1EN4A

Crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANHDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 72
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en4A02
4JZGA 1MNGA 3C3TA 1IXBA 2P4KA 1MA1A 1I08A 1SZXA 2ADQB 3IC9A 5AG2A 4GUNA 3BFRA 2ADPA 1EN6A 1AR5A 1VARA 2QKCA 3EVKA 3CEIA 1XDCA 4X9QA 1AP5A 3TJTA 3AK3A 1MSDA 1MMMA 3MDSA 1P7GA 4C7UA 1GN3A 1ZUQA 2CE4A 1ZTEA 3QVNA 4F6EA 2RCVA 3LSUA 1BSMA 3DC6A 1QNMA 1EN5A 1LUWA 1XILA 1N0NA 3K9SA 4YIOA 1WB8A 3OT7A 1B06A 5A9GA 1VEWA 3DC5A 4BR6A 1I0HA 1D5NA 4FFKA 1XREA 2CDYA 1N0JA 1PL4A 1IX9A 1PM9A 1XUQA 1Y67A 1IDSA 1AR4A 2AW9A 1BS3A 4JZ2A 1GN6A 1KKCA 1LUVA 1JR9A 4JYYA 1EM1A 3RN4A 4E4EA 3C3SA 2QKAA 1AVMA 1GN4A 3AK2A 1AP6A 1JA8A 1GN2A 1BT8A 3AK1A 1ZLZA 4YIPA 2GDSA 1EN4A 1ZSPA 1WB7A 3KKYA
chains in the Genus database with same CATH superfamily
3K5LA 4NXNO 4WCEV 3DGEA 1IVSA 3FX7A 4DO2A 2BCCH 2VWKA 2QDOA 4I55B 3SJQC 2Q4PA 2UXCO 1V54B 2EULA 3L73H 4UB6Z 2F93B 3M99B 1QLEB 3UQ8A 5KHKA 4N21A 2EBOA 1XDCA 1JPXA 1AP5A 1U97A 3ZEDA 1NT2B 5LGUA 2B1IA 3KZIZ 4AHCA 2JEXA 4NTXA 2EINB 1AROP 3CJHA 1MOFA 2DE0X 2HG5C 3TK1A 3AG4B 4TV9B 2EJRA 3TXSA 2AZ2A 4J7ZA 5L3DA 1VQ8V 3SYAA 4JPRA 2QSAA 4DR2O 4GZRB 2IJJA 4QNHB 4MW3A 1I0HA 3O65A 4CC5A 1L0NH 2EJ7A 4DK0A 1OCZB 3JALA 3ML0A 5A2QN 1SZTA 1AB3A 3JASB 3ZS8C 2CTPA 3E89A 5D5PA 3F7VC 3E8GA 4LF7O 3FYEB 2DN9A 1OCRC 1QVFU 1NI8A 2IJIA 3STZC 5B3SB 1I94O 4FM1A 1S5JA 3D3IA 3ZHQA 4I55A 1EZVH 4FK5C 2GTSA 2PGGA 3TETA 4E4EA 1AJQA 3T4ZA 2B5UA 3C90A 3OTOO 2PUSA 1B04A 1HNXB 2GSMB 4B3TO 2PY5A 3ZMUA 2RN9A 4LWSB 2X0LA 3JCUZ 4WFHA 3LSQA 4DUZB 5LBQA 2C2AA 2HEPA 4DV7B 3ZX6A 2UXBO 4J80A 4QIWF 2BTQB 3ZBHA 5CB4B 1WNSA 4TV9A 4P2ZA 5GONB 1AR1B 2HHHO 2H94A 2V7QG 2XAFA 2FL4A 2F4VB 3RGBA 1YTFB 1XI1A 4H13B 3QTCA 3MDSA 3JASA 4BAYA 2RCVA 3G4SV 2QKSA 3B77A 3OR6C 4LF8O 4JYCA 1YTFD 4FLVA 4BIZA 3K58A 3E8FA 1K97A 1N4CA 4ZOLB 4MTFA 4QGPA 3AG1C 4BR6A 5KUMA 2EZOA 2WPDG 3OMIB 5IWAO 1Q82W 1K7DA 2HVJC 1EBOA 4J7KA 5LGTA 4LWSA 4DR5B 3LDEA 1SQQH 4BIUA 2CTRA 3J81N 3CCVV 5LP6B 4R50A 5LHIA 3UT5B 1W59A 3ICXA 4PHZA 4JI0B 2W6JG 2BTQA 1RSOB 5CB4A 2ZR3A 4TUYB 4JZ2A 1GN6A 3ABMB 1YSCA 1PP9H 3BCCH 3QO8A 4ASUG 2Y69B 4H0LB 2EIJB 4DR4B 3KCXA 4DW1A 4JI5O 3FYIB 4UVBA 1IBMO 3IAYA 4YIPA 3GB7C 3SYCA 3D8CA 1S5HC 1XQ8A 3HKDB 2JJ1G 1PNKA 2X6CA 2O57A 1GRJA 3LDDA 2ETNA 4LR3A 4TWKA 1Q3EA 2ITDC 1S76D 4J9ZB 3CXHF 2PTMA 5KUKA 2FKXA 3RYHB 3BVOA 3BFRA 4YHHO 4JI8B 4ZOLA 1Y74B 3UM7A 3ZN0A 2DWEC 4B3MB 2L35A 1NQTA 1OCOC 1VF6A 3OEEG 4UV9A 3EXAA 5LP6A 3FB8C 1GN3A 3CRQA 3UT5A 4JI6B 2UXNA 2UUAO 1B3QA 2Q9LA 2Q5ZA 1RSOA 1H2KA 3W7TA 1LUWA 1NR7A 4TUYA 1VQ7V 5EBLC 2Q73A 4MVQA 3O9OA 1P84F 2HJFC 5A9GA 4TV8B 5LYJA 3OMAB 4FFKA 1IURA 1KYOF 3JD4A 1HNXO 3ASNC 3BY6A 4OPHA 4DV5O 4G27B 2E5LO 3CP1A 1VQMV 3BPZA 1THZA 3JAWA 1YXBA 2DQ3A 2UUCO 2WLJA 1PV0A 1DK1A 3HKDA 1OCRB 4MTOA 1LR1A 5FPOA 2W0XA 1G1XB 4DR3O 2QTSA 3RYHA 4FLYA 1IBKO 5BR8O 2KQXA 1Y74A 3HKCB 1OCCB 1SQBH 1IBLO 3NR7A 4OGQB 3H1KH 2JS5A 2PI4A 3FFQA 1VF5B 1NBMG 4NTWA 5J2TB 1TAEA 2JGDB 4KHPB 5L3GA 3GWKC 2Y4UA 1KB9F 1M90W 2IJHA 5EYPB 4X8AA 5EK0A 1NVPB 4TSFG 5AG2A 4AQYB 3OEHG 1Y66A 4TV8A 1ZX3A 3JD0A 1AI4A 1S72V 1OJHA 4FPPA 1ZWIC 2N04A 3CPWU 1H2GA 4DR5O 2ZKOA 5KLVH 3QF7A 2ZNIA 2UU9B 1NVPD 3T1HB 1TGOA 4UFZA 3IC7A 1QNMA 4OX9B 4JI0O 3S3XA 2Y0IA 4J10A 4DV1O 1XMOB 3U10A 1QLEC 3BABA 1N32O 3DTUB 3HKCA 4IIJB 2VQEB 2QWQB 3AG1B 3LDCA 3T1YB 5IE9A 1D2DA 4DR4O 1N34O 4PDRA 1FFXA 4D7SA 2QM4A 1M56C 3CB2A 4JYBA 3VBBA 5JCOC 2WLLB 5H6QA 5J2TA 3HPLC 1JCHA 2JGDA 5LOVB 2UXCB 3BA8A 4X88A 3G67A 2BE3A 2CTWA 3R65A 2H3OA 5LL6Y 4GX5A 2YSUB 2PF4E 5CBHA 4WF9V 5C8YA 4ZIBA 4JI8O 4NKGB 2JGUA 3B8MA 4MTXA 3RVYA 3TGUH 1KP2A 3WB0A 2X7RB 4EEQA 5TISZ 4CH5A 1VP7A 3ZHRA 4XDLA 3CYOA 4J41A 3ZHTA 4JI6O 3P3PA 5IYZB 3AG7A 2EZPA 2VQFO 2Q0AA 2WLNA 2QJ1A 3BRCA 2WSSG 4PA7A 4EKWA 1R73A 3IC9A 3RWRD 1H2SB 1CP9A 5FPRA 3OUFA 4PA3A 5GTHZ 4LC1A 5L3FA 4R7CA 4DK1A 4IIJA 2JK5C 1R3JC 4CS4A 4B3SB 1OZ0A 1ROPA 1PL0A 3QNEA 1OCOB 4DW0A 3W7UA 3FB7C 1E1RG 1I94B 2WLLA 5FLXN 5LOVA 3E83A 4O4LB 1HR0O 1P4RA 1JMKC 4CZZA 3ZHVA 4CC6A 1SC5B 4B3TB 3LNMB 3OT7A 4KP4A 4MVZA 3AG2C 2LFSA 5IDJA 4CH6A 1K73W 5LMNO 4CBCA 2Q68A 3DC5A 1AILA 1UPGA 2F1MA 2Q8VA 1Q8IA 1XOUA 3ASNB 1VQPV 2XHBA 3K08A 5L3CA 3U11A 5KAFZ 3E22B 3FB5C 4DRXB 4JTDB 5IYZA 4WFBV 3GWOA 3JATA 2A9HA 2IU3A 4O4IB 5BY1A 5L3EA 5LMUO 4KHPO 1BQ0A 3FD9A 4J7JA 3SJAC 3JSLA 4Z1VA 4DXWA 2YIBD 1PPJH 3ZMSA 2NLJC 1AJPA 4DV0B 3JD1A 1AI7A 4NB5A 1AP6A 1YZBA 3H01A 4O4JB 4X1KB 3CHXA 3CE2A 1T5EA 2AXTZ 4KUMA 4LF8B 3CCRV 4O4LA 3C3TA 3NXSA 1FXVA 4QPJA 4MVSA 3BAAA 4OX9O 1RPRA 4JYAO 4JAUA 1XMOO 4Z1MG 3LNNA 2QTOA 3T2MA 2Z5UA 3MD0A 1R1BA 4NYKA 4X9QA 2DW4A 4Z2WA 4GCZA 5JJNB 4CS2A 1MSDA 5B1BC 2YIBA 2CH7B 4X66B 3E22A 4DRXA 4X1YB 4O4IA 1JFFB 3P3NA 1LNQA 1ZL8B 2W6IG 4P9OA 4RWUA 4JI5B 1IBMB 1GM9A 3ABTA 4B7EA 4IT5A 3GVMA 1R6NA 1K5SA 2Z0AA 3K03A 5H5NA 4BW5A 4P9PA 4YY3O 2VWJA 1DTOA 4O4JA 4X1KA 4BWAA 1XREA 2CDYA 3A2FA 4IHJB 1M56B 1PL4A 2WAMA 3P32A 4TQDA 5JH7B 2JRIA 2YUAA 1KUQA 4ZKIA 4DV4B 3W7SA 4YHHB 2IH3C 1NJIW 4XDJA 1RPOA 4K8ZA 4O2BA 4LF4B 4F4LA 1BZKA 4JTCB 1WJZA 1EM1A 2JS3A 1SETA 2JIZG 2RDCA 1Y6XA 4L8JA 3WFVA 3F5TA 2UUAB 4B3SO 1SQGA 2CGNA 4GLXA 1XNQB 1JA8A 5DN6G 1EFRG 5J2UA 1RFYA 1HNZO 3CX5F 1KKDA 2CH7A 4UCUA 1SKVA 1BHBA 4X1YA 1JFFA 4LFCO 4H37A 1MSWD 1ZL8A 1FKAO 4GKJO 1OCCC 1NH2B 5H9CA 2ZIMA 4RQEA 4DV5B 2P90A 4JGSA 2E5LB 4UCTA 2UUCB 2QWRB 3RT3C 1WA8B 4IHJA 4RO2A 1R3IC 1YDXA 4MW8A 5JCOA 1ZTEA 1SQVH 5CBFA 5JH7A 4DR3B 2FB5A 1NH2D 1VF7A 4K3AA 1IBKB 2XAHA 1YI2V 4Q6GA 1FYJA 3E8HA 5CA3A 5BR8B 3L71H 3IFXA 4YIOA 4XDKA 3HKBB 1IBLB 1JOYA 3K0DA 1GTOA 4FZ1A 4N23A 2XAQA 3DXRB 3FB6C 4DR7B 5IY5C 1B06A 3AG2B 1L8DA 2R70A 2WLIB 3X2QC 2ZQMA 4HNAA 1K5QA 2ZE8A 4DV2B 4DV0O 5B1OA 3JSNA 1TVKB 3HR0A 3K06A 1XEQA 2IM9A 4GKKO 3CC4V 4ABMA 1YVWA 4U3FH 3K5MA 3SR2C 1F23A 4LF9B 3E8BA 1EZJA 1NKDA 4I5SA 1LUVA 4WBNB 2OIGA 3RN4A 2IW5A 1V9PA 1N33O 3ZRVA 3QG5A 1WA8A 2LO1A 3B4SA 1GN2A 4XBFA 3VQWA 2LW7A 2RMKB 4DV1B 4LFAB 2X6BA 1YITV 3SPHA 5ITZB 1L0LH 3OE7G 4X66O 1N36B 5LHGA 3UO3A 1VQ6V 1N32B 3HKBA 1MA1A 2YXYA 2CUGA 3H1JH 1XHZA 3DXRA 3L75H 2ZR2A 3D36C 1AJNA 5LYJB 1N34B 5KHIA 2WLIA 5EBWC 1EN6A 4MSWC 2QKCA 3RVZA 1VIBA 3A0BZ 2MW2B 5KAIZ 3JAWB 4FLTA 4PA4A 3ZN1A 4DR1B 3OFNG 5B1BB 1TVKA 2WA3A 5KMGB 1WP8A 4LP8A 1JJ2U 1ZUQA 2PYLA 2GUZB 2PI5A 1J95A 4E2LA 1QLNA 4DV4O 1Q81W 3OD4A 5K1PA 4WBNA 3I55V 2K9PA 5BZBA 4LF4O 1WPXA 5LXTB 1K4DC 1Q6IA 4QJFB 1MABG 2JEUA 1F7YA 1XNQO 3SYQA 2VQFB 4IYHA 5B5EZ 1Q5OA 2E74B 1MG1A 3ABKC 5E79Z 2WLMA 5ITZA 3STLC 2F66C 1BE3H 1HW7A 3VQYA 1WN7A 2HP8A 1GK9A 4DUYB 3H9VA 1BS3A 4H44B 2A06H 4UB8Z 1G8MA 3CXCU 1R3KC 1Q6HA 3MHSC 3SJBC 3U0ZA 1GN4A 1N8RW 1BGYH 3CC7V 4DV3B 4NR1A 3OW2U 4JF3A 1BT8A 3ABUA 1HR0B 5KMGA 3AK1A 2AHYA 2GUZA 5C93A 4L87A 2V1DA 4DV6B 2ODMA 4JZGA 4LFBO 4JASA 1YJWV 2RQ6A 2CGOA 2ZNJA 3RYCB 5LMNB 3SDLA 1K34A 4JI4B 3SPCA 4X64B 1FOUA 4GUNA 5LXTA 2G38A 5EIBC 4DR7O 4CH4A 1VARA 2GHYA 1FFXB 3OGCC 2P67A 4DV2O 3RW0A 2IU0A 3AK3A 3TCUA 2ATKC 4PJ0Z 2OTLV 2DYSC 5LMUB 4PI0A 1CEZA 3KDRA 4QPKA 1M57C 1L1FA 1S5LZ 4JI3O 4RAIA 3DC6A 4TT3G 4RUFA 2ZCEA 1N0NA 1XHXA 3K9SA 1Q90D 1SF9A 2NNUA 3CC2V 3M8AA 5C8YB 3K04A 4DR6O 2E76B 4LF9O 3TXQA 1G4YB 1GKFA 3DSQA 2A7WA 1TUBB 5IY5B 2DWDC 3X2QB 3APOA 1VEWA 1D5NA 2P06A 4W4LA 2KG7A 1H2LA 3JARB 4K8XA 1FAFA 3JCZA 3EHBB 5JJJB 1IDSA 4MTGA 3CCEV 2QEXV 4LFAO 4JYAB 5CA0B 3N27A 4PDVA 5BMVB 3K5NA 2AW9A 4IGGA 3RYCA 1N36O 1BMFG 4WFEA 3CRCA 4LF6O 2ZM6B 4MVMA 1QR9A 3RFRA 2Q6AA 5KHHA 3H1IH 2Q7EA 3C3SA 2WLHA 4UCRA 4TQFA 5CBGA 4Q20A 4U7NA 2KB1A 2YDEA 1TA8A 2GDSA 4PDLA 4DR1O 1M93A 1KC8W 3ZCCA 3KKYA 3VQXA 1I5XA 2UXXA 3G71V 3ASOB 1IXBA 1P49A 3H1LH 3VOUA 4I7ZB 5J9PC 2N74A 2L6LA 4YY3B 1TUBA 1KQSU 3A0RA 1V55C 3ETDA 1M9NA 4PA6A 4PI2A 4X62B 3B40A 2P5OA 5D5QA 1BL8A 4ZBMA 2QA4V 5DEDA 2HR3A 3JARA 4UVCA 1X4TA 1H38A 2P22C 1DF4A 3JATB 5LGNA 4J11A 5CA0A 2QWOB 2ZXWC 4J9YB 5BMVA 3CCLV 1TUEB 4LH6A 5K1XA 2EIKC 1D5AA 2HLDG 1J5EO 4DUYO 4X20B 4KL1A 4I9QA 4CS3A 1H8EG 5DM6V 1SERA 1HNZB 4R8CA 1SQFA 2BTOA 1GM8A 1YCIA 1AI6A 3PN1A 1RM1C 4DV3O 1Z2GA 4LFCB 2A79B 3E2EA 2XTAA 3L74H 1HDJA 4GKJB 4HYOA 3WG7C 4X65O 3ABKB 1AR4A 2W0FC 3I5DA 3OTFA 3KCYA 4DV6O 1VQ4V 2OYQA 2P6JA 2YEVB 2NR5A 3ZRWB 3D36A 4JI4O 3SPJA 5GW7A 4X64O 1VQKV 2QKAA 1FD9A 2BOCC 1HNWB 1QBZA 1NTZH 5B1AC 1EN4A 4AILC 1Q86W 1WB7A 4P30A 2Q7GA 2FTKA 1UFIA 1KECA 4O4HB 4D7TA 3CMAV 2WA4A 4JI1B 4X20A 4K0KO 1ENVA 4GT1A 3UO2A 5IYBO 5JJEB 3EVKA 1Y76B 4GKKB 5F2VO 2XAGA 2DYSB 4C7UA 3K9AA 1P7BA 3D3QA 1M57B 4D6TH 2OCCC 4O2BB 4JI2O 3WU2Z 3BHPA 2F43G 5EIBD 2YEVA 3ZRWA 3OAAG 2LGWA 1N33B 1ZAUA 3L70H 2D2CB 2YC0A 2ZM6O 5IT9N 1NR1A 5IJ9B 5J2UB 1WP7A 3N2KB 1BHAA 2ZE5A 3OUSA 3W7WA 1S3JA 3T4DA 2QWNB 1XUQA 1QHTA 1IXMA 2ARHA 4U3JB 3UKMA 4O4HA 1A32A 2XOKG 2UUBB 3VQVA 3ABLC 1IJGA 4BW9A 3WB1A 1K4CC 4X1IA 1X59A 4OXSA 1K8AW 3E35A 1Y76A 4PV1B 2LQTA 1AVMA 4B3RB 1JNBA 2DYRC 4X62O 2RJZA 1GMGA 2ITCC 2ZE7A 2Y4TA 3BEHA 1KP3A 4ZHQB 2GBOA 3ZHSA 3ZRXA 5LA6B 1WLEA 2DJVA 2F23A 3ZMVA 1SZXA 3SJCC 4QE9A 4HNAB 1JX9A 1VMGA 3ZHUA 2XT9A 1V55B 5IJ9A 1AR5A 2EIMC 3N2KA 3ZIAG 1YIJV 2VRZA 5EC1C 2EILC 3SYOA 3BA9A 1PD3A 2Q69A 4OPAA 1QQCA 4BIOA 2CE4A 3QVNA 3I56V 4U3JA 4JV5O 1BSMA 2ZXWB 4FZ0A 2EIKB 3RYIB 4MVOA 4HAMA 1W0JG 4YJ3B 2PZSA 5BXZA 4H33A 1GH6A 2ZDIC 1SS3A 5B66Z 1FJGB 1ORQC 1QR8A 2IH1C 5IYDO 3K5OA 3B8NA 5H6RA 4JAAA 1HNWO 3QO5A 4LFBB 1RM1B 1XNRO 1M5IA 4ZHQA 1COWG 2ILMA 2JVDA 4LBEC 3WG7B 1O9GA 1XL6A 5LA6A 4B7KA 3PJSK 2DOSA 1FXHA 4FLWA 3CCUV 1PNMA 3CD6V 4LNUB 1VQNV 4JI1O 4JYYA 1NTKH 2R9RB 1WPBA 4JAVA 1HWYA 5CA1B 4JI3B 3OMNB 1O9HA 2E75B 1M4UA 1H8HG 5B1AB 2YI9A 3J7AU 3A8TA 1ZSPA 2FYUH 1S77D 1I5YA 4DR6B 1JVMA 1YJ9V 1YJNV 3RYIA 2ZIOA 4GX2A 4YJ3A 5GTIZ 4GX1A 3R66A 3JYCA 2ZINA 3FKSG 4FJCC 1XMQO 3AG3C 3WB2A 2F95B 2KKWA 5EC2C 1Y4MA 4DYLA 1P7GA 4JI7B 3ASOC 3JD3A 4FMTA 5E1AC 4FLUA 4MS2A 2YS8A 4LF6B 3K57A 3IJ4A 1JQ0A 2OCCB 1KD1W 3LSUA 3CCQV 2PYJA 2QWPB 1F51A 2YXHA 2UUBO 4KFMA 3OR7C 2AGAA 3FAVB 2VS0A 4LNUA 1B6QA 4PD4F 1FXKC 4UXNA 3CSXA 4KXRA 4MT8A 5GONA 2R72A 2JDIG 3RYFB 4FLZA 1NU1H 5CA1A 2OT5A 5H2FZ 5EZYB 4B3RO 1DLBA 4UUJC 3N2GB 3LUTB 3UCSC 1MZFA 1SQXH 3CRMA 4NVPA 2HJDA 4W4KA 4PDMA 1R6TA 4LCUC 1KU9A 1GAXA 3ABLB 3JD2A 1K9MW 1KKCA 4GYCB 2NN4A 2YIAA 4PELA 1FS0G 4A5UB 2HKOA 2DYRB 3SGIA 2ZD9A 5KX5B 1UJWB 5LHHA 1VQ5V 2V4DA 1ZLZA 2ZT9B 1K33A 5B1NA 2BOBC 3K0GA 4NTYA 1J5EB 1RP3B 4NXMB 1XL4A 1H5WA 4U7OA 2KSDA 5FNVB 4CH3A 4EB6B 2XNDG 3FAVA 3J80N 2LP7A 4MVUA 2ADQB 1NS1A 4UCSA 2Y48A 4X89A 3L72H 1MZEA 2KG7B 3OM3B 3RYFA 2EIMB 1FJGO 4J42A 1JJOA 3CEIA 3CCSV 3T1CA 2EILB 3LSSA 5EZYA 2H8PC 4X65B 4I4TB 3N2GA 1E1QG 4HBNA 3ZMZA 1IZ3A 4FLXA 3HKEB 3ETEA 5IJ0B 1XILA 3K79A 2B9ZA 4DUZO 2LGQA 4DV7O 4LF5B 2A3QA 4K35A 2P7TC 2CTQA 4RQFA 1AI5A 2HVKC 1NTMH 1S0VA 5KX5A 1Q6UA 2Q7HA 3B2EE 1W2BU 1GM7A 2F4VO 3P30A 1SRYA 1I7FA 2LW1A 5EBMC 2D3OW 5FNVA 3CCJV 4K0KB 1SA0B 3IGAC 1G6UA 2CAZC 4EB6A 5KA6A 1WAZA 2JJ2G 2M7WA 3THOA 1Z5WA 1F4NA 1OV9A 4I50B 2RNBA 3JAKB 5JQGB 2UXDB 1JR9A 3SYPA 2YI8A 4PA9A 1K92A 3HB3B 2BSKB 4TOIA 1DGSA 2E3CA 3CMEV 4I4TA 4WFGA 4FIPC 5KHJA 3W7XA 4JI2B 2YIDA 3HKEA 4JI7O 2WWWA 2QM8A 5IJ0A 2OTJV 2P4KA 4FM0A 2AHZA 4ICGA 1DF5A 4UV8A 2M6YA 3G6EV 2ZDIA 2K1EA 1V54C 2ADPA 4O2AB 4JTAB 1BQZA 3AG3B 1VQ9V 3S3WA 4IYIA 4WFAV 3AEIA 1QVGU 3CS5A 2P4VA 5HFMA 3TJTA 1K3EA 1YF2A 3H1HH 1W0KG 4I0XB 1MMMA 1Z5VA 3G80A 5L3BA 2EINC 4F6EA 4NXNB 4ZI7B 1SA0A 1EN5A 1QCEA 3AG4C 4I50A 1FXKB 3JAKA 5JQGA 1WB8A 1FFTB 5EYPA 3A0HZ 4HZ3A 4RUEA 4B08A 2AZ0A 2BSKA 3M7MX 5CN0A 3ZJZA 1OCZC 2HFEC 1F4MA 2XUMA 4LH7A 1XBLA 1N0JA 1BCCH 1IX9A 1Y67A 2GV9A 2OWOA 2MK3A 2QR4A 3ETQA 5JVDB 4B3MO 2WLKA 1VQLV 4NXMO 3MHHC 5FL7G 4WFFA 5B3SC 1YHQV 3KG2A 2ZE6A 4FVMA 3F7YC 2IBZH 4GX0A 3CWBH 2B1GA 2N05A 4O2AA 4DR2B 5HFLA 1Q7YW 1M1KW 1Q43A 2OIEA 4YXWG 5JWPA 4F6RB 3Q4HB 3SPGA 3AK2A 2QM7A 4I0XA 4JV5B 3CCMV 1CPYA 2A0LA 1SQPH 4LF7B 4FM2A 4ZI7A 1KBHA 1MNGA 3ZMTA 2EX3A 3RBZA 1SESA 1I08A 1FXKA 4QE7A 4YJ2B 4FFBB 4LF5O 3ZRSA 1R3LC 3OTOB 3MAQA 1XNRB 1US6A 2DMXA 2Y0PA 3E86A 3G6BA 2R9AA 2QE7G 4EFBA 1PKXA 3EFFK 5JVDA 1R6KA 2UXBB 1CXZB 5IYCO 3ETGA 4AI8A 4X1IB 1PNLA 2DQ0A 3QO7A 3CRRA 4IL6Z 2HHHB 2QGNA 5CMUA 2UXDO 5DECA 2X6AA 4I9WA 1VQOV 4F6RA 3APQA 3Q4HA 1H2MA 2LJ2A 2XAJA 4AQYO 4MVRA 1URFA 2Q67A 1YEWA 1VF6C 2Z3YA 2XASA 1PM9A 3SPIA 5LP6C 2OCHA 3CJHB 2Q0OC 1OHHG 2LFRA 5KHGA 3L9DA 4UCOA 1HP8A 1XMQB 2FMLA 3K59A 2UU9O 1GO3F 3T1HO 3ABMC 3OGIB 4YJ2A 4R6ZA 4EFEA 4FFBA 4UCVA 2YXLA 2YICA 1U96A 2Y69C 1NZ6A 1KMIZ 5IWAB 2EIJC 1QU7A 3CRAA 3F5WC 4G2KA 4UVAA 4G28B 1E79G 2CK3G 3JALB 2R9IA 1FPOA 2IJKA 2VQEO 2GTAA 1H2NA 3JAMN 3T1YO 3K3WA 3B09A 5KA5A
chains in the Genus database with same CATH topology
4JZGA 1MNGA 3C3TA 1IXBA 2P4KA 1MA1A 1I08A 1SZXA 2ADQB 3IC9A 5AG2A 4GUNA 3BFRA 2ADPA 1EN6A 1AR5A 1VARA 2QKCA 3EVKA 3CEIA 1XDCA 4X9QA 1AP5A 3TJTA 3AK3A 1MSDA 1MMMA 3MDSA 1P7GA 4C7UA 1GN3A 1ZUQA 2CE4A 1ZTEA 3QVNA 4F6EA 2RCVA 3KDRA 3LSUA 1BSMA 3DC6A 1QNMA 1EN5A 1LUWA 1XILA 1N0NA 3K9SA 4YIOA 1WB8A 3OT7A 1B06A 5A9GA 1VEWA 3DC5A 4BR6A 1I0HA 1D5NA 4FFKA 1XREA 2CDYA 1N0JA 1PL4A 1IX9A 1PM9A 1XUQA 1Y67A 1IDSA 1AR4A 2AW9A 1BS3A 4JZ2A 1GN6A 1KKCA 1LUVA 1JR9A 4JYYA 1EM1A 3RN4A 4E4EA 3C3SA 2QKAA 1AVMA 1GN4A 3AK2A 1AP6A 1JA8A 1GN2A 1BT8A 3AK1A 1ZLZA 4YIPA 2GDSA 1EN4A 1ZSPA 1WB7A 3KKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZG A;  1MNG A;  3C3T A;  1IXB A;  2P4K A;  1MA1 A;  1I08 A;  1SZX A;  2ADQ B;  3IC9 A;  5AG2 A;  4GUN A;  3BFR A;  2ADP A;  1EN6 A;  1AR5 A;  1VAR A;  2QKC A;  3EVK A;  3CEI A;  1XDC A;  4X9Q A;  1AP5 A;  3TJT A;  3AK3 A;  1MSD A;  1MMM A;  3MDS A;  1P7G A;  4C7U A;  1GN3 A;  1ZUQ A;  2CE4 A;  1ZTE A;  3QVN A;  4F6E A;  2RCV A;  3LSU A;  1BSM A;  3DC6 A;  1QNM A;  1EN5 A;  1LUW A;  1XIL A;  1N0N A;  3K9S A;  4YIO A;  1WB8 A;  3OT7 A;  1B06 A;  5A9G A;  1VEW A;  3DC5 A;  4BR6 A;  1I0H A;  1D5N A;  4FFK A;  1XRE A;  2CDY A;  1N0J A;  1PL4 A;  1IX9 A;  1PM9 A;  1XUQ A;  1Y67 A;  1IDS A;  1AR4 A;  2AW9 A;  1BS3 A;  4JZ2 A;  1GN6 A;  1KKC A;  1LUV A;  1JR9 A;  4JYY A;  1EM1 A;  3RN4 A;  4E4E A;  3C3S A;  2QKA A;  1AVM A;  1GN4 A;  3AK2 A;  1AP6 A;  1JA8 A;  1GN2 A;  1BT8 A;  3AK1 A;  1ZLZ A;  4YIP A;  2GDS A;  1EN4 A;  1ZSP A;  1WB7 A;  3KKY A; 
#chains in the Genus database with same CATH topology
 3K5L A;  4NXN O;  4WCE V;  3DGE A;  1IVS A;  3FX7 A;  4DO2 A;  2BCC H;  2VWK A;  2QDO A;  4I55 B;  3SJQ C;  2Q4P A;  2UXC O;  1V54 B;  2EUL A;  3L73 H;  4UB6 Z;  2F93 B;  3M99 B;  1QLE B;  3UQ8 A;  5KHK A;  4N21 A;  2EBO A;  1XDC A;  1JPX A;  1AP5 A;  1U97 A;  3ZED A;  1NT2 B;  5LGU A;  2B1I A;  3KZI Z;  4AHC A;  2JEX A;  4NTX A;  2EIN B;  1ARO P;  3CJH A;  1MOF A;  2DE0 X;  2HG5 C;  3TK1 A;  3AG4 B;  4TV9 B;  2EJR A;  3TXS A;  2AZ2 A;  4J7Z A;  5L3D A;  1VQ8 V;  3SYA A;  4JPR A;  2QSA A;  4DR2 O;  4GZR B;  2IJJ A;  4QNH B;  4MW3 A;  1I0H A;  3O65 A;  4CC5 A;  1L0N H;  2EJ7 A;  4DK0 A;  1OCZ B;  3JAL A;  3ML0 A;  5A2Q N;  1SZT A;  1AB3 A;  3JAS B;  3ZS8 C;  2CTP A;  3E89 A;  5D5P A;  3F7V C;  3E8G A;  4LF7 O;  3FYE B;  2DN9 A;  1OCR C;  1QVF U;  1NI8 A;  2IJI A;  3STZ C;  5B3S B;  1I94 O;  4FM1 A;  1S5J A;  3D3I A;  3ZHQ A;  4I55 A;  1EZV H;  4FK5 C;  2GTS A;  2PGG A;  3TET A;  4E4E A;  1AJQ A;  3T4Z A;  2B5U A;  3C90 A;  3OTO O;  2PUS A;  1B04 A;  1HNX B;  2GSM B;  4B3T O;  2PY5 A;  3ZMU A;  2RN9 A;  4LWS B;  2X0L A;  3JCU Z;  4WFH A;  3LSQ A;  4DUZ B;  5LBQ A;  2C2A A;  2HEP A;  4DV7 B;  3ZX6 A;  2UXB O;  4J80 A;  4QIW F;  2BTQ B;  3ZBH A;  5CB4 B;  1WNS A;  4TV9 A;  4P2Z A;  5GON B;  1AR1 B;  2HHH O;  2H94 A;  2V7Q G;  2XAF A;  2FL4 A;  2F4V B;  3RGB A;  1YTF B;  1XI1 A;  4H13 B;  3QTC A;  3MDS A;  3JAS A;  4BAY A;  2RCV A;  3G4S V;  2QKS A;  3B77 A;  3OR6 C;  4LF8 O;  4JYC A;  1YTF D;  4FLV A;  4BIZ A;  3K58 A;  3E8F A;  1K97 A;  1N4C A;  4ZOL B;  4MTF A;  4QGP A;  3AG1 C;  4BR6 A;  5KUM A;  2EZO A;  2WPD G;  3OMI B;  5IWA O;  1Q82 W;  1K7D A;  2HVJ C;  1EBO A;  4J7K A;  5LGT A;  4LWS A;  4DR5 B;  3LDE A;  1SQQ H;  4BIU A;  2CTR A;  3J81 N;  3CCV V;  5LP6 B;  4R50 A;  5LHI A;  3UT5 B;  1W59 A;  3ICX A;  4PHZ A;  4JI0 B;  2W6J G;  2BTQ A;  1RSO B;  5CB4 A;  2ZR3 A;  4TUY B;  4JZ2 A;  1GN6 A;  3ABM B;  1YSC A;  1PP9 H;  3BCC H;  3QO8 A;  4ASU G;  2Y69 B;  4H0L B;  2EIJ B;  4DR4 B;  3KCX A;  4DW1 A;  4JI5 O;  3FYI B;  4UVB A;  1IBM O;  3IAY A;  4YIP A;  3GB7 C;  3SYC A;  3D8C A;  1S5H C;  1XQ8 A;  3HKD B;  2JJ1 G;  1PNK A;  2X6C A;  2O57 A;  1GRJ A;  3LDD A;  2ETN A;  4LR3 A;  4TWK A;  1Q3E A;  2ITD C;  1S76 D;  4J9Z B;  3CXH F;  2PTM A;  5KUK A;  2FKX A;  3RYH B;  3BVO A;  3BFR A;  4YHH O;  4JI8 B;  4ZOL A;  1Y74 B;  3UM7 A;  3ZN0 A;  2DWE C;  4B3M B;  2L35 A;  1NQT A;  1OCO C;  1VF6 A;  3OEE G;  4UV9 A;  3EXA A;  5LP6 A;  3FB8 C;  1GN3 A;  3CRQ A;  3UT5 A;  4JI6 B;  2UXN A;  2UUA O;  1B3Q A;  2Q9L A;  2Q5Z A;  1RSO A;  1H2K A;  3W7T A;  1LUW A;  1NR7 A;  4TUY A;  1VQ7 V;  5EBL C;  2Q73 A;  4MVQ A;  3O9O A;  1P84 F;  2HJF C;  5A9G A;  4TV8 B;  5LYJ A;  3OMA B;  4FFK A;  1IUR A;  1KYO F;  3JD4 A;  1HNX O;  3ASN C;  3BY6 A;  4OPH A;  4DV5 O;  4G27 B;  2E5L O;  3CP1 A;  1VQM V;  3BPZ A;  1THZ A;  3JAW A;  1YXB A;  2DQ3 A;  2UUC O;  2WLJ A;  1PV0 A;  1DK1 A;  3HKD A;  1OCR B;  4MTO A;  1LR1 A;  5FPO A;  2W0X A;  1G1X B;  4DR3 O;  2QTS A;  3RYH A;  4FLY A;  1IBK O;  5BR8 O;  2KQX A;  1Y74 A;  3HKC B;  1OCC B;  1SQB H;  1IBL O;  3NR7 A;  4OGQ B;  3H1K H;  2JS5 A;  2PI4 A;  3FFQ A;  1VF5 B;  1NBM G;  4NTW A;  5J2T B;  1TAE A;  2JGD B;  4KHP B;  5L3G A;  3GWK C;  2Y4U A;  1KB9 F;  1M90 W;  2IJH A;  5EYP B;  4X8A A;  5EK0 A;  1NVP B;  4TSF G;  5AG2 A;  4AQY B;  3OEH G;  1Y66 A;  4TV8 A;  1ZX3 A;  3JD0 A;  1AI4 A;  1S72 V;  1OJH A;  4FPP A;  1ZWI C;  2N04 A;  3CPW U;  1H2G A;  4DR5 O;  2ZKO A;  5KLV H;  3QF7 A;  2ZNI A;  2UU9 B;  1NVP D;  3T1H B;  1TGO A;  4UFZ A;  3IC7 A;  1QNM A;  4OX9 B;  4JI0 O;  3S3X A;  2Y0I A;  4J10 A;  4DV1 O;  1XMO B;  3U10 A;  1QLE C;  3BAB A;  1N32 O;  3DTU B;  3HKC A;  4IIJ B;  2VQE B;  2QWQ B;  3AG1 B;  3LDC A;  3T1Y B;  5IE9 A;  1D2D A;  4DR4 O;  1N34 O;  4PDR A;  1FFX A;  4D7S A;  2QM4 A;  1M56 C;  3CB2 A;  4JYB A;  3VBB A;  5JCO C;  2WLL B;  5H6Q A;  5J2T A;  3HPL C;  1JCH A;  2JGD A;  5LOV B;  2UXC B;  3BA8 A;  4X88 A;  3G67 A;  2BE3 A;  2CTW A;  3R65 A;  2H3O A;  5LL6 Y;  4GX5 A;  2YSU B;  2PF4 E;  5CBH A;  4WF9 V;  5C8Y A;  4ZIB A;  4JI8 O;  4NKG B;  2JGU A;  3B8M A;  4MTX A;  3RVY A;  3TGU H;  1KP2 A;  3WB0 A;  2X7R B;  4EEQ A;  5TIS Z;  4CH5 A;  1VP7 A;  3ZHR A;  4XDL A;  3CYO A;  4J41 A;  3ZHT A;  4JI6 O;  3P3P A;  5IYZ B;  3AG7 A;  2EZP A;  2VQF O;  2Q0A A;  2WLN A;  2QJ1 A;  3BRC A;  2WSS G;  4PA7 A;  4EKW A;  1R73 A;  3IC9 A;  3RWR D;  1H2S B;  1CP9 A;  5FPR A;  3OUF A;  4PA3 A;  5GTH Z;  4LC1 A;  5L3F A;  4R7C A;  4DK1 A;  4IIJ A;  2JK5 C;  1R3J C;  4CS4 A;  4B3S B;  1OZ0 A;  1ROP A;  1PL0 A;  3QNE A;  1OCO B;  4DW0 A;  3W7U A;  3FB7 C;  1E1R G;  1I94 B;  2WLL A;  5FLX N;  5LOV A;  3E83 A;  4O4L B;  1HR0 O;  1P4R A;  1JMK C;  4CZZ A;  3ZHV A;  4CC6 A;  1SC5 B;  4B3T B;  3LNM B;  3OT7 A;  4KP4 A;  4MVZ A;  3AG2 C;  2LFS A;  5IDJ A;  4CH6 A;  1K73 W;  5LMN O;  4CBC A;  2Q68 A;  3DC5 A;  1AIL A;  1UPG A;  2F1M A;  2Q8V A;  1Q8I A;  1XOU A;  3ASN B;  1VQP V;  2XHB A;  3K08 A;  5L3C A;  3U11 A;  5KAF Z;  3E22 B;  3FB5 C;  4DRX B;  4JTD B;  5IYZ A;  4WFB V;  3GWO A;  3JAT A;  2A9H A;  2IU3 A;  4O4I B;  5BY1 A;  5L3E A;  5LMU O;  4KHP O;  1BQ0 A;  3FD9 A;  4J7J A;  3SJA C;  3JSL A;  4Z1V A;  4DXW A;  2YIB D;  1PPJ H;  3ZMS A;  2NLJ C;  1AJP A;  4DV0 B;  3JD1 A;  1AI7 A;  4NB5 A;  1AP6 A;  1YZB A;  3H01 A;  4O4J B;  4X1K B;  3CHX A;  3CE2 A;  1T5E A;  2AXT Z;  4KUM A;  4LF8 B;  3CCR V;  4O4L A;  3C3T A;  3NXS A;  1FXV A;  4QPJ A;  4MVS A;  3BAA A;  4OX9 O;  1RPR A;  4JYA O;  4JAU A;  1XMO O;  4Z1M G;  3LNN A;  2QTO A;  3T2M A;  2Z5U A;  3MD0 A;  1R1B A;  4NYK A;  4X9Q A;  2DW4 A;  4Z2W A;  4GCZ A;  5JJN B;  4CS2 A;  1MSD A;  5B1B C;  2YIB A;  2CH7 B;  4X66 B;  3E22 A;  4DRX A;  4X1Y B;  4O4I A;  1JFF B;  3P3N A;  1LNQ A;  1ZL8 B;  2W6I G;  4P9O A;  4RWU A;  4JI5 B;  1IBM B;  1GM9 A;  3ABT A;  4B7E A;  4IT5 A;  3GVM A;  1R6N A;  1K5S A;  2Z0A A;  3K03 A;  5H5N A;  4BW5 A;  4P9P A;  4YY3 O;  2VWJ A;  1DTO A;  4O4J A;  4X1K A;  4BWA A;  1XRE A;  2CDY A;  3A2F A;  4IHJ B;  1M56 B;  1PL4 A;  2WAM A;  3P32 A;  4TQD A;  5JH7 B;  2JRI A;  2YUA A;  1KUQ A;  4ZKI A;  4DV4 B;  3W7S A;  4YHH B;  2IH3 C;  1NJI W;  4XDJ A;  1RPO A;  4K8Z A;  4O2B A;  4LF4 B;  4F4L A;  1BZK A;  4JTC B;  1WJZ A;  1EM1 A;  2JS3 A;  1SET A;  2JIZ G;  2RDC A;  1Y6X A;  4L8J A;  3WFV A;  3F5T A;  2UUA B;  4B3S O;  1SQG A;  2CGN A;  4GLX A;  1XNQ B;  1JA8 A;  5DN6 G;  1EFR G;  5J2U A;  1RFY A;  1HNZ O;  3CX5 F;  1KKD A;  2CH7 A;  4UCU A;  1SKV A;  1BHB A;  4X1Y A;  1JFF A;  4LFC O;  4H37 A;  1MSW D;  1ZL8 A;  1FKA O;  4GKJ O;  1OCC C;  1NH2 B;  5H9C A;  2ZIM A;  4RQE A;  4DV5 B;  2P90 A;  4JGS A;  2E5L B;  4UCT A;  2UUC B;  2QWR B;  3RT3 C;  1WA8 B;  4IHJ A;  4RO2 A;  1R3I C;  1YDX A;  4MW8 A;  5JCO A;  1ZTE A;  1SQV H;  5CBF A;  5JH7 A;  4DR3 B;  2FB5 A;  1NH2 D;  1VF7 A;  4K3A A;  1IBK B;  2XAH A;  1YI2 V;  4Q6G A;  1FYJ A;  3E8H A;  5CA3 A;  5BR8 B;  3L71 H;  3IFX A;  4YIO A;  4XDK A;  3HKB B;  1IBL B;  1JOY A;  3K0D A;  1GTO A;  4FZ1 A;  4N23 A;  2XAQ A;  3DXR B;  3FB6 C;  4DR7 B;  5IY5 C;  1B06 A;  3AG2 B;  1L8D A;  2R70 A;  2WLI B;  3X2Q C;  2ZQM A;  4HNA A;  1K5Q A;  2ZE8 A;  4DV2 B;  4DV0 O;  5B1O A;  3JSN A;  1TVK B;  3HR0 A;  3K06 A;  1XEQ A;  2IM9 A;  4GKK O;  3CC4 V;  4ABM A;  1YVW A;  4U3F H;  3K5M A;  3SR2 C;  1F23 A;  4LF9 B;  3E8B A;  1EZJ A;  1NKD A;  4I5S A;  1LUV A;  4WBN B;  2OIG A;  3RN4 A;  2IW5 A;  1V9P A;  1N33 O;  3ZRV A;  3QG5 A;  1WA8 A;  2LO1 A;  3B4S A;  1GN2 A;  4XBF A;  3VQW A;  2LW7 A;  2RMK B;  4DV1 B;  4LFA B;  2X6B A;  1YIT V;  3SPH A;  5ITZ B;  1L0L H;  3OE7 G;  4X66 O;  1N36 B;  5LHG A;  3UO3 A;  1VQ6 V;  1N32 B;  3HKB A;  1MA1 A;  2YXY A;  2CUG A;  3H1J H;  1XHZ A;  3DXR A;  3L75 H;  2ZR2 A;  3D36 C;  1AJN A;  5LYJ B;  1N34 B;  5KHI A;  2WLI A;  5EBW C;  1EN6 A;  4MSW C;  2QKC A;  3RVZ A;  1VIB A;  3A0B Z;  2MW2 B;  5KAI Z;  3JAW B;  4FLT A;  4PA4 A;  3ZN1 A;  4DR1 B;  3OFN G;  5B1B B;  1TVK A;  2WA3 A;  5KMG B;  1WP8 A;  4LP8 A;  1JJ2 U;  1ZUQ A;  2PYL A;  2GUZ B;  2PI5 A;  1J95 A;  4E2L A;  1QLN A;  4DV4 O;  1Q81 W;  3OD4 A;  5K1P A;  4WBN A;  3I55 V;  2K9P A;  5BZB A;  4LF4 O;  1WPX A;  5LXT B;  1K4D C;  1Q6I A;  4QJF B;  1MAB G;  2JEU A;  1F7Y A;  1XNQ O;  3SYQ A;  2VQF B;  4IYH A;  5B5E Z;  1Q5O A;  2E74 B;  1MG1 A;  3ABK C;  5E79 Z;  2WLM A;  5ITZ A;  3STL C;  2F66 C;  1BE3 H;  1HW7 A;  3VQY A;  1WN7 A;  2HP8 A;  1GK9 A;  4DUY B;  3H9V A;  1BS3 A;  4H44 B;  2A06 H;  4UB8 Z;  1G8M A;  3CXC U;  1R3K C;  1Q6H A;  3MHS C;  3SJB C;  3U0Z A;  1GN4 A;  1N8R W;  1BGY H;  3CC7 V;  4DV3 B;  4NR1 A;  3OW2 U;  4JF3 A;  1BT8 A;  3ABU A;  1HR0 B;  5KMG A;  3AK1 A;  2AHY A;  2GUZ A;  5C93 A;  4L87 A;  2V1D A;  4DV6 B;  2ODM A;  4JZG A;  4LFB O;  4JAS A;  1YJW V;  2RQ6 A;  2CGO A;  2ZNJ A;  3RYC B;  5LMN B;  3SDL A;  1K34 A;  4JI4 B;  3SPC A;  4X64 B;  1FOU A;  4GUN A;  5LXT A;  2G38 A;  5EIB C;  4DR7 O;  4CH4 A;  1VAR A;  2GHY A;  1FFX B;  3OGC C;  2P67 A;  4DV2 O;  3RW0 A;  2IU0 A;  3AK3 A;  3TCU A;  2ATK C;  4PJ0 Z;  2OTL V;  2DYS C;  5LMU B;  4PI0 A;  1CEZ A;  3KDR A;  4QPK A;  1M57 C;  1L1F A;  1S5L Z;  4JI3 O;  4RAI A;  3DC6 A;  4TT3 G;  4RUF A;  2ZCE A;  1N0N A;  1XHX A;  3K9S A;  1Q90 D;  1SF9 A;  2NNU A;  3CC2 V;  3M8A A;  5C8Y B;  3K04 A;  4DR6 O;  2E76 B;  4LF9 O;  3TXQ A;  1G4Y B;  1GKF A;  3DSQ A;  2A7W A;  1TUB B;  5IY5 B;  2DWD C;  3X2Q B;  3APO A;  1VEW A;  1D5N A;  2P06 A;  4W4L A;  2KG7 A;  1H2L A;  3JAR B;  4K8X A;  1FAF A;  3JCZ A;  3EHB B;  5JJJ B;  1IDS A;  4MTG A;  3CCE V;  2QEX V;  4LFA O;  4JYA B;  5CA0 B;  3N27 A;  4PDV A;  5BMV B;  3K5N A;  2AW9 A;  4IGG A;  3RYC A;  1N36 O;  1BMF G;  4WFE A;  3CRC A;  4LF6 O;  2ZM6 B;  4MVM A;  1QR9 A;  3RFR A;  2Q6A A;  5KHH A;  3H1I H;  2Q7E A;  3C3S A;  2WLH A;  4UCR A;  4TQF A;  5CBG A;  4Q20 A;  4U7N A;  2KB1 A;  2YDE A;  1TA8 A;  2GDS A;  4PDL A;  4DR1 O;  1M93 A;  1KC8 W;  3ZCC A;  3KKY A;  3VQX A;  1I5X A;  2UXX A;  3G71 V;  3ASO B;  1IXB A;  1P49 A;  3H1L H;  3VOU A;  4I7Z B;  5J9P C;  2N74 A;  2L6L A;  4YY3 B;  1TUB A;  1KQS U;  3A0R A;  1V55 C;  3ETD A;  1M9N A;  4PA6 A;  4PI2 A;  4X62 B;  3B40 A;  2P5O A;  5D5Q A;  1BL8 A;  4ZBM A;  2QA4 V;  5DED A;  2HR3 A;  3JAR A;  4UVC A;  1X4T A;  1H38 A;  2P22 C;  1DF4 A;  3JAT B;  5LGN A;  4J11 A;  5CA0 A;  2QWO B;  2ZXW C;  4J9Y B;  5BMV A;  3CCL V;  1TUE B;  4LH6 A;  5K1X A;  2EIK C;  1D5A A;  2HLD G;  1J5E O;  4DUY O;  4X20 B;  4KL1 A;  4I9Q A;  4CS3 A;  1H8E G;  5DM6 V;  1SER A;  1HNZ B;  4R8C A;  1SQF A;  2BTO A;  1GM8 A;  1YCI A;  1AI6 A;  3PN1 A;  1RM1 C;  4DV3 O;  1Z2G A;  4LFC B;  2A79 B;  3E2E A;  2XTA A;  3L74 H;  1HDJ A;  4GKJ B;  4HYO A;  3WG7 C;  4X65 O;  3ABK B;  1AR4 A;  2W0F C;  3I5D A;  3OTF A;  3KCY A;  4DV6 O;  1VQ4 V;  2OYQ A;  2P6J A;  2YEV B;  2NR5 A;  3ZRW B;  3D36 A;  4JI4 O;  3SPJ A;  5GW7 A;  4X64 O;  1VQK V;  2QKA A;  1FD9 A;  2BOC C;  1HNW B;  1QBZ A;  1NTZ H;  5B1A C;  1EN4 A;  4AIL C;  1Q86 W;  1WB7 A;  4P30 A;  2Q7G A;  2FTK A;  1UFI A;  1KEC A;  4O4H B;  4D7T A;  3CMA V;  2WA4 A;  4JI1 B;  4X20 A;  4K0K O;  1ENV A;  4GT1 A;  3UO2 A;  5IYB O;  5JJE B;  3EVK A;  1Y76 B;  4GKK B;  5F2V O;  2XAG A;  2DYS B;  4C7U A;  3K9A A;  1P7B A;  3D3Q A;  1M57 B;  4D6T H;  2OCC C;  4O2B B;  4JI2 O;  3WU2 Z;  3BHP A;  2F43 G;  5EIB D;  2YEV A;  3ZRW A;  3OAA G;  2LGW A;  1N33 B;  1ZAU A;  3L70 H;  2D2C B;  2YC0 A;  2ZM6 O;  5IT9 N;  1NR1 A;  5IJ9 B;  5J2U B;  1WP7 A;  3N2K B;  1BHA A;  2ZE5 A;  3OUS A;  3W7W A;  1S3J A;  3T4D A;  2QWN B;  1XUQ A;  1QHT A;  1IXM A;  2ARH A;  4U3J B;  3UKM A;  4O4H A;  1A32 A;  2XOK G;  2UUB B;  3VQV A;  3ABL C;  1IJG A;  4BW9 A;  3WB1 A;  1K4C C;  4X1I A;  1X59 A;  4OXS A;  1K8A W;  3E35 A;  1Y76 A;  4PV1 B;  2LQT A;  1AVM A;  4B3R B;  1JNB A;  2DYR C;  4X62 O;  2RJZ A;  1GMG A;  2ITC C;  2ZE7 A;  2Y4T A;  3BEH A;  1KP3 A;  4ZHQ B;  2GBO A;  3ZHS A;  3ZRX A;  5LA6 B;  1WLE A;  2DJV A;  2F23 A;  3ZMV A;  1SZX A;  3SJC C;  4QE9 A;  4HNA B;  1JX9 A;  1VMG A;  3ZHU A;  2XT9 A;  1V55 B;  5IJ9 A;  1AR5 A;  2EIM C;  3N2K A;  3ZIA G;  1YIJ V;  2VRZ A;  5EC1 C;  2EIL C;  3SYO A;  3BA9 A;  1PD3 A;  2Q69 A;  4OPA A;  1QQC A;  4BIO A;  2CE4 A;  3QVN A;  3I56 V;  4U3J A;  4JV5 O;  1BSM A;  2ZXW B;  4FZ0 A;  2EIK B;  3RYI B;  4MVO A;  4HAM A;  1W0J G;  4YJ3 B;  2PZS A;  5BXZ A;  4H33 A;  1GH6 A;  2ZDI C;  1SS3 A;  5B66 Z;  1FJG B;  1ORQ C;  1QR8 A;  2IH1 C;  5IYD O;  3K5O A;  3B8N A;  5H6R A;  4JAA A;  1HNW O;  3QO5 A;  4LFB B;  1RM1 B;  1XNR O;  1M5I A;  4ZHQ A;  1COW G;  2ILM A;  2JVD A;  4LBE C;  3WG7 B;  1O9G A;  1XL6 A;  5LA6 A;  4B7K A;  3PJS K;  2DOS A;  1FXH A;  4FLW A;  3CCU V;  1PNM A;  3CD6 V;  4LNU B;  1VQN V;  4JI1 O;  4JYY A;  1NTK H;  2R9R B;  1WPB A;  4JAV A;  1HWY A;  5CA1 B;  4JI3 B;  3OMN B;  1O9H A;  2E75 B;  1M4U A;  1H8H G;  5B1A B;  2YI9 A;  3J7A U;  3A8T A;  1ZSP A;  2FYU H;  1S77 D;  1I5Y A;  4DR6 B;  1JVM A;  1YJ9 V;  1YJN V;  3RYI A;  2ZIO A;  4GX2 A;  4YJ3 A;  5GTI Z;  4GX1 A;  3R66 A;  3JYC A;  2ZIN A;  3FKS G;  4FJC C;  1XMQ O;  3AG3 C;  3WB2 A;  2F95 B;  2KKW A;  5EC2 C;  1Y4M A;  4DYL A;  1P7G A;  4JI7 B;  3ASO C;  3JD3 A;  4FMT A;  5E1A C;  4FLU A;  4MS2 A;  2YS8 A;  4LF6 B;  3K57 A;  3IJ4 A;  1JQ0 A;  2OCC B;  1KD1 W;  3LSU A;  3CCQ V;  2PYJ A;  2QWP B;  1F51 A;  2YXH A;  2UUB O;  4KFM A;  3OR7 C;  2AGA A;  3FAV B;  2VS0 A;  4LNU A;  1B6Q A;  4PD4 F;  1FXK C;  4UXN A;  3CSX A;  4KXR A;  4MT8 A;  5GON A;  2R72 A;  2JDI G;  3RYF B;  4FLZ A;  1NU1 H;  5CA1 A;  2OT5 A;  5H2F Z;  5EZY B;  4B3R O;  1DLB A;  4UUJ C;  3N2G B;  3LUT B;  3UCS C;  1MZF A;  1SQX H;  3CRM A;  4NVP A;  2HJD A;  4W4K A;  4PDM A;  1R6T A;  4LCU C;  1KU9 A;  1GAX A;  3ABL B;  3JD2 A;  1K9M W;  1KKC A;  4GYC B;  2NN4 A;  2YIA A;  4PEL A;  1FS0 G;  4A5U B;  2HKO A;  2DYR B;  3SGI A;  2ZD9 A;  5KX5 B;  1UJW B;  5LHH A;  1VQ5 V;  2V4D A;  1ZLZ A;  2ZT9 B;  1K33 A;  5B1N A;  2BOB C;  3K0G A;  4NTY A;  1J5E B;  1RP3 B;  4NXM B;  1XL4 A;  1H5W A;  4U7O A;  2KSD A;  5FNV B;  4CH3 A;  4EB6 B;  2XND G;  3FAV A;  3J80 N;  2LP7 A;  4MVU A;  2ADQ B;  1NS1 A;  4UCS A;  2Y48 A;  4X89 A;  3L72 H;  1MZE A;  2KG7 B;  3OM3 B;  3RYF A;  2EIM B;  1FJG O;  4J42 A;  1JJO A;  3CEI A;  3CCS V;  3T1C A;  2EIL B;  3LSS A;  5EZY A;  2H8P C;  4X65 B;  4I4T B;  3N2G A;  1E1Q G;  4HBN A;  3ZMZ A;  1IZ3 A;  4FLX A;  3HKE B;  3ETE A;  5IJ0 B;  1XIL A;  3K79 A;  2B9Z A;  4DUZ O;  2LGQ A;  4DV7 O;  4LF5 B;  2A3Q A;  4K35 A;  2P7T C;  2CTQ A;  4RQF A;  1AI5 A;  2HVK C;  1NTM H;  1S0V A;  5KX5 A;  1Q6U A;  2Q7H A;  3B2E E;  1W2B U;  1GM7 A;  2F4V O;  3P30 A;  1SRY A;  1I7F A;  2LW1 A;  5EBM C;  2D3O W;  5FNV A;  3CCJ V;  4K0K B;  1SA0 B;  3IGA C;  1G6U A;  2CAZ C;  4EB6 A;  5KA6 A;  1WAZ A;  2JJ2 G;  2M7W A;  3THO A;  1Z5W A;  1F4N A;  1OV9 A;  4I50 B;  2RNB A;  3JAK B;  5JQG B;  2UXD B;  1JR9 A;  3SYP A;  2YI8 A;  4PA9 A;  1K92 A;  3HB3 B;  2BSK B;  4TOI A;  1DGS A;  2E3C A;  3CME V;  4I4T A;  4WFG A;  4FIP C;  5KHJ A;  3W7X A;  4JI2 B;  2YID A;  3HKE A;  4JI7 O;  2WWW A;  2QM8 A;  5IJ0 A;  2OTJ V;  2P4K A;  4FM0 A;  2AHZ A;  4ICG A;  1DF5 A;  4UV8 A;  2M6Y A;  3G6E V;  2ZDI A;  2K1E A;  1V54 C;  2ADP A;  4O2A B;  4JTA B;  1BQZ A;  3AG3 B;  1VQ9 V;  3S3W A;  4IYI A;  4WFA V;  3AEI A;  1QVG U;  3CS5 A;  2P4V A;  5HFM A;  3TJT A;  1K3E A;  1YF2 A;  3H1H H;  1W0K G;  4I0X B;  1MMM A;  1Z5V A;  3G80 A;  5L3B A;  2EIN C;  4F6E A;  4NXN B;  4ZI7 B;  1SA0 A;  1EN5 A;  1QCE A;  3AG4 C;  4I50 A;  1FXK B;  3JAK A;  5JQG A;  1WB8 A;  1FFT B;  5EYP A;  3A0H Z;  4HZ3 A;  4RUE A;  4B08 A;  2AZ0 A;  2BSK A;  3M7M X;  5CN0 A;  3ZJZ A;  1OCZ C;  2HFE C;  1F4M A;  2XUM A;  4LH7 A;  1XBL A;  1N0J A;  1BCC H;  1IX9 A;  1Y67 A;  2GV9 A;  2OWO A;  2MK3 A;  2QR4 A;  3ETQ A;  5JVD B;  4B3M O;  2WLK A;  1VQL V;  4NXM O;  3MHH C;  5FL7 G;  4WFF A;  5B3S C;  1YHQ V;  3KG2 A;  2ZE6 A;  4FVM A;  3F7Y C;  2IBZ H;  4GX0 A;  3CWB H;  2B1G A;  2N05 A;  4O2A A;  4DR2 B;  5HFL A;  1Q7Y W;  1M1K W;  1Q43 A;  2OIE A;  4YXW G;  5JWP A;  4F6R B;  3Q4H B;  3SPG A;  3AK2 A;  2QM7 A;  4I0X A;  4JV5 B;  3CCM V;  1CPY A;  2A0L A;  1SQP H;  4LF7 B;  4FM2 A;  4ZI7 A;  1KBH A;  1MNG A;  3ZMT A;  2EX3 A;  3RBZ A;  1SES A;  1I08 A;  1FXK A;  4QE7 A;  4YJ2 B;  4FFB B;  4LF5 O;  3ZRS A;  1R3L C;  3OTO B;  3MAQ A;  1XNR B;  1US6 A;  2DMX A;  2Y0P A;  3E86 A;  3G6B A;  2R9A A;  2QE7 G;  4EFB A;  1PKX A;  3EFF K;  5JVD A;  1R6K A;  2UXB B;  1CXZ B;  5IYC O;  3ETG A;  4AI8 A;  4X1I B;  1PNL A;  2DQ0 A;  3QO7 A;  3CRR A;  4IL6 Z;  2HHH B;  2QGN A;  5CMU A;  2UXD O;  5DEC A;  2X6A A;  4I9W A;  1VQO V;  4F6R A;  3APQ A;  3Q4H A;  1H2M A;  2LJ2 A;  2XAJ A;  4AQY O;  4MVR A;  1URF A;  2Q67 A;  1YEW A;  1VF6 C;  2Z3Y A;  2XAS A;  1PM9 A;  3SPI A;  5LP6 C;  2OCH A;  3CJH B;  2Q0O C;  1OHH G;  2LFR A;  5KHG A;  3L9D A;  4UCO A;  1HP8 A;  1XMQ B;  2FML A;  3K59 A;  2UU9 O;  1GO3 F;  3T1H O;  3ABM C;  3OGI B;  4YJ2 A;  4R6Z A;  4EFE A;  4FFB A;  4UCV A;  2YXL A;  2YIC A;  1U96 A;  2Y69 C;  1NZ6 A;  1KMI Z;  5IWA B;  2EIJ C;  1QU7 A;  3CRA A;  3F5W C;  4G2K A;  4UVA A;  4G28 B;  1E79 G;  2CK3 G;  3JAL B;  2R9I A;  1FPO A;  2IJK A;  2VQE O;  2GTA A;  1H2N A;  3JAM N;  3T1Y O;  3K3W A;  3B09 A;  5KA5 A; 
#chains in the Genus database with same CATH homology
 4JZG A;  1MNG A;  3C3T A;  1IXB A;  2P4K A;  1MA1 A;  1I08 A;  1SZX A;  2ADQ B;  3IC9 A;  5AG2 A;  4GUN A;  3BFR A;  2ADP A;  1EN6 A;  1AR5 A;  1VAR A;  2QKC A;  3EVK A;  3CEI A;  1XDC A;  4X9Q A;  1AP5 A;  3TJT A;  3AK3 A;  1MSD A;  1MMM A;  3MDS A;  1P7G A;  4C7U A;  1GN3 A;  1ZUQ A;  2CE4 A;  1ZTE A;  3QVN A;  4F6E A;  2RCV A;  3KDR A;  3LSU A;  1BSM A;  3DC6 A;  1QNM A;  1EN5 A;  1LUW A;  1XIL A;  1N0N A;  3K9S A;  4YIO A;  1WB8 A;  3OT7 A;  1B06 A;  5A9G A;  1VEW A;  3DC5 A;  4BR6 A;  1I0H A;  1D5N A;  4FFK A;  1XRE A;  2CDY A;  1N0J A;  1PL4 A;  1IX9 A;  1PM9 A;  1XUQ A;  1Y67 A;  1IDS A;  1AR4 A;  2AW9 A;  1BS3 A;  4JZ2 A;  1GN6 A;  1KKC A;  1LUV A;  1JR9 A;  4JYY A;  1EM1 A;  3RN4 A;  4E4E A;  3C3S A;  2QKA A;  1AVM A;  1GN4 A;  3AK2 A;  1AP6 A;  1JA8 A;  1GN2 A;  1BT8 A;  3AK1 A;  1ZLZ A;  4YIP A;  2GDS A;  1EN4 A;  1ZSP A;  1WB7 A;  3KKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...