1EN5A

Crystal structure analysis of the e. coli manganese superoxide dismutase y34f mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTFVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 74
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en5A02
1GN6A 3K9SA 4YIPA 1WB7A 4FFKA 1QNMA 1XREA 4C7UA 4X9QA 1IX9A 2ADPA 1AVMA 1MNGA 4JZ2A 1EN6A 1MA1A 3AK1A 3BFRA 4GUNA 1D5NA 1AR4A 5A9GA 1XUQA 1ZUQA 3OT7A 3IC9A 1GN4A 4F6EA 3TJTA 1EM1A 1I0HA 3QVNA 1ZTEA 3C3TA 1IXBA 1B06A 1VARA 3C3SA 1WB8A 3CEIA 1BSMA 1Y67A 3LSUA 3RN4A 4BR6A 2AW9A 1GN3A 1AP5A 1EN5A 2ADQB 4E4EA 3DC5A 1LUWA 1JR9A 4YIOA 5AG2A 2GDSA 1N0JA 1EN4A 1LUVA 1ZSPA 1VEWA 2QKCA 3AK3A 2P4KA 3DC6A 1AP6A 1XDCA 1MSDA 2CE4A 3AK2A 1ZLZA 1MMMA 1I08A 3EVKA 4JZGA 1JA8A 1N0NA 1KKCA 1PM9A 3MDSA 1P7GA 2RCVA 4JYYA 1XILA 1IDSA 1AR5A 2QKAA 1GN2A 1BS3A 1BT8A 1SZXA 3KKYA 1PL4A 2CDYA
chains in the Genus database with same CATH superfamily
4ZIBA 1GH6A 1AJNA 3E22B 1HR0B 3J7AU 4PV1B 4OX9O 2PUSA 1N36O 3ASOC 3VOUA 5HFLA 3ZMTA 1RM1C 4I55A 5KLVH 3CRCA 1JOYA 4OPHA 1FXHA 4YJ2A 2RMKB 3CX5F 3E22A 2YS8A 4J11A 4I0XA 1F7YA 4PDLA 3ABTA 4UVCA 4NXMO 3ABLB 2F43G 4MW3A 3MHHC 2YI9A 1BL8A 3BCCH 2YEVB 1L0LH 1OCRB 3BPZA 4ABMA 1X59A 2EULA 2F4VO 1XBLA 3DTUB 2BSKB 3OMAB 4LF8O 4GZRB 4O4LB 4NR1A 4NXNB 2OIGA 4EKWA 3RVYA 4OGQB 4XDLA 5BXZA 5H2FZ 1I7FA 2JGDB 1WAZA 1KU9A 1KD1W 3K04A 2B1IA 4K8ZA 4R6ZA 2YEVA 3OTOB 5J9PC 3L9DA 3O9OA 1S77D 5CBHA 2YDEA 4X66B 2D2CB 2PY5A 1IBLB 4LWSB 4B3RO 2BSKA 2EJ7A 4O4LA 1AR5A 4IT5A 2IU3A 2R9AA 4LF6O 2JGDA 4O4IB 1OJHA 1PL4A 1IXMA 2LO1A 5B1OA 5JQGB 4JAAA 4DUZO 3SYQA 1GN6A 3JSNA 2HVKC 2IH1C 1J5EO 4EFBA 2PF4E 5LP6C 4LWSA 4X9QA 1GM8A 2MK3A 4RQEA 2XAFA 4H0LB 2FB5A 2YSUB 1Z5WA 1W2BU 2CTWA 4O4IA 1WPXA 2Z5UA 1SQBH 2XAGA 3IC9A 1Q6UA 1Q5OA 2VWKA 1I94B 3D36C 2YUAA 3SPCA 3LSUA 4JPRA 3CXHF 2F93B 1AR1B 3E8HA 1FD9A 1E1QG 4JI7B 3X2QB 3APOA 3QTCA 4MVMA 1VIBA 3RYFB 1N34O 3CS5A 3H1LH 1VF7A 3ZMZA 2UXNA 3ABMC 1YI2V 1VQ4V 1Q81W 2NNUA 3K5NA 5LGUA 4DV3B 1YTFD 4JI8O 3EVKA 5CA1B 2GUZB 5K1PA 1TUBB 1PM9A 3D3IA 5BR8B 4CC6A 4PA3A 4DV7O 1NR1A 3ZEDA 3RYFA 2R72A 4B7EA 5LMUB 2ZE5A 5A2QN 2CDYA 4JAVA 4RWUA 2CTPA 4YJ3B 1X4TA 1VQNV 2Q73A 2H3OA 2LJ2A 5JWPA 5CA1A 4FFBB 1H2MA 2GUZA 3TXSA 5EBMC 1H2LA 2RQ6A 2WLIB 1OHHG 2A9HA 4TV8A 2P67A 4DR1B 1TVKB 1A32A 4W4LA 4DV4B 1NJIW 4WCEV 5E1AC 3K5MA 1ZL8B 4K0KB 2DWEC 1TA8A 4P9PA 1VMGA 2BOCC 3UM7A 2ZD9A 4UVBA 2BTOA 2VQFB 3CCMV 4UCTA 3FYIB 3UKMA 1GTOA 3B77A 2ATKC 2ILMA 4FFBA 1EFRG 3BHPA 4WFEA 2JEXA 3C3SA 5KA5A 1GM7A 1QLNA 4GLXA 3SPHA 1TVKA 1YJWV 2IU0A 1IVSA 4DK0A 1XHZA 1YF2A 2Q7HA 2YC0A 2ADQB 3LUTB 2BTQB 2PI4A 1ZL8A 3HKDB 5KHJA 1NVPD 1K4CC 1VQ7V 4N23A 5F2VO 1HR0O 2GDSA 1RSOB 1ZAUA 1QLEC 3U10A 5D5QA 2ETNA 2QDOA 3K9AA 3CCVV 1AP6A 3G6EV 1XDCA 1MG1A 2X6BA 1E79G 4X64B 2P22C 1KYOF 3D3QA 2ZR3A 2F95B 1KKCA 2EIMC 3JSLA 4Z1MG 1JFFB 1K8AW 3LSSA 2BTQA 4FLZA 4O2BB 1B6QA 5FNVB 2D3OW 1XQ8A 3HKDA 4JI1B 1XILA 4FM0A 3SYPA 2DW4A 1RSOA 1O9HA 3CC2V 4TQFA 4GYCB 1CPYA 2G38A 3HKCB 4MVOA 3AG3B 4JI2B 1H2NA 1BE3H 2DYRC 2EINC 3QF7A 4LF4B 2ZIOA 4FM1A 3BRCA 5LMNB 1Q8IA 1JFFA 1GKFA 3H01A 4O2BA 4NXNO 2KKWA 5FNVA 5EYPB 3H9VA 4MTFA 4X89A 3RW0A 1Y76B 2CTQA 4WFHA 4DR6B 2P7TC 4B7KA 4TSFG 1EN6A 1TAEA 4MTOA 4CH3A 1SA0B 3ABKB 3HKCA 1FXKC 3OTOO 4B3TB 1GM9A 2H94A 1H5WA 2Y69B 3B4SA 2ZKOA 1P7BA 1KMIZ 1ZX3A 4X66O 4F6EA 1EM1A 2KSDA 1IBLO 4PA6A 1JQ0A 1YVWA 3BA8A 4D6TH 1GAXA 5EYPA 3W7TA 4TV9B 1K5SA 5GTIZ 2DN9A 2QJ1A 1Y76A 4LF7B 4WFBV 1SZTA 2UUAB 1PP9H 1HNXB 2DWDC 3STLC 3A0HZ 1FS0G 4DV1B 2PYJA 1L1FA 1PPJH 5DECA 1FPOA 1W59A 4CH6A 3K03A 3JAMN 3IGAC 3JAKB 4MVZA 1EZJA 4DR2B 1KC8W 1MZEA 3DC6A 4TV9A 3ZHRA 1WPBA 1VQ6V 3W7WA 3GVMA 2XTAA 3SJCC 3CMEV 3OMNB 4K35A 3S3WA 2XUMA 4B3SB 3UO3A 2QKSA 2Y0IA 1I94O 1F4NA 1EBOA 5IYCO 3N2KA 3M8AA 1MSWD 3G6BA 2LQTA 2QWPB 4O4HB 2B1GA 4JI7O 1KECA 3LDDA 4I4TB 1YSCA 1NTKH 5L3FA 1AVMA 3LSQA 3K3WA 3AK1A 3ZMUA 2GTAA 5A9GA 2VWJA 1XUQA 4BW5A 4BW9A 4DV3O 4DK1A 4I5SA 2P5OA 2GV9A 4IYHA 4O4HA 5BR8O 4MVQA 2BOBC 4JI4B 2UU9B 5LGNA 1JX9A 2EIKC 2GSMB 2WLKA 3CCLV 3BA9A 2DQ0A 4PI2A 1QVGU 4BR6A 5LMUO 2GTSA 2ZE7A 3ETGA 1PNKA 2FYUH 4QNHB 1VP7A 2W6IG 3UCSC 3CXCU 3T1CA 4UV9A 1VQ8V 5J2TA 4DR1O 5BZBA 4YHHO 4O2AB 4HNAB 1JJOA 4HAMA 1S0VA 3RYIB 4DV4O 2UXBB 5L3BA 3CCEV 4K0KO 4JF3A 3TGUH 3ZRWB 1FJGB 1P7GA 1YZBA 2XHBA 3F5TA 2VQFO 2ZM6B 2W0XA 4JTCB 1BT8A 1NKDA 2V7QG 1Z5VA 2DYSC 2Y48A 3KKYA 3ABKC 4O2AA 4H37A 1ROPA 5CN0A 3CPWU 3RYIA 4LC1A 1JNBA 3ZMSA 1URFA 4QPJA 1H8EG 3ZRWA 3ZHSA 5KHGA 1VQ5V 2YI8A 4PELA 1MNGA 4B3MB 4R8CA 3ABMB 3CRRA 2Q4PA 1AJQA 4LCUC 4NTYA 4PA7A 3KCXA 2V4DA 4I0XB 2Y4TA 4X64O 2WLMA 2PTMA 3FX7A 1NQTA 2GBOA 1YDXA 3L70H 2OWOA 4R7CA 2E75B 3E8BA 1KP3A 1V9PA 2X6CA 4JI1O 2JK5C 2R9IA 3RWRD 5KAFZ 1XL6A 4FPPA 2JJ2G 3JALB 1MOFA 1SQVH 4JI2O 3ABUA 5KUMA 2HEPA 1AJPA 3ZIAG 5L3CA 5GONB 4LF4O 4DR4B 4CBCA 1EN4A 5LMNO 3GWOA 4MVUA 1EZVH 2QTOA 5LYJB 4B08A 1NH2B 4DYLA 4GX0A 4DR6O 4WFFA 5JJNB 2LGQA 3OGIB 1I08A 2VRZA 1XL4A 3J81N 1XHXA 3JALA 4B3TO 3OD4A 3QG5A 1K7DA 2PGGA 4Z1VA 2JS5A 5GONA 3TETA 2QM7A 1AI7A 1BQZA 1ENVA 3ZJZA 3G4SV 1GN2A 4UB8Z 3CCJV 1DTOA 3WB1A 1NBMG 1BHAA 1OCZC 5D5PA 5LYJA 1F51A 3KCYA 3WG7C 4LF7O 5IDJA 3K9SA 2LFSA 3F7VC 1L8DA 2UUAO 3R66A 1HNXO 2ZCEA 1Q43A 4MW8A 4DV6B 4FLTA 3AG1C 2A79B 1P4RA 4IHJB 2ITDC 4DV1O 5IYDO 3ZHVA 4K8XA 1R3KC 3IJ4A 1QLEB 5CMUA 1WA8B 2XAQA 2OT5A 5CB4B 4UCRA 3ZRSA 1NTMH 4JZ2A 5C8YB 4H44B 1GRJA 4DR2O 4AILC 5FL7G 2E74B 3CP1A 3ETEA 1D5AA 4GX1A 2EIMB 1JMKC 3HKEA 5LHIA 1FAFA 3JCUZ 4IHJA 1QVFU 3RGBA 3C3TA 2LFRA 1IZ3A 5IYBO 4B3SO 1WA8A 2EILB 2F66C 5CB4A 1S3JA 3P3NA 3RN4A 3CSXA 4QGPA 5C8YA 2DYRB 2AW9A 4UXNA 3C90A 4KFMA 1GN3A 2EINB 2AZ2A 2M6YA 1YCIA 3N2GA 5KHKA 2QWQB 2L6LA 1CXZB 1M4UA 2HLDG 3T1YB 4N21A 4MVRA 1NI8A 1LR1A 1QCEA 2HJFC 3HB3B 4FK5C 4DUYB 4KUMA 2ODMA 2P4KA 3LDEA 1R6KA 1K5QA 4CH4A 1FXKB 2EZPA 2HG5C 5H6RA 4JZGA 1JA8A 3QO7A 4UFZA 1JCHA 4JYYA 3CRQA 1R1BA 4G27B 2DMXA 2QKAA 1Q6IA 5DM6V 1KBHA 2M7WA 4LH6A 4JI4O 2UU9O 1BGYH 2BCCH 1IBMB 4RO2A 4BIOA 2EIJC 1FXKA 1PKXA 4CS2A 4JASA 4U7NA 2AZ0A 5DEDA 5L3EA 1TGOA 3MHSC 5B1BC 3QO8A 2JGUA 4TV8B 2IW5A 1IX9A 2Q69A 1V54B 3ZHTA 4WFAV 1KQSU 3T1HB 4NVPA 1YIJV 5BY1A 4AQYB 1K97A 1N4CA 3BVOA 4GX2A 3K57A 2JIZG 3BEHA 2UXBO 1GO3F 3CCRV 1FJGO 3H1JH 1THZA 1ZTEA 5IWAB 1SQXH 3ETQA 2ZM6O 1VARA 2YXLA 4YHHB 1BZKA 2JDIG 1RFYA 2QA4V 2HP8A 1FXVA 1K34A 4J7KA 1WNSA 2WLNA 4R50A 1PD3A 3JAWA 4HYOA 2N74A 1PV0A 1JR9A 1Q90D 3W7XA 4LNUB 2WA3A 3F7YC 4RAIA 5FPRA 5KUKA 2QR4A 4PDMA 5LHGA 4B3MO 5FLXN 5L3GA 2ZINA 1YTFB 3ZHUA 2Q6AA 1VQMV 4FLYA 5IYZB 2UUBB 1N0NA 4LF5B 5GTHZ 1UPGA 4FMTA 3L71H 2ZE6A 4JTDB 4LNUA 1NZ6A 3VQYA 4D7TA 2EIKB 3GWKC 1GMGA 2Q67A 1SF9A 4UCUA 4JYAB 4U7OA 3UQ8A 4GX5A 4J7ZA 3FB6C 5IYZA 3G71V 4PD4F 4NB5A 4DR4O 5JCOC 3OW2U 1RP3B 4Q20A 2WLHA 2ZT9B 2AHZA 5ITZB 4X20B 2AXTZ 4H33A 4FLUA 2EILC 5BMVA 4IIJB 1G4YB 3J80N 1D5NA 2F23A 2Q5ZA 1QU7A 5EIBD 1HNWB 2ZDIC 1JPXA 5KHIA 3AG2B 1E1RG 4FLWA 1IJGA 1AI6A 2QEXV 1HWYA 1NU1H 4WBNB 1KP2A 1B06A 2HVJC 1MZFA 4J9YB 2ZXWB 2MW2B 5K1XA 2AGAA 3M99B 4JAUA 2CK3G 1K3EA 4D7SA 5ITZA 3OE7G 3LNNA 2DYSB 1M9NA 2Q9LA 5IJ0B 4X20A 3FAVB 3K58A 4JTAB 1AB3A 3S3XA 4IIJA 3OUSA 1NVPB 1R3LC 5IJ9A 2XAHA 2HKOA 4DV6O 3RYHA 1K9MW 4GKKB 4J7JA 4ZI7B 4UUJC 3SJBC 5LHHA 4LFAB 3QO5A 1XMOB 2ZE8A 1VEWA 3EFFK 1H8HG 4PA4A 4WFGA 4WBNA 4NYKA 3W7SA 2W0FC 5EZYB 4I9WA 3SDLA 3H1IH 3CRMA 1PNLA 5J2UB 1ZLZA 5IJ0A 1PL0A 2WLLA 3FAVA 5LXTB 2Q7GA 3B2EE 4JYCA 1ZWIC 3SR2C 4TWKA 4ZOLA 1N32B 1RPRA 2QM4A 4DV2B 4ZI7A 1DF5A 1M93A 1AI5A 2EBOA 2DJVA 2K1EA 2IH3C 1V54C 3A0RA 4ICGA 1VQOV 4LP8A 3N2KB 4MVSA 5EZYA 4JI6B 3QNEA 4DR7B 5J2UA 5LXTA 4FFKA 5EBWC 3ZX6A 4X1KB 3AEIA 1L0NH 2UXDB 4ZHQB 1J95A 1R6NA 3T1YO 1VQPV 3VQVA 1K73W 3T4ZA 3B09A 1BCCH 4DUYO 4YY3B 5B3SC 1O9GA 3PJSK 5LL6Y 4CS3A 3LNMB 1Q7YW 2UXCB 4YXWG 2N04A 5CBGA 1WP7A 4DW1A 4X1KA 2LP7A 4PDVA 3I56V 1FFXB 4ZHQA 4QE7A 4X88A 2CAZC 1DF4A 5B1AC 2LW7A 5EC1C 1F23A 3DGEA 3ASNB 4UCSA 5LA6B 4FJCC 2EZOA 1OCZB 3NR7A 5LGTA 1SQQH 3WG7B 2CTRA 4MSWC 2OCHA 1IBMO 3K06A 3CC7V 2A7WA 3AG1B 3U0ZA 1G8MA 1YJ9V 1AI4A 3APQA 2IJHA 4TT3G 2OYQA 4O4JA 1N0JA 2RNBA 1VF5B 3HKBA 4PJ0Z 1SC5B 5J2TB 1SKVA 1P84F 3OFNG 4FZ0A 3L72H 2PI5A 4J10A 1FFXA 3AK3A 1Y4MA 3JCZA 3MAQA 2WSSG 4OPAA 4UV8A 3RFRA 4EB6B 1WP8A 1SESA 5LA6A 3T1HO 4AQYO 2Z0AA 1WLEA 3WU2Z 1HNZB 3E89A 3ZN1A 1I5XA 5GW7A 2NN4A 2GHYA 2Z3YA 2XOKG 4XDKA 2QE7G 1P49A 4DV0B 2YXYA 3K5OA 4XDJA 5IWAO 1AROP 1SZXA 4CZZA 2FL4A 4DO2A 4EB6A 4ZKIA 3E86A 1YHQV 4TQDA 3FB7C 3CCUV 4GT1A 4CC5A 3STZC 4OXSA 1YEWA 2Q0OC 4JV5B 3AG2C 1M57B 2LGWA 3T2MA 3VBBA 1Z2GA 2ZXWC 2UUCB 1CP9A 2FTKA 2HJDA 2QWNB 5KA6A 3U11A 3CJHB 4JYBA 5IY5C 5EBLC 2E3CA 1SS3A 3TK1A 3UT5A 4DRXB 2JRIA 3RYCB 4PDRA 2UUBO 5H9CA 4LF5O 2P6JA 2HR3A 2P4VA 2ZR2A 4EFEA 2WPDG 3CB2A 4DR3B 3OEHG 3SGIA 2RJZA 3SPIA 4KP4A 2NR5A 3CJHA 4E4EA 2EIJB 4JYAO 5B1NA 2IJJA 2Q8VA 1T5EA 3HPLC 4KXRA 4DRXA 5B1BB 1NT2B 3ZN0A 3RYCA 3CMAV 4J41A 3IAYA 1JJ2U 2QKCA 5CBFA 2PYLA 1HP8A 3P32A 4MT8A 4G2KA 1VQ9V 3VQWA 2K9PA 3AK2A 5EIBC 3OM3B 5L3DA 1B04A 3K5LA 1S5HC 2WLJA 4P9OA 3SPGA 4J42A 1HNWO 1IDSA 4PA9A 4LR3A 1XNRB 2E5LB 1NR7A 3CCQV 3B40A 4Z2WA 2IJIA 2JEUA 4X65B 1H2KA 3CYOA 4J80A 4DV5B 1UJWB 1WB7A 1H2SB 3JD1A 3Q4HB 3JARB 3BABA 3CWBH 3F5WC 2C2AA 4UVAA 2QGNA 2B9ZA 4GKKO 3AG4C 4W4KA 3JATB 1W0JG 2CUGA 4UB6Z 4LFAO 1XMOO 1KKDA 3DXRB 4LBEC 1H38A 5H5NA 1MA1A 3AG7A 1FYJA 3ASNC 3E8GA 1XMQB 2BE3A 3TCUA 2A3QA 1ZUQA 3HKEB 3SYAA 2RN9A 4NKGB 1V55B 3ZMVA 1IBKB 3TJTA 3Q4HA 3JARA 1R73A 3ZS8C 1N32O 4QPKA 4DV2O 1YXBA 3JATA 1U96A 3ICXA 4QJFB 3DXRA 4IL6Z 4RQFA 3HR0A 4KHPB 2FMLA 3N2GB 1WJZA 3DC5A 4NTXA 4JI6O 4JI5B 4CH5A 1CEZA 1FFTB 3UO2A 2XT9A 4DR7O 4EEQA 1QQCA 4P30A 1JVMA 1SETA 2UXDO 2DOSA 1R3JC 1OZ0A 2YICA 3NXSA 3ZRXA 2IBZH 4YY3O 2Y4UA 1M56C 3BY6A 4H13B 2CGNA 2UXCO 5B5EZ 1M57C 3M7MX 5EK0A 3JD0A 2OCCC 1SQPH 3EXAA 3FKSG 5JCOA 4X62B 1G1XB 5LOVB 2YIAA 2XASA 2QWOB 5B66Z 2YXHA 2P06A 2ITCC 2QM8A 5JQGA 4YIPA 4J9ZB 2KQXA 5KAIZ 2Q68A 3L73H 1M90W 2ZDIA 1FOUA 1XREA 3OR6C 4XBFA 3DSQA 1XOUA 2JJ1G 4IYIA 4FIPC 1COWG 2LW1A 3BFRA 5LOVA 4JI3B 4K3AA 1N33B 2ARHA 4G28B 4JGSA 2QWRB 1TUEB 2HHHB 4PI0A 3K08A 1UFIA 1HNZO 1Q86W 3H1HH 3PN1A 2H8PC 1YJNV 4DV0O 4KL1A 4I7ZB 1XI1A 4IGGA 4JI0B 1U97A 4F4LA 1OCOB 2FKXA 2UXXA 3JAWB 4X1YB 3OTFA 1VF6A 1PNMA 2Y0PA 1BQ0A 2WAMA 5AG2A 1WN7A 3E83A 2YIDA 3FFQA 4JV5O 4AHCA 2W6JG 1D2DA 1I5YA 4F6RB 2JS3A 1F4MA 2UUCO 3OEEG 5B3SB 1MSDA 3L74H 3OUFA 3WB2A 4I9QA 1Y6XA 1XNQB 2OTJV 1K4DC 4GKJB 3ABLC 1TUBA 3K0DA 4X1YA 3A0BZ 1Q3EA 4MTXA 1BHBA 5H6QA 5E79Z 3CRAA 5B1AB 1HDJA 4RUEA 1OCRC 1OCCB 4UCOA 2A06H 4DR3O 1RPOA 4F6RA 1SERA 4LF9B 2JVDA 2CGOA 2PZSA 2HFEC 3T4DA 3H1KH 2ZQMA 4YJ3A 2YIBD 1LNQA 3CE2A 1V55C 1K33A 4DR5B 5IT9N 2WLIA 4FLVA 4RUFA 5BMVB 2ZNJA 3E35A 2VQEB 3MD0A 3E8FA 4LFBB 4LFCB 3OMIB 1R6TA 3RT3C 5TISZ 2ZNIA 5JJEB 1VQKV 1SQGA 3SYOA 4GCZA 3RVZA 3QVNA 3N27A 3JASB 1K92A 3ZBHA 1N8RW 3KG2A 5CA0B 1Y74B 1XNRO 2O57A 1WB8A 2X7RB 2E5LO 3CEIA 2RDCA 1DK1A 1Y67A 1MABG 4FLXA 3B8NA 1DLBA 4MS2A 1OV9A 1EN5A 5IJ9B 4X65O 4NTWA 3RYHB 4OX9B 2F1MA 4DV5O 1N36B 1LUWA 4BIUA 2P90A 5LBQA 3LDCA 2E76B 4FZ1A 3THOA 2QSAA 1LUVA 1VQLV 1W0KG 1AILA 3JASA 5CA0A 2WA4A 1Y74A 1M5IA 2QTSA 2R9RB 5JH7B 2WLLB 5IY5B 2XAJA 1MMMA 1XMQO 5KX5B 4NXMB 2R70A 1Q6HA 2Q7EA 4ZOLB 4ZBMA 2RCVA 1Q82W 1IBKO 3SJQC 3SJAC 1S5JA 4PHZA 5C93A 1BMFG 3CD6V 3IC7A 3I5DA 2F4VB 5KMGB 2X6AA 1VF6C 4LF8B 5JH7A 3ETDA 4KHPO 3X2QC 5KX5A 2YIBA 1FKAO 4U3JB 4JI5O 4WF9V 4Q6GA 3JD2A 2ADPA 2VS0A 2EX3A 1H2GA 1XEQA 1S5LZ 4TOIA 3L75H 3KDRA 3SYCA 2EJRA 1SA0A 3D8CA 4GUNA 3OAAG 4FM2A 2V1DA 1S72V 1IURA 1OCOC 4AI8A 5KMGA 4B3RB 3CCSV 2Q0AA 1GN4A 3ASOB 4LF6B 4TUYB 4U3JA 1RM1B 3EHBB 4DW0A 4U3FH 3KZIZ 1DGSA 1NS1A 4DUZB 3OR7C 1BSMA 1M1KW 1R3IC 3ZRVA 2X0LA 4X62O 1J5EB 1S76D 4I50B 1KB9F 4HZ3A 3JD4A 3WFVA 1YITV 2KB1A 4O4JB 3HKBB 1G6UA 3AG4B 4ASUG 5FPOA 4DXWA 3FB8C 4TUYA 3JAKA 1OCCC 4BIZA 2CE4A 3P3PA 5EC2C 5IE9A 4I50A 3SPJA 1NTZH 4JI3O 1N33O 3MDSA 4HBNA 2HHHO 4E2LA 1GK9A 2WWWA 2CH7B 2A0LA 3ML0A 3TXQA 4QE9A 2DQ3A 3RBZA 3K79A 1KUQA 3CC4V 5HFMA 3I55V 4JI0O 4FVMA 5KHHA 1N34B 2OTLV 1QNMA 2OIEA 4CS4A 2DE0X 4I4TA 4C7UA 2NLJC 3A2FA 3GB7C 3K0GA 3ZCCA 4X1IB 3JD3A 5CA3A 2CH7A 1QR8A 1Y66A 1SQFA 4JI8B 2B5UA 1AR4A 3UT5B 1M56B 2IM9A 4DV7B 3OT7A 3ZHQA 1ORQC 5LP6B 4L8JA 1XNQO 1I0HA 1B3QA 4GKJO 4X8AA 3E2EA 1IXBA 3B8MA 1QR9A 2KG7B 2OCCB 3JYCA 3R65A 2IJKA 3BAAA 3AG3C 4X1IA 3FD9A 4BWAA 3VQXA 3P30A 2N05A 1AP5A 4A5UB 3IFXA 3O65A 4LF9O 3CHXA 1SRYA 3OGCC 4YIOA 2XNDG 5LP6A 4L87A 1ZSPA 5JVDB 3W7UA 4P2ZA 4DR5O 1NH2D 2KG7A 3G67A 4LH7A 1HW7A 5DN6G 2L35A 3K59A 4HNAA 2VQEO 1QHTA 1US6A 2Y69C 4LFBO 4LFCO 3G80A 2ZIMA 4UCVA 3A8TA 4BAYA 2AHYA 4I55B 5JJJB 3FYEB 1BS3A 4QIWF 5JVDA 3D36A 4YJ2B 1QBZA 4MTGA 3WB0A 3FB5C
chains in the Genus database with same CATH topology
1GN6A 3K9SA 4YIPA 1WB7A 4FFKA 1QNMA 1XREA 4C7UA 4X9QA 1IX9A 2ADPA 1AVMA 1MNGA 4JZ2A 1EN6A 1MA1A 3AK1A 3KDRA 3BFRA 4GUNA 1D5NA 1AR4A 5A9GA 1XUQA 1ZUQA 3OT7A 3IC9A 1GN4A 4F6EA 3TJTA 1EM1A 1I0HA 3QVNA 1ZTEA 3C3TA 1IXBA 1B06A 1VARA 3C3SA 1WB8A 3CEIA 1BSMA 1Y67A 3LSUA 3RN4A 4BR6A 2AW9A 1GN3A 1AP5A 1EN5A 2ADQB 4E4EA 3DC5A 1LUWA 1JR9A 4YIOA 5AG2A 2GDSA 1N0JA 1EN4A 1LUVA 1ZSPA 1VEWA 2QKCA 3AK3A 2P4KA 3DC6A 1AP6A 1XDCA 1MSDA 2CE4A 3AK2A 1ZLZA 1MMMA 1I08A 3EVKA 4JZGA 1JA8A 1N0NA 1KKCA 1PM9A 3MDSA 1P7GA 2RCVA 4JYYA 1XILA 1IDSA 1AR5A 2QKAA 1GN2A 1BS3A 1BT8A 1SZXA 3KKYA 1PL4A 2CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN6 A;  3K9S A;  4YIP A;  1WB7 A;  4FFK A;  1QNM A;  1XRE A;  4C7U A;  4X9Q A;  1IX9 A;  2ADP A;  1AVM A;  1MNG A;  4JZ2 A;  1EN6 A;  1MA1 A;  3AK1 A;  3BFR A;  4GUN A;  1D5N A;  1AR4 A;  5A9G A;  1XUQ A;  1ZUQ A;  3OT7 A;  3IC9 A;  1GN4 A;  4F6E A;  3TJT A;  1EM1 A;  1I0H A;  3QVN A;  1ZTE A;  3C3T A;  1IXB A;  1B06 A;  1VAR A;  3C3S A;  1WB8 A;  3CEI A;  1BSM A;  1Y67 A;  3LSU A;  3RN4 A;  4BR6 A;  2AW9 A;  1GN3 A;  1AP5 A;  1EN5 A;  2ADQ B;  4E4E A;  3DC5 A;  1LUW A;  1JR9 A;  4YIO A;  5AG2 A;  2GDS A;  1N0J A;  1EN4 A;  1LUV A;  1ZSP A;  1VEW A;  2QKC A;  3AK3 A;  2P4K A;  3DC6 A;  1AP6 A;  1XDC A;  1MSD A;  2CE4 A;  3AK2 A;  1ZLZ A;  1MMM A;  1I08 A;  3EVK A;  4JZG A;  1JA8 A;  1N0N A;  1KKC A;  1PM9 A;  3MDS A;  1P7G A;  2RCV A;  4JYY A;  1XIL A;  1IDS A;  1AR5 A;  2QKA A;  1GN2 A;  1BS3 A;  1BT8 A;  1SZX A;  3KKY A;  1PL4 A;  2CDY A; 
#chains in the Genus database with same CATH topology
 4ZIB A;  1GH6 A;  1AJN A;  3E22 B;  1HR0 B;  3J7A U;  4PV1 B;  4OX9 O;  2PUS A;  1N36 O;  3ASO C;  3VOU A;  5HFL A;  3ZMT A;  1RM1 C;  4I55 A;  5KLV H;  3CRC A;  1JOY A;  4OPH A;  1FXH A;  4YJ2 A;  2RMK B;  3CX5 F;  3E22 A;  2YS8 A;  4J11 A;  4I0X A;  1F7Y A;  4PDL A;  3ABT A;  4UVC A;  4NXM O;  3ABL B;  2F43 G;  4MW3 A;  3MHH C;  2YI9 A;  1BL8 A;  3BCC H;  2YEV B;  1L0L H;  1OCR B;  3BPZ A;  4ABM A;  1X59 A;  2EUL A;  2F4V O;  1XBL A;  3DTU B;  2BSK B;  3OMA B;  4LF8 O;  4GZR B;  4O4L B;  4NR1 A;  4NXN B;  2OIG A;  4EKW A;  3RVY A;  4OGQ B;  4XDL A;  5BXZ A;  5H2F Z;  1I7F A;  2JGD B;  1WAZ A;  1KU9 A;  1KD1 W;  3K04 A;  2B1I A;  4K8Z A;  4R6Z A;  2YEV A;  3OTO B;  5J9P C;  3L9D A;  3O9O A;  1S77 D;  5CBH A;  2YDE A;  4X66 B;  2D2C B;  2PY5 A;  1IBL B;  4LWS B;  4B3R O;  2BSK A;  2EJ7 A;  4O4L A;  1AR5 A;  4IT5 A;  2IU3 A;  2R9A A;  4LF6 O;  2JGD A;  4O4I B;  1OJH A;  1PL4 A;  1IXM A;  2LO1 A;  5B1O A;  5JQG B;  4JAA A;  4DUZ O;  3SYQ A;  1GN6 A;  3JSN A;  2HVK C;  2IH1 C;  1J5E O;  4EFB A;  2PF4 E;  5LP6 C;  4LWS A;  4X9Q A;  1GM8 A;  2MK3 A;  4RQE A;  2XAF A;  4H0L B;  2FB5 A;  2YSU B;  1Z5W A;  1W2B U;  2CTW A;  4O4I A;  1WPX A;  2Z5U A;  1SQB H;  2XAG A;  3IC9 A;  1Q6U A;  1Q5O A;  2VWK A;  1I94 B;  3D36 C;  2YUA A;  3SPC A;  3LSU A;  4JPR A;  3CXH F;  2F93 B;  1AR1 B;  3E8H A;  1FD9 A;  1E1Q G;  4JI7 B;  3X2Q B;  3APO A;  3QTC A;  4MVM A;  1VIB A;  3RYF B;  1N34 O;  3CS5 A;  3H1L H;  1VF7 A;  3ZMZ A;  2UXN A;  3ABM C;  1YI2 V;  1VQ4 V;  1Q81 W;  2NNU A;  3K5N A;  5LGU A;  4DV3 B;  1YTF D;  4JI8 O;  3EVK A;  5CA1 B;  2GUZ B;  5K1P A;  1TUB B;  1PM9 A;  3D3I A;  5BR8 B;  4CC6 A;  4PA3 A;  4DV7 O;  1NR1 A;  3ZED A;  3RYF A;  2R72 A;  4B7E A;  5LMU B;  2ZE5 A;  5A2Q N;  2CDY A;  4JAV A;  4RWU A;  2CTP A;  4YJ3 B;  1X4T A;  1VQN V;  2Q73 A;  2H3O A;  2LJ2 A;  5JWP A;  5CA1 A;  4FFB B;  1H2M A;  2GUZ A;  3TXS A;  5EBM C;  1H2L A;  2RQ6 A;  2WLI B;  1OHH G;  2A9H A;  4TV8 A;  2P67 A;  4DR1 B;  1TVK B;  1A32 A;  4W4L A;  4DV4 B;  1NJI W;  4WCE V;  5E1A C;  3K5M A;  1ZL8 B;  4K0K B;  2DWE C;  1TA8 A;  4P9P A;  1VMG A;  2BOC C;  3UM7 A;  2ZD9 A;  4UVB A;  2BTO A;  2VQF B;  3CCM V;  4UCT A;  3FYI B;  3UKM A;  1GTO A;  3B77 A;  2ATK C;  2ILM A;  4FFB A;  1EFR G;  3BHP A;  4WFE A;  2JEX A;  3C3S A;  5KA5 A;  1GM7 A;  1QLN A;  4GLX A;  3SPH A;  1TVK A;  1YJW V;  2IU0 A;  1IVS A;  4DK0 A;  1XHZ A;  1YF2 A;  2Q7H A;  2YC0 A;  2ADQ B;  3LUT B;  2BTQ B;  2PI4 A;  1ZL8 A;  3HKD B;  5KHJ A;  1NVP D;  1K4C C;  1VQ7 V;  4N23 A;  5F2V O;  1HR0 O;  2GDS A;  1RSO B;  1ZAU A;  1QLE C;  3U10 A;  5D5Q A;  2ETN A;  2QDO A;  3K9A A;  3CCV V;  1AP6 A;  3G6E V;  1XDC A;  1MG1 A;  2X6B A;  1E79 G;  4X64 B;  2P22 C;  1KYO F;  3D3Q A;  2ZR3 A;  2F95 B;  1KKC A;  2EIM C;  3JSL A;  4Z1M G;  1JFF B;  1K8A W;  3LSS A;  2BTQ A;  4FLZ A;  4O2B B;  1B6Q A;  5FNV B;  2D3O W;  1XQ8 A;  3HKD A;  4JI1 B;  1XIL A;  4FM0 A;  3SYP A;  2DW4 A;  1RSO A;  1O9H A;  3CC2 V;  4TQF A;  4GYC B;  1CPY A;  2G38 A;  3HKC B;  4MVO A;  3AG3 B;  4JI2 B;  1H2N A;  1BE3 H;  2DYR C;  2EIN C;  3QF7 A;  4LF4 B;  2ZIO A;  4FM1 A;  3BRC A;  5LMN B;  1Q8I A;  1JFF A;  1GKF A;  3H01 A;  4O2B A;  4NXN O;  2KKW A;  5FNV A;  5EYP B;  3H9V A;  4MTF A;  4X89 A;  3RW0 A;  1Y76 B;  2CTQ A;  4WFH A;  4DR6 B;  2P7T C;  4B7K A;  4TSF G;  1EN6 A;  1TAE A;  4MTO A;  4CH3 A;  1SA0 B;  3ABK B;  3HKC A;  1FXK C;  3OTO O;  4B3T B;  1GM9 A;  2H94 A;  1H5W A;  2Y69 B;  3B4S A;  2ZKO A;  1P7B A;  1KMI Z;  1ZX3 A;  4X66 O;  4F6E A;  1EM1 A;  2KSD A;  1IBL O;  4PA6 A;  1JQ0 A;  1YVW A;  3BA8 A;  4D6T H;  1GAX A;  5EYP A;  3W7T A;  4TV9 B;  1K5S A;  5GTI Z;  2DN9 A;  2QJ1 A;  1Y76 A;  4LF7 B;  4WFB V;  1SZT A;  2UUA B;  1PP9 H;  1HNX B;  2DWD C;  3STL C;  3A0H Z;  1FS0 G;  4DV1 B;  2PYJ A;  1L1F A;  1PPJ H;  5DEC A;  1FPO A;  1W59 A;  4CH6 A;  3K03 A;  3JAM N;  3IGA C;  3JAK B;  4MVZ A;  1EZJ A;  4DR2 B;  1KC8 W;  1MZE A;  3DC6 A;  4TV9 A;  3ZHR A;  1WPB A;  1VQ6 V;  3W7W A;  3GVM A;  2XTA A;  3SJC C;  3CME V;  3OMN B;  4K35 A;  3S3W A;  2XUM A;  4B3S B;  3UO3 A;  2QKS A;  2Y0I A;  1I94 O;  1F4N A;  1EBO A;  5IYC O;  3N2K A;  3M8A A;  1MSW D;  3G6B A;  2LQT A;  2QWP B;  4O4H B;  2B1G A;  4JI7 O;  1KEC A;  3LDD A;  4I4T B;  1YSC A;  1NTK H;  5L3F A;  1AVM A;  3LSQ A;  3K3W A;  3AK1 A;  3ZMU A;  2GTA A;  5A9G A;  2VWJ A;  1XUQ A;  4BW5 A;  4BW9 A;  4DV3 O;  4DK1 A;  4I5S A;  2P5O A;  2GV9 A;  4IYH A;  4O4H A;  5BR8 O;  4MVQ A;  2BOB C;  4JI4 B;  2UU9 B;  5LGN A;  1JX9 A;  2EIK C;  2GSM B;  2WLK A;  3CCL V;  3BA9 A;  2DQ0 A;  4PI2 A;  1QVG U;  4BR6 A;  5LMU O;  2GTS A;  2ZE7 A;  3ETG A;  1PNK A;  2FYU H;  4QNH B;  1VP7 A;  2W6I G;  3UCS C;  3CXC U;  3T1C A;  4UV9 A;  1VQ8 V;  5J2T A;  4DR1 O;  5BZB A;  4YHH O;  4O2A B;  4HNA B;  1JJO A;  4HAM A;  1S0V A;  3RYI B;  4DV4 O;  2UXB B;  5L3B A;  3CCE V;  4K0K O;  4JF3 A;  3TGU H;  3ZRW B;  1FJG B;  1P7G A;  1YZB A;  2XHB A;  3F5T A;  2VQF O;  2ZM6 B;  2W0X A;  4JTC B;  1BT8 A;  1NKD A;  2V7Q G;  1Z5V A;  2DYS C;  2Y48 A;  3KKY A;  3ABK C;  4O2A A;  4H37 A;  1ROP A;  5CN0 A;  3CPW U;  3RYI A;  4LC1 A;  1JNB A;  3ZMS A;  1URF A;  4QPJ A;  1H8E G;  3ZRW A;  3ZHS A;  5KHG A;  1VQ5 V;  2YI8 A;  4PEL A;  1MNG A;  4B3M B;  4R8C A;  3ABM B;  3CRR A;  2Q4P A;  1AJQ A;  4LCU C;  4NTY A;  4PA7 A;  3KCX A;  2V4D A;  4I0X B;  2Y4T A;  4X64 O;  2WLM A;  2PTM A;  3FX7 A;  1NQT A;  2GBO A;  1YDX A;  3L70 H;  2OWO A;  4R7C A;  2E75 B;  3E8B A;  1KP3 A;  1V9P A;  2X6C A;  4JI1 O;  2JK5 C;  2R9I A;  3RWR D;  5KAF Z;  1XL6 A;  4FPP A;  2JJ2 G;  3JAL B;  1MOF A;  1SQV H;  4JI2 O;  3ABU A;  5KUM A;  2HEP A;  1AJP A;  3ZIA G;  5L3C A;  5GON B;  4LF4 O;  4DR4 B;  4CBC A;  1EN4 A;  5LMN O;  3GWO A;  4MVU A;  1EZV H;  2QTO A;  5LYJ B;  4B08 A;  1NH2 B;  4DYL A;  4GX0 A;  4DR6 O;  4WFF A;  5JJN B;  2LGQ A;  3OGI B;  1I08 A;  2VRZ A;  1XL4 A;  3J81 N;  1XHX A;  3JAL A;  4B3T O;  3OD4 A;  3QG5 A;  1K7D A;  2PGG A;  4Z1V A;  2JS5 A;  5GON A;  3TET A;  2QM7 A;  1AI7 A;  1BQZ A;  1ENV A;  3ZJZ A;  3G4S V;  1GN2 A;  4UB8 Z;  3CCJ V;  1DTO A;  3WB1 A;  1NBM G;  1BHA A;  1OCZ C;  5D5P A;  5LYJ A;  1F51 A;  3KCY A;  3WG7 C;  4LF7 O;  5IDJ A;  3K9S A;  2LFS A;  3F7V C;  1L8D A;  2UUA O;  3R66 A;  1HNX O;  2ZCE A;  1Q43 A;  4MW8 A;  4DV6 B;  4FLT A;  3AG1 C;  2A79 B;  1P4R A;  4IHJ B;  2ITD C;  4DV1 O;  5IYD O;  3ZHV A;  4K8X A;  1R3K C;  3IJ4 A;  1QLE B;  5CMU A;  1WA8 B;  2XAQ A;  2OT5 A;  5CB4 B;  4UCR A;  3ZRS A;  1NTM H;  4JZ2 A;  5C8Y B;  4H44 B;  1GRJ A;  4DR2 O;  4AIL C;  5FL7 G;  2E74 B;  3CP1 A;  3ETE A;  1D5A A;  4GX1 A;  2EIM B;  1JMK C;  3HKE A;  5LHI A;  1FAF A;  3JCU Z;  4IHJ A;  1QVF U;  3RGB A;  3C3T A;  2LFR A;  1IZ3 A;  5IYB O;  4B3S O;  1WA8 A;  2EIL B;  2F66 C;  5CB4 A;  1S3J A;  3P3N A;  3RN4 A;  3CSX A;  4QGP A;  5C8Y A;  2DYR B;  2AW9 A;  4UXN A;  3C90 A;  4KFM A;  1GN3 A;  2EIN B;  2AZ2 A;  2M6Y A;  1YCI A;  3N2G A;  5KHK A;  2QWQ B;  2L6L A;  1CXZ B;  1M4U A;  2HLD G;  3T1Y B;  4N21 A;  4MVR A;  1NI8 A;  1LR1 A;  1QCE A;  2HJF C;  3HB3 B;  4FK5 C;  4DUY B;  4KUM A;  2ODM A;  2P4K A;  3LDE A;  1R6K A;  1K5Q A;  4CH4 A;  1FXK B;  2EZP A;  2HG5 C;  5H6R A;  4JZG A;  1JA8 A;  3QO7 A;  4UFZ A;  1JCH A;  4JYY A;  3CRQ A;  1R1B A;  4G27 B;  2DMX A;  2QKA A;  1Q6I A;  5DM6 V;  1KBH A;  2M7W A;  4LH6 A;  4JI4 O;  2UU9 O;  1BGY H;  2BCC H;  1IBM B;  4RO2 A;  4BIO A;  2EIJ C;  1FXK A;  1PKX A;  4CS2 A;  4JAS A;  4U7N A;  2AZ0 A;  5DED A;  5L3E A;  1TGO A;  3MHS C;  5B1B C;  3QO8 A;  2JGU A;  4TV8 B;  2IW5 A;  1IX9 A;  2Q69 A;  1V54 B;  3ZHT A;  4WFA V;  1KQS U;  3T1H B;  4NVP A;  1YIJ V;  5BY1 A;  4AQY B;  1K97 A;  1N4C A;  3BVO A;  4GX2 A;  3K57 A;  2JIZ G;  3BEH A;  2UXB O;  1GO3 F;  3CCR V;  1FJG O;  3H1J H;  1THZ A;  1ZTE A;  5IWA B;  1SQX H;  3ETQ A;  2ZM6 O;  1VAR A;  2YXL A;  4YHH B;  1BZK A;  2JDI G;  1RFY A;  2QA4 V;  2HP8 A;  1FXV A;  1K34 A;  4J7K A;  1WNS A;  2WLN A;  4R50 A;  1PD3 A;  3JAW A;  4HYO A;  2N74 A;  1PV0 A;  1JR9 A;  1Q90 D;  3W7X A;  4LNU B;  2WA3 A;  3F7Y C;  4RAI A;  5FPR A;  5KUK A;  2QR4 A;  4PDM A;  5LHG A;  4B3M O;  5FLX N;  5L3G A;  2ZIN A;  1YTF B;  3ZHU A;  2Q6A A;  1VQM V;  4FLY A;  5IYZ B;  2UUB B;  1N0N A;  4LF5 B;  5GTH Z;  1UPG A;  4FMT A;  3L71 H;  2ZE6 A;  4JTD B;  4LNU A;  1NZ6 A;  3VQY A;  4D7T A;  2EIK B;  3GWK C;  1GMG A;  2Q67 A;  1SF9 A;  4UCU A;  4JYA B;  4U7O A;  3UQ8 A;  4GX5 A;  4J7Z A;  3FB6 C;  5IYZ A;  3G71 V;  4PD4 F;  4NB5 A;  4DR4 O;  5JCO C;  3OW2 U;  1RP3 B;  4Q20 A;  2WLH A;  2ZT9 B;  2AHZ A;  5ITZ B;  4X20 B;  2AXT Z;  4H33 A;  4FLU A;  2EIL C;  5BMV A;  4IIJ B;  1G4Y B;  3J80 N;  1D5N A;  2F23 A;  2Q5Z A;  1QU7 A;  5EIB D;  1HNW B;  2ZDI C;  1JPX A;  5KHI A;  3AG2 B;  1E1R G;  4FLW A;  1IJG A;  1AI6 A;  2QEX V;  1HWY A;  1NU1 H;  4WBN B;  1KP2 A;  1B06 A;  2HVJ C;  1MZF A;  4J9Y B;  2ZXW B;  2MW2 B;  5K1X A;  2AGA A;  3M99 B;  4JAU A;  2CK3 G;  1K3E A;  4D7S A;  5ITZ A;  3OE7 G;  3LNN A;  2DYS B;  1M9N A;  2Q9L A;  5IJ0 B;  4X20 A;  3FAV B;  3K58 A;  4JTA B;  1AB3 A;  3S3X A;  4IIJ A;  3OUS A;  1NVP B;  1R3L C;  5IJ9 A;  2XAH A;  2HKO A;  4DV6 O;  3RYH A;  1K9M W;  4GKK B;  4J7J A;  4ZI7 B;  4UUJ C;  3SJB C;  5LHH A;  4LFA B;  3QO5 A;  1XMO B;  2ZE8 A;  1VEW A;  3EFF K;  1H8H G;  4PA4 A;  4WFG A;  4WBN A;  4NYK A;  3W7S A;  2W0F C;  5EZY B;  4I9W A;  3SDL A;  3H1I H;  3CRM A;  1PNL A;  5J2U B;  1ZLZ A;  5IJ0 A;  1PL0 A;  2WLL A;  3FAV A;  5LXT B;  2Q7G A;  3B2E E;  4JYC A;  1ZWI C;  3SR2 C;  4TWK A;  4ZOL A;  1N32 B;  1RPR A;  2QM4 A;  4DV2 B;  4ZI7 A;  1DF5 A;  1M93 A;  1AI5 A;  2EBO A;  2DJV A;  2K1E A;  2IH3 C;  1V54 C;  3A0R A;  4ICG A;  1VQO V;  4LP8 A;  3N2K B;  4MVS A;  5EZY A;  4JI6 B;  3QNE A;  4DR7 B;  5J2U A;  5LXT A;  4FFK A;  5EBW C;  3ZX6 A;  4X1K B;  3AEI A;  1L0N H;  2UXD B;  4ZHQ B;  1J95 A;  1R6N A;  3T1Y O;  1VQP V;  3VQV A;  1K73 W;  3T4Z A;  3B09 A;  1BCC H;  4DUY O;  4YY3 B;  5B3S C;  1O9G A;  3PJS K;  5LL6 Y;  4CS3 A;  3LNM B;  1Q7Y W;  2UXC B;  4YXW G;  2N04 A;  5CBG A;  1WP7 A;  4DW1 A;  4X1K A;  2LP7 A;  4PDV A;  3I56 V;  1FFX B;  4ZHQ A;  4QE7 A;  4X88 A;  2CAZ C;  1DF4 A;  5B1A C;  2LW7 A;  5EC1 C;  1F23 A;  3DGE A;  3ASN B;  4UCS A;  5LA6 B;  4FJC C;  2EZO A;  1OCZ B;  3NR7 A;  5LGT A;  1SQQ H;  3WG7 B;  2CTR A;  4MSW C;  2OCH A;  1IBM O;  3K06 A;  3CC7 V;  2A7W A;  3AG1 B;  3U0Z A;  1G8M A;  1YJ9 V;  1AI4 A;  3APQ A;  2IJH A;  4TT3 G;  2OYQ A;  4O4J A;  1N0J A;  2RNB A;  1VF5 B;  3HKB A;  4PJ0 Z;  1SC5 B;  5J2T B;  1SKV A;  1P84 F;  3OFN G;  4FZ0 A;  3L72 H;  2PI5 A;  4J10 A;  1FFX A;  3AK3 A;  1Y4M A;  3JCZ A;  3MAQ A;  2WSS G;  4OPA A;  4UV8 A;  3RFR A;  4EB6 B;  1WP8 A;  1SES A;  5LA6 A;  3T1H O;  4AQY O;  2Z0A A;  1WLE A;  3WU2 Z;  1HNZ B;  3E89 A;  3ZN1 A;  1I5X A;  5GW7 A;  2NN4 A;  2GHY A;  2Z3Y A;  2XOK G;  4XDK A;  2QE7 G;  1P49 A;  4DV0 B;  2YXY A;  3K5O A;  4XDJ A;  5IWA O;  1ARO P;  1SZX A;  4CZZ A;  2FL4 A;  4DO2 A;  4EB6 A;  4ZKI A;  3E86 A;  1YHQ V;  4TQD A;  3FB7 C;  3CCU V;  4GT1 A;  4CC5 A;  3STZ C;  4OXS A;  1YEW A;  2Q0O C;  4JV5 B;  3AG2 C;  1M57 B;  2LGW A;  3T2M A;  3VBB A;  1Z2G A;  2ZXW C;  2UUC B;  1CP9 A;  2FTK A;  2HJD A;  2QWN B;  5KA6 A;  3U11 A;  3CJH B;  4JYB A;  5IY5 C;  5EBL C;  2E3C A;  1SS3 A;  3TK1 A;  3UT5 A;  4DRX B;  2JRI A;  3RYC B;  4PDR A;  2UUB O;  5H9C A;  4LF5 O;  2P6J A;  2HR3 A;  2P4V A;  2ZR2 A;  4EFE A;  2WPD G;  3CB2 A;  4DR3 B;  3OEH G;  3SGI A;  2RJZ A;  3SPI A;  4KP4 A;  2NR5 A;  3CJH A;  4E4E A;  2EIJ B;  4JYA O;  5B1N A;  2IJJ A;  2Q8V A;  1T5E A;  3HPL C;  4KXR A;  4DRX A;  5B1B B;  1NT2 B;  3ZN0 A;  3RYC A;  3CMA V;  4J41 A;  3IAY A;  1JJ2 U;  2QKC A;  5CBF A;  2PYL A;  1HP8 A;  3P32 A;  4MT8 A;  4G2K A;  1VQ9 V;  3VQW A;  2K9P A;  3AK2 A;  5EIB C;  3OM3 B;  5L3D A;  1B04 A;  3K5L A;  1S5H C;  2WLJ A;  4P9O A;  3SPG A;  4J42 A;  1HNW O;  1IDS A;  4PA9 A;  4LR3 A;  1XNR B;  2E5L B;  1NR7 A;  3CCQ V;  3B40 A;  4Z2W A;  2IJI A;  2JEU A;  4X65 B;  1H2K A;  3CYO A;  4J80 A;  4DV5 B;  1UJW B;  1WB7 A;  1H2S B;  3JD1 A;  3Q4H B;  3JAR B;  3BAB A;  3CWB H;  3F5W C;  2C2A A;  4UVA A;  2QGN A;  2B9Z A;  4GKK O;  3AG4 C;  4W4K A;  3JAT B;  1W0J G;  2CUG A;  4UB6 Z;  4LFA O;  1XMO O;  1KKD A;  3DXR B;  4LBE C;  1H38 A;  5H5N A;  1MA1 A;  3AG7 A;  1FYJ A;  3ASN C;  3E8G A;  1XMQ B;  2BE3 A;  3TCU A;  2A3Q A;  1ZUQ A;  3HKE B;  3SYA A;  2RN9 A;  4NKG B;  1V55 B;  3ZMV A;  1IBK B;  3TJT A;  3Q4H A;  3JAR A;  1R73 A;  3ZS8 C;  1N32 O;  4QPK A;  4DV2 O;  1YXB A;  3JAT A;  1U96 A;  3ICX A;  4QJF B;  3DXR A;  4IL6 Z;  4RQF A;  3HR0 A;  4KHP B;  2FML A;  3N2G B;  1WJZ A;  3DC5 A;  4NTX A;  4JI6 O;  4JI5 B;  4CH5 A;  1CEZ A;  1FFT B;  3UO2 A;  2XT9 A;  4DR7 O;  4EEQ A;  1QQC A;  4P30 A;  1JVM A;  1SET A;  2UXD O;  2DOS A;  1R3J C;  1OZ0 A;  2YIC A;  3NXS A;  3ZRX A;  2IBZ H;  4YY3 O;  2Y4U A;  1M56 C;  3BY6 A;  4H13 B;  2CGN A;  2UXC O;  5B5E Z;  1M57 C;  3M7M X;  5EK0 A;  3JD0 A;  2OCC C;  1SQP H;  3EXA A;  3FKS G;  5JCO A;  4X62 B;  1G1X B;  5LOV B;  2YIA A;  2XAS A;  2QWO B;  5B66 Z;  2YXH A;  2P06 A;  2ITC C;  2QM8 A;  5JQG A;  4YIP A;  4J9Z B;  2KQX A;  5KAI Z;  2Q68 A;  3L73 H;  1M90 W;  2ZDI A;  1FOU A;  1XRE A;  3OR6 C;  4XBF A;  3DSQ A;  1XOU A;  2JJ1 G;  4IYI A;  4FIP C;  1COW G;  2LW1 A;  3BFR A;  5LOV A;  4JI3 B;  4K3A A;  1N33 B;  2ARH A;  4G28 B;  4JGS A;  2QWR B;  1TUE B;  2HHH B;  4PI0 A;  3K08 A;  1UFI A;  1HNZ O;  1Q86 W;  3H1H H;  3PN1 A;  2H8P C;  1YJN V;  4DV0 O;  4KL1 A;  4I7Z B;  1XI1 A;  4IGG A;  4JI0 B;  1U97 A;  4F4L A;  1OCO B;  2FKX A;  2UXX A;  3JAW B;  4X1Y B;  3OTF A;  1VF6 A;  1PNM A;  2Y0P A;  1BQ0 A;  2WAM A;  5AG2 A;  1WN7 A;  3E83 A;  2YID A;  3FFQ A;  4JV5 O;  4AHC A;  2W6J G;  1D2D A;  1I5Y A;  4F6R B;  2JS3 A;  1F4M A;  2UUC O;  3OEE G;  5B3S B;  1MSD A;  3L74 H;  3OUF A;  3WB2 A;  4I9Q A;  1Y6X A;  1XNQ B;  2OTJ V;  1K4D C;  4GKJ B;  3ABL C;  1TUB A;  3K0D A;  4X1Y A;  3A0B Z;  1Q3E A;  4MTX A;  1BHB A;  5H6Q A;  5E79 Z;  3CRA A;  5B1A B;  1HDJ A;  4RUE A;  1OCR C;  1OCC B;  4UCO A;  2A06 H;  4DR3 O;  1RPO A;  4F6R A;  1SER A;  4LF9 B;  2JVD A;  2CGO A;  2PZS A;  2HFE C;  3T4D A;  3H1K H;  2ZQM A;  4YJ3 A;  2YIB D;  1LNQ A;  3CE2 A;  1V55 C;  1K33 A;  4DR5 B;  5IT9 N;  2WLI A;  4FLV A;  4RUF A;  5BMV B;  2ZNJ A;  3E35 A;  2VQE B;  3MD0 A;  3E8F A;  4LFB B;  4LFC B;  3OMI B;  1R6T A;  3RT3 C;  5TIS Z;  2ZNI A;  5JJE B;  1VQK V;  1SQG A;  3SYO A;  4GCZ A;  3RVZ A;  3QVN A;  3N27 A;  3JAS B;  1K92 A;  3ZBH A;  1N8R W;  3KG2 A;  5CA0 B;  1Y74 B;  1XNR O;  2O57 A;  1WB8 A;  2X7R B;  2E5L O;  3CEI A;  2RDC A;  1DK1 A;  1Y67 A;  1MAB G;  4FLX A;  3B8N A;  1DLB A;  4MS2 A;  1OV9 A;  1EN5 A;  5IJ9 B;  4X65 O;  4NTW A;  3RYH B;  4OX9 B;  2F1M A;  4DV5 O;  1N36 B;  1LUW A;  4BIU A;  2P90 A;  5LBQ A;  3LDC A;  2E76 B;  4FZ1 A;  3THO A;  2QSA A;  1LUV A;  1VQL V;  1W0K G;  1AIL A;  3JAS A;  5CA0 A;  2WA4 A;  1Y74 A;  1M5I A;  2QTS A;  2R9R B;  5JH7 B;  2WLL B;  5IY5 B;  2XAJ A;  1MMM A;  1XMQ O;  5KX5 B;  4NXM B;  2R70 A;  1Q6H A;  2Q7E A;  4ZOL B;  4ZBM A;  2RCV A;  1Q82 W;  1IBK O;  3SJQ C;  3SJA C;  1S5J A;  4PHZ A;  5C93 A;  1BMF G;  3CD6 V;  3IC7 A;  3I5D A;  2F4V B;  5KMG B;  2X6A A;  1VF6 C;  4LF8 B;  5JH7 A;  3ETD A;  4KHP O;  3X2Q C;  5KX5 A;  2YIB A;  1FKA O;  4U3J B;  4JI5 O;  4WF9 V;  4Q6G A;  3JD2 A;  2ADP A;  2VS0 A;  2EX3 A;  1H2G A;  1XEQ A;  1S5L Z;  4TOI A;  3L75 H;  3KDR A;  3SYC A;  2EJR A;  1SA0 A;  3D8C A;  4GUN A;  3OAA G;  4FM2 A;  2V1D A;  1S72 V;  1IUR A;  1OCO C;  4AI8 A;  5KMG A;  4B3R B;  3CCS V;  2Q0A A;  1GN4 A;  3ASO B;  4LF6 B;  4TUY B;  4U3J A;  1RM1 B;  3EHB B;  4DW0 A;  4U3F H;  3KZI Z;  1DGS A;  1NS1 A;  4DUZ B;  3OR7 C;  1BSM A;  1M1K W;  1R3I C;  3ZRV A;  2X0L A;  4X62 O;  1J5E B;  1S76 D;  4I50 B;  1KB9 F;  4HZ3 A;  3JD4 A;  3WFV A;  1YIT V;  2KB1 A;  4O4J B;  3HKB B;  1G6U A;  3AG4 B;  4ASU G;  5FPO A;  4DXW A;  3FB8 C;  4TUY A;  3JAK A;  1OCC C;  4BIZ A;  2CE4 A;  3P3P A;  5EC2 C;  5IE9 A;  4I50 A;  3SPJ A;  1NTZ H;  4JI3 O;  1N33 O;  3MDS A;  4HBN A;  2HHH O;  4E2L A;  1GK9 A;  2WWW A;  2CH7 B;  2A0L A;  3ML0 A;  3TXQ A;  4QE9 A;  2DQ3 A;  3RBZ A;  3K79 A;  1KUQ A;  3CC4 V;  5HFM A;  3I55 V;  4JI0 O;  4FVM A;  5KHH A;  1N34 B;  2OTL V;  1QNM A;  2OIE A;  4CS4 A;  2DE0 X;  4I4T A;  4C7U A;  2NLJ C;  3A2F A;  3GB7 C;  3K0G A;  3ZCC A;  4X1I B;  3JD3 A;  5CA3 A;  2CH7 A;  1QR8 A;  1Y66 A;  1SQF A;  4JI8 B;  2B5U A;  1AR4 A;  3UT5 B;  1M56 B;  2IM9 A;  4DV7 B;  3OT7 A;  3ZHQ A;  1ORQ C;  5LP6 B;  4L8J A;  1XNQ O;  1I0H A;  1B3Q A;  4GKJ O;  4X8A A;  3E2E A;  1IXB A;  3B8M A;  1QR9 A;  2KG7 B;  2OCC B;  3JYC A;  3R65 A;  2IJK A;  3BAA A;  3AG3 C;  4X1I A;  3FD9 A;  4BWA A;  3VQX A;  3P30 A;  2N05 A;  1AP5 A;  4A5U B;  3IFX A;  3O65 A;  4LF9 O;  3CHX A;  1SRY A;  3OGC C;  4YIO A;  2XND G;  5LP6 A;  4L87 A;  1ZSP A;  5JVD B;  3W7U A;  4P2Z A;  4DR5 O;  1NH2 D;  2KG7 A;  3G67 A;  4LH7 A;  1HW7 A;  5DN6 G;  2L35 A;  3K59 A;  4HNA A;  2VQE O;  1QHT A;  1US6 A;  2Y69 C;  4LFB O;  4LFC O;  3G80 A;  2ZIM A;  4UCV A;  3A8T A;  4BAY A;  2AHY A;  4I55 B;  5JJJ B;  3FYE B;  1BS3 A;  4QIW F;  5JVD A;  3D36 A;  4YJ2 B;  1QBZ A;  4MTG A;  3WB0 A;  3FB5 C; 
#chains in the Genus database with same CATH homology
 1GN6 A;  3K9S A;  4YIP A;  1WB7 A;  4FFK A;  1QNM A;  1XRE A;  4C7U A;  4X9Q A;  1IX9 A;  2ADP A;  1AVM A;  1MNG A;  4JZ2 A;  1EN6 A;  1MA1 A;  3AK1 A;  3KDR A;  3BFR A;  4GUN A;  1D5N A;  1AR4 A;  5A9G A;  1XUQ A;  1ZUQ A;  3OT7 A;  3IC9 A;  1GN4 A;  4F6E A;  3TJT A;  1EM1 A;  1I0H A;  3QVN A;  1ZTE A;  3C3T A;  1IXB A;  1B06 A;  1VAR A;  3C3S A;  1WB8 A;  3CEI A;  1BSM A;  1Y67 A;  3LSU A;  3RN4 A;  4BR6 A;  2AW9 A;  1GN3 A;  1AP5 A;  1EN5 A;  2ADQ B;  4E4E A;  3DC5 A;  1LUW A;  1JR9 A;  4YIO A;  5AG2 A;  2GDS A;  1N0J A;  1EN4 A;  1LUV A;  1ZSP A;  1VEW A;  2QKC A;  3AK3 A;  2P4K A;  3DC6 A;  1AP6 A;  1XDC A;  1MSD A;  2CE4 A;  3AK2 A;  1ZLZ A;  1MMM A;  1I08 A;  3EVK A;  4JZG A;  1JA8 A;  1N0N A;  1KKC A;  1PM9 A;  3MDS A;  1P7G A;  2RCV A;  4JYY A;  1XIL A;  1IDS A;  1AR5 A;  2QKA A;  1GN2 A;  1BS3 A;  1BT8 A;  1SZX A;  3KKY A;  1PL4 A;  2CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...