1ENPA

Brassica napus enoyl acp reductase/nadh binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enpA00
3UVEA 3TQHA 3DBVO 4W9NC 5FYDA 3WBBA 2X5JO 4OXNA 3RSHA 3ZU5A 2HK7A 1NFFA 1E3EA 4MP6A 1W73A 3P19A 3S2EA 4TROA 4FCCA 4CQLA 4PZDA 2GYYA 4IQ8A 1C3VA 1DLJA 1FDTA 1R0SA 2Q49A 1DRWA 3UAGA 1H5QA 1J5PA 3WR5A 5DULA 1R12A 3JQAB 1XCBA 3E82A 2Q4BA 9LDTA 2E82A 3DZBA 1QSGA 4I9NA 4MINA 2F1KA 4IDEA 1P1JA 1HDGO 4MOWA 2R6JA 1N2SA 3DHYA 3B1JA 4KWIA 4RPLA 4PG6A 2ZB8A 5I8WA 4UUPA 2YQ5A 4YDRA 3ZCXA 1Y8QB 3RVDA 4HKTA 1F17A 3Q2IA 4IZIA 1E6WA 3PEFA 1I2ZA 1IUKA 2Q46A 2DBVO 1AHHA 1GQYA 1YE3A 3UFXA 1T2CA 3U49A 3LC2O 5HA5A 4ZGWA 4D7AA 4O59O 4WCDA 5THQA 4II3A 4ZQBA 1GCOA 2OXIA 1Q1NA 3DTTA 3T4XA 5G4KB 2WWRA 1U8FO 2JKVA 2Q50A 4GPD1 3KRTA 4CM8B 3I9KA 4DUPA 1BXGA 1K6JA 2JD1A 5CDGA 1QLHA 4E30A 2HUNA 5KVSA 4CUKA 1KEUA 1H9BA 3E9MA 3TFQA 5DZSA 5ILGA 3HFSA 3VKUA 1E0DA 2X8LA 4GX1A 2B0JA 1GYPA 2VWHA 4DIBA 2EW2A 2YW9A 4I08A 4QXMA 4RPKA 4CM5A 1ZJYA 4ZD6A 3W4KA 4BKPA 4ZU3A 4AJIA 3Q11A 2HJSA 4JJIA 4BMSA 3K92A 2NU7A 1XEAA 4XGKA 4UVEA 2GN9A 1OC2A 4J43A 1H6DA 1IB6A 1SAYA 1N1GA 2IXBA 4GH5A 1R16A 2NQ8A 1AN9A 1T1RA 4OKNA 1DIBA 5ER9A 1LLUA 5TJ9A 1U7HA 4UVDA 4Y8VA 1MB4A 1FK8A 2A4KA 1IE3A 4NNJA 1HE4A 2GUGA 2X9NA 4HWKA 3I23A 4MJLA 3VH1A 3GH3A 3QV1A 3LLVA 2JHFA 3W4JA 2HU2A 2AQ8A 2DUWA 1IPFA 1Z82A 3OBBA 2UV8A 4PLZA 4CMGA 4YR9A 4BL5A 1JVBA 5EL0A 1AXEA 2GNAA 1LDMA 3NGXA 1A72A 4YAIA 2G0TA 1QYXA 5CEEA 5DP1A 6LDHA 2GN6A 3OJLA 5A9TA 4AJLA 4BV8A 2HK9A 4GX5A 4FFLA 4A7PA 4FFOA 4EW6A 1DFHA 1NXQA 2R00A 2W2KA 3VOSA 3DFUA 2ZB4A 2AQIA 4AJJA 2O23A 4WEOA 4EDFA 1NFQA 2CDCA 4XGNA 3ZNOA 4DGSA 3UCEA 4KQWA 3ADOA 1SB8A 1IHYA 4CR7A 3DOJA 4HFNA 3PZRA 1G6KA 2J3KA 2YQ4A 4GVLA 1NNUA 1RWBA 1T26A 3BHMA 3QSGA 5G0WA 3DQPA 4C7KA 3DAPA 4OAQA 1E1MA 3N58A 4RPGA 1BW9A 3DBHB 1Y9AA 4CLOB 1X15A 2YY7A 3QW2A 1LQTA 1P0FA 2NVUA 3ZHZA 1LSJA 3ROKA 3TPCA 3I9MA 5ER6A 3ZDFA 2ZTUA 1JTVA 1QV7A 4XR9A 1CF2O 1PZEA 1UP4A 4GL4A 8LDHA 1GZ6A 2XPCA 2HDHA 4IBOA 4NU5A 5HS6A 4A27A 1H93A 5DOVA 5CAEA 1LC3A 4WUVA 4BO7A 1O0SA 3RC9A 4DQVA 4QT0A 4YA6A 1JDJA 1UXIA 4B4UA 4PG8A 2P4QA 1P1RA 2FHSA 2HMVA 5T64A 4BO5A 3FD8A 2PH5A 1YDWA 1I3MA 2D2IA 4UULA 3RUHA 3SBOA 5KKAA 3IUPA 1GAEO 4ND3A 5A03A 1ZSVA 3X2EA 1VLLA 3SC6A 2VUTA 2ZB3A 4BNWA 3HB5X 2C59A 1V3UA 3I4FA 1NHWA 3NDRA 2QRLA 4IDGA 3ANLA 1I24A 4L4RA 5K6AA 1DPGA 3QVSA 4NZ9A 4CV2A 1UZNA 4PZCA 1I3KA 3TF5A 1XYGA 3IP1A 1Y5MA 2Y0CA 1DIGA 1YVEI 4WKGA 3KYDA 3JYPA 1ZK3A 1Y1PA 1PQPA 4EI2A 1MXHA 2ZCVA 2J5KA 3OM9A 4JN6B 2GO1A 4ND1A 4CMCA 4E3ZA 4PLPA 4BB6A 3VVBA 3C1TA 3KOUA 3SEFA 3DZHA 4K9DA 4ZQHA 1RYEA 1J6UA 1S6YA 3RROA 2CY0A 1SB9A 4ILKA 5I9MA 3JD1A 4TWRA 4BNFA 3NJ8A 1NQOA 3DR3A 3ITDA 1K89A 2NM0A 1A7KA 1IYZA 1O9BA 1X7DA 4XYGA 1TVEA 1HT0A 3RC7A 4OO3A 2X86A 4R4JA 1EVIA 5L4NA 4UUOA 1XQ6A 4RF2A 2GASA 4PLHA 2FPIA 4K26A 4BO9A 4CUJA 5KOIA 1BTOA 1JKFA 1IZ9A 3UUWA 4Z9FA 4R3WA 1BVUA 3JQDA 2OP1A 4BQRA 2QQ5A 3H9UA 5JAIA 2P91A 4OOFA 5ILOA 2DTXA 2HJRA 4Z0HO 1HLPA 2E49A 2FWMX 4J16A 1PIWA 3E48A 5CPFA 1EBUA 2HKIA 3FBGA 3O9ZA 4M8SA 3NEPX 4AL4A 2NTJA 3BTOA 4MVJM 3PYLA 1IOLA 5BQFA 1C1DA 4XRGA 2VWPA 5GMOA 1HDXA 3AM3A 1MV8A 3L77A 1SEVA 1CETA 1SOVA 2VZ0A 4Q3DA 1YBAA 1M6HA 2YV1A 1PJLA 1LSOA 2GERA 2LDXA 3LC7O 1UAYA 3PYXA 4CQLB 5A5FA 1I30A 1I8TA 1NX6A 4HFRA 3PHJA 4BIIA 4D3SA 1H94A 1ENPA 1YO6A 5A3VA 3AUUA 3FRJA 4DREA 3JQCA 3KSUA 4ONEA 1VI2A 2D3TA 1B26A 1I3NA 3AK4A 3ENKA 4OQZA 2PZLA 1HE3A 1GUYA 1HYGA 2XF8A 3LVFO 1BXKA 3HZZA 1DO8A 2H5LA 4E2WA 3OJEA 4HBGA 5FFFA 3DTYA 3ZHBA 1G1AA 3C85A 3GZNA 3JQAA 1H2BA 4GWKA 4OH1A 4HADA 3BMNB 4KDFA 1SEPA 2JJYA 4QECA 4KDEA 5K0ZA 2I67A 3FNHA 2VWGA 4CM9D 1OOEA 1J49A 1DIRA 1SCUA 3C7CB 1K0UA 1UR5A 3JV7A 4FN4A 2YV3A 4WLNA 2GCGA 2BGLA 4RLHA 4YVFA 3W4IA 4B8WA 3LK7A 2NNLD 1ZXLA 3KBOA 4J2HA 4J49A 3A1NA 4CQMA 5DBGA 1W6UA 4DC1A 1U2GA 1X0VA 2NADA 4XDZA 4YAJA 3MTJA 1V3TA 4NPCA 4L0QA 3TFOA 1YQDA 1LLDA 3GK3A 4D46A 1YB5A 2GN8A 4F6CA 2P4HX 2HMUA 1LU9A 2BI8A 4E2XA 5IN4A 2EEZA 4QFDA 3ZW8A 2YUTA 4M55A 2CDBA 3H5RA 1EK5A 5EERA 1U9JA 2EJVA 1XR3A 4EEXA 1WXDA 3E5MA 5L4SA 5F21A 1JWBB 3VHRA 3I1JA 2Q1WA 5MGBA 3GVIA 1XWFA 1B7GO 4MKZA 3OEYA 4PG7A 5AYVA 4BGIA 3PZBA 4TKLA 4DL9A 4RVGA 2VHWA 4KTTE 4MP3A 3NGLA 5LCXA 5AQ1A 3I6QA 2PNFA 4KUEA 1D1SA 2PY6A 1T2AA 3JYOA 1PL6A 1Q0QA 3GUYA 1IPEA 1OI7A 1Z6ZA 4NBVA 4YB8A 1HDCA 1B14A 4QO7A 3V1TC 1GPDG 1R66A 1O94A 1V3VA 2X5KO 4WK6A 4NK5A 2GN4A 5COAA 4IINA 4CL3A 4MIEA 2I76A 1A27A 4RVFA 9LDBA 4PLYA 2PK3A 4W99A 3SJ7A 4GKBA 3LT2A 1DIHA 4G5HA 2ZTMA 1LRLA 2DQ4A 2WYUA 4NFHA 4L75A 4AICA 3DZKA 3GEGA 4IMPA 1LJ8A 4UREA 2D5CA 1M67A 2DTEA 2X1HA 2ZJ1A 3ONFA 2W2KB 4IIUA 3IIEA 5DCUA 1F8FA 2NSDA 4NFYA 4A03A 4RVHA 4JQCA 5ICSA 2P2SA 1M66A 3ZU4A 3L9XA 1E6EA 4FFPA 1SNYA 3N74A 4D0SA 4J91A 1X1TA 1UP7A 5T67A 1FDWA 2VUUA 1OAAA 2AG8A 3OIDA 4HXYA 2J5QA 5JY1A 2AEMA 2CF5A 1MGOA 3FBTA 3AI1A 1KBZA 2VHYA 4N5NA 4R1SA 4O5OA 2RIRA 2HLPA 3IP3A 4YAKA 1ISFA 4D3DA 1BW9B 3ZW9A 4S1VA 4HFJA 5T5QA 4XEHA 4BGUA 2NVUB 2GRAA 5EQFA 4UEJA 1GZ4A 4ROSA 4JJGA 3KXDA 3QWAA 3WMXA 1FDUA 4XYBA 4AJOA 4X54A 2FN7A 4IY1A 4DPLA 1GV0A 3JCZA 3I5MA 4KMSA 4N7RA 3H5NA 4O0LA 2JCXA 4BNUA 2WMDA 3AWDA 2Z1NA 1QYWA 1NPYA 1TT5B 3DMTC 2IZ0A 3Q0EA 1JAXA 4YAGA 4DLAA 1TA4A 1O89A 4FC6A 3CZMA 3OQ6A 3HJAA 3HADA 3WJAA 3UCFA 4E5NA 4U6QA 2QIOA 2EJWA 3A28A 4AJHA 3L0DA 4KP7A 2ZB7A 4JP2A 2PZJA 2C07A 1ISGA 5CHEA 3EZYA 1H6CA 3P7MA 1XDWA 1T24A 4JIGA 5JY6A 3AOEA 1KIFA 4MKXA 5L7TA 1P1HA 4Z9YA 1ZEMA 4R5HA 2QW8A 3MJEA 1ULUA 1DEHA 2ZCUA 4Z3KA 1JU9A 3QWFA 1KOLA 2OMEA 3NYWA 3D1LA 5KNLA 1F12A 3PXXA 1ZK2A 2DM6A 3BHJA 3ONDA 4WEQA 2P9GA 3KYDB 4DLBA 2WM3A 4GLLA 3L6EA 3KB6A 4FQ8A 5IDWA 2PZKA 5A04A 2Y1FA 3GFBA 2OUIA 4MP8A 3AY7A 2WEKA 3MWDB 5JXWA 4RVUA 2FMUA 2IEDA 3PHIA 1ID1A 3FNGA 4BMNA 4BNLA 3VPGA 3NT5A 3GY0A 1E7WA 1V9LA 1J4AA 4U0KA 4F6LA 2FY8A 4DA9A 2W90A 4B3IA 3GN2A 3SXPA 1KC3A 3VAZA 1MA0A 1WZIA 4P8RA 3DOCA 2B36A 3HHPA 3KVOA 3PPIA 2YFHA 1GTMA 2Y1CA 3HN7A 4Y6PA 4N5LA 4R1TA 3TZQA 1OBFO 5F5LA 4LVCA 2GZ2A 3VPSA 3L4BA 1ENOA 4BGVA 1VL8A 5B1YA 3FTPA 4LISA 3JSAA 5G0VA 2BGMA 1LLQA 1E5LA 3WWYA 4QSMA 3DBRA 4RQUA 1BSVA 4NIMA 3WGTA 4YT8A 3OHSX 5HBRA 3JQGA 1XQ1A 2Q1UA 4D79A 4WLVA 3U4DA 5KJCA 3RBZA 4IDBA 4W7IA 4Z6KA 4ZQGA 2HCTA 4LSWA 5TS3A 2JFGA 4GQAA 1YB4A 1LDGA 2RH8A 1DJQA 1TB4A 2X0NA 4UUMA 2JL1A 1C1DB 2EXXA 2YDYA 4CMIA 4TRJA 3HUDA 1WDLA 4ALKA 3KHUA 2Q4EA 3ZWPA 7MDHA 5A1TA 4IUYA 4CLXA 3K6JA 3F4BA 3IC5A 1LBEA 1PJTA 4FS3A 4HFMA 1P33A 1EBFA 4EGFA 1GD1O 4JX8A 3BMQB 1LDNA 1DC4A 3I9OA 4MVJG 5EESA 4EEZA 5B4UA 1LA2A 5C7OO 1O6ZA 5FEUA 3FR8A 8ADHA 5JMPA 1R0KA 5B12A 2O48X 3IUSA 4M49A 2GZ3A 2D0IA 2YHIA 1ZBQA 3RUDA 1UAGA 1U7TA 2OBYA 2EKQA 1HSOA 2EP7A 3GOHA 3V8BA 2X58A 1VJ1A 4AJKA 4L73A 1P9LA 2BD0A 3GZNB 2EGHA 5THKA 4EYEA 1PSDA 3DO5A 1QP8A 1QMGA 2VZ9A 4IJWA 5IZ4A 1MC4A 1FMCA 4LRSB 1C1XB 2IYOA 1D8AA 2J6IA 1T4DA 5JMWA 1XLTA 3KYBA 4NJMA 4DIFA 1EDZA 1ADBA 3WSVA 4J2OA 5KWEA 7ADHA 3NV9A 4R54A 3BMNA 1ISJA 4WCFC 3EHEA 2C20A 4B7CA 3EC7A 4BNNA 2Y05A 3O03A 3ZWXA 1CQJA 4FSHA 2XOXA 4Q3NA 1PU2A 2PTGA 1R4MA 3H8VA 3JQ9C 5IDQA 3UOGA 4CQMB 4FJ0A 3ETEA 1MLDA 5JCJD 3U4IA 2HAEA 4XIYA 5F3RA 1WDKA 1JW9B 4U6SA 1ZSNA 1PJ2A 3TWOA 2BFPA 1LRKA 1B2LA 2BLLA 1N5DA 5JYDA 3H7AA 3E1KA 4RJTA 2Q2WA 1PWXA 3FPCA 2OORA 1KEPA 1U3UA 1I36A 4CMJA 5AXAA 5GY7A 2NV6A 3MJTA 4LK3A 1NASA 1HSZA 4LMPA 3H65A 2C5EA 3HWRA 3EY4A 1IZ0A 2ZTLA 3I83A 2VT2A 2X9GA 5U1PA 1ONOA 1K6IA 2FZWA 1NWCA 5LC1A 4KUGA 1UZLA 3K2BA 4CODB 3V2UA 4LCEA 4M54A 4UUNA 4XRRA 3LT1A 3OICA 1I10A 3RFTA 2G82A 2IDZA 3MJ4A 4XB1A 3VH3A 2ZYDA 3MEQA 5L7WA 4R5MA 2WJPA 5H82A 3GGGA 3H3FA 3V2GA 1UXKA 2X5OA 5U4QA 3ROPA 3S1LA 2VHXA 1BVRA 1TEHA 3AFNA 3AUAA 4B8ZA 3GLQA 5ITWA 4PN3A 2EV9A 4I5GA 2CVOA 4BB5A 4ZICA 3DZIA 3LU1A 3FHLA 1HL3A 4CLRA 3ROMA 5DN9A 5L45A 5EQDA 2HO5A 5B4VA 4R69A 3QVOA 3F1LA 1SMKA 3WNVA 1T2EA 4PG5A 3L9WA 2H63A 2VNSA 4FJ1A 1ZSYA 5F1OA 4ZJUA 5CEFA 5JW6A 2O7QA 4D42A 1EQUA 1FF9A 3P5SA 2X22A 1E7MA 5LDHA 3I9NA 3I6IA 5C5IA 1GL3A 4BOYA 5K9ZA 3VDQA 4YBZA 5BSFA 1ZMOA 1OMOA 1PQUA 4RF5A 4AJEA 1ZK0A 3TRIA 1PJQA 4KUHA 1B8UA 1V6AA 4E4YA 5IG2A 1HTBA 1R0LA 3PWKA 4EITA 4YJFB 5L53A 2IZ1A 3PQDA 1QLJA 1U2DA 1B15A 1NQTA 3RKUA 5J23A 1MP0A 1Y6JA 1ZW1A 3D0OA 2A9FA 1JKIA 3LLSA 3QA9A 4J3FA 3RASA 3VPXA 2PLAA 4BNKA 2QX7A 4YJDA 4KQXA 3JQEA 1LSUA 4LVUA 5L3ZA 4YRAA 5EINA 1F06A 3GAFA 3RFXA 4PLFA 4YCAA 1LEHA 2CZCA 3OSUA 5DCYA 3PFFA 4Z0TA 3RWBA 1MXFA 5I7EA 4YEDA 3WWZA 3PLNA 4NH4A 2Y0EA 4Q3AA 4C7JA 3KM0A 1HDZA 3IAHA 4IQ0A 4XDYA 3H6KA 1PTJA 3SX2A 3M2TA 3MZ0A 4CR8A 3GC6A 4OSPA 4BKUA 5A9SA 2VCYA 4ALMA 3NTRA 1DLIA 2BHLA 4MVJF 2VRCA 1WZEA 3O8QA 4PZEA 2SCUA 4KZPA 5GZ1A 1DC6A 3U0BA 3M1AA 1KVQA 2OFPA 4E5PA 2VT3A 2FR8A 4YT5A 3E8XA 1PS8A 1U3TA 5C3MA 1ADFA 3L07A 1FDVA 4XR4A 3WJ7A 2I66A 3H4VA 4O6VA 4XYEA 4H15A 3D5QA 5A3JA 5AXBA 4J1QA 4TRRA 2E37A 5ENDA 1BMDA 1ENZA 1ORRA 2TMGA 3IS3A 3OF2A 5FI3A 2AW5A 1EMDA 5BSEA 3FPLA 4K6FA 3LC1O 3PRJA 3S2FA 3GA0A 4JK3A 2CVZA 2H1SA 5IXYA 1TT7A 1GU7A 3NX4A 4GX0A 4ALJA 2DKNA 2Q2VA 3JD4A 1R15A 1TT5A 4K6CA 3M1LA 4TVOA 2BELA 3U5TA 3CSDA 1PJCA 3GG2A 1Z73A 3WGGA 1U3VA 4Y9DA 4D41A 1MC5A 2R00C 1YONA 3E6AA 3GNSA 1L7DA 4CLEA 1DAOA 1C0LA 4DWVA 1KVTA 2CNBA 3BXXA 2JFHA 2NTNA 3DZFA 3W6UA 3UGKA 5KJ6A 4YRDA 4CMBA 1T25A 4ZRNA 3GDOA 1B0AA 1VL6A 4Q3EA 3LSYA 1H9AA 5KKCA 4D44A 4PRKA 1BRMA 4ZHSA 1I33A 3EVTA 1D4FA 2OHXA 3KEQA 3VPFA 5JDCA 2R2GA 4CL8A 3K96A 4GMGA 4J90A 1HYEA 3CUKA 2D4AA 2GD1O 3F47A 4ITUA 3S2GA 4IIVA 5CP8A 4AFNA 2QYSA 4JLWA 4BNVA 5JAQA 1YOVA 1E3WA 1X0XA 4FR5A 3EVNA 3PQEA 4NBRA 3NKLA 1EFKA 3MJCA 1PZGA 2VYNA 3MJVA 4TZKA 2ZIZA 4UVGA 4Z3DA 1EQ2A 4BO6A 3JD3A 4IDDA 4IMRA 2I65A 3OP4A 3W6ZA 3F3SA 3WMWA 4DIOA 2Q2QA 4B3JA 1WPQA 2WE7A 3DMYA 4FFMA 3ITKA 3DBRB 1KEVA 2HSDA 2PV7A 1T4BA 3JQ8A 4RDHA 5C37A 2WD8A 3VZSA 1U4SA 3JQGB 3DB2A 4I5DA 2G1UA 1ZXBA 2X0JA 5B37A 3MWEB 3INTA 3RD5A 1DC3A 3SLGA 2GR9A 1MX3A 3K31A 3JQFA 2DBRA 2C82A 4IDCA 4S3MA 2NVWA 2AEJA 1U28A 2VOEA 4HNGA 2IODA 3AW9A 3RUEA 3E9QA 1H2HA 4BUCA 4GGOA 4IQGA 4ZRMA 2DUUA 1HZZA 3RBXA 4CMIB 2Y66A 5BSHA 2GZ1A 3G3EA 4CM1A 2UYYA 3OH8A 3W1VA 4D45A 1GY8A 5K6AC 1ADGA 3DEYX 5CG2A 3Q2KA 2C7GA 3VZPA 2Q3EA 2AE2A 4RPHA 2DLDA 2W2LA 3WQSB 3CMCO 2DPGA 3D5TA 3RC1A 5TSDA 3L6DA 2PWZA 4YQYA 4XD2A 4WOKA 4HP8A 4II2A 2Y1DA 1IY8A 4BO3A 1GEEA 2VYVA 3GN1A 2YHIB 3OIGA 5GZ3A 3TZ6A 1CYDA 3Q6IA 2VNAA 2Y1GA 5TT1A 3RAJA 2TMDA 5DCWA 1PGQA 3BMQA 5ES3A 2UAGA 3WYEA 2BKAA 4L4XA 4XYLA 1Y7TA 1Y8RB 2O4CA 4ZN6A 3EAGA 1W8DA 4PLVA 2I6TA 3ZV3A 3Q3CA 4Y67A 4NJMB 4P4LA 1NFRA 3A9WA 3DONA 5KJ1A 1I3LA 4G81A 5CDTA 3TOXA 1NBOA 2DVMA 1LSSA 1E5QA 3AJRA 5TT0A 2BMAA 5C7IO 1ZEJA 3BAZA 1N7GA 1C1XA 1R4MB 2I5PO 1WDMA 4BVAA 3PDJA 1T2DA 5DNAA 3CINA 4E12A 1XSEA 4BKRA 2VHZA 3KSDO 2AQHA 3JQBA 4DYDA 3ZN2A 1EVYA 3PJFA 3ZWMA 4D43A 4B3HA 5HRUA 4IPTA 1E1KA 4AJ4A 4WJZA 1VSVA 2BGKA 2V6FA 1YL7A 3BTVA 4UVIA 3UXYA 3DFZA 1PL8A 3OMLA 3H5AA 1WVGA 2Y1EA 3QY9A 2QHXA 1UP6A 5JO0A 2P5YA 3T7EA 4OXKA 1YXMA 3STHA 3CPSA 3TZCA 1NQAO 4A10A 4E21A 1ZKMA 2E6UX 5TNXA 2Y68A 5IZCC 1KYQA 3KTDA 1E3LA 3HG7A 3QLJA 1Y9EA 1NVTA 1JQBA 4QFCA 2BRUA 2Y99A 4XQCA 3UN1A 4XKJA 2C2YA 1XIVA 1HDYA 3A4VA 4XCVA 4AJ1A 5EJ2A 1PX0A 5KIAA 3WGOA 2GPTA 1LXCA 3V2HA 2O3SA 3RBVA 1KC1A 5A05A 3UH1A 5HM8A 4CMEC 2J5RA 4CLRB 1CERA 1ENYA 4CJXA 4U0JA 3DHEA 4AJNA 3GNQA 4AJ2A 5BNIA 3QP9A 1KY4A 2IYPA 4WLEA 3VTZA 3G1TA 4IZHA 2PGJA 3WXBA 5A9RA 5HWSA 1T2FA 2UDPA 3AU8A 1BDBA 2GDZA 5COBA 4QTZA 1WNTA 1D1TA 3HDQA 4FOSA 1DBVO 1ONNA 3JQ6A 3VPHA 4WPGA 1W0CA 3NTOA 2ZK7A 4OIMA 3JYLA 1HLDA 5FI5A 4AJPA 4YYZA 3UICA 2DFDA 4JBHA 4RLSA 1N8KA 5KTKA 1DIAA 3ULKA 4TMFA 4YRBA 1OFGA 2C29D 1LI4A 1N9GA 3DZJA 1LC0A 1NHGA 3LYLA 1YS4A 5GZ6A 1L7EA 1GEGA 3ST7A 2GLXA 1BWSA 3CE6A 3AI3A 3FNEA 4J9VA 3GRKA 4WLOA 4YJFA 1EDOA 1QYVA 3DMTA 3H3JA 1ULSA 2A92A 5DOZA 1QKIA 3PHGA 3WYBA 5JDIC 3G0OA 1CEQA 2AE1A 2WD7A 3ONEA 4MVJE 4OJNA 1A4UA 1BG6A 1GCUA 1DHRA 4E33A 4CUZA 5A9SB 4WLFA 3H9EO 4OXYA 3E18A 4WOJA 3ANMA 2FPPA 1Q2XA 5KJFA 4WASA 3O8QB 2VOJA 4NG5A 2FP4A 4CM7A 3MCVA 4K1LA 4MIYA 4XIJA 4XJSA 3SJUA 3ZWBA 3K73O 4XA8A 3TJRA 4PVDA 2A94A 3HFGA 3K8ZA 3D64A 4GMFA 4FGWA 2O3TA 2P5UA 4CLDA 2W4QA 3E03A 3U4CA 3ETGA 1EVJA 2IZZA 4IDAA 4CV0A 1E1NA 4GSLA 4MVJP 5TJHA 3ENNA 3D4PA 1B8VA 2GSDA 3GQVA 1P74A 4RF4A 1E3JA 4YT4A 3IKTA 3P2YA 3ANNA 1K6XA 4B7XA 3ZU2A 4NR0A 2FOIA 1A4IA 1AE1A 2EKPA 2VUSA 1P31A 4LW8A 3TZHA 2B5VA 3GDFA 3GEMA 3BMCB 2Z95A 4L4SA 3LF2A 3PYMA 1P77A 1HRDA 4M89A 2OZPA 3VH2A 1C0IA 1YBVA 4FB5A 5L4LA 1J0XO 3FF4A 3PIDA 1HDOA 4WGGA 3WYCA 4Y6SA 1NWHA 1RKXA 4MVJH 4FW8A 1R4NA 3ON5A 5G0UA 2F00A 4OHUA 5KJEA 1ONPA 4R51A 1CQIA 5TGDA 3ZWNA 4A2CA 5IXSA 1CWUA 1ISMA 3OETA 4F45A 1Z75A 3IQDB 5KCZA 5AOVA 1PR3A 3FCOA 1U5AA 2IXAA 1DXYA 2UUPA 2J3JA 1GFSA 1RM0A 2V6MA 2D1YA 4R1UA 3FN4A 4EUHA 4J7UA 3RFVA 4K28A 3QE3A 1IL0A 3JQAD 3QVTA 5MDHA 1FJHA 2BFAA 2Z1MA 1RM5A 4A73A 3QVXA 1ZFNA 1DOHA 4JGBA 3WTBA 1PL7A 4RV9A 3TNLA 5CFZA 3S55A 5I7FA 1YOVB 3WGQA 4OYRA 1E3WB 2FR0A 4MIOA 3PTZA 1ML3A 2O3RA 1UH5A 4LN1A 3V1UA 1SO8A 3BTUA 3GVXA 3HDYA 3OIFA 3ZNNA 1DFIA 3DWFA 1YB1A 3K2EA 3BMOA 4CQMD 1WP4A 5DF1A 2I9PA 4YTEA 3OECA 1UJMA 3GDGA 1ZMTA 5I9LA 1N7HA 3JD2A 3JQ8B 5ITVA 4W9NA 1E77A 1EVZA 3NT2A 4BV9A 3S2IA 3F5QA 4HX5A 4ZQEA 5ENVA 2DPHA 3VTFA 1F14A 1Y81A 2PD6A 4L8VA 3C8MA 4I8XA 4P4NA 5BNTA 5JCXA 3O4RA 3KYCA 3NUGA 4HV4A 5JS6A 3INGA 4R9SA 1FXSA 3FWNA 4DRYA 2C54A 4GGPA 4R3NA 3UF0A 1EUCA 1IHXA 2Z5LA 2ZYGA 3GFGA 3K5PA 2V6GA 1I32A 2DU8A 3BIOA 1V35A 3HDHA 3FTNA 3B1KA 3H2ZA 2EF1A 1X13A 2UVDA 4NK4A 5G0TA 3WFIA 3COSA 1SBYA 2H6EA 1A9ZA 4J1NA 5TRTA 1C0KA 4EJMA 4L76A 4YWJA 3U9LA 3PI7A 2CVQA 4XJTA 4WCFA 1Z45A 4JBGA 3WS7A 4PLGA 4DXHA 2EHDA 3GMDA 1AUPA 3ZH2A 5JC1A 4H16A 4DMMA 2VQ3A 2HK8A 3EW7A 2AQKA 4CV1A 4GI2A 3G1UA 1ZCJA 4NDNE 2C7VA 3WICA 4UVHA 2PGLA 2W98A 2WTBA 3JQ7A 3WLEA 2ZQZA 3X2FA 4R01A 4QEDA 2NU9A 4FFNA 1PGJA 4I5FA 1O8CA 5DT9A 3DC2A 1KVUA 5BR7A 4Y98A 4W6ZA 2AG5A 2FR1A 5CDUA 1GYQA 1E6UA 3RKRA 1B3BA 4ID9A 1N1EA 1ZO8A 4A5OA 2DBZA 3PQFA 4JROA 4C4OA 4XB2A 1NR7A 2BH9A 1M76A 4KTVE 5T8KC 4Q9NA 3MOIA 4NI5A 4IM7A 4DPKA 1Y8RA 3L4BC 4IS3A 1YJQA 3IL2A 1PS0A 1LX6A 1VRWA 5TF4A 4OOEA 2B69A 3GPDG 3ZV4A 1V0JA 1EFLA 4HNHA 4BNHA 1UXJA 3F9IA 4DYVA 3ZHXA 4TZTA 3PWZA 1E1LA 2RH4A 3L6OO 2HRZA 3H9GA 1VL0A 2P9CA 1P3DA 3WGYA 2BF7A 5TIIA 3BTSA 3RUAA 4Z0PA 2DT5A 3HB4X 3TZKA 3GUCA 3DBLA 1HE5A 2NACA 1AGNA 1UXGA 1UXHA 5JFOA 1NPTO 2NWQA 1EEHA 4J6FA 1D7OA 1F8GA 1PJSA 3DDNA 3MJSA 4J4BA 4A26A 2ZJ0A 4FD3A 4CM4A 4L74A 2JD0A 4BKQA 3HNPA 4PVCA 5L9AA 1U4OA 2Q45A 3AOGA 3EZLA 4GX2A 2V7PA 3Q9NA 1G0OA 3EYWA 4RO0A 4GVXA 4YJHA 3JD0A 5EMHA 1NM5A 4IXWA 4YJGA 5F1PA 2X0IA 1Q0LA 1PEDA 5L7YA 1YRLA 2QYTA 3LZ6A 4BKOA 1HYHA 4DBVO 4DQUA 2JD2A 3ZV6A 3RJ9A 2B4TO 3CKYA 3GR6A 1PZFA 3SLKA 4J4TA 3ROQA 2OGUA 4CMHA 3OQBA 5IDXA 2CF6A 2WSBA 1X7GA 2G17A 5CG1A 4E2ZA 1RM4A 1LNQA 3NRCA 4BQPA 2NVBA 4Q3CA 4B79A 4KWHA 5I9NA 4UAGA 3TL3A 4XQGA 1HXHA 1K5HA 3GGPA 4O63O 1I01A 1KY5A 2PR2A 4M86A 5KVQA 3I9JA 4ZQFA 1K3TA 5DDIP 1BGVA 5JNLA 2YZ7A 4J4HA 3ZWWA 4D3FA 4DC0A 1ADCA 2ZKLA 3D3WB 4FJ2A 4TVBA 4NHEA 2G5CA 4NBWA 2AMFA 2IE0A 1RPNA 3SVTA 3L4SO 3RU7A 4RVDA 1N92A 5TLSA 2NTVA 3IDSA 1D3AA 1AHIA 1N9GB 4JP3A 3PJEA 2PKQP 3LT4A 5DBIA 4EJ0A 5I7SA 2JCVA 3B20A 1I2CA 4JXKA 3AM5A 2LDBA 3CMMA 2JHGA 4RCVA 3T7CA 4ND2A 3GVHA 2AXQA 4G2NA 3QWIA 3OJ0A 5CDSA 2POQX 4CR6A 1XGKA 1W4ZA 4LRTB 3S8MA 1AXGA 2BFMA 4FC7A 2WD7B 4BNJA 2WYWA 3WNQA 1P44A 1NP3A 3GPIA 3VDRA 4Q3BA 2Q99A 4WLUA 3HQ4O 4ALIA 4PLTA 1WWKA 1C0PA 1NYTA 2HMWA 4RPJA 3ZZNA 3AUTA 1GQ2A 4NBUA 3GF4A 3GHHA 2FSVA 3AU9A 4RGBA 3ZNPA 1YQXA 4LCJA 1G0NA 1WW8A 3C7DB 3WOHA 4OMUA 5F5NA 2RBEA 4IGFA 1LTHR 1MG5A 4RZIA 3WGHA 3ORFA 2EWMA 1I5RA 3ZV5A 4RORA 4CM9A 5TX7A 4E2YA 5JYEA 2Y1OA 4ZA2A 2D5AA 4BNZA 1ZJZA 3AFMA 3AI2A 1VC2A 3WIDA 4OM8A 3H2SA 1R6DA 2O7SA 4I5EA 1YKFA 1HETA 3G79A 1NPDA 3HDJA 4R16A 3V5NA 2DTDA 1S7CA 1DDOA 2DBQA 2YYYA 3Q9UA 5ADHA 1P1FA 3C24A 3PDUA 4YQZA 3B1FA 4UEKA 5CEJA 1U1IA 3GVPA 2O50A 1DSSG 4E13A 2HMSA 3LQFA 4I9HA 1M75A 1YH3A 2WDZA 1R4NB 3P2OA 3HN2A 1YL5A 3V1YA 4DMLA 3BMCA 1XU9A 2I3GA 3PGJA 1QRRA 3D4NA 3AY6A 3B70A 1GADO 1QORA 2O2YA 5G4LA 1PQWA 1XA0A 3QVWA 4F3YA 4QX6A 1SPXA 2EGGA 1I0ZA 1JVSA 3FR7A 5ICMA 2D8AA 3C3XA 1OC4A 3AM4A 3AUSA 1VJTA 3KO8A 4FPXA 3RUCA 1GR0A 1RYDA 4QO8A 2OOSA 3QRWA 3WLFA 4J9UE 1QG6A 3DOOA 4L9RA 3RUIA 3QHAA 3EUWA 1HF3A 1VKOA 3SC4A 3NJ4A 1O5IA 4AVYA 2QRJA 2BI7A 1U3WA 4DVJA 3E5RA 3RJ5A 4GWGA 1PJ4A 4GSKA 3W8FA 3FSRA 1VSUA 4TQGA 1YGYA 3I52A 4BS9A 4CM3A 3WB9A 4WECA 1E7YA 3R3JA 5T6BA 3PHLA 4E6PA 1YWGO 4IJVA 3GVCA 1ZIDA 3BMOB 3Q1LA 2X6TA 2I99A 3IJPA 1GV1A 3WQRA 4GAEA 3OJOA 3ZI0A 1A9YA 3CIFA 3WGZA 1BHSA 1EE9A 4GBJA 1RJWA 2Y67A 4GKVA 5EIOA 2VRBA 1RM3A 4HUJA 4NJOA 1A7AA 1GYRA 3CTMA 1C14A 3QJ5A 4OL9A 4PG4A 4MDHA 1M2WA 2NU8A 4PCVA 2J3HA 4W82A 3ZWAA 1GUZA 1UDCA 2VZ8A 3EK2A 3KYCB 2O3JA 1GUFA 2C0CA 1ZVMA 4N18A 4N54A 4WE3A 1X7HA 1P1IA 4QQRA 2GGSA 4MVJA 1QV6A 2B35A 4OQYA 2JFFA 2OP0A 1XELA 4J7CA 4CV3A 1CDOA 5H83A 1HDRA 1ZZEA 2B37A 4YAEA 1VM6A 3KZVA 3RC2A 1B3RA 4IJKA 4R68A 3I3OA 2AA3A 1QR6A 4FDAA 2Y0DA 4I9UA 4WCFB 5BT9A 1U5CA 3EGOA 3ZWOA 3GAZA 4PRLA 3ADPA 4E5MA 2IRWA 4E5YA 2X9VA 4JCOA 4FOOA 2YJZA 3KUXA 3OFSA 1NAIA 3HSKA 3QQPA 1VE9A 3NDJA 5I7VA 3JQ7B 2RHCA 5JDCC 2ILTA 1JKJA 1NQ5A 3M2PA 2PA3A 3ZHYA 4E5KA 5A06A 4NBTA 4NU6A 4RVSA 3RI3A 1BDMA 2CDAA 3OJFA 3W8DA 3OA2A 4ND5A 2AHRA 2WYVA 2O4UX 4M87A 4Y6RA 1ARZA 3DHNA 1LUAA 3CXRA 1LQUA 3H9QA 1EZ4A 5EN4A 4KOAA 1PGOA 4W7HA 4CM6A 4DBZA 1QYDA 3ZGYA 5CDYA 3U3XA 3W8EA 4XQEA 3DL2A 3ZNQA 2HRBA 4LSMA 1LRJA 2NU6A 3ASUA 1CRWG 4UEOA 1A71A 4R1NA 3N7UA 4BGEA 1ZK1A 5IZCA 3QWHA 1KEWA 2B83A 3O26A 5JSFA 4FFRA 4JBIA 3D4OA 2QZ9A 4QUKA 3JYQA 3LF1A 1MUUA 1SZJG 2FPGA 1TLTA 3BZUA 2OL4A 3JQFC 4Z9XA 5JE8A 1O95A 4INAA 4WNIA 3ICCA 4HY3A 4GLOA 2VWQA 5JO9A 3ASVA 4AG3A 5COQA 1R37A 2QZZA 3B6ZA 3DBLB 4N5MA 5L51A 2YV2A 5JBIA 5AXCA 3QWBA 5A5EA 4CMEA 4ZVVA 4P4GA 5KVCA 2RHRA 4CPDA 3E9NA 3CZRA 3GNTA 4CM4B 2YDXA 4YACA 2UUOA 2OBNA 2VRCD 2JCYA 4RZHA 3AY3A 3K30A 2A35A 3OEWA 3BA1A 2X23A 5G0SA 3UCXA 1SC6A 2P68A 1B8PA 1JWAB 5I8ZA 3WIEA 4OGWA 1EE2A 2NLOA 3TN7A 1JAYA 4EZBA 4YJHB 3F6YA 1MFPA 1IULA 1DAPA 2P9EA 4YJGB 5L40A 4CLHA 1QYCA 3BYZA 1KERA 1Y8QA 4LMRA 3K9QO 4B4VA 3U4HA 1F0YA 1UDBA 2B4RO 5BNFA 2DAPA 3FWZA 2BFOA 3GRPA 3DAFA 4RF3A 3WSWA 2QG4A 3U62A 3R3SA 4R9RA 1P45A 1A5ZA 3WFJA 1BXGB 5G2OA 1ZNQO 1DHTA 4IDFA 3RIHA 4F46A 5G4KA 1X14A 4DPMA 1GQQA 4BO8A 3JTMA 1VJ0A 4BHTA 3PGXA 4U5QA 1E3SA 1LLCA 4OKIA 4CM8A 5FWNA 1MFZA 3OA0A 4BO4A 5JDIA 3IKVA 5TC4A 3KEOA 3DAGA 4ND4A 4XZ3A 2IEBA 5AXDA 2PD4A 2PFGA 3VKVA 1NVGA 4U8GA 3IMFA 5A4DA 4OSOA 1TXGA 1GPJA 4J0EA 4YT2A 3WGIA 3EMKA 2CFCA 4U7WA 4JJFA 4YXFA 2JAPA 2H9IA 3TOZA 1YBMA 2GF2A 3KV3O 4BNYA 3WBFA 3ZU3A 3JQBC 1H6AA 4G65A 4PGFA 3D3WA 4BO2A 4ESOA 3ABIA 1XKQA 1LDBA 1Q7CA 1DC5A 1YQGA 2PKQO 1I2BA 2PKRA 3GT0A 2EP5A 4BNIA 3U09A 3KLMX 2J3IA 3IJRA 3PLRA 2VTDA 2XXBA 1UDAA 3PWSA 5BSGA 1EUZA 2PH3A 4ALLA 3RU9A 3VZRA 6ADHA 5HTOA 3GMSA 1PWZA 1UZMA 4RQTA 3UKOA 2ZTVA 1B16A 4B4OA 4XX0A 2E4AA 2VYND 1FDSA 4XWYA 2X0RA 4BNXA 2O3QA 3GGOA 1LDYA 2C5AA 4E0BA 4J1TA 5FF9A 2PGDA 2O2SA 1DRUA 1NAHA 2B5WA 5EPOA 4DLLA 4NMHA 1E7RA 3RCBA 4MPDA 1DJNA 5F1KA 2CMDA 2DC1A 3PIIA 5DBFA 4H7PA 4E32A 4DQXA 1Q7GA 1XU7A 2ZATA 4MVJD 1ZUD1 1GZ3A 1Q7BA 2CD9A 3NTQA 3A14A 4B4WA 4MVJI 5A02A 2YHUA 4P38A 4EJ6A 3PVZA 4J0FA 1XG5A 4BNGA 5JCJA 3KLPX 3DXFA 3GZ4A 4TKMA 4URFA 1H0KA 3F4LA 4TRNA 3ICPA 1YDEA 4EBFA 2Q1SA 1WMBA 5IFLA 1WLYA 4I1IA 5IJZA 1E7SA 3PP8A 5IDYA 1ISIA 2W2LD 3WQQA 5TQVA 1HWYA 1PGPA 2AEFA 3NAQA 2VHVA 3MTGA 3WG9A 4FIZA 2VTEA 3PK0A 3DBHA 4MKRA 5JPIA 3LDHA 3TSCA 3ZWCA 4EUEA 2VYVD 4CLOA 1NR1A 3IOYA 4BO0A 5HS4A 3GEDA 4B7UA 2EIHA 3G49A 2V6BA 1PR9A 1H6BA 1PJBA 2EG9A 2J8ZA 3C1AA 2EERA 3C7AA 4IXTA 3VVCA 2G76A 4ALNA 4A0SA 1BXZA 1JLLA 3CEAA 2XAAA 3C1OA 2FZEA 2V65A 3GHYA 4D0RA 1GDHA 1HKUA 1E7QA 1P0CA 1EUDA 1ZH8A 2JAHA 1PJ3A 3GG9A 3M6IA 4RDIA 4BMVA 1K2WA 3DZGA 5AVOA 3BHIA 3KSZO 5H81A 3ZWYA 2ZYAA 2CUKA 5C7LO 4PLWA 3VH4A 3RQSA 1NTOA 1PS9A 2HQ1A 3VC7A 1DRVA 1PZHA 3WTCA 1Q0HA 3F5SA 3NDIA 4H3VA 1KVRA 2D59A 4W4TA 1E3IA 1ISHA 3R0IA 2ZQYA 2X7HA 4BO1A 5JAMA 1DB3A 3TL2A 3F1KA 1KVSA 1VPDA 4J7XA 3TDKA 3ETDA 3RUFA 5DP2A 4DTIA 2RCYA 1CIVA 1KETA 2PZMA 5CPBA 3ZWVA 3UW3A 3O38A 5T57A 5KVVA 1T1SA 2EW8A 4PLCA 4PIVA 5IF3A 3VZQA 1JA9A 1TI7A 3WX0A 1HEUA 3CH6A 1YL6A 3LT0A 5JC8A 5LDGA 1LDEA 4NQZA 4RL6A 2CSUA 3OQ1A 2NUAA 1UUFA 3F46A 2HMTA 1MG0A 1XHLA 2XXJA 2W8ZA 1Z7EA 2E48A 3AOEC 1HE2A 5IN5A 3NT4A 3PHHA 2OO5A 1NVMB 4IS2A 2C2XA 3G17A 5U9CA 1HZJA 4EUFA 2VN8A 1WMAA 4XQ9A 4JNKA 1U8XX 1M6WA 1V8BA 3PJDA 2ET6A 5T8KA 3HE3A 1YJ8A 4TRMA 4CMAA 1ZK4A 4BNTA 2PD3A 3MOGA 1OZAA 2B4QA 4IJUA 3PJGA 2X4GA 1P1KA 4WNCA 4MO2A 5JAZA 4YPOA 3KETA 4BNMA 3WDSA 3PFWO 5IAAA 5B4TA 2DFVA 1KS9A 1QXSA 4M1QA 2QRKA 4PFJA 4CMKA 2EKLA 2WE8A 3R6DA 3FI9A 1X1EA 4J1SA 4FBGA 4TSKA 1Z7BA 3T4EA 2Q1TA 4O1MA 1SOWA 5JLAA 1DFGA 1JN0A 3D3EA 2NQTA 2Y93A 1E92A 4FGSA 1L1FA 3QIVA 3JQ9A 3R1IA 2RAFA 3A06A 4R41A 3D7LA 2O3UA 4IGEA 4Q39A 2FSSA 3I4CA 4XYMA 3JYNA 5L95A 1Z74A 4LGVA 2FRDA 4P22A 2YFQA 3H9JA 1Y5RA 1VKNA 2I3AA 3FNFA 3I9LA 3EDMA 4XGIA 4NFSA 1PGNA 1WAMA 3UHAA 4E31A 1EK6A 1CJCA 3INRA
chains in the Genus database with same CATH superfamily
3UVEA 2RKWA 2VQFB 3MCZA 2XMQA 2O8BA 3IEKA 5FYDA 1N6NA 3L8MA 2A5LA 2H2GA 4L3OA 5IYZF 2QTFA 3PF9A 5HJ2A 3RSHA 3SSAA 3WKEA 1YJXA 4ZP1A 1N3IA 4MP6A 2O57A 4PBSA 2VXBA 3AEQB 4TTIA 4LC1A 4TROA 1TJYA 4FCCA 1UL1X 4MUHA 5BWMA 1M54A 3KTAA 2QVXX 1FDTA 1R0SA 2HSGA 2Q49A 4Q7EA 5DM0A 2IOQA 4G1MB 5BOVA 1H5QA 1GZHB 1QOZA 4H0NA 3UAGA 1W19A 3HVRA 2JVJA 4HGNA 4WESB 3IBSA 5H68A 1EJ0A 2IWHA 3MRXA 3V4ZA 1NXWA 1MW9X 1NI4A 4MJXA 1R12A 2B1JA 3JQAB 3DQZA 3SHTA 4C5AA 1E2PA 1GTG1 4X1IB 9LDTA 4V03A 1QSGA 2ZJ4A 3PEWA 1FC0A 1G5FA 3NAZA 5E95A 5F9FA 2HW8A 3ND5A 5BWNA 2QT1A 4C22A 4U39A 3FUWA 2ZBPA 421PA 2FEXA 1N2SA 2X2EA 3F2IA 4RPLA 2UVPA 5TY0A 3GT7A 2G1AA 2ZB8A 3QUAA 1C50A 2YQ5A 4UUPA 3AP2A 2P5TB 4TYMA 1OHHA 13PKA 5HF5A 4HX9A 4YXWA 1UQRA 1DAGA 1F17A 4HKTA 4BEVA 1RC8A 1XVTA 2VZEA 1CFZA 3IQEA 2ZJYA 3G7SA 3HKBA 4LF8B 3UFXA 1Z8FA 1GPNA 1MJGA 3LC2O 1BS1A 3RHTA 3HBLA 4H6PA 4ZT2A 2JAXA 5TGTA 2EFEB 2W9XA 4OB6A 5NLLA 1KNXA 3ICWA 2GAIA 5I7HA 3HP7A 4ZQBA 1GCOA 2WFLB 4Q47A 1Q1NA 2WJJA 3PC3A 4X5OA 2Y71A 1JA1A 4QQ8A 5TMEA 3X3HA 2J0UA 1FFXB 2WWRA 4ACAA 4D4LA 1W94A 1IHPA 3ESQA 2CXPA 3FCCA 4BKMA 1CRQA 3F5FA 3THWB 4B3RB 2MYTA 1UBKS 5LXTB 1VJ5A 2EL7A 2XA9A 2H1HA 1BXGA 1GVNB 4I9GA 1B6SA 2JD1A 2QVGA 2DLCX 3EVFA 3GFFA 1XZHA 5KVSA 4JJEA 4I46A 4I1RA 1FP7A 2EAUA 2ZJ5A 1GILA 2J3MA 4TXNA 1Z0ZA 2X8LA 3ZLJA 4X41A 5HUHA 4KI0A 4MR8A 4ENSA 2GCIA 5C52B 4FWTA 2VWHA 1PNQA 4IG9A 4RPKA 2A7XA 1ZJYA 4ZD6A 4JSRA 5D6OA 2CJXA 3PR1A 5FQNA 2HJSA 4JXXA 4YJ3F 3WL7A 4GF5A 1V3QE 2YUIA 3BQMB 1IONA 3EFHA 5D8DA 3MLEA 4R8MA 2GN9A 2HF7A 5TPWA 2F3RA 5EIWA 1SAYA 1PFKA 5TPZD 4GZLA 3TAUA 4F56A 2ZYVX 4V3BA 5CDFE 5IABA 3TCXB 4EBBA 3ZHUA 2F2TA 4FNAA 4JSTA 4RKYA 2Z09A 2ACEA 2ZVJA 1YI0A 1XTBA 2IPXA 3G8DA 4PAGA 4LX0A 5JV5A 1T1RA 1JLRA 2WIFA 6REQA 4W5NA 5IAOA 3EA4A 4CBVA 1LLUA 1TCVA 1VMAA 1U7HA 4DIKA 5KYYA 1JFSA 1AGYA 2MMGA 3DUFB 5JAUA 1MB4A 5JD3A 2JBWA 1FK8A 2AX4A 4HDNB 4EA6A 1CS4C 1ZN7A 2DOKA 2GUGA 1QFMA 3QFFA 4HWKA 4LMBA 3V3KA 1T6YA 2VHQA 3CLTD 3QV1A 1U8AA 4M53A 3LLVA 4Z6KA 2ZI3A 3I34X 4FBLA 1A95A 4KO1S 4L2IB 1RIIA 2UYGA 5DM4A 2AQ8A 4O02B 4BFVA 4Y0VA 3JALB 4YS6A 4AY5A 4IQFA 3ZDCA 3OBBA 3JATA 3G13A 2F48A 4EHDA 1GCGA 4TV8B 2OK8A 3P2JA 1Y7HA 1Y5NA 4LF5B 4BL5A 4HAYA 3COVA 5EL0A 1AXEA 1B0PA 2L2QA 2P78A 2O07A 1A72A 2V7UA 2IS1A 1QYXA 2GK6A 2LPMA 3TIGA 1TTTA 2Z6AA 4BV8A 1OWLA 4ENVA 1JHVA 4I6GA 4EW6A 4PRZA 3ZDAA 3LK6A 1NXQA 5DHFA 4Y9UA 2CE7A 3VOSA 1AQUA 3AT1A 3LGSA 3DFUA 2ZREA 2B8EA 5AOAA 5HOEA 1Z4QA 3SVTA 1OFUX 2O23A 4WEOA 3GB9A 4V0QA 1NFQA 3KPYA 2CDCA 2GN2A 1JHZA 3C5VA 4R6WA 4EDFA 1J1IA 1RXUA 1OVMA 2H7CA 1WSBA 5FUXA 2X9QA 4TTVA 1SB8A 5LBIA 3FOZA 3C8ZA 3OQVA 5K8VA 5ECWA 4X90A 3VO9A 2NO4A 3GGSA 3M83A 4L6AA 2WTEA 2O8EB 1K6EA 1G6KA 2WKPA 2XKBA 1QO7A 4BU0A 1OFIA 1N5MA 1PR1A 3EEIA 1UPAA 1DNPA 1SFRA 1T26A 2J1LA 3MS2A 5KPDA 3BHMA 2PNJA 2AK2A 1JDVA 5FV7A 4DRZA 3R9IA 4BZZA 3DAPA 2OO7A 3AEYA 4RJJA 4U00A 3N58A 3ZIAD 3DBHB 4E22A 1ZD4A 2I8CA 1C4XA 1SUSA 4ZRDA 4CRWB 4YUYA 1P0FA 4MJ3A 1U7ZA 5C5DA 1KJWA 3KZMA 1F1BA 2NVUA 5FLXA 3KT8A 1LSJA 3ROKA 3UH0A 1N9KA 4RY8A 4B40A 5JARA 3R3HA 4M1EA 4Q7KA 1AHNA 4R8SA 1UPCA 5J5CA 1CF2O 1PZEA 4GL4A 1L7PA 2O1WA 3Q3IA 3URKA 2V97A 2XPCA 3NNDA 1C1YA 1I7NA 3EPPA 5EMNA 3GLVA 4IBOA 5DRYA 5IAGA 4LDAA 3TOCA 4A27A 2VPTA 1V71A 3L6BA 3PEUA 3V9PA 5CAEA 5ICEA 2QPTA 3ZBPA 1M2VB 1VBNA 3AJAA 2NO0A 1KJIA 5AKHA 1LFAA 4WUVA 5JS2A 2VP5A 4G0NA 1O0SA 4LGYA 4UBOA 3VKGA 4G6ZA 4K6OA 4RXMA 4B4UA 3CJQA 5F77A 5DNCA 2P4QA 3CZAA 3KHKA 3DW1X 3PFGA 3SY8A 1JQ3A 1M2OA 1YDWA 2PH5A 3FD8A 4UULA 1ZIXA 3A4LA 2FSVC 4DCGA 2R1TA 5AW1A 1RQGA 3MN1A 2Q8NA 4KO2S 1GAEO 1REQA 5DK4A 4ND3A 4FVTA 2EKBA 1W52X 3EW9A 5C8ZA 2C78A 1UM9B 2D7CA 2VUTA 4LHSA 4AMYA 4B6GA 4FDUA 4BNWA 2Q9BA 3I4FA 4DBLE 4G8BA 1GFZA 4MWGA 4UBJA 3TSAA 3IPRA 3Q5DA 5KYWB 4L4RA 1VMIA 4KWCA 1CS0A 1W1UA 1DPGA 3H84A 3QVSA 1B00A 1HMYA 1I3KA 4K05A 1M0SA 1OLXA 1Y5MA 3C6BA 3Q7SA 1VOTA 1L8OA 4AKIA 3KYDA 2XOKA 1ZK3A 1T0IA 2C92A 3CURA 3E5HA 4WACA 5JU6A 1QIFA 3G0GA 3SQMA 4ZT7A 3UKJA 3O8LA 4KXYA 1D07A 3PXEA 4PZUA 5IAJA 4BX8A 1S96A 3PV0A 1BQ3A 2JIQA 3AFGA 3F2VA 4JR0A 4CMCA 1PJRA 4X3PA 4NESA 4BRUA 5DK6A 4WBNF 4W5JA 3KOUA 3TXAA 3T54A 1SC9A 3U7EB 1I5OA 4K9DA 3PC8C 4ZQHA 1RC0A 3ENVA 1S6YA 5EIEA 4B3TB 1SB9A 3OHMA 1N2XA 4JZKA 4TWRA 1BJRE 3NJ8A 1KO8A 1NQOA 2WM9B 4I3GA 5LOVB 3FOBA 2F3UA 3QYFA 4OBXA 1N2OA 1KP2A 2JJ1D 3DT6A 1XXHA 4F9FA 2QI9F 1XUOA 1RABA 2I80A 5JWOA 1TUGA 2IPLA 2OPHA 3NDPA 1IYZA 1NXTA 2GHRA 2K7FA 2FW6A 5EXTA 1DKMA 3C7TA 1OFUA 3DKVA 2X86A 2R6CA 3RRBA 2VQEB 1XQ6A 4PLHA 1FZQA 3QU2A 3W5JA 1N6PA 1BTOA 1JKFA 3MFYA 5KSZA 1DRJA 1ZQ1A 1DG1G 1RKQA 1BVUA 3B78A 3HWWA 4JOBA 1I4EB 3E3MA 2P9TA 5CXUA 4CTKA 1LNSA 2ARKA 4W5HA 2HSWA 2OP1A 4FN5A 4IW3B 1SCAA 1XHFA 4CHGA 2OXEA 3LDAA 2E49A 3DO6A 1CUCA 1RMQA 4F3CA 2HKIA 5TGZA 4AS2A 2G4VA 3FBGA 3IOBA 3C2QA 4X1OA 2A1TS 1NYLA 4L72A 3MTDA 5JISA 2NTJA 1BVHA 4HTFA 3L05A 3SHOA 4WKNA 4CEJA 4MVJM 3PYLA 1IOLA 4DT1B 5BQFA 1C1DA 4XRGA 3Q8KA 3ZZUA 4ZZ3A 3WKDA 5GMOA 3AM3A 3L77A 2CLEB 1RPZA 1ZA2A 1CETA 2W6PA 5J2TF 1JU3A 3VU9B 4Q3DA 4WIAA 2Q3DA 5CFOA 4BXOB 4D97A 2HCJB 2IEIA 5KOHB 3W9UA 2LDXA 2P3OA 2PYDA 5T6MA 1Y98A 2A2ZA 4BP3A 1GRRA 2ZSEA 4AKHA 1MHTA 1GL7A 4HFRA 4TMYA 4RADA 3TMYA 4AF8A 4LPSA 1NBIA 4DREA 3K32A 2B4AA 1L7RA 2WT9A 4US1R 5B6PA 1FDRA 2XUDA 1I3NA 2XDAA 3GLTA 1NVFA 4OQZA 4XDHA 5HR5A 2XTNA 1W1WA 1YUBA 3EAFA 1ZN8A 1QE5A 1AK1A 2H5LA 2YFYA 4O1IA 2CEKA 4HQRA 2QYHA 1I7LA 1GRCA 2JAOA 4HBGA 1JQLB 4IHKA 5TQ0B 4D57A 1KDTA 2ZOSA 1J22A 5G02A 4GWKA 2E3JA 4I55B 1XFDA 4DS3A 1JR3A 1TU4A 2JJYA 5IEBA 5G53C 1WNFA 5EJAA 4KDEA 2F9FA 2K7ZA 4LYEA 5K0ZA 3U7QA 1EE1A 1VMEA 3DV0A 3FNHA 3PKIA 4GOLD 4RIIA 4CM9D 3ZCPA 2G3YA 4IG4A 4GNKA 1D6NA 1J49A 2PL1A 4HAXA 1K0UA 3WJ2A 1WV0A 4DM4A 5IDVA 3ZE7A 1KJNA 2C5SA 3DMHA 4FN4A 3KJEA 4RLHA 5JJ5A 3TPZA 1BEEA 1PVVA 4PC6A 1MQ8B 4LSGA 3KBOA 6ABPA 4J49A 1L4MA 1QKJA 4OK5A 4GYKA 5AQEA 3EC2A 1WXEA 3T3IA 3S8EA 3JZDA 2GBGA 1FZTA 4MWBA 1V3TA 4L0QA 4IO0A 4W9MC 1VSTA 1DO2A 2Q0QA 3GLKA 3C3JA 3AJDA 3VBEA 2HMUA 2P4HX 2BI8A 3LBIA 3HDTA 2EEZA 4JWTA 3N2KB 1R3UA 3M9XA 4N5HX 3PSAA 2YUTA 2V6IA 2HTFA 4M55A 5HCIA 2QAGB 1DV2A 1GG5A 4KE7A 1MCZA 3CUYA 3W3AA 1EK5A 4MQ4A 3FHCB 4RFVA 3SD7A 1J25A 1H8HD 1YI1A 3GEEA 3E5MA 1Z28A 4C9BA 1JWBB 1P4RA 1T3HA 2NU7B 4MCJA 5AHXA 1K7YA 1KEKA 3TPFA 1Z35A 3UB3A 4AMBA 1JEDA 4KXXA 1U3FA 4N40A 4DV6B 1X8KA 4FFWA 5BQPA 3OEYA 2B2CA 3R5FA 5BXYA 3ENZA 1E3MA 1EHCA 2VK4A 1DKLA 4MRVA 3M6LA 3VYSB 4EQZA 1KE2A 3LHKA 2NG1A 2Q5IA 4KNYA 2G6BA 1FRVA 5BN3A 1AQLA 1IUOA 1Q0QA 3GUYA 1VHTA 2OPBA 3GAMA 2FZVA 4NBVA 3GROA 2JI9A 4FFBA 4RPCA 4ME6A 4QO7A 5AVXA 2GZHA 1E9BA 2JI4A 3QTTA 1IZZA 1UFKA 1GPDG 2DWUA 4ER7A 3L4JA 1O94A 1Q21A 2VDLB 1EXWA 2GH1A 2I1VB 3QTLA 3SZ3A 2CHVA 4DWWA 4NK5A 2DY1A 5COAA 3KVYA 5DTIA 4MIEA 2I76A 3QFHA 2O2HA 1KIAA 3MINB 4JMPA 4AZVA 1GZDA 3SU8A 2G07A 1Y3DE 4GKBA 4P3YA 5ALZA 1YASA 2OGZA 4RIEA 4JI6B 2IA5A 2ZTMA 2IU0A 1VYUA 1PFVA 5FV4A 3KQTA 4K9NA 3EXFA 4N3GA 1BHJA 2ZTHA 3EXAA 5FOWA 1QRUA 5HM6A 1NJ6A 3ZDZB 2DTEA 1S2OA 3NM6B 2X1HA 5FLYA 3ONFA 2W2KB 4HDRA 2VA8A 3AR3A 4IFTA 2J9FB 5EMLA 4TKZA 4M8KA 1EK1A 2R1VB 1XKTA 4KH1A 3LM8A 4ZEVA 4MUIA 4BAGA 2C58A 2F43A 1M1NA 1R8XA 4RTKA 1P2BA 3U6BA 3L9XA 2WHQA 3C70A 1GP2A 1MZVA 2C9CA 5HHTA 2YIDA 1D7AA 3T7KA 5L3SA 4FFPA 2O2XA 3FMOB 4V02A 4D0SA 1WTAA 4X94A 2ANCA 2VNJA 2VYCA 2IW1A 4HEHA 3SG0A 4BZQA 5BSVA 4F71A 2VUUA 1Z56C 2AG8A 5A6VA 3TNFA 3QIAA 4HXYA 3OPYA 2YRWA 3N6XA 3BCRA 1BZYA 4B71A 4P32A 4NZYA 5J4KA 4MLCA 5JSYA 3QOXA 1XVUA 4AS3A 2R2AA 3GJ3A 4FM9A 2FSGA 3WLRA 3OKFA 2EF0A 4DHEA 5LQMA 5EQFA 4PGMA 4DFDA 2OXRA 2QTRA 1ST2A 3TINA 5IT0A 3IXQA 3IT2A 4MWTA 4LSZA 3WMXA 3P4UA 2DP4E 4QOJA 1OAOA 2LVBA 4O4HA 5IC4A 4X54A 1XTKA 1BD3A 2A1IA 2FN7A 5CCDA 4IY1A 3JCZA 4IXNA 3I5MA 4UAUA 3H5NA 3D2AA 1T36A 4CIBA 2ZSHA 4JVNA 4QODA 3WRXC 5A4KA 1XCGB 2FPRA 4QTYA 1GWNA 3I45A 3EE6A 2IZ0A 5C5CA 2IYFA 4DLAA 2LKDA 3HKDB 1O89A 3G59A 3ITEA 1GM5A 1Z3CA 2HRRA 2WG1A 2YHAA 4X9XA 1OTYA 3O2NA 3WJAA 3UCFA 4QPPA 2A0YA 2QIOA 3JPYA 4KQ9A 1DKQA 1L1RA 4FCWA 4HMQA 4JP2A 4ZCLA 2C07A 4DN6A 3EZYA 4JYBA 1H6CA 2PS3A 3NCHA 1ZNZA 1XDWA 3R0VA 4KQ1A 2O06A 2DHCA 5JY6A 1VFPA 3BFJA 3IO5A 1KYXA 4FE3A 3ZIUA 5C18A 4QQFA 1QGYA 3SJBA 2BDUA 3O8OB 4WFKA 3IP6A 2GKGA 4PNEA 3KWJA 4RZXA 1JU9A 3KKMA 1ZC3A 4I2NA 5BMVF 2R11A 4JP5A 3O3CA 3EA0A 2DY0A 1DL5A 1DUSA 3EXEA 2QRVB 3AIKA 4FYWA 1IRIA 1I4OA 2DM6A 4WEQA 2P9GA 1BWRA 3IP9A 4E70A 3GLHA 1D2EA 2N75A 3KB6A 3ZCVA 1OLSB 2PZKA 3LXXA 2HWYA 4RULA 1XMPA 3GFBA 1IJKA 2OZKA 2YJTD 4O4JB 3AY7A 3BE4A 2WEKA 4ARIA 3UBMA 2R6FA 2RGNA 1GPYA 4JB8A 1RYHA 3WWPA 3QHQA 3PHIA 2PH7A 4DMFA 1Z22A 4EO7A 4DJFC 1ID1A 3MUNA 3R0JA 3D0RA 2ADMA 3KQNA 1E7WA 3KXPA 1EK0A 4JLBA 1X1SA 1Q6ZA 2I4RA 4X95A 2R65A 3MILA 4U0KA 5DYGA 2XUFA 5LFAA 1N6RA 2HJGA 2ZIEA 3K9NA 3SXPA 1KC3A 4ARBA 1HEYA 1QANA 2B6NA 3B1YA 4ER3A 4YN3A 4I1PA 4CIAA 4F1KA 1XLWA 4P8RA 5HEKA 1C9NA 3K9HA 3AKZA 1ZWKA 2JASA 2XD9A 3DOCA 1RACA 4KCGA 4TLAA 2AL7A 3HHPA 3KVOA 3PPIA 4CG3A 4ED9A 2FPMA 2Y1CA 4JVLA 5HRCA 1Z37A 4M7PA 4OFWA 1AKWA 2ERYA 2QQFA 1OBFO 2V9PA 2VDKB 2GBIA 1AU9A 3TZQA 3PPXA 4IHJF 1T4CB 3L4BA 5KYXB 1TZBA 3MWJA 1VL8A 5B58T 2QTZA 5CVEA 1N6KA 4UNSA 5G0VA 2UZ1B 4HB4A 5EXSA 5E3HA 1TEVA 4EFNA 2K5UA 4WJLA 2ZJAA 5ITZA 4DCTA 1E2LA 3VSAA 4RQUA 2RGRA 1BSVA 1XV5A 1EWQA 1JJIA 1M1ZA 2B8NA 5IWAB 1GZUA 2C9MA 4JLAA 3SOPA 4LTNA 5DN6A 3FTCA 3PC6A 5AI8A 4ZO6A 3AHGA 1DADA 4P93A 4X0EA 2JIRA 4IDOA 4LSWA 3FCYA 3ADDA 3OQIB 4ZOAA 5CTAA 1V5IA 1JHMA 2RH8A 1QFZA 1DJQA 3H1BA 3VR6D 1O08A 4KRGA 1GQFA 4JQYA 4YROA 2XB9A 3OIWA 4LHYA 3NIGB 4XE5A 1SCBA 5AKLA 1T91A 4UKDA 4RHFA 4Z0NA 3GCXA 4PE5B 3I1FA 5FWYB 1VJCA 2FSFA 3EOZA 3BF8A 3HBFA 2FJPA 1U8CB 1LD3A 1G5RA 4PBRA 2FDXA 1ACLA 1IXRC 3F4BA 4IVPA 3G2PA 1LBEA 4NKRA 4D0LB 2H17A 4HVLA 4NABA 2DKFA 3QU7A 4I66A 2QOEA 4DSNA 4I8IA 3C74A 4LRUA 1G20A 1NRWA 4EGFA 5EESA 2RFLA 4EEZA 5J5VA 3Q3JB 3WGJA 1L5OA 3GT3A 4D9NA 1L7MA 1O6ZA 3HH8A 3FOFC 2WU1A 1OX5A 2O48X 5BUCA 4LJLA 3EEOA 2AB0A 3H99A 1V8ZA 5K3CA 2CLMB 3FLMA 4NOLA 4MULA 2H5JA 2X58A 1J20A 3GZNB 4EGJA 1KZ1A 3IESA 3LWZA 3PF8A 4HN4B 2DE0X 1G16A 4RMIA 5DLDA 5L3QB 3IODA 4FT2A 4UBKA 2PS0A 4IJWA 3H13A 3MSXA 5BMVA 3PFNA 2QPOA 4HPJB 4WAUA 5JJKA 4UJ3A 3B1VA 1YTLA 5E9AA 3NWOA 4HDKA 1C1XB 1RAFA 2IYOA 4ETIA 2YN0A 3R77A 4DIFA 1A9XB 4GXQA 4JL6A 1EKXA 5DHTA 1FSFA 1B43A 4RA6B 1RS0A 3OUZA 4PWZA 5CH3A 4GXNA 4R54A 1WETA 4JBLA 4WCFC 2FG7C 3EHEA 2C20A 3NNNA 4PYJA 3BN3A 4CGZA 1I4LD 3TYXA 1UKBA 3IEUA 3O03A 1R3DA 5BRAA 1XTPA 3B2EA 4Q3NA 3QKWA 3TS1A 1DZ3A 1GQRA 1R4MA 3JQ9C 1J97A 1SWWA 1NRJB 3CLHA 1A2OA 1JXMA 4G5RA 1T8RA 4DMRA 3RS5A 5JHHB 4PINA 5IJXA 5A7HA 1YZKA 3UPDA 1N78A 1U99A 1FTQA 1WDKA 2BMVA 2CNWA 3HSYA 4RCYA 3TWOA 4MTLA 4IOJA 1WUHS 1XL0A 1B2LA 1T8SA 2BLLA 3G8CA 4NBLA 4REMA 2D00A 5WRFA 1H1TA 3ZGNA 4FWIB 1HC7A 5EZYF 1XC7A 2AN9A 2CMGA 1I36A 1WCV1 2FWRA 4JOQA 2NV6A 4P3PA 4PPQA 4R1QA 1NVWQ 1P39A 3QNWA 4RMGA 3U4AA 4QZVA 4LMPA 2ZUCA 3DAYA 3IAFA 2X1MA 5DWQA 1JQJC 5I9IA 4TYPA 1FUUA 1RRPA 4DLVA 1HUQA 2C94A 2QX8A 3CF2A 2GAOA 4MVXA 5BOSA 1PVDA 1CJTC 1JIQA 3MMZA 1Y4UA 1GRNA 1DAFA 3A1CA 3Q88A 4OX9Y 4OHOA 1E4YA 1O03A 4IGKA 1Z0KA 4CODB 4EHJA 3PDIB 3G0HA 1CIPA 3PEYA 1Z0IA 4AZTA 4XRRA 2G08A 1OYVA 4YP7A 3SMQA 5B58C 3PNBA 3BWBA 2G82A 1Y1SA 2IDZA 4KRYA 1J2RA 5JSQA 3KSAC 4V0SA 3N0VA 4D99A 3QU4A 3UHPA 4JJZA 2HSZA 2JIDA 4AM8A 2J4DA 2ODPA 2FP3A 1SCJA 3WLKX 4DSZA 4QU8A 4RBNA 5KNBH 3E0QA 2I7DA 5KI6A 4YMVA 1A0OA 2FXVA 1TA0A 2HFKA 3ZTWA 3GLQA 3PCXA 1GAXA 1MDFA 3ODPA 1PEYA 4A2WA 4PN3A 2EV9A 1V25A 3QVLA 2VDJA 2VBFA 3DZIA 3OM0A 4HGOA 3LU1A 4KQ2A 2ODTX 1FJGB 2W6ID 4B75A 2IU6A 3OU6A 1Q1BA 1R6AA 5EQDA 1LWNA 5JASA 1YGPA 3D81A 1Q83A 2E1RA 4R69A 3AY0A 3OT1A 1T2EA 2A9VA 3T12A 4W7SA 3DEKA 1AY0A 2IGBA 1DQNA 2X2PA 4JLSA 1YR3A 4C6TA 1JZQA 2XUJA 2CW5A 5CEFA 5FFMA 3WB1A 2ZS8A 4D42A 4DLPA 3P5SA 2H7VA 3GJ4A 1Y6ZA 5DW0A 3ZD6A 2X22A 4DDUA 1E9RA 1DBPA 4KYTA 1GPAA 1EHYA 4BOYA 5BWBA 1NM5C 1QX4A 3GBSA 3IQFA 4YBZA 2AIRA 2QN8A 1ZMOA 1OMOA 2GLUA 3VDQA 5BSFA 6GPBA 1E1QD 1G2OA 1Y1QA 3PE6A 4KUHA 2VDQB 4J2TA 1H9CA 1DUIA 4E4YA 1WXIA 1IOWA 5TXGA 1HTBA 1NXVA 3BXPA 3EEYA 3ILYA 3PFIA 4O2AB 4C87A 4EITA 2AK3A 5LNK1 3RYCA 3NI2A 1NBEA 1TE2A 1U2DA 1VLJA 3FTQA 3L0PA 1NQTA 4OJYA 1Y6JA 3K0KA 3L93A 2A9FA 1AKQA 3Q8WA 3R8CA 3RASA 3VPXA 3UAYA 4YH1A 1LB1B 4FE4A 4BNKA 5LZ5A 2GBCA 4BECA 1RXEA 1F06A 4REOA 3D6UA 1E9CA 5CLHA 4HGQA 2OC9A 5EINA 3AEUB 3VJRA 1CRPA 3OSUA 2XCTB 1T2VA 3PFFA 5FJIA 5IT9A 1PWHA 4Q3AA 3KM0A 3IAHA 4IQ0A 4H27A 1PNTA 3EC1A 4W9RA 3BXOA 3HL0A 1AK2A 5K8UA 4WWHA 1TECE 3GC6A 3PFCA 4OSPA 4EHHA 3WZMA 2H1WA 5CT8A 5A9SA 3EJ6A 2PMBA 4MLZA 1DLIA 2VRCA 3O8QA 2YXDA 3TSWA 2QLMA 2YMMA 1I51A 2VBIA 3HWX1 4EX7A 2IP1A 3O8RA 3OEHA 3SC2B 1H2ZA 1JQ5A 2P3QA 4BBZA 1BDHA 1G19A 1FP4A 1JHRA 2DXIA 4D9JA 2B94A 3KC2A 1Q74A 4O6VA 1C9DB 3D5QA 4IKEA 4AWBA 1PF7E 3QEMB 2FX2A 1ZWLA 4ACBA 1GQOA 2JBAA 4FFVA 1P5JA 2V7TA 1EJ2A 2XI4A 2GKSA 4E5DA 2HA3A 2HB6A 1XO1A 1ENZA 1ORRA 2TMGA 2Q2OA 2WB2A 3MPUA 5FI3A 1EMDA 3C3BA 1NR5A 2ETXA 3DKIA 3AHIA 2XGOA 3FPLA 3JAWA 3LTEA 3PRJA 4YLGA 3KZNA 3LX5A 4CIVA 4CEJB 5IXYA 3BXHA 1B23P 3MJRA 3VU8A 3A7EA 2Q2VA 5CNMA 1QF6A 3PVCA 2Q4OA 4MH0R 2JPDA 1E2QA 4LJ8A 1RI2A 1WA5A 2F4VB 3M1LA 2BELA 3MMPA 3IUYA 3GG2A 3B9QA 4QBFA 2DECA 3CLRC 1G64A 2I3ZA 4D41A 1YDMA 2WSLA 2PSEA 4ESHA 4DNFA 1XEXA 1HT1E 3AP3A 2FGKA 3EASA 3U2QA 3UFBA 4DCPA 3UMMA 1YONA 4NZMA 4OQFA 4RVCA 3RRYA 3SDZA 3T5DA 3I61A 3T3OA 3P1JA 3G23A 1OT3A 1YC5A 4PYKA 5CX1B 4A2QA 4CLEA 1KVTA 4UASA 4QVKA 3BXXA 1MJHA 5EJ8A 3JRWA 3K70D 1SBIA 4JU9A 1S2IA 1WF3A 3VX3A 5CB6A 1BXRA 3HKEB 3ZKWA 2IBTA 4QOHA 3V8MA 1K97A 3LSYA 2GB4A 1DAMA 3JYHA 4Z7NB 5KKCA 4KEAA 4ZAVA 3OOEA 1BRMA 3NHMA 1H4SA 4JB0A 3WYFA 5MN6A 3HDGA 4G41A 1SELA 1KQNA 4QATA 3HR7A 3KEQA 1XEWY 3VPFA 1I7SB 1IY2A 5KHOC 3RS2A 3V1NA 4GMGA 1OHHD 2CMFA 4J90A 3T99A 4JBNA 2D4AA 3MWDA 2GD1O 3F47A 3IV9A 4TXLA 4UDOA 4F06A 4YCNA 1VB3A 4ITUA 3THXB 4JLWA 4BNVA 3R7DA 1XTUA 4Q9JA 5JAQA 5IVIA 5KNDH 1J1UA 4FR5A 1NGSA 2RJOA 3C4JA 2Z3ZA 1OASA 2ZUWA 4DWJA 1WS6A 1KARA 1V4VA 3FDJA 1DCKA 1Q19A 3MJVA 4UVGA 1EQ2A 1L5KA 3MXTA 3QKRB 3W6ZA 1IXZA 2E87A 3F49S 1EZZA 3WMWA 5ICGA 4RENA 2WKRA 4NPCA 3V4FA 3G1WA 3DMYA 4FFMA 3HUEA 3FDIA 4PEVA 2BFEB 1A96A 4WN9B 3WGKA 1KEVA 3UBTA 3TNYA 3UMJA 4D9FA 1T4BA 3DTNA 4RDHA 5C37A 1X1CA 3DLIA 1L7OA 4V2UA 3VZSA 3T3NA 1WZUA 2VP9A 2ZYRA 1GPBA 2G1UA 1HOXA 2QL7A 3DB2A 3EUAA 4L0MA 5AK6A 3V34A 3SLGA 1Q11A 4YV0A 2QSJA 1JS1X 3MWKA 4JYZA 1UJCA 4WMLA 2ZRKA 5AP9A 2C82A 1XDSA 2F6RA 2P2GA 4IDCA 2E4VA 4MW7A 4S3MA 1BGWA 2AEJA 3RAPR 3A6DA 3DE4X 1E3QA 3ANTA 4KGZA 4M1WA 2YICA 3THYB 2JKYA 2W6CX 4ZARA 2DUUA 3IA7A 4CMIB 1WCXA 2OC4A 9MHTA 3G3EA 1BN7A 2O7VA 1UANA 4ZOLB 5K09A 1P60A 2LGJA 3FDZB 1GY8A 5LXTF 5KYKA 3QLVC 3R5SA 4YUZA 4OU4A 2Q6OA 4WRRA 5JUWA 3U4CA 1E62A 2ORIA 2X0EA 1PZMA 3K0CC 1NATA 2J0QA 2AHOA 1F48A 4QELA 3VZPA 2AE2A 1H42A 1Z6QA 2GD6A 3HLKA 3I3SR 4DVGA 1FU8A 2OESA 1XE3A 4YMWA 3CMCO 3D8UA 2IY7A 4Q6WA 5TSDA 2YY6A 3L6DA 3MJFA 4E15A 4HXFB 4HCJA 1UC4B 3K15A 2GILA 4ZVKA 1GNRA 1X7YB 1UOQA 4LJRA 3B60A 4KGVA 1GEEA 4Y30A 3LO8A 4N48A 1SBCA 2YHIB 5GQSA 2W58A 3OIGA 2WG0A 4L5AA 5GZ3A 1CYDA 4DQ0A 4JUBA 3H4TA 2VNAA 3B7GA 3HN6A 1K3UB 2W0MA 2TMDA 3CPHA 1FIUA 1PGQA 5K0BA 2B8TA 2QPLA 2UAGA 1OIXA 2G9NA 2HJ9A 2YRFA 1Y8RB 4OQNA 2FWBA 1ZHHA 1L4HA 4XPZA 2AJCA 1AKYA 2I1LA 4HQOA 1M2KA 3AKYA 5DNYB 1YV9A 2JA1A 2WICA 3ZLUA 2XMZA 5P21A 4AN4A 2BR5A 1NFRA 3CEPB 5KDLA 3DONA 1BFUA 4K0RA 3LWNA 3KQVA 3SYRA 5CDTA 3BD6A 3TOXA 2DVMA 3VGJA 1J7JA 3AJRA 4YUWA 1L5WA 5CLQA 1IY1A 3FGOA 2Z2KA 3SDSA 1AD2A 5ELLA 4DUGA 3ID6C 2HMAA 5LQSA 4NRDA 2JFBA 4LXHA 2I5PO 5KOJA 3HBAA 3L7NA 4CKEB 4BVAA 1MOQA 5DNAA 2B3DA 1RT9A 4IL5A 3BJIC 3OLYA 2VHZA 3TXYA 1NC1A 1U8TA 2YX1A 2ZI7A 2PXAA 4KFSA 4DNPA 1WB6A 4AN0A 4J16C 4D43A 3GRVA 4UCXA 1AMUA 4R1OA 5AM1A 3E8SA 2GZDA 5KOYA 5HRUA 3BJMA 1U7UA 2WU8A 2AG0A 5LYYA 2JFZA 1X94A 2NO5A 4AJ4A 1EX7A 3CT4A 4FOTA 5CUQA 4PNPA 1KFEB 1YD7A 1YL7A 3B9RA 1NYRA 1O1YA 4F93B 4HQ6A 4K9SA 2EJBA 5FB3A 1NX9A 1MT3A 1PL8A 3H5AA 3OMLA 1XWWA 1DXQA 1WVGA 3QY9A 1NVKA 1N2CE 4UMVA 5HJ7A 2DSTA 3REFA 4Y1FA 1GGNA 1TC2A 1CUIA 3OQNA 1GGFA 4MUEA 1YXMA 3ORRA 4RK4A 521PA 3P9ZA 1ZKMA 2E6UX 1XVAA 4NATA 2YVUA 4JDUA 5K0SA 1RI3A 1ZRSA 1E3LA 1BVYF 4YJKA 1NVTA 3UV7A 4BP1A 3MHTA 1RADA 5E6SA 1KYWA 4KVFA 1QR2A 1T5SA 1CUEA 1JFRA 1HDYA 4KFTA 2Z8YM 4XCVA 3OD5A 1KRXA 1ZN2A 2BGNA 4DRXB 3QU9A 5BMOA 1N7IA 3EUFA 2GPTA 3IX7A 2JVKA 3Q10A 4ISBA 3WB0A 2WILA 4OUDB 3RBVA 5H80A 4CJXA 4EMSA 5C8YF 1F6DA 4LWOA 5KQPA 3NBQA 3DHEA 4AJNA 4BNDB 4F60A 2WJWA 3WZ2A 4RACA 1P29A 3B8EA 4XAQA 2ECPA 1NSFA 4LOKA 3VGPA 2G77B 4QL3A 2E4YA 4LMAA 3VTZA 1K75A 4RM3A 5F12A 5HFJA 3WXBA 2ZCJA 4RZ2A 3E3OA 2UDPA 5HKBA 1BDBA 3CF4A 3JR7A 2H5EA 4FONA 3L1JA 4W1QA 3FCAA 2XNSA 1FXWA 2RGEA 1FJ2A 3JQ6A 5ESDA 5KB3A 4GP9A 4HWGA 1J5EB 1MTZA 4MI6A 2MSLA 4OIMA 3JYLA 5FKJA 1DX9A 4ZTZB 2XOKD 2M6KA 4JX9A 4RE6A 4L16A 2BEJA 2L42A 4OG2A 5KTKA 3FMVA 4KK4A 4RLSA 1C7IA 2H65A 4V3CA 2CXXA 4TMFA 1OFGA 2RGUA 4ARVA 4D2IA 1LI4A 1D4AA 1DP4A 2P62A 1LC0A 3CS3A 1FRQA 3F7TA 4UTNA 1COZA 1HDIA 1L7EA 5AVTA 2XUKA 2GJ4A 2GLXA 1BWSA 3FNEA 1T9KA 3AI3A 1SIOA 3GRKA 4CN9A 1QYVA 2X77A 2JLZA 3DD5A 3ETCA 4CL2A 1R18A 2HHAA 1ELOA 2Y1LA 2SICE 1KYVA 3D02A 3PHGA 3EISA 4PAQA 4X20A 4NCAA 4MR9A 1NVBA 4ZI2A 2IZ6A 3P71T 2BIFA 3GPCA 5DI9A 4MVJE 1BG6A 2R6HA 1SU6A 1J39A 2VK1A 1PDVA 3H9EO 3E18A 4GMDA 4WLFA 1NV9A 1Q2XA 4MKGA 4WASA 4LE2A 5FL3A 3NORA 1IN7A 1ANKA 3IFSA 3L79A 4FZJA 1WCWA 2FP4A 3FETA 4M76B 2AJBA 4NG5A 4PZPA 2KI5A 1TIBA 5EA2A 3K73O 4XA8A 1NOKA 4P2GA 3GPBA 2A94A 4OV6B 4Q7LA 5KEIA 3D64A 2OZVA 1S9DA 3B9PA 4D98A 2ZM6B 3A1EA 4CLDA 5IKEA 1BAPA 5FA6A 3ZHVA 3CZ4A 5LQDA 2IZZA 3ABQB 4IDAA 4CV0A 4RD2A 1E1NA 5AI6A 1DAEA 1SOMA 2E2WA 3O84A 4D8XA 1WU8A 1HRKA 2I2DA 2FPXA 3ENNA 1I1QB 2VKQA 3D4PA 3FPJA 3FSJX 4YAFA 4NCXA 5JZOA 4TPKA 3GLGA 3WMEA 1M6YA 1IMJA 1UC5B 2ECFA 2XW6A 4RY2A 5F1YA 4RMHA 4YT4A 3R3VA 3IKTA 3OZIA 3GDWA 3BMXA 1N2CB 4OLFA 5JATA 3G8BA 4QARA 5K8JB 3EF3A 1A4IA 1AE1A 1RBZA 2EKPA 2HWXA 2N47A 2PWBA 2VUSA 3DMRA 3I6ZA 4H1UA 5HZHA 1G63A 3TFOA 1WRBA 2RDMA 2HM7A 1ZI8A 2Z95A 3BMCB 3LF2A 3PYMA 5FOTA 1USKA 5CH8A 3TDNA 2IPMA 3JZFA 4ENPA 1VE1A 3P4XA 4R8RA 3S5JA 5BVGB 3D6TB 1L5HB 1WF6A 3KWMA 3VH2A 1USWA 1C0IA 1YBVA 1FFEA 4YFVA 4FB5A 1SUBA 3AHDA 3FF4A 3PIDA 5K0LA 1PN3A 3BE5A 3C5CA 5C1BA 4MI9A 5J3JA 3RYIA 4MVJH 3VC2A 2IYLD 1TQ2A 1E5DA 2F00A 2C00A 2RGGA 2ZJFA 5KJEA 1Y34E 3DF7A 3PEEA 4R51A 2EJCA 1OFTA 2IIVA 1CC1S 2LRHA 3UA3A 4A2CA 4O4IB 1NTRA 2NZJA 4LHXA 5KCZA 5JRZA 5C8YA 2OCPA 4FGKA 3W2GA 4KSCA 4GE3A 1LK5A 1PR3A 2ZBQA 3F90A 2H51A 2SECE 3L5KA 3FCOA 3TW4A 2P2NA 3TTWA 5EWLA 1U5AA 1LPAB 5FNVF 1C30B 3ZOKA 2UUPA 3IQZA 4KQFA 3MT8A 4KQKA 3S99A 1GFSA 1RM0A 3BFXA 4S05A 4JQZA 4HS4A 3FAZA 2QS9A 1IL0A 2QR3A 3H05A 1K0FA 3X0DA 4MEJA 1OTHA 3LYAA 4X60A 4EWLA 2SNIE 1JDPA 1JR3D 3LW8A 4X61A 3TQIA 1Y9DA 4A73A 2BF4A 1ZFNA 2YWXA 3RYFA 4CEIA 1DOHA 4JGBA 3GJ6A 1VBMA 1XJQA 1O0BA 2A9JA 2J5XA 3UUGA 5CFZA 3ET5A 3S55A 4F84A 4D8UA 4ZV9A 5LLDA 1T3GA 2XDYA 5AW3A 2E5WA 2BM0A 1E79A 1UDXA 4F7DA 5LQCA 3WKBA 1TK3A 4MIOA 4ZYYA 2VR1A 3IUEA 5GIPE 1ML3A 4FR0A 4YRLA 2O3RA 3UHOA 5AHWA 1PNVA 1UH5A 3BREA 3T3MB 3V1UA 4RZ3A 1QQ7A 1XALA 1ZLXA 3GVXA 1S0UA 3HDYA 3OIFA 4M98A 2XODA 3RV4A 3U26A 3ZLVA 4JYAB 1ZM2A 1DFIA 3MWGA 3LCUA 3K2EA 4I55F 4UZEA 1SU8A 2YINC 2ZDQA 4MS3B 1LZKA 5FR1A 3VQTA 4DEXA 4YTEA 2PM8A 5ARCA 4Q24A 4BDTA 1ZMTA 1B0ZA 1N7HA 1EPUA 2P35A 4W9NA 1E77A 1EVZA 1U1GA 3AHFA 3MELA