1EN4A

Crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANHDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 72
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en4A02
1PL4A 2ADQB 3C3TA 2ADPA 1Y67A 4JZ2A 1I0HA 1BS3A 1MNGA 1SZXA 3KKYA 3OT7A 3AK2A 1BSMA 1WB8A 3K9SA 3AK1A 1AP6A 1VARA 1IDSA 1ZTEA 1QNMA 1LUWA 1XDCA 4JYYA 1IX9A 1I08A 4BR6A 4FFKA 1MA1A 4YIOA 1AR4A 1ZSPA 3EVKA 1EN4A 1ZLZA 2QKCA 1PM9A 2AW9A 1P7GA 1AR5A 5AG2A 1JR9A 4YIPA 1MMMA 1KKCA 2GDSA 1LUVA 1XILA 5A9GA 4E4EA 1EM1A 1GN6A 3CEIA 3RN4A 3AK3A 3QVNA 3IC9A 3BFRA 1GN2A 1WB7A 1EN5A 3DC5A 1XUQA 1GN3A 4JZGA 1GN4A 1VEWA 3C3SA 1JA8A 4C7UA 4GUNA 2QKAA 1MSDA 1EN6A 2CE4A 1AP5A 1ZUQA 1N0NA 1AVMA 4F6EA 1IXBA 3MDSA 3DC6A 1N0JA 3LSUA 1D5NA 1BT8A 2P4KA 4X9QA 3TJTA 2CDYA 1B06A 2RCVA 1XREA
chains in the Genus database with same CATH superfamily
4ZIBA 1PL4A 2IU0A 3OM3B 3H1IH 5JJEB 1VQNV 4DUZB 3KKYA 4A5UB 2ZM6O 1WP8A 5B3SB 2MK3A 3IFXA 3UT5B 2UXCO 2KQXA 3G80A 1IX9A 2Q6AA 2UXNA 4H33A 3LDEA 1PV0A 2PYLA 4MW8A 3E8HA 3DGEA 1YITV 1MA1A 2QGNA 4FIPC 4I5SA 1O9GA 5JCOA 5CA1B 4F6RA 2F4VO 4O2AA 1JMKC 3T4DA 4DV1B 2FB5A 4JI4O 1OCZB 2OCCB 4CH3A 2N05A 5AG2A 4D7TA 3T2MA 2GTAA 2A7WA 1JX9A 1PL0A 2LP7A 3QF7A 3W7TA 5BY1A 1NKDA 4TUYB 1OCOB 3ZMSA 3R66A 1UFIA 1G8MA 2Q69A 2AGAA 3H01A 1Y74A 1VQ4V 2FTKA 3QO8A 4WF9V 4O4IB 4RWUA 2UU9O 2BOBC 4I0XB 4DR1B 2F95B 3CJHA 2HHHB 3JSNA 5B1NA 1EZJA 4C7UA 4R8CA 5BMVB 4U3JB 5BZBA 2EJ7A 3ASOC 3QO7A 4R7CA 2ATKC 5EZYA 4LF7B 2BCCH 3U11A 1K3EA 1MG1A 3JD1A 1NI8A 4YHHB 4O4HA 4K0KO 3CCVV 4GYCB 2CTPA 3CXHF 4JYAO 1K8AW 5IY5B 4JAAA 4UV8A 4NYKA 2UXBO 5IDJA 1AROP 3AG3C 3IAYA 3ZRSA 4PDRA 4KXRA 4K3AA 2DQ3A 2KKWA 2ZD9A 1FS0G 4BIUA 3S3XA 3FYEB 1QR8A 3KCXA 4MVUA 4X1KA 1WB8A 3X2QC 4DUYB 1W0JG 2JEXA 3AK1A 4ASUG 2Y4UA 4H0LB 4FK5C 1VF5B 2Y0PA 5LOVB 2EX3A 4FLVA 3JATB 4LWSA 4TOIA 4DR5O 5C8YB 1QCEA 2GBOA 2YI9A 5B1OA 4NXNB 2F43G 2ZIOA 3F5TA 2GSMB 2HVKC 1LUVA 1R1BA 2HVJC 3WB1A 3ASNB 4MVOA 3CHXA 3K9AA 1Q82W 4LF6B 1PPJH 1H2GA 2GUZB 1WN7A 1HW7A 3BFRA 4Q20A 3JARA 3H1HH 1WNSA 4X89A 3SYOA 4DRXA 1CP9A 2M6YA 2AZ0A 2V1DA 2OT5A 2Q8VA 4IYIA 3JAWB 1W0KG 3HKBB 1FYJA 5FNVA 1Y74B 2W0FC 4R6ZA 2Y0IA 4JAUA 1QLEB 3OMAB 4AHCA 5DEDA 2QWNB 1SRYA 3TK1A 3CRQA 1N8RW 4MTXA 1N0JA 1MABG 2JGDB 4DR3O 3T1HB 1BT8A 4I9WA 3CC4V 1S76D 1YIJV 3SYQA 4X9QA 5HFLA 3C90A 2HFEC 2R9RB 5H2FZ 2GHYA 1Y76A 3OTFA 1N32O 2WA3A 2E3CA 2JIZG 3G6BA 4JZ2A 5LA6B 3CCQV 3TCUA 5KLVH 1MNGA 1QR9A 4LFCO 1NU1H 2OTJV 3K06A 3BEHA 3UO3A 4BWAA 2Q0AA 3J81N 2JJ2G 4FFKA 2DJVA 1Q6UA 2ZE8A 5LOVA 3P3NA 3SDLA 1Z5VA 3H9VA 4DR5B 2QKCA 3VQYA 2D3OW 2XAQA 5D5QA 3CC7V 2RNBA 1M4UA 5GTIZ 4JI1B 3NR7A 5B1AB 1PD3A 3CCMV 1F4MA 1WPXA 2QTSA 2W0XA 1HNXO 3L71H 1HDJA 5CA0A 4CBCA 3RN4A 4AQYB 1XL4A 2P22C 2BOCC 3VQVA 1RPOA 3DC5A 2Q0OC 5IJ0A 2X6AA 4NVPA 4HZ3A 1JFFA 3D36A 1RM1C 3K3WA 3JD0A 1SETA 1SQPH 3ABMB 4UFZA 3Q4HA 1Q81W 4HNAB 5FPOA 1QU7A 1R6KA 4LF7O 4FZ1A 1MZEA 5GONB 1ORQC 3B8MA 5EBWC 1S0VA 1Q3EA 1FKAO 3ABLC 1OCRC 1M57B 1FXKB 4O2BA 2JK5C 4LCUC 4DV2O 2GV9A 1FXKA 1NR7A 4DV2B 1NS1A 1PNMA 1H2LA 1RFYA 2ILMA 1YJNV 4GKJB 1NQTA 2XTAA 2UUBB 1VIBA 3JARB 1TUBA 1AILA 1NT2B 4J9ZB 3OMIB 5GONA 3K04A 2HR3A 4NTWA 3APQA 1XDCA 1WAZA 1KD1W 5LBQA 1XNQO 4IHJA 4FLXA 4HNAA 3CCEV 3RYHA 2EIKC 4LF5O 1DF4A 1OZ0A 4XDLA 5LXTB 1N33B 1ZLZA 1RSOB 1VQ7V 2WLLB 4H44B 1IVSA 2CGNA 1VQKV 4YJ2A 2FL4A 1KKCA 3SGIA 3QG5A 4MS2A 2HLDG 2UUAO 1I94O 4L8JA 3K57A 1E1RG 3OTOB 3AG4C 4JV5B 5EC2C 1T5EA 3IGAC 1G4YB 1WB7A 4QE9A 1JOYA 4DW1A 1BL8A 1HWYA 4JZGA 1R6NA 1VF7A 4LNUA 2CTWA 5EIBC 4I55A 4CH5A 2ZIMA 1TA8A 2Q7EA 4X1YA 1IBMB 3I5DA 4UCSA 3WB2A 5KHIA 1IBMO 1NR1A 4RUFA 2KG7A 5EC1C 3FFQA 4QPJA 4JI5B 4ZHQA 3VQWA 2R70A 1SQXH 3K0GA 3J7AU 1FFTB 3MAQA 4I0XA 3E22A 4MVSA 4I9QA 1BQZA 2PUSA 3L70H 1SQVH 2JEUA 5LHIA 4U7OA 3ZHVA 2A79B 2DQ0A 2CUGA 2L6LA 4UB8Z 1DK1A 1N32B 4JV5O 2QR4A 3OTOO 1BSMA 3GVMA 1SERA 1MZFA 1JJ2U 2VWKA 4W4KA 4DR4O 1I7FA 1IDSA 3FAVA 2UXBB 4PDLA 4NR1A 1J95A 1NTZH 1N36O 2OIEA 2YS8A 1E1QG 1Q90D 2NR5A 2ZINA 1H2SB 3L75H 1F7YA 2XT9A 2FKXA 1FFXA 5J2UA 3SPCA 4YY3B 1XMOO 4UB6Z 1D5AA 2ZQMA 1RM1B 1OCCC 4DV5B 1XILA 1GH6A 1AB3A 3VOUA 1L1FA 3I55V 1Q43A 2UUBO 2E5LB 2Q7GA 2QTOA 3ZN1A 4DR1O 2BSKB 1YF2A 2W6JG 2WLNA 3R65A 1K4CC 3ABKC 1VQ8V 1NJIW 3RGBA 2V7QG 4X1IA 5CBFA 5DM6V 4P30A 3W7XA 4WCEV 1IXMA 1BHAA 4ZBMA 4NXNO 4LR3A 3K59A 2R72A 3OGIB 5KAIZ 2OIGA 1ZUQA 2EZOA 1XQ8A 1PP9H 5IT9N 4J41A 1GMGA 1RP3B 2YSUB 4DV3O 5L3DA 2QDOA 1J5EO 2B5UA 4FLZA 3FX7A 1SC5B 2Z3YA 4XDJA 4DUYO 1TGOA 2EULA 1WLEA 2A06H 4PI2A 3F5WC 5IYZB 4FJCC 1S5LZ 1Q8IA 4JYCA 3ZIAG 1JPXA 4DUZO 4AILC 3ZRXA 1S5JA 4L87A 2Z5UA 4BIOA 2W6IG 2JVDA 1D2DA 2QWRB 3LSQA 1KP3A 3CCLV 2Y69B 3SJCC 3ZS8C 5BR8B 4KFMA 4UVBA 3OW2U 5B66Z 3JCUZ 2QM7A 4ZOLB 2QWQB 5LP6C 4WFAV 5IWAO 4U3JA 1K5SA 2JGUA 5J2UB 3B4SA 2AW9A 3CRAA 2LW7A 1M1KW 3M99B 4WFGA 1XHZA 3DSQA 1TAEA 2EILB 3E8BA 5B1AC 2GDSA 1YTFD 3ZRVA 3ETDA 1AJQA 2UU9B 3D3IA 3IC9A 2KB1A 1KYOF 4H13B 4JTAB 5IE9A 5GW7A 1GN3A 2IH3C 3D36C 2RJZA 2K1EA 2XAJA 4X1IB 4B3SO 4U7NA 4GLXA 1JA8A 4X20B 1AI7A 1EN6A 4MVZA 1L0NH 1M5IA 3J80N 2IJKA 4B3MB 2ODMA 2YDEA 1P84F 2QEXV 1FJGB 3CSXA 3CS5A 2NLJC 4RO2A 5JJJB 4DV4B 3LSUA 3T1YB 3HKDB 4FFBA 4IGGA 3KCYA 1KBHA 3B77A 3RWRD 1FPOA 5EBMC 1FXHA 1WA8B 2O57A 4LF4B 1Q6HA 1YJ9V 4NXMB 2YXYA 3ZN0A 5CN0A 1AI6A 2ADPA 4HAMA 3CCRV 2HJFC 3ETQA 2V4DA 4DV6O 1SZXA 4GX2A 2R9IA 4Z1MG 5L3GA 3H1KH 1IURA 3BA8A 3RYCA 3AK2A 4LFAB 4YJ3A 3ZRWB 4RUEA 1ZWIC 1AP6A 1K92A 4JI3B 4ZKIA 5K1XA 2ZT9B 4DR2B 4X64O 4PD4F 1US6A 5J9PC 5JQGB 4LF9O 4XDKA 2MW2B 4G2KA 4OXSA 3CWBH 2LO1A 2Y4TA 2WLMA 2BSKA 5JVDB 4CS4A 1EN4A 4EFBA 1CPYA 5IYBO 3FB6C 3K5NA 4J11A 4CC5A 1BE3H 1YHQV 4O4LB 2EIKB 2ZR3A 4JTDB 4E4EA 1DLBA 3MHSC 1IBLB 3CPWU 2DE0X 2AZ2A 2DYSC 3JAKA 2N04A 5B1BC 3ZHUA 4PDMA 4JI2B 1XUQA 1YI2V 3WG7C 3IJ4A 1X59A 4UCVA 4GUNA 5LHGA 2YIDA 1TUEB 1H2NA 4YHHO 2WLIA 4LNUB 3AEIA 3ZMVA 3W7SA 1IXBA 5LHHA 2C2AA 2Q7HA 4X1KB 3CRCA 4GT1A 1XMQB 3ZBHA 4LF8O 3TJTA 5LYJB 1MOFA 3BA9A 3CCSV 4UCRA 4MVMA 4DRXB 1F23A 1H8EG 3EHBB 4J7ZA 5KHGA 3RYFA 2DWEC 3N2KA 3G67A 1URFA 1NH2B 1SZTA 4QPKA 4YJ3B 1SQQH 3CJHB 1IBLO 3O65A 5CBHA 3CC2V 5J2TA 3FD9A 3AG4B 5LA6A 3G6EV 5KA6A 1ROPA 5KHJA 2WLIB 3E22B 1PKXA 3E35A 2LFRA 3B40A 4WBNA 3M8AA 3N2GA 3OD4A 3SPGA 1V55C 2H8PC 4DYLA 1Q7YW 4FPPA 3GWOA 1GKFA 1MMMA 4JAVA 4JI8B 3FB8C 1Q5OA 3CRRA 3BRCA 4DXWA 3AG1C 2VQFB 2P6JA 5TISZ 1P4RA 2YEVA 4FM0A 4LFAO 2NNUA 3RW0A 2EINC 1P49A 3GB7C 3ZMZA 4DR6B 1BGYH 1VEWA 3SPIA 4RQEA 2UXDB 1JVMA 3G71V 1I5YA 4OPAA 4OX9B 3JAKB 2QKAA 3ZHTA 4X20A 4UV9A 5L3FA 2ZDIC 4JI8O 1V54C 2GUZA 1N0NA 1AI5A 5H9CA 4J7JA 4KP4A 2IJJA 3FYIB 3BVOA 1TVKA 3AG3B 4QJFB 2PTMA 1VF6C 3CX5F 1VQ9V 2A0LA 4DV7B 3ABLB 3TXSA 3T1CA 1M57C 5GTHZ 1Y6XA 1XHXA 4Z2WA 3OFNG 4OPHA 2EIMC 5JQGA 1HNWB 3RYIB 4D7SA 4MTGA 3B2EE 3JSLA 3A2FA 4JI7B 2ZE7A 3OAAG 4P2ZA 1Z5WA 3SPJA 2ZKOA 1B6QA 4MVRA 1QNMA 1K9MW 5A2QN 3PN1A 4WFFA 1M90W 2XAFA 1UJWB 5LP6A 1AI4A 4LP8A 1Y76B 1R73A 2HEPA 1FAFA 5LP6B 2JGDA 5IWAB 1PM9A 4AI8A 3VBBA 1OCOC 4YJ2B 2RMKB 2M7WA 2OCCC 2F93B 1VQMV 4B7KA 1EM1A 2EZPA 2RQ6A 2PI4A 3CEIA 3K79A 2Z0AA 4JPRA 4I7ZB 1EN5A 3L9DA 2ARHA 1Z2GA 1VQOV 3W7WA 2LJ2A 4N21A 4TV8A 2QA4V 1XBLA 4EB6B 3ASOB 3RYHB 1G1XB 1JJOA 1WPBA 4ZHQB 1M9NA 5F2VO 4PHZA 4RAIA 3JASB 2OTLV 3LSSA 1QBZA 2E74B 2DW4A 2PYJA 1Y66A 1ZL8A 3FKSG 3MDSA 1M56C 4JASA 4CC6A 1GRJA 1HR0B 2CH7A 4F4LA 3K5MA 1M56B 4Q6GA 3STLC 2RCVA 3ETEA 4X62B 1S3JA 5H6QA 1NBMG 5H5NA 3ZCCA 2P5OA 3FB7C 2P90A 3HKCA 2Q5ZA 4O4JB 4F6RB 2PI5A 1N4CA 1VARA 4LF8B 3AG1B 1CEZA 4GKKO 3EFFK 3HKCB 1LUWA 4JYYA 3X2QB 1KP2A 3Q4HB 1XMOB 2JS3A 4MSWC 4DV4O 1XI1A 4X65O 1ZSPA 3EVKA 4YY3O 3KG2A 4MW3A 1H8HG 3I56V 5LMNO 1JR9A 3U10A 3E83A 5KHKA 5EK0A 2BTQB 3CYOA 2YI8A 4JI7O 4H37A 2N74A 4MTFA 3CCUV 2JS5A 4ZI7A 4W4LA 2F23A 3ABKB 1DTOA 4PA6A 1GN4A 2XAGA 4MTOA 4FM2A 2XOKG 4J9YB 4X1YB 4HBNA 4U3FH 4PELA 4JI6B 3LDCA 3F7VC 4DV0B 1GM7A 4CZZA 1KU9A 4JTCB 1M93A 3OGCC 4B3TB 1QLNA 2H3OA 4E2LA 4PA4A 1N34B 4LF9B 3DXRA 1HNZB 3CRMA 3JAWA 4OX9O 1JQ0A 2CH7B 4JI3O 4DR7O 2EJRA 4KHPO 5E1AC 1BMFG 4X8AA 1SA0A 2VQEO 2XAHA 2HG5C 1IBKO 4JI0O 4K8ZA 5IYZA 1XNRB 5LGNA 1KKDA 3MHHC 3SJAC 1GK9A 5FLXN 3B09A 2HJDA 4KL1A 2P06A 5J2TB 3CMEV 1K73W 2DMXA 1VP7A 4WFBV 3G4SV 2CTRA 2DN9A 3OE7G 2QJ1A 2VQFO 2LGWA 4FLYA 4EFEA 3UKMA 2UUAB 2JRIA 3RYFB 1NVPB 3TXQA 1I08A 4X66O 4LFBB 2A9HA 1GM9A 1P7BA 2EILC 1J5EB 2ZE5A 4YIOA 5LMNB 1K34A 1PNLA 1R3IC 4B3MO 1LNQA 2DYRB 3OR6C 4YIPA 1GO3F 3SR2C 1GM8A 2YICA 1E79G 2DYRC 3JD3A 5D5PA 4TV9B 1GN6A 1ENVA 2F1MA 3BY6A 1QHTA 5IYDO 4TWKA 5FPRA 2EINB 3T4ZA 4TUYA 3UM7A 3N27A 2XUMA 5KHHA 3OR7C 4X62O 3JD2A 2QM8A 2ZNIA 2E5LO 4O4IA 1UPGA 2B1GA 1QVFU 1OCCB 4ZOLA 2WLKA 4IL6Z 4EKWA 1MSDA 1NTKH 3GWKC 4LBEC 4I4TA 1YVWA 1HP8A 1VF6A 2P4VA 1VQ5V 2QWOB 4O2AB 5EIBD 5C93A 5CB4B 1N36B 3JCZA 3KZIZ 4QE7A 1R6TA 4BAYA 3D3QA 1XREA 3KDRA 3O9OA 1GAXA 2ADQB 1SESA 3DTUB 4IHJB 3W7UA 4PI0A 1Y67A 4QGPA 4BW5A 5CA3A 4PA9A 3K5OA 2WWWA 3OT7A 3OUFA 4AQYO 4JI0B 1IBKB 3RYIA 1ZTEA 2P67A 3HR0A 2JJ1G 2X0LA 3VQXA 4IIJA 1NH2D 2QM4A 4B3RO 4O2BB 4DR7B 3E89A 3OUSA 1GTOA 4FM1A 4JI1O 2XASA 5CBGA 3K08A 5ITZA 1HNZO 3LNNA 4OGQB 3RYCB 3SPHA 4CS2A 5LYJA 1K4DC 3H1JH 2WLJA 1AR5A 1V9PA 3EXAA 3LUTB 4X64B 2WPDG 3ASNC 5B1BB 1SQBH 2YXHA 2CAZC 3ABTA 5JJNB 2RN9A 3AK3A 1OCZC 4CH6A 4FLTA 2E75B 2LGQA 3A0RA 2WSSG 2ZXWB 1K5QA 5ITZB 3E86A 1OJHA 2CTQA 5LMUB 1QQCA 4FMTA 5H6RA 3HPLC 2H94A 4J10A 2VS0A 3C3SA 3A8TA 2KSDA 2Q9LA 4DV7O 2IU3A 2NN4A 4UVAA 4GX0A 1L8DA 5CA0B 4DW0A 3LDDA 4BW9A 3BAAA 3OMNB 4LF5B 4UUJC 3ABUA 4G28B 5L3CA 1S77D 4LFBO 1AR1B 3BPZA 3OEEG 2CDYA 2YC0A 2YIAA 1B06A 4JF3A 1MSWD 3D8CA 3RFRA 3UQ8A 2K9PA 4FVMA 5LMUO 4DR6O 1WP7A 2XNDG 5KX5A 3E2EA 1VQPV 1BS3A 1XNRO 3M7MX 1EFRG 4ABMA 2F66C 4GCZA 1L0LH 4J80A 3K9SA 3AG7A 2LW1A 3HKDA 4LF6O 1JFFB 1PNKA 1F4NA 2ZCEA 5CMUA 2YIBA 4J7KA 2EIMB 2YXLA 4J42A 1YCIA 3RVYA 1KB9F 1YEWA 2E76B 1AJNA 3BHPA 3E8GA 2XHBA 5BR8O 2ETNA 4DV0O 1K33A 4B3RB 4K35A 2ZNJA 3ZHSA 1B04A 2CK3G 1WA8A 1COWG 1H38A 2VRZA 2EIJB 3N2KB 1THZA 4D6TH 3N2GB 1R3KC 1YDXA 4YXWG 5KAFZ 4O4LA 1GN2A 1SF9A 5L3EA 2HP8A 2BTQA 3QTCA 2WAMA 3ZX6A 4NB5A 1XEQA 5L3BA 1W2BU 2ZXWC 1Y4MA 4JYBA 5C8YA 4FLWA 1HNXB 4Z1VA 5JH7A 3CCJV 2CE4A 4JGSA 2DYSB 5HFMA 4DV3B 4WFHA 4F6EA 2FMLA 2ZR2A 2ZDIA 1NTMH 3ZRWA 5FL7G 3DC6A 2IJHA 3WG7B 4UCTA 1SKVA 2IW5A 3JATA 1YZBA 3L72H 4LWSB 2ZE6A 1BCCH 4GKKB 1A32A 3F7YC 3DXRB 3SJQC 4GKJO 1DGSA 1EBOA 3BABA 1B3QA 3HKEA 1VQ6V 1W59A 5EBLC 3HKBA 3JALB 1YJWV 3CD6V 5DECA 4DV5O 3CB2A 3P30A 4NKGB 1HR0O 1ZL8B 4P9PA 4XBFA 1H2MA 1U97A 5DN6G 1RSOA 4BR6A 1SA0B 4B08A 1KUQA 2Y69C 1AR4A 4JI4B 3OEHG 5EYPA 2PY5A 3H1LH 4TV9A 2PF4E 3AG2B 3HKEB 4PA3A 4X66B 2L35A 3A0HZ 3HB3B 4EEQA 3SJBC 4DR4B 3QO5A 1YXBA 2UXCB 3IC7A 2UXDO 3FAVB 3QVNA 4GX5A 2ZM6B 2QSAA 2WLHA 3RBZA 3CXCU 1YSCA 1TVKB 3CMAV 2PGGA 2KG7B 4DV6B 4PV1B 3PJSK 4MT8A 3ICXA 2VQEB 4TV8B 4NXMO 4LF4O 1S72V 1YTFB 3S3WA 3U0ZA 4KHPB 1XL6A 4JI5O 2RDCA 2X6CA 1EZVH 1N34O 4GZRB 2X6BA 1AVMA 3ZHQA 3TGUH 4B3TO 2B9ZA 2ITDC 2YUAA 1FJGO 1R3JC 1F51A 1WJZA 3THOA 1R3LC 3ABMC 4LH7A 3SYCA 3L73H 4JI6O 4O4JA 1NZ6A 2YEVB 5IY5C 2JDIG 5IJ0B 4O4HB 2UUCB 4I55B 4NTXA 4G27B 1FXKC 1SS3A 1ZX3A 1V54B 1FD9A 1U96A 1Q86W 2LQTA 1I0HA 4UCUA 3ML0A 1RPRA 4IIJB 2BE3A 4PA7A 5JH7B 1BZKA 1IJGA 5LXTA 3UT5A 3P3PA 5IJ9B 5KMGA 2IM9A 3SYAA 1TUBB 1I94B 1K7DA 2VWJA 4IT5A 5BXZA 5B3SC 3ZJZA 3K58A 4FZ0A 4PDVA 2LFSA 3WFVA 3STZC 1N33O 2YIBD 1NVPD 4X65B 3RVZA 3A0BZ 3NXSA 3ETGA 2AHYA 1XNQB 4B7EA 1ZAUA 3BCCH 3LNMB 4R50A 2EIJC 3ZMTA 5K1PA 5EYPB 2PZSA 5CA1A 4UCOA 1CXZB 1S5HC 2AXTZ 2IJIA 5KUMA 1IZ3A 4WFEA 2A3QA 1FOUA 1AJPA 4I4TB 2G38A 1X4TA 3JALA 1FXVA 2OWOA 4HYOA 4IYHA 2QKSA 4I50B 4TSFG 4RQFA 1LR1A 4MVQA 1BHBA 3P32A 4DO2A 3JASA 2F4VB 3L74H 4LC1A 5FNVB 1H2KA 2R9AA 5JCOC 2OCHA 4P9OA 3K03A 1SQGA 2P4KA 4QIWF 2P7TC 3FB5C 3B8NA 4TQDA 4LH6A 2WLLA 4DR2O 1KECA 2Q73A 2X7RB 2AHZA 3RT3C 3C3TA 4NTYA 2EBOA 2DOSA 3APOA 3ZMUA 5KUKA 3UO2A 5LGTA 4GX1A 4K8XA 2IBZH 5JVDA 4UVCA 5BMVA 2Q4PA 3SYPA 4CH4A 1OV9A 4TT3G 2WA4A 2UXXA 3CP1A 4EB6A 5KX5B 5EZYB 4JYAB 4KUMA 1VQLV 1QVGU 5KA5A 1XMQO 3JD4A 4K0KB 1SQFA 1DF5A 4I50A 3T1YO 3AG2C 5E79Z 1BQ0A 4PJ0Z 4UXNA 4TQFA 2HKOA 3E8FA 1P7GA 4FLUA 5JWPA 3ZHRA 3WB0A 1O9HA 1XOUA 2B1IA 4DK1A 1KMIZ 2IH1C 3K5LA 1V55B 2CGOA 1Q6IA 2HHHO 2OYQA 3QNEA 4X88A 3WU2Z 5A9GA 4LFCB 1K97A 4B3SB 1FFXB 4JI2O 4WBNB 1KC8W 2QWPB 3K0DA 1HNWO 3TETA 2FYUH 2Y48A 1JCHA 3MD0A 4BIZA 4QNHB 2QE7G 2BTOA 3JAMN 3UCSC 2Q68A 2UUCO 5B5EZ 4ICGA 4DK0A 1I5XA 1OHHG 1VMGA 4DR3B 3T1HO 2Q67A 4CS3A 1JNBA 1AP5A 2D2CB 2GTSA 4DV1O 1G6UA 1OCRB 4FFBB 1KQSU 4N23A 4ZI7B 1QLEC 5LL6Y 3JYCA 1D5NA 2ITCC 2DWDC 5IYCO 5IJ9A 5KMGB 5CB4A 1H5WA 3ZEDA 5LGUA 3CE2A
chains in the Genus database with same CATH topology
3KDRA 1PL4A 2ADQB 3C3TA 2ADPA 1Y67A 4JZ2A 1I0HA 1BS3A 1MNGA 1SZXA 3KKYA 3OT7A 3AK2A 1BSMA 1WB8A 3K9SA 3AK1A 1AP6A 1VARA 1IDSA 1ZTEA 1QNMA 1LUWA 1XDCA 4JYYA 1IX9A 1I08A 4BR6A 4FFKA 1MA1A 4YIOA 1AR4A 1ZSPA 3EVKA 1EN4A 1ZLZA 2QKCA 1PM9A 2AW9A 1P7GA 1AR5A 5AG2A 1JR9A 4YIPA 1MMMA 1KKCA 2GDSA 1LUVA 1XILA 5A9GA 4E4EA 1EM1A 1GN6A 3CEIA 3RN4A 3AK3A 3QVNA 3IC9A 3BFRA 1GN2A 1WB7A 1EN5A 3DC5A 1XUQA 1GN3A 4JZGA 1GN4A 1VEWA 3C3SA 1JA8A 4C7UA 4GUNA 2QKAA 1MSDA 1EN6A 2CE4A 1AP5A 1ZUQA 1N0NA 1AVMA 4F6EA 1IXBA 3MDSA 3DC6A 1N0JA 3LSUA 1D5NA 1BT8A 2P4KA 4X9QA 3TJTA 2CDYA 1B06A 2RCVA 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PL4 A;  2ADQ B;  3C3T A;  2ADP A;  1Y67 A;  4JZ2 A;  1I0H A;  1BS3 A;  1MNG A;  1SZX A;  3KKY A;  3OT7 A;  3AK2 A;  1BSM A;  1WB8 A;  3K9S A;  3AK1 A;  1AP6 A;  1VAR A;  1IDS A;  1ZTE A;  1QNM A;  1LUW A;  1XDC A;  4JYY A;  1IX9 A;  1I08 A;  4BR6 A;  4FFK A;  1MA1 A;  4YIO A;  1AR4 A;  1ZSP A;  3EVK A;  1EN4 A;  1ZLZ A;  2QKC A;  1PM9 A;  2AW9 A;  1P7G A;  1AR5 A;  5AG2 A;  1JR9 A;  4YIP A;  1MMM A;  1KKC A;  2GDS A;  1LUV A;  1XIL A;  5A9G A;  4E4E A;  1EM1 A;  1GN6 A;  3CEI A;  3RN4 A;  3AK3 A;  3QVN A;  3IC9 A;  3BFR A;  1GN2 A;  1WB7 A;  1EN5 A;  3DC5 A;  1XUQ A;  1GN3 A;  4JZG A;  1GN4 A;  1VEW A;  3C3S A;  1JA8 A;  4C7U A;  4GUN A;  2QKA A;  1MSD A;  1EN6 A;  2CE4 A;  1AP5 A;  1ZUQ A;  1N0N A;  1AVM A;  4F6E A;  1IXB A;  3MDS A;  3DC6 A;  1N0J A;  3LSU A;  1D5N A;  1BT8 A;  2P4K A;  4X9Q A;  3TJT A;  2CDY A;  1B06 A;  2RCV A;  1XRE A; 
#chains in the Genus database with same CATH topology
 4ZIB A;  1PL4 A;  2IU0 A;  3OM3 B;  3H1I H;  5JJE B;  1VQN V;  4DUZ B;  3KKY A;  4A5U B;  2ZM6 O;  1WP8 A;  5B3S B;  2MK3 A;  3IFX A;  3UT5 B;  2UXC O;  2KQX A;  3G80 A;  1IX9 A;  2Q6A A;  2UXN A;  4H33 A;  3LDE A;  1PV0 A;  2PYL A;  4MW8 A;  3E8H A;  3DGE A;  1YIT V;  1MA1 A;  2QGN A;  4FIP C;  4I5S A;  1O9G A;  5JCO A;  5CA1 B;  4F6R A;  2F4V O;  4O2A A;  1JMK C;  3T4D A;  4DV1 B;  2FB5 A;  4JI4 O;  1OCZ B;  2OCC B;  4CH3 A;  2N05 A;  5AG2 A;  4D7T A;  3T2M A;  2GTA A;  2A7W A;  1JX9 A;  1PL0 A;  2LP7 A;  3QF7 A;  3W7T A;  5BY1 A;  1NKD A;  4TUY B;  1OCO B;  3ZMS A;  3R66 A;  1UFI A;  1G8M A;  2Q69 A;  2AGA A;  3H01 A;  1Y74 A;  1VQ4 V;  2FTK A;  3QO8 A;  4WF9 V;  4O4I B;  4RWU A;  2UU9 O;  2BOB C;  4I0X B;  4DR1 B;  2F95 B;  3CJH A;  2HHH B;  3JSN A;  5B1N A;  1EZJ A;  4C7U A;  4R8C A;  5BMV B;  4U3J B;  5BZB A;  2EJ7 A;  3ASO C;  3QO7 A;  4R7C A;  2ATK C;  5EZY A;  4LF7 B;  2BCC H;  3U11 A;  1K3E A;  1MG1 A;  3JD1 A;  1NI8 A;  4YHH B;  4O4H A;  4K0K O;  3CCV V;  4GYC B;  2CTP A;  3CXH F;  4JYA O;  1K8A W;  5IY5 B;  4JAA A;  4UV8 A;  4NYK A;  2UXB O;  5IDJ A;  1ARO P;  3AG3 C;  3IAY A;  3ZRS A;  4PDR A;  4KXR A;  4K3A A;  2DQ3 A;  2KKW A;  2ZD9 A;  1FS0 G;  4BIU A;  3S3X A;  3FYE B;  1QR8 A;  3KCX A;  4MVU A;  4X1K A;  1WB8 A;  3X2Q C;  4DUY B;  1W0J G;  2JEX A;  3AK1 A;  4ASU G;  2Y4U A;  4H0L B;  4FK5 C;  1VF5 B;  2Y0P A;  5LOV B;  2EX3 A;  4FLV A;  3JAT B;  4LWS A;  4TOI A;  4DR5 O;  5C8Y B;  1QCE A;  2GBO A;  2YI9 A;  5B1O A;  4NXN B;  2F43 G;  2ZIO A;  3F5T A;  2GSM B;  2HVK C;  1LUV A;  1R1B A;  2HVJ C;  3WB1 A;  3ASN B;  4MVO A;  3CHX A;  3K9A A;  1Q82 W;  4LF6 B;  1PPJ H;  1H2G A;  2GUZ B;  1WN7 A;  1HW7 A;  3BFR A;  4Q20 A;  3JAR A;  3H1H H;  1WNS A;  4X89 A;  3SYO A;  4DRX A;  1CP9 A;  2M6Y A;  2AZ0 A;  2V1D A;  2OT5 A;  2Q8V A;  4IYI A;  3JAW B;  1W0K G;  3HKB B;  1FYJ A;  5FNV A;  1Y74 B;  2W0F C;  4R6Z A;  2Y0I A;  4JAU A;  1QLE B;  3OMA B;  4AHC A;  5DED A;  2QWN B;  1SRY A;  3TK1 A;  3CRQ A;  1N8R W;  4MTX A;  1N0J A;  1MAB G;  2JGD B;  4DR3 O;  3T1H B;  1BT8 A;  4I9W A;  3CC4 V;  1S76 D;  1YIJ V;  3SYQ A;  4X9Q A;  5HFL A;  3C90 A;  2HFE C;  2R9R B;  5H2F Z;  2GHY A;  1Y76 A;  3OTF A;  1N32 O;  2WA3 A;  2E3C A;  2JIZ G;  3G6B A;  4JZ2 A;  5LA6 B;  3CCQ V;  3TCU A;  5KLV H;  1MNG A;  1QR9 A;  4LFC O;  1NU1 H;  2OTJ V;  3K06 A;  3BEH A;  3UO3 A;  4BWA A;  2Q0A A;  3J81 N;  2JJ2 G;  4FFK A;  2DJV A;  1Q6U A;  2ZE8 A;  5LOV A;  3P3N A;  3SDL A;  1Z5V A;  3H9V A;  4DR5 B;  2QKC A;  3VQY A;  2D3O W;  2XAQ A;  5D5Q A;  3CC7 V;  2RNB A;  1M4U A;  5GTI Z;  4JI1 B;  3NR7 A;  5B1A B;  1PD3 A;  3CCM V;  1F4M A;  1WPX A;  2QTS A;  2W0X A;  1HNX O;  3L71 H;  1HDJ A;  5CA0 A;  4CBC A;  3RN4 A;  4AQY B;  1XL4 A;  2P22 C;  2BOC C;  3VQV A;  1RPO A;  3DC5 A;  2Q0O C;  5IJ0 A;  2X6A A;  4NVP A;  4HZ3 A;  1JFF A;  3D36 A;  1RM1 C;  3K3W A;  3JD0 A;  1SET A;  1SQP H;  3ABM B;  4UFZ A;  3Q4H A;  1Q81 W;  4HNA B;  5FPO A;  1QU7 A;  1R6K A;  4LF7 O;  4FZ1 A;  1MZE A;  5GON B;  1ORQ C;  3B8M A;  5EBW C;  1S0V A;  1Q3E A;  1FKA O;  3ABL C;  1OCR C;  1M57 B;  1FXK B;  4O2B A;  2JK5 C;  4LCU C;  4DV2 O;  2GV9 A;  1FXK A;  1NR7 A;  4DV2 B;  1NS1 A;  1PNM A;  1H2L A;  1RFY A;  2ILM A;  1YJN V;  4GKJ B;  1NQT A;  2XTA A;  2UUB B;  1VIB A;  3JAR B;  1TUB A;  1AIL A;  1NT2 B;  4J9Z B;  3OMI B;  5GON A;  3K04 A;  2HR3 A;  4NTW A;  3APQ A;  1XDC A;  1WAZ A;  1KD1 W;  5LBQ A;  1XNQ O;  4IHJ A;  4FLX A;  4HNA A;  3CCE V;  3RYH A;  2EIK C;  4LF5 O;  1DF4 A;  1OZ0 A;  4XDL A;  5LXT B;  1N33 B;  1ZLZ A;  1RSO B;  1VQ7 V;  2WLL B;  4H44 B;  1IVS A;  2CGN A;  1VQK V;  4YJ2 A;  2FL4 A;  1KKC A;  3SGI A;  3QG5 A;  4MS2 A;  2HLD G;  2UUA O;  1I94 O;  4L8J A;  3K57 A;  1E1R G;  3OTO B;  3AG4 C;  4JV5 B;  5EC2 C;  1T5E A;  3IGA C;  1G4Y B;  1WB7 A;  4QE9 A;  1JOY A;  4DW1 A;  1BL8 A;  1HWY A;  4JZG A;  1R6N A;  1VF7 A;  4LNU A;  2CTW A;  5EIB C;  4I55 A;  4CH5 A;  2ZIM A;  1TA8 A;  2Q7E A;  4X1Y A;  1IBM B;  3I5D A;  4UCS A;  3WB2 A;  5KHI A;  1IBM O;  1NR1 A;  4RUF A;  2KG7 A;  5EC1 C;  3FFQ A;  4QPJ A;  4JI5 B;  4ZHQ A;  3VQW A;  2R70 A;  1SQX H;  3K0G A;  3J7A U;  1FFT B;  3MAQ A;  4I0X A;  3E22 A;  4MVS A;  4I9Q A;  1BQZ A;  2PUS A;  3L70 H;  1SQV H;  2JEU A;  5LHI A;  4U7O A;  3ZHV A;  2A79 B;  2DQ0 A;  2CUG A;  2L6L A;  4UB8 Z;  1DK1 A;  1N32 B;  4JV5 O;  2QR4 A;  3OTO O;  1BSM A;  3GVM A;  1SER A;  1MZF A;  1JJ2 U;  2VWK A;  4W4K A;  4DR4 O;  1I7F A;  1IDS A;  3FAV A;  2UXB B;  4PDL A;  4NR1 A;  1J95 A;  1NTZ H;  1N36 O;  2OIE A;  2YS8 A;  1E1Q G;  1Q90 D;  2NR5 A;  2ZIN A;  1H2S B;  3L75 H;  1F7Y A;  2XT9 A;  2FKX A;  1FFX A;  5J2U A;  3SPC A;  4YY3 B;  1XMO O;  4UB6 Z;  1D5A A;  2ZQM A;  1RM1 B;  1OCC C;  4DV5 B;  1XIL A;  1GH6 A;  1AB3 A;  3VOU A;  1L1F A;  3I55 V;  1Q43 A;  2UUB O;  2E5L B;  2Q7G A;  2QTO A;  3ZN1 A;  4DR1 O;  2BSK B;  1YF2 A;  2W6J G;  2WLN A;  3R65 A;  1K4C C;  3ABK C;  1VQ8 V;  1NJI W;  3RGB A;  2V7Q G;  4X1I A;  5CBF A;  5DM6 V;  4P30 A;  3W7X A;  4WCE V;  1IXM A;  1BHA A;  4ZBM A;  4NXN O;  4LR3 A;  3K59 A;  2R72 A;  3OGI B;  5KAI Z;  2OIG A;  1ZUQ A;  2EZO A;  1XQ8 A;  1PP9 H;  5IT9 N;  4J41 A;  1GMG A;  1RP3 B;  2YSU B;  4DV3 O;  5L3D A;  2QDO A;  1J5E O;  2B5U A;  4FLZ A;  3FX7 A;  1SC5 B;  2Z3Y A;  4XDJ A;  4DUY O;  1TGO A;  2EUL A;  1WLE A;  2A06 H;  4PI2 A;  3F5W C;  5IYZ B;  4FJC C;  1S5L Z;  1Q8I A;  4JYC A;  3ZIA G;  1JPX A;  4DUZ O;  4AIL C;  3ZRX A;  1S5J A;  4L87 A;  2Z5U A;  4BIO A;  2W6I G;  2JVD A;  1D2D A;  2QWR B;  3LSQ A;  1KP3 A;  3CCL V;  2Y69 B;  3SJC C;  3ZS8 C;  5BR8 B;  4KFM A;  4UVB A;  3OW2 U;  5B66 Z;  3JCU Z;  2QM7 A;  4ZOL B;  2QWQ B;  5LP6 C;  4WFA V;  5IWA O;  4U3J A;  1K5S A;  2JGU A;  5J2U B;  3B4S A;  2AW9 A;  3CRA A;  2LW7 A;  1M1K W;  3M99 B;  4WFG A;  1XHZ A;  3DSQ A;  1TAE A;  2EIL B;  3E8B A;  5B1A C;  2GDS A;  1YTF D;  3ZRV A;  3ETD A;  1AJQ A;  2UU9 B;  3D3I A;  3IC9 A;  2KB1 A;  1KYO F;  4H13 B;  4JTA B;  5IE9 A;  5GW7 A;  1GN3 A;  2IH3 C;  3D36 C;  2RJZ A;  2K1E A;  2XAJ A;  4X1I B;  4B3S O;  4U7N A;  4GLX A;  1JA8 A;  4X20 B;  1AI7 A;  1EN6 A;  4MVZ A;  1L0N H;  1M5I A;  3J80 N;  2IJK A;  4B3M B;  2ODM A;  2YDE A;  1P84 F;  2QEX V;  1FJG B;  3CSX A;  3CS5 A;  2NLJ C;  4RO2 A;  5JJJ B;  4DV4 B;  3LSU A;  3T1Y B;  3HKD B;  4FFB A;  4IGG A;  3KCY A;  1KBH A;  3B77 A;  3RWR D;  1FPO A;  5EBM C;  1FXH A;  1WA8 B;  2O57 A;  4LF4 B;  1Q6H A;  1YJ9 V;  4NXM B;  2YXY A;  3ZN0 A;  5CN0 A;  1AI6 A;  2ADP A;  4HAM A;  3CCR V;  2HJF C;  3ETQ A;  2V4D A;  4DV6 O;  1SZX A;  4GX2 A;  2R9I A;  4Z1M G;  5L3G A;  3H1K H;  1IUR A;  3BA8 A;  3RYC A;  3AK2 A;  4LFA B;  4YJ3 A;  3ZRW B;  4RUE A;  1ZWI C;  1AP6 A;  1K92 A;  4JI3 B;  4ZKI A;  5K1X A;  2ZT9 B;  4DR2 B;  4X64 O;  4PD4 F;  1US6 A;  5J9P C;  5JQG B;  4LF9 O;  4XDK A;  2MW2 B;  4G2K A;  4OXS A;  3CWB H;  2LO1 A;  2Y4T A;  2WLM A;  2BSK A;  5JVD B;  4CS4 A;  1EN4 A;  4EFB A;  1CPY A;  5IYB O;  3FB6 C;  3K5N A;  4J11 A;  4CC5 A;  1BE3 H;  1YHQ V;  4O4L B;  2EIK B;  2ZR3 A;  4JTD B;  4E4E A;  1DLB A;  3MHS C;  1IBL B;  3CPW U;  2DE0 X;  2AZ2 A;  2DYS C;  3JAK A;  2N04 A;  5B1B C;  3ZHU A;  4PDM A;  4JI2 B;  1XUQ A;  1YI2 V;  3WG7 C;  3IJ4 A;  1X59 A;  4UCV A;  4GUN A;  5LHG A;  2YID A;  1TUE B;  1H2N A;  4YHH O;  2WLI A;  4LNU B;  3AEI A;  3ZMV A;  3W7S A;  1IXB A;  5LHH A;  2C2A A;  2Q7H A;  4X1K B;  3CRC A;  4GT1 A;  1XMQ B;  3ZBH A;  4LF8 O;  3TJT A;  5LYJ B;  1MOF A;  3BA9 A;  3CCS V;  4UCR A;  4MVM A;  4DRX B;  1F23 A;  1H8E G;  3EHB B;  4J7Z A;  5KHG A;  3RYF A;  2DWE C;  3N2K A;  3G67 A;  1URF A;  1NH2 B;  1SZT A;  4QPK A;  4YJ3 B;  1SQQ H;  3CJH B;  1IBL O;  3O65 A;  5CBH A;  3CC2 V;  5J2T A;  3FD9 A;  3AG4 B;  5LA6 A;  3G6E V;  5KA6 A;  1ROP A;  5KHJ A;  2WLI B;  3E22 B;  1PKX A;  3E35 A;  2LFR A;  3B40 A;  4WBN A;  3M8A A;  3N2G A;  3OD4 A;  3SPG A;  1V55 C;  2H8P C;  4DYL A;  1Q7Y W;  4FPP A;  3GWO A;  1GKF A;  1MMM A;  4JAV A;  4JI8 B;  3FB8 C;  1Q5O A;  3CRR A;  3BRC A;  4DXW A;  3AG1 C;  2VQF B;  2P6J A;  5TIS Z;  1P4R A;  2YEV A;  4FM0 A;  4LFA O;  2NNU A;  3RW0 A;  2EIN C;  1P49 A;  3GB7 C;  3ZMZ A;  4DR6 B;  1BGY H;  1VEW A;  3SPI A;  4RQE A;  2UXD B;  1JVM A;  3G71 V;  1I5Y A;  4OPA A;  4OX9 B;  3JAK B;  2QKA A;  3ZHT A;  4X20 A;  4UV9 A;  5L3F A;  2ZDI C;  4JI8 O;  1V54 C;  2GUZ A;  1N0N A;  1AI5 A;  5H9C A;  4J7J A;  4KP4 A;  2IJJ A;  3FYI B;  3BVO A;  1TVK A;  3AG3 B;  4QJF B;  2PTM A;  1VF6 C;  3CX5 F;  1VQ9 V;  2A0L A;  4DV7 B;  3ABL B;  3TXS A;  3T1C A;  1M57 C;  5GTH Z;  1Y6X A;  1XHX A;  4Z2W A;  3OFN G;  4OPH A;  2EIM C;  5JQG A;  1HNW B;  3RYI B;  4D7S A;  4MTG A;  3B2E E;  3JSL A;  3A2F A;  4JI7 B;  2ZE7 A;  3OAA G;  4P2Z A;  1Z5W A;  3SPJ A;  2ZKO A;  1B6Q A;  4MVR A;  1QNM A;  1K9M W;  5A2Q N;  3PN1 A;  4WFF A;  1M90 W;  2XAF A;  1UJW B;  5LP6 A;  1AI4 A;  4LP8 A;  1Y76 B;  1R73 A;  2HEP A;  1FAF A;  5LP6 B;  2JGD A;  5IWA B;  1PM9 A;  4AI8 A;  3VBB A;  1OCO C;  4YJ2 B;  2RMK B;  2M7W A;  2OCC C;  2F93 B;  1VQM V;  4B7K A;  1EM1 A;  2EZP A;  2RQ6 A;  2PI4 A;  3CEI A;  3K79 A;  2Z0A A;  4JPR A;  4I7Z B;  1EN5 A;  3L9D A;  2ARH A;  1Z2G A;  1VQO V;  3W7W A;  2LJ2 A;  4N21 A;  4TV8 A;  2QA4 V;  1XBL A;  4EB6 B;  3ASO B;  3RYH B;  1G1X B;  1JJO A;  1WPB A;  4ZHQ B;  1M9N A;  5F2V O;  4PHZ A;  4RAI A;  3JAS B;  2OTL V;  3LSS A;  1QBZ A;  2E74 B;  2DW4 A;  2PYJ A;  1Y66 A;  1ZL8 A;  3FKS G;  3MDS A;  1M56 C;  4JAS A;  4CC6 A;  1GRJ A;  1HR0 B;  2CH7 A;  4F4L A;  3K5M A;  1M56 B;  4Q6G A;  3STL C;  2RCV A;  3ETE A;  4X62 B;  1S3J A;  5H6Q A;  1NBM G;  5H5N A;  3ZCC A;  2P5O A;  3FB7 C;  2P90 A;  3HKC A;  2Q5Z A;  4O4J B;  4F6R B;  2PI5 A;  1N4C A;  1VAR A;  4LF8 B;  3AG1 B;  1CEZ A;  4GKK O;  3EFF K;  3HKC B;  1LUW A;  4JYY A;  3X2Q B;  1KP2 A;  3Q4H B;  1XMO B;  2JS3 A;  4MSW C;  4DV4 O;  1XI1 A;  4X65 O;  1ZSP A;  3EVK A;  4YY3 O;  3KG2 A;  4MW3 A;  1H8H G;  3I56 V;  5LMN O;  1JR9 A;  3U10 A;  3E83 A;  5KHK A;  5EK0 A;  2BTQ B;  3CYO A;  2YI8 A;  4JI7 O;  4H37 A;  2N74 A;  4MTF A;  3CCU V;  2JS5 A;  4ZI7 A;  4W4L A;  2F23 A;  3ABK B;  1DTO A;  4PA6 A;  1GN4 A;  2XAG A;  4MTO A;  4FM2 A;  2XOK G;  4J9Y B;  4X1Y B;  4HBN A;  4U3F H;  4PEL A;  4JI6 B;  3LDC A;  3F7V C;  4DV0 B;  1GM7 A;  4CZZ A;  1KU9 A;  4JTC B;  1M93 A;  3OGC C;  4B3T B;  1QLN A;  2H3O A;  4E2L A;  4PA4 A;  1N34 B;  4LF9 B;  3DXR A;  1HNZ B;  3CRM A;  3JAW A;  4OX9 O;  1JQ0 A;  2CH7 B;  4JI3 O;  4DR7 O;  2EJR A;  4KHP O;  5E1A C;  1BMF G;  4X8A A;  1SA0 A;  2VQE O;  2XAH A;  2HG5 C;  1IBK O;  4JI0 O;  4K8Z A;  5IYZ A;  1XNR B;  5LGN A;  1KKD A;  3MHH C;  3SJA C;  1GK9 A;  5FLX N;  3B09 A;  2HJD A;  4KL1 A;  2P06 A;  5J2T B;  3CME V;  1K73 W;  2DMX A;  1VP7 A;  4WFB V;  3G4S V;  2CTR A;  2DN9 A;  3OE7 G;  2QJ1 A;  2VQF O;  2LGW A;  4FLY A;  4EFE A;  3UKM A;  2UUA B;  2JRI A;  3RYF B;  1NVP B;  3TXQ A;  1I08 A;  4X66 O;  4LFB B;  2A9H A;  1GM9 A;  1P7B A;  2EIL C;  1J5E B;  2ZE5 A;  4YIO A;  5LMN B;  1K34 A;  1PNL A;  1R3I C;  4B3M O;  1LNQ A;  2DYR B;  3OR6 C;  4YIP A;  1GO3 F;  3SR2 C;  1GM8 A;  2YIC A;  1E79 G;  2DYR C;  3JD3 A;  5D5P A;  4TV9 B;  1GN6 A;  1ENV A;  2F1M A;  3BY6 A;  1QHT A;  5IYD O;  4TWK A;  5FPR A;  2EIN B;  3T4Z A;  4TUY A;  3UM7 A;  3N27 A;  2XUM A;  5KHH A;  3OR7 C;  4X62 O;  3JD2 A;  2QM8 A;  2ZNI A;  2E5L O;  4O4I A;  1UPG A;  2B1G A;  1QVF U;  1OCC B;  4ZOL A;  2WLK A;  4IL6 Z;  4EKW A;  1MSD A;  1NTK H;  3GWK C;  4LBE C;  4I4T A;  1YVW A;  1HP8 A;  1VF6 A;  2P4V A;  1VQ5 V;  2QWO B;  4O2A B;  5EIB D;  5C93 A;  5CB4 B;  1N36 B;  3JCZ A;  3KZI Z;  4QE7 A;  1R6T A;  4BAY A;  3D3Q A;  1XRE A;  3KDR A;  3O9O A;  1GAX A;  2ADQ B;  1SES A;  3DTU B;  4IHJ B;  3W7U A;  4PI0 A;  1Y67 A;  4QGP A;  4BW5 A;  5CA3 A;  4PA9 A;  3K5O A;  2WWW A;  3OT7 A;  3OUF A;  4AQY O;  4JI0 B;  1IBK B;  3RYI A;  1ZTE A;  2P67 A;  3HR0 A;  2JJ1 G;  2X0L A;  3VQX A;  4IIJ A;  1NH2 D;  2QM4 A;  4B3R O;  4O2B B;  4DR7 B;  3E89 A;  3OUS A;  1GTO A;  4FM1 A;  4JI1 O;  2XAS A;  5CBG A;  3K08 A;  5ITZ A;  1HNZ O;  3LNN A;  4OGQ B;  3RYC B;  3SPH A;  4CS2 A;  5LYJ A;  1K4D C;  3H1J H;  2WLJ A;  1AR5 A;  1V9P A;  3EXA A;  3LUT B;  4X64 B;  2WPD G;  3ASN C;  5B1B B;  1SQB H;  2YXH A;  2CAZ C;  3ABT A;  5JJN B;  2RN9 A;  3AK3 A;  1OCZ C;  4CH6 A;  4FLT A;  2E75 B;  2LGQ A;  3A0R A;  2WSS G;  2ZXW B;  1K5Q A;  5ITZ B;  3E86 A;  1OJH A;  2CTQ A;  5LMU B;  1QQC A;  4FMT A;  5H6R A;  3HPL C;  2H94 A;  4J10 A;  2VS0 A;  3C3S A;  3A8T A;  2KSD A;  2Q9L A;  4DV7 O;  2IU3 A;  2NN4 A;  4UVA A;  4GX0 A;  1L8D A;  5CA0 B;  4DW0 A;  3LDD A;  4BW9 A;  3BAA A;  3OMN B;  4LF5 B;  4UUJ C;  3ABU A;  4G28 B;  5L3C A;  1S77 D;  4LFB O;  1AR1 B;  3BPZ A;  3OEE G;  2CDY A;  2YC0 A;  2YIA A;  1B06 A;  4JF3 A;  1MSW D;  3D8C A;  3RFR A;  3UQ8 A;  2K9P A;  4FVM A;  5LMU O;  4DR6 O;  1WP7 A;  2XND G;  5KX5 A;  3E2E A;  1VQP V;  1BS3 A;  1XNR O;  3M7M X;  1EFR G;  4ABM A;  2F66 C;  4GCZ A;  1L0L H;  4J80 A;  3K9S A;  3AG7 A;  2LW1 A;  3HKD A;  4LF6 O;  1JFF B;  1PNK A;  1F4N A;  2ZCE A;  5CMU A;  2YIB A;  4J7K A;  2EIM B;  2YXL A;  4J42 A;  1YCI A;  3RVY A;  1KB9 F;  1YEW A;  2E76 B;  1AJN A;  3BHP A;  3E8G A;  2XHB A;  5BR8 O;  2ETN A;  4DV0 O;  1K33 A;  4B3R B;  4K35 A;  2ZNJ A;  3ZHS A;  1B04 A;  2CK3 G;  1WA8 A;  1COW G;  1H38 A;  2VRZ A;  2EIJ B;  3N2K B;  1THZ A;  4D6T H;  3N2G B;  1R3K C;  1YDX A;  4YXW G;  5KAF Z;  4O4L A;  1GN2 A;  1SF9 A;  5L3E A;  2HP8 A;  2BTQ A;  3QTC A;  2WAM A;  3ZX6 A;  4NB5 A;  1XEQ A;  5L3B A;  1W2B U;  2ZXW C;  1Y4M A;  4JYB A;  5C8Y A;  4FLW A;  1HNX B;  4Z1V A;  5JH7 A;  3CCJ V;  2CE4 A;  4JGS A;  2DYS B;  5HFM A;  4DV3 B;  4WFH A;  4F6E A;  2FML A;  2ZR2 A;  2ZDI A;  1NTM H;  3ZRW A;  5FL7 G;  3DC6 A;  2IJH A;  3WG7 B;  4UCT A;  1SKV A;  2IW5 A;  3JAT A;  1YZB A;  3L72 H;  4LWS B;  2ZE6 A;  1BCC H;  4GKK B;  1A32 A;  3F7Y C;  3DXR B;  3SJQ C;  4GKJ O;  1DGS A;  1EBO A;  3BAB A;  1B3Q A;  3HKE A;  1VQ6 V;  1W59 A;  5EBL C;  3HKB A;  3JAL B;  1YJW V;  3CD6 V;  5DEC A;  4DV5 O;  3CB2 A;  3P30 A;  4NKG B;  1HR0 O;  1ZL8 B;  4P9P A;  4XBF A;  1H2M A;  1U97 A;  5DN6 G;  1RSO A;  4BR6 A;  1SA0 B;  4B08 A;  1KUQ A;  2Y69 C;  1AR4 A;  4JI4 B;  3OEH G;  5EYP A;  2PY5 A;  3H1L H;  4TV9 A;  2PF4 E;  3AG2 B;  3HKE B;  4PA3 A;  4X66 B;  2L35 A;  3A0H Z;  3HB3 B;  4EEQ A;  3SJB C;  4DR4 B;  3QO5 A;  1YXB A;  2UXC B;  3IC7 A;  2UXD O;  3FAV B;  3QVN A;  4GX5 A;  2ZM6 B;  2QSA A;  2WLH A;  3RBZ A;  3CXC U;  1YSC A;  1TVK B;  3CMA V;  2PGG A;  2KG7 B;  4DV6 B;  4PV1 B;  3PJS K;  4MT8 A;  3ICX A;  2VQE B;  4TV8 B;  4NXM O;  4LF4 O;  1S72 V;  1YTF B;  3S3W A;  3U0Z A;  4KHP B;  1XL6 A;  4JI5 O;  2RDC A;  2X6C A;  1EZV H;  1N34 O;  4GZR B;  2X6B A;  1AVM A;  3ZHQ A;  3TGU H;  4B3T O;  2B9Z A;  2ITD C;  2YUA A;  1FJG O;  1R3J C;  1F51 A;  1WJZ A;  3THO A;  1R3L C;  3ABM C;  4LH7 A;  3SYC A;  3L73 H;  4JI6 O;  4O4J A;  1NZ6 A;  2YEV B;  5IY5 C;  2JDI G;  5IJ0 B;  4O4H B;  2UUC B;  4I55 B;  4NTX A;  4G27 B;  1FXK C;  1SS3 A;  1ZX3 A;  1V54 B;  1FD9 A;  1U96 A;  1Q86 W;  2LQT A;  1I0H A;  4UCU A;  3ML0 A;  1RPR A;  4IIJ B;  2BE3 A;  4PA7 A;  5JH7 B;  1BZK A;  1IJG A;  5LXT A;  3UT5 A;  3P3P A;  5IJ9 B;  5KMG A;  2IM9 A;  3SYA A;  1TUB B;  1I94 B;  1K7D A;  2VWJ A;  4IT5 A;  5BXZ A;  5B3S C;  3ZJZ A;  3K58 A;  4FZ0 A;  4PDV A;  2LFS A;  3WFV A;  3STZ C;  1N33 O;  2YIB D;  1NVP D;  4X65 B;  3RVZ A;  3A0B Z;  3NXS A;  3ETG A;  2AHY A;  1XNQ B;  4B7E A;  1ZAU A;  3BCC H;  3LNM B;  4R50 A;  2EIJ C;  3ZMT A;  5K1P A;  5EYP B;  2PZS A;  5CA1 A;  4UCO A;  1CXZ B;  1S5H C;  2AXT Z;  2IJI A;  5KUM A;  1IZ3 A;  4WFE A;  2A3Q A;  1FOU A;  1AJP A;  4I4T B;  2G38 A;  1X4T A;  3JAL A;  1FXV A;  2OWO A;  4HYO A;  4IYH A;  2QKS A;  4I50 B;  4TSF G;  4RQF A;  1LR1 A;  4MVQ A;  1BHB A;  3P32 A;  4DO2 A;  3JAS A;  2F4V B;  3L74 H;  4LC1 A;  5FNV B;  1H2K A;  2R9A A;  5JCO C;  2OCH A;  4P9O A;  3K03 A;  1SQG A;  2P4K A;  4QIW F;  2P7T C;  3FB5 C;  3B8N A;  4TQD A;  4LH6 A;  2WLL A;  4DR2 O;  1KEC A;  2Q73 A;  2X7R B;  2AHZ A;  3RT3 C;  3C3T A;  4NTY A;  2EBO A;  2DOS A;  3APO A;  3ZMU A;  5KUK A;  3UO2 A;  5LGT A;  4GX1 A;  4K8X A;  2IBZ H;  5JVD A;  4UVC A;  5BMV A;  2Q4P A;  3SYP A;  4CH4 A;  1OV9 A;  4TT3 G;  2WA4 A;  2UXX A;  3CP1 A;  4EB6 A;  5KX5 B;  5EZY B;  4JYA B;  4KUM A;  1VQL V;  1QVG U;  5KA5 A;  1XMQ O;  3JD4 A;  4K0K B;  1SQF A;  1DF5 A;  4I50 A;  3T1Y O;  3AG2 C;  5E79 Z;  1BQ0 A;  4PJ0 Z;  4UXN A;  4TQF A;  2HKO A;  3E8F A;  1P7G A;  4FLU A;  5JWP A;  3ZHR A;  3WB0 A;  1O9H A;  1XOU A;  2B1I A;  4DK1 A;  1KMI Z;  2IH1 C;  3K5L A;  1V55 B;  2CGO A;  1Q6I A;  2HHH O;  2OYQ A;  3QNE A;  4X88 A;  3WU2 Z;  5A9G A;  4LFC B;  1K97 A;  4B3S B;  1FFX B;  4JI2 O;  4WBN B;  1KC8 W;  2QWP B;  3K0D A;  1HNW O;  3TET A;  2FYU H;  2Y48 A;  1JCH A;  3MD0 A;  4BIZ A;  4QNH B;  2QE7 G;  2BTO A;  3JAM N;  3UCS C;  2Q68 A;  2UUC O;  5B5E Z;  4ICG A;  4DK0 A;  1I5X A;  1OHH G;  1VMG A;  4DR3 B;  3T1H O;  2Q67 A;  4CS3 A;  1JNB A;  1AP5 A;  2D2C B;  2GTS A;  4DV1 O;  1G6U A;  1OCR B;  4FFB B;  1KQS U;  4N23 A;  4ZI7 B;  1QLE C;  5LL6 Y;  3JYC A;  1D5N A;  2ITC C;  2DWD C;  5IYC O;  5IJ9 A;  5KMG B;  5CB4 A;  1H5W A;  3ZED A;  5LGU A;  3CE2 A; 
#chains in the Genus database with same CATH homology
 3KDR A;  1PL4 A;  2ADQ B;  3C3T A;  2ADP A;  1Y67 A;  4JZ2 A;  1I0H A;  1BS3 A;  1MNG A;  1SZX A;  3KKY A;  3OT7 A;  3AK2 A;  1BSM A;  1WB8 A;  3K9S A;  3AK1 A;  1AP6 A;  1VAR A;  1IDS A;  1ZTE A;  1QNM A;  1LUW A;  1XDC A;  4JYY A;  1IX9 A;  1I08 A;  4BR6 A;  4FFK A;  1MA1 A;  4YIO A;  1AR4 A;  1ZSP A;  3EVK A;  1EN4 A;  1ZLZ A;  2QKC A;  1PM9 A;  2AW9 A;  1P7G A;  1AR5 A;  5AG2 A;  1JR9 A;  4YIP A;  1MMM A;  1KKC A;  2GDS A;  1LUV A;  1XIL A;  5A9G A;  4E4E A;  1EM1 A;  1GN6 A;  3CEI A;  3RN4 A;  3AK3 A;  3QVN A;  3IC9 A;  3BFR A;  1GN2 A;  1WB7 A;  1EN5 A;  3DC5 A;  1XUQ A;  1GN3 A;  4JZG A;  1GN4 A;  1VEW A;  3C3S A;  1JA8 A;  4C7U A;  4GUN A;  2QKA A;  1MSD A;  1EN6 A;  2CE4 A;  1AP5 A;  1ZUQ A;  1N0N A;  1AVM A;  4F6E A;  1IXB A;  3MDS A;  3DC6 A;  1N0J A;  3LSU A;  1D5N A;  1BT8 A;  2P4K A;  4X9Q A;  3TJT A;  2CDY A;  1B06 A;  2RCV A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...