1ENPA

Brassica napus enoyl acp reductase/nadh binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enpA00
2O3TA 1EVJA 3ZWPA 4CQMD 2WEKA 5JO0A 2C82A 2HO5A 4KP7A 3C1OA 2DTDA 4YQYA 1M67A 4I8XA 4RVDA 1BHSA 1EUCA 3GH3A 3GRKA 1CEQA 1QYDA 4I1IA 4PZEA 2I3AA 8ADHA 5T8KA 4WNCA 4Y98A 3RCBA 1U7TA 1JN0A 1O8CA 4MDHA 5JO9A 4IMRA 3JQFA 2JCXA 4IIUA 4M87A 1ONOA 5C3MA 4OIMA 1LLCA 5JFOA 4TZTA 1WW8A 2VUUA 3QLJA 1RWBA 1XCBA 2OFPA 1P1KA 1HE3A 4MVJE 4YT5A 2YHIB 4WECA 2QRKA 1DHTA 1EZ4A 3KYDA 4A73A 1E5QA 5FWNA 2ZTVA 3JQ9C 1Y8RA 3DBRB 1ISIA 3K2EA 1PQPA 3IDSA 1RM3A 1ZMTA 3I9OA 3KSUA 4BNZA 3FHLA 2IEBA 3GAFA 1Y7TA 2PFGA 1NBOA 3IP1A 5L53A 1V9LA 1MFPA 4J49A 3JTMA 4KUGA 1HXHA 4CV2A 4CM9D 2IXAA 1XWFA 3TJRA 5BSFA 3VH2A 1U3VA 1P1IA 1XELA 2FZEA 1BXKA 2VT2A 2ZJ1A 3PRJA 3QE3A 3T7EA 4EGFA 1SC6A 1Q7BA 4EYEA 1DIBA 3ROKA 1R0KA 1X7HA 2PV7A 4MVJA 4E0BA 1FDUA 2NUAA 4W4TA 1LDGA 1KC1A 2CDAA 3VDQA 3MTGA 4GSLA 4JX8A 3H5NA 1UXKA 5TNXA 2Y0DA 1T2EA 3ORFA 1K6XA 3TRIA 1IHYA 4QXMA 3UKOA 3FWNA 1SO8A 2CDCA 1X1TA 3JD3A 4OAQA 4RCVA 3ZGYA 3GZNB 4J6FA 4HKTA 4KUEA 2O7SA 2VN8A 2PD6A 3AFMA 3FNHA 4R01A 1G6KA 2EP7A 3ETGA 3KSZO 2NQ8A 3RU9A 2G0TA 3FBTA 1ZO8A 2AEJA 1RJWA 3DAGA 1I3NA 4BKPA 2EP5A 3RKUA 3Q2IA 4GAEA 3HDJA 3RSHA 1EE9A 2BKAA 4GGPA 3GNQA 2PGJA 2PY6A 3GG9A 1LEHA 2NTNA 4R1NA 4XZ3A 2NSDA 5DNAA 3QW2A 3S1LA 2YFQA 1VJ0A 3PHJA 1N92A 4JXKA 1IB6A 2W2LD 2HMWA 1KYQA 3H3FA 3DB2A 3QJ5A 1N7HA 1CJCA 5G4LA 1C0KA 2OL4A 5A5EA 5KKCA 4QT0A 1CDOA 4BUCA 4E33A 1BXGA 1P1RA 3H8VA 1NPYA 3ZHYA 4LN1A 1BDBA 3Q2KA 4U6SA 5JLAA 3L4BC 1H9AA 1QXSA 4KQWA 3ZCXA 1EBUA 3KEOA 1Y5MA 4BNYA 1JLLA 1JWBB 5ENVA 5CG1A 4HBGA 4E2ZA 3IJPA 2GZ3A 3F47A 4QEDA 4UVEA 3O4RA 1DJNA 4BO4A 4YT4A 1IUKA 2CF6A 3DEYX 3NDJA 3OP4A 4YAJA 2C2XA 4ZHSA 4I5FA 1UUFA 2X7HA 3B1FA 4G81A 2VZ0A 3RIHA 3D1LA 1U4SA 3QVWA 3MWDB 4BIIA 1YRLA 4I5DA 1I10A 4GX1A 4E5YA 4TVOA 2X9GA 3NDIA 2EGGA 2EV9A 5TRTA 2G1UA 4TKMA 3U4CA 5DCYA 4XDZA 5KNLA 1KOLA 2FPIA 3KBOA 1XHLA 4P4GA 5DF1A 4B4VA 5AXAA 3TZHA 2J8ZA 3E1KA 3O38A 2CVZA 4E5NA 3AUTA 5KOIA 2OMEA 7ADHA 1HSOA 3H2ZA 5B37A 4P4LA 4WOKA 1P45A 1EK6A 1YH3A 5A03A 3JQGA 4MP8A 5U9CA 2E48A 1ZZEA 3UH1A 4EBFA 2R2GA 4ILKA 4UVIA 3RBXA 1YL7A 4WLNA 1VJ1A 3G1UA 4BS9A 3ZHZA 1ZFNA 1P3DA 1NFFA 3GVXA 1YQDA 4D44A 4CMEA 5JPIA 3ZNNA 4IS2A 3QVXA 2GF2A 3SX2A 4BGIA 1ZK0A 4R9SA 1G1AA 1SMKA 2EW8A 3AI3A 1KVSA 1PEDA 1QYVA 3I9NA 4FC7A 3WGOA 4ALMA 4B7UA 3FBGA 4R1SA 5CPBA 3AM5A 1UDAA 5EINA 1PTJA 3GMDA 3SJ7A 1PS0A 5B4TA 2UVDA 5JAMA 2VRCA 4RDHA 1LBEA 3WGHA 2YHIA 3BTVA 1E77A 3PXXA 2VT3A 4RF2A 5G4KB 3PJGA 1IPEA 3W4JA 1IL0A 3BIOA 1LQTA 4YPOA 3HN2A 3DBRA 4H7PA 4PRLA 4DLLA 3H3JA 3DWFA 4X54A 3AI2A 3DMTA 3OIDA 4R9RA 1O94A 3PJEA 5TQVA 5JBIA 3QA9A 4UEJA 4IXWA 4GLOA 3T4EA 3TZCA 1GFSA 4NJOA 1TT5B 2IYOA 1PL6A 3GMSA 2AHRA 1PGQA 4J1TA 4MVJP 2EW2A 4CM6A 4G5HA 4WCDA 4WJZA 5AXDA 3TOZA 2EGHA 2H9IA 1PIWA 3WQRA 1ZNQO 3NUGA 2HAEA 4IDBA 1NM5A 1GR0A 2DVMA 4XD2A 4ZVVA 2NU7A 3GNTA 4XGIA 5ER9A 5IDWA 5ITVA 4A26A 3U49A 4BV8A 1SB8A 4FGWA 3UAGA 2YZ7A 1DHRA 1SOWA 3PWKA 4LW8A 3GZNA 1KVQA 1SAYA 3BHIA 2EKPA 5H83A 5K6AC 2O3JA 4HNHA 1V0JA 1WNTA 1S7CA 3PZBA 4LMPA 3A4VA 4WOJA 4NPCA 4E5KA 1HL3A 2ZYDA 4HFMA 4TROA 1ZSNA 3RFXA 4YJFB 4YQZA 3ZN2A 1UP6A 4OXYA 1Q0LA 5B1YA 3VC7A 3K9QO 2GGSA 1A5ZA 4AJKA 1JAYA 4Z6KA 2X5KO 3DTTA 1WPQA 1ISHA 3MOGA 5T57A 3SJUA 1LC0A 2X5OA 4WLEA 3RC7A 4GVLA 2GN9A 5TX7A 1E1MA 3WMXA 4E3ZA 4FJ2A 3DC2A 3ZNPA 1P9LA 4MIYA 4EJ0A 3WGQA 3DTYA 1NTOA 2IRWA 3GN2A 3W1VA 4BNGA 1UXGA 2VHXA 2EWMA 3HDHA 2CNBA 4BQRA 4KZPA 2JD2A 2X8LA 5T67A 5JCJD 3HQ4O 4L74A 3TL3A 3UOGA 5A1TA 2BFPA 3W8FA 1AN9A 2FPPA 3F4BA 3FF4A 4CM4A 3LK7A 2A94A 5KVVA 1OMOA 1T2CA 1I3KA 1NAHA 4OQZA 3H9UA 1BWSA 1EVYA 1EK5A 4BKRA 1B2LA 4RPJA 1PSDA 4B79A 3Q9NA 3SVTA 4BO1A 2JD1A 1V3TA 2VNAA 4MPDA 5L51A 2GCGA 3IJRA 1EMDA 3AWDA 4PGFA 2HKIA 4PLVA 4CMIA 1CRWG 4K28A 2NU8A 3ANMA 4BHTA 5A5FA 3L0DA 1WAMA 2NTVA 1U2DA 3N7UA 3PHLA 3V2GA 4R5HA 2P9EA 2JJYA 3PYMA 1PJSA 1UZMA 4N54A 1ZUD1 4FDAA 1EBFA 4B4UA 4ZU3A 2WMDA 1NVTA 4I9UA 4R3NA 4XB2A 4RLHA 2VHVA 1CQIA 1MLDA 3KEQA 1TA4A 2CF5A 2Y1EA 3DAFA 4RVGA 5COBA 3G1TA 1OBFO 2PLAA 2FN7A 3H9GA 3VZQA 4QTZA 4OL9A 4J2OA 1MUUA 3NV9A 5T5QA 3A28A 3RUCA 1GQ2A 1WLYA 3WQQA 3L9XA 1QYCA 4NR0A 1E3IA 1N7GA 5AXBA 4EJ6A 5L4NA 1R4NA 4OJNA 2Q1SA 3F1KA 2D2IA 3JQFC 2Y05A 4DIOA 3ZWAA 5IDYA 1XU9A 4JK3A 3V2UA 4NZ9A 3G0OA 4Q3EA 1X15A 4L9RA 1M76A 4CQLB 1NVGA 3K92A 5DBFA 3WIEA 3I5MA 4PCVA 1QYWA 3MEQA 3NGXA 2PH3A 1V8BA 4IGFA 3KETA 1QRRA 5C7LO 3DBLB 1GAEO 2Z5LA 3L4BA 3NAQA 4DXHA 1WVGA 1E7WA 4WGGA 1LRJA 1T24A 2O48X 4BB5A 5A04A 4DRYA 4XIYA 4PLCA 3PEFA 4FCCA 1YOVB 3IUSA 2IDZA 4DQVA 4U7WA 1P77A 3JQCA 4EW6A 1PU2A 1SZJG 5I7EA 1BW9B 5CP8A 3AUSA 5TC4A 3VVBA 1E7SA 3QVTA 3GUYA 3VKUA 4AJOA 1HDOA 4TRNA 3K5PA 3GF4A 4PG7A 4Y9DA 5BNFA 2PWZA 1M6WA 4LVUA 3WQSB 3MJCA 1EDOA 5F5NA 4XA8A 3WDSA 2Q50A 4P4NA 1YONA 5KIAA 3NT2A 4HADA 3JSAA 3EAGA 3OA0A 4DUPA 1UAGA 1TT5A 1GL3A 4FSHA 3V5NA 5HWSA 1ISFA 3GT0A 4J0FA 1YL6A 2JL1A 2PGLA 1U5AA 3JQEA 2WD8A 1FXSA 1Y9AA 4WLOA 2YUTA 3ZNQA 2BF7A 1J4AA 2YQ5A 1IY8A 2CY0A 2QYSA 5L95A 1B8VA 4UVGA 1ADBA 1Q1NA 2A92A 4D3DA 3K73O 4L4SA 2V6BA 3FTNA 4ZD6A 3ZWCA 4UULA 3AY7A 2DUWA 2VHYA 4DGSA 3RROA 1F14A 1GUFA 2YV2A 3E5MA 3SC4A 2Y1GA 1C0IA 2IZ0A 4JROA 4E2YA 3RUAA 2QRJA 4P8RA 4FJ1A 1O0SA 3DQPA 2AG8A 2C29D 1K0UA 3DFUA 2GPTA 5DN9A 1UXJA 1V6AA 4Z9FA 4OH1A 3JD2A 5ES3A 4BNWA 1YB5A 4ESOA 4L75A 3L6DA 1F8FA 4D46A 4RORA 2P68A 1EFKA 1DXYA 2Z95A 3D3EA 2OP0A 3BTOA 1U3UA 1YB1A 4A03A 1B15A 1KIFA 2AA3A 5TJHA 1EDZA 3Q6IA 1NQTA 4DTIA 3GZ4A 3IMFA 1EUZA 4JP3A 3I4FA 4GSKA 3JD1A 4J9UE 3O26A 1JVBA 2C7VA 1KEWA 1XR3A 4DQUA 2P9GA 3VZPA 4XQGA 4BNHA 1N2SA 1Q0QA 4W7IA 1H9BA 2RH4A 3JQ8B 2VTEA 3M1AA 2E4AA 4J90A 4QO8A 5F3RA 4YEDA 5I8ZA 2TMDA 4WLUA 1IZ0A 3PZRA 4IS3A 1HDZA 1DO8A 1AGNA 4UUPA 4CM3A 1Q7CA 1B16A 4XKJA 4EDFA 4Q3DA 2Q1WA 3KLMX 2AW5A 4GMFA 3HUDA 1I8TA 3DHNA 1ONNA 4IDCA 3F4LA 3IQDB 4CUKA 4HNGA 2Q1TA 2HJRA 2HMUA 3ROMA 4TZKA 2FWMX 5EQFA 2YDYA 3GFGA 3HG7A 2D59A 1IPFA 2J5RA 4A5OA 5C7OO 1D1SA 3UUWA 1Z82A 4IUYA 4RDIA 4YWJA 3H5AA 1QV6A 1WMBA 3PTZA 5EJ2A 4CLEA 2BELA 2C7GA 2ET6A 1KY4A 3E82A 2GNAA 4UEKA 5K6AA 1LSOA 3WWZA 3KOUA 2VZ9A 4M86A 1LLQA 3A9WA 4BMSA 5JYEA 2DM6A 5K9ZA 4GH5A 3GEDA 1BXGB 1HE2A 2W2KB 4IJWA 4BNTA 1E92A 2AQHA 3KLPX 1CYDA 1IOLA 1DIGA 1ISMA 3H65A 1HDRA 1P33A 3FCOA 2HRZA 3R0IA 2OBNA 4E31A 4BMVA 3FWZA 4GQAA 2Y99A 3IKTA 2E82A 1XU7A 4FFPA 2QIOA 4PLHA 1LLUA 4B3HA 1CQJA 2BGLA 4HX5A 4CQLA 1LU9A 1Q7GA 3OJEA 4E2XA 4JQCA 2X22A 2X23A 4PLZA 4N5LA 2Y66A 3LSYA 5IZCC 4RPKA 1X1EA 2DBQA 5HTOA 1HKUA 3DBLA 5C5IA 1PGJA 2CZCA 1P74A 1PQUA 2GN6A 3TZKA 4CODB 5A3JA 2XPCA 3WMWA 3DMTC 3OJ0A 3ITKA 4IZIA 5JS6A 2FSSA 3GPDG 1YOVA 3FR8A 1BVUA 4O0LA 5AYVA 3ZWMA 5ICSA 3QWHA 4NMHA 1H5QA 2P9CA 4J16A 4S1VA 3I6QA 3LC1O 4JLWA 3FI9A 4GKVA 2QRLA 5G0SA 3TQHA 3ULKA 4IDAA 4DA9A 3E9MA 3ANNA 5BQFA 2ZQZA 3SXPA 1VE9A 1F8GA 3RKRA 4FIZA 1NR7A 3VPFA 1H94A 1A72A 3BMQA 1K2WA 1LI4A 3WS7A 1WZEA 1TVEA 2AQ8A 4OMUA 1KEPA 1MC5A 5ILGA 5BSEA 3BHMA 5JXWA 2FR8A 1XYGA 3KYCA 3JQGB 2X58A 4HFRA 1QV7A 2PH5A 1I3LA 2JFGA 3ONDA 3ZHBA 2WE8A 4AJ4A 4WCFC 4ZQFA 5IG2A 1FMCA 3FTPA 5B4VA 5KTKA 4IPTA 4DBVO 4BNLA 1GUZA 1HE4A 3GEGA 3PFWO 4KUHA 1VI2A 4II2A 5B4UA 1YDEA 1DLJA 2VYNA 1KC3A 1BVRA 4ZJUA 4NU5A 1HYEA 3AY6A 1NAIA 1RM5A 3R6DA 3QY9A 4DYDA 4NBWA 4HP8A 2Y0EA 4URFA 1OZAA 3COSA 2YHUA 5HA5A 5KJEA 1U2GA 1JDJA 3GHYA 4BO5A 1DOHA 4BKUA 5JNLA 4Z0PA 4H15A 2HU2A 3FNGA 4BL5A 5A9RA 1YVEI 3HZZA 3UCEA 3EYWA 3UF0A 1ADGA 2BH9A 2EJWA 2H1SA 1NYTA 4I9NA 5BT9A 1YBAA 3GLQA 1MV8A 4BO2A 3ZU2A 2OP1A 3WYEA 3GDOA 1I3MA 3VAZA 4HWKA 4AL4A 1ID1A 1PR9A 1NNUA 1FF9A 1GZ3A 5DULA 4Y67A 1ISGA 3VH4A 4XWYA 3E8XA 3UCFA 2X86A 3DZBA 4WEOA 5LDHA 4GWKA 1ZIDA 2RHRA 1NWCA 3LLVA 3DFZA 4PFJA 4N7RA 4LVCA 3RUHA 4CMHA 4RF5A 2D8AA 2QG4A 1DFHA 1HDYA 2R00A 4BGUA 4MP3A 4E4YA 4PVDA 3PDUA 4NG5A 2VQ3A 3S2IA 3JQ8A 3PWSA 1GEEA 4AVYA 4JBHA 1ULSA 3ENNA 1E3EA 4D3SA 1JVSA 2O23A 2EXXA 4MP6A 1HYGA 1I36A 2V6GA 1DB3A 5L40A 4WCFB 1WDMA 1Y6JA 4OSPA 1I2CA 2D5CA 4NFSA 1EFLA 1JW9B 1W4ZA 1XQ6A 4JJFA 4QECA 3WFIA 3WOHA 5JC8A 1NP3A 1HLDA 1NQ5A 3F1LA 1I2ZA 1PS8A 2OORA 3MJEA 3CXRA 3DR3A 4FFRA 3CH6A 4ZQBA 4NBTA 3GDFA 4RVSA 1LDNA 3F5SA 1LRKA 1XIVA 1B3RA 3OJLA 1B8UA 4ZRMA 2NVBA 4OYRA 1S6YA 1A71A 2PKQP 1QLJA 1R12A 3ENKA 4W7HA 4QSMA 4WKGA 2W2KA 4EI2A 5LCXA 2EEZA 1X7GA 4TWRA 2WD7B 3K6JA 3PWZA 4CM4B 3ADPA 7MDHA 1IE3A 3PYXA 1RKXA 4O59O 4J4HA 1XSEA 2JFHA 4CM7A 1HDCA 5TS3A 3K8ZA 4J3FA 4RL6A 2B83A 1YWGO 3D4NA 1I33A 2JKVA 1Z7BA 3E6AA 2WYWA 3EGOA 1R0LA 2H63A 3IS3A 3E48A 4CMIB 2JAPA 5DT9A 3S2FA 1GY8A 4BNMA 4FC6A 2CD9A 2PZLA 2XAAA 5CPFA 1L1FA 2QZ9A 1E6EA 1DIAA 2GLXA 1P0FA 4MIOA 4XYBA 3P7MA 5BSHA 4A27A 4NK5A 2HUNA 3PVZA 4RZIA 4RPHA 4E32A 5I7SA 4KDFA 4PN3A 4DYVA 1CWUA 3GR6A 4R1TA 4PZCA 4B4OA 1K5HA 3FR7A 4YA6A 4A7PA 3PJDA 3WB9A 2JCYA 3U4IA 5BR7A 4TQGA 4IJUA 1GYRA 1EVIA 1U7HA 2DBVO 2PZJA 3QWFA 4OXKA 1X7DA 4DPMA 1YJQA 3KXDA 4Q3BA 3M2TA 3PGJA 4KOAA 3WGGA 1NHWA 1R4NB 2GDZA 4NH4A 4RZHA 2W4QA 1ARZA 5JSFA 3VTFA 1SB9A 2CUKA 3MJTA 3BMOB 5C37A 4QO7A 4IZHA 2HRBA 3HE3A 4QQRA 1GADO 1MP0A 2X1HA 2P91A 4DIFA 2RH8A 2FPGA 1U8FO 1BTOA 2QX7A 4IDGA 5JYDA 3V1TC 3PP8A 4XGNA 2DC1A 4Q39A 1E1KA 4UUNA 1ZMOA 5G2OA 5THQA 3HNPA 3PHGA 4DMLA 2ZTUA 1E1LA 1YXMA 2OBYA 1MG0A 4JIGA 4R54A 5EESA 5JY1A 1E7RA 1ENOA 1M66A 2JD0A 2GERA 4DIBA 1QMGA 4GLLA 4RV9A 3WGZA 4BNXA 1X13A 3EVTA 1RM0A 4Z3KA 5KVCA 5IZCA 1SEVA 3WIDA 2VWQA 4ND1A 3IKVA 1U5CA 4I5GA 1PJ4A 3WNVA 4F45A 1DFGA 5I9LA 1J5PA 1LNQA 1NXQA 4LRSB 3GGOA 4MVJM 3VPGA 1GEGA 1IYZA 1HLPA 1HZJA 4YAKA 1UXHA 4PRKA 5I7FA 4TVBA 4HXYA 3U62A 3GGGA 2IZZA 1E7QA 3MTJA 1JQBA 1PJTA 5EPOA 4JJGA 2GUGA 4CR7A 5A02A 1N5DA 3GAZA 4XB1A 3QRWA 1AXGA 4J2HA 2RCYA 3ST7A 1U4OA 4XQCA 4K1LA 3OMLA 4C7KA 3CEAA 3WGTA 1U9JA 2EG9A 1DC6A 5GZ3A 4XIJA 3G17A 4OKIA 1C1DA 4D7AA 5IDXA 1Z73A 4J91A 1N1GA 1O6ZA 1ENYA 1VM6A 1EVZA 3K30A 3EUWA 1ZSYA 2EKLA 4OHUA 5DCWA 4JP2A 1DRVA 2WWRA 3PI7A 1RM4A 1R0SA 3ZV4A 4E5PA 3DBHA 4LCEA 2DPHA 1JKJA 2Y67A 3RFTA 2VCYA 1O9BA 3RJ9A 4WCFA 1GU7A 4O63O 1GDHA 3WXBA 5AQ1A 4MINA 3NJ4A 1TLTA 1YBMA 5EIOA 1XLTA 4IXTA 5H81A 1NFRA 4B8WA 5CEFA 4XDYA 4BB6A 4ALIA 3B20A 3TNLA 1SCUA 5ILOA 4DPLA 3RVDA 2YYYA 4R5MA 3UHAA 1ONPA 2FRDA 3PQDA 2EIHA 1O95A 1E6UA 4NNJA 4FR5A 1PL8A 4AJ2A 2HK8A 3MOIA 3GDGA 2FSVA 5J23A 2BFMA 5I9MA 4AFNA 2ZTLA 3NTQA 4R41A 2VYVD 2OUIA 1LDMA 3WFJA 1ISJA 1PWXA 4GPD1 5DP2A 3TOXA 4BO3A 3VZRA 3VDRA 1Z6ZA 5KJCA 3ABIA 3NRCA 2RHCA 5CEEA 2WD7A 4HY3A 1I01A 3DOOA 4Y6PA 4C4OA 4CUJA 2VHWA 1ZEJA 1Y9EA 2O3QA 4RVFA 1DDOA 4W99A 3ZWVA 1XQ1A 2BD0A 2GN8A 2QQ5A 2J3KA 3ZZNA 4AJ1A 1QLHA 4XYLA 3C3XA 2X9NA 3T7CA 4I08A 1KVRA 4NK4A 3NX4A 3RU7A 4CQMA 4DREA 2X0IA 3OECA 3E03A 2NQTA 1QP8A 1GYPA 3PQFA 2LDBA 1FK8A 4UAGA 4IJKA 5DOVA 3KSDO 5BNIA 2O50A 4W6ZA 2FR0A 4E6PA 3DONA 4PLTA 1WP4A 4BNNA 3DZHA 5THKA 4CLRB 5FFFA 1ZBQA 1FDVA 4YB8A 3ZV5A 3SBOA 5G0TA 5C7IO 4FBGA 3L4SO 5KJFA 1XDWA 3P5SA 1NFQA 1GV0A 3KVOA 4F6CA 1Y8QB 4BMNA 3PK0A 4H3VA 4P22A 3GVHA 3FPLA 1CETA 1DRWA 1W0CA 1YO6A 3W4IA 4EUEA 3HN7A 3OETA 2DQ4A 3TFQA 1HTBA 3OJFA 2XXBA 1A7KA 3GUCA 1PJ3A 2C20A 3BMOA 4J9VA 2JHFA 3KV3O 2D3TA 2WSBA 3I9KA 3A1NA 3V8BA 4EUHA 2HMVA 4CM9A 3ZNOA 4DLBA 4PZDA 4UEOA 5F1OA 3ZWOA 4BNFA 3QWBA 4MVJD 3D3WA 5EL0A 3UVEA 4HFNA 2Q2VA 1SNYA 3C7AA 3HB5X 3VH3A 4OM8A 2JCVA 3I6IA 4WEQA 4D79A 1PJLA 4XYEA 1K89A 2NLOA 1B8PA 1E7MA 3EZYA 1LC3A 4D45A 2HK9A 1D3AA 2I9PA 1LRLA 2DKNA 1TEHA 2PTGA 3DL2A 4LCJA 4ALJA 4CPDA 1I2BA 3U9LA 3ZH2A 5B12A 2OHXA 4ALNA 4YTEA 3WLFA 1V3VA 3RQSA 1A9ZA 2C59A 2YDXA 3ZV3A 3LVFO 1U3WA 4DQXA 2RAFA 3EHEA 4CLOA 4IQ0A 2R00C 3SC6A 1NR1A 4ROSA 5BNTA 3BMQB 4CJXA 1AHHA 1H2BA 4RF3A 3Q9UA 4IDDA 3DDNA 4NI5A 1U8XX 2NU6A 4KTTE 2CDBA 1BDMA 4D41A 1HWYA 5HS6A 3MZ0A 4RF4A 3KYCB 1H6DA 4INAA 1CERA 4GX0A 2RBEA 2J3HA 3BTSA 4IY1A 4JJIA 5AVOA 4BO6A 2Y1DA 3V1YA 3JYLA 2GYYA 3HB4X 3VPSA 1TI7A 5KJ1A 5JAZA 2NNLD 2BLLA 3WLEA 1GPJA 5IFLA 2YY7A 4IDFA 2AE1A 2W98A 4MKZA 3WG9A 4R4JA 1OI7A 1Z74A 3GPIA 4J0EA 4CL8A 2FY8A 3BMCB 4DC1A 4M89A 2WTBA 2VNSA 1T4BA 4HUJA 3OJOA 3QSGA 3U4DA 3JYQA 4W9NA 1MA0A 3JCZA 1GQYA 3SLKA 1DRUA 2GO1A 2YQ4A 4YAEA 3QVSA 5L45A 5L4SA 4BNVA 3AOGA 3U09A 3OIGA 4TKLA 5TF4A 1VL6A 4CV0A 1B26A 1A4IA 2E49A 4L0QA 3NT4A 5TT1A 3RC9A 1QORA 5DBGA 1VSUA 1P0CA 1YL5A 3WNQA 1MX3A 2D5AA 2Q99A 3Q3CA 2X9VA 1E3WA 2O2YA 3RUEA 5FI5A 2GZ1A 1YQXA 1UJMA 3ETEA 4CR8A 4OO3A 3W8EA 3TPCA 2HJSA 4RQUA 4WPGA 5T64A 3I9MA 3O8QB 3WSVA 4KTVE 3IP3A 4WLVA 1B3BA 4IJVA 3LDHA 4UVDA 4PG8A 1XG5A 2HQ1A 3JQDA 4FOOA 4B3IA 3EC7A 2VRBA 1LUAA 3I4CA 1WDLA 3L6OO 1NVMB 1YE3A 4AJLA 4Z3DA 2PR2A 1V35A 2ZTMA 2Y68A 3OA2A 1EQ2A 3ON5A 3C8MA 4F3YA 5G0WA 2XOXA 3SEFA 2DBRA 3ZU5A 4D3FA 4WK6A 1T1RA 1AHIA 2DTXA 3LLSA 5KKAA 1UXIA 2O2SA 3DHYA 4JN6B 3P19A 2UYYA 1T1SA 2PD3A 3DBVO 1GQQA 3BMNA 5F1KA 3U0BA 4BO9A 2H5LA 1M6HA 2GRAA 4RVUA 2NADA 3GOHA 1K6JA 3VKVA 5HRUA 3MCVA 1I32A 2NVWA 3AM4A 1HF3A 2Q4EA 1Y1PA 4FGSA 2PKQO 3M1LA 2ZKLA 2HMTA 4RJTA 3HDYA 3TZ6A 4CLRA 1NWHA 2WM3A 3ITDA 2VRCD 1OC2A 4MO2A 4Z0HO 1OAAA 3B1JA 4GL4A 1JTVA 2NV6A 4YRDA 1WZIA 3EY4A 1WWKA 1VLLA 1JA9A 1Y8QA 1C0PA 1VJTA 2O7QA 3ONEA 3W4KA 1WMAA 2BHLA 3DZJA 4YDRA 2EJVA 5JE8A 4HFJA 4G65A 3OSUA 2I3GA 2I5PO 4PG5A 4CL3A 4D43A 1NPTO 2ZB4A 5TJ9A 5FI3A 4S3MA 3D5TA 5EN4A 4PVCA 1I0ZA 1CIVA 1D7OA 1J0XO 2FMUA 4ND4A 3BZUA 5JDCA 3WGIA 2F1KA 4EZBA 2DUUA 3AY3A 1T2DA 3CKYA 3JYPA 1XKQA 3JQBA 2D0IA 4FFLA 1QG6A 3ONFA 5TLSA 3R1IA 3QV1A 3GFBA 2WDZA 1W6UA 4U5QA 1JKIA 1UP7A 4PIVA 1H2HA 3RBZA 1LXCA 3WTBA 5HM8A 4MKXA 1B7GO 4DPKA 3QVOA 3STHA 3VH1A 4ND5A 4A0SA 1UR5A 3T4XA 5CDUA 4CM5A 4RPGA 3SLGA 1T2FA 5CEJA 5IAAA 2Z1MA 3ADOA 4MVJF 1A27A 4OSOA 2BFOA 3HSKA 3LYLA 1JWAB 2PGDA 1HEUA 1ZJZA 2I65A 3H9EO 4GX5A 2CVOA 6ADHA 4AJNA 3B70A 1A7AA 4FFOA 5L4LA 3AI1A 5DOZA 1YQGA 4FW8A 5L7TA 5F5LA 1I30A 3WBBA 2NU9A 4YT8A 1ZEMA 1YDWA 4J7UA 2Y93A 3OQ6A 4IMPA 5JCJA 5JAIA 3LC7O 3E18A 3NJ8A 3ZW8A 2G76A 1FDWA 1MFZA 4GX2A 5TIIA 3BMCA 2VHZA 5HS4A 2P5UA 3UFXA 2YW9A 2IYPA 1R15A 2W8ZA 4XR4A 1NQOA 1KVTA 1OFGA 1ADCA 3OEYA 3C24A 4C7JA 5FF9A 1P1HA 1HSZA 5A9SB 3FRJA 3C1AA 3R3JA 5F1PA 1PWZA 1I24A 2X0JA 1BMDA 2AMFA 1JAXA 2AQIA 5CHEA 5DBIA 4M8SA 4BGEA 3LQFA 3A14A 5K0ZA 5IJZA 8LDHA 1E3JA 1UAYA 3OHSX 4JCOA 4CMCA 3PDJA 4R51A 4ALLA 4A10A 4CMJA 4D42A 3K96A 3O8QA 4IINA 5A06A 4K26A 4PLPA 4YJGA 4NDNE 1JKFA 4EUFA 3PGXA 5A4DA 5IXYA 5U4QA 3O03A 4TSKA 5G0VA 3F46A 1C1DB 1MG5A 1LX6A 1T26A 3CZRA 1HZZA 2ZYAA 5CFZA 3IOYA 3O9ZA 2HMSA 3JYNA 3AU9A 3TSCA 3WGYA 1Q2XA 3DBHB 3JQAB 1E5LA 4XGKA 5COQA 3FPCA 2POQX 3OF2A 2B35A 4R3WA 3NTRA 3ZDFA 2DU8A 2VUSA 2NWQA 4WLFA 1DPGA 1ZXBA 4XQEA 3C85A 2IODA 3D4PA 2AEFA 3CMMA 5KCZA 4AJJA 4ZQGA 4BKQA 4LGVA 4CM1A 3INRA 2J3IA 4BQPA 1HETA 3LT0A 4YACA 2O3SA 3OFSA 1LJ8A 3NT5A 2A35A 3PQEA 4DL9A 2AEMA 3OH8A 1LTHR 3H6KA 2DFDA 3BXXA 4AICA 3Q1LA 4CUZA 4WASA 4YAIA 5L9AA 4ALKA 4FOSA 3GRPA 5I7VA 1GD1O 4AJHA 3TL2A 2VWPA 1K3TA 1RYEA 3D5QA 1U28A 3CZMA 1PZFA 3LF2A 4BKOA 3PYLA 3CMCO 4ZQEA 1H93A 2E6UX 2BI8A 3FNEA 3DOCA 4RPLA 3RD5A 3GN1A 1R37A 1ZJYA 5JDIC 1LLDA 5A9TA 2X6TA 4EITA 3JQ7B 4IIVA 1GCUA 1HT0A 4MVJI 2J5KA 3L6EA 1QKIA 3QHAA 1IZ9A 3AUUA 4CM8A 2QW8A 3DHEA 3NEPX 1KVUA 1MB4A 2CVQA 3MWEB 4CQMB 2HCTA 1PJQA 3S2GA 2A4KA 1HRDA 4XRGA 2BI7A 4IDEA 1GZ4A 2QHXA 3I52A 3LC2O 4I5EA 4B4WA 1DC3A 3OQ1A 1OOEA 2NTJA 3ZHXA 3UCXA 4KWHA 1XEAA 1PJ2A 2Q2QA 4GBJA 3UN1A 5LDGA 2A9FA 2VWGA 1G0OA 3N74A 4CMGA 1DSSG 1NHGA 1GTMA 4YRAA 1QSGA 4NJMB 3EW7A 1XA0A 2FHSA 3AOEC 3JD0A 2Q45A 2I99A 4YVFA 3ASUA 3PIIA 4JGBA 4CMBA 3LU1A 1ZK3A 1LSUA 3RBVA 2C5AA 3RJ5A 1E6WA 2YV1A 4LMRA 1LDBA 3DZKA 2ZIZA 3S2EA 4BVAA 4UREA 3F9IA 1SBYA 3IC5A 3PLRA 5CDTA 2X0NA 2F00A 1C0LA 2G17A 5COAA 3DZFA 1O89A 2P5YA 4W9NC 2P4QA 1G0NA 2ILTA 2JAHA 3QIVA 4R1UA 4TRRA 4XYMA 5AOVA 1DIRA 2EKQA 2UUOA 4YT2A 5JW6A 5JCXA 3DO5A 2ZJ0A 4NU6A 2CSUA 5EQDA 3W6ZA 3D3WB 2HDHA 3PFFA 4MKRA 4O5OA 1H0KA 1KERA 3ZV6A 4K6FA 2WE7A 3NYWA 1SEPA 4R69A 1E7YA 4ZQHA 1C1XB 1IULA 1H6BA 2D4AA 2JHGA 5KVSA 4E5MA 4XJSA 3KUXA 1R16A 2J6IA 4O6VA 4AJEA 1XGKA 2ZK7A 4QUKA 3DAPA 4M1QA 2C54A 3DXFA 4WNIA 1GV1A 4EEXA 4TRMA 4W82A 2OOSA 3KO8A 4NQZA 1N9GB 5A9SA 1M75A 1ZW1A 2BGKA 4XR9A 3LT2A 3KZVA 4E21A 3X2EA 4CLOB 5MDHA 2Q49A 3WWYA 1VRWA 2CFCA 4Y6RA 4IGEA 3AK4A 1PZEA 4GWGA 4TRJA 3CPSA 1C3VA 1MXHA 2UAGA 2W90A 3PIDA 1D1TA 4YJDA 3ZI0A 5GY7A 5TGDA 5JY6A 2C0CA 4CV3A 3GVPA 1P1FA 5DP1A 2C07A 2OGUA 2I76A 4RVHA 3GA0A 1C14A 4M55A 4XX0A 1Z7EA 2B5WA 4ZN6A 3QWAA 1K6IA 3D4OA 1DAOA 1ZK2A 4J43A 4ITUA 4J7CA 3JD4A 4LSWA 2Y1CA 3E9QA 3TF5A 2H6EA 4U6QA 1A4UA 3ZWBA 5ADHA 3UW3A 4FQ8A 2Q1UA 2VWHA 1GPDG 3AFNA 1BSVA 4QFCA 1HYHA 4WE3A 4B7XA 1TXGA 4J1QA 3ZU4A 1X0XA 5KWEA 1E1NA 5I8WA 1N1EA 3DZIA 1LDYA 3AJRA 3QWIA 2GZ2A 4JBGA 4A2CA 2YFHA 1PJBA 3JQAA 3WYBA 2VOJA 3S55A 2B4QA 3IUPA 5ENDA 4TMFA 3G79A 4YBZA 3QQPA 2DBZA 3ZWXA 2V7PA 2AXQA 3FSRA 3OM9A 1ZK4A 1BGVA 2V65A 2VTDA 3RFVA 1KBZA 2GSDA 3ZW9A 1V3UA 3KRTA 4DLAA 5GZ1A 2PZKA 1E3WB 3PLNA 3LT1A 1HDGO 3H5RA 2IE0A 5CDYA 3CINA 1RPNA 1LSSA 3N58A 4F6LA 1GCOA 2DFVA 3MJSA 3BA1A 4QFDA 4FFMA 4OOEA 2WYVA 1I5RA 3EMKA 3M6IA 2GN4A 3WJ7A 3I23A 3MJ4A 4OQYA 2I66A 4G2NA 3AW9A 2Z1NA 1PGPA 2ZCVA 5JDCC 3RWBA 1L7EA 3CUKA 1KY5A 3FNFA 1VC2A 4LISA 1ZVMA 2X0RA 5T6BA 5JMWA 2B0JA 3HJAA 2HSDA 4ONEA 2ZATA 5L3ZA 5TSDA 3ZWNA 2G82A 5JAQA 3TN7A 1P1JA 3JQBC 3OBBA 3B6ZA 1ZCJA 3U3XA 2IZ1A 2B69A 2FP4A 1GYQA 3JQ7A 4Q3AA 1PGOA 2PKRA 4Y6SA 5L7WA 3I1JA 4H16A 1A9YA 3TWOA 3VPXA 4E12A 4Q9NA 3CTMA 1ADFA 2NACA 3F5QA 3BMNB 2DPGA 3VPHA 3CE6A 3JQ9A 1UP4A 4MOWA 1Z45A 2VYND 4EEZA 2OXIA 1QR6A 1ZH8A 4E13A 3E5RA 4BNKA 1AUPA 2EF1A 1DBVO 4K9DA 4BNJA 3HDQA 4ID9A 1ZSVA 4LRTB 3FD8A 2HLPA 2ZB7A 2GD1O 4XEHA 4D0SA 3EDMA 5AXCA 4BO7A 1MXFA 4I9HA 4RLSA 4KMSA 4NJMA 3RAJA 1F12A 3GY0A 4L8VA 3HHPA 1MGOA 5KJ6A 4FD3A 1YGYA 1T2AA 4KDEA 3HFGA 3EZLA 2GR9A 2ZYGA 1VL0A 2WJPA 4AJPA 4EJMA 3RC1A 3H9JA 3NTOA 1DJQA 2QYTA 1R4MB 1H6AA 2X5JO 1O5IA 3OICA 1VL8A 4II3A 1MC4A 1E3SA 3TZQA 3GEMA 1B14A 2B37A 3QP9A 2B4RO 4M54A 4WUVA 3AU8A 4O1MA 2YV3A 4E2WA 1J6UA 1L7DA 3F6YA 1DIHA 1W73A 1C1XA 5ER6A 5GMOA 1ZKMA 5T8KC 4GKBA 4YJHB 3EK2A 4J1NA 4UUMA 4NBVA 3BYZA 1EUDA 2EERA 5ITWA 5JDIA 3ROQA 4XYGA 4ND2A 1ORRA 1SPXA 1X14A 3PHHA 2PZMA 2CMDA 3X2FA 5JC1A 4BO8A 3NKLA 2ZCUA 1ENPA 2GASA 1N9GA 4BNUA 4CMAA 5IDQA 1YBVA 4P38A 3GGPA 3A06A 2EHDA 3ASVA 4N5MA 1M2WA 2X4GA 4B3JA 3JYOA 2J5QA 3RI3A 4RO0A 2I67A 3LF1A 3INGA 4PG4A 4LK3A 5L7YA 1ZK1A 2YJZA 4YAGA 3IL2A 1IHXA 1T4DA 3ICCA 3KM0A 4YYZA 4BGVA 3PJFA 4OOFA 1P31A 5IF3A 1LA2A 3AUAA 3RUDA 2NVUB 3GQVA 3CSDA 2BFAA 2W2LA 4PLFA 4ZRNA 3DMYA 2UV8A 3W6UA 4PLGA 5G4KA 3AOEA 2B4TO 3I9LA 4KQXA 1NQAO 4E30A 1VPDA 4YXFA 4CV1A 1H6CA 2HK7A 3GVIA 4XCVA 2PD4A 5CG2A 3DOJA 4ZA2A 1F0YA 2QZZA 5BSGA 3OIFA 3M2PA 3W8DA 4NBRA 6LDHA 4GGOA 3C7CB 4L73A 5DCUA 1FDTA 2Q46A 3HWRA 3IAHA 3WJAA 4DMMA 1P44A 1Y81A 3VZSA 1YS4A 3IIEA 4BV9A 3OEWA 3U5TA 3JQ6A 3JV7A 1VKOA 4R68A 3D0OA 1FJHA 5CDSA 3NDRA 2AQKA 3GG2A 4PLYA 3P2YA 2R6JA 2NM0A 3R3SA 4OKNA 2IXBA 1ENZA 4DBZA 2AE2A 1PZGA 1Z75A 4IQ8A 4M49A 3CIFA 3C7DB 4FFNA 1JU9A 1GUYA 4RGBA 4U0JA 1LQUA 2AG5A 1DAPA 3WICA 1KETA 1RYDA 3ZWWA 3E9NA 1DC4A 3WTCA 3AM3A 1TB4A 2D1YA 1TT7A 2OO5A 2Q2WA 4FJ0A 4KWIA 2UDPA 3HADA 4L76A 1UZNA 4FPXA 4MVJH 3TDKA 1NX6A 2DLDA 4IM7A 3H9QA 4N18A 4ZICA 5IZ4A 3RUIA 3Q0EA 2OZPA 3KYDB 5HBRA 1EEHA 2J3JA 4YJGB 4YJFA 5DDIP 3L07A 1Y8RB 4MVJG 5U1PA 9LDTA 3OQBA 3RASA 4BO0A 4YRBA 1R66A 2Y1OA 3K31A 4GI2A 3TFOA 1LSJA 2DAPA 1ULUA 4JBIA 1PGNA 3NGLA 1D4FA 1OC4A 1ZXLA 4RQTA 2TMGA 3D64A 2RIRA 4AG3A 3ROPA 1B0AA 5KVQA 5I9NA 2PA3A 4Q3NA 1N8KA 1U1IA 5G0UA 5IN4A 1KEUA 2ZB8A 3KB6A 1HDXA 1T25A 2LDXA 2VZ8A 4CLXA 4JNKA 1BRMA 2BRUA 3FN4A 3WX0A 1Y5RA 1YKFA 3G3EA 3KHUA 2JFFA 2O4UX 5CDGA 2DTEA 4LSMA 3GNSA 3MJVA 3L77A 3ANLA 2V6MA 3BHJA 3BAZA 1X0VA 5DZSA 5GZ6A 1D8AA 2O3RA 1PJCA 3VHRA 2P4HX 4D0RA 1E3LA 1DFIA 1UH5A 2PNFA 4DC0A 3BTUA 1WDKA 5IXSA 2DT5A 4J4TA 5A3VA 3RUFA 1KEVA 1EQUA 3P2OA 4Z9YA 3G49A 2I6TA 5EMHA 9LDBA 3RC2A 4FS3A 1AE1A 1DEHA 3VVCA 3WYCA 1BXZA 2ZB3A 4PLWA 4Y8VA 4R16A 3EVNA 1F06A 3INTA 5JMPA 3I83A 1VSVA 4XJTA 3L9WA 1NPDA 3V2HA 4NHEA 3U4HA 1R4MA 2B5VA 2B36A 1DC5A 3I9JA 1QYXA 3ICPA 5CAEA 4CM8B 2SCUA 4IQGA 4Z9XA 4B7CA 4GMGA 3GC6A 4CLDA 1UDBA 3GVCA 4CMEC 1EE2A 1GZ6A 4AJIA 1HE5A 1KS9A 3H7AA 3UICA 3V1UA 1LDEA 1J49A 1DLIA 3DZGA 1U3TA 4YJHA 5LC1A 5ICMA 2PK3A 2O4CA 2V6FA 3GHHA 2BMAA 4NFYA 3UXYA 1F17A 3WR5A 1E0DA 2O3UA 1YJ8A 3JQAD 4L4RA 4Q3CA 4HV4A 4FN4A 1PX0A 1Q0HA 1VKNA 2UUPA 1BG6A 2G5CA 1NASA 2Q4BA 3ZU3A 4OGWA 2FZWA 1UZLA 3H2SA 3I3OA 3K2BA 3LT4A 5EERA 3VOSA 1PR3A 3GK3A 2Y1FA 5F21A 4ZGWA 4XQ9A 2Q3EA 4NIMA 1SOVA 2P2SA 1WXDA 3PHIA 3C1TA 1UDCA 1W8DA 3WSWA 4MIEA 5TT0A 3KYBA 4UVHA 4CMKA 3S8MA 4J1SA 3H4VA 2BGMA 4J4BA 1PS9A 4YCAA 3F3SA 1PL7A 1ML3A 4J7XA 4QX6A 4K6CA 4Z0TA 3UGKA 5H82A 3D7LA 4DWVA 1BW9A 4BOYA 4F46A 2VUTA 2NVUA 1PZHA 2Y0CA 5FYDA 3WBFA 5MGBA 3PPIA 2C5EA 4U0KA 3B1KA 3HFSA 2FR1A 4N5NA 3ZWYA 2WYUA 2FOIA 4PG6A 4CR6A 4MJLA 2VYVA 4DVJA 2E37A 5FEUA 4YR9A 1AXEA 5IN5A 4L4XA 3VTZA 1FDSA 4NFHA 2ZQYA 1R6DA 5A05A 2XXJA 4OXNA 4U8GA 4XRRA 2XF8A 3LZ6A 4IBOA 4FB5A 1YB4A 3KTDA 4UUOA 4BNIA 3Q11A 4GVXA 4B8ZA 2IEDA 1PQWA 1CF2O 2VOEA 3ETDA 4NBUA 4CLHA 2C2YA 4ND3A
chains in the Genus database with same CATH superfamily
1W35A 5THXA 5JO0A 2YHBA 4F9FA 2C82A 3FDFA 1F2DA 2O5VA 2CC2A 2IEIA 4P08A 1WB6A 4YQYA 1KAMA 4JP1A 5DI3A 4AWBA 4QODA 3THOA 5A1JA 3EGXA 1QYDA 2PVCA 4UUQA 4IHKA 1UODA 5KYWA 2VPTA 5I6DA 1M0EA 1K9VF 3RCBA 1JN0A 3DDUA 1YR7A 3LCJA 5JO9A 3WA7A 3CNQS 2P40A 2VF4X 4IIUA 5AHWA 5AW8A 1ONOA 1QIDA 2B61A 3LRPA 4O4HB 4OIMA 2CNWD 3FVWA 2YV5A 3GRRA 4TZTA 5CBKA 3VYWA 1G1MA 3H13A 1KTVA 3OZGA 2HWKA 4DJ5X 5FCDA 2W6IA 3QBTA 4FIDA 1U5BA 2YHIB 1F8YA 3LGXA 4IWXA 4YT5A 5J5CA 4BUZA 1C5KA 1DHTA 1ZW6A 4GMHA 3RF7A 1E5QA 2X41A 1F7VA 2W5UA 4XLZA 5IMBA 1ISIA 2AXNA 1SBTA 4BC0A 4ZIRB 4DA4A 4C3VA 3E1SA 4BNZA 3FHLA 2VDKB 3UHPA 4BMZA 2A0WA 1OFHA 3ECSA 5KNBH 1LVUA 3FRIA 4ZKEA 1GSHA 3GPBA 1V9LA 2ORVA 3NPMA 2ZW9A 1J24A 1L4EA 4J49A 3TSZA 4MQ5A 4CM9D 2V7QD 5DTJA 2C83A 2FX5A 2O8NA 2OYSA 4QQFA 4XLTA 5FT9A 1U3VA 1P1IA 2VT2A 3DXXA 1KZ7B 3QE3A 4G5RA 4JUCA 1X1BA 5DWVA 5MN4A 1Q7BA 2HHCA 1DIBA 4QNRA 3TRDA 3X1DA 4ZGGA 3QEJA 1N2ZA 2E4VA 2PV7A 3E70C 3G2JA 1FDUA 4MVJA 1W34A 4E0BA 5IX8A 1X80A 4W4TA 1UPCA 2P62A 3VDQA 2DR2A 1OWPA 1Q83A 4C30A 1PFVA 3W8FA 2Y0DA 3ZS9A 1K6XA 3ZK8A 3IE0A 1IHYA 2WFZA 3MM4A 3UKOA 2H7XA 2X14A 2VDRB 5EKSA 4O02B 4IEIA 4J6FA 2AJ8A 4D74A 5BURA 4F7WA 4L15A 4P3NA 4DEVA 1S2GA 2FWIA 3FNHA 3SS8A 1XALA 2ZIEA 1G6KA 4LTDA 5KYTA 3E84A 3KSZO 4FWIB 4DCVA 4EPVA 2GEKA 4HZIA 2I6QA 2CEAA 1UWKA 5F5XA 2IA5A 2CYAA 3MF4A 5KYYB 1JHVA 2RK4A 1K88A 1W96A 1Y5IA 2YJ5A 2ZR8A 3KPUA 4P93A 2PBLA 3PUJA 3UAOA 3RKUA 4BKPA 1KTIA 1GRRA 3Q2IA 2D2FA 1N4AA 1II9A 1ODLA 4B2IA 3IBGA 3JY6A 3OPVA 2VDJA 1WCIB 2Q4DA 3GNQA 1DWOA 2PGJA 3ESXA 2C4VA 4IH4A 4TWZA 5DHFA 4ZQIA 4XSHA 5ALGA 2P3LA 2M6KA 4XZ3A 4A8TA 2NSDA 2J1LA 5HK8A 1TTQB 2QSJA 2JIQA 3S1LA 4BBZA 4CIDA 3ZPXA 1N92A 2BR5A 4TV8A 2P0AA 1IG3A 2Y1KA 5FBHA 1YR6A 4QYXA 3B1ZA 2EBWA 4C4RA 3BDAA 4DVGA 1FEZA 2PX5A 2Z8YA 3KELA 1V5GA 4P92A 3U7GA 1II8A 3QJ5A 1AK9A 3IVXA 4R0VA 5CGZA 1R5BA 4J0DA 3HPRA 5TGZA 4AKHA 2OL4A 4GHWA 5KKCA 1DL5A 3ZHYA 4QJBA 5C2JB 4RQAA 3L1KA 4U6SA 5JJLA 4K9MA 1S4QA 1RXCA 1PEKE 1RE1A 3CG0A 2F3UA 3PXEA 4LQDA 5T4HA 3I9V1 1DG9A 1JLLA 1K4MA 1ZH0A 1QC5A 2AN5A 2MDTA 3HJUA 4QASA 2JIOA 1AMUA 3EFHA 1RQPA 5K0BA 4KPUB 5CG1A 2HNBA 2ZPTX 3WYDA 3KTOA 2OSVA 2HWXA 4G0OA 3S2UA 2V7GA 3C3BA 4CRWB 1GXSA 3SBDA 1HFJA 4YO8A 1V5WA 1DJNA 4Y1FA 4YT4A 1IUKA 4Z0NA 5DYNA 1GN9A 4YLEA 4XWKA 2JBAA 3B1FA 3V32A 2EFHB 3RIHA 4MEJA 3QVWA 2W00A 4MRMA 1DIOB 4BIIA 5D00A 1LD3A 1DJLA 1TK2A 1K6EA 4LYGA 4G5FA 1YRLA 4LF9B 1GDDA 3I12A 5F73A 3VR2A 1GTRA 4E5YA 3Q4GA 1U6KA 1WL8A 3S2ZA 2EGGA 5TRTA 1RIFA 4F12A 2IHUA 2Y0BA 3QYJA 2KBFA 3K71B 4JLDA 4PRYA 1L7BA 5DCYA 5I4CA 1NXWA 2WKSA 1KZ1A 2OAGA 2YZ2A 4GLBA 3NZEA 1XMOB 2VQEB 3KBOA 1XHLA 1I6WA 5DF1A 4B4VA 2RDMA 3U7IA 5AXAA 1IK6A 3TTWA 1F2TA 2Z57A 4LXXA 3AUTA 3L02A 5EPEA 4NS4A 1YKSA 3F8TA 1E3DA 4AS2A 4EQZA 5A4KA 1UM9B 7ADHA 1IJEA 3A6ZA 3E7PA 3QSYA 2OV8A 4WBNA 3DDOA 2B2NA 5AESA 1GZ5A 3KKLA 5AKEA 4MQLA 4GOOD 2B20A 1UBRS 2ONZA 1O97D 5JRJA 9ATCA 1L5VA 3ENWA 4JYCA 3VJMA 1EUDB 5BSUA 4BJ1A 4O3MA 1S3SA 2HWUA 1Z0JA 1EK6A 1RIIA 4M9ZA 4HVLA 3OOYA 3JQGA 3P2MA 4MP8A 1Y33E 3PFGA 5AH0A 1CCWA 3ZVRA 3X1ZA 3UH1A 4XQ0A 3OJXA 3S70A 4ILKA 1XOIA 4UVIA 4EBFA 1QGAA 4NCJA 3RBXA 1RR6A 1NRXA 1KR2A 1SKYB 3K5HA 4C0KA 2PJDA 3G1UA 2OK8A 3HP1A 1ZFNA 2CXXA 4REMA 4WY5A 4LXTA 1T4MA 2DKOA 1UT8A 4CMEA 3ZNNA 1E5DA 1AA9A 3L4JA 1M1NB 5C8VA 3SX2A 4JB3A 5CT4A 1ZK0A 3UO8B 4GBGA 1KZ6A 1G1AA 1TM2A 3A1WA 4FC7A 3V4PB 1O0BA 2PUWA 4B7UA 4HAYA 2DCUA 3JR7A 2K2WA 3WL8A 3AM5A 3UK1A 4EW2A 3EVAA 5EIFA 4UARA 5JVDF 4MV8A 4O2BB 1L9XA 4H1TA 1ZI8A 3PDWA 5CW1A 5FL7A 5HKLA 2VRCA 4XWOA 1G9SA 4XUDA 5I9SA 4GL2A 1JI3A 3E9YA 3PXXA 4F5WA 3CVVA 2ZI4A 4B83A 5KSYA 5ALPA 4KE9A 1F8UA 3AERB 1SKAA 3B7WA 3GWZA 2IS4A 1GZ7A 4UXHA 5FDFA 1RI5A 3DBRA 5JU6A 3LP5A 1HLGA 4IUCS 4F8JA 3BXEA 4DLLA 4FZRA 1V37A 1E1DA 1WV1A 3QUBA 3N8GA 3AI2A 2AJBA 5KCMA 1IEVA 2NVOA 4L5YA 1EIWA 4CGZA 2IYRA 2PKEA 1NF2A 1NVAA 4WFIA 4IXWA 1KRXA 1ZIYA 4BXOA 1BMQA 1GT6A 3MS4A 4TN1A 2P9TA 4WA8A 3V8PA 4G89A 1IZYA 1EX1A 1QH8B 4MLDA 1TT5B 2O19A 1Z5PA 2YYZA 4WKOA 4YFYA 3ZQ4A 2CL7X 1PGQA 1QGED 4J1TA 4MVJP 3AONB 5CIQA 4G5HA 2JAQA 3SF8B 3OX4A 3MHPA 1JT2A 2EGHA 3TOZA 2H9IA 1PIWA 4LOAA 3V8NA 4YIHA 4AUEA 2BP7B 4QGFA 1ZNQO 3NUGA 2JDIA 4FXPA 4KR9A 1SXJA 2PG3A 4C0BA 4XD2A 3NMUF 1BOOA 4OHZA 1XZEA 2EFYA 3KCQA 3ZGZA 1I7LA 1MAWA 2NU7A 4DIDA 5ITVA 2RGNC 2C3PA 4MEAA 4WZBE 1W52X 4MPTA 3CNLA 4Q12A 2YZ7A 1OILA 4TKVA 1DHRA 2CZGA 2YVQA 2BT4A 3GZNA 3R6LA 4LW8A 1IVSA 1F3LA 3HM2A 2W9XA 3FWPA 3NIWA 3P0FA 1C4WA 1D04A 1GG9A 4KN9S 5AKLA 3KQTA 5H83A 3A3NA 4LMPA 1V0JA 1QK3A 1S7CA 3AIMA 3PFKA 1OLOA 2BJVA 3A4VA 3PZBA 4L0DA 4NPCA 4BFVA 4E5KA 1JEDA 1XEFA 1ZCZA 4XARA 4HFMA 1V7CA 2W7TA 4XPZA 1EG2A 1Q0LA 1QWOA 2ZE6A 4DJEC 1T3ZA 1W25A 2GGSA 4BWVA 2OESA 1XZNA 1XCMA 2X5KO 3DTTA 4KQCA 5FB3A 2ZCJA 3B6IA 2LCIA 3F97A 5DYYA 1LC0A 2X5OA 4WLEA 4JJ8A 1K5GA 3DC2A 3ZNPA 3AVOA 1P9LA 4ARVA 4M76B 3WZ2A 2O8DA 3DTYA 1M2VA 1R4ZA 5D84A 5JG7A 3CRQA 4KRGA 4XJXA 4X7PA 3W1VA 4BNGA 1GTL1 3GLRA 1W7AA 4B44A 4L9AA 2MINB 4UDXX 3HDHA 2CNBA 3C4QA 4H59A 4JHXA 4KMMA 1PWHA 4KZPA 3GMIA 4MV5A 3WP0A 1TW2A 5JCJD 1OAOA 4Q4LA 4BNDB 3I61A 2QX6A 1K66A 1MT3A 2BTQA 4KAAA 4ASUD 4OBBA 3D43A 1Q7TA 1SFRA 1XK7A 3GYGA 4LVOA 2I1LA 3BB4A 4BVFA 5K0JA 2PIDA 3EQ7A 1F0NA 1EVYA 1PT6A 1EK5A 1QRUA 3OLZA 4RPJA 4B6JA 4B79A 1R0CA 3NHRA 1AA6A 4ZRDA 2ADMA 1YS7A 2XGMA 5JV5A 4BO1A 1RKQA 2O7VA 2H08A 3CRW1 3WK6A 4J16C 2VNAA 1R00A 2PPLA 1VGVA 1CY7A 3QVLA 3IJRA 3N86A 3B9PA 4IFTA 1J9EA 2HKIA 4H3SA 3NOVA 4I1RA 4PQYA 4K28A 4KU4A 4QL3A 4U1RA 2XNHA 4BHTA 3LY9A 4UD6A 5E6RA 5A5FA 3T9AA 3H11A 5JATA 1JFFA 1XPUA 4FE3A 4CG1A 2ECFA 1UMBB 3N7UA 2BTOA 4JLSA 2JZNA 4F9TA 3H2IA 1XZIA 2C88A 1U99A 3QKSB 3T1QA 1QG2A 3CM0A 4Q00A 3EQ9A 1NV8A 1M34B 3K2IA 4I9UA 3IAXA 4R3NA 1N3LA 4XB2A 1B6SA 3AZPA 3I2KA 4YJ3B 2QRUA 2ZSEA 3NONA 4JEIA 3RVRA 5LP6F 1CQIA 1MLDA 5IM4A 3SZGA 4KMOA 3VMMA 1SOMA 2OFXA 1VLZA 2XCQA 6REQB 3IPAA 1YJCA 1Q84A 3PNLA 2FN7A 3HJBA 4XW2A 4GO1A 4BFWA 1OYVA 1O2DA 2OV2A 2H1WA 3DL4A 1MUUA 3G2OA 4A8PA 3LP6A 4N6GA 3UOAB 3MRVA 2PBRA 3WQQA 4KO1S 4NR0A 4Q02A 4EJ6A 5L4NA 1HOTA 4TUYB 2FRVA 1KDRA 4QVKA 1DNPA 2GF0A 3F1KA 1G20E 1XVVA 2C1EA 3KT6A 4WXYB 3UJ7A 4F06A 1NVVR 5I45A 4DIOA 1YULA 5IDYA 2XYGA 1SKMA 1AZTA 5JH7B 3MWGA 5E1OA 4Q3EA 3NB0A 4FR0A 1X15A 5IDVA 4K5QA 1V2GA 5DHQA 5KC8A 1GZSA 1MQSA 3THRA 1KWGA 1TADA 3BE5A 4WDQA 2QTWB 5B6PA 3HO6A 5IWAB 2YC4C 1RWOA 1NJGA 3BWCA 5K03A 5DBFA 3I5MA 3FZNA 3VYTB 2BR3A 1QR2A 3IOBA 2PH3A 3MCZA 3MEQA 4BJ6A 1PAUA 4FCTA 3TXAA 4RXMA 2B1RA 4H60A 3KETA 3BXFA 3V6MA 1H2RS 4J0IA 3QW4B 2HEIA 3L4BA 4TLLB 1VXOA 3STXA 5J2TB 1A3CA 1E7WA 4WGGA 1E99A 4QZVA 1RPZA 1T24A 2EBHX 2Y9MB 3WWDA 4C08A 4DRYA 4X63A 5IUKC 3ACCA 3KX2A 1C2YA 3BVPA 4FCCA 4GSYA 4GPZA 2I91A 2YWEA 1L1QA 5I7EA 3VDNB 1XQXA 4OKSA 4MKIA 1U3FA 1P81A 2V0NA 1J97A 3VVBA 3QVTA 4DWOA 2PS0A 1FE8A 2W6OA 3UWDA 3KJGA 1BX1A 1PN3A 1TVCA 1G4HA 4LGMA 5LFAA 3Q5GA 2IXDA 3M6AA 4URYR 3H0CA 5BN5B 3UGQA 3L8CA 3VSEA 4UNRA 3BG5A 1CUDA 4WK0B 3H5IA 1IN6A 1PR5A 1YV9A 2SNIE 3D6MA 3QFRA 3ZEIA 1ACJA 3P0JA 3SOZA 1EDOA 4A6EA 1KJYA 4E08A 4P4TA 5F2KA 4JUBA 1G18A 2Q50A 1APBA 1MO4A 1ZOOA 2OB2A 1XTUA 3MJRA 3JSAA 3R2JA 4DR2B 1IWBB 1CZHA 1MCZA 2GEFA 4F5YA 3SE0A 4D82A 4W9MC 1LI5A 1W4CA 1GL3A 5LR6A 5AT1A 1SU7A 1R6UA 4YWHA 2P1DA 2OLKA 1ISFA 4RFSA 3GT0A 5FULA 3TCNA 4E4TA 4F97A 621PA 1U5AA 5AM1A 4WLOA 3FYDA 3RVMA 1GSIA 5C80A 1ZI6A 3ZVKA 2ADFA 3OFJA 4JI2B 2WBLC 5KDOA 5IFKA 4FVTA 3SNKA 3RYTC 2J4DA 3EGXB 3QU5A 3EIWA 1L7PA 4PAGA 5L95A 2XMGA 5CFLA 1G19A 4D3DA 2QD2A 4HDOB 4P98A 5DHSA 1H0RA 2ESRA 2GXSA 3ENVA 3O7MA 4LOKA 5CB8A 3GBPA 5FWDA 3SC4A 2HNKA 3E5MA 1C0IA 4V2UA 4JROA 5F7ZA 1JQKA 2ECQA 1ECLA 4QOEA 3SJAA 5LUAA 3AEQB 2H9YA 1UWVA 4AUMA 1NSYA 3QXGA 2J9YB 4D8TA 3RK4A 1UXJA 1V6AA 5F35A 2YS7A 3CO0S 4TXHA 1J00A 4ZCSA 4G0PA 1U5BB 3OZBA 3I76A 3HGQA 3PUXA 2OAP1 1YB5A 4BNWA 2VJPA 4L75A 4MUYA 3L6DA 4DDWA 4HC4A 4G56A 3AGQA 1DXYA 2PAFA 4WHMA 2OP0A 2VF8A 2O20A 4I19A 1OD6A 2WYHA 3AZQA 1U3UA 2XQFA 3AQ4A 4MRSA 5LU9A 4QTUB 2FEWB 1KIFA 2AA3A 4NYIR 4OFBA 3PEYA 3MMNA 2OVFA 5H70A 5DK4A 4H1WA 1NQTA 1MVNA 3GZ4A 4P3XA 4Y18A 1PE0A 5HNKA 3I4FA 1TUIA 3UWOA 1TCAA 2RB5A 2HRRA 3A1UA 1OWOA 2HSWA 1MV5A 2XCOA 4AU1A 5B6IA 4J9UE 5ULLA 2XB2A 3G82C 3O26A 3CUTA 3T4PA 2C7VA 1KEWA 4RW0A 2P8JA 3JPWA 16PKA 3DC7A 3VZPA 2FSPA 4XQGA 1HTTA 1KF0A 3RG2A 3FHTA 3OIVA 1H9BA 4M1OA 4O0MA 2FTKE 3RC3A 3PSAA 3M1AA 1CUCA 2B4KA 4J90A 2FQ1A 4UUAA 5J4KA 4QJ3A 5I8ZA 2TMDA 3QM1A 3C6KA 3L3BA 1YS1X 4CDNA 4EO9A 4WLUA 2Q28A 1Q0SA 3EBLA 2OXTA 4IS3A 2NZXA 4GWLA 1Q7CA 1B16A 4MGHA 4DJFC 2PUGA 2C31A 4BEVA 3HUDA 3M4YA 1ADYA 3DHNA 4IDCA 4LPSA 5CA1F 3F4LA 1A5AB 2HLDA 4OLHA 4CNBA 1QGDA 2NV0A 4IICA 4ND6A 2HMUA 1VFPA 1Z68A 3AIKA 4TZKA 1J06A 4I9GA 2ZZMA 3NTXA 5EQFA 3UXEA 4GLFA 3DR5A 2XGJA 2FNAA 3OCCA 5HMLA 1IAVA 1YMQA 4L4YA 3UJAA 4OUKX 3RK0A 4A5OA 3UUWA 4EYOA 4ABTA 1NBME 2EFGA 3QKUA 2CXSA 4RDIA 5JSZA 1X7YB 3P4UA 1B2RA 1WMBA 1YHYA 2VJMA 2EARA 2ETXA 3H5AA 4FFDA 4HDAA 3B2NA 2BELA 3KKKA 3U4QA 4RK1A 2GNAA 1T3TA 5A0VA 3RANA 1II8B 3IUNA 4PPFA 1N5JA 3KB8A 3KOUA 3ZZTA 2Q0HA 4LDJA 2YIDA 4M1WA 2DM6A 4D9EA 6PFKA 1K1EA 2Z9DA 4GH5A 3FW1A 4YRKA 2DPLA 1HG0A 2W2TA 2A5LA 1UK6A 1J8MF 3LUFA 3WI7A 3DF9A 5EMKA 3EF0A 4W9RA 5LB4A 2HB6A 1IVNA 1M7GA 1CYDA 1Z8NA 4TT3A 1IOLA 1JHRA 1Q91A 2OWDA 1M1XB 4NICA 3C3MA 5ADVA 1KI2A 1D2AA 2Z2JA 1P33A 1L5OA 3ZY5A 3PXBA 3R0IA 5LPNA 1L3IA 1QC5B 3PKIA 4BMVA 2Y99A 4BJ3A 1NGSA 4RV4A 5AVJA 2E82A 4MB6A 3WNBA 4BKMA 1XU7A 3D4LA 4HDSB 4FFPA 1T8UA 4D9NA 4RTKA 4B3HA 2OD9A 5IK2A 5ICCA 2ABWA 4G4SP 1V5IA 4AMBA 4IYJA 4CQLA 3TE7A 4OAOA 1LU9A 2Y3IA 3MRSA 1Q20A 1BS9A 3SI7A 4JQCA 4E2XA 3HBMA 5JPCA 4NOMA 4OJTA 5GIPE 3LSYA 5IZCC 2HV8A 1DGQA 3WLPA 2PWAA 2JBAB 2ERYA 3G2PA 1QANA 4F5DA 1GNSA 1T6ZA 1PGJA 2CZCA 3A37A 2HA2A 3TDMA 1D03A 1V9SA 4MRMB 1KR5A 1JR4A 2XPCA 5B1HA 2AN1A 4C87A 5KYNA 1KP3A 5E38A 1Y3AA 3W2TA 3F78A 2VF2A 5JS6A 2XB8A 2PGAA 3HU5A 1NLYA 3BORA 3A8TA 1R6BX 4O0LA 2IC5A 5KNBD 1UJCA 2WF5A 1M74A 2ZWMA 2P9CA 5H9WA 3I6QA 4J1TC 3GT3A 5J4LA 5FOWA 2DOKA 3ULKA 4LYAA 5EJ9A 1F2TB 3E9MA 1U2PA 4GPIB 4BRUA 2ZQZA 2CXPA 2XMQA 4JI8B 3SXPA 1QO7A 2ZG6A 1VE9A 5HDBB 4FIZA 1NR7A 4OU4A 1SQ0A 3WLAA 4I6EA 1PQ4A 1LI4A 2CYCA 4WBNB 5CW2A 2EF0A 4O4JF 2I6GA 1VE6A 4V39A 1M10A 1KEPA 5BSEA 3C8DA 1Z18A 5H3HA 1KAQA 1PCXA 2CJFA 1GCIA 1JAZA 3LGSA 3QH4A 1FS6A 4NF2A 1H8HD 2Z09A 1PZMA 3JQGB 4R98A 4YO7A 2B5OA 2CJXA 1SVLA 3WLIA 1CP2A 4AJ4A 1KI1A 5SYMA 3SZOA 4WCFC 1CJKC 1UPAA 5IG2A 1YJXA 5B4VA 5J58A 4JEHA 4DBVO 3WVNA 1QVWA 4BNLA 3GEGA 3M8KA 1WULS 3LDFA 3PFWO 3A26A 3CPJB 3PKZA 5DM70 2AOVA 1YDEA 4ZJUA 4KH0A 3OZCA 4NU5A 1HYEA 3D7NA 3HR7A 4A9AA 5EJ4A 3LPNA 3OCZA 4X1KA 1NRIA 3FAZA 1WUHS 3NWBA 2AG6A 2MU1A 2PMWB 2V03A 2BMDA 3P9YA 4G8JA 4L0CA 4V2IA 4EFLA 2MMCA 1OZAA 1XTZA 3QK7A 4WBSA 4AX4A 3EX7C 2R6ZA 5EIXA 1YGPA 2KWIA 1UC8A 2ZJ5A 1U2GA 3E9EA 1TF5A 3HY4A 2J7KA 5DEIA 3BCHA 1DOHA 4HH3C 2JFXA 4BKUA 2UVQA 2R5NA 4P5DA 4BIMA 3QPVA 3I6BA 5A9RA 3HZZA 4TTIA 3CIOA 5JRZA 3EYWA 1DKNA 1XQ9A 4CKXA 1GTG1 2V9PA 1O8BA 2BH9A 5HG0A 1U11A 3P0IA 3VPBA 3VR3D 4EW3A 2AT1A 4UMVA 2G4CA 3SR4A 4K87A 2WB4A 3FLAA 3NDBB 1UBNA 3IMEA 2X0EA 2XGSA 2QN6A 2ZWOA 3EC1A 3OJCA 2KHZA 3GDOA 5DNYB 1E3MA 3SY8A 2IV2X 4HWKA 4RK0A 4E6EA 2CUZA 1FF9A 5JZVA 2PKXA 5DULA 1R27A 4MWBA 3W2FA 1ISGA 2V55B 1T8YA 3FA2A 4IX9A 4RSRA 3UMJA 1XMJA 4CYMA 3QBDA 4WEOA 3RSFA 4GWKA 5LDHA 3BOSA 4N7RA 2IL1A 3ZCPA 4RF5A 1HDYA 2W48A 2YWBA 2PSJA 4S04A 5ECYA 4E4YA 1Q1GA 1F8XA 1WABA 2VQ3A 4Y9UA 3JQ8A 2NU7B 3DVLA 4O4LF 5DH9A 2G80A 4H17A 3ZV7A 1GEEA 5CVEA 3BSWA 3GP3A 4OUDA 4AMYA 4AVYA 1Z9BA 4Y7DA 3NHJA 3TEFA 4ZVKA 3CVWA 4YV0A 1DT5A 2GLUA 3HMKA 3THXA 3OZXA 2O23A 3C8HA 1JDSA 2L82A 1DB3A 2II6A 2WSSA 2X5XA 1VKHA 1PUIA 1WDMA 1YDMA 4WCFB 5AHKA 5DNWA 4LKOA 3GH1A 2A58A 5CDHA 1W4ZA 1A5SB 3FLEA 4GMXA 4QECA 2RGBA 1F6DA 5TE9A 3WOHA 1N2XA 3V7NA 3VO8A 1IEWA 3L8DA 3L40A 2ZFUA 1RXVA 1NQ5A 4G07A 1I2ZA 4KQKA 5MN6A 1XYYA 3MJEA 3KKNA 1JG1A 1N0VC 3I1FA 3DR3A 5EMNA 5IHPA 1Z0SA 3WAGA 3TIGA 2ZDQA 3DDHA 2HMAA 2OFOA 2QM3A 2I1VB 5GGXA 2R8YA 1B3RA 1EVQA 3BJMA 3FFWA 1YQEA 1VCIA 4X3PA 4OYRA 1S6YA 5A5VA 2O8DB 3SKYA 421PA 3GRFA 2ZPAA 4OGLA 1M2KA 2ENUA 1O54A 1JDVA 5AM2A 1ECGA 1S3FA 3E1GA 4CBVA 4L3VA 3OT4A 3ICOA 4NDAA 4O3FA 1YR3A 3ZWDA 5FBVB 3IHLA 1JR2A 5GGYA 4EB6A 1U8TA 4G01B 3T7TA 4IDNA 4AECA 1T5SA 1JSCA 2BTQB 4FCVA 2IELA 4KJXA 4Y30A 3HVRA 1FVFA 3BF7A 4TT8A 1GN8A 4BY9E 3PENA 3NS7A 3KDAA 3L7OA 1P0QA 2WJ6A 4IMIB 1CDEA 4IOLA 4PX5A 3K8ZA 4RL6A 4GMDA 4ZXFA 2IGTA 2WQ7A 2W37A 4KFTA 2DQSA 2JKVA 3ZIAD 2V5VA 2Z1DA 5LA6F 3E6AA 2EBFX 4Z4IA 2XMDA 3EGOA 1R0LA 3BH6A 3DKRA 1L5RA 3OZUA 1BWPA 2JAPA 1AS2A 2PWBA 2CHFA 4X62B 2EKDA 3TBFA 2CD9A 2IYTA 2TSYB 1JFFB 2G72A 3H11B 4NOJA 2IZOA 1JU3A 4V0ME 5CPFA 4E2FA 2Y1WA 4F3KA 1KXJA 2XWQA 3GJ6A 3D8TA 2ZWIA 1TJ5A 4OREX 2FE1A 2M98A 5FTMA 3CO5A 4G85A 1N75A 3AIIA 1HG1A 2J6CA 1CTQA 1KMCA 1FRZA 2GJ8A 2H5JA 3LWBA 1V4VA 4HRAA 4LHZA 3T3MB 3W8RA 4FNGA 1FIUA 4H1VA 4F96A 4QHYA 1B42A 1AY0A 4UDYX 1CWUA 5HIAA 3N3BC 4PZCA 1XXHA 4LTNA 3OAAD 4YA6A 3PJDA 3WB9A 1GQSA 2RHWA 4DT1A 4TQGA 2FVXA 2JAUA 1WY7A 1GYRA 1XLVA 2PLWA 3FKSA 1Y3FE 1U7HA 3N05A 2CBXA 4IXMA 4OXKA 3PE3A 1YJQA 2C7PA 5JJ5A 2WLSA 4Q3BA 5E6UB 3W5JA 5F7OA 3GGSA 2AUTA 3ZG6A 4TLDA 2CXUA 3BREA 4NH4A 2EOAA 4YGYA 2D13A 1WE2A 3I5UA 5SICE 1KE1A 5BNZA 2B82A 2W2XA 4I3GA 3UXHA 2VXYA 2XCIA 1K3FA 1NUQA 1Z17A 1SZDA 3HA3A 1HKHA 2HRBA 3HE3A 1M54A 4IZHA 2PS1A 4QQRA 5AJUA 2JH3A 3U1TA 1DEOA 1T91A 2JFPA 3QHQA 1QG0A 4NJEB 5HPYB 2P91A 3CLHA 3FROA 4G84A 3AVTA 1KP2A 1VG8A 4HHEA 2Y77A 4ZALA 1P9NA 4L22A 4IXNA 4BU0A 4ZMBA 1T36B 1PBTA 2CLIB 2FPGA 1U8FO 1X8KA 2Q0QA 3SQNA 2RKBA 3CLTC 2VHEA 2VQ6A 4IDGA 1M6VB 4RZSA 1ZVKA 1EVEA 5FEMA 2O2JA 2YIVX 1E1KA 3M3HA 4UUNA 1ZMOA 2EIXA 3E27A 4DMLA 1JHMA 3PHGA 2APJA 2D1QA 3C6YA 4UDNA 3F6RA 1MG0A 3VISA 2XA9A 4QTTB 4PZAA 5C34B 5JY1A 4OY3A 3B9RA 1XDZA 3QPUA 3PJRA 1ZJ5A 4ZYUA 1ENOA 3HJHA 1MF7A 3H1EA 4UBOA 1QMGA 1KU6A 4RV9A 3SFVA 5FWAA 3H4MA 3AV3A 4G36A 3IKMB 2RGEA 4BJ5A 5KU1A 4C0WA 1H5NA 5IAKA 1IIBA 1PWEA 3EVTA 1RM0A 2O59A 1IJKA 1KK1A 3WIDA 2J6HA 1Z2NX 1E2JA 2VWQA 3CRZA 4RMHA 5AR1A 2EC5A 1D0VA 4I5GA 4Z4FA 3N0VA 3WNVA 1P61B 4PYRA 1XTQA 4QATA 1YBHA 3ZUGA 1P75A 3KVVA 4LRSB 2ZAMA 4NPAA 4DADA 2HC9A 1IYZA 2FUG6 2ZEJA 1Q7RA 1HZJA 2Z9CA 4PRKA 4R2MA 2A1UB 1TO2E 2ERCA 2R6R1 1V8DA 3AYZB 4FQ7A 2FPKA 1U3DA 3U62A 4EM6A 1KQFA 3NAGA 2ZRBA 1JQBA 3UPUA 5EPOA 2BSAA 3TW0A 3Q87B 1UPBA 3SHVA 5A02A 3QU7A 4WTOA 2F3RA 3QRWA 3JVDA 3Q5DA 2XTNA 4RFSB 3ECAA 3S0JA 1ORTA 2M2IA 2OQRA 3I01M 3MPUA 1V26A 1RWKA 4K1LA 4YASA 5SZIA 3K6RA 4LXQA 4LWOA 4C7KA 5H9VA 1T9HA 3O92A 1DC6A 3Q3VA 5T4BA 2CXNA 3LA6A 4XIJA 4R3UC 1XCLA 5LD2C 3QEAZ 1C1DA 5CDFA 5IDXA 4J91A 5HIMA 1KJ8A 1N1GA 1O6ZA 1S96A 2Q6TA 2XTAA 3ACDA 3DE0X 3K1AA 4NU8X 3PGLA 3K30A 4X84A 1E2LA 1WHTB 2EKLA 3KOOA 1ZAKA 1GPUA 4HGYA 2ZIUB 5DCWA 3TI7A 1TRKA 3IPLA 2WWRA 1RM4A 1H2ZA 1YCHA 3CSSA 1AUXA 1TCVA 3OC6A 3SX0A 1CS4C 4LCEA 5JJCA 1X87A 2CNKA 1XCGB 2E9SA 3PFCA 5DVZA 3ZQUA 4A4DA 3GLFB 2VCYA 2BMVA 1QCCA 3THWA 3KSBC 1MKYA 3LO8A 4WJLA 3PA8A 4MINA 1RZRA 1BQ4A 2EYUA 2I22A 5G1OA 2H1FA 4DMHA 2FDCA 1B6GA 4ZJYA 4S2EA 3KFXA 1GGHA 1ICEA 3CXUA 3PQ2A 4B82A 3T52A 1ZONA 2ZITA 3H4IA 4BB6A 1O9GA 4K6HA 2VZEA 3EAQA 5AP9A 3UMRA 5ALHA 2ZSBA 3Q98A 4FUTA 3TNLA 4ZEMA 1SCUA 2YQZA 5ILOA 1WQ3A 1GILA 2IYZA 4LOHA 4DDVA 2FMXA 1E6UA 2C95A 4YUZA 5FA6A 1VCNA 3MOIA 1MN6A 2FSVA 4JENA 4N01A 4XVUA 3STWA 5AW9A 1QIGA 5JSYA 4P5EA 1OFTA 2WAMA 5TGTA 2ZTLA 3P4XA 3PB3A 2Y8EA 3IIKA 4EB8A 1EJ6A 2IHVA 3VZRA 4F5ZA 5CJPA 1GL7A 5BOSB 2RHCA 3DP7A 2WUDA 1VLMA 2P69A 3QNMA 1ORHA 1T0HB 1UMCA 4Y6PA 4C4OA 2G08A 4MA4A 4MGZR 5A7FA 3MLBA 2WIBA 3PX3A 5JVDA 2ZJYA 2BW0A 3QENA 5KTRA 1DJMA 2O3QA 3ZWVA 3NP7A 3V7UA 1IWOA 1Z26A 5AUOB 2J3KA 3DCJA 3ZZNA 5EQJB 2NYRA 1EJ2A 2WKPA 3TJZA 1ZCFA 3JVIA 3OE7D 4BTEA 4X65B 2NV2B 4E5VA 1PUXA 3HM9A 4NK4A 4QEKA 4XWAA 4D4GA 3NX4A 3WK4A 3RU7A 3OPMA 1H2EA 4WXRA 2VSOA 2J87A 4DREA 4IVRA 4WADA 3K3PA 1T9DA 3UMSA 2YY6A 1QOZA 3DKKA 3EE6A 3E03A 4R1PA 4K9RA 2NQTA 2H2GA 4B8YA 4BAGA 2Z3WA 2WWIA 3DVSX 4LTMA 5LD2B 2LDBA 1FK8A 1OV6A 1RFGE 5F4BA 1U2QA 1RQGA 3CRNA 3AT1A 1JRLA 2AV6A 5JBNA 3ISVA 2QTHA 5BUQA 2FWNA 3AUKA 1PG2A 2ZTHA 4K88A 3D0QA 1XDUA 3DZHA 4FYWA 1IHOA 4GOND 4Q1DA 3ROGA 3RR2A 4YUVA 1SCQA 5AUNB 1SUFA 1J0AA 3MAAC 1P62B 1XZFA 1FDVA 3B5IA 3EQ2A 1E20A 4EY3A 4TQ9A 3X44A 1OXKB 1JIJA 3LGAA 2P2LA 4I4LA 3O8OA 5C7IO 2PZAA 3P5SA 1ZP6A 2V6IA 5CB4A 1NFQA 3CB2A 3B13B 4NV3A 4PAOA 4JHLA 1Y8QB 2FXVA 4DCOA 1ORDA 5HSGA 2YJ4A 3GVHA 3L5KA 3HRKA 3C5WP 2IPNA 3OOSA 4PO1A 3FF1A 1K92A 1M5TA 1M2JA 3H8WA 3F5FA 2ZJ2A 4D98A 5BQXA 5C53B 3M49A 3BUSA 1S5PA 3SF0A 1X8XA 3WBJA 2I1QA 2XXBA 4HVAA 1A7KA 4QO8A 4EZEA 2ZUFA 3BMOA 1Z5UA 2H5EA 3KV3O 3I9KA 4GKJB 3T3PB 2XUDA 3QX8A 1G7SA 5KINB 3RTCA 3FRHA 4UEOA 2FQXA 5F1OA 4BNFA 4LJ8A 4YMUA 3UVEA 3STUA 3RW9A 4ZAZA 3SFZA 3WNCA 1SNYA 4KMRA 3CUUA 3KXPA 1V48A 4F4FA 2X76A 5H3CA 4UCXA 2CJPA 3HPQA 5HBGA 1SVSA 2JCVA 3QJYA 4ZAFA 1PJLA 1PZNA 3IVRA 2NLOA 3A36A 1E7MA 1E8MA 4BVBA 3KJQA 3NHBA 3C3WA 2WJ3A 1H23A 1LC3A 4K05A 1R3UA 2R8PA 1NKTA 1AZSC 1D3AA 2JA2A 3WGUA 2DKNA 2OGZA 2B8EA 4C5BA 4CI0B 1Z88A 1DO0A 2UVPA 3T9CA 2PTGA 4CPDA 4C89A 3O8LA 3OHPA 1B73A 1ZN9A 2OHXA 2QROA 1G7TA 5C52B 3RQSA 3A6JA 2YDXA 4HDNB 3ZV3A 2YN0A 3GWGA 4A0HA 3O2SB 1P1CA 2YRWA 3GFRA 3PD1A 2XIQA 4HDRA 3BWDD 3EHEA 3OFNA 3UK2A 1GCGA 2JFWA 4M0UA 5IVHA 5BNTA 2XQGA 2WSYB 2X15A 1NW6A 3E15A 4CJXA 2BYTA 3BD6A 3HBJA 3PQ3A 3T0IA 3ENZA 3LCRA 3EPJA 3MJDA 2XRMA 2BEWA 2NU6A 4KTTE 2W6MA 5I47A 1F3OA 4D41A 3ZGNA 5F2NA 5HS6A 4O5AA 1CERA 4GX0A 1MD9A 2RBEA 4Y2PA 5AVOA 1TMGE 5EZQA 1J09A 2NU9B 3HB4X 6ABPA 5EE1A 1WZNA 1XE3A 3H18A 2BLLA 2R1TA 3F5MA 2Y0PA 1A04A 2ZT5A 3BL6A 1JR3D 2GPBA 5C51B 1HNZB 4IDFA 2AE1A 2W98A 4MKZA 3GCZA 4R4JA 1Z74A 5LP6A 1E2MA 1YHNA 4MQBA 2FY8A 5IJAA 2WTBA 5M7EA 2JJ1A 3GCWA 4X1KB 2OCDA 2AI1A 3OJOA 2ZLBA 3QSGA 3D4BA 3JYQA 4W9NA 4KXLA 3LCVB 5DRTA 1SCJA 3HBAA 2H3EA 3A05A 4IIJB 1KI9A 1SY7A 3SLKA 2HRDA 5L4SA 1FTYA 2R8XA 1VL6A 1VYVA 4CV0A 2JLBA 2REBA 2GAOA 2WIJA 4B3SB 3VGPA 4URZR 1UFKA 1I4EB 4L0QA 5TT1A 3QX7A 5DBGA 3RK1A 1NLFA 1LCIA 1YL5A 1NG1A 1MX3A 3MBKA 4QPNA 4ARCA 4D9BA 2OFWA 2DP4E 3L41A 2Q9UA 1WPXA 1UJMA 1E1RD 3QY0A 3I73A 4JQYA 4OQEA 4OO3A 1C7QA 5AJYA 3SXJA 4MVYA 3G2MA 3HV2A 4HQFA 2HJSA 4CMKA 3AEZA 4RQUA 2H7CA 4IIGA 3G5MA 4RADA 3A4LA 4WPGA 5ELMA 5T64A 4URXR 3ZQKA 1Q0RA 2C98A 3WSVA 2R1VB 3G0GA 5A7HA 5KTPA 1EPUA 2YZMA 2QTZA 4L6CA 1LB1B 1QAMA 4KX3A 1XG5A 4FOOA 3EC7A 4FHEA 1LUAA 2J7PA 3KQLA 1XRSB 1Z5VA 3L6OO 4RKQA 1YI0A 4ZU6X 4LI0A 4OHKA 3TIFA 1NG9A 4KGVA 2J9ZB 3OA2A 1PNOA 1ZMXA 2C4TA 2QU8A 3ON5A 4IIHA 5F4ZA 3S7TA 4F3YA 1IDOA 2GEBA 2WIAA 2BWJA 2CCGA 4NQRA 2XOXA 4MPRA 2HLNA 3DTVB 3L1HA 3G23A 3NNSA 4X8LA 1VG9B 3THXB 3QVUA 4WK6A 3G9UA 4G1UC 4DABA 2QU7A 4IIXA 1UXIA 3DHYA 1E79A 3N2ZB 2NYVA 3AVQA 3BMNA 1E5TA 3L8EA 2PX3A 3AEKA 3GOHA 5CVVA 2GM4A 1I6MA 1QMPA 3FMPB 3BBPA 4K9OA 4NY1A 3UXMA 4ENUA 1JIKA 5HRUA 1I32A 2NVWA 1C50A 3OTGA 2QPOA 1Z0FA 3EMBA 1L5LA 3RYFA 2Q4EA 3T3DA 5KHOC 3P9NA 3HCAA 3WMGA 2FUCA 2PCLA 3B12A 4CF3A 2ZKLA 5BMOA 5FXMA 5D85A 1YS2X 1WZCA 4L8YA 4CLRA 2BY4A 4B3BA 1KO8A 4JXXA 2NTEA 5D7BA 1QX4A 3OZTA 3VR5A 4CG2A 1WUIS 1CF4A 4GS5A 3T1VA 3K0SA 5SZJA 2QDKA 2VDNB 4GL4A 1ZUHA 3VMFA 1RKBA 1JJAA 4RVOA 2NV6A 2VDVE 4K0KB 3EY4A 3K0AB 4LY6A 1N5OX 1VLLA 3H9BA 2O7QA 5DIFA 2P9JA 1BNCA 3DFMA 5JE8A 3CCCA 1O94D 2IIVA 5JZSA 3OSUA 3FJ1A 4KC0A 5EUBA 2BZGA 1K6MA 3EA4A 1CUAA 1XDBA 3HLYA 4M0MA 4BTVA