1EN4A

Crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANHDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 72
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en4A02
2ADQB 1IDSA 1I08A 1SZXA 1IXBA 1PL4A 3C3TA 1ZLZA 4F6EA 1AP6A 1P7GA 1XILA 2RCVA 1BSMA 3TJTA 1VEWA 1EN4A 1XDCA 1XREA 1LUVA 1MNGA 3C3SA 1ZSPA 1GN3A 1D5NA 1MA1A 1WB8A 1MMMA 1ZUQA 2QKCA 4JZ2A 4YIPA 1EN6A 4BR6A 1LUWA 1KKCA 1GN4A 3CEIA 3RN4A 1AR5A 4GUNA 1EN5A 5AG2A 3KKYA 1PM9A 3AK2A 3BFRA 3DC6A 1VARA 1BT8A 1GN2A 1MSDA 4X9QA 3DC5A 3AK3A 2P4KA 2QKAA 1GN6A 4YIOA 5A9GA 1B06A 4JZGA 1AR4A 1WB7A 1IX9A 1Y67A 2AW9A 4C7UA 2CE4A 3OT7A 1JR9A 1QNMA 3EVKA 1BS3A 1AP5A 3LSUA 4FFKA 3QVNA 3IC9A 2ADPA 1AVMA 1EM1A 1JA8A 1XUQA 4E4EA 1I0HA 2CDYA 1N0JA 1N0NA 4JYYA 3K9SA 3MDSA 3AK1A 2GDSA 1ZTEA
chains in the Genus database with same CATH superfamily
1VQPV 2ADQB 4PA6A 4U3JA 3IAYA 1ZLZA 5EK0A 3UO3A 3S3WA 1P7GA 2RCVA 1AI4A 3AG4B 2UUCB 1Q43A 4X66B 1XDCA 3SGIA 2JDIG 3P3PA 4CH4A 2EIMB 2LW7A 1NS1A 1K4CC 2NN4A 4J9ZB 4ZI7A 2K1EA 2UXXA 3OTOO 1KU9A 1RSOA 3AG2B 3VQVA 4MVUA 1CPYA 2DJVA 1AR5A 5ITZB 4DV6B 2ZDIC 2PYJA 4DR4B 5CB4B 2YC0A 4OGQB 5IWAB 4X1KB 4DUYO 1GN2A 2IH3C 2EIJB 3SPIA 2DOSA 3B09A 4TQFA 2P4KA 2ZT9B 1YJWV 5CBGA 1ZAUA 3EFFK 3TXQA 5L3BA 1Q7YW 2A3QA 3H9VA 3RT3C 1Q81W 3RYIB 4TT3G 2DYRB 3K03A 3TXSA 4MTGA 4ZKIA 2DMXA 2W0XA 4UVCA 4MVZA 4DR7O 5D5PA 3BA9A 2P90A 1M5IA 4YJ3B 1EM1A 5B1BB 3ZRWA 4FM1A 4OX9B 2ZE6A 1SA0A 2CDYA 2CH7A 2Z5UA 2ITCC 4GX1A 3JAWB 4JI8O 2LQTA 3E86A 5KA6A 2LGWA 4F6RA 4J9YB 2YS8A 2P6JA 2QWRB 3SJQC 1YTFB 5JJEB 4Q6GA 1IXMA 4FLZA 1K97A 2Q8VA 1R3IC 1XREA 4HNAB 3SYAA 2N05A 2WLHA 2GTAA 1MMMA 1YJ9V 4TSFG 2AGAA 5LHHA 4DUYB 1IURA 2DYSC 2WLMA 2QKCA 3E22A 3T1YO 3CMEV 1GH6A 1LUWA 4LWSB 1QLEB 3SJBC 4EKWA 2QE7G 3OW2U 4NTXA 5DN6G 5IT9N 2XAQA 1XMOO 4UFZA 2UUBO 3ASOC 2P67A 1HP8A 1PP9H 4Z1VA 1Z5WA 3ZMUA 1Y76B 2YICA 3RYFA 1IBLO 1HNWO 3JYCA 3TGUH 4X65B 1RM1C 2ZIOA 1HNXO 4DR7B 5KMGA 4QGPA 3DXRB 4Z2WA 3LDDA 4NXNO 4DR6B 1IX9A 4FM0A 4J41A 3LSSA 2IU3A 4IHJB 4MSWC 4JI8B 2LW1A 3ASNC 1N33O 1OZ0A 1P4RA 1JX9A 3NR7A 1NJIW 3LSUA 2WLNA 1H2KA 2UXBB 2CGNA 4EB6A 4E4EA 3A0RA 4RAIA 2XHBA 4FFBA 1MG1A 4XDJA 2JRIA 4FZ0A 1F23A 4R8CA 2UXNA 3HKBB 2H94A 3HKCB 3OR7C 2ARHA 1XNRO 4L8JA 3T1YB 4YXWG 2BTQA 3A0HZ 2EJRA 5EBLC 1N8RW 1NU1H 2Q9LA 1NKDA 1B6QA 3GB7C 3CCLV 1LNQA 3JALB 4IYIA 4NTYA 4X1YB 2R72A 4DV1B 3BAAA 3K5OA 3MHSC 4O4LA 1R3KC 5KHKA 1HR0O 1IBLB 1D5AA 3WFVA 3KDRA 4JZ2A 3CCJV 1PPJH 2QM4A 1JQ0A 1URFA 4IL6Z 4UV9A 1HNXB 1JJOA 4X1IB 4H33A 1XL4A 2JJ1G 4L87A 4EEQA 5AG2A 1KBHA 1W0JG 3JSLA 2YIDA 4QPJA 4LC1A 1EBOA 1G4YB 4ZHQB 4NXNB 5CMUA 3PJSK 1VARA 2EJ7A 2QJ1A 5A2QN 4X9QA 3ZMVA 5EBMC 1N33B 3AG7A 4CH6A 2DWEC 3B4SA 4UCUA 5KX5B 1IZ3A 2YDEA 2QEXV 4MT8A 4LR3A 4QJFB 3H1LH 2IU0A 4DK1A 2WLLB 2VQFB 4WFGA 1DGSA 2OCCB 1MSWD 4O4HA 4K8XA 2ZINA 4G28B 2OWOA 1XNRB 1QLNA 1K9MW 3K3WA 1XEQA 2P22C 4LNUA 3JD1A 5E79Z 1X59A 1BMFG 3M99B 2GHYA 4ICGA 5IJ0B 3N2GA 4PDLA 1WA8B 1ZX3A 5KAFZ 3SJAC 3CJHB 3Q4HA 5KHIA 1HR0B 1E1QG 1EFRG 5LGNA 3B77A 4FVMA 4X88A 2QWNB 5C8YB 4O2AA 2YSUB 2QWPB 3K9AA 1RPOA 2VRZA 2WA4A 2JJ2G 4I50B 4IGGA 3CS5A 2CUGA 3K04A 5GONB 1TGOA 1KYOF 2ZNJA 3GWKC 2XAJA 2CAZC 2DWDC 2X0LA 3H1KH 2VWJA 4J42A 3EHBB 2KG7B 1GN4A 3ZMZA 3OGCC 2B5UA 2EILB 4YHHB 5ITZA 1FPOA 3OEEG 3BFRA 4I55B 2DYSB 5HFMA 5CB4A 1SQQH 1XNQO 4P2ZA 2LGQA 1JOYA 1IBKB 1O9HA 2GBOA 2BSKB 3ZHVA 1H8EG 2GV9A 3HPLC 4FMTA 2ZR3A 3ZN0A 5JVDB 5BY1A 5B1NA 2QKAA 1QCEA 4TOIA 2FTKA 5L3GA 1B3QA 1FFXB 2EIKC 4I4TB 3RYIA 2CE4A 1JR9A 2PI5A 2ADPA 5B66Z 2XOKG 1H2NA 2GUZB 1N0JA 1M56C 5LXTA 1XL6A 4GKJB 4K3AA 3ASNB 1VP7A 4MVRA 2HVKC 2L6LA 3JARB 1QR9A 5L3DA 1TUBB 1Q90D 1AI7A 3HB3B 1G6UA 3TETA 3C3TA 3JD3A 1JFFB 2EBOA 3LSQA 3L73H 3K5LA 2F1MA 3T4DA 1AI6A 3B8MA 5LOVB 1XBLA 1BL8A 1JCHA 4KHPO 4DYLA 2ZR2A 4HNAA 1MA1A 2BTOA 1OCZB 2VQEO 2FKXA 4TWKA 1I94B 3OMIB 2R9RB 4IYHA 4DW1A 1PNMA 3CEIA 4QE7A 4MW3A 1A32A 5H2FZ 2ZE7A 3I55V 1GMGA 3JASB 1I5XA 1Q3EA 4NVPA 3RYHA 2ZIMA 3GWOA 3DGEA 5DECA 1PD3A 2LFSA 1S5HC 2F95B 2KQXA 1YZBA 2R70A 3FYEB 4I9WA 1SQVH 4AILC 2CGOA 4TV8B 1WPXA 1AR4A 1M4UA 1H2MA 2F43G 4ZOLB 3F5TA 4C7UA 5KHJA 3OT7A 3JD2A 1WP8A 3CE2A 4LF9O 1AP5A 3THOA 4MS2A 4LF8O 1AJQA 4FLUA 1VQ5V 2PI4A 5IYDO 5GTIZ 3UT5B 1AVMA 1U97A 4E2LA 5KUKA 2QTOA 5FL7G 3SPGA 5CA0A 4DV6O 4QNHB 3I5DA 2FL4A 3R65A 1H5WA 1R73A 3AK1A 3U10A 4JGSA 2JGDA 3ZRVA 4W4KA 4YY3O 4G27B 1Z2GA 1S77D 3HKEB 5BXZA 1FXKC 2DN9A 2VQEB 2A06H 2PF4E 4NXMB 2BE3A 3CRRA 1AP6A 1IBMO 4JTAB 3STLC 4O2BA 2DW4A 3CCSV 1LUVA 2XT9A 5B3SC 3JALA 4FK5C 4X1YA 1D5NA 1H2LA 4W4LA 2HJDA 1N4CA 2ZM6O 4UXNA 1RFYA 2W6JG 1PL0A 5H9CA 1VQNV 4GCZA 4OX9O 1AI5A 4XBFA 3H1JH 4P9PA 2ZD9A 5BMVB 3OR6C 4RQEA 3DC6A 2YIAA 3OMAB 4UV8A 2F4VO 3FAVB 2UUAB 1FAFA 3QO7A 2QM7A 4LFAO 4LF9B 1PV0A 4BIUA 5LHGA 4LF8B 2EINC 4AI8A 1KP2A 3LNMB 3X2QC 4D6TH 3ABLC 1NBMG 5IYZB 1GKFA 2ZXWC 5KUMA 4GX2A 3SYCA 4FLTA 4YY3B 4KUMA 5JCOA 4I0XB 2UU9O 1WP7A 1EZVH 2Q0AA 4UCOA 4LF6O 4DV5B 1JA8A 1ZL8A 1K8AW 1WPBA 1FKAO 1IBMB 5IJ0A 3SPJA 4DV2O 1YSCA 4JI2B 4WBNA 1N0NA 2WSSG 2Q6AA 3K9SA 1X4TA 2JVDA 3F7YC 4H13B 1DTOA 2ITDC 1YXBA 5J2TA 2F23A 3OFNG 2B9ZA 3KG2A 4PA9A 4FLVA 3SYQA 4PHZA 2AZ2A 2RQ6A 4DO2A 2ZM6B 4X65O 1K5QA 1OJHA 4DV3O 2CK3G 5C8YA 1BQ0A 2V7QG 3VQYA 2Q5ZA 2Q4PA 4MW8A 4F6EA 4IIJA 2RNBA 2H3OA 2ZQMA 1VEWA 4I50A 2IBZH 4XDLA 1R6KA 3ABMC 5JQGB 4DR6O 1CEZA 1SC5B 3T4ZA 3BRCA 2F66C 3AG3C 5JH7B 3RVZA 3RBZA 2F4VB 4WFAV 3D8CA 1YEWA 5LYJA 2OYQA 1UPGA 4MVOA 1HWYA 4DRXB 2XTAA 4LFAB 2Q68A 1K3EA 4O4JB 2KG7A 2UXBO 4KL1A 1UFIA 2L35A 4I5SA 4LCUC 4CZZA 3CYOA 2Y4TA 3CWBH 2WLIB 5IJ9B 3H1HH 4OPHA 4U3FH 3ZIAG 1K4DC 2PY5A 1SQFA 4JI7O 4HZ3A 1US6A 4DR5B 2UU9B 2DQ0A 4MTOA 1HNZB 4JI5O 3SDLA 4LF6B 1G1XB 3FB6C 2CTRA 5IYBO 2ATKC 3N27A 3UO2A 4DV2B 1NTMH 4DV1O 4I4TA 3IC7A 5HFLA 3QTCA 2YIBA 4LF4O 3UCSC 4JAVA 4DV3B 3QVNA 1NTZH 3RWRD 3CC7V 2FB5A 2HKOA 3J80N 4CS4A 5LP6A 1TVKA 5CBFA 4PDMA 4ZIBA 4JAUA 3OMNB 3JARA 3UM7A 5H5NA 4K35A 4D7TA 3UKMA 3VQXA 3CHXA 1TUBA 4LFBB 5J9PC 4R7CA 1JFFA 5CA1A 3E8BA 5LOVA 4GX5A 2VQFO 3LDCA 1XI1A 2FYUH 3AG1B 4PJ0Z 4RUFA 2GTSA 1Y74B 2QWQB 3JAKB 4JF3A 4JI7B 1N32O 4YJ2B 2Y0PA 4JI0O 1N36O 2ZCEA 3L74H 3RN4A 3NXSA 2AHZA 4JI5B 3IGAC 1SQGA 1EN5A 4FJCC 3ABKC 3AK2A 1Y6XA 2HLDG 3O9OA 1R6TA 3OE7G 1M90W 3T1CA 5EZYA 3W7UA 4LF4B 1V55C 5CA3A 5IDJA 1Q86W 1NR7A 3FKSG 1QBZA 2YXHA 3VBBA 1VF5B 1WB7A 4DR3O 5FPOA 5J2UA 3R66A 4H44B 4RUEA 2Q7GA 2LFRA 4ZOLA 4TUYB 2R9AA 5KAIZ 3SPCA 2AZ0A 4MVSA 3B40A 3A2FA 1D2DA 4JI6B 2DQ3A 1O9GA 4FFKA 2AXTZ 2EULA 4FIPC 3FB8C 1Y4MA 4WFBV 1K7DA 4K8ZA 4YHHO 5IYCO 2Z0AA 2LP7A 1CP9A 4DXWA 4CH5A 1FD9A 1GRJA 4DV0B 1NR1A 5IY5C 1IBKO 3CCEV 1IDSA 3KCXA 1F4MA 4ZI7B 1R3LC 4GLXA 1N32B 1RSOB 1MABG 4JI0B 1Q82W 3PN1A 1N36B 3CCQV 1Y66A 3N2KA 1W0KG 1P84F 3OGIB 1GM9A 5H6QA 3CD6V 4JI3O 4JV5O 1GN3A 3B2EE 1WN7A 2YEVA 5LMUB 4U7NA 4DR1B 4LBEC 4MVMA 1GTOA 4WF9V 2XUMA 3P3NA 1EN6A 1GM7A 4JI1B 4UUJC 2JGUA 5H6RA 2OIGA 3D36A 1M1KW 3M7MX 3ABMB 4QIWF 1ZWIC 4GUNA 3I56V 3AG3B 1Q6UA 4GKJO 2KKWA 4DR3B 4LFCO 5LGUA 2EZOA 2XNDG 5EIBC 3L72H 1YF2A 4CBCA 2M6YA 2Q7HA 1JPXA 1FOUA 2YUAA 4FZ1A 1K34A 3ZRWB 1SA0B 3CRAA 2A9HA 1GN6A 4YIOA 3EXAA 1VQ6V 1N34O 2HVJC 2RN9A 1NH2D 3RYCB 3E89A 4F6RB 4X1KA 4DUZB 1I94O 3ZHRA 3CX5F 1FXVA 3IC9A 1NZ6A 3BEHA 4P30A 3ASOB 2OTLV 1VQOV 3AG2C 4PI2A 3FD9A 4TV9B 1R1BA 5E1AC 3OAAG 4JI3B 3E22B 4JV5B 3QG5A 3W7WA 1RM1B 4K0KB 2QTSA 4MTFA 5F2VO 1TAEA 2P7TC 1I08A 1W2BU 2B1GA 2F93B 2P06A 3TJTA 1BHBA 1SERA 4YJ3A 2N74A 3FB5C 5D5QA 3OD4A 2ZKOA 1YITV 2NLJC 3K57A 1ZSPA 2O57A 4R6ZA 4LFCB 1YHQV 5BZBA 4BIOA 3JAWA 1TA8A 5JH7A 5L3CA 5LBQA 4PV1B 5KMGB 1KB9F 3DTUB 4JTCB 4X62O 4DRXA 1J5EB 3A0BZ 4LF5O 1BCCH 1U96A 4B3TO 2LO1A 5FNVB 2GSMB 3CC4V 1K73W 3BHPA 3WU2Z 3WB2A 1P7BA 2JS3A 1N34B 3G67A 4FLYA 3CCVV 2UXCB 2CTWA 1BT8A 2QDOA 2AHYA 5IJ9A 2Y69C 4NTWA 4BAYA 2V4DA 1TUEB 1VF6A 3H01A 3CP1A 4WFEA 4NXMO 1BE3H 3ABKB 4LWSA 1L1FA 4GT1A 2HG5C 3MD0A 4D7SA 1Y67A 1AB3A 5CN0A 5KLVH 4PDRA 4KFMA 1QVGU 1BGYH 4EFEA 1Y76A 2OT5A 1QQCA 1S72V 1XQ8A 4F4LA 5FLXN 4P9OA 4BW5A 3ETQA 5B1OA 1Q6IA 4A5UB 3ZHUA 1OCOC 1QLEC 5EYPB 2H8PC 3DXRA 5DM6V 1KP3A 4O4LB 3JD4A 2Q7EA 2BCCH 2UUAO 2NNUA 1H2GA 4JYCA 4IHJA 1F51A 1IXBA 1KC8W 1PL4A 2KB1A 4X62B 1K33A 4LF5B 4B3TB 3OUSA 5JJJB 2Y48A 3QO5A 4HYOA 3BA8A 5IY5B 1MZEA 3HKBA 2VS0A 3E8GA 5JWPA 1EZJA 3BCCH 3HKCA 3ZRXA 1Y74A 4YIPA 3JAKA 1XOUA 1NH2B 1MOFA 3HR0A 4DV5O 1UJWB 1ENVA 1PKXA 1AJNA 4JI2O 3A8TA 3KKYA 1COWG 4O4IB 3S3XA 2HR3A 4UCTA 4O4HB 2NR5A 4WCEV 4ABMA 1MSDA 3E8HA 4X64B 1ROPA 3J81N 3E83A 2IJKA 4LNUB 4R50A 1S0VA 4DV4O 3H1IH 4DW0A 3VQWA 4FLWA 5K1XA 4X1IA 4UB6Z 4GYCB 2RMKB 1W59A 4PDVA 3GVMA 4ZHQA 3ZS8C 1SRYA 5EC1C 1QHTA 4TUYA 1IJGA 4UVAA 1YCIA 2XAGA 4O2AB 1V9PA 1FJGO 3JAMN 2W6IG 1RP3B 1WAZA 3BY6A 2WWWA 2ZDIA 1I0HA 5KX5A 1VQLV 1E1RG 3D3IA 2FMLA 3STZC 1KUQA 3W7SA 1SS3A 2WLLA 3MAQA 3OM3B 1YIJV 4JAAA 1VQKV 2ODMA 4DR5O 2XAHA 2PUSA 1I7FA 3IFXA 1HNZO 1JJ2U 1JMKC 4NKGB 2EIKB 1KECA 1WA8A 5B1AC 2A7WA 3CJHA 2QKSA 4UCRA 4UCVA 2OCCC 3ABTA 1ORQC 1OCCC 1R6NA 5LGTA 5JCOC 3JCZA 1KKCA 2JIZG 1J95A 2M7WA 1M56B 3K06A 4DV4B 1BQZA 1XHXA 3SYOA 1PM9A 3BVOA 3B8NA 4RO2A 4MTXA 5GONA 1BHAA 4DV7B 5LMNO 3F5WC 4OPAA 3MHHC 3G4SV 2WA3A 1S3JA 1FJGB 3P30A 3KZIZ 4J80A 2WLKA 5DEDA 4LFBO 1S5LZ 1L8DA 1NVPD 4J10A 5LXTB 1F7YA 3FX7A 2Y69B 4DR2O 4J7ZA 1IVSA 4I55A 5LL6Y 2IJIA 3RYCA 1VF7A 2Q69A 2QR4A 2HP8A 2E5LO 3O65A 3WB0A 4H37A 2BSKA 1DLBA 3OTOB 1NI8A 5JVDA 3W7TA 4KXRA 3P32A 1SQBH 1H2SB 5B5EZ 2EILC 4TV9A 3HKDB 4PA7A 3ETDA 1FFXA 4CS3A 4B3RO 2PTMA 1HDJA 2R9IA 4PA3A 1OCOB 2Q73A 1BZKA 5CBHA 4LH6A 3CSXA 3D3QA 3JATB 5L3FA 1XHZA 2GUZA 2JEXA 1V54C 3CC2V 3SYPA 3CB2A 3RYHB 5FPRA 2ILMA 1ZUQA 2IJJA 4J7KA 5LMNB 4RQFA 1HW7A 1YVWA 3C90A 3K0GA 4JI6O 4JASA 3ZCCA 3ZHQA 3ABUA 4EFBA 3ZRSA 2V1DA 2JK5C 5FNVA 4N21A 4U7OA 3E2EA 2IM9A 2YXYA 2LJ2A 2HEPA 5LP6C 1FXKB 2G38A 4DR2B 3CCRV 2XAFA 1JNBA 4DV0O 4NR1A 2Z3YA 1LR1A 4UVBA 3AEIA 3WG7C 4CC5A 4B7KA 3AK3A 4HBNA 3M8AA 2E5LB 1QVFU 5CA0B 3L9DA 2IJHA 4X89A 3SPHA 1GK9A 4WFHA 5B3SB 1T5EA 5A9GA 4JZGA 5GTHZ 5K1PA 3VOUA 1SQXH 2JGDB 1YI2V 3SJCC 5LA6B 2AW9A 4FPPA 3ZHSA 1DF4A 5LMUO 3JASA 2CTQA 4DR1O 1VQ4V 3K5MA 3FYIB 4B3RB 4LF7O 3EVKA 1S76D 2E3CA 5IE9A 4JI1O 5BR8O 3FFQA 1OCZC 2YIBD 4O2BB 4I9QA 2PYLA 4JTDB 5EYPA 1XMOB 4TV8A 2UUBB 3U0ZA 3MDSA 2GDSA 2QM8A 2WLJA 1L0NH 4X20B 2XASA 2W0FC 3CXCU 4HAMA 2RJZA 1HNWB 1SZXA 5JJNB 2EZPA 2QSAA 3F7VC 4U3JB 2ETNA 2EINB 2ZE5A 3W7XA 3X2QB 3ABLB 3TCUA 1OCRC 5LHIA 3CMAV 3UT5A 2ZXWB 2WAMA 4GX0A 3JSNA 1AROP 3E35A 1CXZB 1SESA 1WJZA 3G80A 5EC2C 4DUZO 1NVPB 2UXDO 4JI4O 1K5SA 3T1HO 3G6EV 2P4VA 3HKEA 2B1IA 1M57C 4MVQA 4FM2A 4AQYO 1YJNV 2X7RB 2JEUA 4WFFA 3L71H 3JCUZ 4B3SO 3APOA 5B1AB 3BPZA 2DE0X 2X6CA 2BOBC 4O4IA 1OCCB 1L0LH 4K0KO 3T2MA 3ZEDA 4X8AA 3U11A 3JD0A 4LF7B 1FFTB 3K5NA 5BR8B 2YXLA 1K92A 2MW2B 1ZL8B 4ZBMA 4WBNB 5KHGA 1B06A 1Z5VA 1F4NA 4UCSA 3APQA 5J2TB 1SQPH 4LP8A 1KMIZ 5BMVA 2X6AA 3RGBA 3FAVA 1Q5OA 3RW0A 4IIJB 1QU7A 4BW9A 1J5EO 2VWKA 3D36C 2A79B 2CH7B 1NTKH 3SR2C 1SF9A 2IW5A 5IYZA 1I5YA 3AG4C 2UXCO 4QPKA 3ZX6A 4CC6A 1PNKA 1M93A 5LYJB 4G2KA 1WLEA 2OTJV 4J11A 2UXDB 4JI4B 1KKDA 2EIMC 3T1HB 1SKVA 3LNNA 4I0XA 1B04A 2Y0IA 4AQYB 1S5JA 1EN4A 3K08A 4B3SB 2P5OA 1VIBA 3CCMV 1MNGA 3G71V 4PA4A 4TQDA 4B3MO 4XDKA 1WB8A 3ZMSA 3K0DA 4QE9A 3ZJZA 5L3EA 4NB5A 1VQMV 1GM8A 1G8MA 2KSDA 3CRMA 1WNSA 4JYBA 4BR6A 5EIBD 1KQSU 1PNLA 4J7JA 1Q8IA 2EIJC 4FLXA 2HFEC 1V54B 3ZN1A 3J7AU 2HHHO 2Q0OC 4I7ZB 1FXHA 3ZHTA 1THZA 1NT2B 4JPRA 5JQGA 3RYFB 4GZRB 4AHCA 1YDXA 3ICXA 2CTPA 1KD1W 3DC5A 1Q6HA 2DYRC 3DSQA 4PI0A 4O4JA 2MK3A 3E8FA 4JYAO 2IH1C 1VMGA 4ASUG 4Z1MG 5LP6B 1TVKB 2YI8A 3TK1A 2Y4UA 5B1BC 1E79G 3WG7B 4PD4F 2WLIA 3L70H 4B08A 4GKKO 1QNMA 1XMQO 2PGGA 2C2AA 4EB6B 3BABA 4OXSA 1VQ7V 3FB7C 5TISZ 2OIEA 1XUQA 5CA1B 4FFBB 4CS2A 1MZFA 4JYYA 2N04A 3K59A 2ZE8A 1JVMA 3QNEA 4B3MB 1XNQB 3HKDA 2QWOB 1GAXA 4X64O 3OTFA 2PZSA 3K58A 1V55B 2WPDG 4IT5A 2BTQB 1P49A 1AJPA 1VF6C 4BIZA 4PELA 2A0LA 1GO3F 2OCHA 1XILA 3JATA 1BSMA 3QF7A 1RPRA 3CPWU 2D3OW 1VQ9V 1DK1A 2HHHB 2X6BA 2QGNA 4H0LB 3ML0A 2HJFC 3C3SA 2JS5A 3WB1A 3LDEA 3ETGA 5EZYB 4N23A 3LUTB 5GW7A 4NYKA 1OCRB 1H38A 3KCYA 3ZMTA 4KP4A 3UQ8A 2UUCO 5EBWC 1DF5A 2E74B 4X66O 5J2UB 4JYAB 4B7EA 1YTFD 1M57B 1FXKA 1SETA 5KHHA 3CCUV 3CRQA 4BWAA 4GKKB 3ZBHA 4UB8Z 1XMQB 1R3JC 4YJ2A 3OUFA 3G6BA 3K79A 3CRCA 3CXHF 3QO8A 4DR4O 2QA4V 2K9PA 1FYJA 2RDCA 4LH7A 4KHPB 5IWAO 1H8HG 1QR8A 4Q20A 5LA6A 1NQTA 4DK0A 1AILA 2E75B 1SZTA 3AG1C 1OHHG 5C93A 1BS3A 2Q67A 3IJ4A 3ETEA 3N2KB 1AR1B 1VQ8V 2E76B 3N2GB 2EX3A 2D2CB 1M9NA 4CH3A 2BOCC 1OV9A 3RFRA 3RVYA 3Q4HB 2YEVB 5KA5A 2ZNIA 3OEHG 1FS0G 4DV7O 4RWUA 2YI9A 3L75H 1ZTEA 4X20A
chains in the Genus database with same CATH topology
2ADQB 1IDSA 1I08A 1SZXA 1IXBA 1PL4A 3C3TA 1ZLZA 4F6EA 1AP6A 1P7GA 1XILA 2RCVA 1BSMA 3TJTA 1VEWA 1EN4A 1XDCA 1XREA 1LUVA 1MNGA 3C3SA 1ZSPA 1GN3A 1D5NA 1MA1A 1WB8A 1MMMA 1ZUQA 2QKCA 3KDRA 4JZ2A 4YIPA 1EN6A 4BR6A 1LUWA 1KKCA 1GN4A 3CEIA 3RN4A 1AR5A 4GUNA 1EN5A 5AG2A 3KKYA 1PM9A 3AK2A 3BFRA 3DC6A 1VARA 1BT8A 1GN2A 1MSDA 4X9QA 3DC5A 3AK3A 2P4KA 2QKAA 1GN6A 4YIOA 5A9GA 1B06A 4JZGA 1AR4A 1WB7A 1IX9A 1Y67A 2AW9A 4C7UA 2CE4A 3OT7A 1JR9A 1QNMA 3EVKA 1BS3A 1AP5A 3LSUA 4FFKA 3QVNA 3IC9A 2ADPA 1AVMA 1EM1A 1JA8A 1XUQA 4E4EA 1I0HA 2CDYA 1N0JA 1N0NA 4JYYA 3K9SA 3MDSA 3AK1A 2GDSA 1ZTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADQ B;  1IDS A;  1I08 A;  1SZX A;  1IXB A;  1PL4 A;  3C3T A;  1ZLZ A;  4F6E A;  1AP6 A;  1P7G A;  1XIL A;  2RCV A;  1BSM A;  3TJT A;  1VEW A;  1EN4 A;  1XDC A;  1XRE A;  1LUV A;  1MNG A;  3C3S A;  1ZSP A;  1GN3 A;  1D5N A;  1MA1 A;  1WB8 A;  1MMM A;  1ZUQ A;  2QKC A;  4JZ2 A;  4YIP A;  1EN6 A;  4BR6 A;  1LUW A;  1KKC A;  1GN4 A;  3CEI A;  3RN4 A;  1AR5 A;  4GUN A;  1EN5 A;  5AG2 A;  3KKY A;  1PM9 A;  3AK2 A;  3BFR A;  3DC6 A;  1VAR A;  1BT8 A;  1GN2 A;  1MSD A;  4X9Q A;  3DC5 A;  3AK3 A;  2P4K A;  2QKA A;  1GN6 A;  4YIO A;  5A9G A;  1B06 A;  4JZG A;  1AR4 A;  1WB7 A;  1IX9 A;  1Y67 A;  2AW9 A;  4C7U A;  2CE4 A;  3OT7 A;  1JR9 A;  1QNM A;  3EVK A;  1BS3 A;  1AP5 A;  3LSU A;  4FFK A;  3QVN A;  3IC9 A;  2ADP A;  1AVM A;  1EM1 A;  1JA8 A;  1XUQ A;  4E4E A;  1I0H A;  2CDY A;  1N0J A;  1N0N A;  4JYY A;  3K9S A;  3MDS A;  3AK1 A;  2GDS A;  1ZTE A; 
#chains in the Genus database with same CATH topology
 1VQP V;  2ADQ B;  4PA6 A;  4U3J A;  3IAY A;  1ZLZ A;  5EK0 A;  3UO3 A;  3S3W A;  1P7G A;  2RCV A;  1AI4 A;  3AG4 B;  2UUC B;  1Q43 A;  4X66 B;  1XDC A;  3SGI A;  2JDI G;  3P3P A;  4CH4 A;  2EIM B;  2LW7 A;  1NS1 A;  1K4C C;  2NN4 A;  4J9Z B;  4ZI7 A;  2K1E A;  2UXX A;  3OTO O;  1KU9 A;  1RSO A;  3AG2 B;  3VQV A;  4MVU A;  1CPY A;  2DJV A;  1AR5 A;  5ITZ B;  4DV6 B;  2ZDI C;  2PYJ A;  4DR4 B;  5CB4 B;  2YC0 A;  4OGQ B;  5IWA B;  4X1K B;  4DUY O;  1GN2 A;  2IH3 C;  2EIJ B;  3SPI A;  2DOS A;  3B09 A;  4TQF A;  2P4K A;  2ZT9 B;  1YJW V;  5CBG A;  1ZAU A;  3EFF K;  3TXQ A;  5L3B A;  1Q7Y W;  2A3Q A;  3H9V A;  3RT3 C;  1Q81 W;  3RYI B;  4TT3 G;  2DYR B;  3K03 A;  3TXS A;  4MTG A;  4ZKI A;  2DMX A;  2W0X A;  4UVC A;  4MVZ A;  4DR7 O;  5D5P A;  3BA9 A;  2P90 A;  1M5I A;  4YJ3 B;  1EM1 A;  5B1B B;  3ZRW A;  4FM1 A;  4OX9 B;  2ZE6 A;  1SA0 A;  2CDY A;  2CH7 A;  2Z5U A;  2ITC C;  4GX1 A;  3JAW B;  4JI8 O;  2LQT A;  3E86 A;  5KA6 A;  2LGW A;  4F6R A;  4J9Y B;  2YS8 A;  2P6J A;  2QWR B;  3SJQ C;  1YTF B;  5JJE B;  4Q6G A;  1IXM A;  4FLZ A;  1K97 A;  2Q8V A;  1R3I C;  1XRE A;  4HNA B;  3SYA A;  2N05 A;  2WLH A;  2GTA A;  1MMM A;  1YJ9 V;  4TSF G;  2AGA A;  5LHH A;  4DUY B;  1IUR A;  2DYS C;  2WLM A;  2QKC A;  3E22 A;  3T1Y O;  3CME V;  1GH6 A;  1LUW A;  4LWS B;  1QLE B;  3SJB C;  4EKW A;  2QE7 G;  3OW2 U;  4NTX A;  5DN6 G;  5IT9 N;  2XAQ A;  1XMO O;  4UFZ A;  2UUB O;  3ASO C;  2P67 A;  1HP8 A;  1PP9 H;  4Z1V A;  1Z5W A;  3ZMU A;  1Y76 B;  2YIC A;  3RYF A;  1IBL O;  1HNW O;  3JYC A;  3TGU H;  4X65 B;  1RM1 C;  2ZIO A;  1HNX O;  4DR7 B;  5KMG A;  4QGP A;  3DXR B;  4Z2W A;  3LDD A;  4NXN O;  4DR6 B;  1IX9 A;  4FM0 A;  4J41 A;  3LSS A;  2IU3 A;  4IHJ B;  4MSW C;  4JI8 B;  2LW1 A;  3ASN C;  1N33 O;  1OZ0 A;  1P4R A;  1JX9 A;  3NR7 A;  1NJI W;  3LSU A;  2WLN A;  1H2K A;  2UXB B;  2CGN A;  4EB6 A;  4E4E A;  3A0R A;  4RAI A;  2XHB A;  4FFB A;  1MG1 A;  4XDJ A;  2JRI A;  4FZ0 A;  1F23 A;  4R8C A;  2UXN A;  3HKB B;  2H94 A;  3HKC B;  3OR7 C;  2ARH A;  1XNR O;  4L8J A;  3T1Y B;  4YXW G;  2BTQ A;  3A0H Z;  2EJR A;  5EBL C;  1N8R W;  1NU1 H;  2Q9L A;  1NKD A;  1B6Q A;  3GB7 C;  3CCL V;  1LNQ A;  3JAL B;  4IYI A;  4NTY A;  4X1Y B;  2R72 A;  4DV1 B;  3BAA A;  3K5O A;  3MHS C;  4O4L A;  1R3K C;  5KHK A;  1HR0 O;  1IBL B;  1D5A A;  3WFV A;  3KDR A;  4JZ2 A;  3CCJ V;  1PPJ H;  2QM4 A;  1JQ0 A;  1URF A;  4IL6 Z;  4UV9 A;  1HNX B;  1JJO A;  4X1I B;  4H33 A;  1XL4 A;  2JJ1 G;  4L87 A;  4EEQ A;  5AG2 A;  1KBH A;  1W0J G;  3JSL A;  2YID A;  4QPJ A;  4LC1 A;  1EBO A;  1G4Y B;  4ZHQ B;  4NXN B;  5CMU A;  3PJS K;  1VAR A;  2EJ7 A;  2QJ1 A;  5A2Q N;  4X9Q A;  3ZMV A;  5EBM C;  1N33 B;  3AG7 A;  4CH6 A;  2DWE C;  3B4S A;  4UCU A;  5KX5 B;  1IZ3 A;  2YDE A;  2QEX V;  4MT8 A;  4LR3 A;  4QJF B;  3H1L H;  2IU0 A;  4DK1 A;  2WLL B;  2VQF B;  4WFG A;  1DGS A;  2OCC B;  1MSW D;  4O4H A;  4K8X A;  2ZIN A;  4G28 B;  2OWO A;  1XNR B;  1QLN A;  1K9M W;  3K3W A;  1XEQ A;  2P22 C;  4LNU A;  3JD1 A;  5E79 Z;  1X59 A;  1BMF G;  3M99 B;  2GHY A;  4ICG A;  5IJ0 B;  3N2G A;  4PDL A;  1WA8 B;  1ZX3 A;  5KAF Z;  3SJA C;  3CJH B;  3Q4H A;  5KHI A;  1HR0 B;  1E1Q G;  1EFR G;  5LGN A;  3B77 A;  4FVM A;  4X88 A;  2QWN B;  5C8Y B;  4O2A A;  2YSU B;  2QWP B;  3K9A A;  1RPO A;  2VRZ A;  2WA4 A;  2JJ2 G;  4I50 B;  4IGG A;  3CS5 A;  2CUG A;  3K04 A;  5GON B;  1TGO A;  1KYO F;  2ZNJ A;  3GWK C;  2XAJ A;  2CAZ C;  2DWD C;  2X0L A;  3H1K H;  2VWJ A;  4J42 A;  3EHB B;  2KG7 B;  1GN4 A;  3ZMZ A;  3OGC C;  2B5U A;  2EIL B;  4YHH B;  5ITZ A;  1FPO A;  3OEE G;  3BFR A;  4I55 B;  2DYS B;  5HFM A;  5CB4 A;  1SQQ H;  1XNQ O;  4P2Z A;  2LGQ A;  1JOY A;  1IBK B;  1O9H A;  2GBO A;  2BSK B;  3ZHV A;  1H8E G;  2GV9 A;  3HPL C;  4FMT A;  2ZR3 A;  3ZN0 A;  5JVD B;  5BY1 A;  5B1N A;  2QKA A;  1QCE A;  4TOI A;  2FTK A;  5L3G A;  1B3Q A;  1FFX B;  2EIK C;  4I4T B;  3RYI A;  2CE4 A;  1JR9 A;  2PI5 A;  2ADP A;  5B66 Z;  2XOK G;  1H2N A;  2GUZ B;  1N0J A;  1M56 C;  5LXT A;  1XL6 A;  4GKJ B;  4K3A A;  3ASN B;  1VP7 A;  4MVR A;  2HVK C;  2L6L A;  3JAR B;  1QR9 A;  5L3D A;  1TUB B;  1Q90 D;  1AI7 A;  3HB3 B;  1G6U A;  3TET A;  3C3T A;  3JD3 A;  1JFF B;  2EBO A;  3LSQ A;  3L73 H;  3K5L A;  2F1M A;  3T4D A;  1AI6 A;  3B8M A;  5LOV B;  1XBL A;  1BL8 A;  1JCH A;  4KHP O;  4DYL A;  2ZR2 A;  4HNA A;  1MA1 A;  2BTO A;  1OCZ B;  2VQE O;  2FKX A;  4TWK A;  1I94 B;  3OMI B;  2R9R B;  4IYH A;  4DW1 A;  1PNM A;  3CEI A;  4QE7 A;  4MW3 A;  1A32 A;  5H2F Z;  2ZE7 A;  3I55 V;  1GMG A;  3JAS B;  1I5X A;  1Q3E A;  4NVP A;  3RYH A;  2ZIM A;  3GWO A;  3DGE A;  5DEC A;  1PD3 A;  2LFS A;  1S5H C;  2F95 B;  2KQX A;  1YZB A;  2R70 A;  3FYE B;  4I9W A;  1SQV H;  4AIL C;  2CGO A;  4TV8 B;  1WPX A;  1AR4 A;  1M4U A;  1H2M A;  2F43 G;  4ZOL B;  3F5T A;  4C7U A;  5KHJ A;  3OT7 A;  3JD2 A;  1WP8 A;  3CE2 A;  4LF9 O;  1AP5 A;  3THO A;  4MS2 A;  4LF8 O;  1AJQ A;  4FLU A;  1VQ5 V;  2PI4 A;  5IYD O;  5GTI Z;  3UT5 B;  1AVM A;  1U97 A;  4E2L A;  5KUK A;  2QTO A;  5FL7 G;  3SPG A;  5CA0 A;  4DV6 O;  4QNH B;  3I5D A;  2FL4 A;  3R65 A;  1H5W A;  1R73 A;  3AK1 A;  3U10 A;  4JGS A;  2JGD A;  3ZRV A;  4W4K A;  4YY3 O;  4G27 B;  1Z2G A;  1S77 D;  3HKE B;  5BXZ A;  1FXK C;  2DN9 A;  2VQE B;  2A06 H;  2PF4 E;  4NXM B;  2BE3 A;  3CRR A;  1AP6 A;  1IBM O;  4JTA B;  3STL C;  4O2B A;  2DW4 A;  3CCS V;  1LUV A;  2XT9 A;  5B3S C;  3JAL A;  4FK5 C;  4X1Y A;  1D5N A;  1H2L A;  4W4L A;  2HJD A;  1N4C A;  2ZM6 O;  4UXN A;  1RFY A;  2W6J G;  1PL0 A;  5H9C A;  1VQN V;  4GCZ A;  4OX9 O;  1AI5 A;  4XBF A;  3H1J H;  4P9P A;  2ZD9 A;  5BMV B;  3OR6 C;  4RQE A;  3DC6 A;  2YIA A;  3OMA B;  4UV8 A;  2F4V O;  3FAV B;  2UUA B;  1FAF A;  3QO7 A;  2QM7 A;  4LFA O;  4LF9 B;  1PV0 A;  4BIU A;  5LHG A;  4LF8 B;  2EIN C;  4AI8 A;  1KP2 A;  3LNM B;  3X2Q C;  4D6T H;  3ABL C;  1NBM G;  5IYZ B;  1GKF A;  2ZXW C;  5KUM A;  4GX2 A;  3SYC A;  4FLT A;  4YY3 B;  4KUM A;  5JCO A;  4I0X B;  2UU9 O;  1WP7 A;  1EZV H;  2Q0A A;  4UCO A;  4LF6 O;  4DV5 B;  1JA8 A;  1ZL8 A;  1K8A W;  1WPB A;  1FKA O;  1IBM B;  5IJ0 A;  3SPJ A;  4DV2 O;  1YSC A;  4JI2 B;  4WBN A;  1N0N A;  2WSS G;  2Q6A A;  3K9S A;  1X4T A;  2JVD A;  3F7Y C;  4H13 B;  1DTO A;  2ITD C;  1YXB A;  5J2T A;  2F23 A;  3OFN G;  2B9Z A;  3KG2 A;  4PA9 A;  4FLV A;  3SYQ A;  4PHZ A;  2AZ2 A;  2RQ6 A;  4DO2 A;  2ZM6 B;  4X65 O;  1K5Q A;  1OJH A;  4DV3 O;  2CK3 G;  5C8Y A;  1BQ0 A;  2V7Q G;  3VQY A;  2Q5Z A;  2Q4P A;  4MW8 A;  4F6E A;  4IIJ A;  2RNB A;  2H3O A;  2ZQM A;  1VEW A;  4I50 A;  2IBZ H;  4XDL A;  1R6K A;  3ABM C;  5JQG B;  4DR6 O;  1CEZ A;  1SC5 B;  3T4Z A;  3BRC A;  2F66 C;  3AG3 C;  5JH7 B;  3RVZ A;  3RBZ A;  2F4V B;  4WFA V;  3D8C A;  1YEW A;  5LYJ A;  2OYQ A;  1UPG A;  4MVO A;  1HWY A;  4DRX B;  2XTA A;  4LFA B;  2Q68 A;  1K3E A;  4O4J B;  2KG7 A;  2UXB O;  4KL1 A;  1UFI A;  2L35 A;  4I5S A;  4LCU C;  4CZZ A;  3CYO A;  2Y4T A;  3CWB H;  2WLI B;  5IJ9 B;  3H1H H;  4OPH A;  4U3F H;  3ZIA G;  1K4D C;  2PY5 A;  1SQF A;  4JI7 O;  4HZ3 A;  1US6 A;  4DR5 B;  2UU9 B;  2DQ0 A;  4MTO A;  1HNZ B;  4JI5 O;  3SDL A;  4LF6 B;  1G1X B;  3FB6 C;  2CTR A;  5IYB O;  2ATK C;  3N27 A;  3UO2 A;  4DV2 B;  1NTM H;  4DV1 O;  4I4T A;  3IC7 A;  5HFL A;  3QTC A;  2YIB A;  4LF4 O;  3UCS C;  4JAV A;  4DV3 B;  3QVN A;  1NTZ H;  3RWR D;  3CC7 V;  2FB5 A;  2HKO A;  3J80 N;  4CS4 A;  5LP6 A;  1TVK A;  5CBF A;  4PDM A;  4ZIB A;  4JAU A;  3OMN B;  3JAR A;  3UM7 A;  5H5N A;  4K35 A;  4D7T A;  3UKM A;  3VQX A;  3CHX A;  1TUB A;  4LFB B;  5J9P C;  4R7C A;  1JFF A;  5CA1 A;  3E8B A;  5LOV A;  4GX5 A;  2VQF O;  3LDC A;  1XI1 A;  2FYU H;  3AG1 B;  4PJ0 Z;  4RUF A;  2GTS A;  1Y74 B;  2QWQ B;  3JAK B;  4JF3 A;  4JI7 B;  1N32 O;  4YJ2 B;  2Y0P A;  4JI0 O;  1N36 O;  2ZCE A;  3L74 H;  3RN4 A;  3NXS A;  2AHZ A;  4JI5 B;  3IGA C;  1SQG A;  1EN5 A;  4FJC C;  3ABK C;  3AK2 A;  1Y6X A;  2HLD G;  3O9O A;  1R6T A;  3OE7 G;  1M90 W;  3T1C A;  5EZY A;  3W7U A;  4LF4 B;  1V55 C;  5CA3 A;  5IDJ A;  1Q86 W;  1NR7 A;  3FKS G;  1QBZ A;  2YXH A;  3VBB A;  1VF5 B;  1WB7 A;  4DR3 O;  5FPO A;  5J2U A;  3R66 A;  4H44 B;  4RUE A;  2Q7G A;  2LFR A;  4ZOL A;  4TUY B;  2R9A A;  5KAI Z;  3SPC A;  2AZ0 A;  4MVS A;  3B40 A;  3A2F A;  1D2D A;  4JI6 B;  2DQ3 A;  1O9G A;  4FFK A;  2AXT Z;  2EUL A;  4FIP C;  3FB8 C;  1Y4M A;  4WFB V;  1K7D A;  4K8Z A;  4YHH O;  5IYC O;  2Z0A A;  2LP7 A;  1CP9 A;  4DXW A;  4CH5 A;  1FD9 A;  1GRJ A;  4DV0 B;  1NR1 A;  5IY5 C;  1IBK O;  3CCE V;  1IDS A;  3KCX A;  1F4M A;  4ZI7 B;  1R3L C;  4GLX A;  1N32 B;  1RSO B;  1MAB G;  4JI0 B;  1Q82 W;  3PN1 A;  1N36 B;  3CCQ V;  1Y66 A;  3N2K A;  1W0K G;  1P84 F;  3OGI B;  1GM9 A;  5H6Q A;  3CD6 V;  4JI3 O;  4JV5 O;  1GN3 A;  3B2E E;  1WN7 A;  2YEV A;  5LMU B;  4U7N A;  4DR1 B;  4LBE C;  4MVM A;  1GTO A;  4WF9 V;  2XUM A;  3P3N A;  1EN6 A;  1GM7 A;  4JI1 B;  4UUJ C;  2JGU A;  5H6R A;  2OIG A;  3D36 A;  1M1K W;  3M7M X;  3ABM B;  4QIW F;  1ZWI C;  4GUN A;  3I56 V;  3AG3 B;  1Q6U A;  4GKJ O;  2KKW A;  4DR3 B;  4LFC O;  5LGU A;  2EZO A;  2XND G;  5EIB C;  3L72 H;  1YF2 A;  4CBC A;  2M6Y A;  2Q7H A;  1JPX A;  1FOU A;  2YUA A;  4FZ1 A;  1K34 A;  3ZRW B;  1SA0 B;  3CRA A;  2A9H A;  1GN6 A;  4YIO A;  3EXA A;  1VQ6 V;  1N34 O;  2HVJ C;  2RN9 A;  1NH2 D;  3RYC B;  3E89 A;  4F6R B;  4X1K A;  4DUZ B;  1I94 O;  3ZHR A;  3CX5 F;  1FXV A;  3IC9 A;  1NZ6 A;  3BEH A;  4P30 A;  3ASO B;  2OTL V;  1VQO V;  3AG2 C;  4PI2 A;  3FD9 A;  4TV9 B;  1R1B A;  5E1A C;  3OAA G;  4JI3 B;  3E22 B;  4JV5 B;  3QG5 A;  3W7W A;  1RM1 B;  4K0K B;  2QTS A;  4MTF A;  5F2V O;  1TAE A;  2P7T C;  1I08 A;  1W2B U;  2B1G A;  2F93 B;  2P06 A;  3TJT A;  1BHB A;  1SER A;  4YJ3 A;  2N74 A;  3FB5 C;  5D5Q A;  3OD4 A;  2ZKO A;  1YIT V;  2NLJ C;  3K57 A;  1ZSP A;  2O57 A;  4R6Z A;  4LFC B;  1YHQ V;  5BZB A;  4BIO A;  3JAW A;  1TA8 A;  5JH7 A;  5L3C A;  5LBQ A;  4PV1 B;  5KMG B;  1KB9 F;  3DTU B;  4JTC B;  4X62 O;  4DRX A;  1J5E B;  3A0B Z;  4LF5 O;  1BCC H;  1U96 A;  4B3T O;  2LO1 A;  5FNV B;  2GSM B;  3CC4 V;  1K73 W;  3BHP A;  3WU2 Z;  3WB2 A;  1P7B A;  2JS3 A;  1N34 B;  3G67 A;  4FLY A;  3CCV V;  2UXC B;  2CTW A;  1BT8 A;  2QDO A;  2AHY A;  5IJ9 A;  2Y69 C;  4NTW A;  4BAY A;  2V4D A;  1TUE B;  1VF6 A;  3H01 A;  3CP1 A;  4WFE A;  4NXM O;  1BE3 H;  3ABK B;  4LWS A;  1L1F A;  4GT1 A;  2HG5 C;  3MD0 A;  4D7S A;  1Y67 A;  1AB3 A;  5CN0 A;  5KLV H;  4PDR A;  4KFM A;  1QVG U;  1BGY H;  4EFE A;  1Y76 A;  2OT5 A;  1QQC A;  1S72 V;  1XQ8 A;  4F4L A;  5FLX N;  4P9O A;  4BW5 A;  3ETQ A;  5B1O A;  1Q6I A;  4A5U B;  3ZHU A;  1OCO C;  1QLE C;  5EYP B;  2H8P C;  3DXR A;  5DM6 V;  1KP3 A;  4O4L B;  3JD4 A;  2Q7E A;  2BCC H;  2UUA O;  2NNU A;  1H2G A;  4JYC A;  4IHJ A;  1F51 A;  1IXB A;  1KC8 W;  1PL4 A;  2KB1 A;  4X62 B;  1K33 A;  4LF5 B;  4B3T B;  3OUS A;  5JJJ B;  2Y48 A;  3QO5 A;  4HYO A;  3BA8 A;  5IY5 B;  1MZE A;  3HKB A;  2VS0 A;  3E8G A;  5JWP A;  1EZJ A;  3BCC H;  3HKC A;  3ZRX A;  1Y74 A;  4YIP A;  3JAK A;  1XOU A;  1NH2 B;  1MOF A;  3HR0 A;  4DV5 O;  1UJW B;  1ENV A;  1PKX A;  1AJN A;  4JI2 O;  3A8T A;  3KKY A;  1COW G;  4O4I B;  3S3X A;  2HR3 A;  4UCT A;  4O4H B;  2NR5 A;  4WCE V;  4ABM A;  1MSD A;  3E8H A;  4X64 B;  1ROP A;  3J81 N;  3E83 A;  2IJK A;  4LNU B;  4R50 A;  1S0V A;  4DV4 O;  3H1I H;  4DW0 A;  3VQW A;  4FLW A;  5K1X A;  4X1I A;  4UB6 Z;  4GYC B;  2RMK B;  1W59 A;  4PDV A;  3GVM A;  4ZHQ A;  3ZS8 C;  1SRY A;  5EC1 C;  1QHT A;  4TUY A;  1IJG A;  4UVA A;  1YCI A;  2XAG A;  4O2A B;  1V9P A;  1FJG O;  3JAM N;  2W6I G;  1RP3 B;  1WAZ A;  3BY6 A;  2WWW A;  2ZDI A;  1I0H A;  5KX5 A;  1VQL V;  1E1R G;  3D3I A;  2FML A;  3STZ C;  1KUQ A;  3W7S A;  1SS3 A;  2WLL A;  3MAQ A;  3OM3 B;  1YIJ V;  4JAA A;  1VQK V;  2ODM A;  4DR5 O;  2XAH A;  2PUS A;  1I7F A;  3IFX A;  1HNZ O;  1JJ2 U;  1JMK C;  4NKG B;  2EIK B;  1KEC A;  1WA8 A;  5B1A C;  2A7W A;  3CJH A;  2QKS A;  4UCR A;  4UCV A;  2OCC C;  3ABT A;  1ORQ C;  1OCC C;  1R6N A;  5LGT A;  5JCO C;  3JCZ A;  1KKC A;  2JIZ G;  1J95 A;  2M7W A;  1M56 B;  3K06 A;  4DV4 B;  1BQZ A;  1XHX A;  3SYO A;  1PM9 A;  3BVO A;  3B8N A;  4RO2 A;  4MTX A;  5GON A;  1BHA A;  4DV7 B;  5LMN O;  3F5W C;  4OPA A;  3MHH C;  3G4S V;  2WA3 A;  1S3J A;  1FJG B;  3P30 A;  3KZI Z;  4J80 A;  2WLK A;  5DED A;  4LFB O;  1S5L Z;  1L8D A;  1NVP D;  4J10 A;  5LXT B;  1F7Y A;  3FX7 A;  2Y69 B;  4DR2 O;  4J7Z A;  1IVS A;  4I55 A;  5LL6 Y;  2IJI A;  3RYC A;  1VF7 A;  2Q69 A;  2QR4 A;  2HP8 A;  2E5L O;  3O65 A;  3WB0 A;  4H37 A;  2BSK A;  1DLB A;  3OTO B;  1NI8 A;  5JVD A;  3W7T A;  4KXR A;  3P32 A;  1SQB H;  1H2S B;  5B5E Z;  2EIL C;  4TV9 A;  3HKD B;  4PA7 A;  3ETD A;  1FFX A;  4CS3 A;  4B3R O;  2PTM A;  1HDJ A;  2R9I A;  4PA3 A;  1OCO B;  2Q73 A;  1BZK A;  5CBH A;  4LH6 A;  3CSX A;  3D3Q A;  3JAT B;  5L3F A;  1XHZ A;  2GUZ A;  2JEX A;  1V54 C;  3CC2 V;  3SYP A;  3CB2 A;  3RYH B;  5FPR A;  2ILM A;  1ZUQ A;  2IJJ A;  4J7K A;  5LMN B;  4RQF A;  1HW7 A;  1YVW A;  3C90 A;  3K0G A;  4JI6 O;  4JAS A;  3ZCC A;  3ZHQ A;  3ABU A;  4EFB A;  3ZRS A;  2V1D A;  2JK5 C;  5FNV A;  4N21 A;  4U7O A;  3E2E A;  2IM9 A;  2YXY A;  2LJ2 A;  2HEP A;  5LP6 C;  1FXK B;  2G38 A;  4DR2 B;  3CCR V;  2XAF A;  1JNB A;  4DV0 O;  4NR1 A;  2Z3Y A;  1LR1 A;  4UVB A;  3AEI A;  3WG7 C;  4CC5 A;  4B7K A;  3AK3 A;  4HBN A;  3M8A A;  2E5L B;  1QVF U;  5CA0 B;  3L9D A;  2IJH A;  4X89 A;  3SPH A;  1GK9 A;  4WFH A;  5B3S B;  1T5E A;  5A9G A;  4JZG A;  5GTH Z;  5K1P A;  3VOU A;  1SQX H;  2JGD B;  1YI2 V;  3SJC C;  5LA6 B;  2AW9 A;  4FPP A;  3ZHS A;  1DF4 A;  5LMU O;  3JAS A;  2CTQ A;  4DR1 O;  1VQ4 V;  3K5M A;  3FYI B;  4B3R B;  4LF7 O;  3EVK A;  1S76 D;  2E3C A;  5IE9 A;  4JI1 O;  5BR8 O;  3FFQ A;  1OCZ C;  2YIB D;  4O2B B;  4I9Q A;  2PYL A;  4JTD B;  5EYP A;  1XMO B;  4TV8 A;  2UUB B;  3U0Z A;  3MDS A;  2GDS A;  2QM8 A;  2WLJ A;  1L0N H;  4X20 B;  2XAS A;  2W0F C;  3CXC U;  4HAM A;  2RJZ A;  1HNW B;  1SZX A;  5JJN B;  2EZP A;  2QSA A;  3F7V C;  4U3J B;  2ETN A;  2EIN B;  2ZE5 A;  3W7X A;  3X2Q B;  3ABL B;  3TCU A;  1OCR C;  5LHI A;  3CMA V;  3UT5 A;  2ZXW B;  2WAM A;  4GX0 A;  3JSN A;  1ARO P;  3E35 A;  1CXZ B;  1SES A;  1WJZ A;  3G80 A;  5EC2 C;  4DUZ O;  1NVP B;  2UXD O;  4JI4 O;  1K5S A;  3T1H O;  3G6E V;  2P4V A;  3HKE A;  2B1I A;  1M57 C;  4MVQ A;  4FM2 A;  4AQY O;  1YJN V;  2X7R B;  2JEU A;  4WFF A;  3L71 H;  3JCU Z;  4B3S O;  3APO A;  5B1A B;  3BPZ A;  2DE0 X;  2X6C A;  2BOB C;  4O4I A;  1OCC B;  1L0L H;  4K0K O;  3T2M A;  3ZED A;  4X8A A;  3U11 A;  3JD0 A;  4LF7 B;  1FFT B;  3K5N A;  5BR8 B;  2YXL A;  1K92 A;  2MW2 B;  1ZL8 B;  4ZBM A;  4WBN B;  5KHG A;  1B06 A;  1Z5V A;  1F4N A;  4UCS A;  3APQ A;  5J2T B;  1SQP H;  4LP8 A;  1KMI Z;  5BMV A;  2X6A A;  3RGB A;  3FAV A;  1Q5O A;  3RW0 A;  4IIJ B;  1QU7 A;  4BW9 A;  1J5E O;  2VWK A;  3D36 C;  2A79 B;  2CH7 B;  1NTK H;  3SR2 C;  1SF9 A;  2IW5 A;  5IYZ A;  1I5Y A;  3AG4 C;  2UXC O;  4QPK A;  3ZX6 A;  4CC6 A;  1PNK A;  1M93 A;  5LYJ B;  4G2K A;  1WLE A;  2OTJ V;  4J11 A;  2UXD B;  4JI4 B;  1KKD A;  2EIM C;  3T1H B;  1SKV A;  3LNN A;  4I0X A;  1B04 A;  2Y0I A;  4AQY B;  1S5J A;  1EN4 A;  3K08 A;  4B3S B;  2P5O A;  1VIB A;  3CCM V;  1MNG A;  3G71 V;  4PA4 A;  4TQD A;  4B3M O;  4XDK A;  1WB8 A;  3ZMS A;  3K0D A;  4QE9 A;  3ZJZ A;  5L3E A;  4NB5 A;  1VQM V;  1GM8 A;  1G8M A;  2KSD A;  3CRM A;  1WNS A;  4JYB A;  4BR6 A;  5EIB D;  1KQS U;  1PNL A;  4J7J A;  1Q8I A;  2EIJ C;  4FLX A;  2HFE C;  1V54 B;  3ZN1 A;  3J7A U;  2HHH O;  2Q0O C;  4I7Z B;  1FXH A;  3ZHT A;  1THZ A;  1NT2 B;  4JPR A;  5JQG A;  3RYF B;  4GZR B;  4AHC A;  1YDX A;  3ICX A;  2CTP A;  1KD1 W;  3DC5 A;  1Q6H A;  2DYR C;  3DSQ A;  4PI0 A;  4O4J A;  2MK3 A;  3E8F A;  4JYA O;  2IH1 C;  1VMG A;  4ASU G;  4Z1M G;  5LP6 B;  1TVK B;  2YI8 A;  3TK1 A;  2Y4U A;  5B1B C;  1E79 G;  3WG7 B;  4PD4 F;  2WLI A;  3L70 H;  4B08 A;  4GKK O;  1QNM A;  1XMQ O;  2PGG A;  2C2A A;  4EB6 B;  3BAB A;  4OXS A;  1VQ7 V;  3FB7 C;  5TIS Z;  2OIE A;  1XUQ A;  5CA1 B;  4FFB B;  4CS2 A;  1MZF A;  4JYY A;  2N04 A;  3K59 A;  2ZE8 A;  1JVM A;  3QNE A;  4B3M B;  1XNQ B;  3HKD A;  2QWO B;  1GAX A;  4X64 O;  3OTF A;  2PZS A;  3K58 A;  1V55 B;  2WPD G;  4IT5 A;  2BTQ B;  1P49 A;  1AJP A;  1VF6 C;  4BIZ A;  4PEL A;  2A0L A;  1GO3 F;  2OCH A;  1XIL A;  3JAT A;  1BSM A;  3QF7 A;  1RPR A;  3CPW U;  2D3O W;  1VQ9 V;  1DK1 A;  2HHH B;  2X6B A;  2QGN A;  4H0L B;  3ML0 A;  2HJF C;  3C3S A;  2JS5 A;  3WB1 A;  3LDE A;  3ETG A;  5EZY B;  4N23 A;  3LUT B;  5GW7 A;  4NYK A;  1OCR B;  1H38 A;  3KCY A;  3ZMT A;  4KP4 A;  3UQ8 A;  2UUC O;  5EBW C;  1DF5 A;  2E74 B;  4X66 O;  5J2U B;  4JYA B;  4B7E A;  1YTF D;  1M57 B;  1FXK A;  1SET A;  5KHH A;  3CCU V;  3CRQ A;  4BWA A;  4GKK B;  3ZBH A;  4UB8 Z;  1XMQ B;  1R3J C;  4YJ2 A;  3OUF A;  3G6B A;  3K79 A;  3CRC A;  3CXH F;  3QO8 A;  4DR4 O;  2QA4 V;  2K9P A;  1FYJ A;  2RDC A;  4LH7 A;  4KHP B;  5IWA O;  1H8H G;  1QR8 A;  4Q20 A;  5LA6 A;  1NQT A;  4DK0 A;  1AIL A;  2E75 B;  1SZT A;  3AG1 C;  1OHH G;  5C93 A;  1BS3 A;  2Q67 A;  3IJ4 A;  3ETE A;  3N2K B;  1AR1 B;  1VQ8 V;  2E76 B;  3N2G B;  2EX3 A;  2D2C B;  1M9N A;  4CH3 A;  2BOC C;  1OV9 A;  3RFR A;  3RVY A;  3Q4H B;  2YEV B;  5KA5 A;  2ZNI A;  3OEH G;  1FS0 G;  4DV7 O;  4RWU A;  2YI9 A;  3L75 H;  1ZTE A;  4X20 A; 
#chains in the Genus database with same CATH homology
 2ADQ B;  1IDS A;  1I08 A;  1SZX A;  1IXB A;  1PL4 A;  3C3T A;  1ZLZ A;  4F6E A;  1AP6 A;  1P7G A;  1XIL A;  2RCV A;  1BSM A;  3TJT A;  1VEW A;  1EN4 A;  1XDC A;  1XRE A;  1LUV A;  1MNG A;  3C3S A;  1ZSP A;  1GN3 A;  1D5N A;  1MA1 A;  1WB8 A;  1MMM A;  1ZUQ A;  2QKC A;  3KDR A;  4JZ2 A;  4YIP A;  1EN6 A;  4BR6 A;  1LUW A;  1KKC A;  1GN4 A;  3CEI A;  3RN4 A;  1AR5 A;  4GUN A;  1EN5 A;  5AG2 A;  3KKY A;  1PM9 A;  3AK2 A;  3BFR A;  3DC6 A;  1VAR A;  1BT8 A;  1GN2 A;  1MSD A;  4X9Q A;  3DC5 A;  3AK3 A;  2P4K A;  2QKA A;  1GN6 A;  4YIO A;  5A9G A;  1B06 A;  4JZG A;  1AR4 A;  1WB7 A;  1IX9 A;  1Y67 A;  2AW9 A;  4C7U A;  2CE4 A;  3OT7 A;  1JR9 A;  1QNM A;  3EVK A;  1BS3 A;  1AP5 A;  3LSU A;  4FFK A;  3QVN A;  3IC9 A;  2ADP A;  1AVM A;  1EM1 A;  1JA8 A;  1XUQ A;  4E4E A;  1I0H A;  2CDY A;  1N0J A;  1N0N A;  4JYY A;  3K9S A;  3MDS A;  3AK1 A;  2GDS A;  1ZTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...