1ENPA

Brassica napus enoyl acp reductase/nadh binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enpA00
4CMHA 2X6TA 5C5IA 4PVDA 3ROQA 1IYZA 5CDSA 4MKXA 2YYYA 5G2OA 3D5QA 2CY0A 3P2OA 4CM9D 2FR1A 4RGBA 4JX8A 3SVTA 3OJ0A 4R9RA 3DFUA 2X22A 2C5EA 4GKVA 3I9OA 5TJHA 5DULA 2E48A 4NBUA 3MZ0A 1A5ZA 3OJOA 4W82A 1EE9A 4MVJA 3C7AA 1PR3A 1K2WA 3NT2A 1P9LA 3D7LA 1A9YA 3OHSX 4E21A 3NGLA 4KTTE 3PJDA 1DO8A 2WMDA 5F1OA 2WE8A 1KY4A 4B4VA 4WLFA 1MG0A 1T1RA 3W6UA 3WLFA 5C7OO 3PWKA 3UAGA 4MKZA 2D0IA 2QW8A 1NVTA 2QRKA 4HX5A 1N1EA 3GZNA 5TLSA 2NTJA 3CMCO 1ID1A 3PEFA 3GPIA 4CUJA 1Q1NA 3CSDA 2GPTA 4PG8A 1E6UA 3LVFO 1DIAA 5IZ4A 4AJIA 1JVSA 4J3FA 1GUZA 4QECA 5IDWA 3JQ9A 3WBBA 4R41A 4BS9A 3EC7A 3H3JA 4FFNA 2DBZA 1R0LA 3M2PA 4E2XA 2B4TO 2Y0EA 4WLNA 3EMKA 1U3UA 3AUAA 2VT2A 4FDAA 3OMLA 3Q2KA 2P4QA 4I5GA 4XIJA 4DYDA 5ADHA 3ZWMA 4CLHA 4I8XA 1NVGA 1ISIA 3AOEA 1X0VA 4CR8A 1UP6A 5J23A 3FPCA 3V2GA 1ONPA 1SOWA 1K3TA 4GGOA 4NHEA 2JD0A 3GUCA 1I2BA 4MVJE 3D64A 1K89A 4O5OA 3DB2A 3PTZA 3WB9A 4J6FA 3DONA 4OHUA 3OFSA 4CV1A 3GGGA 1Q0HA 1Y81A 4R68A 2ZCVA 3LK7A 1XLTA 5CFZA 1Z45A 1IZ9A 3RVDA 1VLLA 2RH8A 4EEXA 5G0UA 4I5FA 2VOEA 2O3QA 2PR2A 1Z82A 4RF4A 4UUOA 3UVEA 3W8DA 1ARZA 1GL3A 3BTSA 3NTOA 2J3KA 3JQGB 3X2EA 2X23A 3OEYA 1KS9A 4AJEA 2VTEA 3RU7A 2EV9A 2V6GA 3DEYX 3STHA 3ZW8A 3AFMA 4DPLA 2Q1UA 2RIRA 3KSUA 4PLVA 4NBVA 4D7AA 1I2ZA 2V6BA 5KJ1A 1XYGA 4XB2A 4DC1A 3LZ6A 4FJ1A 2J5KA 1M75A 5A9SA 3GG9A 1H9BA 3ZWVA 4EJ6A 2VYND 2PGLA 3C85A 4NU5A 3BXXA 4E2WA 2OHXA 2QZZA 4LGVA 2C7VA 2NACA 5T8KA 4R16A 3I5MA 4B3JA 4IGEA 1WZEA 2X5OA 2D59A 3KTDA 5ITVA 5DOVA 3L0DA 2J5RA 2A35A 4BKRA 3DC2A 3WQSB 2B4QA 1X1TA 5GZ6A 1J5PA 1JAXA 3DZJA 3ZGYA 4XRGA 1TLTA 1V3TA 3PQEA 5JCJD 4YVFA 1L7EA 1O94A 4OOFA 2JFFA 1LSOA 1XQ1A 1J4AA 2CMDA 1LUAA 4MP3A 4E0BA 2Q2VA 4RF3A 2AHRA 3O26A 4GH5A 2J3JA 4Q3NA 1Z6ZA 2O7QA 3GUYA 1VKNA 1UAGA 1ZIDA 1E3JA 3ONFA 3W8FA 3GNQA 3MCVA 4IIUA 2ZKLA 1DFGA 1DAOA 1EQUA 2Q50A 3EVTA 3GAZA 3AUTA 3RUAA 1T2CA 4R5MA 3K9QO 5KVQA 2BRUA 2ZATA 1GEEA 4AJNA 3QVWA 5THKA 4QX6A 1U1IA 2DUUA 3EDMA 4FOOA 1O6ZA 3EYWA 3MJSA 4F3YA 2AQIA 3I9NA 3AJRA 4W4TA 4EEZA 5DZSA 2NVUB 4BNNA 1KEPA 3FNFA 4B7UA 4M87A 1Y6JA 3AU8A 3JD3A 1NFQA 5A5FA 4URFA 1GYPA 1PZEA 3BMNA 3NJ4A 1ISHA 5JNLA 1P74A 1R37A 2X4GA 3NEPX 1N8KA 1LDYA 3R3JA 3K5PA 5A3JA 3U4DA 2QX7A 2IEBA 3AM5A 2HRBA 3H7AA 2HLPA 3WTCA 2GUGA 1DFHA 5B4UA 4IQ0A 3NJ8A 1HETA 2VYVA 3NDRA 1U4OA 2VRBA 3HFSA 4J1TA 1UJMA 4RLHA 3U49A 3NDIA 4HADA 3H4VA 5DCUA 1DIHA 1QYCA 2I76A 3ZU2A 1B8UA 3H8VA 3WGTA 4BGEA 5I8WA 4B7XA 1C0PA 3ENNA 4GVXA 3LLSA 2OO5A 3LDHA 4AJPA 4KUGA 4MVJM 1AHHA 2W2KA 3O38A 3NV9A 4LSMA 1EDZA 1JKFA 4W99A 2PZMA 1JLLA 3JD2A 2GN6A 2B0JA 3ABIA 3D5TA 2X7HA 3B70A 4XR4A 4FS3A 4TKMA 3KM0A 3FBGA 4DREA 1I2CA 1FDWA 1LDBA 4TZTA 4WNIA 4AJKA 3I9KA 3OP4A 1KC3A 3L6EA 3TJRA 3UKOA 4ALKA 2UUOA 3FRJA 1UZNA 4QQRA 3T4XA 5L40A 4J43A 1E3WA 3P7MA 1A27A 1QV7A 3ETDA 3IKTA 1IHXA 4XGIA 4ZRMA 1S7CA 4A0SA 1GTMA 2GN4A 3LC2O 1MA0A 1VL0A 3ZNNA 2JAHA 2CD9A 2DTEA 2YV2A 3U9LA 1HLPA 1V3UA 3HFGA 4IZHA 4BO0A 1B7GO 3KYBA 3DZFA 1XHLA 2E82A 3EZLA 3JQAD 1X14A 4NG5A 2P9GA 3HDYA 5COAA 4FW8A 1YH3A 1VE9A 4I9NA 1R0KA 4JROA 5F3RA 3JQ8B 5ICMA 2FN7A 1I5RA 2NADA 4YTEA 4J1NA 3ZV6A 3ZWBA 4FPXA 2B5VA 2BI8A 1UP7A 3EUWA 3ZDFA 5ILOA 4CMGA 4BNIA 1DHRA 2G76A 3JQ8A 2GERA 2AQ8A 4GWKA 4HFJA 3W8EA 2ZB4A 3VOSA 4N7RA 3OQ1A 2HDHA 3LQFA 5T64A 2VWPA 2I5PO 3JQ7A 3KV3O 3PRJA 4N54A 2PTGA 5EIOA 3LSYA 4YCAA 2HKIA 4BGUA 3U4IA 2OFPA 3M1AA 4W6ZA 1F14A 1E5LA 1VKOA 2WD7B 1T1SA 4PFJA 3E5MA 3G1UA 1LXCA 3GRKA 3FBTA 1XGKA 4RVGA 5JAMA 4P4GA 5DBIA 4AJLA 2FHSA 4B8WA 1I3LA 3JQFA 3GY0A 1ISGA 2HMWA 3HB4X 4NH4A 2V7PA 2DLDA 4II3A 3IMFA 1WMBA 3TPCA 1JU9A 4NFYA 1EUZA 4FQ8A 3IQDB 1A4IA 1R4MB 5DCYA 1YS4A 3I83A 4WEQA 4JK3A 4RVHA 2DM6A 2FR0A 2A4KA 3LLVA 1C14A 1NNUA 1MLDA 3FF4A 2HRZA 1DB3A 3E1KA 2EJVA 4L76A 1SO8A 4Q3DA 2X9VA 3HDHA 1M76A 2Q2QA 3JV7A 3LC1O 2VHVA 2LDXA 4R3NA 3F4BA 1O8CA 3GZNB 4R1SA 1LNQA 1DOHA 2EEZA 4RF2A 4YB8A 3SX2A 4PGFA 1HSZA 2YV3A 4OM8A 3IS3A 2PD4A 1O0SA 3AU9A 3WR5A 4XZ3A 1P0CA 4DPMA 5BSEA 3NDJA 3OH8A 6LDHA 2LDBA 3RD5A 5HWSA 1H6CA 3BMOA 3PYLA 1PGPA 1Y1PA 2FPPA 3IIEA 1XA0A 5TRTA 1PS0A 2QHXA 4RVFA 2NSDA 3NTRA 4GAEA 4PG5A 3FCOA 2I67A 3WMWA 3TZHA 2Q2WA 5ENVA 1UH5A 3ICPA 4FR5A 3G49A 1P0FA 4Z9YA 4BMNA 1E3EA 1NPDA 4R5HA 2ZJ1A 2EP7A 4TMFA 4CM5A 3F46A 2HO5A 3TOZA 3JQBA 4EJMA 1VSVA 4WCDA 1K6IA 4AVYA 1E3LA 2Q49A 3F47A 1CIVA 2GF2A 3VZRA 2ZQZA 4PZCA 1LRKA 3GH3A 3D4OA 2Y1EA 3K2EA 1WVGA 5KKAA 5IXYA 5HTOA 4P4NA 4BGVA 3CMMA 2W98A 4L0QA 4L9RA 4IXTA 3ZV3A 5TJ9A 5JDCA 4WNCA 4YJFB 5AXCA 1LC0A 5IF3A 1NHWA 2DUWA 1E7MA 4NK5A 4OXKA 5T6BA 1DBVO 1GFSA 3C7CB 3ZV5A 4BO8A 2R6JA 1XELA 2QIOA 4UEKA 2XAAA 2C2XA 5BSHA 4YAJA 1EQ2A 5AXAA 1YOVB 1I36A 2Y05A 1L1FA 5CEEA 3ZH2A 4IY1A 1Q0LA 2G5CA 3QV1A 3PLNA 3H2SA 3VH4A 2TMGA 4H7PA 4DGSA 3VZQA 1HYHA 3O8QA 1BGVA 1NPYA 4CPDA 1E3SA 4NQZA 4OO3A 1CJCA 5HA5A 2X1HA 4RQTA 4U7WA 2YDXA 2EF1A 1CF2O 4D3DA 2IEDA 4M49A 3O8QB 5LDGA 3V1TC 1WXDA 2OBYA 2WJPA 3JYOA 3GNTA 3I4CA 5G0SA 1LDEA 1PSDA 3HNPA 1NQ5A 1Q7GA 4J9VA 2YFHA 4J9UE 1WAMA 3BHMA 3AM4A 1OI7A 3U4CA 1BW9B 1ENYA 1RJWA 3G17A 3WGGA 1B3RA 3RI3A 4XGKA 2HMVA 3BTVA 4TROA 2PFGA 1Q7BA 4BQPA 2XF8A 4Y98A 5A9RA 1I3KA 4E5YA 4NU6A 3VDRA 4QO8A 2P2SA 3PI7A 4E13A 2AW5A 5ENDA 4BNUA 2ZYAA 3WIDA 3ZWWA 1JVBA 3H9JA 5K0ZA 4WLUA 3K96A 5LCXA 3INTA 4WE3A 3CEAA 5IDQA 3A06A 2ZJ0A 4U0KA 2CVQA 3N58A 3COSA 4TRRA 4O6VA 4HNHA 4BKQA 4PG7A 3RUDA 4O1MA 3GZ4A 3D3WA 2EP5A 2FR8A 2NU8A 4BL5A 4FFLA 3QWIA 3HQ4O 2EWMA 3H9QA 2O3SA 4CLXA 1YE3A 1U3VA 2X0RA 3R3SA 4K9DA 1QSGA 5KCZA 4HXYA 3SJUA 4E3ZA 2X5KO 1A4UA 2G17A 2PGJA 2PKQP 1DC3A 1FF9A 1LQUA 4UUPA 1NXQA 3GN1A 4TWRA 4YR9A 4R69A 2FOIA 3E8XA 2NU6A 3T7CA 1OOEA 4GGPA 4IDEA 1GUFA 4N5LA 2B5WA 1KVRA 4KDFA 3QVSA 3TOXA 4CR6A 1DRVA 1HE2A 3GR6A 4BNXA 1G0OA 3DR3A 3QVXA 3JQBC 4AJ1A 2Q45A 1KYQA 3TNLA 1YDWA 4R1NA 2GDZA 4U6SA 3LF2A 5FI5A 3RUHA 3CTMA 3S2IA 5L45A 4M86A 1C1XA 1G1AA 1ZSNA 3EY4A 4AJJA 4BO6A 1HDGO 2V6FA 3DAFA 4UULA 1HE4A 4UEOA 4LVCA 4XB1A 4XR9A 2IYPA 3UCXA 1U5AA 1LDNA 3BTOA 1FDSA 1U2DA 4M8SA 4XRRA 1XSEA 3H5AA 5TX7A 2DC1A 4FC6A 1GYQA 1IUKA 2NLOA 4DQVA 5I7VA 1ZZEA 1H9AA 1PZGA 1Y9EA 2RH4A 3FR7A 4KP7A 5JDIC 3RFVA 4GSKA 1K6JA 2BI7A 3WDSA 1VJTA 4E5NA 3H9GA 4CV0A 1JTVA 4RDIA 5ICSA 5B4TA 2DQ4A 3RUEA 1Q7CA 1ZEMA 4YJFA 1T4DA 1YBMA 4L74A 2VOJA 4F6CA 4MDHA 1NQAO 2W90A 4OIMA 1P1HA 3HDJA 3WNVA 4CLRA 1I33A 1S6YA 2RHRA 3JQDA 1IPFA 2PWZA 4RJTA 5JC1A 1XEAA 5L7YA 4IZIA 1WDMA 2O48X 4L73A 3PHJA 4NI5A 4CMEC 5C37A 3DHYA 3RIHA 3CINA 4D3FA 4Z0HO 1ONNA 2PA3A 3ZNOA 1H2HA 3V1YA 1F0YA 3FWZA 1JWAB 5T67A 5KKCA 3C1TA 5U1PA 5A03A 2BMAA 3PFFA 4CMEA 5KVSA 4YJDA 3AFNA 4R9SA 3PDUA 5A1TA 4LSWA 3DBLB 3OBBA 4PLGA 1W8DA 2ZTVA 4XX0A 3W4KA 1R16A 4E30A 1A71A 1FDTA 3BHJA 2BFPA 4KWIA 1N5DA 4J4TA 3M6IA 2WYVA 5TF4A 5BR7A 1XU7A 2GN9A 4LRTB 2HMUA 4K28A 4GLLA 2AMFA 1MX3A 1RPNA 4TVBA 2BELA 4QUKA 3DBHB 2RBEA 3ZV4A 1MGOA 3W6ZA 3WJAA 5GZ1A 2X0JA 4FOSA 5I7EA 3GG2A 1HLDA 3ZHBA 3WSWA 5L7TA 1E1KA 3ETEA 2IZ0A 2PNFA 2EKPA 4ZQGA 3DZHA 3GA0A 1HSOA 5T57A 2VT3A 4YYZA 1T4BA 3ZZNA 1T25A 3CIFA 4Z9XA 4U8GA 3BYZA 2H1SA 3TSCA 1PS8A 1U8FO 3JQAA 3WNQA 3ANLA 1I30A 4W9NA 3OA0A 3ONDA 4XCVA 1KVQA 3OECA 5IXSA 3JTMA 2BGMA 2PH3A 4LRSB 4YRDA 2HCTA 3FPLA 2OXIA 2BHLA 3ITDA 3N74A 4B4UA 2VWGA 4Z0TA 4E4YA 4YXFA 2DBVO 4YACA 3NTQA 1T2DA 3TF5A 4E5KA 3SLKA 4CQMA 4OL9A 4CJXA 1GQQA 1I3NA 4UUNA 4YT5A 2P9CA 5L51A 4TKLA 1LBEA 4BO9A 4QTZA 1QLJA 2JD2A 3F9IA 4YJGB 3PXXA 1YDEA 2AA3A 4MINA 1R0SA 1WZIA 4CM4A 3Q1LA 4WASA 5CEFA 1ZK0A 5BNTA 2WDZA 4GMGA 4DRYA 1D7OA 2BGLA 5DN9A 4U6QA 1NAHA 1CEQA 4U5QA 2DPHA 3DZKA 4KZPA 2ZK7A 3OIDA 5DOZA 1H6AA 2C2YA 1IOLA 3QWAA 5KJEA 5H82A 2V6MA 3RCBA 1YL6A 1LJ8A 4MO2A 3GFGA 4YEDA 2Q4EA 2YJZA 5AVOA 3I6QA 2VUUA 2X58A 3QWHA 4YT4A 3K31A 5TSDA 4LW8A 4ZQHA 5K9ZA 1U8XX 4OXYA 4D43A 1GPJA 1DC6A 1BWSA 3UUWA 3ROKA 1GV1A 2ZYGA 3S2FA 4N5NA 1E6EA 3N7UA 4X54A 3KO8A 2EGGA 2H5LA 2BFOA 3E9QA 2CF6A 3G79A 3HB5X 4D44A 5CG2A 5FWNA 4H15A 4NJMB 4LCJA 2Y93A 1I01A 3M2TA 3WYBA 3VH2A 1R15A 4BNFA 1QRRA 3DOCA 1LSSA 3IP1A 2R2GA 3CH6A 1KETA 4FJ2A 3NGXA 1GEGA 3P19A 1DFIA 2D2IA 3ON5A 4WJZA 3I3OA 4IXWA 1WP4A 2BKAA 4OMUA 4BO7A 1LRLA 3EVNA 4KDEA 1K6XA 3UCFA 3DFZA 4P38A 1NBOA 4ZN6A 5I9LA 4P22A 3GVXA 1EFLA 4MVJP 4EUEA 1IPEA 1D8AA 1KOLA 1E92A 1BW9A 3GVCA 3L9XA 2GNAA 3LC7O 1KVSA 2IE0A 1N92A 1OC2A 2ZIZA 1YQDA 3FWNA 4YWJA 1W0CA 3PQFA 3ST7A 1G6KA 1GAEO 3RC7A 3F5SA 1M67A 3S1LA 1V0JA 4XKJA 3ZWYA 1X7DA 3KYCB 3KLPX 4MP8A 4NMHA 1Z74A 3DZGA 3LT1A 3QHAA 4CMKA 4E6PA 2FPIA 3B1FA 4YRAA 3NUGA 4AJHA 1Z7BA 4IDBA 1X7HA 2AEMA 1DAPA 2B69A 3HSKA 4I5EA 4DL9A 1NX6A 4XQGA 2HAEA 5JAZA 1I24A 1C0IA 1V3VA 1T2AA 4ZD6A 5ILGA 1RM4A 1QLHA 1HRDA 2X0IA 1U5CA 3Q11A 3EGOA 4JP3A 2JFHA 4ND4A 4BV8A 2C82A 3KEOA 4HWKA 4Y6RA 4UVEA 4UUMA 4DIBA 4PG6A 4B8ZA 4PN3A 5L53A 1Y8QB 4EZBA 1M2WA 3WGQA 2ZB3A 3UH1A 5LDHA 2JCYA 3WG9A 4IMPA 2F1KA 5A5EA 3DOJA 4GWGA 4TRNA 2FMUA 5U4QA 8LDHA 5JXWA 5B12A 4CMBA 5JO0A 4ZU3A 2VCYA 3ZWCA 4ZQEA 1EMDA 3OETA 7MDHA 3EZYA 5ER6A 4DC0A 3HUDA 4JP2A 3X2FA 4CL3A 3MWDB 1MFZA 2P9EA 4E2YA 3E9MA 1WPQA 1NR1A 1PGOA 2O23A 4J16A 5IDXA 4C4OA 1PJQA 3F3SA 2GO1A 4PZEA 3PHHA 4CMIB 2CF5A 3BHIA 3SXPA 2VN8A 3KSDO 1PJSA 1JA9A 4R1TA 1CQIA 1N9GB 4J91A 3PZBA 2B4RO 1SEVA 3PK0A 1PWZA 1BTOA 3E9NA 4TQGA 3RBZA 1A7AA 4PCVA 1ADFA 3JYQA 4MIEA 4K1LA 4FFOA 4CQLB 3WFIA 1XR3A 3I52A 1BHSA 3SC4A 3JYLA 4OQZA 3DTYA 3HE3A 4Q9NA 2GZ1A 3ASUA 8ADHA 4CLEA 3KXDA 5IN5A 3C1AA 4A03A 4ZHSA 2OUIA 5F1PA 5F5LA 3QIVA 4PIVA 2DU8A 5KTKA 5COBA 4CV3A 5G0TA 3D4NA 2VNSA 1R4NA 2HUNA 1ML3A 2PY6A 1E7QA 4S3MA 4B7CA 4L4RA 4QFDA 1PZHA 4ZVVA 1YXMA 2PZKA 3GC6A 1QYXA 2ZB7A 1TEHA 3ICCA 1U7HA 3C3XA 3H3FA 1P33A 4Z0PA 3MJ4A 2E49A 3DMYA 1ZH8A 1PU2A 4BO2A 3WICA 1LSJA 1FDUA 1HE3A 4WLVA 1SB8A 1B26A 2PKQO 3U5TA 3PYXA 2XXJA 4PLHA 3OQ6A 5H81A 3MEQA 4BNWA 1M66A 2EG9A 5IFLA 4H3VA 5JYEA 3U0BA 3KZVA 4BNHA 1PZFA 1ZJYA 2OGUA 1HEUA 3ZU3A 5A4DA 5IJZA 1KERA 1VL6A 5DDIP 3CKYA 4W7HA 3I9MA 3WFJA 5F21A 1CDOA 5G0WA 4LK3A 4CR7A 3GFBA 1JAYA 4YAIA 1Y5MA 1YGYA 1ZSVA 1UDBA 3JQAB 4RVSA 1I10A 1LI4A 5EQDA 2WM3A 3GT0A 2JHGA 3ANMA 5IDYA 2VQ3A 4NFSA 4CM9A 2DT5A 3NKLA 2O4CA 1NQOA 4I9HA 3UF0A 2FZEA 3W4IA 4AG3A 1MB4A 3B20A 2CVOA 1W6UA 4ROSA 4YJHA 2I3GA 3V2UA 4DA9A 6ADHA 3ZU5A 1H93A 4YT8A 3DBRB 3OIGA 3UOGA 1XCBA 2EGHA 3H5RA 4NIMA 1GCUA 1EFKA 3RASA 4PLCA 4MOWA 5KWEA 2X0NA 3ZWAA 2AE1A 5TC4A 2HJSA 4DXHA 3ZI0A 4OYRA 1KBZA 4IQ8A 1EUDA 1D4FA 1NP3A 3H2ZA 4AICA 4MIOA 1B0AA 4QFCA 2UYYA 1F12A 3ITKA 1V8BA 1XG5A 1DIRA 4IJKA 4XQCA 5G4KA 3GVHA 1LU9A 3KBOA 1GCOA 4M89A 4RCVA 1UAYA 1KVUA 4J7XA 1MFPA 3D3EA 3PQDA 2XOXA 4XYGA 3JQ6A 2X86A 4BNKA 3GN2A 4CM8A 4ZJUA 1SCUA 1AGNA 5EMHA 3L4BA 2A9FA 1EBFA 4J1SA 2YZ7A 1HE5A 1PIWA 2P5YA 3Q3CA 3RQSA 3UHAA 3DL2A 3R6DA 4PLZA 3Q9UA 3U4HA 9LDTA 3Q0EA 3BIOA 5ES3A 4GLOA 4CQMD 3BMNB 2UV8A 3AOGA 4CQLA 3PYMA 3VPFA 2PD3A 4EITA 4OXNA 3QA9A 3NYWA 3UGKA 1QMGA 3AI3A 4B3IA 1U4SA 3I9LA 4CV2A 1YL5A 1ISJA 4DBZA 3KOUA 2CUKA 3D1LA 1PQUA 4JCOA 3RUCA 3JQEA 4PLYA 4AL4A 1QYVA 4GBJA 1F06A 1RM3A 3RFTA 3UICA 2BFAA 4BIIA 1VM6A 1JN0A 2HMSA 1WDKA 4GVLA 4M55A 4ND3A 4RVDA 2JHFA 1VSUA 1ZKMA 2IZZA 4JXKA 4CM1A 1BVUA 2EJWA 1YRLA 1E7WA 5CPBA 5L95A 1UXKA 1B8VA 1C1XB 2VWHA 4IIVA 1DLIA 4YQYA 3JQFC 2HK7A 3VPSA 4BNMA 4QXMA 4CMJA 2AQKA 5KJ6A 1AXEA 3PWZA 3OJFA 3Q2IA 4D41A 3VH1A 2GN8A 5GY7A 1GYRA 3L07A 5FI3A 3PHIA 4KUEA 1OBFO 2DFVA 1EE2A 3JQGA 2NWQA 4XYMA 1ZXBA 1LQTA 1YKFA 1UXHA 2VHWA 3DAGA 3OJEA 4UVIA 1K5HA 4OAQA 4WPGA 5A02A 1A9ZA 3AUUA 4ONEA 2J6IA 3ZHYA 2VNAA 3VKVA 5ER9A 3B1JA 3TZ6A 4YBZA 3OJLA 5FYDA 2BH9A 1EVIA 2P5UA 2Y1FA 5JMWA 1HXHA 3V2HA 1IULA 3ZHZA 4AJOA 1HT0A 1IB6A 1TA4A 2ZTUA 5KJCA 1DJQA 2VZ0A 2Y0CA 3QP9A 4HP8A 1L7DA 4IM7A 1OAAA 3K30A 1XKQA 2IXAA 1UP4A 1Y9AA 3HHPA 3GEGA 4GPD1 4BNZA 2Q1WA 4FGWA 2IRWA 3JD0A 3PIDA 2NU9A 1HDRA 2JL1A 2WYUA 2WEKA 2YY7A 4LISA 4NDNE 4RDHA 1EVZA 2IDZA 3GNSA 3H5NA 2TMDA 2Z1MA 4RPLA 2VWQA 4PZDA 4WLEA 4D79A 1FK8A 4IS2A 3U3XA 3U09A 2I65A 1T2FA 2O3UA 5L3ZA 1PQPA 1WMAA 4JIGA 4RPHA 3ZHXA 1EVJA 1W73A 3ZW9A 2UDPA 4MIYA 3IDSA 1TT5A 4DWVA 1NVMB 1DIGA 2OBNA 3OIFA 4L8VA 1NHGA 3BMQB 5JSFA 1G0NA 5EESA 3ANNA 1X7GA 1FJHA 3LYLA 3L6OO 4HFRA 3WXBA 1TB4A 5BNFA 2Q46A 1DXYA 3IAHA 4J4HA 1PJ4A 3OA2A 2P91A 4HV4A 1GV0A 1KEWA 1LTHR 3TRIA 4FFRA 1LC3A 2J8ZA 1B15A 2OL4A 3OF2A 3T4EA 3ZWPA 2BD0A 4GX1A 4MJLA 1GQYA 2E37A 3GQVA 5BT9A 1CERA 5CEJA 1IE3A 2DBRA 4KQXA 5KIAA 3WS7A 3AY3A 2W2KB 3ZWNA 5KVVA 4E12A 1WDLA 2CDAA 1ORRA 5TIIA 4WOKA 4CUZA 1TXGA 1GR0A 4RVUA 3OSUA 3KRTA 1GPDG 1PEDA 1OZAA 5JDCC 1U28A 4D46A 3UXYA 3PHGA 4J4BA 2C0CA 3L9WA 3JCZA 4IGFA 4FC7A 3DHEA 1P45A 1DJNA 3RAJA 3KYDB 3KB6A 4XEHA 3H6KA 2PH5A 4PLPA 2A94A 3UN1A 4NK4A 2ZTMA 1DEHA 2R00A 3HJAA 3QSGA 1QV6A 4DLBA 3DDNA 2P4HX 4NBTA 4CMCA 3SC6A 4ZQFA 4E32A 1YB4A 3GRPA 1LDMA 2O3TA 3KUXA 5MGBA 5CP8A 4MP6A 3EK2A 1BXZA 3INRA 4CUKA 1B8PA 2DBQA 1OC4A 3K8ZA 4B79A 2PKRA 1VL8A 2G1UA 3WQQA 3GHHA 3INGA 2GCGA 2J3IA 1V9LA 1DPGA 3AM3A 3VPHA 2C20A 5JE8A 2Z95A 3VKUA 3I4FA 4J0EA 1IL0A 4ND1A 2FSVA 4EJ0A 1RM0A 4YPOA 1BDBA 2Y1GA 3DHNA 2D5AA 4BKPA 5CDGA 4CM7A 1LLUA 1GD1O 2D4AA 1ONOA 4JJIA 3LT4A 2NNLD 4D0RA 1E1NA 4A2CA 1RYEA 2Z1NA 3MJTA 4XYEA 3B1KA 1QP8A 5ITWA 1UZLA 4YAGA 5THQA 5EN4A 3VH3A 1YWGO 2W4QA 1R4MA 1NFRA 2O2SA 3RUIA 1GUYA 1OFGA 3E82A 2C29D 4GX5A 5TT1A 2I99A 3Q6IA 4YDRA 3DAPA 2Q3EA 4BVAA 2PGDA 3BMOB 3QRWA 3ASVA 4HNGA 3CE6A 3MOIA 1N2SA 2ZQYA 1Y8QA 4RQUA 4WECA 4BB6A 1E5QA 4JGBA 1PTJA 3NRCA 4DMLA 3BMCB 3WOHA 4LVUA 1C0KA 1ADBA 2VZ8A 2NTNA 2HJRA 4LMPA 3DWFA 5FF9A 5KVCA 3JQCA 2Y0DA 1PGNA 2YHUA 1I0ZA 4YAKA 5L4LA 2Y68A 2UUPA 1TVEA 5DP2A 2D5CA 5JY6A 4R4JA 5L4NA 2WD7A 3GPDG 3DOOA 4Q3CA 3VVBA 3EHEA 1ZK3A 1ENOA 1PJ3A 2EW8A 1YONA 3VPGA 2V65A 3DXFA 2QRLA 4FFPA 3AY6A 3GK3A 2YHIA 3MJEA 3RKRA 3WJ7A 4EW6A 5DBGA 3LU1A 3H9EO 4P4LA 1E1LA 1NWCA 1TT5B 2FSSA 5GMOA 4J2HA 2VZ9A 4CLOB 3GGOA 2I66A 3JYPA 3GF4A 2Q99A 4BNLA 5JAQA 4NNJA 2FWMX 5C7IO 5IN4A 2JAPA 3K2BA 4OQYA 4CODB 5C7LO 5T5QA 1FXSA 4Q39A 3FI9A 2C5AA 5GZ3A 3GOHA 2AEFA 3JQ9C 4BO3A 3C7DB 3AI2A 3WMXA 2G82A 3CXRA 1UXIA 3BMCA 5JDIA 3FTNA 2JKVA 4WKGA 3WTBA 2RCYA 1I8TA 3IUPA 3I9JA 2VUSA 4HFMA 2P68A 5EERA 2WSBA 2O3RA 2FY8A 4IJVA 2B36A 3GVPA 3KSZO 1CQJA 1LLDA 2VYVD 1R4NB 4WLOA 3AY7A 1PR9A 4H16A 4MVJF 2QZ9A 4CM4B 4F45A 3AOEC 1EEHA 1DIBA 3H65A 3G1TA 2Y1DA 3T7EA 5C3MA 4JQCA 2W2LA 3S2GA 4IDGA 1C0LA 4G2NA 4FD3A 3OQBA 5EJ2A 3A4VA 4Y8VA 3C8MA 4MVJI 3KHUA 2UVDA 4RF5A 4Z3DA 3WGOA 1AN9A 1M6WA 3DBLA 4MVJG 3PJEA 1ZVMA 1DLJA 2AG5A 1P1KA 4DIFA 4XJTA 1QKIA 1C1DB 2B37A 3F6YA 4CL8A 4II2A 4D45A 1PJBA 1SB9A 4JLWA 3RSHA 1E1MA 4BNJA 4BUCA 4FN4A 1TT7A 2QQ5A 2Y67A 4K6FA 3RC9A 3G3EA 4IDAA 4WCFB 5COQA 3IJRA 1O95A 3MWEB 5A04A 1EK6A 4J49A 3QLJA 3PJGA 1H94A 1Y5RA 2EW2A 4B3HA 4ESOA 4YT2A 3ZCXA 1PJCA 3TZKA 3FNGA 1F8FA 1V35A 5A06A 1X15A 1UZMA 2C59A 4EI2A 5JW6A 5BQFA 5A3VA 3DBHA 4GI2A 4JN6B 1SAYA 1EDOA 1VRWA 4TZKA 4YAEA 3L4SO 3Q9NA 4Q3AA 4KOAA 4XIYA 5IZCC 3BAZA 2CSUA 2GD1O 2H63A 4S1VA 1SEPA 4BNYA 4ZQBA 5T8KC 3DBVO 2YDYA 1PL7A 4GMFA 1SMKA 2JCXA 4ALJA 1GADO 3WQRA 1C3VA 2B35A 3ENKA 3FNHA 4EBFA 1X0XA 1MUUA 1F17A 5L9AA 1DRUA 5BSGA 1HKUA 1DC4A 5DT9A 5AXDA 3QE3A 3K73O 1R66A 2ZB8A 3WYCA 1ISMA 1BXKA 3S8MA 5JLAA 1PJTA 2OP0A 3RC2A 3FNEA 1KEVA 4A10A 4D0SA 2HU2A 4G65A 2GZ3A 4XDYA 2O50A 3FN4A 4BOYA 1DSSG 2UAGA 2X9GA 1O89A 4XYBA 1QG6A 1BDMA 2Q1TA 4CLOA 2G0TA 4IDFA 2VUTA 1D3AA 2NQTA 4G5HA 1E77A 2GGSA 3GDGA 4LN1A 1BXGB 1EZ4A 1M6HA 1BRMA 3BMQA 3DTTA 2POQX 4E2ZA 4XD2A 3ZNQA 4BV9A 4E33A 3NAQA 5JS6A 5JFOA 1HDOA 3A28A 3L77A 1ZK1A 1LLQA 1UXGA 5TNXA 1ZBQA 1T26A 1XDWA 4KQWA 1YJ8A 3CZRA 4PVCA 1BVRA 4RLSA 1TI7A 4WK6A 3VVCA 1WLYA 3TL3A 1JKIA 1YJQA 4L4SA 1IHYA 5A9SB 4ZA2A 1CRWG 2H6EA 1JDJA 5BNIA 4ALIA 4JNKA 4A73A 3ZWXA 1ZMOA 2OP1A 3BA1A 3D0OA 2W8ZA 1P3DA 3QJ5A 5CDTA 2DVMA 3RWBA 1GZ3A 2DPGA 4UEJA 2DTDA 1EVYA 2O3JA 2E6UX 5EL0A 2YQ5A 1ZXLA 3H9UA 4MKRA 3WGHA 2CNBA 4ALLA 2O2YA 3ONEA 4DQXA 1X13A 2VRCA 4BMSA 4JJGA 4BNTA 1PJLA 4FCCA 1QR6A 1YVEI 1RYDA 2AXQA 4OOEA 1VC2A 3EAGA 2B83A 2GZ2A 2X9NA 3OICA 2BLLA 4O63O 3S55A 3GAFA 4PLFA 3QW2A 1EUCA 3HADA 3PZRA 1YL7A 1HZJA 2YFQA 1HF3A 1KEUA 5KNLA 3HN7A 1MXFA 3HWRA 3QY9A 1NQTA 1PGQA 5I9NA 2Q1SA 3K92A 1E3WB 1JKJA 1HTBA 4HUJA 1ZW1A 1LA2A 1P1JA 5TT0A 5HS4A 4OSPA 1P31A 4ITUA 1BG6A 2WWRA 2QRJA 5JCJA 1J6UA 1ENPA 4TVOA 3RUFA 4NJMA 3B6ZA 3P5SA 5FFFA 3TQHA 4J1QA 3FSRA 4BQRA 4NFHA 2NVBA 3KLMX 1V6AA 1NFFA 5KJFA 3UCEA 1U3TA 2NQ8A 3IC5A 2O7SA 2D1YA 1CYDA 3M1LA 1RWBA 2NVWA 2C54A 1J49A 4RO0A 1VJ1A 3ZWOA 4Z6KA 5G4LA 2GASA 3O4RA 1NWHA 2NVUA 2YQ4A 2ZYDA 3F5QA 1R6DA 3A1NA 1ZNQO 5DBFA 2EERA 1NASA 5KOIA 3R0IA 3WYEA 4DIOA 1D1TA 3BTUA 5FEUA 4OH1A 1QXSA 3IJPA 5F5NA 4BHTA 4Y6PA 3W1VA 3IUSA 1PS9A 1YO6A 4R3WA 3ROPA 4KWHA 3GHYA 4IS3A 3PIIA 2ILTA 3NX4A 2DAPA 5L4SA 1PQWA 1PL8A 4JJFA 4NBWA 4U0JA 2PK3A 4RPKA 4E5MA 2HQ1A 2YW9A 3ZN2A 1W4ZA 4CQMB 1IZ0A 3PDJA 1AE1A 1ZMTA 3TL2A 5JC8A 4UREA 3ZNPA 3IL2A 3A9WA 4GQAA 3KVOA 5CPFA 4DVJA 3DMTA 3WWZA 3P2YA 4NPCA 1IY8A 2Y99A 1A7KA 4IDCA 3RC1A 4A7PA 3O9ZA 4DYVA 5HM8A 3RFXA 3RROA 1XQ6A 2JD1A 3VZSA 4Q3BA 4ZICA 4PG4A 3PLRA 1H0KA 4WEOA 1C1DA 1U3WA 4RZIA 3SBOA 2NUAA 4UVHA 5EINA 1ZSYA 2PZJA 4MPDA 2HK8A 1I3MA 5HRUA 5I9MA 1H6BA 2EIHA 3KETA 2ZCUA 2CDCA 1VI2A 3EW7A 1YQGA 4EDFA 4WOJA 2NM0A 1ZO8A 3E5RA 1PWXA 4M54A 5JYDA 1ADGA 3LT2A 4R1UA 4IJWA 4XQ9A 4BKUA 2CVZA 5I7FA 1B3BA 4N5MA 4XA8A 5K6AC 4QEDA 1FDVA 3MTJA 4MVJD 4DLLA 3AI1A 1FMCA 4RPJA 4DLAA 3V8BA 4XJSA 4Z3KA 1U9JA 1UR5A 1EK5A 2XPCA 4TRJA 2FP4A 4IUYA 5JCXA 2RAFA 5A05A 3I23A 2Z5LA 5JMPA 3TN7A 4AJ4A 1BSVA 2PV7A 3FTPA 3ROMA 1DHTA 3PPIA 4KMSA 4CLRB 4ALMA 4ND2A 3PP8A 3TDKA 4BGIA 1F8GA 2JCVA 1ZFNA 3GGPA 1NR7A 2OMEA 2YV1A 1E6WA 1XU9A 3KYCA 5JPIA 4W7IA 5EPOA 4FBGA 4K6CA 5IG2A 4IMRA 3WX0A 4GSLA 3C24A 4XDZA 4HBGA 4BB5A 4CM3A 2PD6A 1MP0A 5BSFA 3GLQA 2JJYA 3MOGA 2J3HA 4ND5A 4ZGWA 4R54A 4GX0A 1VPDA 3KYDA 4J7UA 1QYDA 2IXBA 1YB1A 4Y9DA 1JWBB 4QSMA 4F6LA 2ET6A 3VPXA 1Y8RA 1HZZA 4O59O 4ID9A 3QWBA 1ZEJA 4BKOA 2IYOA 3GEDA 4CM6A 3AWDA 4XGNA 3CZMA 4INAA 3TZQA 4QO7A 4D3SA 1KC1A 3I6IA 4RPGA 1ULUA 3R1IA 5MDHA 1K0UA 1Y8RB 5HS6A 4EUFA 2O4UX 4PLTA 5CDYA 4B4OA 5AYVA 3WGIA 1A72A 1LX6A 3ZU4A 3D3WB 3RJ9A 1ZJZA 1RKXA 3PWSA 1QYWA 4J0FA 5G0VA 3NT5A 3SLGA 1H2BA 2FRDA 2OOSA 1P77A 4YJGA 2EKLA 1BMDA 2HSDA 1QORA 2Y1OA 2ZTLA 4FIZA 2EHDA 4FFMA 4GL4A 3WIEA 1H5QA 3JYNA 1Z73A 2BF7A 3MTGA 5I8ZA 1RM5A 1UDCA 3AK4A 1MC5A 1P1IA 1O9BA 3RJ5A 3IOYA 2BFMA 1SPXA 4OKIA 4BO4A 4PRKA 4WGGA 4RZHA 2OORA 1AUPA 1GDHA 3IKVA 1SOVA 3L6DA 3GVIA 3F1KA 3HN2A 3HG7A 3LT0A 4CMIA 3RBVA 2QYSA 5CHEA 5LC1A 3MJVA 4DBVO 2I6TA 2CZCA 3KEQA 5DCWA 1E0DA 4L75A 4FSHA 1AXGA 4OJNA 5IZCA 1XIVA 1P1FA 2WYWA 4J7CA 4XQEA 4I5DA 4QT0A 5DNAA 5EQFA 4WUVA 1PL6A 4NR0A 5DF1A 3E6AA 1E3IA 3GDFA 3MJCA 1YBVA 2AQHA 4Z9FA 3GEMA 3TWOA 4JBIA 3E48A 1NYTA 3V5NA 4RL6A 1B2LA 2C07A 3AUSA 4HKTA 5A9TA 4KUHA 1EBUA 1ZK4A 2AEJA 4JBHA 1DC5A 3F4LA 4J90A 1GZ4A 2DKNA 1I32A 3GMDA 3K6JA 1B14A 3LF1A 3DZBA 3VTFA 5K6AA 1Q0QA 3PGJA 2Y1CA 2NTVA 1Z75A 1D1SA 2C7GA 3RBXA 2HMTA 4XWYA 3VDQA 1N7GA 3WLEA 4A27A 4Y67A 2YUTA 1YBAA 1H6DA 4KTVE 4NBRA 5DP1A 4HFNA 4CMAA 2SCUA 1P1RA 4C7JA 5JBIA 4G81A 5AQ1A 2XXBA 3VTZA 4L4XA 1E7YA 1HDCA 1DDOA 1N9GA 1SZJG 2DFDA 5HBRA 5TGDA 4DPKA 4O0LA 3F1LA 2GSDA 3ORFA 1GQ2A 4BNGA 4FGSA 2NV6A 1HYEA 3SJ7A 4R51A 1LLCA 5IAAA 1U2GA 4NJOA 4LCEA 3TFQA 1PX0A 2GYYA 1MV8A 3PFWO 1UXJA 4ZRNA 4D42A 1CETA 2X5JO 2WE7A 3OEWA 4GKBA 2RHCA 1UDAA 2OZPA 5B1YA 3GDOA 4M1QA 4PLWA 1MG5A 3ETGA 2FZWA 5JY1A 1YQXA 3PVZA 3RKUA 2Q4BA 4OSOA 3S2EA 2I9PA 3ULKA 1LDGA 4DTIA 1GU7A 1Q2XA 1YB5A 2F00A 3WGZA 3E18A 1PJ2A 4IDDA 3OM9A 4OKNA 4I9UA 4XYLA 1ZK2A 1MXHA 1HL3A 3DZIA 3VAZA 1KVTA 1KY5A 1SBYA 1Y7TA 5I7SA 3QVTA 4EGFA 4BO1A 3G0OA 3QQPA 4Q3EA 2FPGA 5B37A 3V1UA 2VHXA 1PGJA 4DQUA 4IPTA 2IZ1A 4EYEA 1DRWA 3BZUA 5JO9A 3JQ7B 1NM5A 4AFNA 1NAIA 3AW9A 1ENZA 4BMVA 3WWYA 1XWFA 3WBFA 3WGYA 1J0XO 3VHRA 3DBRA 2YHIB 3ADOA 1HDZA 3O03A 4LMRA 1GY8A 3PHLA 2W2LD 3RU9A 4CM8B 4NZ9A 1Z7EA 1CWUA 1JQBA 1UUFA 1HDXA 4TSKA 4UVDA 3SEFA 3VC7A 5CG1A 3L4BC 1WW8A 1X1EA 2PLAA 4W9NC 4E31A 3ADPA 5AOVA 1HDYA 3JSAA 2VRCD 1N1GA 5G4KB 2J5QA 4N18A 1U7TA 4RV9A 4ILKA 4R01A 2JFGA 4K26A 5F1KA 4P8RA 1LRJA 3E03A 1AHIA 2IODA 3JD1A 4PRLA 1WNTA 2PZLA 1N7HA 1VJ0A 7ADHA 4J2OA 4A26A 2AE2A 4JBGA 1NPTO 3QWFA 1O5IA 1E7RA 4I08A 1OMOA 3PJFA 4C7KA 4UAGA 2VHYA 1LEHA 2EKQA 3DQPA 4UVGA 4FB5A 1E7SA 2QYTA 2VHZA 4IQGA 1HWYA 5TQVA 4DUPA 4YJHB 4F46A 1JW9B 4ALNA 3D4PA 2D8AA 2VTDA 3HDQA 1HYGA 2AG8A 2QG4A 2R00C 3GMSA 3W4JA 1SC6A 2CDBA 3FHLA 1T24A 2VYNA 1GZ6A 3NT4A 5H83A 4FJ0A 5JAIA 2WTBA 2EXXA 2A92A 2I3AA 5AXBA 2GRAA 9LDBA 3TZCA 5CDUA 2D3TA 3QVOA 4YA6A 2GLXA 4DMMA 2HK9A 4Y6SA 1MC4A 1P44A 1ULSA 1R12A 2BGKA 1T2EA 3U62A 3CUKA 4YQZA 3HZZA 3PGXA 3CPSA 5L7WA 4RORA 1KIFA 3C1OA 4IINA 2Y66A 4GX2A 4BNVA 4BO5A 3IP3A 2WD8A 3FD8A 3UW3A 1BXGA 4AJ2A 3TFOA 2CFCA 3I1JA 1ZCJA 1ISFA 1LSUA 5CAEA 3FR8A 3WSVA 4B4WA 1NTOA 4IBOA 2E4AA 2X8LA 5B4VA 4WCFC 4A5OA 2H9IA 4CLDA 1SNYA 4EUHA 5U9CA 3A14A 1B16A 3DO5A 4E5PA 3JD4A 4HY3A 4OGWA 4I1IA 1YOVA 4YRBA 3VZPA 2NU7A 5TS3A 4IJUA 2DTXA 3DMTC 4MVJH 1ADCA 4TRMA 2GR9A 3UFXA 4WCFA 1ZUD1 1WWKA
chains in the Genus database with same CATH superfamily
2QRUA 3I8XA 1C3OA 4JUDX 2JPDA 2XUAA 3ROQA 3UATA 3VNAA 4MW1A 2DWOA 1ZICA 2P4SA 1VHQA 1RXIA 3N75A 4I50B 1A5AB 4JCCA 5G2OA 3TAUA 1RYNA 1S9DA 1JJAA 4CM9D 5LLDA 2G9QA 4DR3B 4QBKA 5AW6A 2CXUA 4MR9B 1KYYA 4UU7A 1OCEA 2YMPA 1UOEA 2HEIA 4KOEC 1NUQA 2E48A 1VXOA 3ILVA 3PC2A 2RGBA 2UVQA 2Z8YA 5T3UA 3KE9A 4F7DA 5BR4A 1UC4B 1KEKA 5CTJA 4OI0A 5JTTA 2NT3A 4A0QA 2QAIA 3DAHA 3RYFB 4W82A 4ERNA 4RJTA 1BOFA 2XVXA 4KBGA 4HYEA 1IN8A 3FPGA 1JEDA 1C4XA 2B6HA 4CKCB 2O6LA 5JTUA 4B7ZA 1S8FA 4C0XA 4KO3S 2AN1A 3HXQA 2R1UA 2JGNA 4ZQIA 4EL5A 5ALSA 2HDWA 2RGYA 4AU1A 3NGLA 2O1SA 2HA7A 1E2HA 4I9FA 3PA6A 3SR0A 1THMA 1ZDMA 1ZI9A 1GA4A 3C1UA 3QPCA 3IKJA 1VG0B 1WCIB 4IIYA 4V39A 3TCNA 3OTOB 3UAOA 4RXMA 5I47A 3BRCA 3K5IA 4I6GA 1XNJA 5DH9A 3NEYA 1XPJA 4JVNA 2P2NA 2WE8A 2WFZA 3L8MA 4X7BA 1OLUA 4HQ6A 4CU2A 1AV6A 3SS9X 5ECGC 5KBYA 2AFIA 3W6UA 3X44A 4B6PA 4JI2B 1RYBA 5C7OO 1YMQA 1E79D 1NJ1A 2GEUA 1NVTA 5TMBA 2LW7A 3AETB 3FBWA 4U2FA 3EIQA 3M7IA 2CMKA 3PEFA 2FJ0A 2D54A 1N6LA 2C58A 2G71A 3I04A 2WHPA 5E8JA 5HKLA 3TPZA 2XMPA 1FMTA 1E6UA 4KN8A 4UEWA 3LVFO 4V0QA 3K32A 5TQJA 5KTRA 4RY2A 1JVSA 4U9IS 2ZJ6A 3CURA 1GUZA 4F72A 5I3CA 2H1LA 5IDWA 5LUBA 5F4BA 3H3JA 1R0LA 4E2XA 2ZXUA 3NLLA 5CITA 3ABQB 4WLNA 1Q7EA 2X4LA 1T8RA 3EMKA 3OP1A 5AHOA 5E4YA 2JGLA 4FDAA 4EKIA 5AUNB 5KQRA 1RZRD 4XSHA 1FP6A 2IJGX 1J7KA 1THTA 1ZBDA 3DEHA 3OMLA 3Q6NA 4I5GA 3OKPA 4R2MA 2I6GA 1NXSA 1S2OA 4GO1A 5AW2A 4CKEA 4MUAA 3Q3EA 4WY2A 5DBHX 1NI5A 3SZOA 4EEZA 3ASYA 3IPXA 4I8XA 4ZDWA 4B6JA 1ISIA 1SU7A 3UG7A 2ZVPX 2NXEA 4ITVA 1DDGA 3G2PA 1UP6A 1DBIA 3FPCA 1TCAA 3PC8A 5FOQA 3A25A 2BDEA 2G83A 5EOVA 4YAOA 2FFRA 4L8WB 2EDCA 3GUCA 2CKMA 2RC5A 4U9UA 1I2BA 2M9MA 2XTAA 3DLAA 1F4PA 1K89A 3AJEA 5AOAA 5HMLA 4BFTA 2VP4A 4BRWA 1S8OA 2AC2A 4CV1A 3LCUA 3GGGA 1KJWA 1Q0HA 4R68A 5P21A 3DJFA 5EE3A 2AKYA 2VJKA 4R2IA 4IH1A 1XLTA 3STUA 2RH8A 3FPKA 2W43A 3HCRA 3KKQA 2IY7A 2IYTA 5B7GA 2NZVG 4Y2PA 4RF4A 2TECE 4NEGA 5CK4A 2OXTA 2EZUA 3NTOA 3QXXA 721PA 5F2NA 2EWVA 1ABBA 1OZGA 3JQGB 3ZDEA 1ZR4A 2BEJA 1G5HA 2QTGA 3GLHB 1VCHA 1PEYA 3AR6A 4HNAB 2FJUA 5CB6A 4G0MA 4YP6A 8MHTA 4RJJA 3RU7A 2EV9A 1AKNA 1PZXA 1X19A 2R48A 2WU0A 2OVFA 2E4UA 3OEHA 5SYAA 3ZW8A 2RIRA 1JIXA 5GOTA 2V6BA 5KJ1A 2OV2A 1E61A 1LJUA 5HFAA 1A4XA 3SR4A 3TLJA 3FYUA 4FJ1A 4PIMA 5FI0B 2J5KA 5FP0A 4ER6A 8ABPA 3KVNA 1T8PA 2OBXA 1BROA 3C85A 4NU5A 3BXXA 2OHXA 2HPVA 1HL7A 4EGSA 1W0JA 1E0SA 3AF3A 4L50A 1UJ2A 4GKAA 4A8HA 5ALXA 1A8QA 4H6XA 2YMMA 5KSZA 4GI3A 5L6LB 2YXNA 2AZXA 1WZEA 3F96A 3BWBA 3D8SA 2DR0A 5EQJB 2GJ9A 2Y4OA 3EMDA 4FN5A 4M0EA 4RH1A 4JDPA 4UQPA 4QVGA 5DOVA 4AZTA 4BKRA 2ZDQA 4Z1OA 4NY1A 5C4IA 1X94A 4I55A 3FFWA 1PT7A 4X3CA 2L42A 5EZSA 1K86A 3DZJA 3CNLA 1V6CA 5JCJD 3PQEA 2CNWD 4XGQA 1L7EA 5LXTF 3FOZA 1FP4A 2JLRA 1QHHB 1XQ1A 4MP3A 4XI9A 4RF3A 5EWMA 5K8IA 2J0SA 1YBFA 2F62A 1F7VA 2DY1A 4UPEA 1JQKA 2J46A 3L41A 3DHVA 4NYMQ 3UC9A 2XYHA 3HU3A 1H4QA 1YJ5A 2EC5A 3R75A 1VKNA 1NX9A 4RHUA 4Z8YA 2CDNA 4TUYA 4IRMA 2PIDA 4Y2JA 3EIOA 1QUFA 1AU9A 1JPJA 5AW0A 3FMOB 1DFGA 2HPHA 1EQUA 2Q50A 4A16A 4QU0A 4DM4A 3DT9A 1ZLYA 3AUTA 3IE0A 5HEKA 1T2CA 4QBFA 2EP8A 4MPPA 2GNOA 4D4GA 2G4CA 2QJRA 1A5TA 4QX6A 5FV7A 1YTLA 3EDMA 4JHXA 1O6ZA 4H77A 4FOLA 3VR4A 1SVLA 1TJPB 3TVDA 1JH9A 2IP4A 4EJSA 3C8DA 4RKFA 1YQEA 5J59A 3JQRA 5EP2A 1Z5NA 1XRSB 2C2WA 2CL7X 1UBGA 5FIUA 1G1MA 1GSOA 2NXWA 5DZSA 4BNNA 5JWRA 1KEPA 1XALA 4K81B 1RQNA 3FNFA 3OKFA 1KFCB 4LUCA 1L8LA 4QWMA 4RHTA 2MR6A 3PHBE 4UM7A 5CT9A 3DPSA 2WNIA 3W7VA 3NFYA 3RIYA 4B46A 2R9VA 2I0FA 1W4CA 2RAUA 3VC3A 4YMVA 2EYQA 3F8SA 1MX9A 4W5JA 5F77A 1BE6A 3LZCA 2HPZA 2QMZA 5DXAA 5A3JA 3U4DA 1U99A 2IEBA 2PX4A 5JS8A 4GP9A 4B6OA 3H7AA 2HLPA 3FDJA 4YMWA 5B4UA 4O25A 4EKDA 1WUTA 2VSNA 3B6MA 3NDIA 1GSAA 3KPYA 3E9CA 3LWNA 3MCZA 3UW1A 4EMTA 1GA1A 1M2FA 5BW8A 4BJ3A 1XTZA 2FK8A 1TGVA 2OZLA 4BGEA 4HGZA 5I8WA 1X87A 1I7LA 3IP6A 3TLGA 1A69A 1E2IA 4LJLA 4NICA 4YAUA 2X4IA 4GVXA 3UFXB 4IVPA 2MT9A 2D5BA 4EK9A 2OO5A 3LDHA 2VKTA 3H0KA 1TQHA 4CIYA 1P8JA 3WI7A 5AI8A 3AV0B 3CW9A 1UKCA 4MYUA 5JUWA 1MQAA 2YIMA 1AHHA 2FMFA 4MVJM 4N6GA 4ZP1A 2HRDA 3VKWA 4B74A 5I7OA 5BQOA 2VVTA 1RWQA 5B1SA 5LJLA 1R6BX 1XK6A 1NBHA 2PZMA 2OG1A 3QEBZ 2JI7A 4BGDA 2GN6A 4JKIA 1PE0A 4M9SA 4FS3A 2R86A 1TZMA 1E9VA 1MNAA 3CN9A 3RYHA 4DREA 1OR8A 3PWTA 1DXOA 4XTRA 4AJKA 3OP4A 1KC3A 3KQOA 1G9XA 1WZUA 3UK2A 3TJRA 3UKOA 4ALKA 1QQ5A 5CFMA 1M72A 5JI2E 2ARKA 3HY3A 4M2LA 2CK3D 1HTTA 3IV6A 3FFBA 1ESCA 2E4YA 3H2YA 3MIIA 4MS1A 3W9BA 4AG5A 4UD2A 5DCLA 1K92A 4DIEA 1WUHS 3PRHA 2YVKA 2A14A 3P2MA 4WDRA 1XXHB 3UMGA 3JALB 1NYRA 2NXNA 4JT4A 1S3IA 4A0SA 5HSGA 5JARA 2GN4A 2HJHA 2H1CA 4TXHA 3PVCA 4IUBS 3PQ8A 2OAP1 1TA9A 2WFLA 4K9PA 4YALA 4WESB 3U9LA 1L5RA 1K2VN 1YRYE 4IZHA 4WW0A 3R7SA 3DZFA 3EZLA 3P1JA 4Y7DA 2WU3A 4FW8A 4NDZA 3U4AA 3LLMA 1R0KA 3O83A 4UXHA 5L3SB 4RD2A 3OC0A 3AH8A 1N5LA 2NADA 4YTEA 1TA0A 3GA7A 4G5GA 2RB4A 4J1NA 1R0CA 1TYEB 4LE0A 5DISB 2WUVA 3UJCA 3HKCB 3ZKWA 4D9GA 3THYA 2BI8A 3GRUA 4Y2QA 1UP7A 1ZMXA 3ENQA 3Q3GE 3DPIA 4HAVA 4HDAA 3S3TA 2HQBA 3ZDFA 2M32A 4CMGA 1BQEA 4D92A 1T9DA 4XVCA 3JQ8A 3U44B 3KJEA 1RD4A 3VU9A 4HFJA 3QU9A 1JFLA 3VOSA 4Q1CA 3HMQA 2FSFA 2HDHA 2VPXA 3L7LA 4DEXA 1JQDA 1DAMA 1ZLXA 3PRJA 3O4VA 1D1PA 1NDUA 5EIOA 4PSKA 4JN6B 2H29A 3M83A 2VXCA 1IG0A 1HNXB 4AMYA 2ZYUX 4KVFA 4NFLA 1VKOA 2GN2A 1YBHA 3QPVA 3E5MA 2PYZA 3G1UA 1LXCA 4R31A 2GWRA 3O21A 9GPBA 1ST2A 1SULA 5DBIA 4AJLA 1EKXA 2VNIA 2W22A 4LY0A 5E9QA 1BS1A 3WLNA 2JAXA 4P93A 4N48A 1ISGA 1J23A 2HMWA 2OAGA 3T06B 2UZIR 5J4VA 1ZRMA 4II3A 3IRVA 3W7BA 1BE8A 2F90A 1ZINA 1G3IA 2CLCX 4FFVA 5HRAA 4RTSA 3GO4A 2CV1A 1YS4A 3MGGA 3UWOA 3FZQA 4YJ3F 2ZIWB 2P9YA 3UK0A 4P6VF 3RS7A 4KNYA 4FYIA 2QY6A 3LLVA 4PZLA 2C9CA 2JFBA 5HIMA 5CIYA 3A6EA 3CF4A 1K8ZB 4U2BA 5IJ9B 2BFBA 4DBLE 4UTNA 4FX2A 1SO8A 2C4KA 4LPKA 4Q3DA 3HDHA 1M76A 3JV7A 1V7ZA 2G7MC 3NATA 4DIKA 1XMSA 2H7CA 2V7QD 2AJTA 3E1GA 3RS2A 4E03A 5KNBD 3TZBA 4F86A 1LNQA 3OCVA 2ZWAA 2A5DA 2DWPA 2EEZA 3G0DA 4CEIB 4PGFA 4HNRA 1I6WA 4R98A 2IU4A 2BPOA 4YRCA 4BMDA 1ZD8A 4KGXA 2PD4A 1R8SA 5B1EA 5LQUA 4CL2A 4TYMA 3NHZA 4PCUA 1GQRA 4G0UA 1VA4A 3OH8A 6LDHA 1CY6A 2FUG1 1N8TA 1OFTA 3G2IA 1MX1A 1RIFA 5JR3A 1G9TA 2WF7A 1W0KD 1PGPA 3KV1A 3RPEA 1NRJB 1RHQA 2J5XA 2A5JA 1PS0A 2X8AA 2XCOA 3RODA 1FJGB 4PG5A 1SCKA 2IP2A 1NQXA 3TZHA 1EGQA 3W2EA 4RNCA 3G49A 3ETCA 1P0FA 2GB4A 2GZSA 3LK6A 4H7IA 4L6AA 5ALOA 5BQ5A 4DCGA 3L3BA 2OCGA 1FSPA 3DYIA 2EP7A 3TOZA 1VSVA 4WCDA 4MW4A 4AVYA 1LCIA 2RG1A 3KHSA 1CIVA 3IEIA 2ZJ5A 2C84A 3OEHD 3RG8A 2V03A 3T5PA 2QTBA 3C97A 1HE1C 1W6RA 5HTOA 1IWOA 4QGGA 4BGVA 1QPBA 5ADUS 1CRZA 3CMMA 5CD1A 1CY1A 1S0UA 2W8BA 4IXTA 5KINB 1NJ5A 1SD5A 4YJFB 1F48A 1CXZA 1LC0A 2ACEA 1E7MA 2HWUA 2C03A 4BO8A 1DBVO 1N2BA 4GE0A 1VIAA 2OV6A 5FNVB 1SRRA 2IDMA 5DMHA 4DJFC 3T7AA 2XAAA 3HNRA 3QHQA 3EEYA 4C30A 4I66A 2X77A 5AXAA 3VR2D 5DWVA 1KI9A 1MQ9A 2Y05A 5BN4A 1Z5WA 2UZ1B 4RD4A 1U1FA 1Q0LA 2FG6C 2G5CA 2RHLA 1ZA2A 5AK3A 4DGSA 1Z0AA 4EARA 1M6NA 2ZBQA 2G9UA 2Z2KA 5A5DA 1HYHA 1T8WA 3K94A 3ZE8A 3RBAA 1EDEA 3TBFA 1NPYA 4O3FA 3T5GA 4CPDA 3S68A 2V7XA 2YUIA 4JX9A 2BH2A 1CJCA 1JBEA 1YR6A 3MVEA 2IYWA 2DQKA 2AJBA 4WFQA 2YDXA 1KEZA 3QYPA 2ZS9A 1F2UB 1YA4A 3RHSA 1IY9A 3QPUA 2QZ4A 3BL5A 4G0ZA 5IUJC 2ADMA 5EMLA 4TXJA 1T8SA 1WXDA 2D1QA 1RWOA 3I4CA 5G0SA 4PN7A 3FUTA 1D0SA 2B8NA 2FN8A 2XITA 1Q7GA 2ISQA 2QUZA 4GI5A 4J9VA 2RH9B 3OX3A 2Q7OE 4WKBA 3IBSA 2QXYA 2LR0A 4J9UE 1GKYA 4BJ1A 1JTEA 3BHMA 3HCWA 2IVZA 3AT1A 3PGLA 4DLYA 3IPRA 1EAMA 1MOPA 4LBWA 1QF6A 5E6UB 4JASB 4F4DA 2X9LA 2ZDHA 2QP4A 3G17A 4EG6A 1UODA 4MVXA 5AM2A 3ACDA 1EFAA 4D4HA 1L4MA 2PFGA 1Q7BA 4R83A 3B9RA 4Z1MD 4HN2A 4BQPA 4K88A 3NKFA 3A2LA 4LWPA 2K7FA 2B2NA 1L4FA 3QEKA 4E5YA 5AVRA 4WKCA 4O4LF 4MQBA 1WSBA 2V58A 2XUPA 2P2SA 3THRA 3TRHA 5AI5A 4DLXA 6Q21A 1CEYA 4K6HA 4BNUA 3OFNA 2AI2A 1U31A 1WQ1R 4KXVA 1CULC 4H1HA 4ZAYA 2PRIA 3BPSA 1NOKA 1JMYA 4UHKA 4E09A 5LMCA 5K0ZA 2ZYWX 3M3DA 4R8KA 1JR3D 4Q19A 3WGMA 2ZJYA 3SIPA 4YUWA 3JRXA 5CLJA 2OFXA 1PKEA 1REQB 1WD7A 4ZT2A 3B82A 2HU8A 2TSYB 4ZO6A 1P0IA 3LBHA 1GPUA 2CVQA 2JFQA 4MK4A 2ZR8A 3BFXA 1SU8A 1U90A 3RUDA 3OZDA 3LX5A 2OO7A 4LWOA 3D3WA 4YONB 5C9ZA 1SKBA 2FR8A 4BL5A 3CLUC 2GFHA 4CKBA 5CX1A 2HNAA 3H9QA 5FCDA 1G8YA 5IJ0A 5I7HA 4HD8A 1X1AA 2X0RA 1F8XA 4K9DA 4FBLA 4U3JA 4HXYA 1Z6XA 3A1WA 4ND8A 4N47A 3F7OA 3SJUA 4GS5A 4E3ZA 5ITZB 5JNUA 2PKQP 1JT9A 1CUXA 3RRZA 3TTUA 5MF6A 2BBSA 2D13A 4O2LA 4E94A 3D3KA 4R69A 1AS3A 4NZNA 3HVKA 4RY9A 5TY0A 3AI7A 1R0XA 2CN1A 4IDEA 4MWTA 4X24A 4GICA 4OBXA 1U98A 1KI6B 2IYFA 2H54A 4CR6A 1G0OA 3DR3A 3VVCA 1HT1E 1XEWX 3JQBC 5JRJA 5FBRB 1Y4ZA 2PSSA 1JYFA 2R6CA 2H52A 4FW9A 3EGEA 4F4UA 5AVWA 3THOA 1MOZA 2GPJA 3M81A 1J2UA 1YDWA 2BZ1A 3BXOA 1LVGA 3IPYA 3QUAA 4JJ8A 1IM2A 1UBCA 1OTHA 4U6SA 3LF2A 5FI5A 3B2QA 3CTMA 3RUHA 3S2IA 3M89A 1G1AA 2YOGA 3HU2A 4X94A 5AUQA 3H18A 3T9DA 4BO6A 1A8IA 1ZL2A 4L8LA 5ARCA 3GDHA 1HE4A 3HFRA 3OG9A 4C0AC 4F2WA 4XB1A 4IXMA 1B0ZA 3ZJ4A 1U63A 3WB0A 3ZW7A 4D6XA 4XEUA 1ZOPA 4IIEA 2YCLA 4MI3A 4REQA 4RENA 3BTOA 5JPDA 2OV8A 3W1VA 1JHMA 2WA1A 3OT5A 4M8SA 4P80A 1XSEA 5TX7A 3ETNA 1XVIA 3C15C 5C0OE 4UNQA 4N7BA 1GYQA 4UUAA 5I7VA 4C7OA 3QV2A 1RRFA 4KP7A 2YY6A 3BHNA 3EGCA 4L07A 4X60A 1YK1A 1GGVA 4E5NA 4X0EA 2C3MA 1JTVA 1C7RA 3N8IA 4RDIA 3AHCA 3HTXA 3LDUA 3PI6A 4LHEA 1P9WA 1ZEMA 2IUEA 2JIZD 4GOOD 1T4DA 1YBMA 3SKVA 4BX9A 1DADA 3H16A 1DTEA 4MDHA 3K0HA 1NQAO 2W90A 4IG9A 1P1HA 3U40A 1XHEA 3A3NA 5FTMA 3A0RB 5K20A 3C6MA 2I4MA 2HC9A 4LBYA 1S6YA 1ISSA 3EZNA 4GPZA 1IPFA 2PWZA 3L0OA 3GJSA 2Q9CA 3FFTA 1XEAA 3GLSA 4XUCA 2O20A 4LDNA 2F8MA 4P7FA 1IJBA 1ZM9A 5C37A 2Q6OA 3NOXA 3CINA 2X4DA 4IVRA 4D3FA 2QL7A 3VU1A 1Q7TA 4KODA 4Q7MB 3TZLA 3HMKA 5KC8A 1H2HA 2QUKA 1ZJ6A 3GLRA 1YS6A 1TK3A 4FKMA 4DDTA 5KU7A 2PUGA 1JWAB 4ZHQB 3DCJA 1XVLA 3C1TA 3EEBA 4H2DA 1Z6QA 5DHPA 2G25A 3ZE6A 4ZV4A 4OXIA 4PZ9A 3LYUA 1V8ZA 5CT5A 4OBEA 1QIHA 1NURA 1G3MA 1UBLS 1A8PA 1AUQA 2FPWA 3V4RA 5CNKA 3UWDA 3JATB 1IWPB 1KKUA 1UL1X 2A1UB 1Z88A 1JEAA 1V39A 4C3VA 3BHJA 4LDJA 5D84A 4KWIA 1Y5IA 2GVNA 3VR5H 3M6IA 3D0QA 5TF4A 5BNWA 1XU7A 2HL6A 2Z6UA 1DGQA 3ZQ4A 2YS7A 4YWHA 4GVPA 3CEPB 2Z4RA 4MUGA 2HMUA 1Q1QA 5AW8A 1WB9A 2PLNA 3AL3A 3FMVA 3GL9A 3AF1A 2C9DA 3W6ZA 4I3FA 1MO4A 5I7EA 5AI9A 2ADFA 3CBQA 2BUCA 3LG2A 4MYTA 4QGBA 1YIAA 3ETEA 1FFSA 2PNFA 3DQQA 4IIJA 3RU3A 1ATIA 4FMPA 3ZBQA 4OLBA 3KCNA 4A8JC 2V4MA 2XWBF 3ZZNA 3IV7A 4G1MB 1T25A 4JZKA 4DSUA 1H2AS 5HXAA 4Z9XA 4N76A 4PYKA 1NTRA 1SU4A 2PBZA 3BYZA 4X1IB 4DMHA 3JQAA 5A6SA 4KO2S 2C4WA 3R7FA 3C6XA 3WK6A 1T4CB 1SQFA 3K05A 5ANRB 4BNDA 3HCEA 2P35A 3OECA 1PVVA 2BGMA 2NZJA 3JTMA 4LGCA 3VI3B 1YZGA 2OXIA 2BHLA 2C97A 2G7ZA 1IM5A 1DG9A 2XE8A 3FRHA 3WA7A 3BKXA 1TRKA 2VWGA 2A4MA 2BM8A 3CJQA 3T7IA 3HDVA 1QF7A 3T9AA 1E2QA 2HR1A 3GFRA 1T2DA 1UT8A 3VXKA 1RBZA 3OD5A 1JHPA 4H08A 1I3NA 1BKYA 4UUNA 5L6MB 1YI8A 2V7WA 3D0RA 5TMEA 5EJ7A 1U3CA 4IX9A 1LBEA 4BO9A 2P6RA 3I58A 5ALYA 4KPYA 2WHEA 1KAOA 3FGZA 3HJUA 1YRQA 2N1MA 4OAPA 1IEWA 1DRKA 2WM8A 1YFJA 1R0SA 2HFJA 4FHZA 3Q1LA 3AIKA 4K5QA 2A78A 5CEFA 2ZRBA 3MWKA 4L15A 1ULBA 1Y3DE 1SY7A 1IZ7A 4E7OA 2WDZA 4RJIA 4N1AA 5CGZA 4DRYA 5IXJA 2RHHA 4AMGA 3IR5A 1QMPA 2DGDA 3CYFA 3DZKA 4OD0A 5CM2Z 4E46A 2JKYA 5DOZA 2C2YA 3QWAA 4L95C 4AKTA 1GGHA 4YEDA 3GFGA 1KPHA 3DHWC 2FZ5A 2IEZA 4OHZA 1JJVA 4YUYA 1FFYA 3L8EA 4YT4A 5TSDA 1N2CA 4PX9A 2CW5A 5K0NA 4D43A 1DC6A 1CQPA 1UMKA 4OQNA 1D6JA 1ZC3A 5H3LA 3ELDA 3A3KA 2WRZA 1HNZB 3C41J 4GW3A 1VGRA 2JLQA 4BAUA 3WYGA 2G0NA 3KO8A 3G79A 2ZYRA 3E35A 3K9WA 4NMMA 2A9OA 3NJRA 4NJMB 1IIRA 4BZWA 4J0QA 4KREA 2W6NA 3E61A 3M2TA 3W2FA 3VH2A 3DW3X 3PQ3A 3ZZ0A 3KSRA 2WM2A 2IVFA 4S1NA 4Q7QA 2IS4A 5A7GA 3STYA 3RLFA 2XE7A 3HL0A 2Q6TA 3TW0A 3MS2A 1EHIA 4CDRA 1GEGA 2QNRA 4WJKB 2E87A 3ON5A 4NZOA 3ZV7A 3QNWA 1WP4A 2BKAA 2Z2YA 5AJUA 2G1AA 2PKWA 5ALTA 1WPGA 3EVNA 4BO7A 2P5TB 1VPLA 4OCZA 1NBOA 2ECFA 2GOYA 2IZ5A 3N05A 4OYYA 3AW8A 3IDOA 2IPMA 3P2IA 4MVJP 1YVRA 1IPEA 1CX9B 4WESA 5LLSA 3SS7X 1WOMA 1KOLA 3H75A 3T0FA 1Y4DE 5AHWA 2XDYA 2CKDA 4GIBA 2UYCA 4QGFA 1Q0TA 2D6FA 1KVSA 1LWNA 1Z37A 2IE0A 2KBFA 2VK2A 3AIOA 1Y9DA 1L5YA 1YQDA 1Z28A 4N0QA 4EB8A 4X1OA 3ESBA 1IK6A 3PQFA 3PRKE 1T9KA 4GQIA 4MUFA 4C0JA 3MMPA 4YAWA 1FIUA 3F5SA 2FUNB 1M67A 3R5HA 2PLRA 2VPYA 4LHSA 1X7DA 4QDTA 4MUBA 1P0PA 4URWR 4PBRA 1ZZGA 4PGGA 3AYZB 3DO8A 3L6CA 3ZCUA 4E08A 5C1DA 1ATZA 2I3ZA 3DZGA 3QHAA 2F8LA 5M29A 1QP7A 4CGZA 1AC5A 1QU3A 2E85A 1F2UA 1Q92A 1XJCA 2YWFA 3NUGA 3GLIA 3ZGNA 1X7HA 1JEYA 1DAPA 2B69A 3QU7A 1N1DA 2CSXA 3EFEA 4X6YA 3PCXA 4B31A 4XQGA 4CHGA 4E5SA 4IH4A 3R24A 2BMEA 2J32A 5DTMA 2ST1A 3ABZA 3IAAA 4W1PA 4ZD6A 4CHTA 3H17A 2D62A 4I4TB 1CIJA 3VBEA 1HRDA 1NMYA 1U5CA 1GGMA 4EPYA 1A9XA 1GGNA 4RTJA 2I29A 1V1MA 3I3SR 2PEYA 3NO4A 5JVDF 3KEOA 4O2AF 1FRNA 3S28A 2CMGA 2JBAB 5CFQA 1VJRA 1QIKA 1Z13A 1LB1B 4UUMA 3ELUA 2J6HA 1NXWA 4Q9HA 4GMDA 1D4ZA 1GPH1 4MQUA 4PG6A 4KR3A 1GKIA 3W05A 3PFHA 1OTXA 2JBWA 2CLEB 5EE9A 5H70A 2QROA 2QKYA 3WGQA 1C7FA 2ZB3A 2CC2A 4XPIA 4Q7JB 1S3FA 4WXRA 5IBQA 1I0LA 1ZHFA 3BVPA 1W5SA 4G2TA 4P83A 5EZ6B 5CHYA 4TRNA 2BGNA 4LEIA 4U7PB 1BVHA 3I92A 4ZZ2A 4CMBA 4TV8B 2R7KA 2IXFA 2P27A 3UAXA 4ZU3A 4FFWA 1E4EA 1EMDA 4D6YA 3OETA 5TMDA 1C30A 2FZ4A 3V48A 1L2TA 3EZYA 7MDHA 2VF5X 4DJDC 3HUDA 3LJKA 3X2FA 4EI9A 3PV0A 4CL3A 2WPDA 5KMGB 2NO5A 2NT4A 3MQ4A 3OSZA 2J4CA 2XIQA 3K6KA 3EGDA 3R5TA 3E9MA 2Y1LA 3KOMA 5DEIA 5BY2A 4RHFA 3GJTA 4DV5B 3N2ZB 2XWQA 1Z2EA 2O23A 5IDXA 4WN9B 2PS0A 2OCKA 2L19A 2O1XA 3F74A 3F3SA 2OCPA 4PTZA 3UMMA 4RULA 2OHHA 3BRQA 1O7JA 1L8AA 4LOHA 1TO2E 1G20B 4QOHA 4ZYVA 2QW0X 2XXAB 1L1RA 3BHIA 3IVAA 4UHHA 1JA9A 1L3BA 2B4RO 5EQTA 3TQOA 1PBNA 5FWYA 2XOKA 4LKRA 3ZE7A 3PXUA 1PWZA 2Q9UA 2C8VA 5DHUA 3LUJA 3N76A 1YS2X 4PCVA 2P78A 1ADFA 1PDVA 2E2WA 5LKAA 4IFTA 4CQLB 1C7EA 3WFIA 1W8IA 3I52A 2XUHA 4BIMA 3FVQA 3ZIUA 3HI6A 3L46A 3SC4A 1ZVVA 3DTYA 4BTLA 3MUOA 5F7ZA 4IMIB 3ADKA 2FUEA 1OYOA 1OF1A 5INTA 4DGQA 3GP8A 5F1PA 5F5LA 4PIVA 2DU8A 1N6PA 2H7XA 4Y1RB 5KTKA 3JWEA 1JQLB 5G0TA 3BCSA 3NRBA 4MRRA 2VNSA 3PDWA 5FRDA 2PXCA 4G09A 4B3BA 5D8DA 3O8OB 4K9SA 4FGLA 2ILVA 2VUIB 1CF9A 5FBLB 3LQYA 2X13A 4LC9A 1DUIA 1D9ZA 1OHHD 4L4RA 1PZHA 4KR0A 4A0FA 5J2TA 5AVXA 1QYXA 2OZEA 2FPOA 4LV8B 3QMWA 3F98A 4DCJA 5CB8A 1U7HA 3C3XA 5FOWA 1FMJA 3R2JA 1SBTA 4BLQA 2IH2A 2BISA 1CJKC 3CBGA 1ZH8A 3SVZA 3P2KA 2FQXA 3B7GA 2Q1YA 4ZK6A 2J33A 1NQWA 3B9BA 1U8UA 4MPJA 4BO2A 1GZSA 4IHJF 5DX1A 1Y1SA 4I6JA 3RE1A 4YV0A 2NZYA 2XV1A 3FHCB 1OXMA 4PXAA 4RLQA 2NZWA 5EXEA 1Y3IA 4KR7A 3HY6A 1W9HA 3U5TA 3SQWA 2YWGA 3ASZA 4X95A 2JFNA 4TM8A 3QVLA 2XCUA 1EFVB 3I9FA 1E1YA 3OQ6A 4ODIA 5J1SB 1IG3A 2C9BA 4QYSA 4BNWA 1M66A 1QRUA 3WHIA 1IWBB 1OBVA 1URPA 4MH0R 4TKVB 5IFLA 4JI3B 2OFWA 2JI4A 3U0BA 2HZ7A 4Z7QB 1Q2UA 1A2BA 3H4MA 3OCWA 2A0XA 4GZMA 4YECA 4BNHA 4RZQA 4AKIA 1ZJYA 3ZU3A 2WV9A 4D4LA 5B30A 3L04A 3I62A 1VL6A 3WYDA 5DDIP 4Q12A 4ZU6X 5EHGA 4BZZA 5G0WA 4LK3A 1YMUA 1BXRA 2BGRA 4WMLA 4KRYA 4WINA 3VOAA 3NHAA 1C9EA 4YAIA 5BUZA 1YGYA 3HL4A 4QICA 4DDMA 2QRVA 1UDBA 1YC5A 4ZVKA 3JQAB 4RVSA 5A6SB 4ES6A 2WJAA 3DKIA 1XPRA 2ZKIA 5E6RA 4NQRA 5EQDA 2A9VA 3ZIDA 1Z9BA 2AR0A 4M1KA 3WL4A 521PA 2Q2OA 1NZFA 1UFOA 3PTLA 3CZPA 2WTUA 5GV8A 1CFJA 1Z4IA 1NLMA 3U3OA 1QZUA 2UXDB 2O4CA 5BXQC 2MYPA 2VP9A 4AG3A 3JZFA 1ZVQA 4EY7A 1W6UA 4YJHA 5EWJB 3HBNA 1Z8NA 5I48A 1PT9A 1H93A 1Y1QA 3UOGA 4YT8A 4GC5A 3N0RA 2JJQA 1XZIA 1GCUA 3HR7A 4EMBA 1TZ2A 3I1YA 5EKSA 3MWFA 3RASA 4GD3Q 3WIVA 4B2YA 5EKUA 1SBIA 5J4HA 3AR4A 3ZWAA 3KXIA 5TC4A 1JQ3A 3LC0A 1QO7A 2DHRA 3NM6B 3ZI0A 3GQBA 2F43A 2EBHX 1D4FA 3BGOS 4ZIRB 5FOVA 2K2QB 4QFCA 1MORA 3NBXX 4GOMD 2GXAA 5F9HA 3MCAA 1XG5A 2G8NA 4ZXPA 2P77A 3WNCA 3SZGA 4XQCA 1UBJS 3VV3A 2WZBA 3U9TA 4BMOB 4QG3A 4MRNA 5GVSA 1ZG3A 3OTWA 2JLSA 4RCVA 4RM3A 2Q41A 1F3OA 1Z8HA 4J7XA 3RARA 1EA7A 2XEDA 5D86A 5DX8A 1FUEA 5SZIA 1MHPA 2R6AA 2R68A 1XVUA 2AI1A 2NNWB 2VXYA 3LVRE 5A0VA 1SCUA 3IOBA 3MHTA 2A9FA 2H4WA 3CUSA 3DMFA 2JFZA 4PHCA 4QPZA 5F3DA 2EBUA 2YZ7A 5EUBA 1IMOA 5CCEA 5HKOA 1EXDA 1KXZA 1EBBA 3GX1A 1C8KA 5D3KA 1H2WA 2NTEA 2IY8A 4PLZA 4QD3A 4WCVA 4ZOLA 1XTKA 3ZHTA 3ENWA 9LDTA 1M0WA 2DOKA 4B6EA 3LUKA 2BONA 3HGQA 4UBLA 3FSGA 2YWRA 5ES4B 2GNPA 3FPHA 1U8ZA 4CF3A 3SHVA 3CLTD 1LNSA 3OPYI 4I1VA 3MGBA 3PQ2A 2PD3A 3AYXB 3UAZA 5K4HA 1JIKA 4M8LA 2JAUA 5FX2A 1TCVA 1W4BA 2R8ZA 2Q8QA 1CLUA 3UGKA 2QEQA 4FXPA 4AZ3B 2DH6A 1U4SA 3IUJA 3DKVA 3KJIA 1D5CA 4I50A 4B3CA 3L1VA 4CV2A 2XGMA 1HR0B 4JH0A 4PHGA 1SWWA 4N8EA 1C3OB 4AMUA 3F3YA 3QX3A 5LWHA 3AKEA 1WD5A 5FFNA 2P2GA 4FFBA 1JPUA 3AHHA 1SUWA 1O8BA 3RUCA 3UHPA 1CE8B 4V1CI 4PAQA 4AL4A 3ZYCA 3RH0A 1AQJA 4DMKA 3ZX4A 1RWKA 3FMFA 3UICA 2BFAA 1VM6A 5CNMA 1RXSA 2HMSA 2QM0A 2CNKA 3FCSB 4M55A 1SA0B 1XFAA 4TS4A 4RVDA 2JHFA 4FGJA 1Z56C 2IZZA 1N0IA 2EJWA 2WFMA 4RA9B 3B36A 2XUZA 4AZWA 1NBMD 2VWHA 2QVYX 3OMWA 4IL5A 3JQFC 3H11B 4RVOA 3VPSA 1YZTA 3MINB 1QGDA 4QHTA 4QXMA 4CMJA 5KJ6A 3UM9A 4NWIA 3A9CA 2HXGA 1B8NA 3Q2IA 5HIJA 3VU0A 4D41A 5JSZA 2GN8A 4HEA1 1VPVA 1GYRA 5GY7A 1A1SA 2Z04A 3EZ6A 1OBFO 2WU8A 2H0AA 4TTTS 4EMUA 2XE6A 2CLIB 2F3PA 1U2ZA 1DE0A 4M1ZA 3G5TA 2FFJA 2J9YB 1GG5A 3B6IA 2BHSA 4P36A 4PNHA 1XXLA 3BIXA 5JROA 3NEAA 4G84A 3OJEA 1UXHA 2R8RA 2VHWA 3OOWA 2BVNA 4C6RA 4P7GA 3BG5A 5EP4A 4F1JA 1K5HA 1B00A 2G67A 4WPGA 2HQSA 1DAEA 3NPAA 4UUQA 4D9IA 3P0HA 3VMFA 5A02A 3ZHYA 2JFYA 4WVFA 3FNQA 4DLTA 5IK2D 5JEEA 4IW3B 3B3FA 3B1JA 4NV3A 4RMJA 5F35A 1P0MA 5FYDA 3WK5A 2I3BA 2Y1FA 5DHQA 2OTCA 3E23A 3V2HA 4M37A 3U1VA 3ZHZA 4AJOA 1XD9A 4LF7B 1SXJC 2GCOB 4V1CB 1DJQA 4MUMA 2VRWA 2Y0CA 4HP8A 3QYFA 3RREA 5BNZA 1NUSA 1OAAA 2IXAA 2AMJA 4JVMA 3BZBA 5TQ0B 4CN9A 3WKAA 1YS9A 2Q1WA 3MAJA 2IRWA 2QYOA 3JD0A 4EPVA 1HDRA 5LKRA 2CCKA 2WEKA 2N75A 3D4LA 3NIDB 2E1PA 3DAYA 4NDNE 1EXWA 1C3LA 1ZD5A 3GNSA 3KQKA 3H5NA 2TMDA 4TTRA 2VH2A 1W85A 2C99A 2VWQA 2E55A 1WOYA 1GNSA 3NBYC 4QBGB 4D79A 5HW0A 3TNJA 1FK8A 3TUJC 3U3XA 1U11A 3U09A 1QBKC 4G5FA 4EG3A 3HJGA 2F8TA 2ONZA 2W37A 3ZG6A 1NUUA 1T2FA 3KELA 2Z1DA 1Z63A 2GD2A 1NV9A 2R87A 5FWYB 3ZHXA 2LIPA 6REQB 2HB6A 4MIYA 4DBLC 4DWVA 1DI0A 3OCXA 5ALDA 2ZI7A 4V38A 1DIGA 2OBNA 2QUHA 3V55A 5F9FA 2PKCA 3OIFA 2HSWA 3DUFB 5K03A 2A5GA 4FXOA 3I61A 4O29A 1RJDA 5IVHA 1EZ1A 2JAOA 1SOAA 3ANNA 3GZJA 3ENVA 2HA5A 3S27A 4DNOA 2Z56A 3WXBA 3FB1A 3BQMB 1PJ4A 1W75A 2P9FA 2P91A 3RFUA 1XEWY 3HVUA 4HV4A 3KTAB 1KEWA 3C4QA 3HWSA 3N2NA 2C4HA 1LC3A 5CNIA 1B15A 1NYQA 3T4EA 1N6HA 1I6LA 1HOXA 4Q9LA 2Q3BA 1OWLA 2ZT8A 3GQVA 3SC3A 1FVOA 1CERA 5CEJA 4DV2B 4X66B 1KQPA 1RU3A 2OHIA 4Y2HA 1UBNA 3ZWNA 1B74A 3LO8A 3HS3A 2BFEA 3DMPA 4OUKX 5MN4A 2CDAA 3Q3VA 2FPUA 1EP2B 3R0JA 4AKEA 1TXGA 4PF1A 4RVUA 4FZVA 4JB0A 2NYRA 4FHDA 1PEDA 1XL0A 2DFTA 4FFBB 4RK0A 1VE1A 1RRVA 1VG9B 3C2QA 2WG1A 1F38A 3H1GA 3L9WA 2QN2A 4J4BA 5I4IA 2CD7A 3NASA 3AVWA 1QK4A 4IGFA 4FC7A 1P4SA 3WLTA 3ZCQA 3L8ZA 1DJNA 4DV0B 4PLPA 2PH5A 4ZYTA 3OOJA 4F9GA 4MR9A 1UKAA 1DKPA 3NOOA 1LZLA 1Z3CA 3KOXA 1WHSA 5AO9A 4AECA 3VNRA 5BYJA 3ECCA 4DLBA 3C6KA 2BGGA 1QVWA 1P17A 4D8VA 4C7BA 4L9WA 3BJMA 3HB7A 3PD1A 4NBTA 3GFPA 3NH9A 4EW3A 1YVDA 3RYFA 2A30A 2OY0A 1YB4A 3G2LA 2KE5A 1FLNA 1A8SA 2O3TA 4Y1GA 3FPAA 1KTIA 5MGBA 3RVOA 3X1DA 1AH2A 1UM9B 4MP6A 2AYXA 4A2WA 2DFPA 4TL7A 2W6OA 4ZV7A 3UMYA 1M1YB 1NULA 1QF9A 2AVDA 2Z9CA 2R5NA 4FKBA 4KV9A 1UPTA 4B79A 2GEDA 3USES 4MUIA 3RSFA 3WWDA 3I2GA 1VL8A 4FMCB 4G1EB 4I9GA 4IGIA 1WX1A 3INGA 2P9HA 3VPHA 1V9LA 1U7WA 2JI9A 4F85A 1TF7A 1SXPA 1IXRC 1MQSA 2CHUA 5K3EA 3NWPA 3M34A 3SE7A 4J0EA 1VECA 1NVBA 4KWTA 1EIZA 4EJ0A 3CPJB 5BYBA 1ZH4A 1SCBA 1U0OC 3SGLA 2FWIA 1QO0A 3LUGA 2PL9A 2XJ9A 1W19A 3HM2A 1MVLA 2D5AA