1EM7A

Helix variant of the b1 domain from streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
TTYKLILNGKTLKGETTTEAVDAETAERVFKEYAKKNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein G helix variant suggests the importance of helix propensity and helix dipole interactions in protein design.
pubmed rcsb
source organism Streptococcus sp.
molecule tags Membrane protein
molecule keywords PROTEIN G
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1em7A00
1HEZE 4KGRA 5BMGA 1K51A 2KDMA 1XCQL 1IBXA 4GLSC 4IKGA 2IGDA 2J52A 2JU6X 1IGCA 2JXTA 2I2YA 4KGSA 1GB4A 2QSDA 2QMTA 2PLPA 1D4BA 1MPEA 5HG2A 2IGGA 2KWDA 3FILA 1MVKA 1UWXA 1MHHE 2LHDA 1F2RI 1PGXA 1HZ5A 2ZW0A 3FILB 1P7FA 2JSVX 2K0PA 1K50A 1IGDA 1MHXA 1FCLA 1ZXHA 2IGHA 2OEDA 5BMIA 5HFYA 2JZPA 2RPVA 3V3XA 4HKZE 4OZAA 4HJGE 5JXVA 2N9KA 3MP9A 1C9FA 2LUMA 1YNTE 2GB1A 1HZ6A 2PW9A 2KACA 1EM7A 2ON8A 1IBXB 2J53A 1QKZA 2PTLA 4WH4A 4MACA 1FCCC 1PGBA 2ONQA 2RMMA 4OZBA 4IOIE 3GB1A 5HHDG 5HI1A 2KQ4X 2N9LA 1PGAA 1Q10A 2GI9A 1XCTL 3UI3A 2KN4A 2I38A 1K53A 2EELA 2N7JA 1XF5L 1F2RC 1MI0A 1KH0A 2LHEA 2JWUA 4KGTA 1K52A 5BMHA 2LGIA 1P7EA 1FD6A 1YMHE 4D2KA 1JMLA 4OZCA 2ZW1A 2NMQA 1GB1A
chains in the Genus database with same CATH superfamily
4N58A 2M4NA 2WS3B 3SR6A 4FN2A 3FAHA 4RNAA 1J8CA 2AL6A 1BUIC 4LDTB 1YJJA 3PTFC 4JL9A 1XT9B 1UELA 3PS6A 4BOZB 4II2B 2KFJA 4MGYE 1JWBD 2FIDA 2RR9A 2MX2A 3A9JB 2CHZA 2WYQA 4DDID 1JRUA 1VD2A 3JW0X 4GDKB 4G11A 4ICVA 4BFRA 4PYZA 4HPMB 1FCLA 3LB8C 4XC2A 1TKEA 3IAM1 1R4NB 5IAAC 5FR6A 1YN4A 3AE3B 1SJHD 2KMAA 1DYQA 1YJIA 2LUMA 1QT9A 2J42A 4BBNF 1UGJA 1WJUA 4LNNA 2KT7A 4TSSA 1CZPA 4N9F4 3BVZA 2KWCA 4GU2A 1GJZA 4W9LA 1MG4A 3VDZA 1KLGD 4G0NB 3VHTC 3KWLA 2GI9A 1V2YA 1WFYA 2KYWA 3AE4B 2E3TA 4C7ZA 3P63A 3Q2AC 4LNKA 3ZKJC 1NDDA 3QCAA 4BKSA 4CHKA 4MH8A 1RWSA 3JSVA 4RF1A 1I4HA 1FFUA 3B9JA 2PIAA 2QCZA 4JWUC 5EE9A 3AM9A 3M63B 2OJWA 4HLEA 2ZW1A 4JLCA 5CX3A 1N5WA 4LNFA 5BMGA 2RDHA 3Q6BA 2WXHA 2LFIA 2B76B 1C4PA 1WGYA 1I7HA 2GOWA 3B0AA 1ZUD2 1TJEA 2DNFA 2GBNA 4ANXA 4WURA 4RCOA 3UINB 1FRDA 3AV8A 4L1BA 2DZIA 1V86A 4L2YA 1XLNA 2Q5WD 4IWQA 2FBWB 3QQ8B 3PVLA 2PVGC 3FILA 5H92C 2MBHA 1MHHE 2BYTA 3MHZA 3L0WB 5KHQA 1B1ZA 4HKQA 4DBGA 1JCKB 2MRPA 1Q1OA 3VRBB 4JQWC 3N9YC 2MCNB 1ZDVA 1E8WA 4FLHA 2VRRB 2SEBD 1Q0WB 1VRAB 4ZDVA 1KLUD 2N9PC 3U30A 1VZ6A 3APCA 4DHZB 1J7AA 2GMIC 1QOGA 4N59A 2Z0DB 3TMPB 1T6BX 3PLVA 1GOZA 2J4XA 1E9MA 4OHJA 2BVCA 1WXMA 1TKYA 1OTRB 2KX3A 2KFKB 2W54A 3DHHC 3EUB2 2R2QA 4GXBA 5D94A 2BYEA 2E6XA 1ACCA 3ZIMA 3IXSA 2C7MB 1L6UA 4DXFA 4XZ4A 2KTFA 4E3CA 3AE6B 4YXDB 4S0RA 1FXTB 1V49A 1VJKA 1WXQA 1OQRA 3EC8A 3C8YA 3PT2B 1RYJA 1VCBA 3O13A 1LO5D 1WXAA 2HD5B 3V62A 3ZRCA 2J52A 1P1AA 3DVNV 4JWSC 4BVUC 1HA5A 2WXLA 1T0YA 2BQQA 2WXQA 1FRRA 3Q3MC 3P4SB 2L83A 1D4BA 2KWDA 3A1QB 1UH6A 4TKNA 3KVFB 1SB3C 1WGKA 3WAMA 4P1CC 2K22A 1QOAA 3SU8X 1RAXA 4P7IA 1RFKA 2JRIB 2KVZA 2LJIA 2YLMA 2K0PA 3VVWB 2FIFA 2C9WB 4EE2A 2MWSB 4RGOS 3DCGA 5LXHA 4HJGE 2XK5B 3VUYA 4NZLB 2QEJC 1T0RC 3MP9A 4M0WA 2KTRA 3RFZB 4HRSA 4C56C 3OG5A 4ZRJA 3DBLI 3NS1A 4C7YA 1JWUD 2L00B 3B08A 3V60A 3BK1A 4W9GA 2JWZA 4EFOA 1WYGA 1TZOA 2LEKA 3NUHB 1FM0D 2H88B 1JW9D 2WU5B 3UF8A 4A55A 2PPHA 1E6EB 4TQ1A 4IC7B 4EZKA 1SIFA 2N9XA 2QC8A 4XWWA 1Q10A 3TSSA 4BOSC 2ZJDA 1TY0A 2XN9C 5BYRA 3Q8AA 1TT5B 3MC8A 4EEWA 2G4SA 3ZXRA 3DBHI 5H8YE 2RSUA 1N5XA 1KTKA 1V5OA 3DWMA 2DAJA 2WX1A 1SE2A 2JWUA 4HPPA 5J17A 4M01A 4FHKA 2L05A 1QQRA 1SIJA 4RGMA 1P9DU 4IWPA 2INDC 1UD7A 1JWAD 2NMQA 1MG8A 3PV1A 1NYRA 3I3TB 1SE3A 2A4ZA 5FKAC 1X1MA 2KJ6A 3K9OB 4IKGA 3CSTA 2IGDA 4AP4C 5D2MB 3PPAA 3DVGY 4I6LB 3NG0A 1PDXA 3AEFB 4F8CB 5CHFA 1L6VA 3ZDMC 4ZRIA 4DHZE 4W9IA 4EZLA 2N9EB 4AOFA 3ZUNA 3H7PA 4RH6A 3N1YC 1TS4A 1EUVB 4HXDA 2MSED 2G9HD 1P7FA 1YIWA 1ZOYB 3NS8A 1TBEA 4ZHOA 4JIOU 1MHXA 2ZCCA 5BMIA 5E6OA 4P6VF 1WRIA 1E8XA 3AB5A 1Q5WB 3QA8A 2BWFA 2V9HA 3BYTB 1UNSA 3RPFC 4FHJA 1C4AA 1WJ6A 2M0XA 2YEPB 3L54A 2KWUB 3IBEA 4NJ6A 4WAFA 3DHIC 5AUIA 5CHWA 3QHTA 4A3OA 3LXFA 4B6WA 1HTOA 3KH0A 3GB1A 2HTHA 3SFDB 2HJ8A 5E6JA 1WGDA 3HRDD 3ZNID 1YX5B 4JX1C 3I5JC 4K7SA 2IPKD 3ZLZA 2L32A 4R3DA 1TYGB 3V05A 1K53A 3BVGA 5DPWA 2EELA 2JYEA 4YWGG 2BGFA 1JWSD 4WQMA 4KX6B 2LVQA 3FC4A 1RRBA 1UUPA 4DHJD 4HJKA 1BMLC 3PZ8A 1YQBA 2R61A 1L2NA 2RDGA 3GE3C 1ZKHA 4OZCA 4AS1A 2NCNA 1OQYA 2Y3AA 3P4PB 1HEZE 2KDFB 3E9SA 2HTME 2KDMA 2NBWB 5JH5C 1ET6A 4ARIA 4ZHPA 5C1ZA 4KIKA 4L23A 3R2TA 4MJSA 3PZ7A 4EZJA 3M95A 4ACFA 4NQLB 4PYUA 1WJ4A 3TBLD 2MJ3A 3AMZA 2ZPNA 2CJNA 4J6IA 1WJNA 2ZPYA 4HCNB 2LRUA 3X23A 3W1YA 3SHQA 1WX7A 1VZ7A 3URYA 2NVUI 2A5UA 1K50A 2XBBC 4DXAB 3UQAA 1IGDA 1E0ZA 1E10A 2G4DB 1C4CA 2C5LC 2N9KA 4GGQA 3ZW3A 5IKCM 2LJ5A 4NNJB 2D3AA 2KACA 3AEBB 2J53A 2V3PA 3NRZA 1BXTA 2TSSA 2NTTA 5C23A 4E71A 1NYQA 3EFUA 3NZSA 5L83A 1OEYJ 3EGRA 2KLCA 3BWUD 3PRPB 3AU4A 1WX8A 1EWYC 3IFWB 1FMAD 2LZ6A 1Y8RC 2SAKA 4G50A 2KN4A 3VQIA 3EA6A 1I42A 4CO7A 2UWQA 3Q8CA 4RGTA 4WWNA 3K9PB 5D7GA 2IO1B 4WWOA 1C78A 4XGAB 3T3OA 3PHXB 1UGMA 1LM8B 2DHZA 4G3XB 4P1BC 4XYCA 3AH7A 4KKIA 4PT5A 3QIJA 2WXOA 4EOYA 4KSKC 5LXIB 4EUTA 4GIVA 1G6JA 2JXXA 2MBQA 4P16A 1WE7A 4RM9A 3VTVA 1NI2A 2KTRB 2M17A 3OJ3A 5D3IB 3VTUA 3ZJTA 2MBOA 3SFEB 4M02A 1IUEA 3NZUA 2LXAA 3T9LA 4DHJB 1JRPA 3SDLC 5DCNA 5C3JB 3T8MA 4KGSA 3IHPC 4US9A 1YOVB 1ZPSA 1C77A 5HG2A 5EDSA 3A9KB 4PS8A 3VUXA 1J19A 1U4AA 2LHDA 5BO4B 2KO3A 1E7VA 3V6CB 2ZEQA 3APDA 2LRWA 3PSEB 3U7ZA 2JZPA 3RZFA 1V80A 1GUAB 3HVZA 4ZRPA 1FNWA 4ARCA 4HCPB 4WJNA 4M0WB 4II3B 4MACA 2AQ2B 1FCCC 5I4DA 3TEYA 3U8ZA 2CU3A 2MH7A 4URKA 3Q3FA 5HHDG 3MJWA 4USAA 1FFVA 2KDIA 4DWFA 4HDQA 1T0SC 3FKYA 4C4VB 2EKEC 4RM8A 1STEA 2RPQA 3SD5A 2IY0B 2D07B 5EE1A 3BY4B 2PE9A 2L3ZA 2QDFA 3P42A 2LGDA 5AUKA 2B3AA 4IM2A 1KRHA 1SGHA 1WH3A 3LDZE 4LNOA 4MGZE 1WX9A 1S1QB 4KV2A 1Z2MA 2WXIA 1WSPA 3N30A 3QAQA 3H7PB 1JROA 2FUG1 4OVVA 5J2RA 3AULA 5CHVC 4IUMB 4IM0A 2C7HA 2MP2B 2PLPA 1MPEA 2WXJA 2IGGA 2D11A 2WXFA 4HWIB 3D32A 2KJHB 2ICIA 4X57B 3OLMD 1WMHB 3GZNI 5EE0A 2NR2A 3PRMB 1KFYB 4WJOA 2IGHA 2OEDA 4GDLB 3V3XA 3I9V1 4M8MA 2JZ3B 4OVUA 3HVDA 3RNCC 1YJ1A 4LDTD 4BAXA 4W9EA 3DOWA 2D10A 3ZQ4A 5GXGB 2IO2B 3Q3OC 4TUUA 2ONQA 4IW0A 4AJWA 4MT5A 1WY8A 1OQQA 2KQ4X 4ZRQA 2XEWA 4B0MA 3IG3A 1JQ4A 2BW2A 3Q8BA 1FPYA 3VAWA 3PLUA 2DZJA 2QIEB 3DVGX 3ZTDA 2FCSA 2LI5A 2MHJA 4NPNA 3DBRI 3R7RA 3T3NA 1WGRA 4JGHB 1E90A 5LLIA 2I1JA 4W9CA 1ENFA 1L4DB 3OJ4B 2K25A 1GB1A 2ZCBA 1K51A 1EO6A 1FNVA 1XCQL 3VFKA 2AQ3B 2KK8A 1F52A 3DBSA 4ANVA 2PKOA 2KNBA 2KXJA 2JVCA 1SXTA 1GB4A 2UU7A 4W9KA 3KYDD 4FXCA 2IYDB 4ANUA 1SE4A 3ZO5B 1SE9A 1WR6E 1WF9A 3A9JA 2CR5A 3RUIB 3FILB 5DPTA 4FADA 2INPE 3RT3B 1TZ1A 2CHWA 1V9JA 5HFYA 2JF5A 4HKZE 4HROA 2WX0A 2VH2A 3Q8EA 4HK2A 2GB1A 2L8JA 4YT0B 2R2OA 2ON8A 1J7CA 4JPSA 1I4RA 1N6ZA 4NAWA 3C0RB 1ZDXA 3N1ZC 3QJZA 2ASQA 1JWMD 1L4ZB 2PVOD 4N6EB 3MFGA 2N9LA 1V5TA 3IT4B 2FUHB 3ZJVA 2KWVB 3A4RA 2N1VA 1JALA 2RD0A 5FR3A 3UI3A 1WWTA 2QJLA 2FCMA 1V97A 2NTSA 2KDEB 2Z0EB 3KUDB 2N7JA 3O65B 2Y5PA 1DOXA 2EKIA 2V4IB 4A90A 3RCZA 2K8CA 3TIXA 4IM3A 4HEA1 5MPOA 4F1SA 1GG3A 1TTNA 1YMHE 2DZMA 4A6QA 5DPRA 4LLGM 2BB6A 3B2GA 2JX5A 2K5PA 3VH4B 1C1YB 3NVWA 1KM7A 3GZNB 4ZYSA 1IBXA 1IPGA 2WXNA 2CKHB 1XO3A 4CYEA 2L1AA 3ABVB 2V0GA 2ACZB 4MM3B 2L0FA 4RFBA 2I2YA 2BKRB 2QMTA 3Q3NC 1KF6B 1WRDB 2FAZA 2LASA 4MEMA 3BIID 2KN5A 2BYFA 3PRZA 1F2RI 1ZXIA 2L7RA 4TV3A 3E56A 3U2SC 1TS3A 2DLBA 2GBMA 1Z5SB 4K81A 1UF0A 1LGRA 5JXVA 2K8HA 3ZJUA 4KIKB 3UIPB 1CMXB 2JRHA 3RNEC 3R8BA 1QKZA 2K9XA 2PTLA 2FCQA 1AARA 3DVNU 1F9JA 1QF6A 1L5PA 3W5VB 3MC0B 4MH0E 4W9JA 2WDRB 3RNAC 3WCQA 1I4QA 2PMVA 2JZZA 2KKCA 2WDQB 1CJEA 3R3MA 1OFFA 3DWGC 1RM6C 4YSXB 2KMMA 3HK0A 4C4VA 2G3QB 1KH0A 1P98A 2KD0A 3L4PA 2LGIA 3L10B 2MJDA 2D5GA 1GC7A 1E8ZA 1E5WA 2XNAC 2LGYA 1FXIA 2C7NB 2AWTA 2WHIA 2ZNVC 2FNJB 2LGSA 3CF6E 3MTNB 3N20C 5KHOA 3B2FA 4E74A 1NBFC 2BPSA 1M4VA 1I35A 5BYQA 1V1PB 1VZ8A 4WQOB 1NI3A 4W9FA 3GE8C 1ZW7A 4ZYNA 3NVYA 3PO0A 4MJSB 3CIRB 2DWQA 4HVBA 1ZGUB 5AZGA 2KDBA 1MVKA 3RN9C 3W2DA 2H89B 5IA7A 2V4LA 2M19A 2JQRB 1CQVA 3AE9B 4WAAA 2QILA 2K1FA 3QARA 1R7SA 2RPVA 2HE7A 1Y56A 2CU1A 2BT6A 3AU5A 1FXAA 2MQJA 1NVID 3VXWA 3H1UA 3TEZA 1QOBA 1WGHA 3EHVA 4WWMA 1T5XD 4UDUC 2IY1B 2WDVB 1E8YA 4NJCA 3ZYYX 2XK5A 2K8BA 4BKTA 3DBHB 5HKHA 3DBRB 4KDLB 1YN5A 5HI1A 1XLQA 4FJZA 2M8SA 3A33B 3EFCA 3NVVA 1WI0A 1WMHA 1IYFA 2LWPA 1BT0A 3APFA 1LQBA 2MJEA 1XF5L 1VLBA 3HM3A 5G55A 2I1KA 1WXSA 1L0XB 3J9CA 2LHEA 4MDKE 4C80A 3B1LX 4K3CA 2W9NA 3WALA 4B95A 1AWDA 3NHEB 2DYMA 2JUOA 1D3ZA 5D6JB 3WAOA 1WIAA 1XQQA 3VH3B 1PQSA 1VDVA 4RF0A 2M1MA 2L76A 3TJPA 4AWJA 1IGCA 5BYSA 5G2NA 1XLPA 2CJOA 2BS3B 4BKGA 3PREA 1H4RA 1ESFA 1F0ZA 3V61A 4B0EA 4DDGD 4XDDA 2FCNA 2UYZB 3AI5A 3Q14C 4MSMB 1HTQA 1UBIA 1AW7A 4GDLA 1TS2A 5J18A 2WP9B 3OAWA 3DHGC 3R7QA 1CK1A 3TL5A 2MBEA 4FJYA 1C9FA 2DBYA 1YNTE 2G45B 1F77A 2AX5A 1HZ6A 2PW9A 2J0KA 3HUIA 3IAS1 4KKJA 4I6PA 1OGWA 1WM2A 4LTUA 3AE8B 3ML8A 3VRAB 5TR5A 1T0QC 2IJ0A 2K6DB 4BKSD 1GC6A 4H2AA 3JSVB 1YX6B 3P1MA 1E7UA 1QILA 1D6EC 3ECIA 2W55A 2KX0A 3M62B 3RZWC 3P4RB 1MI0A 4MSQB 3CMMB 4XWTA 3NOBA 1K52A 5BMHA 4PS7A 3HIZA 3PGEA 3TUOA 3M3JA 4EKUA 1D5XC 3ONSA 4WJPA 3RNBC 1V1OA 2LXCA 1MJDA 3P2BA 3L17A 4NAMA 3RD2A 1XLOA 4BBNC 1A5RA 2O6VD 4GLSC 4YSYB 1UWMA 4IDIA 1QOFA 2BS4B 3NVZA 3IT6B 2CS4A 4ANWA 1WM3A 2N1WA 2X38A 4IWOA 1XXGA 2AL3A 3WIMA 2N7EA 3VR8B 1WR1A 2JXTA 2NBVB 1TGZB 2QSDA 3W1SA 1D5ZC 2W3SA 5D3DA 3RNGC 2Y5CA 1YQ3B 3QK0A 4QAYA 4GSWA 2REXA 4WIPA 1YQ4B 2N0SB 5IO9A 4IG7B 4LNIA 3W5UB 1ZXHA 4TMAB 2WXMA 4JE3B 4C00A 3VR9B 2GRIA 3MHSD 1L0YB 4GN1A 3H8HA 3ALBA 3UQBA 3C19A 3AEGB 4K3BA 2PE6B 1D5MC 3RYTA 2BBCA 3AEDB 3RMKC 3HM6X 1WZ0A 2BF8B 2DX5B 2INCC 2RMMA 2DYBA 4FULA 2VZKB 1S3SG 2O2VB 2JT4B 2YEPF 2GBRA 2WNMA 2INNE 2CHXA 3I57A 1V8CA 2WXPA 2BS2B 4XX5A 1UZXB 4M8NA 2Z59B 2JYTA 4W9HA 2KAJA 4M00A 3KUZA 1E7PB 4PS3A 3HHMA 4XDCA 2W82A 4AJYB 4K7WA 1LXDA 2LUEA 4KZ0A 1K8RB 3ML9A 2RGFA 3LYYA 2LD9A 4S17A 1EU3A 2OJRA 1DGJA 4K7UA 2C60A 4HDOA 1HXYD 2GBKA 3QC8B 3DPDA 3ZNHB 3TEXA 2KMCA 3UGBB 4GDKA 4LJOB 1HZ5A 3N3KB 2ZNVB 4K1RB 5AEKB 2MP2A 3JVZX 1I4XA 1MFWA 3NZ3A 4CQNA 3Q69A 1IP9A 3RNFC 2WU2B 1SF0A 3MJ5A 5EE3A 4BZAA 5IN7A 1XD3B 5TSSA 5IOIA 4A9AA 3I63C 4W9DA 3NJTA 1AN8A 1FIQA 2LVOA 2M56B 4US8A 3ZGZA 1N62A 4OZBA 2IO0B 2NS5A 1I4GA 2NPTA 2D3GA 2W3RA 4MGIE 2MW5A 3Q3JA 3TCAA 3VUWA 4YSZB 2GLSA 1H8CA 2MBBB 1FEHA 5L95C 1C76A 2I38A 3BVMA 1ROEA 1SEBD 2DAFA 2IZVB 1M94A 2KC2A 4OVZA 4RGNA 3GS2A 3LJ3A 4KGTA 2L52A 2KQ7A 2QHOA 4KVGB 2DZKA 1TKGA 3U4EG 2KVRA 4DK5A 2L0TA 4AUQC 1P3QU 2OHFA 1R4NI 1EF5A 2M0AA 1EF1A 5AZFA 1J7BA 1I4PA 1YD8U 2KFKA 4F7ZA 5JHBA 5E6PA 3SEBA 1QZEA 4I6NB 2AQ1B 5JZEB 4MGKE 2EMTA 4MM3A 2NPTB 1WYWB 4ICUA 2WXGA 4NAWB 5G5GA 1RLFA 1R4MB 1UWXA 4KSLC 2N7DA 1KJTA 3BINA 3A9KA 3ETRA 4PK1A 1L7YA 3BZDB 4TQ0A 3ZNZB 2KHWB 3RULA 1LFDA 2N4FA 4MELA 1B9RA 2ZVOA 3R2IA 1TS5A 3W1SC 3H9DA 3R66C 4WH4A 2O6VA 1VR9A 3UIOB 1ISNA 3ZTCA 2EMSA 2PJHA 2RDBC 2Y5BB 5CTRC 4IOIE 2IO3B 3A4SC 2HDEA 1PUTA 2PEAA 4DXGA 1KLVA 1V1PA 2VH1A 2K6QA 2ZVNA 1NENB 3W9CB 3WANA 1OEYA 3A1QA 4YTNB 2LGXA 3ZVVA 1XEEA 2J7QB 2D3CA 2GBJA 3GOEA 5E6NA 2WXKA 3AEAB 2JPHA 3ZRFA 1A70A 2BB5A 3S2AA 1ZP0B 3NY5A 4NY0A 4FA6A 2LMCA 2O6VB 4DQOC 2WQYB 1QLBB 4KGRA 2LVPA 2J0MA 3KLSX 2JY6A 4OW0A 1R4MI 4NJ7A 3U52E 2OOBB 1DOIA 3V6EB 2MLBA 1YN3A 1FNUA 5LNK1 3TEWA 1SBBB 1J0GA 4LJPB 1ET9A 2G1EA 2FE8A 3BK2A 2NBUA 4GOCA 3WA0A 3P4QB 2ZW0A 2JSVX 1WGGA 2HJ1A 4FBJB 2KZRA 3JYUA 2KANA 4OZAA 5JHAA 5FK9C 2KJRA 1N60A 1EU4A 2ZZPB 4YTPB 1SSNA 2V3SA 3KYCD 3AEEB 3ZXVA 3DDCB 1EM7A 1N61A 2BWES 3OWEB 1AYFA 1IBXB 3AN1A 2D2QA 1TIFA 4GB9A 2WGSA 2YVCA 2KLGA 3N1XC 4WJQA 1C3TA 3EECA 1GPXA 2IDYA 4LK0M 3VTWA 1N63A 1C79A 3U7DA 4YL8A 2Z8LA 3ZDTA 2WWZA 3H6NA 3ENEA 4B9KA 2X8XX 3KW5B 2IBIB 4REZA 4KZCA 4YTMB 3QX1A 2D3BA 1V6EA 4J3OD 3IVFA 1FD6A 4ASWC 2BKFA 1KOTA 3DBLB 2KOXA 2V3NA 2DENB 3AE2B 1T3QA 4A20A 3X0WA 4LCDE 1NEKB 1EWCA 2V1YA 1TY2A 2K3UA 4Q2JA 1HE8A 5GMVA 1SJED 3H7SA 1RFAA 2K39A 4GMVA 2JU6X 4ITKA 3WAPA 2O2VA 2DYOA 1GAQB 2VZKD 4NQKE 2KQSA 4A8XC 3AECB 4FJVB 1V81A 1PGXA 1FO4A 1HQRD 3PZDA 4ZOHC 2BTEA 4ZRKA 1GNUA 4RMAA 3KQ4A 3AE7B 4A3PA 1PYWD 5IP4D 3CSFA 1WE6A 1PFDA 3AE1B 3GP7A 5AZHA 5DPSA 4KDIC 1PGBA 5T8IA 5C2TB 4HPLB 4WWPA 4XE0A 2WLBA 3AXCA 1UBQA 3KWVA 4O1NA 1L0VB 2WXRA 1PGAA 2MEKA 3ZNGC 1XCTL 2AEHA 3MC9A 2MA9B 2WDTB 1DOYA 1F1HA 2KC1A 1F2RC 5G5HA 3DQVA 1P0RA 3BYYB 3PHWB 2AYOB 2BYVE 3L08A 3QWZB 3CWIA 3Q8FA 1P7EA 3L13A 4AQ7A 3RI7C 1ZE3D 4D2KA 1WXVA 3N32A 2J0JA 1JMLA 3AE5B 3L16A 1WZ3A 3KUCB
chains in the Genus database with same CATH topology
3P4PB 1HEZE 4N58A 3E9SA 3NVWA 2HTME 2KDMA 4ZYSA 1IBXA 2WS3B 3SR6A 3FAHA 4RNAA 3LYYA 1BUIC 2WXNA 1ET6A 1EU3A 4ARIA 1XO3A 1YJJA 4ZHPA 2L1AA 3ABVB 1DGJA 4L23A 2V0GA 3R2TA 3PZ7A 2ACZB 4MM3B 4RFBA 1HXYD 2I2YA 1JWBD 2QMTA 2MJ3A 3AMZA 1KF6B 3TEXA 2CJNA 3BIID 1F2RI 4GDKB 1ZXIA 1HZ5A 1VZ7A 4A90A 3URYA 1K50A 1IGDA 3E56A 3LB8C 1E0ZA 1FCLA 3U2SC 1TS3A 2DLBA 1E10A 1TKEA 1I4XA 3IAM1 3NZ3A 4CQNA 3Q69A 1YN4A 1C4CA 3AE3B 5JXVA 2N9KA 1SJHD 3ZJUA 1DYQA 1YJIA 2LUMA 2WU2B 1SF0A 3MJ5A 1QT9A 5EE3A 2J42A 1UGJA 2KACA 5TSSA 3AEBB 4TSSA 1CZPA 2J53A 3R8BA 3BVZA 4A9AA 1QKZA 2K9XA 2PTLA 2V3PA 1AN8A 3NRZA 1BXTA 1FIQA 2NTTA 2TSSA 2M56B 4US8A 1NYQA 1QF6A 3ZGZA 1L5PA 1N62A 3W5VB 3EGRA 4OZBA 3BWUD 1I4GA 3MC0B 2WDRB 1KLGD 1I4QA 2PMVA 3WCQA 2W3RA 2WDQB 1EWYC 4YSZB 3KWLA 1FMAD 2SAKA 1FEHA 2GI9A 1CJEA 3AE4B 1C76A 2KN4A 2E3TA 1OFFA 2I38A 3DWGC 1RM6C 3BVMA 3EA6A 3VQIA 4C7ZA 3P63A 3Q8CA 4YSXB 4RGTA 1ROEA 1SEBD 2KMMA 4OVZA 4RGNA 5D7GA 1KH0A 4MH8A 1RWSA 3GS2A 1C78A 4RF1A 1I4HA 4KGTA 3T3OA 1FFUA 3B9JA 2PIAA 2L52A 3L4PA 2LGIA 3AH7A 2MJDA 4JWUC 4KKIA 4PT5A 2D5GA 2WXOA 1TKGA 5EE9A 3AM9A 2XNAC 3U4EG 1FXIA 2ZW1A 2OHFA 1N5WA 2M0AA 5BMGA 1J7BA 2RDHA 1I4PA 3B2FA 4P16A 2WXHA 1M4VA 2LFIA 5D3IB 3ZJTA 2B76B 1C4PA 3SEBA 5BYQA 1V1PB 1VZ8A 1I7HA 3SFEB 1IUEA 1ZUD2 1TJEA 2AQ1B 4WURA 4RCOA 1JRPA 1NI3A 1FRDA 3AV8A 4L1BA 5C3JB 4KGSA 3B2GA 3NVYA 4L2YA 3PO0A 4US9A 1XLNA 4NAWB 2Q5WD 2WXGA 3CIRB 2DWQA 1ZPSA 1C77A 5G5GA 5HG2A 2FBWB 2PVGC 3FILA 1MVKA 1UWXA 5H92C 3W2DA 1MHHE 2H89B 2LHDA 2BYTA 2M19A 3MHZA 2JQRB 1CQVA 3AE9B 2QILA 1B1ZA 3ETRA 4HKQA 3BZDB 4TQ0A 1JCKB 3U7ZA 3VRBB 1R7SA 2JZPA 2RPVA 3N9YC 1Y56A 1ZDVA 2BT6A 1FXAA 1NVID 2SEBD 3HVZA 3TEZA 1VRAB 1QOBA 1KLUD 4ZRPA 4WWMA 1B9RA 1T5XD 1FNWA 3R2IA 1TS5A 4UDUC 4ARCA 1VZ6A 2WDVB 1J7AA 4WH4A 4MACA 1VR9A 1FCCC 2AQ2B 4NJCA 1QOGA 3ZYYX 5I4DA 4N59A 3TEYA 2CU3A 4IOIE 2MH7A 1T6BX 2HDEA 1GOZA 2J4XA 1E9MA 1PUTA 4OHJA 5HHDG 1YN5A 5HI1A 4DXGA 1XLQA 4USAA 1FFVA 1V1PA 3NVVA 1TKYA 1NENB 3W9CB 2W54A 3EUB2 4YTNB 1XEEA 1STEA 2E6XA 2MJEA 1ACCA 1XF5L 1VLBA 2WXKA 5EE1A 3AEAB 3IXSA 1L0XB 3J9CA 2LHEA 4C80A 3P42A 1A70A 1L6UA 5AUKA 2BB5A 4DXFA 1ZP0B 1AWDA 3AE6B 4YXDB 1VJKA 1WXQA 2LMCA 1OQRA 1KRHA 3C8YA 4DQOC 2WQYB 1QLBB 1RYJA 2DYMA 4KGRA 2WXIA 3O13A 3KLSX 1VDVA 1LO5D 4RF0A 1WSPA 4OW0A 2J52A 3U52E 1JROA 2FUG1 4JWSC 1DOIA 1HA5A 1YN3A 1IGCA 1FNUA 2WXLA 5LNK1 5BYSA 2WXQA 1XLPA 2CJOA 1FRRA 3TEWA 1SBBB 2BS3B 3P4SB 2L83A 2PLPA 1D4BA 1MPEA 1ESFA 2WXJA 2IGGA 1F0ZA 1ET9A 2KWDA 2G1EA 2WXFA 4B0EA 2FE8A 3BK2A 1SB3C 1WGKA 2ICIA 4XDDA 2K22A 1QOAA 3P4QB 1RFKA 2ZW0A 5EE0A 2JSVX 1AW7A 2LJIA 2K0PA 1TS2A 1KFYB 2WP9B 4EE2A 2IGHA 2OEDA 4GDLB 3V3XA 4RGOS 4OZAA 1CK1A 3I9V1 4HJGE 5FK9C 1N60A 1EU4A 4NZLB 2QEJC 3MP9A 3HVDA 1SSNA 4YTPB 4M0WA 3RFZB 2DBYA 1C9FA 3AEEB 1YNTE 4HRSA 1F77A 4C56C 2AX5A 1HZ6A 2PW9A 3NS1A 3HUIA 1EM7A 1N61A 3IAS1 3OWEB 1AYFA 3ZQ4A 4C7YA 5GXGB 3AN1A 1IBXB 4KKJA 1JWUD 4LTUA 3BK1A 2ONQA 3AE8B 3VRAB 1WYGA 1TZOA 2LEKA 2IJ0A 3NUHB 1FM0D 2H88B 2IDYA 1JW9D 4MT5A 1GPXA 4LK0M 2WU5B 4A55A 1N63A 1OQQA 1C79A 2KQ4X 4H2AA 4ZRQA 1E6EB 4TQ1A 3P1MA 4B0MA 4XWWA 1JQ4A 2BW2A 3Q8BA 1QILA 1Q10A 3TSSA 1D6EC 2Z8LA 1TY0A 2XN9C 2W55A 5BYRA 3Q8AA 2QIEB 3P4RB 1DOXA 1MI0A 5H8YE 1N5XA 1KTKA 3DWMA 4REZA 4XWTA 1SE2A 2JWUA 1K52A 4YTMB 3T3NA 5BMHA 4J3OD 3TUOA 1FD6A 1QQRA 1SIJA 1ENFA 4RGMA 1L4DB 1D5XC 1V1OA 2V3NA 1JWAD 2NMQA 3AE2B 1T3QA 1GB1A 1NYRA 1NEKB 1EWCA 1K51A 1TY2A 1FNVA 1SE3A 1XCQL 2AQ3B 2K3UA 4NAMA 4Q2JA 5FKAC 1XLOA 1SJED 4GLSC 4IKGA 4YSYB 1UWMA 4IDIA 1QOFA 2BS4B 2IGDA 3NVZA 2PKOA 3IT6B 2JU6X 4ITKA 2X38A 1XXGA 2DYOA 1GAQB 3VR8B 1PDXA 1SXTA 2JXTA 3AEFB 1L6VA 1GB4A 2VZKD 2QSDA 3W1SA 4FXCA 1D5ZC 4A8XC 2W3SA 3AECB 4RH6A 1TS4A 5D3DA 2Y5CA 1SE4A 1YQ3B 1PGXA 1FO4A 4WIPA 1YQ4B 2G9HD 2N0SB 1P7FA 3FILB 1ZOYB 4ZHOA 1HQRD 4ZOHC 3W5UB 2BTEA 1MHXA 2INPE 1ZXHA 4TMAB 5BMIA 2WXMA 4JE3B 5HFYA 3VR9B 4HKZE 4HROA 2GRIA 1WRIA 4P6VF 1L0YB 3KQ4A 3AE7B 3AB5A 3H8HA 1PYWD 3Q8EA 2GB1A 3AEGB 1D5MC 4YT0B 1PFDA 1UNSA 3AE1B 3BYTB 2ON8A 3GP7A 1C4AA 2BBCA 1J7CA 3RPFC 4JPSA 1I4RA 2YEPB 3AEDB 4WAFA 1PGBA 5AUIA 2RMMA 5T8IA 1ZDXA 3LXFA 5C2TB 4XE0A 2VZKB 2WLBA 1JWMD 1L4ZB 2PVOD 3KWVA 3MFGA 3GB1A 4N6EB 4O1NA 1L0VB 2N9LA 3SFDB 3IT4B 3ZJVA 5E6JA 2WXRA 3HRDD 1PGAA 2MEKA 1JALA 4JX1C 2YEPF 1XCTL 5FR3A 3UI3A 2WNMA 2IPKD 2L32A 1WWTA 2INNE 1TYGB 2QJLA 4R3DA 1K53A 3BVGA 1V97A 2NTSA 3I57A 3V05A 2EELA 2JYEA 2N7JA 1DOYA 1F2RC 2Y5PA 2EKIA 2V4IB 1JWSD 1V8CA 2WXPA 4YWGG 5G5HA 3BYYB 2BS2B 4WQMA 4KX6B 3FC4A 1UUPA 4HEA1 2JYTA 3CWIA 2KAJA 1P7EA 3Q8FA 5MPOA 1BMLC 1E7PB 4AQ7A 1YMHE 3PZ8A 2R61A 1ZE3D 4A6QA 4D2KA 2RDGA 1JMLA 4LLGM 3AE5B 2BB6A 4OZCA 4XDCA 2W82A 4AS1A 2JX5A 2Y3AA 2K5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEZ E;  4KGR A;  5BMG A;  1K51 A;  2KDM A;  1XCQ L;  1IBX A;  4GLS C;  4IKG A;  2IGD A;  2J52 A;  2JU6 X;  1IGC A;  2JXT A;  2I2Y A;  4KGS A;  1GB4 A;  2QSD A;  2QMT A;  2PLP A;  1D4B A;  1MPE A;  5HG2 A;  2IGG A;  2KWD A;  3FIL A;  1MVK A;  1UWX A;  1MHH E;  2LHD A;  1F2R I;  1PGX A;  1HZ5 A;  2ZW0 A;  3FIL B;  1P7F A;  2JSV X;  2K0P A;  1K50 A;  1IGD A;  1MHX A;  1FCL A;  1ZXH A;  2IGH A;  2OED A;  5BMI A;  5HFY A;  2JZP A;  2RPV A;  3V3X A;  4HKZ E;  4OZA A;  4HJG E;  5JXV A;  2N9K A;  3MP9 A;  1C9F A;  2LUM A;  1YNT E;  2GB1 A;  1HZ6 A;  2PW9 A;  2KAC A;  1EM7 A;  2ON8 A;  1IBX B;  2J53 A;  1QKZ A;  2PTL A;  4WH4 A;  4MAC A;  1FCC C;  1PGB A;  2ONQ A;  2RMM A;  4OZB A;  4IOI E;  3GB1 A;  5HHD G;  5HI1 A;  2KQ4 X;  2N9L A;  1PGA A;  1Q10 A;  2GI9 A;  1XCT L;  3UI3 A;  2KN4 A;  2I38 A;  1K53 A;  2EEL A;  2N7J A;  1XF5 L;  1F2R C;  1MI0 A;  1KH0 A;  2LHE A;  2JWU A;  4KGT A;  1K52 A;  5BMH A;  2LGI A;  1P7E A;  1FD6 A;  1YMH E;  4D2K A;  1JML A;  4OZC A;  2ZW1 A;  2NMQ A;  1GB1 A; 
#chains in the Genus database with same CATH topology
 4N58 A;  2M4N A;  2WS3 B;  3SR6 A;  4FN2 A;  3FAH A;  4RNA A;  1J8C A;  2AL6 A;  1BUI C;  4LDT B;  1YJJ A;  3PTF C;  4JL9 A;  1XT9 B;  1UEL A;  3PS6 A;  4BOZ B;  4II2 B;  2KFJ A;  4MGY E;  1JWB D;  2FID A;  2RR9 A;  2MX2 A;  3A9J B;  2CHZ A;  2WYQ A;  4DDI D;  1JRU A;  1VD2 A;  3JW0 X;  4GDK B;  4G11 A;  4ICV A;  4BFR A;  4PYZ A;  4HPM B;  1FCL A;  3LB8 C;  4XC2 A;  1TKE A;  3IAM 1;  1R4N B;  5IAA C;  5FR6 A;  1YN4 A;  3AE3 B;  1SJH D;  2KMA A;  1DYQ A;  1YJI A;  2LUM A;  1QT9 A;  2J42 A;  4BBN F;  1UGJ A;  1WJU A;  4LNN A;  2KT7 A;  4TSS A;  1CZP A;  4N9F 4;  3BVZ A;  2KWC A;  4GU2 A;  1GJZ A;  4W9L A;  1MG4 A;  3VDZ A;  1KLG D;  4G0N B;  3VHT C;  3KWL A;  2GI9 A;  1V2Y A;  1WFY A;  2KYW A;  3AE4 B;  2E3T A;  4C7Z A;  3P63 A;  3Q2A C;  4LNK A;  3ZKJ C;  1NDD A;  3QCA A;  4BKS A;  4CHK A;  4MH8 A;  1RWS A;  3JSV A;  4RF1 A;  1I4H A;  1FFU A;  3B9J A;  2PIA A;  2QCZ A;  4JWU C;  5EE9 A;  3AM9 A;  3M63 B;  2OJW A;  4HLE A;  2ZW1 A;  4JLC A;  5CX3 A;  1N5W A;  4LNF A;  5BMG A;  2RDH A;  3Q6B A;  2WXH A;  2LFI A;  2B76 B;  1C4P A;  1WGY A;  1I7H A;  2GOW A;  3B0A A;  1ZUD 2;  1TJE A;  2DNF A;  2GBN A;  4ANX A;  4WUR A;  4RCO A;  3UIN B;  1FRD A;  3AV8 A;  4L1B A;  2DZI A;  1V86 A;  4L2Y A;  1XLN A;  2Q5W D;  4IWQ A;  2FBW B;  3QQ8 B;  3PVL A;  2PVG C;  3FIL A;  5H92 C;  2MBH A;  1MHH E;  2BYT A;  3MHZ A;  3L0W B;  5KHQ A;  1B1Z A;  4HKQ A;  4DBG A;  1JCK B;  2MRP A;  1Q1O A;  3VRB B;  4JQW C;  3N9Y C;  2MCN B;  1ZDV A;  1E8W A;  4FLH A;  2VRR B;  2SEB D;  1Q0W B;  1VRA B;  4ZDV A;  1KLU D;  2N9P C;  3U30 A;  1VZ6 A;  3APC A;  4DHZ B;  1J7A A;  2GMI C;  1QOG A;  4N59 A;  2Z0D B;  3TMP B;  1T6B X;  3PLV A;  1GOZ A;  2J4X A;  1E9M A;  4OHJ A;  2BVC A;  1WXM A;  1TKY A;  1OTR B;  2KX3 A;  2KFK B;  2W54 A;  3DHH C;  3EUB 2;  2R2Q A;  4GXB A;  5D94 A;  2BYE A;  2E6X A;  1ACC A;  3ZIM A;  3IXS A;  2C7M B;  1L6U A;  4DXF A;  4XZ4 A;  2KTF A;  4E3C A;  3AE6 B;  4YXD B;  4S0R A;  1FXT B;  1V49 A;  1VJK A;  1WXQ A;  1OQR A;  3EC8 A;  3C8Y A;  3PT2 B;  1RYJ A;  1VCB A;  3O13 A;  1LO5 D;  1WXA A;  2HD5 B;  3V62 A;  3ZRC A;  2J52 A;  1P1A A;  3DVN V;  4JWS C;  4BVU C;  1HA5 A;  2WXL A;  1T0Y A;  2BQQ A;  2WXQ A;  1FRR A;  3Q3M C;  3P4S B;  2L83 A;  1D4B A;  2KWD A;  3A1Q B;  1UH6 A;  4TKN A;  3KVF B;  1SB3 C;  1WGK A;  3WAM A;  4P1C C;  2K22 A;  1QOA A;  3SU8 X;  1RAX A;  4P7I A;  1RFK A;  2JRI B;  2KVZ A;  2LJI A;  2YLM A;  2K0P A;  3VVW B;  2FIF A;  2C9W B;  4EE2 A;  2MWS B;  4RGO S;  3DCG A;  5LXH A;  4HJG E;  2XK5 B;  3VUY A;  4NZL B;  2QEJ C;  1T0R C;  3MP9 A;  4M0W A;  2KTR A;  3RFZ B;  4HRS A;  4C56 C;  3OG5 A;  4ZRJ A;  3DBL I;  3NS1 A;  4C7Y A;  1JWU D;  2L00 B;  3B08 A;  3V60 A;  3BK1 A;  4W9G A;  2JWZ A;  4EFO A;  1WYG A;  1TZO A;  2LEK A;  3NUH B;  1FM0 D;  2H88 B;  1JW9 D;  2WU5 B;  3UF8 A;  4A55 A;  2PPH A;  1E6E B;  4TQ1 A;  4IC7 B;  4EZK A;  1SIF A;  2N9X A;  2QC8 A;  4XWW A;  1Q10 A;  3TSS A;  4BOS C;  2ZJD A;  1TY0 A;  2XN9 C;  5BYR A;  3Q8A A;  1TT5 B;  3MC8 A;  4EEW A;  2G4S A;  3ZXR A;  3DBH I;  5H8Y E;  2RSU A;  1N5X A;  1KTK A;  1V5O A;  3DWM A;  2DAJ A;  2WX1 A;  1SE2 A;  2JWU A;  4HPP A;  5J17 A;  4M01 A;  4FHK A;  2L05 A;  1QQR A;  1SIJ A;  4RGM A;  1P9D U;  4IWP A;  2IND C;  1UD7 A;  1JWA D;  2NMQ A;  1MG8 A;  3PV1 A;  1NYR A;  3I3T B;  1SE3 A;  2A4Z A;  5FKA C;  1X1M A;  2KJ6 A;  3K9O B;  4IKG A;  3CST A;  2IGD A;  4AP4 C;  5D2M B;  3PPA A;  3DVG Y;  4I6L B;  3NG0 A;  1PDX A;  3AEF B;  4F8C B;  5CHF A;  1L6V A;  3ZDM C;  4ZRI A;  4DHZ E;  4W9I A;  4EZL A;  2N9E B;  4AOF A;  3ZUN A;  3H7P A;  4RH6 A;  3N1Y C;  1TS4 A;  1EUV B;  4HXD A;  2MSE D;  2G9H D;  1P7F A;  1YIW A;  1ZOY B;  3NS8 A;  1TBE A;  4ZHO A;  4JIO U;  1MHX A;  2ZCC A;  5BMI A;  5E6O A;  4P6V F;  1WRI A;  1E8X A;  3AB5 A;  1Q5W B;  3QA8 A;  2BWF A;  2V9H A;  3BYT B;  1UNS A;  3RPF C;  4FHJ A;  1C4A A;  1WJ6 A;  2M0X A;  2YEP B;  3L54 A;  2KWU B;  3IBE A;  4NJ6 A;  4WAF A;  3DHI C;  5AUI A;  5CHW A;  3QHT A;  4A3O A;  3LXF A;  4B6W A;  1HTO A;  3KH0 A;  3GB1 A;  2HTH A;  3SFD B;  2HJ8 A;  5E6J A;  1WGD A;  3HRD D;  3ZNI D;  1YX5 B;  4JX1 C;  3I5J C;  4K7S A;  2IPK D;  3ZLZ A;  2L32 A;  4R3D A;  1TYG B;  3V05 A;  1K53 A;  3BVG A;  5DPW A;  2EEL A;  2JYE A;  4YWG G;  2BGF A;  1JWS D;  4WQM A;  4KX6 B;  2LVQ A;  3FC4 A;  1RRB A;  1UUP A;  4DHJ D;  4HJK A;  1BML C;  3PZ8 A;  1YQB A;  2R61 A;  1L2N A;  2RDG A;  3GE3 C;  1ZKH A;  4OZC A;  4AS1 A;  2NCN A;  1OQY A;  2Y3A A;  3P4P B;  1HEZ E;  2KDF B;  3E9S A;  2HTM E;  2KDM A;  2NBW B;  5JH5 C;  1ET6 A;  4ARI A;  4ZHP A;  5C1Z A;  4KIK A;  4L23 A;  3R2T A;  4MJS A;  3PZ7 A;  4EZJ A;  3M95 A;  4ACF A;  4NQL B;  4PYU A;  1WJ4 A;  3TBL D;  2MJ3 A;  3AMZ A;  2ZPN A;  2CJN A;  4J6I A;  1WJN A;  2ZPY A;  4HCN B;  2LRU A;  3X23 A;  3W1Y A;  3SHQ A;  1WX7 A;  1VZ7 A;  3URY A;  2NVU I;  2A5U A;  1K50 A;  2XBB C;  4DXA B;  3UQA A;  1IGD A;  1E0Z A;  1E10 A;  2G4D B;  1C4C A;  2C5L C;  2N9K A;  4GGQ A;  3ZW3 A;  5IKC M;  2LJ5 A;  4NNJ B;  2D3A A;  2KAC A;  3AEB B;  2J53 A;  2V3P A;  3NRZ A;  1BXT A;  2TSS A;  2NTT A;  5C23 A;  4E71 A;  1NYQ A;  3EFU A;  3NZS A;  5L83 A;  1OEY J;  3EGR A;  2KLC A;  3BWU D;  3PRP B;  3AU4 A;  1WX8 A;  1EWY C;  3IFW B;  1FMA D;  2LZ6 A;  1Y8R C;  2SAK A;  4G50 A;  2KN4 A;  3VQI A;  3EA6 A;  1I42 A;  4CO7 A;  2UWQ A;  3Q8C A;  4RGT A;  4WWN A;  3K9P B;  5D7G A;  2IO1 B;  4WWO A;  1C78 A;  4XGA B;  3T3O A;  3PHX B;  1UGM A;  1LM8 B;  2DHZ A;  4G3X B;  4P1B C;  4XYC A;  3AH7 A;  4KKI A;  4PT5 A;  3QIJ A;  2WXO A;  4EOY A;  4KSK C;  5LXI B;  4EUT A;  4GIV A;  1G6J A;  2JXX A;  2MBQ A;  4P16 A;  1WE7 A;  4RM9 A;  3VTV A;  1NI2 A;  2KTR B;  2M17 A;  3OJ3 A;  5D3I B;  3VTU A;  3ZJT A;  2MBO A;  3SFE B;  4M02 A;  1IUE A;  3NZU A;  2LXA A;  3T9L A;  4DHJ B;  1JRP A;  3SDL C;  5DCN A;  5C3J B;  3T8M A;  4KGS A;  3IHP C;  4US9 A;  1YOV B;  1ZPS A;  1C77 A;  5HG2 A;  5EDS A;  3A9K B;  4PS8 A;  3VUX A;  1J19 A;  1U4A A;  2LHD A;  5BO4 B;  2KO3 A;  1E7V A;  3V6C B;  2ZEQ A;  3APD A;  2LRW A;  3PSE B;  3U7Z A;  2JZP A;  3RZF A;  1V80 A;  1GUA B;  3HVZ A;  4ZRP A;  1FNW A;  4ARC A;  4HCP B;  4WJN A;  4M0W B;  4II3 B;  4MAC A;  2AQ2 B;  1FCC C;  5I4D A;  3TEY A;  3U8Z A;  2CU3 A;  2MH7 A;  4URK A;  3Q3F A;  5HHD G;  3MJW A;  4USA A;  1FFV A;  2KDI A;  4DWF A;  4HDQ A;  1T0S C;  3FKY A;  4C4V B;  2EKE C;  4RM8 A;  1STE A;  2RPQ A;  3SD5 A;  2IY0 B;  2D07 B;  5EE1 A;  3BY4 B;  2PE9 A;  2L3Z A;  2QDF A;  3P42 A;  2LGD A;  5AUK A;  2B3A A;  4IM2 A;  1KRH A;  1SGH A;  1WH3 A;  3LDZ E;  4LNO A;  4MGZ E;  1WX9 A;  1S1Q B;  4KV2 A;  1Z2M A;  2WXI A;  1WSP A;  3N30 A;  3QAQ A;  3H7P B;  1JRO A;  2FUG 1;  4OVV A;  5J2R A;  3AUL A;  5CHV C;  4IUM B;  4IM0 A;  2C7H A;  2MP2 B;  2PLP A;  1MPE A;  2WXJ A;  2IGG A;  2D11 A;  2WXF A;  4HWI B;  3D32 A;  2KJH B;  2ICI A;  4X57 B;  3OLM D;  1WMH B;  3GZN I;  5EE0 A;  2NR2 A;  3PRM B;  1KFY B;  4WJO A;  2IGH A;  2OED A;  4GDL B;  3V3X A;  3I9V 1;  4M8M A;  2JZ3 B;  4OVU A;  3HVD A;  3RNC C;  1YJ1 A;  4LDT D;  4BAX A;  4W9E A;  3DOW A;  2D10 A;  3ZQ4 A;  5GXG B;  2IO2 B;  3Q3O C;  4TUU A;  2ONQ A;  4IW0 A;  4AJW A;  4MT5 A;  1WY8 A;  1OQQ A;  2KQ4 X;  4ZRQ A;  2XEW A;  4B0M A;  3IG3 A;  1JQ4 A;  2BW2 A;  3Q8B A;  1FPY A;  3VAW A;  3PLU A;  2DZJ A;  2QIE B;  3DVG X;  3ZTD A;  2FCS A;  2LI5 A;  2MHJ A;  4NPN A;  3DBR I;  3R7R A;  3T3N A;  1WGR A;  4JGH B;  1E90 A;  5LLI A;  2I1J A;  4W9C A;  1ENF A;  1L4D B;  3OJ4 B;  2K25 A;  1GB1 A;  2ZCB A;  1K51 A;  1EO6 A;  1FNV A;  1XCQ L;  3VFK A;  2AQ3 B;  2KK8 A;  1F52 A;  3DBS A;  4ANV A;  2PKO A;  2KNB A;  2KXJ A;  2JVC A;  1SXT A;  1GB4 A;  2UU7 A;  4W9K A;  3KYD D;  4FXC A;  2IYD B;  4ANU A;  1SE4 A;  3ZO5 B;  1SE9 A;  1WR6 E;  1WF9 A;  3A9J A;  2CR5 A;  3RUI B;  3FIL B;  5DPT A;  4FAD A;  2INP E;  3RT3 B;  1TZ1 A;  2CHW A;  1V9J A;  5HFY A;  2JF5 A;  4HKZ E;  4HRO A;  2WX0 A;  2VH2 A;  3Q8E A;  4HK2 A;  2GB1 A;  2L8J A;  4YT0 B;  2R2O A;  2ON8 A;  1J7C A;  4JPS A;  1I4R A;  1N6Z A;  4NAW A;  3C0R B;  1ZDX A;  3N1Z C;  3QJZ A;  2ASQ A;  1JWM D;  1L4Z B;  2PVO D;  4N6E B;  3MFG A;  2N9L A;  1V5T A;  3IT4 B;  2FUH B;  3ZJV A;  2KWV B;  3A4R A;  2N1V A;  1JAL A;  2RD0 A;  5FR3 A;  3UI3 A;  1WWT A;  2QJL A;  2FCM A;  1V97 A;  2NTS A;  2KDE B;  2Z0E B;  3KUD B;  2N7J A;  3O65 B;  2Y5P A;  1DOX A;  2EKI A;  2V4I B;  4A90 A;  3RCZ A;  2K8C A;  3TIX A;  4IM3 A;  4HEA 1;  5MPO A;  4F1S A;  1GG3 A;  1TTN A;  1YMH E;  2DZM A;  4A6Q A;  5DPR A;  4LLG M;  2BB6 A;  3B2G A;  2JX5 A;  2K5P A;  3VH4 B;  1C1Y B;  3NVW A;  1KM7 A;  3GZN B;  4ZYS A;  1IBX A;  1IPG A;  2WXN A;  2CKH B;  1XO3 A;  4CYE A;  2L1A A;  3ABV B;  2V0G A;  2ACZ B;  4MM3 B;  2L0F A;  4RFB A;  2I2Y A;  2BKR B;  2QMT A;  3Q3N C;  1KF6 B;  1WRD B;  2FAZ A;  2LAS A;  4MEM A;  3BII D;  2KN5 A;  2BYF A;  3PRZ A;  1F2R I;  1ZXI A;  2L7R A;  4TV3 A;  3E56 A;  3U2S C;  1TS3 A;  2DLB A;  2GBM A;  1Z5S B;  4K81 A;  1UF0 A;  1LGR A;  5JXV A;  2K8H A;  3ZJU A;  4KIK B;  3UIP B;  1CMX B;  2JRH A;  3RNE C;  3R8B A;  1QKZ A;  2K9X A;  2PTL A;  2FCQ A;  1AAR A;  3DVN U;  1F9J A;  1QF6 A;  1L5P A;  3W5V B;  3MC0 B;  4MH0 E;  4W9J A;  2WDR B;  3RNA C;  3WCQ A;  1I4Q A;  2PMV A;  2JZZ A;  2KKC A;  2WDQ B;  1CJE A;  3R3M A;  1OFF A;  3DWG C;  1RM6 C;  4YSX B;  2KMM A;  3HK0 A;  4C4V A;  2G3Q B;  1KH0 A;  1P98 A;  2KD0 A;  3L4P A;  2LGI A;  3L10 B;  2MJD A;  2D5G A;  1GC7 A;  1E8Z A;  1E5W A;  2XNA C;  2LGY A;  1FXI A;  2C7N B;  2AWT A;  2WHI A;  2ZNV C;  2FNJ B;  2LGS A;  3CF6 E;  3MTN B;  3N20 C;  5KHO A;  3B2F A;  4E74 A;  1NBF C;  2BPS A;  1M4V A;  1I35 A;  5BYQ A;  1V1P B;  1VZ8 A;  4WQO B;  1NI3 A;  4W9F A;  3GE8 C;  1ZW7 A;  4ZYN A;  3NVY A;  3PO0 A;  4MJS B;  3CIR B;  2DWQ A;  4HVB A;  1ZGU B;  5AZG A;  2KDB A;  1MVK A;  3RN9 C;  3W2D A;  2H89 B;  5IA7 A;  2V4L A;  2M19 A;  2JQR B;  1CQV A;  3AE9 B;  4WAA A;  2QIL A;  2K1F A;  3QAR A;  1R7S A;  2RPV A;  2HE7 A;  1Y56 A;  2CU1 A;  2BT6 A;  3AU5 A;  1FXA A;  2MQJ A;  1NVI D;  3VXW A;  3H1U A;  3TEZ A;  1QOB A;  1WGH A;  3EHV A;  4WWM A;  1T5X D;  4UDU C;  2IY1 B;  2WDV B;  1E8Y A;  4NJC A;  3ZYY X;  2XK5 A;  2K8B A;  4BKT A;  3DBH B;  5HKH A;  3DBR B;  4KDL B;  1YN5 A;  5HI1 A;  1XLQ A;  4FJZ A;  2M8S A;  3A33 B;  3EFC A;  3NVV A;  1WI0 A;  1WMH A;  1IYF A;  2LWP A;  1BT0 A;  3APF A;  1LQB A;  2MJE A;  1XF5 L;  1VLB A;  3HM3 A;  5G55 A;  2I1K A;  1WXS A;  1L0X B;  3J9C A;  2LHE A;  4MDK E;  4C80 A;  3B1L X;  4K3C A;  2W9N A;  3WAL A;  4B95 A;  1AWD A;  3NHE B;  2DYM A;  2JUO A;  1D3Z A;  5D6J B;  3WAO A;  1WIA A;  1XQQ A;  3VH3 B;  1PQS A;  1VDV A;  4RF0 A;  2M1M A;  2L76 A;  3TJP A;  4AWJ A;  1IGC A;  5BYS A;  5G2N A;  1XLP A;  2CJO A;  2BS3 B;  4BKG A;  3PRE A;  1H4R A;  1ESF A;  1F0Z A;  3V61 A;  4B0E A;  4DDG D;  4XDD A;  2FCN A;  2UYZ B;  3AI5 A;  3Q14 C;  4MSM B;  1HTQ A;  1UBI A;  1AW7 A;  4GDL A;  1TS2 A;  5J18 A;  2WP9 B;  3OAW A;  3DHG C;  3R7Q A;  1CK1 A;  3TL5 A;  2MBE A;  4FJY A;  1C9F A;  2DBY A;  1YNT E;  2G45 B;  1F77 A;  2AX5 A;  1HZ6 A;  2PW9 A;  2J0K A;  3HUI A;  3IAS 1;  4KKJ A;  4I6P A;  1OGW A;  1WM2 A;  4LTU A;  3AE8 B;  3ML8 A;  3VRA B;  5TR5 A;  1T0Q C;  2IJ0 A;  2K6D B;  4BKS D;  1GC6 A;  4H2A A;  3JSV B;  1YX6 B;  3P1M A;  1E7U A;  1QIL A;  1D6E C;  3ECI A;  2W55 A;  2KX0 A;  3M62 B;  3RZW C;  3P4R B;  1MI0 A;  4MSQ B;  3CMM B;  4XWT A;  3NOB A;  1K52 A;  5BMH A;  4PS7 A;  3HIZ A;  3PGE A;  3TUO A;  3M3J A;  4EKU A;  1D5X C;  3ONS A;  4WJP A;  3RNB C;  1V1O A;  2LXC A;  1MJD A;  3P2B A;  3L17 A;  4NAM A;  3RD2 A;  1XLO A;  4BBN C;  1A5R A;  2O6V D;  4GLS C;  4YSY B;  1UWM A;  4IDI A;  1QOF A;  2BS4 B;  3NVZ A;  3IT6 B;  2CS4 A;  4ANW A;  1WM3 A;  2N1W A;  2X38 A;  4IWO A;  1XXG A;  2AL3 A;  3WIM A;  2N7E A;  3VR8 B;  1WR1 A;  2JXT A;  2NBV B;  1TGZ B;  2QSD A;  3W1S A;  1D5Z C;  2W3S A;  5D3D A;  3RNG C;  2Y5C A;  1YQ3 B;  3QK0 A;  4QAY A;  4GSW A;  2REX A;  4WIP A;  1YQ4 B;  2N0S B;  5IO9 A;  4IG7 B;  4LNI A;  3W5U B;  1ZXH A;  4TMA B;  2WXM A;  4JE3 B;  4C00 A;  3VR9 B;  2GRI A;  3MHS D;  1L0Y B;  4GN1 A;  3H8H A;  3ALB A;  3UQB A;  3C19 A;  3AEG B;  4K3B A;  2PE6 B;  1D5M C;  3RYT A;  2BBC A;  3AED B;  3RMK C;  3HM6 X;  1WZ0 A;  2BF8 B;  2DX5 B;  2INC C;  2RMM A;  2DYB A;  4FUL A;  2VZK B;  1S3S G;  2O2V B;  2JT4 B;  2YEP F;  2GBR A;  2WNM A;  2INN E;  2CHX A;  3I57 A;  1V8C A;  2WXP A;  2BS2 B;  4XX5 A;  1UZX B;  4M8N A;  2Z59 B;  2JYT A;  4W9H A;  2KAJ A;  4M00 A;  3KUZ A;  1E7P B;  4PS3 A;  3HHM A;  4XDC A;  2W82 A;  4AJY B;  4K7W A;  1LXD A;  2LUE A;  4KZ0 A;  1K8R B;  3ML9 A;  2RGF A;  3LYY A;  2LD9 A;  4S17 A;  1EU3 A;  2OJR A;  1DGJ A;  4K7U A;  2C60 A;  4HDO A;  1HXY D;  2GBK A;  3QC8 B;  3DPD A;  3ZNH B;  3TEX A;  2KMC A;  3UGB B;  4GDK A;  4LJO B;  1HZ5 A;  3N3K B;  2ZNV B;  4K1R B;  5AEK B;  2MP2 A;  3JVZ X;  1I4X A;  1MFW A;  3NZ3 A;  4CQN A;  3Q69 A;  1IP9 A;  3RNF C;  2WU2 B;  1SF0 A;  3MJ5 A;  5EE3 A;  4BZA A;  5IN7 A;  1XD3 B;  5TSS A;  5IOI A;  4A9A A;  3I63 C;  4W9D A;  3NJT A;  1AN8 A;  1FIQ A;  2LVO A;  2M56 B;  4US8 A;  3ZGZ A;  1N62 A;  4OZB A;  2IO0 B;  2NS5 A;  1I4G A;  2NPT A;  2D3G A;  2W3R A;  4MGI E;  2MW5 A;  3Q3J A;  3TCA A;  3VUW A;  4YSZ B;  2GLS A;  1H8C A;  2MBB B;  1FEH A;  5L95 C;  1C76 A;  2I38 A;  3BVM A;  1ROE A;  1SEB D;  2DAF A;  2IZV B;  1M94 A;  2KC2 A;  4OVZ A;  4RGN A;  3GS2 A;  3LJ3 A;  4KGT A;  2L52 A;  2KQ7 A;  2QHO A;  4KVG B;  2DZK A;  1TKG A;  3U4E G;  2KVR A;  4DK5 A;  2L0T A;  4AUQ C;  1P3Q U;  2OHF A;  1R4N I;  1EF5 A;  2M0A A;  1EF1 A;  5AZF A;  1J7B A;  1I4P A;  1YD8 U;  2KFK A;  4F7Z A;  5JHB A;  5E6P A;  3SEB A;  1QZE A;  4I6N B;  2AQ1 B;  5JZE B;  4MGK E;  2EMT A;  4MM3 A;  2NPT B;  1WYW B;  4ICU A;  2WXG A;  4NAW B;  5G5G A;  1RLF A;  1R4M B;  1UWX A;  4KSL C;  2N7D A;  1KJT A;  3BIN A;  3A9K A;  3ETR A;  4PK1 A;  1L7Y A;  3BZD B;  4TQ0 A;  3ZNZ B;  2KHW B;  3RUL A;  1LFD A;  2N4F A;  4MEL A;  1B9R A;  2ZVO A;  3R2I A;  1TS5 A;  3W1S C;  3H9D A;  3R66 C;  4WH4 A;  2O6V A;  1VR9 A;  3UIO B;  1ISN A;  3ZTC A;  2EMS A;  2PJH A;  2RDB C;  2Y5B B;  5CTR C;  4IOI E;  2IO3 B;  3A4S C;  2HDE A;  1PUT A;  2PEA A;  4DXG A;  1KLV A;  1V1P A;  2VH1 A;  2K6Q A;  2ZVN A;  1NEN B;  3W9C B;  3WAN A;  1OEY A;  3A1Q A;  4YTN B;  2LGX A;  3ZVV A;  1XEE A;  2J7Q B;  2D3C A;  2GBJ A;  3GOE A;  5E6N A;  2WXK A;  3AEA B;  2JPH A;  3ZRF A;  1A70 A;  2BB5 A;  3S2A A;  1ZP0 B;  3NY5 A;  4NY0 A;  4FA6 A;  2LMC A;  2O6V B;  4DQO C;  2WQY B;  1QLB B;  4KGR A;  2LVP A;  2J0M A;  3KLS X;  2JY6 A;  4OW0 A;  1R4M I;  4NJ7 A;  3U52 E;  2OOB B;  1DOI A;  3V6E B;  2MLB A;  1YN3 A;  1FNU A;  5LNK 1;  3TEW A;  1SBB B;  1J0G A;  4LJP B;  1ET9 A;  2G1E A;  2FE8 A;  3BK2 A;  2NBU A;  4GOC A;  3WA0 A;  3P4Q B;  2ZW0 A;  2JSV X;  1WGG A;  2HJ1 A;  4FBJ B;  2KZR A;  3JYU A;  2KAN A;  4OZA A;  5JHA A;  5FK9 C;  2KJR A;  1N60 A;  1EU4 A;  2ZZP B;  4YTP B;  1SSN A;  2V3S A;  3KYC D;  3AEE B;  3ZXV A;  3DDC B;  1EM7 A;  1N61 A;  2BWE S;  3OWE B;  1AYF A;  1IBX B;  3AN1 A;  2D2Q A;  1TIF A;  4GB9 A;  2WGS A;  2YVC A;  2KLG A;  3N1X C;  4WJQ A;  1C3T A;  3EEC A;  1GPX A;  2IDY A;  4LK0 M;  3VTW A;  1N63 A;  1C79 A;  3U7D A;  4YL8 A;  2Z8L A;  3ZDT A;  2WWZ A;  3H6N A;  3ENE A;  4B9K A;  2X8X X;  3KW5 B;  2IBI B;  4REZ A;  4KZC A;  4YTM B;  3QX1 A;  2D3B A;  1V6E A;  4J3O D;  3IVF A;  1FD6 A;  4ASW C;  2BKF A;  1KOT A;  3DBL B;  2KOX A;  2V3N A;  2DEN B;  3AE2 B;  1T3Q A;  4A20 A;  3X0W A;  4LCD E;  1NEK B;  1EWC A;  2V1Y A;  1TY2 A;  2K3U A;  4Q2J A;  1HE8 A;  5GMV A;  1SJE D;  3H7S A;  1RFA A;  2K39 A;  4GMV A;  2JU6 X;  4ITK A;  3WAP A;  2O2V A;  2DYO A;  1GAQ B;  2VZK D;  4NQK E;  2KQS A;  4A8X C;  3AEC B;  4FJV B;  1V81 A;  1PGX A;  1FO4 A;  1HQR D;  3PZD A;  4ZOH C;  2BTE A;  4ZRK A;  1GNU A;  4RMA A;  3KQ4 A;  3AE7 B;  4A3P A;  1PYW D;  5IP4 D;  3CSF A;  1WE6 A;  1PFD A;  3AE1 B;  3GP7 A;  5AZH A;  5DPS A;  4KDI C;  1PGB A;  5T8I A;  5C2T B;  4HPL B;  4WWP A;  4XE0 A;  2WLB A;  3AXC A;  1UBQ A;  3KWV A;  4O1N A;  1L0V B;  2WXR A;  1PGA A;  2MEK A;  3ZNG C;  1XCT L;  2AEH A;  3MC9 A;  2MA9 B;  2WDT B;  1DOY A;  1F1H A;  2KC1 A;  1F2R C;  5G5H A;  3DQV A;  1P0R A;  3BYY B;  3PHW B;  2AYO B;  2BYV E;  3L08 A;  3QWZ B;  3CWI A;  3Q8F A;  1P7E A;  3L13 A;  4AQ7 A;  3RI7 C;  1ZE3 D;  4D2K A;  1WXV A;  3N32 A;  2J0J A;  1JML A;  3AE5 B;  3L16 A;  1WZ3 A;  3KUC B; 
#chains in the Genus database with same CATH homology
 3P4P B;  1HEZ E;  4N58 A;  3E9S A;  3NVW A;  2HTM E;  2KDM A;  4ZYS A;  1IBX A;  2WS3 B;  3SR6 A;  3FAH A;  4RNA A;  3LYY A;  1BUI C;  2WXN A;  1ET6 A;  1EU3 A;  4ARI A;  1XO3 A;  1YJJ A;  4ZHP A;  2L1A A;  3ABV B;  1DGJ A;  4L23 A;  2V0G A;  3R2T A;  3PZ7 A;  2ACZ B;  4MM3 B;  4RFB A;  1HXY D;  2I2Y A;  1JWB D;  2QMT A;  2MJ3 A;  3AMZ A;  1KF6 B;  3TEX A;  2CJN A;  3BII D;  1F2R I;  4GDK B;  1ZXI A;  1HZ5 A;  1VZ7 A;  4A90 A;  3URY A;  1K50 A;  1IGD A;  3E56 A;  3LB8 C;  1E0Z A;  1FCL A;  3U2S C;  1TS3 A;  2DLB A;  1E10 A;  1TKE A;  1I4X A;  3IAM 1;  3NZ3 A;  4CQN A;  3Q69 A;  1YN4 A;  1C4C A;  3AE3 B;  5JXV A;  2N9K A;  1SJH D;  3ZJU A;  1DYQ A;  1YJI A;  2LUM A;  2WU2 B;  1SF0 A;  3MJ5 A;  1QT9 A;  5EE3 A;  2J42 A;  1UGJ A;  2KAC A;  5TSS A;  3AEB B;  4TSS A;  1CZP A;  2J53 A;  3R8B A;  3BVZ A;  4A9A A;  1QKZ A;  2K9X A;  2PTL A;  2V3P A;  1AN8 A;  3NRZ A;  1BXT A;  1FIQ A;  2NTT A;  2TSS A;  2M56 B;  4US8 A;  1NYQ A;  1QF6 A;  3ZGZ A;  1L5P A;  1N62 A;  3W5V B;  3EGR A;  4OZB A;  3BWU D;  1I4G A;  3MC0 B;  2WDR B;  1KLG D;  1I4Q A;  2PMV A;  3WCQ A;  2W3R A;  2WDQ B;  1EWY C;  4YSZ B;  3KWL A;  1FMA D;  2SAK A;  1FEH A;  2GI9 A;  1CJE A;  3AE4 B;  1C76 A;  2KN4 A;  2E3T A;  1OFF A;  2I38 A;  3DWG C;  1RM6 C;  3BVM A;  3EA6 A;  3VQI A;  4C7Z A;  3P63 A;  3Q8C A;  4YSX B;  4RGT A;  1ROE A;  1SEB D;  2KMM A;  4OVZ A;  4RGN A;  5D7G A;  1KH0 A;  4MH8 A;  1RWS A;  3GS2 A;  1C78 A;  4RF1 A;  1I4H A;  4KGT A;  3T3O A;  1FFU A;  3B9J A;  2PIA A;  2L52 A;  3L4P A;  2LGI A;  3AH7 A;  2MJD A;  4JWU C;  4KKI A;  4PT5 A;  2D5G A;  2WXO A;  1TKG A;  5EE9 A;  3AM9 A;  2XNA C;  3U4E G;  1FXI A;  2ZW1 A;  2OHF A;  1N5W A;  2M0A A;  5BMG A;  1J7B A;  2RDH A;  1I4P A;  3B2F A;  4P16 A;  2WXH A;  1M4V A;  2LFI A;  5D3I B;  3ZJT A;  2B76 B;  1C4P A;  3SEB A;  5BYQ A;  1V1P B;  1VZ8 A;  1I7H A;  3SFE B;  1IUE A;  1ZUD 2;  1TJE A;  2AQ1 B;  4WUR A;  4RCO A;  1JRP A;  1NI3 A;  1FRD A;  3AV8 A;  4L1B A;  5C3J B;  4KGS A;  3B2G A;  3NVY A;  4L2Y A;  3PO0 A;  4US9 A;  1XLN A;  4NAW B;  2Q5W D;  2WXG A;  3CIR B;  2DWQ A;  1ZPS A;  1C77 A;  5G5G A;  5HG2 A;  2FBW B;  2PVG C;  3FIL A;  1MVK A;  1UWX A;  5H92 C;  3W2D A;  1MHH E;  2H89 B;  2LHD A;  2BYT A;  2M19 A;  3MHZ A;  2JQR B;  1CQV A;  3AE9 B;  2QIL A;  1B1Z A;  3ETR A;  4HKQ A;  3BZD B;  4TQ0 A;  1JCK B;  3U7Z A;  3VRB B;  1R7S A;  2JZP A;  2RPV A;  3N9Y C;  1Y56 A;  1ZDV A;  2BT6 A;  1FXA A;  1NVI D;  2SEB D;  3HVZ A;  3TEZ A;  1VRA B;  1QOB A;  1KLU D;  4ZRP A;  4WWM A;  1B9R A;  1T5X D;  1FNW A;  3R2I A;  1TS5 A;  4UDU C;  4ARC A;  1VZ6 A;  2WDV B;  1J7A A;  4WH4 A;  4MAC A;  1VR9 A;  1FCC C;  2AQ2 B;  4NJC A;  1QOG A;  3ZYY X;  5I4D A;  4N59 A;  3TEY A;  2CU3 A;  4IOI E;  2MH7 A;  1T6B X;  2HDE A;  1GOZ A;  2J4X A;  1E9M A;  1PUT A;  4OHJ A;  5HHD G;  1YN5 A;  5HI1 A;  4DXG A;  1XLQ A;  4USA A;  1FFV A;  1V1P A;  3NVV A;  1TKY A;  1NEN B;  3W9C B;  2W54 A;  3EUB 2;  4YTN B;  1XEE A;  1STE A;  2E6X A;  2MJE A;  1ACC A;  1XF5 L;  1VLB A;  2WXK A;  5EE1 A;  3AEA B;  3IXS A;  1L0X B;  3J9C A;  2LHE A;  4C80 A;  3P42 A;  1A70 A;  1L6U A;  5AUK A;  2BB5 A;  4DXF A;  1ZP0 B;  1AWD A;  3AE6 B;  4YXD B;  1VJK A;  1WXQ A;  2LMC A;  1OQR A;  1KRH A;  3C8Y A;  4DQO C;  2WQY B;  1QLB B;  1RYJ A;  2DYM A;  4KGR A;  2WXI A;  3O13 A;  3KLS X;  1VDV A;  1LO5 D;  4RF0 A;  1WSP A;  4OW0 A;  2J52 A;  3U52 E;  1JRO A;  2FUG 1;  4JWS C;  1DOI A;  1HA5 A;  1YN3 A;  1IGC A;  1FNU A;  2WXL A;  5LNK 1;  5BYS A;  2WXQ A;  1XLP A;  2CJO A;  1FRR A;  3TEW A;  1SBB B;  2BS3 B;  3P4S B;  2L83 A;  2PLP A;  1D4B A;  1MPE A;  1ESF A;  2WXJ A;  2IGG A;  1F0Z A;  1ET9 A;  2KWD A;  2G1E A;  2WXF A;  4B0E A;  2FE8 A;  3BK2 A;  1SB3 C;  1WGK A;  2ICI A;  4XDD A;  2K22 A;  1QOA A;  3P4Q B;  1RFK A;  2ZW0 A;  5EE0 A;  2JSV X;  1AW7 A;  2LJI A;  2K0P A;  1TS2 A;  1KFY B;  2WP9 B;  4EE2 A;  2IGH A;  2OED A;  4GDL B;  3V3X A;  4RGO S;  4OZA A;  1CK1 A;  3I9V 1;  4HJG E;  5FK9 C;  1N60 A;  1EU4 A;  4NZL B;  2QEJ C;  3MP9 A;  3HVD A;  1SSN A;  4YTP B;  4M0W A;  3RFZ B;  2DBY A;  1C9F A;  3AEE B;  1YNT E;  4HRS A;  1F77 A;  4C56 C;  2AX5 A;  1HZ6 A;  2PW9 A;  3NS1 A;  3HUI A;  1EM7 A;  1N61 A;  3IAS 1;  3OWE B;  1AYF A;  3ZQ4 A;  4C7Y A;  5GXG B;  3AN1 A;  1IBX B;  4KKJ A;  1JWU D;  4LTU A;  3BK1 A;  2ONQ A;  3AE8 B;  3VRA B;  1WYG A;  1TZO A;  2LEK A;  2IJ0 A;  3NUH B;  1FM0 D;  2H88 B;  2IDY A;  1JW9 D;  4MT5 A;  1GPX A;  4LK0 M;  2WU5 B;  4A55 A;  1N63 A;  1OQQ A;  1C79 A;  2KQ4 X;  4H2A A;  4ZRQ A;  1E6E B;  4TQ1 A;  3P1M A;  4B0M A;  4XWW A;  1JQ4 A;  2BW2 A;  3Q8B A;  1QIL A;  1Q10 A;  3TSS A;  1D6E C;  2Z8L A;  1TY0 A;  2XN9 C;  2W55 A;  5BYR A;  3Q8A A;  2QIE B;  3P4R B;  1DOX A;  1MI0 A;  5H8Y E;  1N5X A;  1KTK A;  3DWM A;  4REZ A;  4XWT A;  1SE2 A;  2JWU A;  1K52 A;  4YTM B;  3T3N A;  5BMH A;  4J3O D;  3TUO A;  1FD6 A;  1QQR A;  1SIJ A;  1ENF A;  4RGM A;  1L4D B;  1D5X C;  1V1O A;  2V3N A;  1JWA D;  2NMQ A;  3AE2 B;  1T3Q A;  1GB1 A;  1NYR A;  1NEK B;  1EWC A;  1K51 A;  1TY2 A;  1FNV A;  1SE3 A;  1XCQ L;  2AQ3 B;  2K3U A;  4NAM A;  4Q2J A;  5FKA C;  1XLO A;  1SJE D;  4GLS C;  4IKG A;  4YSY B;  1UWM A;  4IDI A;  1QOF A;  2BS4 B;  2IGD A;  3NVZ A;  2PKO A;  3IT6 B;  2JU6 X;  4ITK A;  2X38 A;  1XXG A;  2DYO A;  1GAQ B;  3VR8 B;  1PDX A;  1SXT A;  2JXT A;  3AEF B;  1L6V A;  1GB4 A;  2VZK D;  2QSD A;  3W1S A;  4FXC A;  1D5Z C;  4A8X C;  2W3S A;  3AEC B;  4RH6 A;  1TS4 A;  5D3D A;  2Y5C A;  1SE4 A;  1YQ3 B;  1PGX A;  1FO4 A;  4WIP A;  1YQ4 B;  2G9H D;  2N0S B;  1P7F A;  3FIL B;  1ZOY B;  4ZHO A;  1HQR D;  4ZOH C;  3W5U B;  2BTE A;  1MHX A;  2INP E;  1ZXH A;  4TMA B;  5BMI A;  2WXM A;  4JE3 B;  5HFY A;  3VR9 B;  4HKZ E;  4HRO A;  2GRI A;  1WRI A;  4P6V F;  1L0Y B;  3KQ4 A;  3AE7 B;  3AB5 A;  3H8H A;  1PYW D;  3Q8E A;  2GB1 A;  3AEG B;  1D5M C;  4YT0 B;  1PFD A;  1UNS A;  3AE1 B;  3BYT B;  2ON8 A;  3GP7 A;  1C4A A;  2BBC A;  1J7C A;  3RPF C;  4JPS A;  1I4R A;  2YEP B;  3AED B;  4WAF A;  1PGB A;  5AUI A;  2RMM A;  5T8I A;  1ZDX A;  3LXF A;  5C2T B;  4XE0 A;  2VZK B;  2WLB A;  1JWM D;  1L4Z B;  2PVO D;  3KWV A;  3MFG A;  3GB1 A;  4N6E B;  4O1N A;  1L0V B;  2N9L A;  3SFD B;  3IT4 B;  3ZJV A;  5E6J A;  2WXR A;  3HRD D;  1PGA A;  2MEK A;  1JAL A;  4JX1 C;  2YEP F;  1XCT L;  5FR3 A;  3UI3 A;  2WNM A;  2IPK D;  2L32 A;  1WWT A;  2INN E;  1TYG B;  2QJL A;  4R3D A;  1K53 A;  3BVG A;  1V97 A;  2NTS A;  3I57 A;  3V05 A;  2EEL A;  2JYE A;  2N7J A;  1DOY A;  1F2R C;  2Y5P A;  2EKI A;  2V4I B;  1JWS D;  1V8C A;  2WXP A;  4YWG G;  5G5H A;  3BYY B;  2BS2 B;  4WQM A;  4KX6 B;  3FC4 A;  1UUP A;  4HEA 1;  2JYT A;  3CWI A;  2KAJ A;  1P7E A;  3Q8F A;  5MPO A;  1BML C;  1E7P B;  4AQ7 A;  1YMH E;  3PZ8 A;  2R61 A;  1ZE3 D;  4A6Q A;  4D2K A;  2RDG A;  1JML A;  4LLG M;  3AE5 B;  2BB6 A;  4OZC A;  4XDC A;  2W82 A;  4AS1 A;  2JX5 A;  2Y3A A;  2K5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...