1EN5A

Crystal structure analysis of the e. coli manganese superoxide dismutase y34f mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTFVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 74
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en5A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en5A02
1I0HA 3C3TA 4C7UA 1P7GA 3OT7A 3RN4A 4X9QA 1VARA 5AG2A 1EN6A 1ZSPA 3C3SA 4E4EA 1GN2A 1LUWA 1JA8A 1XUQA 1SZXA 1MNGA 2ADQB 3AK3A 5A9GA 3CEIA 3LSUA 1B06A 1XDCA 4BR6A 1D5NA 1AVMA 3EVKA 4JZGA 3AK1A 4GUNA 1MSDA 1MMMA 3IC9A 1XILA 2P4KA 3TJTA 4JZ2A 1GN3A 2QKCA 1Y67A 1EN5A 3QVNA 4YIPA 2CDYA 2CE4A 1AR4A 1IX9A 1MA1A 1VEWA 1BS3A 4YIOA 1N0NA 1GN4A 1WB7A 3BFRA 1QNMA 4FFKA 3AK2A 1LUVA 3K9SA 4F6EA 2ADPA 2RCVA 1BSMA 2AW9A 1XREA 1AP5A 4JYYA 1N0JA 1IDSA 1AR5A 3DC5A 3KKYA 1EN4A 2GDSA 1IXBA 1I08A 1WB8A 1PM9A 1BT8A 2QKAA 1ZTEA 1ZUQA 1AP6A 1PL4A 1ZLZA 3MDSA 3DC6A 1EM1A 1JR9A 1GN6A 1KKCA
chains in the Genus database with same CATH superfamily
3G80A 4MT8A 2UU9O 1PNKA 5KMGB 4TOIA 4YJ2A 3ZS8C 5A2QN 3RN4A 5KA5A 3JD4A 1YF2A 3L73H 4I0XA 2HVKC 4ZBMA 3CJHA 1N36B 2WLIB 4GLXA 3FYIB 1NS1A 3ZEDA 5EBWC 5LGNA 3B2EE 1BZKA 4LNUA 1K3EA 4LF7B 4YHHO 3CCRV 1S77D 4DV6O 3KCYA 4I5SA 3CPWU 2C2AA 2YICA 3M7MX 2YIDA 1D5NA 5LYJA 1J5EB 2D3OW 4CBCA 3BHPA 2HJFC 4CS4A 3K0DA 3RYFA 3HKEA 1N33B 1SETA 4UFZA 3TETA 2F43G 4RWUA 5EIBC 1HR0O 4GKJB 5DECA 5L3GA 2ZIOA 2R70A 3AG3B 4K35A 4LFAB 4F4LA 3BRCA 5LOVB 2QTSA 1HNXB 3MD0A 4O2AA 5L3FA 4KUMA 1DF4A 1EZVH 3E2EA 4OPAA 1AROP 5JH7A 5JVDB 4O4IB 2ZKOA 2E75B 4PV1B 2YEVA 4G27B 5L3CA 2Y0IA 2ZIMA 2LW1A 2V7QG 3FFQA 1DK1A 3CC4V 1XL4A 5DEDA 5H6RA 4PA6A 1TAEA 2PGGA 1NZ6A 1J95A 1FXKB 1KD1W 2JK5C 4G2KA 4TQDA 1LR1A 4Z1MG 5IYDO 4X20B 3CWBH 1YZBA 2A79B 5LBQA 1S5HC 1TUEB 4DV5B 3CC7V 1GN6A 3OR6C 1FFXA 4C7UA 3RYHB 4WFAV 3WU2Z 2AHZA 3A0HZ 1U96A 2HHHO 4Q20A 2XT9A 1XNQO 1JMKC 4WBNA 5B3SC 1N32O 1SC5B 4NXMO 4NXNB 4AI8A 1WPXA 3A8TA 3KCXA 3WFVA 4FM2A 1OV9A 2VQEO 4JGSA 2Y48A 1MNGA 2JGUA 1R1BA 4I7ZB 4UV8A 2QSAA 2ZDIA 3THOA 1THZA 3SPJA 4I4TB 2XNDG 1AVMA 1NI8A 4DW0A 4O2BA 3ABMB 4FFBB 4JZ2A 2Z3YA 2CGNA 1NR7A 2ZR2A 3CYOA 5LP6C 3KG2A 4PA9A 4ZOLA 1BHBA 2HFEC 1BE3H 4YJ3A 1S5JA 4UV9A 1Q86W 1JVMA 2LO1A 2CE4A 4X1KA 1IX9A 4K3AA 4YIOA 1JPXA 1GN4A 3RFRA 3HPLC 2YC0A 2UXDB 5CBFA 3G6EV 1Y6XA 4DK1A 3JD1A 4J80A 2ITDC 3UO3A 4IHJA 3M8AA 3CE2A 3WG7B 4QPJA 2CTQA 4FVMA 3DSQA 2JJ1G 2BSKB 4DV7B 3G4SV 3N2GA 2M6YA 3HKBA 1D2DA 5JQGA 2QKAA 4DUYO 3G67A 4IYHA 4LBEC 1N36O 2UXXA 3T1HB 1R6NA 1TGOA 3E8FA 4L8JA 2F66C 3ZHVA 5IT9N 3ZN0A 4TV9A 1F7YA 4LF7O 3CRQA 3D3IA 3I55V 1PV0A 3AG7A 5C8YB 4DV3B 4O4LA 2CK3G 4DR6B 2ZXWC 1J5EO 3CP1A 3OAAG 2ZE6A 1GM8A 3L70H 2A9HA 1I5XA 1TUBB 5B1BB 4P2ZA 4JI1B 2QGNA 1N33O 4D7SA 4GKJO 4LFAO 1VIBA 4FJCC 3RGBA 1AI5A 3JALA 1YHQV 1HNXO 3IAYA 5F2VO 2ZE8A 3B8MA 3FB5C 1HWYA 3S3WA 1PPJH 2DN9A 2WLIA 4WF9V 1QCEA 1N34B 4DR2B 1Y67A 3JSNA 1ENVA 3J80N 3OMAB 3TGUH 4CC6A 5KAFZ 2CDYA 4NB5A 1XL6A 1Q81W 3DGEA 2BE3A 1KKDA 2P06A 1BGYH 1XMOB 5DN6G 3A0RA 1N0NA 3RYCB 3ZCCA 3QTCA 3SPGA 4JI4B 2OTJV 4WFBV 4JI8B 1OCOB 3SJCC 4Q6GA 1VMGA 1WP7A 5LOVA 3JAWA 1VQOV 3N2KB 1IDSA 5H2FZ 2EINB 2F23A 3ASOB 4GT1A 3K57A 5CA3A 4DV5O 3OUFA 4DRXA 4HBNA 5CBGA 4X88A 2JDIG 3SJQC 4ASUG 3CX5F 3UT5B 4J9ZB 3E86A 2GSMB 2ZT9B 1ZLZA 3I56V 3P3PA 4R50A 2XASA 2LP7A 4X8AA 1NR1A 2XAQA 3UQ8A 4YJ2B 4KXRA 2RDCA 4DXWA 1FXKA 1YEWA 4I0XB 1PP9H 1ZSPA 4I55A 4ZI7A 2JVDA 5KHKA 3H1IH 3QO5A 4PI0A 4UCUA 4GX5A 1JFFA 1RSOA 3ETDA 3ABTA 1RPRA 3RWRD 2H3OA 1SKVA 3CSXA 3OGIB 1KYOF 2P6JA 1FJGB 3BAAA 3OEEG 2R72A 4JZGA 3K3WA 5LYJB 1NJIW 2W6JG 4GUNA 2FMLA 3FD9A 3P30A 1RM1B 1E79G 1XILA 2P4KA 3RYFB 3HKEB 2YSUB 4DV2B 2IM9A 2OYQA 3CRCA 3JD2A 2KB1A 1G8MA 2UXDO 4X66B 1VF6C 2WPDG 2QM8A 4QPKA 2WWWA 2QKSA 1H2SB 4O2AB 4RQEA 3JASA 1MA1A 3DXRB 4I4TA 3HKDA 2RQ6A 2UUCB 3H1JH 1ZWIC 3RVZA 5JH7B 3U0ZA 4DV7O 4LH6A 2R9RB 2YEVB 1K5SA 3NXSA 1NH2B 4KHPB 1KC8W 2BOBC 1XHZA 2QM7A 2EIKB 3E22B 3FB6C 3QF7A 3KKYA 3T1HO 4UCOA 2HP8A 2RNBA 1NTKH 3T1YO 1FOUA 1HR0B 4Z1VA 4TUYA 1SQQH 5B1OA 5K1XA 2DYRB 2WSSG 4DR6O 3K03A 3SYAA 2Y4TA 3ZMVA 3OD4A 3ZHUA 4PJ0Z 4NTXA 1ORQC 5FNVA 4JI1O 1FFXB 1YJ9V 1K4DC 5L3DA 5LGUA 2JRIA 2AXTZ 4IYIA 3OUSA 2KSDA 4WBNB 2QJ1A 2DW4A 1JA8A 3MHSC 3CRRA 1S72V 4D7TA 4TWKA 2CH7A 3BA8A 2PI5A 4DR2O 4JTAB 2YDEA 1H2LA 2ETNA 3CCLV 3SPIA 1MZFA 4FM0A 5GONA 2ZCEA 1R6KA 1Q6HA 4UXNA 2YI8A 4O2BB 2OTLV 3JCZA 2Q9LA 3HR0A 1XMOO 2DMXA 2LGWA 5IJ9A 2JS5A 4TT3G 2EJRA 4HZ3A 1O9GA 4ZOLB 4JI4O 1WA8B 4JF3A 4JI8O 3JD0A 4A5UB 4N21A 4CZZA 3H01A 1VEWA 4BIUA 1BS3A 3SPHA 4TQFA 4JAAA 4WFFA 3JCUZ 5JCOC 1BL8A 1AB3A 2Q0OC 3ASNC 2L6LA 2QTOA 3L71H 3LSQA 1QVGU 3AG4C 3OMIB 4MVUA 2JS3A 4IHJB 4R8CA 1Q7YW 4FMTA 3N2GB 2EILB 3LDDA 1KMIZ 2WLKA 3OW2U 5L3BA 1DGSA 1VQ8V 3BABA 1R3JC 3HKBB 4B3MB 3LDCA 4E2LA 1ZTEA 5JQGB 2YIAA 4H37A 5HFMA 1VF5B 2AHYA 3DC6A 3VOUA 1V54C 3LUTB 3N2KA 3FAVB 1SF9A 3S3XA 2WLJA 4TV9B 2B9ZA 2ZINA 2XTAA 4EB6A 2F4VB 2FKXA 1IJGA 4PELA 3T1CA 1FPOA 1H8HG 4O4LB 1FJGO 1XUQA 4JI6B 1XMQB 5BZBA 4UCSA 3WG7C 2QWNB 3WB0A 5E1AC 1IBMB 4DV2O 5FLXN 2XAHA 5KX5A 1DLBA 4UCTA 1M90W 3L74H 1XDCA 4X66O 4P30A 4DV1B 1Z2GA 4EFBA 3JALB 1VQ7V 5ITZA 3FB7C 1K92A 4ABMA 4DUYB 3SJAC 3SPCA 4AILC 1M5IA 2UUCO 1P7BA 3ZMSA 2AZ0A 5B1AC 3RYIA 3F5TA 3CCUV 2KQXA 4JPRA 2GHYA 1BHAA 2VQFB 4JI3B 5JJNB 4KHPO 1PD3A 3VQXA 2X6AA 1S3JA 1IBLB 5E79Z 1BQ0A 4FLWA 1GK9A 4J9YB 3W7TA 3QO7A 4EKWA 2DE0X 5BR8O 2L35A 4FPPA 3MHHC 5LP6A 4FZ1A 4BW5A 2HLDG 4IGGA 3OTOB 2XOKG 3JAWB 1N0JA 3LNMB 5EYPB 5FL7G 3DC5A 1XBLA 3DXRA 3RBZA 3ZRWA 3AG2B 5H6QA 1GM7A 4DRXB 1NH2D 5IDJA 1HNZB 2OWOA 3ZHSA 1W0KG 1SERA 2PF4E 1G1XB 5H9CA 4LFBB 3E22A 4MVSA 2X6CA 4LWSB 5IY5B 2ZNIA 1DF5A 3BA9A 4MS2A 1Z5VA 1FFTB 5IJ0A 3B8NA 3CCJV 2XAFA 3TXSA 3C90A 4X64B 4I50A 4I55B 4ZI7B 3LNNA 4PI2A 3K04A 2E5LB 1VQKV 1AI4A 4I9WA 1JFFB 1RSOB 3ETEA 4K0KB 2EULA 1S76D 1NKDA 4LF8B 1SA0A 4UB8Z 1ROPA 3J7AU 1BMFG 1WP8A 1I94B 2N05A 3AG1B 3W7XA 1AR4A 1YDXA 2Y69C 1QR8A 3K06A 4CH6A 3JASB 1HNWB 2RMKB 1SS3A 3HKDB 2BTQA 4U7OA 5B5EZ 1T5EA 4Z2WA 4B3MO 1WA8A 1JOYA 1Q6IA 5LL6Y 3KDRA 3D36C 2P22C 2B1IA 3CMAV 1WB8A 2Z5UA 1UFIA 1V9PA 1KQSU 4J7KA 4TUYB 4B3RB 4K8XA 2F4VO 2LFRA 1BCCH 1ZUQA 2EX3A 4FM1A 1AP6A 1WAZA 1K9MW 1W2BU 4FLXA 5KUKA 1XMQO 4JI6O 5KHHA 3RVYA 2XAGA 2QWPB 3KZIZ 2IJKA 5FNVB 1IBMO 3IFXA 1RFYA 4JYAB 3W7UA 1SQVH 2P4VA 4E4EA 4DV1O 5KAIZ 2WLLB 5EBMC 2EIMB 2GBOA 1N8RW 4B3SB 4JAVA 2HKOA 1MSWD 4DK0A 2CH7B 3FAVA 2CTPA 2BCCH 4B08A 3T1YB 4DYLA 1X4TA 2JEXA 2QWOB 3ABLC 2VQFO 4JI3O 1QR9A 5J2TA 2DYRC 5GONB 4J7ZA 3JARA 4O4JA 3LSSA 1URFA 1YXBA 1IBLO 1PL0A 2QKCA 3JAKA 1P4RA 3U10A 5IJ9B 1SQBH 2ILMA 2YIBD 4X1IA 4LH7A 2YIBA 4P9PA 3OTOO 3U11A 4GYCB 2YI9A 4X62B 2R9IA 3L9DA 4KL1A 2WLHA 4BWAA 5BY1A 1LUVA 1QHTA 4ZIBA 1B04A 5CB4A 5LHHA 1HNZO 2QA4V 2ZDIC 1NBMG 1VF6A 1OZ0A 5L3EA 5IYCO 3OEHG 3Q4HA 4LFBO 5EC1C 1KECA 5BXZA 3GWOA 1QLEB 1O9HA 1M57C 1XEQA 3JSLA 5D5QA 3E89A 4U7NA 1VQLV 3ZBHA 1QBZA 5CA0A 3EFFK 3SYOA 4QE9A 2OCHA 4X64O 1M56C 4O4HA 4W4KA 3M99B 4RQFA 2CGOA 5EYPA 5CN0A 1Q3EA 2PY5A 3OT7A 3OFNG 5GW7A 2E5LO 5J9PC 5AG2A 2FTKA 4EB6B 1I5YA 4K0KO 4ZHQA 2EIJB 4MVQA 1PNLA 1Y74B 1YJNV 1D5AA 4LF8O 1IBKB 4PA4A 1COWG 2IH3C 1OCZB 4LWSA 4DW1A 3ZHQA 2IU3A 2H8PC 2OCCC 5KX5B 1I94O 4J11A 2PYLA 2Y0PA 4OX9B 2GV9A 4UVAA 5ITZB 3E8HA 5B3SB 1HNWO 1AJPA 4MVMA 4FLVA 3NR7A 3ZIAG 3ABUA 4UVCA 3OR7C 1K73W 2Q73A 3RYIB 3RW0A 1B6QA 1WNSA 2F1MA 2W0FC 4GCZA 3FB8C 4ICGA 1JQ0A 4IL6Z 3ABKC 3WB1A 4JI0B 3K58A 3X2QC 1MZEA 4MVZA 4PDVA 2HVJC 5IWAB 2KG7A 2A06H 5GTHZ 2NN4A 5LP6B 4JYYA 4NTWA 4B3RO 4PHZA 3CCVV 1PKXA 4F6RB 1NQTA 1K7DA 4D6TH 2NLJC 2GDSA 2P90A 4UB6Z 4CS2A 3ZRWB 1Y76A 3ETGA 1Z5WA 1CPYA 2Q67A 3ETQA 5JCOA 3G6BA 1K33A 1R3KC 2M7WA 1PL4A 2N74A 1VQ4V 4JYAO 1DTOA 4JV5B 2ZE7A 1RPOA 1F51A 3H1KH 5IYBO 1FXVA 4B3SO 4WFHA 4PD4F 2Q0AA 5BR8B 3BVOA 2A0LA 4J10A 5IJ0B 2ZQMA 1LUWA 1Q5OA 4I50B 1VQPV 3AG3C 4OXSA 4KFMA 2GUZA 1K8AW 2ZE5A 4LR3A 1K34A 1VF7A 1XOUA 5A9GA 2WAMA 4GKKB 1B06A 4J42A 4BR6A 5LA6A 3EVKA 1CP9A 4BAYA 2JEUA 1MSDA 1QLNA 1SA0B 3STLC 1JJ2U 3GVMA 2WLLA 3E35A 4X62O 1GMGA 3ZMTA 1VQ5V 3L75H 1WN7A 3F7VC 4CH4A 5IY5C 1L8DA 4I9QA 1ZAUA 2W6IG 3AEIA 3BEHA 3APQA 3PN1A 5LHIA 1FXKC 3GWKC 4DV4B 2BTQB 4FLUA 1Q82W 1R6TA 4J7JA 3BCCH 2JGDA 5H5NA 4YY3O 4NYKA 1M93A 2RCVA 3A0BZ 3K79A 3CCMV 2JJ2G 4X1YA 4QNHB 1QVFU 4IT5A 4DR3B 4GX0A 3ZHTA 2YS8A 1JX9A 2Q4PA 4HNAA 1L0NH 1GKFA 5DM6V 5LHGA 1XQ8A 4EEQA 3EHBB 5EIBD 3B09A 2V4DA 1EFRG 5JJEB 1NTZH 3T4ZA 5KHIA 1KKCA 1VQNV 2MW2B 1VQMV 1IBKO 5LGTA 2BTOA 1CEZA 5CA1B 3CMEV 1FS0G 3CRMA 3ABMC 1G4YB 1OJHA 4QJFB 3TCUA 5FPRA 5JJJB 4UUJC 2BOCC 3A2FA 5TISZ 4OX9O 1Q6UA 3T4DA 2IJIA 1SRYA 1YIJV 1I7FA 5B66Z 3VQWA 3TXQA 3CCQV 4EFEA 5LMUB 1ZL8A 1PNMA 3PJSK 4JTDB 3K08A 2Q7EA 1Y4MA 4LP8A 3H1LH 3AK1A 5BMVA 2QWRB 5HFLA 5J2TB 2HEPA 3JARB 1Y74A 4O4JB 2OIGA 3CC2V 1QU7A 1VP7A 1EN5A 3OMNB 4JI0O 1H8EG 3JAKB 3QVNA 5IWAO 1B3QA 2Q7HA 1AILA 4GZRB 1R3LC 4DO2A 4WCEV 4X1IB 3SYCA 3SR2C 1EZJA 3JYCA 3CXHF 3IJ4A 1BSMA 3ML0A 2AW9A 1JJOA 5CB4B 1AP5A 1TVKA 1R73A 2GTSA 4MTOA 5J2UB 2X7RB 4JV5O 4CH5A 2FYUH 3Q4HB 4MW3A 4H44B 4HYOA 3F5WC 1MABG 2H94A 2ZR3A 1US6A 2B5UA 1XHXA 4B7KA 1XNRB 5B1BC 3CXCU 2FB5A 1WJZA 3HB3B 3P32A 4NTYA 4XDJA 3H9VA 5CA0B 3IC7A 4WFGA 1IZ3A 1YI2V 4F6RA 4O4HB 1I0HA 3J81N 3D36A 3D3QA 2LFSA 3HKCA 1WPBA 4GKKO 1FD9A 4R6ZA 2IU0A 1IURA 3K0GA 4TV8A 3UCSC 1ZX3A 4BIOA 4LF6B 2OT5A 4ZHQB 1OCRB 4DR5O 4RUEA 1OCCB 3ZRSA 1SZXA 1WLEA 5C93A 1MG1A 1NU1H 3BPZA 1OHHG 2EBOA 1X59A 4PDMA 2ZM6B 5KHGA 4CC5A 1QLEC 3SYPA 1M9NA 5IYZA 4U3JA 1MMMA 1OCOC 4H13B 3RT3C 2DQ0A 5B1NA 3JAMN 3EXAA 4MTXA 4DV4O 3E8BA 4X89A 2EINC 2DOSA 3ASOC 2O57A 2IBZH 4B3TB 1Q90D 4MTFA 2PTMA 2Q68A 2EIJC 3BFRA 4FLZA 4JI2B 4DR3O 3B40A 1CXZB 2F93B 2UXNA 1H2KA 1OCZC 1XREA 2KG7B 4BIZA 4IIJA 3R66A 1M4UA 1R3IC 1AJNA 4TSFG 4X65B 4LF9B 1IXBA 4UVBA 4QGPA 1Y76B 3CD6V 4DR1B 1KBHA 4JI5B 3ASNB 1EM1A 4XBFA 2Z0AA 1M1KW 3AG4B 3SJBC 1YCIA 4FK5C 1HP8A 4U3FH 4FIPC 5LMNB 2ITCC 1HDJA 3OTFA 5LMUO 1RM1C 1IXMA 1JNBA 1NVPD 2E76B 4AQYB 2UXCB 2QEXV 4YXWG 5K1PA 1AI6A 2GUZB 1F4NA 2QWQB 3AK3A 1L0LH 1V55B 2XUMA 3VQYA 4DUZO 1V54B 2ODMA 5CA1A 5LXTB 4LFCO 3STZC 1GM9A 1FXHA 5LA6B 2CTWA 4QE7A 1YTFD 3K5OA 2OIEA 3TJTA 5EZYA 1GN3A 3L72H 1SQFA 2DYSB 2EIKC 4PA7A 1K4CC 4YIPA 5EBLC 4FLYA 1E1QG 3JATA 4H0LB 4LC1A 1MOFA 1QNMA 1GTOA 2E74B 4JYBA 3ZHRA 3K9SA 2ADPA 1NT2B 3CB2A 2JGDB 3UO2A 1L1FA 4DV0B 1XNRO 2DWDC 5B1AB 4X1YB 1HW7A 1FYJA 1SQPH 3H1HH 2IW5A 2PZSA 4HNAB 1PM9A 3F7YC 1LNQA 5IE9A 3OE7G 4OPHA 5KHJA 4NR1A 2Q6AA 1SQXH 2IJJA 4LF6O 1XI1A 5KMGA 5J2UA 2HR3A 2UXBB 1Q8IA 4G28B 1P7GA 2K9PA 4X9QA 1AI7A 4YY3B 2ZM6O 1SESA 3CS5A 4UCRA 1IVSA 1GN2A 1TA8A 2EZOA 3CCEV 5JWPA 2IJHA 3K5LA 1Q43A 4ZKIA 3FX7A 3SYQA 4DR4B 1BQZA 5GTIZ 2A3QA 1ZL8B 5KA6A 2X0LA 1VQ6V 3FKSG 4B3TO 5BMVB 2N04A 4LF4B 3B77A 2UUAB 1W0JG 4JI2O 2P5OA 3QO8A 1P49A 2P67A 4DR7B 2XAJA 1FKAO 3CCSV 3K5NA 2R9AA 2EILC 1H38A 2WLMA 5JVDA 4O4IA 1H2GA 3D8CA 2LQTA 1KU9A 3N27A 1VQ9V 4X65O 4LF9O 3AK2A 3B4SA 2YXLA 3E83A 3W7WA 4NXNO 4CH3A 1H5WA 1UJWB 1TVKB 2RJZA 4DR1O 3T2MA 4LF5B 1FAFA 4JI5O 3GB7C 1JCHA 1AR5A 4N23A 1F4MA 3G71V 4JI7B 2QE7G 4MVRA 2ZNJA 2Y69B 1P84F 3CJHB 2DJVA 5LMNO 4P9OA 4HAMA 4X20A 3W7SA 1F23A 1KB9F 3ICXA 4LNUB 2ATKC 4AQYO 1S0VA 2UXCO 2V1DA 3RYHA 3K5MA 3C3TA 3BY6A 1U97A 2G38A 4JYCA 3ZRVA 2UUBB 1NTMH 3HKCB 1VARA 4W4LA 4PDRA 5EK0A 4XDKA 3JD3A 3C3SA 2YXYA 3VQVA 3CRAA 4TV8B 2QDOA 2HJDA 3APOA 2UU9B 2VS0A 2WA4A 1Y66A 4R7CA 1GRJA 2ADQB 2E3CA 4MW8A 3CEIA 5CBHA 3ZJZA 4L87A 2NNUA 3TK1A 4MSWC 2IH1C 2WA3A 1YJWV 4GX2A 2Y4UA 2LJ2A 3OM3B 1GAXA 4FFBA 5KUMA 5IYZB 4B7EA 4YHHB 4U3JB 2Q69A 2PYJA 4DV6B 4MTGA 1RP3B 3SDLA 2ZD9A 2QR4A 3K59A 1SQGA 3LDEA 4XDLA 3ZN1A 4JASA 4DV0O 1KP3A 2D2CB 5LXTA 3AG2C 3UKMA 4UCVA 3O65A 4DR5B 1UPGA 3ABLB 4QIWF 2PI4A 1OCRC 3I5DA 1A32A 1OCCC 3ZMZA 2VRZA 4DV3O 2FL4A 1EBOA 2ZXWB 4BW9A 2ARHA 3IGAC 2JIZG 1K5QA 2DQ3A 4IIJB 1K97A 2MK3A 4NVPA 2XHBA 2BSKA 4RAIA 1QQCA 2HG5C 2KKWA 3VBBA 1EN4A 4RO2A 3QNEA 1I08A 1S5LZ 3ZRXA 4FZ0A 4CS3A 2UXBO 1W59A 2F95B 1YSCA 3DTUB 3ZX6A 2WLNA 3FYEB 1N34O 3ZMUA 2NR5A 1JR9A 2W0XA 4LCUC 2CAZC 3WB2A 2X6BA 2P7TC 2VWJA 4DR4O 5C8YA 3OGCC 3E8GA 1EN6A 4JAUA 4FLTA 1M57B 4J41A 2K1EA 1TUBA 2YUAA 4LF4O 1NVPB 3AG1C 4H33A 3K9AA 4YJ3B 2HHHB 2UUAO 2VWKA 3LSUA 3SGIA 1M56B 4GX1A 1XNQB 1KP2A 1N32B 2CUGA 4X1KB 4NXMB 4DR7O 2B1GA 5D5PA 3UM7A 2VQEB 4MVOA 2DWEC 2LW7A 3IC9A 1GH6A 1AJQA 4RUFA 4AHCA 5EZYB 2Q5ZA 2GTAA 1YTFB 2LGQA 1YVWA 3QG5A 3P3NA 4PDLA 3CHXA 2Q8VA 1H2MA 1H2NA 3JATB 1N4CA 3RYCA 2OCCB 4LF5O 5KLVH 1E1RG 1WB7A 1KUQA 4JI7O 2PUSA 4JTCB 3R65A 4FFKA 5CMUA 4F6EA 1V55C 1SZTA 2CTRA 4DUZB 4K8ZA 3O9OA 2QM4A 4NKGB 2EZPA 4LFCB 2EJ7A 5FPOA 3MAQA 4PA3A 2YXHA 1AR1B 3UT5A 1BT8A 2DYSC 2RN9A 2EIMC 2UUBO 3ABKB 3X2QB 2AGAA 5EC2C 4WFEA 2A7WA 1GO3F 4KP4A 1YITV 3MDSA 1G6UA 2AZ2A 4OGQB 2Q7GA
chains in the Genus database with same CATH topology
1I0HA 3C3TA 4C7UA 1P7GA 3OT7A 3RN4A 4X9QA 1VARA 5AG2A 1EN6A 1ZSPA 3C3SA 4E4EA 1GN2A 1LUWA 1JA8A 1XUQA 1SZXA 1MNGA 2ADQB 3AK3A 5A9GA 3CEIA 3LSUA 1B06A 1XDCA 4BR6A 1D5NA 1AVMA 3EVKA 4JZGA 3AK1A 4GUNA 1MSDA 1MMMA 3IC9A 1XILA 2P4KA 3TJTA 4JZ2A 1GN3A 2QKCA 1Y67A 1EN5A 3QVNA 4YIPA 2CDYA 2CE4A 1AR4A 1IX9A 1MA1A 1VEWA 1BS3A 4YIOA 1N0NA 1GN4A 1WB7A 3BFRA 1QNMA 4FFKA 3AK2A 1LUVA 3K9SA 4F6EA 2ADPA 2RCVA 1BSMA 2AW9A 1XREA 1AP5A 4JYYA 3KDRA 1N0JA 1IDSA 1AR5A 3DC5A 3KKYA 1EN4A 2GDSA 1IXBA 1I08A 1WB8A 1PM9A 1BT8A 2QKAA 1ZTEA 1ZUQA 1AP6A 1PL4A 1ZLZA 3MDSA 3DC6A 1EM1A 1JR9A 1GN6A 1KKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0H A;  3C3T A;  4C7U A;  1P7G A;  3OT7 A;  3RN4 A;  4X9Q A;  1VAR A;  5AG2 A;  1EN6 A;  1ZSP A;  3C3S A;  4E4E A;  1GN2 A;  1LUW A;  1JA8 A;  1XUQ A;  1SZX A;  1MNG A;  2ADQ B;  3AK3 A;  5A9G A;  3CEI A;  3LSU A;  1B06 A;  1XDC A;  4BR6 A;  1D5N A;  1AVM A;  3EVK A;  4JZG A;  3AK1 A;  4GUN A;  1MSD A;  1MMM A;  3IC9 A;  1XIL A;  2P4K A;  3TJT A;  4JZ2 A;  1GN3 A;  2QKC A;  1Y67 A;  1EN5 A;  3QVN A;  4YIP A;  2CDY A;  2CE4 A;  1AR4 A;  1IX9 A;  1MA1 A;  1VEW A;  1BS3 A;  4YIO A;  1N0N A;  1GN4 A;  1WB7 A;  3BFR A;  1QNM A;  4FFK A;  3AK2 A;  1LUV A;  3K9S A;  4F6E A;  2ADP A;  2RCV A;  1BSM A;  2AW9 A;  1XRE A;  1AP5 A;  4JYY A;  1N0J A;  1IDS A;  1AR5 A;  3DC5 A;  3KKY A;  1EN4 A;  2GDS A;  1IXB A;  1I08 A;  1WB8 A;  1PM9 A;  1BT8 A;  2QKA A;  1ZTE A;  1ZUQ A;  1AP6 A;  1PL4 A;  1ZLZ A;  3MDS A;  3DC6 A;  1EM1 A;  1JR9 A;  1GN6 A;  1KKC A; 
#chains in the Genus database with same CATH topology
 3G80 A;  4MT8 A;  2UU9 O;  1PNK A;  5KMG B;  4TOI A;  4YJ2 A;  3ZS8 C;  5A2Q N;  3RN4 A;  5KA5 A;  3JD4 A;  1YF2 A;  3L73 H;  4I0X A;  2HVK C;  4ZBM A;  3CJH A;  1N36 B;  2WLI B;  4GLX A;  3FYI B;  1NS1 A;  3ZED A;  5EBW C;  5LGN A;  3B2E E;  1BZK A;  4LNU A;  1K3E A;  4LF7 B;  4YHH O;  3CCR V;  1S77 D;  4DV6 O;  3KCY A;  4I5S A;  3CPW U;  2C2A A;  2YIC A;  3M7M X;  2YID A;  1D5N A;  5LYJ A;  1J5E B;  2D3O W;  4CBC A;  3BHP A;  2HJF C;  4CS4 A;  3K0D A;  3RYF A;  3HKE A;  1N33 B;  1SET A;  4UFZ A;  3TET A;  2F43 G;  4RWU A;  5EIB C;  1HR0 O;  4GKJ B;  5DEC A;  5L3G A;  2ZIO A;  2R70 A;  3AG3 B;  4K35 A;  4LFA B;  4F4L A;  3BRC A;  5LOV B;  2QTS A;  1HNX B;  3MD0 A;  4O2A A;  5L3F A;  4KUM A;  1DF4 A;  1EZV H;  3E2E A;  4OPA A;  1ARO P;  5JH7 A;  5JVD B;  4O4I B;  2ZKO A;  2E75 B;  4PV1 B;  2YEV A;  4G27 B;  5L3C A;  2Y0I A;  2ZIM A;  2LW1 A;  2V7Q G;  3FFQ A;  1DK1 A;  3CC4 V;  1XL4 A;  5DED A;  5H6R A;  4PA6 A;  1TAE A;  2PGG A;  1NZ6 A;  1J95 A;  1FXK B;  1KD1 W;  2JK5 C;  4G2K A;  4TQD A;  1LR1 A;  4Z1M G;  5IYD O;  4X20 B;  3CWB H;  1YZB A;  2A79 B;  5LBQ A;  1S5H C;  1TUE B;  4DV5 B;  3CC7 V;  1GN6 A;  3OR6 C;  1FFX A;  4C7U A;  3RYH B;  4WFA V;  3WU2 Z;  2AHZ A;  3A0H Z;  1U96 A;  2HHH O;  4Q20 A;  2XT9 A;  1XNQ O;  1JMK C;  4WBN A;  5B3S C;  1N32 O;  1SC5 B;  4NXM O;  4NXN B;  4AI8 A;  1WPX A;  3A8T A;  3KCX A;  3WFV A;  4FM2 A;  1OV9 A;  2VQE O;  4JGS A;  2Y48 A;  1MNG A;  2JGU A;  1R1B A;  4I7Z B;  4UV8 A;  2QSA A;  2ZDI A;  3THO A;  1THZ A;  3SPJ A;  4I4T B;  2XND G;  1AVM A;  1NI8 A;  4DW0 A;  4O2B A;  3ABM B;  4FFB B;  4JZ2 A;  2Z3Y A;  2CGN A;  1NR7 A;  2ZR2 A;  3CYO A;  5LP6 C;  3KG2 A;  4PA9 A;  4ZOL A;  1BHB A;  2HFE C;  1BE3 H;  4YJ3 A;  1S5J A;  4UV9 A;  1Q86 W;  1JVM A;  2LO1 A;  2CE4 A;  4X1K A;  1IX9 A;  4K3A A;  4YIO A;  1JPX A;  1GN4 A;  3RFR A;  3HPL C;  2YC0 A;  2UXD B;  5CBF A;  3G6E V;  1Y6X A;  4DK1 A;  3JD1 A;  4J80 A;  2ITD C;  3UO3 A;  4IHJ A;  3M8A A;  3CE2 A;  3WG7 B;  4QPJ A;  2CTQ A;  4FVM A;  3DSQ A;  2JJ1 G;  2BSK B;  4DV7 B;  3G4S V;  3N2G A;  2M6Y A;  3HKB A;  1D2D A;  5JQG A;  2QKA A;  4DUY O;  3G67 A;  4IYH A;  4LBE C;  1N36 O;  2UXX A;  3T1H B;  1R6N A;  1TGO A;  3E8F A;  4L8J A;  2F66 C;  3ZHV A;  5IT9 N;  3ZN0 A;  4TV9 A;  1F7Y A;  4LF7 O;  3CRQ A;  3D3I A;  3I55 V;  1PV0 A;  3AG7 A;  5C8Y B;  4DV3 B;  4O4L A;  2CK3 G;  4DR6 B;  2ZXW C;  1J5E O;  3CP1 A;  3OAA G;  2ZE6 A;  1GM8 A;  3L70 H;  2A9H A;  1I5X A;  1TUB B;  5B1B B;  4P2Z A;  4JI1 B;  2QGN A;  1N33 O;  4D7S A;  4GKJ O;  4LFA O;  1VIB A;  4FJC C;  3RGB A;  1AI5 A;  3JAL A;  1YHQ V;  1HNX O;  3IAY A;  5F2V O;  2ZE8 A;  3B8M A;  3FB5 C;  1HWY A;  3S3W A;  1PPJ H;  2DN9 A;  2WLI A;  4WF9 V;  1QCE A;  1N34 B;  4DR2 B;  1Y67 A;  3JSN A;  1ENV A;  3J80 N;  3OMA B;  3TGU H;  4CC6 A;  5KAF Z;  2CDY A;  4NB5 A;  1XL6 A;  1Q81 W;  3DGE A;  2BE3 A;  1KKD A;  2P06 A;  1BGY H;  1XMO B;  5DN6 G;  3A0R A;  1N0N A;  3RYC B;  3ZCC A;  3QTC A;  3SPG A;  4JI4 B;  2OTJ V;  4WFB V;  4JI8 B;  1OCO B;  3SJC C;  4Q6G A;  1VMG A;  1WP7 A;  5LOV A;  3JAW A;  1VQO V;  3N2K B;  1IDS A;  5H2F Z;  2EIN B;  2F23 A;  3ASO B;  4GT1 A;  3K57 A;  5CA3 A;  4DV5 O;  3OUF A;  4DRX A;  4HBN A;  5CBG A;  4X88 A;  2JDI G;  3SJQ C;  4ASU G;  3CX5 F;  3UT5 B;  4J9Z B;  3E86 A;  2GSM B;  2ZT9 B;  1ZLZ A;  3I56 V;  3P3P A;  4R50 A;  2XAS A;  2LP7 A;  4X8A A;  1NR1 A;  2XAQ A;  3UQ8 A;  4YJ2 B;  4KXR A;  2RDC A;  4DXW A;  1FXK A;  1YEW A;  4I0X B;  1PP9 H;  1ZSP A;  4I55 A;  4ZI7 A;  2JVD A;  5KHK A;  3H1I H;  3QO5 A;  4PI0 A;  4UCU A;  4GX5 A;  1JFF A;  1RSO A;  3ETD A;  3ABT A;  1RPR A;  3RWR D;  2H3O A;  1SKV A;  3CSX A;  3OGI B;  1KYO F;  2P6J A;  1FJG B;  3BAA A;  3OEE G;  2R72 A;  4JZG A;  3K3W A;  5LYJ B;  1NJI W;  2W6J G;  4GUN A;  2FML A;  3FD9 A;  3P30 A;  1RM1 B;  1E79 G;  1XIL A;  2P4K A;  3RYF B;  3HKE B;  2YSU B;  4DV2 B;  2IM9 A;  2OYQ A;  3CRC A;  3JD2 A;  2KB1 A;  1G8M A;  2UXD O;  4X66 B;  1VF6 C;  2WPD G;  2QM8 A;  4QPK A;  2WWW A;  2QKS A;  1H2S B;  4O2A B;  4RQE A;  3JAS A;  1MA1 A;  3DXR B;  4I4T A;  3HKD A;  2RQ6 A;  2UUC B;  3H1J H;  1ZWI C;  3RVZ A;  5JH7 B;  3U0Z A;  4DV7 O;  4LH6 A;  2R9R B;  2YEV B;  1K5S A;  3NXS A;  1NH2 B;  4KHP B;  1KC8 W;  2BOB C;  1XHZ A;  2QM7 A;  2EIK B;  3E22 B;  3FB6 C;  3QF7 A;  3KKY A;  3T1H O;  4UCO A;  2HP8 A;  2RNB A;  1NTK H;  3T1Y O;  1FOU A;  1HR0 B;  4Z1V A;  4TUY A;  1SQQ H;  5B1O A;  5K1X A;  2DYR B;  2WSS G;  4DR6 O;  3K03 A;  3SYA A;  2Y4T A;  3ZMV A;  3OD4 A;  3ZHU A;  4PJ0 Z;  4NTX A;  1ORQ C;  5FNV A;  4JI1 O;  1FFX B;  1YJ9 V;  1K4D C;  5L3D A;  5LGU A;  2JRI A;  2AXT Z;  4IYI A;  3OUS A;  2KSD A;  4WBN B;  2QJ1 A;  2DW4 A;  1JA8 A;  3MHS C;  3CRR A;  1S72 V;  4D7T A;  4TWK A;  2CH7 A;  3BA8 A;  2PI5 A;  4DR2 O;  4JTA B;  2YDE A;  1H2L A;  2ETN A;  3CCL V;  3SPI A;  1MZF A;  4FM0 A;  5GON A;  2ZCE A;  1R6K A;  1Q6H A;  4UXN A;  2YI8 A;  4O2B B;  2OTL V;  3JCZ A;  2Q9L A;  3HR0 A;  1XMO O;  2DMX A;  2LGW A;  5IJ9 A;  2JS5 A;  4TT3 G;  2EJR A;  4HZ3 A;  1O9G A;  4ZOL B;  4JI4 O;  1WA8 B;  4JF3 A;  4JI8 O;  3JD0 A;  4A5U B;  4N21 A;  4CZZ A;  3H01 A;  1VEW A;  4BIU A;  1BS3 A;  3SPH A;  4TQF A;  4JAA A;  4WFF A;  3JCU Z;  5JCO C;  1BL8 A;  1AB3 A;  2Q0O C;  3ASN C;  2L6L A;  2QTO A;  3L71 H;  3LSQ A;  1QVG U;  3AG4 C;  3OMI B;  4MVU A;  2JS3 A;  4IHJ B;  4R8C A;  1Q7Y W;  4FMT A;  3N2G B;  2EIL B;  3LDD A;  1KMI Z;  2WLK A;  3OW2 U;  5L3B A;  1DGS A;  1VQ8 V;  3BAB A;  1R3J C;  3HKB B;  4B3M B;  3LDC A;  4E2L A;  1ZTE A;  5JQG B;  2YIA A;  4H37 A;  5HFM A;  1VF5 B;  2AHY A;  3DC6 A;  3VOU A;  1V54 C;  3LUT B;  3N2K A;  3FAV B;  1SF9 A;  3S3X A;  2WLJ A;  4TV9 B;  2B9Z A;  2ZIN A;  2XTA A;  4EB6 A;  2F4V B;  2FKX A;  1IJG A;  4PEL A;  3T1C A;  1FPO A;  1H8H G;  4O4L B;  1FJG O;  1XUQ A;  4JI6 B;  1XMQ B;  5BZB A;  4UCS A;  3WG7 C;  2QWN B;  3WB0 A;  5E1A C;  1IBM B;  4DV2 O;  5FLX N;  2XAH A;  5KX5 A;  1DLB A;  4UCT A;  1M90 W;  3L74 H;  1XDC A;  4X66 O;  4P30 A;  4DV1 B;  1Z2G A;  4EFB A;  3JAL B;  1VQ7 V;  5ITZ A;  3FB7 C;  1K92 A;  4ABM A;  4DUY B;  3SJA C;  3SPC A;  4AIL C;  1M5I A;  2UUC O;  1P7B A;  3ZMS A;  2AZ0 A;  5B1A C;  3RYI A;  3F5T A;  3CCU V;  2KQX A;  4JPR A;  2GHY A;  1BHA A;  2VQF B;  4JI3 B;  5JJN B;  4KHP O;  1PD3 A;  3VQX A;  2X6A A;  1S3J A;  1IBL B;  5E79 Z;  1BQ0 A;  4FLW A;  1GK9 A;  4J9Y B;  3W7T A;  3QO7 A;  4EKW A;  2DE0 X;  5BR8 O;  2L35 A;  4FPP A;  3MHH C;  5LP6 A;  4FZ1 A;  4BW5 A;  2HLD G;  4IGG A;  3OTO B;  2XOK G;  3JAW B;  1N0J A;  3LNM B;  5EYP B;  5FL7 G;  3DC5 A;  1XBL A;  3DXR A;  3RBZ A;  3ZRW A;  3AG2 B;  5H6Q A;  1GM7 A;  4DRX B;  1NH2 D;  5IDJ A;  1HNZ B;  2OWO A;  3ZHS A;  1W0K G;  1SER A;  2PF4 E;  1G1X B;  5H9C A;  4LFB B;  3E22 A;  4MVS A;  2X6C A;  4LWS B;  5IY5 B;  2ZNI A;  1DF5 A;  3BA9 A;  4MS2 A;  1Z5V A;  1FFT B;  5IJ0 A;  3B8N A;  3CCJ V;  2XAF A;  3TXS A;  3C90 A;  4X64 B;  4I50 A;  4I55 B;  4ZI7 B;  3LNN A;  4PI2 A;  3K04 A;  2E5L B;  1VQK V;  1AI4 A;  4I9W A;  1JFF B;  1RSO B;  3ETE A;  4K0K B;  2EUL A;  1S76 D;  1NKD A;  4LF8 B;  1SA0 A;  4UB8 Z;  1ROP A;  3J7A U;  1BMF G;  1WP8 A;  1I94 B;  2N05 A;  3AG1 B;  3W7X A;  1AR4 A;  1YDX A;  2Y69 C;  1QR8 A;  3K06 A;  4CH6 A;  3JAS B;  1HNW B;  2RMK B;  1SS3 A;  3HKD B;  2BTQ A;  4U7O A;  5B5E Z;  1T5E A;  4Z2W A;  4B3M O;  1WA8 A;  1JOY A;  1Q6I A;  5LL6 Y;  3KDR A;  3D36 C;  2P22 C;  2B1I A;  3CMA V;  1WB8 A;  2Z5U A;  1UFI A;  1V9P A;  1KQS U;  4J7K A;  4TUY B;  4B3R B;  4K8X A;  2F4V O;  2LFR A;  1BCC H;  1ZUQ A;  2EX3 A;  4FM1 A;  1AP6 A;  1WAZ A;  1K9M W;  1W2B U;  4FLX A;  5KUK A;  1XMQ O;  4JI6 O;  5KHH A;  3RVY A;  2XAG A;  2QWP B;  3KZI Z;  2IJK A;  5FNV B;  1IBM O;  3IFX A;  1RFY A;  4JYA B;  3W7U A;  1SQV H;  2P4V A;  4E4E A;  4DV1 O;  5KAI Z;  2WLL B;  5EBM C;  2EIM B;  2GBO A;  1N8R W;  4B3S B;  4JAV A;  2HKO A;  1MSW D;  4DK0 A;  2CH7 B;  3FAV A;  2CTP A;  2BCC H;  4B08 A;  3T1Y B;  4DYL A;  1X4T A;  2JEX A;  2QWO B;  3ABL C;  2VQF O;  4JI3 O;  1QR9 A;  5J2T A;  2DYR C;  5GON B;  4J7Z A;  3JAR A;  4O4J A;  3LSS A;  1URF A;  1YXB A;  1IBL O;  1PL0 A;  2QKC A;  3JAK A;  1P4R A;  3U10 A;  5IJ9 B;  1SQB H;  2ILM A;  2YIB D;  4X1I A;  4LH7 A;  2YIB A;  4P9P A;  3OTO O;  3U11 A;  4GYC B;  2YI9 A;  4X62 B;  2R9I A;  3L9D A;  4KL1 A;  2WLH A;  4BWA A;  5BY1 A;  1LUV A;  1QHT A;  4ZIB A;  1B04 A;  5CB4 A;  5LHH A;  1HNZ O;  2QA4 V;  2ZDI C;  1NBM G;  1VF6 A;  1OZ0 A;  5L3E A;  5IYC O;  3OEH G;  3Q4H A;  4LFB O;  5EC1 C;  1KEC A;  5BXZ A;  3GWO A;  1QLE B;  1O9H A;  1M57 C;  1XEQ A;  3JSL A;  5D5Q A;  3E89 A;  4U7N A;  1VQL V;  3ZBH A;  1QBZ A;  5CA0 A;  3EFF K;  3SYO A;  4QE9 A;  2OCH A;  4X64 O;  1M56 C;  4O4H A;  4W4K A;  3M99 B;  4RQF A;  2CGO A;  5EYP A;  5CN0 A;  1Q3E A;  2PY5 A;  3OT7 A;  3OFN G;  5GW7 A;  2E5L O;  5J9P C;  5AG2 A;  2FTK A;  4EB6 B;  1I5Y A;  4K0K O;  4ZHQ A;  2EIJ B;  4MVQ A;  1PNL A;  1Y74 B;  1YJN V;  1D5A A;  4LF8 O;  1IBK B;  4PA4 A;  1COW G;  2IH3 C;  1OCZ B;  4LWS A;  4DW1 A;  3ZHQ A;  2IU3 A;  2H8P C;  2OCC C;  5KX5 B;  1I94 O;  4J11 A;  2PYL A;  2Y0P A;  4OX9 B;  2GV9 A;  4UVA A;  5ITZ B;  3E8H A;  5B3S B;  1HNW O;  1AJP A;  4MVM A;  4FLV A;  3NR7 A;  3ZIA G;  3ABU A;  4UVC A;  3OR7 C;  1K73 W;  2Q73 A;  3RYI B;  3RW0 A;  1B6Q A;  1WNS A;  2F1M A;  2W0F C;  4GCZ A;  3FB8 C;  4ICG A;  1JQ0 A;  4IL6 Z;  3ABK C;  3WB1 A;  4JI0 B;  3K58 A;  3X2Q C;  1MZE A;  4MVZ A;  4PDV A;  2HVJ C;  5IWA B;  2KG7 A;  2A06 H;  5GTH Z;  2NN4 A;  5LP6 B;  4JYY A;  4NTW A;  4B3R O;  4PHZ A;  3CCV V;  1PKX A;  4F6R B;  1NQT A;  1K7D A;  4D6T H;  2NLJ C;  2GDS A;  2P90 A;  4UB6 Z;  4CS2 A;  3ZRW B;  1Y76 A;  3ETG A;  1Z5W A;  1CPY A;  2Q67 A;  3ETQ A;  5JCO A;  3G6B A;  1K33 A;  1R3K C;  2M7W A;  1PL4 A;  2N74 A;  1VQ4 V;  4JYA O;  1DTO A;  4JV5 B;  2ZE7 A;  1RPO A;  1F51 A;  3H1K H;  5IYB O;  1FXV A;  4B3S O;  4WFH A;  4PD4 F;  2Q0A A;  5BR8 B;  3BVO A;  2A0L A;  4J10 A;  5IJ0 B;  2ZQM A;  1LUW A;  1Q5O A;  4I50 B;  1VQP V;  3AG3 C;  4OXS A;  4KFM A;  2GUZ A;  1K8A W;  2ZE5 A;  4LR3 A;  1K34 A;  1VF7 A;  1XOU A;  5A9G A;  2WAM A;  4GKK B;  1B06 A;  4J42 A;  4BR6 A;  5LA6 A;  3EVK A;  1CP9 A;  4BAY A;  2JEU A;  1MSD A;  1QLN A;  1SA0 B;  3STL C;  1JJ2 U;  3GVM A;  2WLL A;  3E35 A;  4X62 O;  1GMG A;  3ZMT A;  1VQ5 V;  3L75 H;  1WN7 A;  3F7V C;  4CH4 A;  5IY5 C;  1L8D A;  4I9Q A;  1ZAU A;  2W6I G;  3AEI A;  3BEH A;  3APQ A;  3PN1 A;  5LHI A;  1FXK C;  3GWK C;  4DV4 B;  2BTQ B;  4FLU A;  1Q82 W;  1R6T A;  4J7J A;  3BCC H;  2JGD A;  5H5N A;  4YY3 O;  4NYK A;  1M93 A;  2RCV A;  3A0B Z;  3K79 A;  3CCM V;  2JJ2 G;  4X1Y A;  4QNH B;  1QVF U;  4IT5 A;  4DR3 B;  4GX0 A;  3ZHT A;  2YS8 A;  1JX9 A;  2Q4P A;  4HNA A;  1L0N H;  1GKF A;  5DM6 V;  5LHG A;  1XQ8 A;  4EEQ A;  3EHB B;  5EIB D;  3B09 A;  2V4D A;  1EFR G;  5JJE B;  1NTZ H;  3T4Z A;  5KHI A;  1KKC A;  1VQN V;  2MW2 B;  1VQM V;  1IBK O;  5LGT A;  2BTO A;  1CEZ A;  5CA1 B;  3CME V;  1FS0 G;  3CRM A;  3ABM C;  1G4Y B;  1OJH A;  4QJF B;  3TCU A;  5FPR A;  5JJJ B;  4UUJ C;  2BOC C;  3A2F A;  5TIS Z;  4OX9 O;  1Q6U A;  3T4D A;  2IJI A;  1SRY A;  1YIJ V;  1I7F A;  5B66 Z;  3VQW A;  3TXQ A;  3CCQ V;  4EFE A;  5LMU B;  1ZL8 A;  1PNM A;  3PJS K;  4JTD B;  3K08 A;  2Q7E A;  1Y4M A;  4LP8 A;  3H1L H;  3AK1 A;  5BMV A;  2QWR B;  5HFL A;  5J2T B;  2HEP A;  3JAR B;  1Y74 A;  4O4J B;  2OIG A;  3CC2 V;  1QU7 A;  1VP7 A;  1EN5 A;  3OMN B;  4JI0 O;  1H8E G;  3JAK B;  3QVN A;  5IWA O;  1B3Q A;  2Q7H A;  1AIL A;  4GZR B;  1R3L C;  4DO2 A;  4WCE V;  4X1I B;  3SYC A;  3SR2 C;  1EZJ A;  3JYC A;  3CXH F;  3IJ4 A;  1BSM A;  3ML0 A;  2AW9 A;  1JJO A;  5CB4 B;  1AP5 A;  1TVK A;  1R73 A;  2GTS A;  4MTO A;  5J2U B;  2X7R B;  4JV5 O;  4CH5 A;  2FYU H;  3Q4H B;  4MW3 A;  4H44 B;  4HYO A;  3F5W C;  1MAB G;  2H94 A;  2ZR3 A;  1US6 A;  2B5U A;  1XHX A;  4B7K A;  1XNR B;  5B1B C;  3CXC U;  2FB5 A;  1WJZ A;  3HB3 B;  3P32 A;  4NTY A;  4XDJ A;  3H9V A;  5CA0 B;  3IC7 A;  4WFG A;  1IZ3 A;  1YI2 V;  4F6R A;  4O4H B;  1I0H A;  3J81 N;  3D36 A;  3D3Q A;  2LFS A;  3HKC A;  1WPB A;  4GKK O;  1FD9 A;  4R6Z A;  2IU0 A;  1IUR A;  3K0G A;  4TV8 A;  3UCS C;  1ZX3 A;  4BIO A;  4LF6 B;  2OT5 A;  4ZHQ B;  1OCR B;  4DR5 O;  4RUE A;  1OCC B;  3ZRS A;  1SZX A;  1WLE A;  5C93 A;  1MG1 A;  1NU1 H;  3BPZ A;  1OHH G;  2EBO A;  1X59 A;  4PDM A;  2ZM6 B;  5KHG A;  4CC5 A;  1QLE C;  3SYP A;  1M9N A;  5IYZ A;  4U3J A;  1MMM A;  1OCO C;  4H13 B;  3RT3 C;  2DQ0 A;  5B1N A;  3JAM N;  3EXA A;  4MTX A;  4DV4 O;  3E8B A;  4X89 A;  2EIN C;  2DOS A;  3ASO C;  2O57 A;  2IBZ H;  4B3T B;  1Q90 D;  4MTF A;  2PTM A;  2Q68 A;  2EIJ C;  3BFR A;  4FLZ A;  4JI2 B;  4DR3 O;  3B40 A;  1CXZ B;  2F93 B;  2UXN A;  1H2K A;  1OCZ C;  1XRE A;  2KG7 B;  4BIZ A;  4IIJ A;  3R66 A;  1M4U A;  1R3I C;  1AJN A;  4TSF G;  4X65 B;  4LF9 B;  1IXB A;  4UVB A;  4QGP A;  1Y76 B;  3CD6 V;  4DR1 B;  1KBH A;  4JI5 B;  3ASN B;  1EM1 A;  4XBF A;  2Z0A A;  1M1K W;  3AG4 B;  3SJB C;  1YCI A;  4FK5 C;  1HP8 A;  4U3F H;  4FIP C;  5LMN B;  2ITC C;  1HDJ A;  3OTF A;  5LMU O;  1RM1 C;  1IXM A;  1JNB A;  1NVP D;  2E76 B;  4AQY B;  2UXC B;  2QEX V;  4YXW G;  5K1P A;  1AI6 A;  2GUZ B;  1F4N A;  2QWQ B;  3AK3 A;  1L0L H;  1V55 B;  2XUM A;  3VQY A;  4DUZ O;  1V54 B;  2ODM A;  5CA1 A;  5LXT B;  4LFC O;  3STZ C;  1GM9 A;  1FXH A;  5LA6 B;  2CTW A;  4QE7 A;  1YTF D;  3K5O A;  2OIE A;  3TJT A;  5EZY A;  1GN3 A;  3L72 H;  1SQF A;  2DYS B;  2EIK C;  4PA7 A;  1K4C C;  4YIP A;  5EBL C;  4FLY A;  1E1Q G;  3JAT A;  4H0L B;  4LC1 A;  1MOF A;  1QNM A;  1GTO A;  2E74 B;  4JYB A;  3ZHR A;  3K9S A;  2ADP A;  1NT2 B;  3CB2 A;  2JGD B;  3UO2 A;  1L1F A;  4DV0 B;  1XNR O;  2DWD C;  5B1A B;  4X1Y B;  1HW7 A;  1FYJ A;  1SQP H;  3H1H H;  2IW5 A;  2PZS A;  4HNA B;  1PM9 A;  3F7Y C;  1LNQ A;  5IE9 A;  3OE7 G;  4OPH A;  5KHJ A;  4NR1 A;  2Q6A A;  1SQX H;  2IJJ A;  4LF6 O;  1XI1 A;  5KMG A;  5J2U A;  2HR3 A;  2UXB B;  1Q8I A;  4G28 B;  1P7G A;  2K9P A;  4X9Q A;  1AI7 A;  4YY3 B;  2ZM6 O;  1SES A;  3CS5 A;  4UCR A;  1IVS A;  1GN2 A;  1TA8 A;  2EZO A;  3CCE V;  5JWP A;  2IJH A;  3K5L A;  1Q43 A;  4ZKI A;  3FX7 A;  3SYQ A;  4DR4 B;  1BQZ A;  5GTI Z;  2A3Q A;  1ZL8 B;  5KA6 A;  2X0L A;  1VQ6 V;  3FKS G;  4B3T O;  5BMV B;  2N04 A;  4LF4 B;  3B77 A;  2UUA B;  1W0J G;  4JI2 O;  2P5O A;  3QO8 A;  1P49 A;  2P67 A;  4DR7 B;  2XAJ A;  1FKA O;  3CCS V;  3K5N A;  2R9A A;  2EIL C;  1H38 A;  2WLM A;  5JVD A;  4O4I A;  1H2G A;  3D8C A;  2LQT A;  1KU9 A;  3N27 A;  1VQ9 V;  4X65 O;  4LF9 O;  3AK2 A;  3B4S A;  2YXL A;  3E83 A;  3W7W A;  4NXN O;  4CH3 A;  1H5W A;  1UJW B;  1TVK B;  2RJZ A;  4DR1 O;  3T2M A;  4LF5 B;  1FAF A;  4JI5 O;  3GB7 C;  1JCH A;  1AR5 A;  4N23 A;  1F4M A;  3G71 V;  4JI7 B;  2QE7 G;  4MVR A;  2ZNJ A;  2Y69 B;  1P84 F;  3CJH B;  2DJV A;  5LMN O;  4P9O A;  4HAM A;  4X20 A;  3W7S A;  1F23 A;  1KB9 F;  3ICX A;  4LNU B;  2ATK C;  4AQY O;  1S0V A;  2UXC O;  2V1D A;  3RYH A;  3K5M A;  3C3T A;  3BY6 A;  1U97 A;  2G38 A;  4JYC A;  3ZRV A;  2UUB B;  1NTM H;  3HKC B;  1VAR A;  4W4L A;  4PDR A;  5EK0 A;  4XDK A;  3JD3 A;  3C3S A;  2YXY A;  3VQV A;  3CRA A;  4TV8 B;  2QDO A;  2HJD A;  3APO A;  2UU9 B;  2VS0 A;  2WA4 A;  1Y66 A;  4R7C A;  1GRJ A;  2ADQ B;  2E3C A;  4MW8 A;  3CEI A;  5CBH A;  3ZJZ A;  4L87 A;  2NNU A;  3TK1 A;  4MSW C;  2IH1 C;  2WA3 A;  1YJW V;  4GX2 A;  2Y4U A;  2LJ2 A;  3OM3 B;  1GAX A;  4FFB A;  5KUM A;  5IYZ B;  4B7E A;  4YHH B;  4U3J B;  2Q69 A;  2PYJ A;  4DV6 B;  4MTG A;  1RP3 B;  3SDL A;  2ZD9 A;  2QR4 A;  3K59 A;  1SQG A;  3LDE A;  4XDL A;  3ZN1 A;  4JAS A;  4DV0 O;  1KP3 A;  2D2C B;  5LXT A;  3AG2 C;  3UKM A;  4UCV A;  3O65 A;  4DR5 B;  1UPG A;  3ABL B;  4QIW F;  2PI4 A;  1OCR C;  3I5D A;  1A32 A;  1OCC C;  3ZMZ A;  2VRZ A;  4DV3 O;  2FL4 A;  1EBO A;  2ZXW B;  4BW9 A;  2ARH A;  3IGA C;  2JIZ G;  1K5Q A;  2DQ3 A;  4IIJ B;  1K97 A;  2MK3 A;  4NVP A;  2XHB A;  2BSK A;  4RAI A;  1QQC A;  2HG5 C;  2KKW A;  3VBB A;  1EN4 A;  4RO2 A;  3QNE A;  1I08 A;  1S5L Z;  3ZRX A;  4FZ0 A;  4CS3 A;  2UXB O;  1W59 A;  2F95 B;  1YSC A;  3DTU B;  3ZX6 A;  2WLN A;  3FYE B;  1N34 O;  3ZMU A;  2NR5 A;  1JR9 A;  2W0X A;  4LCU C;  2CAZ C;  3WB2 A;  2X6B A;  2P7T C;  2VWJ A;  4DR4 O;  5C8Y A;  3OGC C;  3E8G A;  1EN6 A;  4JAU A;  4FLT A;  1M57 B;  4J41 A;  2K1E A;  1TUB A;  2YUA A;  4LF4 O;  1NVP B;  3AG1 C;  4H33 A;  3K9A A;  4YJ3 B;  2HHH B;  2UUA O;  2VWK A;  3LSU A;  3SGI A;  1M56 B;  4GX1 A;  1XNQ B;  1KP2 A;  1N32 B;  2CUG A;  4X1K B;  4NXM B;  4DR7 O;  2B1G A;  5D5P A;  3UM7 A;  2VQE B;  4MVO A;  2DWE C;  2LW7 A;  3IC9 A;  1GH6 A;  1AJQ A;  4RUF A;  4AHC A;  5EZY B;  2Q5Z A;  2GTA A;  1YTF B;  2LGQ A;  1YVW A;  3QG5 A;  3P3N A;  4PDL A;  3CHX A;  2Q8V A;  1H2M A;  1H2N A;  3JAT B;  1N4C A;  3RYC A;  2OCC B;  4LF5 O;  5KLV H;  1E1R G;  1WB7 A;  1KUQ A;  4JI7 O;  2PUS A;  4JTC B;  3R65 A;  4FFK A;  5CMU A;  4F6E A;  1V55 C;  1SZT A;  2CTR A;  4DUZ B;  4K8Z A;  3O9O A;  2QM4 A;  4NKG B;  2EZP A;  4LFC B;  2EJ7 A;  5FPO A;  3MAQ A;  4PA3 A;  2YXH A;  1AR1 B;  3UT5 A;  1BT8 A;  2DYS C;  2RN9 A;  2EIM C;  2UUB O;  3ABK B;  3X2Q B;  2AGA A;  5EC2 C;  4WFE A;  2A7W A;  1GO3 F;  4KP4 A;  1YIT V;  3MDS A;  1G6U A;  2AZ2 A;  4OGQ B;  2Q7G A; 
#chains in the Genus database with same CATH homology
 1I0H A;  3C3T A;  4C7U A;  1P7G A;  3OT7 A;  3RN4 A;  4X9Q A;  1VAR A;  5AG2 A;  1EN6 A;  1ZSP A;  3C3S A;  4E4E A;  1GN2 A;  1LUW A;  1JA8 A;  1XUQ A;  1SZX A;  1MNG A;  2ADQ B;  3AK3 A;  5A9G A;  3CEI A;  3LSU A;  1B06 A;  1XDC A;  4BR6 A;  1D5N A;  1AVM A;  3EVK A;  4JZG A;  3AK1 A;  4GUN A;  1MSD A;  1MMM A;  3IC9 A;  1XIL A;  2P4K A;  3TJT A;  4JZ2 A;  1GN3 A;  2QKC A;  1Y67 A;  1EN5 A;  3QVN A;  4YIP A;  2CDY A;  2CE4 A;  1AR4 A;  1IX9 A;  1MA1 A;  1VEW A;  1BS3 A;  4YIO A;  1N0N A;  1GN4 A;  1WB7 A;  3BFR A;  1QNM A;  4FFK A;  3AK2 A;  1LUV A;  3K9S A;  4F6E A;  2ADP A;  2RCV A;  1BSM A;  2AW9 A;  1XRE A;  1AP5 A;  4JYY A;  3KDR A;  1N0J A;  1IDS A;  1AR5 A;  3DC5 A;  3KKY A;  1EN4 A;  2GDS A;  1IXB A;  1I08 A;  1WB8 A;  1PM9 A;  1BT8 A;  2QKA A;  1ZTE A;  1ZUQ A;  1AP6 A;  1PL4 A;  1ZLZ A;  3MDS A;  3DC6 A;  1EM1 A;  1JR9 A;  1GN6 A;  1KKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...