A;  2H89 B;  5JH5 C;  3PHX B;  1R4N I;  1WMH A;  2C7H A;  3H7S A;  3P63 A;  4KIK A;  4A6Q A;  2KLC A;  3EUB 2;  3CMM B;  4P1C C;  3KUZ A;  1ZE3 D;  4IWQ A;  3HRD D;  2LJI A;  3QX1 A;  2INP E;  2LI5 A;  4C00 A;  1T5X D;  2IGH A;  3P2B A;  1K52 A;  2G45 B;  2INN E;  1GB4 A;  4ZRI A;  2HD5 B;  2W55 A;  3EA6 A;  4DDI D;  3AMZ A;  3HVZ A;  2JXT A;  1V49 A;  4AJW A;  1E5W A;  2WXR A;  2GI9 A;  2EKE C;  2H88 B;  4C56 C;  2KMA A;  4KKI A;  2JRI B;  1L2N A;  1CK1 A;  2JZZ A;  4O1N A;  2LGX A;  3TL5 A;  3RD2 A;  3RPF C;  2IND C;  5HKH A;  2WS3 B;  1E7P B;  5E6N A;  1E90 A;  3DBR B;  2IJ0 A;  1C79 A;  1XEE A;  3PS6 A;  3ZYY X;  2O6V B;  1SSN A;  2QIL A;  1N62 A;  2WXL A;  4II2 B;  3U2S C;  4ZRK A;  3I63 C;  2WP9 B;  2OJW A;  4WUR A;  2DZM A;  1QOF A;  3RUL A;  3ZKJ C;  3ZRF A;  3R7Q A;  2PEA A;  2NPT A;  2LEK A;  3A33 B;  5D3I B;  4IDI A;  3AV8 A;  2LUE A;  4NAM A;  1ESF A;  2ZEQ A;  3SFE B;  3KQ4 A;  3HUI A;  2WXK A;  1HQR D;  4LDT B;  4KDI C;  2ASQ A;  5IP4 D;  2GRI A;  2GBK A;  4W9E A;  1XLO A;  4PYZ A;  2EEL A;  3RNF C;  2MW5 A;  3V61 A;  2TSS A;  3MJW A;  2OHF A;  4FHJ A;  4I6L B;  4RMA A;  1WX7 A;  4DQO C;  3DBL I;  2IY0 B;  1I42 A;  2NPT B;  1WWT A;  2R2O A;  4ZRJ A;  1E10 A;  1KF6 B;  3NS1 A;  4M01 A;  4OHJ A;  2BBC A;  3HIZ A;  5LNK 1;  2JZP A;  3AEG B;  1E7V A;  2KQ4 X;  3H9D A;  2IBI B;  1KRH A;  2JPH A;  2FUG 1;  1GG3 A;  4E3C A;  1DYQ A;  2O6V A;  3U7D A;  1ZDV A;  4ANW A;  2NR2 A;  2EMS A;  4URK A;  2NTT A;  3R7R A;  3Q2A C;  2K25 A;  1FPY A;  1V1O A;  3VH3 B;  1JW9 D;  5IO9 A;  3AB5 A;  3VRA B;  4REZ A;  2AWT A;  5IOI A;  2AQ2 B;  1JRP A;  2IO3 B;  4GB9 A;  5G5G A;  2MA9 B;  5IAA C;  2N4F A;  4WJQ A;  4GOC A;  5T8I A;  3APC A;  3KUD B;  5HFY A;  2C7M B;  1MG8 A;  3A4S C;  1EO6 A;  1TZ1 A;  4CQN A;  2NBV B;  2A5U A;  1Z2M A;  1JWA D;  1N61 A;  4TMA B;  3OWE B;  3AI5 A;  1FRD A;  1FCC C;  2L0T A;  2ZCC A;  3SHQ A;  2K8C A;  1WM2 A;  5AEK B;  4PS8 A;  4FUL A;  1I35 A;  1WE6 A;  3WIM A;  1PFD A;  4A55 A;  1YIW A;  2B3A A;  4XWT A;  2LUM A;  4FJY A;  1WZ0 A;  4PK1 A;  1L6V A;  5AZF A;  3Q8C A;  2D3B A;  4C80 A;  2LFI A;  3R3M A;  4NAW A;  4KX6 B;  3AE1 B;  1RAX A;  4XX5 A;  4ICV A;  4W9D A;  2ZNV C;  4LJO B;  2PPH A;  4HKZ E;  3A1Q A;  2J53 A;  5EE9 A;  2MWS B;  1L4Z B;  3IXS A;  1D6E C;  1ZDX A;  2MP2 A;  4RFB A;  1DGJ A;  4JLC A;  1T0Q C;  3TJP A;  1PGX A;  3ETR A;  2WU2 B;  2NBW B;  2KFJ A;  3NG0 A;  3NS8 A;  1FNV A;  2BKF A;  1R4M I;  2J4X A;  1WXM A;  2OOB B;  3ZNZ B;  5EE0 A;  2MH7 A;  1BUI C;  2JUO A;  4DXA B;  1VCB A;  2KDF B;  4FAD A;  4KZC A;  2PLP A;  3D32 A;  1E8W A;  2G4D B;  4YTM B;  4DWF A;  1NI3 A;  5H8Y E;  4GLS C;  4GXB A;  3Q3F A;  3MTN B;  4FXC A;  1ZUD 2;  2KX3 A;  4A3P A;  4HJK A;  4IC7 B;  4DHZ E;  2C60 A;  2WX1 A;  3SD5 A;  4RH6 A;  1YQ3 B;  4MSQ B;  3T3O A;  4MGK E;  4ZDV A;  3QAQ A;  3AE2 B;  3DDC B;  1WZ3 A;  1I4X A;  4M8N A;  1NYR A;  2BB6 A;  3R2I A;  4X57 B;  3UIP B;  5C23 A;  5IA7 A;  3VQI A;  2DZJ A;  3N1Z C;  5CTR C;  3ONS A;  1WXV A;  1OEY A;  3UGB B;  3ZXV A;  2FAZ A;  1V1P B;  3M95 A;  5JXV A;  1ET6 A;  1UGJ A;  2HE7 A;  2KTF A;  4Q2J A;  4ZHP A;  2CJO A;  2L0F A;  3MP9 A;  5MPO A;  3BVZ A;  1TKE A;  2AQ3 B;  3RNG C;  1P7E A;  1KLV A;  2FNJ B;  2WXP A;  3DHG C;  2D3A A;  4HPP A;  4JL9 A;  4K3B A;  3NJT A;  1Q0W B;  2J0M A;  4S17 A;  3RNA C;  3N1X C;  1WJN A;  2KN4 A;  2KN5 A;  4LDT D;  1VZ6 A;  3AE8 B;  4OVV A;  2K8H A;  4CO7 A;  2IZV B;  4AUQ C;  2NBU A;  5E6P A;  5E6O A;  1J0G A;  3P1M A;  1OFF A;  3T9L A;  1WXQ A;  3W2D A;  3AUL A;  4I6P A;  1FXA A;  4WJO A;  2OJR A;  3ZJU A;  2CHX A;  2XN9 C;  2VH2 A;  1Y56 A;  1Y8R C;  1FM0 D;  3N3K B;  3PZD A;  2GB1 A;  2QHO A;  1WR6 E;  5AUI A;  3RFZ B;  1ZW7 A;  3H7P A;  3KUC B;  4C7Y A;  1GAQ B;  5BYQ A;  3LYY A;  2KMM A;  4EZJ A;  2G3Q B;  4IM0 A;  5LXI B;  2D11 A;  4F1S A;  1SIJ A;  2EKI A;  4MGY E;  2VRR B;  4YSY B;  3JSV B;  1RM6 C;  3ZTD A;  4C4V A;  2MSE D;  2ICI A;  3ML8 A;  2AEH A;  3GB1 A;  1YX5 B;  4FJZ A;  4GDK B;  1TY2 A;  1C78 A;  1HZ6 A;  4NNJ B;  2V3P A;  2LWP A;  4FHK A;  1F2R I;  3RNC C;  4ANV A;  2PVG C;  3IHP C;  3RUI B;  1SXT A;  2K22 A;  4GSW A;  1TGZ B;  3TMP B;  3TEZ A;  4W9F A;  3H6N A;  3M62 B;  2WXJ A;  2XEW A;  3K9P B;  1PUT A;  2M4N A;  3NUH B;  1FD6 A;  2K6Q A;  3DWG C;  1LO5 D;  4BKS D;  2MBE A;  4ZYN A;  5BMI A;  1EM7 A;  2KAN A;  4NQL B;  2LAS A;  3BYY B;  4IWP A;  4W9C A;  2V4I B;  4GN1 A;  4YTP B;  5LLI A;  3URY A;  2LZ6 A;  3C0R B;  3EC8 A;  2W9N A;  5G2N A;  3H7P B;  1PQS A;  3QAR A;  2BVC A;  4TSS A;  2Y5B B;  3N9Y C;  3DVG X;  1LGR A;  1PDX A;  3VRB B;  1R4N B;  3NZS A;  1WMH B;  4KGT A;  2QIE B;  1TIF A;  1EF1 A;  3VUY A;  1V86 A;  3LJ3 A;  2PMV A;  5AZH A;  4YSZ B;  2NCN A;  3U52 E;  1YN4 A;  2AL3 A;  3CWI A;  4K7U A;  2KXJ A;  2LXC A;  4RM8 A;  3BYT B;  4HCP B;  2JRH A;  3ML9 A;  5DCN A;  4HPL B;  1GB1 A;  3O13 A;  1FFV A;  3N20 C;  3U7Z A;  4HCN B;  1KLG D;  1KFY B;  1UZX B;  2W82 A;  4HKQ A;  3TBL D;  3SU8 X;  5KHO A;  1GC6 A;  2R2Q A;  3A9K A;  2N1V A;  2XK5 A;  4MH0 E;  1MPE A;  1WE7 A;  3ZUN A;  3MC9 A;  1DOY A;  2KDE B;  2N9X A;  3N1Y C;  4OW0 A;  3QA8 A;  1DOX A;  2BYV E;  5G55 A;  3MJ5 A;  4MJS B;  2LMC A;  3PRE A;  4HWI B;  3EEC A;  2KVZ A;  5HHD G;  1F1H A;  4FN2 A;  2A4Z A;  4GU2 A;  4M0W A;  3MFG A;  1QOA A;  1UD7 A;  4JE3 B;  5CHV C;  3VDZ A;  2JWZ A;  5CHF A;  1FXT B;  2G1E A;  3ZVV A;  2I1K A;  2KFK B;  1SF0 A;  1E7U A;  2D10 A;  5D3D A;  2DHZ A;  3AM9 A;  3B08 A;  3TSS A;  1FRR A;  2DBY A;  2PW9 A;  2GOW A;  3GS2 A;  3E9S A;  3U30 A;  4PS3 A;  2K5P A;  2VZK D;  3WCQ A;  4JPS A;  4OVU A;  3WA0 A;  1IBX B;  3N32 A;  1G6J A;  3GE3 C;  3RI7 C;  3W1Y A;  3RT3 B;  2VH1 A;  1EU3 A;  1LQB A;  2IO1 B;  2PKO A;  5JHA A;  2IY1 B;  3Q3N C;  4DDG D;  2BQQ A;  2AL6 A;  1VD2 A;  2C7N B;  1FCL A;  3T3N A;  1VZ7 A;  3AEE B;  3VVW B;  4IM2 A;  2WXQ A;  3VTV A;  1IP9 A;  4EZL A;  1KH0 A;  2UU7 A;  1QQR A;  3NZ3 A;  1OGW A;  1IGD A;  1EWY C;  2QJL A;  3A9J B;  3ZNI D;  3B0A A;  1D5M C;  2L3Z A;  2CU3 A;  3NOB A;  2CKH B;  4MJS A;  1CJE A;  3TUO A;  4QAY A;  4ITK A;  3Q69 A;  4N58 A;  3Q3J A;  3VFK A;  3HHM A;  4WWM A;  2KOX A;  2WYQ A;  4ARC A;  4KKJ A;  3U4E G;  2J7Q B;  2BS3 B;  2LVP A;  3IAS 1;  3NVY A;  2D5G A;  2GLS A;  1ISN A;  2N9L A;  3PLV A;  2LHD A;  3UIO B;  1MVK A;  2J0K A;  4W9G A;  1D5X C;  1F9J A;  4BKS A;  2JYT A;  1OQY A;  5BMH A;  2ACZ B;  3R2T A;  1XXG A;  2RMM A;  1WXA A;  3ZNG C;  2IO0 B;  3W5U B;  2N9E B;  2AX5 A;  1V1P A;  2WHI A;  1IBX A;  1L4D B;  4G11 A;  2DAJ A;  2WNM A;  1XLN A;  2ZVN A;  3ECI A;  5JHB A;  2LRW A;  3GZN B;  2E3T A;  1VZ8 A;  1V5O A;  2NTS A;  2KX0 A;  3ZRC A;  1L0X B;  2N7E A;  1KOT A;  3ZDM C;  1PYW D;  4RGM A;  1XQQ A;  1V80 A;  1E6E B;  4AS1 A;  3LDZ E;  3HK0 A;  2FE8 A;  2HTH A;  4OZA A;  2L8J A;  1AN8 A;  1FFU A;  3L17 A;  2KJ6 A;  2MQJ A;  4E74 A;  2BYE A;  1UEL A;  3OG5 A;  3I5J C;  2JVC A;  1TS5 A;  1YOV B;  1WJ6 A;  4YXD B;  1TY0 A;  1HZ5 A;  3IG3 A;  4YT0 B;  2M56 B;  3I9V 1;  2WXN A;  4WAF A;  2M0A A;  4A8X C;  3ZNH B;  4L2Y A;  1S3S G;  1ZGU B;  3KH0 A;  1K50 A;  3FAH A;  2KTR B;  3RZF A;  3ZO5 B;  1B9R A;  4XWW A;  2RGF A;  3DOW A;  1V5T A;  2DZI A;  1V6E A;  2KHW B;  3AU5 A;  3E56 A;  1WIA A;  1FIQ A;  3QQ8 B;  4HDO A;  4BKT A;  3NVW A;  2QDF A;  1VJK A;  2IYD B;  3AEB B;  4EE2 A;  3QCA A;  1NEN B;  4M8M A;  2N9P C;  4WAA A;  1FXI A;  1QOG A;  4C4V B;  4LNF A;  3DCG A;  4TQ1 A;  4IM3 A;  2M19 A;  2W3R A;  3ZDT A;  1NDD A;  1C4A A;  1QOB A;  1AYF A;  4AP4 C;  2AYO B;  2REX A;  4MAC A;  3VAW A;  3FKY A;  1OQQ A;  5TSS A;  4BFR A;  4W9J A;  4ZRP A;  3W1S A;  3ZQ4 A;  2KO3 A;  3CSF A;  4P16 A;  1L0V B;  1P98 A;  5HI1 A;  3TEY A;  1XT9 B;  3UQB A;  2BS2 B;  1MHH E;  4HEA 1;  3W9C B;  1WGY A;  1WX8 A;  1OEY J;  2X8X X;  1I4Q A;  1UWX A;  1RYJ A;  3RYT A;  3PVL A;  1SE4 A;  3P4Q B;  4TQ0 A;  1Z5S B;  1ZP0 B;  1WGH A;  4YSX B;  1NEK B;  1KM7 A;  2MJ3 A;  1E0Z A;  1ENF A;  3APF A;  1OTR B;  1N6Z A;  3OJ4 B;  1WRD B;  3PLU A;  3UQA A;  2ZZP B;  1YX6 B;  1YN3 A;  4HVB A;  5TR5 A;  2D3G A;  3TEX A;  4N9F 4;  1SIF A;  2EMT A;  4WWN A;  1TZO A;  3L4P A;  1P7F A;  3A9K B;  2N7D A;  4FJV B;  2KAC A;  5IN7 A;  4ZRQ A;  2QEJ C;  1AAR A;  1B1Z A;  3VUW A;  1ZKH A;  1D5Z C;  2PJH A;  2GMI C;  1E8X A;  1QIL A;  1DOI A;  1UBQ A;  1CMX B;  1JWS D;  2IO2 B;  4WQO B;  3V05 A;  2KD0 A;  5IKC M;  1L6U A;  2K6D B;  1ROE A;  1C4C A;  3DVN U;  3DBS A;  3BVG A;  3AED B;  1N5W A;  4EKU A;  1Q5W B;  2NVU I;  2M8S A;  1GC7 A;  1RWS A;  1WRI A;  1D3Z A;  1TJE A;  3VH4 B;  1L5P A;  4FBJ B;  1T3Q A;  4NJC A;  4G0N B;  3VR9 B;  1SGH A;  2YEP F;  1TTN A;  4EOY A;  4YTN B;  2IGG A;  1MI0 A;  1NVI D;  2N7J A;  1LXD A;  2V0G A;  4WJN A;  2PVO D;  2PIA A;  4W9H A;  2BW2 A;  5FR3 A;  5L83 A;  3MHS D;  2QSD A;  2FIF A;  3GE8 C;  3QHT A;  4MDK E;  4NZL B;  5EE3 A;  4DK5 A;  2W3S A;  3NY5 A;  2Y5P A;  4TKN A;  2E6X A;  5GMV A;  4USA A;  5JZE B;  1EU4 A;  3PT2 B;  4BVU C;  4EUT A;  2K3U A;  2G4S A;  1QKZ A;  2HTM E;  2KYW A;  2KC2 A;  2WDT B;  4ZYS A;  2WXI A;  2WDR B;  5BYS A;  3UI3 A;  3ZJV A;  4NQK E;  2DLB A;  4MGI E;  2ZPY A;  1SJE D;  2GBM A;  4J3O D;  4OZC A;  2QC8 A;  1JWM D;  2JU6 X;  1WH3 A;  2FCS A;  3SDL C;  2KDI A;  4NJ6 A;  2N1W A;  2YEP B;  4MGZ E;  3PO0 A;  4G50 A;  3AEC B;  1C3T A;  1SEB D;  5EE1 A;  1V8C A;  2RPV A;  3RN9 C;  5I4D A;  4XE0 A;  2WXO A;  4EEW A;  1WYW B;  3V3X A;  2KJR A;  2N0S B;  4ANX A;  2K8B A;  1GUA B;  1FEH A;  2MBO A;  4II3 B;  1IPG A;  1C1Y B;  1YMH E;  1H4R A;  2DYM A;  2GBN A;  4GMV A;  1MFW A;  1A5R A;  1R4M B;  2RDB C;  4K81 A;  1VR9 A;  1WYG A;  3VR8 B;  1YNT E;  3M3J A;  4ARI A;  1HE8 A;  2KWV B;  4HK2 A;  1QLB B;  5E6J A;  2WU5 B;  4JIO U;  3QJZ A;  1J7C A;  4H2A A;  3MC8 A;  2KLG A;  4A90 A;  1I4R A;  3AEA B;  5DPW A;  1RFK A;  4B95 A;  2MRP A;  1T0R C;  2JF5 A;  2ZVO A;  2UWQ A;  3ENE A;  1WGK A;  2KZR A;  2RDG A;  3Q8F A;  1IYF A;  4B6W A;  4KZ0 A;  1AWD A;  1J7B A;  2INC C;  5D2M B;  3DWM A;  1UGM A;  1J8C A;  4GDL B;  4F7Z A;  1ZPS A;  2KDB A;  1S1Q B;  2K1F A;  2K39 A;  3KVF B;  2Z8L A;  4KVG B;  4ANU A;  4NPN A;  4TUU A;  4MEM A;  3A9J A;  1ZOY B;  2BB5 A;  1YJ1 A;  2M0X A;  4RGT A;  4B9K A;  4LNO A;  5DPT A;  2G9H D;  1SBB B;  2NMQ A;  1CQV A;  1WM3 A;  2BF8 B;  2KJH B;  5AUK A;  1PGB A;  1EF5 A;  4BZA A;  2L1A A;  2BPS A;  3W1S C;  2KDM A;  2IGD A;  4N59 A;  4K7S A;  4A3O A;  1SE9 A;  3PTF C;  5J17 A;  2CHW A;  2FCM A;  5L95 C;  5AZG A;  4P1B C;  1T0Y A;  4FLH A;  3JYU A;  1WSP A;  2DX5 B;  1TS2 A;  1NI2 A;  2MCN B;  2DAF A;  5C2T B;  3ZGZ A;  4OZB A;  1UH6 A;  1JML A;  3AE6 B;  3WAO A;  4ZHO A;  1P0R A;  3EGR A;  2IDY A;  3PZ8 A;  3QWZ B;  4IW0 A;  1L7Y A;  3BK1 A;  1WXS A;  2L83 A;  2BYT A;  4GDK A;  3PZ7 A;  4JQW C;  2B76 B;  2LJ5 A;  2O6V D;  2L52 A;  4LNK A;  2BS4 B;  3RNE C;  2VZK B;  2LGI A;  1FMA D;  4RCO A;  2I38 A;  3TCA A;  5C3J B;  1XF5 L;  3VUX A;  4YWG G; 
#chains in the Genus database with same CATH homology
 1NI3 A;  5H8Y E;  2OED A;  4GLS C;  4XDC A;  3SR6 A;  1XCQ L;  1BML C;  1TY0 A;  4B0M A;  1XCT L;  1ZXI A;  2DWQ A;  3MHZ A;  1HZ5 A;  4FXC A;  1ZUD 2;  3BII D;  4LLG M;  4YT0 B;  2M56 B;  2JYE A;  3I9V 1;  2WXN A;  4WAF A;  2M0A A;  4A8X C;  4L2Y A;  3W5V B;  2XNA C;  1JRO A;  1N5X A;  4RH6 A;  1K50 A;  1N60 A;  1YQ3 B;  3FAH A;  1IGC A;  3T3O A;  1C9F A;  2ZW0 A;  1TYG B;  1B9R A;  1EWC A;  4XWW A;  3AE2 B;  4KGS A;  1I4X A;  1NYR A;  2BB6 A;  3R2I A;  4ZOH C;  1A70 A;  2WXF A;  1KTK A;  3E56 A;  4HJG E;  1FIQ A;  3VQI A;  1SB3 C;  2J52 A;  3NVW A;  3LXF A;  2K0P A;  1OQR A;  1VJK A;  3MC0 B;  1K53 A;  1JAL A;  4NAW B;  3AEB B;  5HG2 A;  4EE2 A;  4MM3 B;  4JWU C;  1NEN B;  1V1P B;  2ZW1 A;  5JXV A;  1ET6 A;  1F2R C;  1UGJ A;  4RGN A;  3NVZ A;  4Q2J A;  4ZHP A;  2CJO A;  1FXI A;  1QOG A;  4D2K A;  1QF6 A;  1HEZ E;  2Q5W D;  2J42 A;  3MP9 A;  5MPO A;  4TQ1 A;  1I4G A;  3BVZ A;  2M19 A;  1TKE A;  2AQ3 B;  4L23 A;  2W3R A;  1P7E A;  1C4A A;  1QOB A;  2PTL A;  1AYF A;  2FBW B;  2WXG A;  2WXP A;  2N9K A;  4MAC A;  1OQQ A;  1L0Y B;  5TSS A;  2R61 A;  1YQ4 B;  3AE9 B;  3B9J A;  3Q8B A;  4A9A A;  3AH7 A;  2BT6 A;  2MEK A;  4ZRP A;  3W1S A;  3ZQ4 A;  3R8B A;  1MHX A;  3P42 A;  4P16 A;  1SE3 A;  1L0V B;  1UUP A;  2IPK D;  5HI1 A;  3TEY A;  1YN5 A;  4LTU A;  4RNA A;  3IT6 B;  2KN4 A;  1I4H A;  2MJD A;  2BS2 B;  1MHH E;  1VZ6 A;  3KWL A;  4HEA 1;  3AE8 B;  4IKG A;  1VDV A;  2KAJ A;  3W9C B;  4US8 A;  4RF0 A;  1BXT A;  1I4Q A;  1UWX A;  2K9X A;  3P1M A;  4YXD B;  1OFF A;  2WXM A;  1WXQ A;  3W2D A;  1C4P A;  4OVZ A;  1RYJ A;  3AE5 B;  3I57 A;  1FXA A;  3ZJU A;  3KWV A;  3ABV B;  2XN9 C;  1XO3 A;  1Y56 A;  3P4P B;  1YJI A;  1SE4 A;  1TKG A;  3B2G A;  1FM0 D;  3P4Q B;  3SEB A;  4TQ0 A;  3KLS X;  4US9 A;  2GB1 A;  1ZP0 B;  1VLB A;  3P4S B;  4YSX B;  1XLQ A;  3FIL A;  5AUI A;  3RFZ B;  1NEK B;  2MJ3 A;  1PGA A;  2V3N A;  1E0Z A;  1M4V A;  4C7Y A;  1GAQ B;  1ENF A;  5BYQ A;  4UDU C;  2Y5C A;  3LYY A;  2KMM A;  1AW7 A;  1VRA B;  1SIJ A;  2EKI A;  1FO4 A;  2JWU A;  1YN3 A;  5FK9 C;  4YSY B;  4DXF A;  3TEX A;  1RM6 C;  1F77 A;  2ON8 A;  1TZO A;  3SFD B;  2JX5 A;  3L4P A;  1P7F A;  2ICI A;  2X38 A;  1YJJ A;  3GB1 A;  2KAC A;  4ZRQ A;  2QEJ C;  4RF1 A;  4GDK B;  1TY2 A;  4RGO S;  1B1Z A;  1C78 A;  1HZ6 A;  3FIL B;  1C77 A;  4WQM A;  2KWD A;  1SE2 A;  3ZJT A;  1D5Z C;  2V3P A;  4AQ7 A;  2H89 B;  1F2R I;  1QIL A;  4P6V F;  1DOI A;  1GOZ A;  2PVG C;  3Q8A A;  1XLP A;  1TS4 A;  5FKA C;  1JWS D;  1SXT A;  3P63 A;  2K22 A;  4JWS C;  3V05 A;  2AQ1 B;  4A6Q A;  3TEZ A;  1L6U A;  1ROE A;  1HA5 A;  1C4C A;  2WXJ A;  3EUB 2;  1PUT A;  3NUH B;  1ZE3 D;  1FD6 A;  3DWG C;  3BVG A;  3P4R B;  1LO5 D;  3HRD D;  3LB8 C;  3AED B;  2LJI A;  1N5W A;  2INP E;  1T5X D;  2IGH A;  2MJE A;  5BMI A;  1RWS A;  1EM7 A;  1K52 A;  4MT5 A;  2INN E;  1GB4 A;  1WRI A;  2JQR B;  2W55 A;  3EA6 A;  3H8H A;  1TJE A;  1L5P A;  3AMZ A;  1T3Q A;  3BYY B;  2JXT A;  3HVZ A;  4DXG A;  4NJC A;  2V4I B;  3VR9 B;  1V97 A;  2WXR A;  2YEP F;  4YTP B;  3URY A;  2GI9 A;  2H88 B;  4C56 C;  1IUE A;  1J7A A;  4KKI A;  4C7Z A;  1CK1 A;  4HRS A;  4O1N A;  4YTN B;  2IGG A;  3RPF C;  1MI0 A;  4TSS A;  1NVI D;  3N9Y C;  2CJN A;  1PDX A;  2DYO A;  2N7J A;  2WS3 B;  3VRB B;  2V0G A;  1E7P B;  1ET9 A;  2PVO D;  2IJ0 A;  3HVD A;  4KGT A;  2QIE B;  2PIA A;  1F0Z A;  2PMV A;  1C79 A;  1XEE A;  4YSZ B;  2BW2 A;  3U52 E;  3ZYY X;  5FR3 A;  1YN4 A;  3CWI A;  2QSD A;  5BYR A;  1SSN A;  3BYT B;  3IAM 1;  4NZL B;  5EE3 A;  2QIL A;  1N62 A;  1GB1 A;  2SEB D;  2WXL A;  3O13 A;  1FFV A;  3U2S C;  3U7Z A;  2W3S A;  1KLG D;  2Y5P A;  1KFY B;  2WP9 B;  2E6X A;  4WUR A;  4USA A;  2W82 A;  4HKQ A;  3GP7 A;  4IOI E;  1EU4 A;  1QOF A;  2K3U A;  2LEK A;  5D3I B;  4IDI A;  1MPE A;  1QKZ A;  3AV8 A;  1KLU D;  2HTM E;  1ESF A;  4NAM A;  1DOY A;  4ZYS A;  3NVV A;  2WXI A;  3SFE B;  2WDR B;  1C76 A;  3KQ4 A;  4OW0 A;  3UI3 A;  3HUI A;  5BYS A;  2WXK A;  1HQR D;  4HRO A;  4WIP A;  5D7G A;  1DOX A;  3ZJV A;  3MJ5 A;  4WH4 A;  2DLB A;  2LMC A;  5G5H A;  2GRI A;  1SJE D;  3BK2 A;  5HHD G;  1XLO A;  2EEL A;  4J3O D;  4OZC A;  2TSS A;  2OHF A;  4M0W A;  4DQO C;  1JWM D;  2JU6 X;  3MFG A;  2WQY B;  1QOA A;  3FC4 A;  2YEP B;  4JE3 B;  1E9M A;  1WWT A;  3PO0 A;  3AEC B;  1SEB D;  5EE1 A;  1V8C A;  2RPV A;  2G1E A;  1E10 A;  3IT4 B;  1JWB D;  5I4D A;  1SF0 A;  4XE0 A;  1KF6 B;  2WXO A;  3NS1 A;  2QMT A;  1NYQ A;  4OHJ A;  3V3X A;  2BBC A;  5D3D A;  3AM9 A;  1R7S A;  2N0S B;  3TSS A;  1FRR A;  5LNK 1;  2DBY A;  2JZP A;  2I2Y A;  1T6B X;  2PW9 A;  3AEG B;  1FEH A;  3E9S A;  3GS2 A;  1JWU D;  2KQ4 X;  4XDD A;  2JSV X;  4LK0 M;  2K5P A;  2VZK D;  1KRH A;  1K51 A;  3WCQ A;  2FUG 1;  1YMH E;  4YTM B;  2HDE A;  4JPS A;  1IBX B;  2DYM A;  1JCK B;  3J9C A;  1DYQ A;  1VR9 A;  1WYG A;  4N6E B;  3VR8 B;  1YNT E;  1STE A;  1ZDV A;  1EU3 A;  1I4P A;  2PKO A;  4ARI A;  3AE7 B;  2NTT A;  3NRZ A;  4R3D A;  1QLB B;  5E6J A;  2WU5 B;  1V1O A;  1J7C A;  1JW9 D;  1FCL A;  2W54 A;  4H2A A;  3T3N A;  1VZ7 A;  2L32 A;  3AB5 A;  4A90 A;  3AEE B;  3VRA B;  1I4R A;  3AEA B;  4REZ A;  1JQ4 A;  2WLB A;  1RFK A;  1HXY D;  2AQ2 B;  1JRP A;  2WXQ A;  1ACC A;  1TS3 A;  5G5G A;  1KH0 A;  2ONQ A;  1QQR A;  3NZ3 A;  5T8I A;  2RDH A;  1IGD A;  1EWY C;  2QJL A;  5HFY A;  1WGK A;  1D5M C;  2RDG A;  3Q8F A;  2CU3 A;  4CQN A;  3TUO A;  1CJE A;  4ITK A;  1JWA D;  1N61 A;  3Q69 A;  4N58 A;  4TMA B;  3OWE B;  4WWM A;  1FRD A;  1AWD A;  1FCC C;  4ARC A;  1J7B A;  4KKJ A;  3U4E G;  3DWM A;  3BWU D;  4GDL B;  2BS3 B;  1ZPS A;  3IAS 1;  3NVY A;  1ZXH A;  2D5G A;  1UNS A;  3AE4 B;  1D4B A;  2N9L A;  2LHD A;  1MVK A;  1PFD A;  4A55 A;  2WDV B;  2LHE A;  1D5X C;  2Z8L A;  1N63 A;  5GXG B;  2JYT A;  4MH8 A;  4XWT A;  2LUM A;  4KGR A;  3TEW A;  1GPX A;  1ZOY B;  5BMH A;  2BB5 A;  4RGT A;  1UWM A;  1SJH D;  2ACZ B;  2Y3A A;  5H92 C;  1L6V A;  3R2T A;  2G9H D;  3Q8C A;  1SBB B;  1XXG A;  2RMM A;  3Q8E A;  4C80 A;  2LFI A;  2NMQ A;  1CQV A;  1TKY A;  3W5U B;  5AUK A;  1PGB A;  3B2F A;  2AX5 A;  4KX6 B;  3AE1 B;  1V1P A;  1IBX A;  3C8Y A;  1L4D B;  1FNW A;  2L1A A;  2WNM A;  1XLN A;  2KDM A;  2IGD A;  4N59 A;  4HKZ E;  1I7H A;  3AN1 A;  3BVM A;  2J53 A;  5EE9 A;  2E3T A;  4B0E A;  1L4Z B;  3IXS A;  4JX1 C;  1CZP A;  1VZ8 A;  2BTE A;  1D6E C;  3AEF B;  1WSP A;  1QT9 A;  1TS2 A;  1Q10 A;  2NTS A;  1ZDX A;  4RFB A;  5C2T B;  1DGJ A;  3ZGZ A;  4OZB A;  1L0X B;  1JML A;  1PGX A;  3ETR A;  1PYW D;  2WU2 B;  3AE6 B;  4RGM A;  4ZHO A;  3EGR A;  2IDY A;  3PZ8 A;  3BZD B;  5BMG A;  1FNU A;  1E6E B;  4AS1 A;  2SAK A;  3BK1 A;  2L83 A;  1FNV A;  2BYT A;  3AE3 B;  2FE8 A;  3PZ7 A;  4OZA A;  2J4X A;  2B76 B;  1AN8 A;  2WXH A;  5EE0 A;  1FFU A;  2L52 A;  2MH7 A;  1BUI C;  2BS4 B;  2WDQ B;  2VZK B;  4PT5 A;  2LGI A;  1FMA D;  2PLP A;  3CIR B;  4RCO A;  2I38 A;  1TS5 A;  5C3J B;  1XF5 L;  4L1B A;  4YWG G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...