1ENPA

Brassica napus enoyl acp reductase/nadh binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enpA00
4II3A 1JTVA 3LT1A 4EITA 4WOKA 5LC1A 3UAGA 4CMAA 1R37A 3TPCA 2I9PA 3PLNA 3FPCA 1GDHA 3PIDA 1LUAA 2Y0DA 1EK6A 1OMOA 1DRVA 1P74A 3I4CA 4R3NA 1P33A 2Q1UA 1E6EA 1C3VA 2PK3A 2OOSA 3MJCA 1ENOA 2WEKA 3VKUA 1DSSG 1YONA 3AY6A 3GPDG 4IDAA 5HS6A 3SX2A 2P68A 4YJHB 2CD9A 2D1YA 2AA3A 2PA3A 4E5KA 3DZBA 1R4MB 1D8AA 3WTCA 3WFJA 4DLBA 3GGGA 4GBJA 4DBZA 1E1NA 3GG2A 1LC3A 1ORRA 1SEVA 1NR1A 1EMDA 3GNQA 5A3JA 5I7VA 2BFPA 3L4BC 3OBBA 3RFVA 1LU9A 3IDSA 4D7AA 1FMCA 4E32A 2Y67A 2PH3A 1HZJA 3DMTC 3SVTA 1QR6A 1D1SA 1V3TA 5DN9A 1UH5A 1L7DA 1Q7BA 1UP4A 4BNZA 3LC1O 4A10A 2NLOA 3KLPX 3EW7A 1I3KA 2O23A 3FNGA 5A02A 2H1SA 1HF3A 3PTZA 1EQ2A 2PGDA 3ABIA 1DC6A 1TXGA 3HDQA 3X2EA 1N7HA 1B3RA 2WYVA 3W4KA 4BGVA 1P44A 3PWZA 3BYZA 1BXZA 1P3DA 4L8VA 3H5NA 1C1DA 3JD1A 1PL8A 2HCTA 3GH3A 3IIEA 4KWIA 1LRLA 1YWGO 3NT2A 5U4QA 3ZHYA 1MX3A 1W0CA 3BHIA 1X1EA 4NQZA 3BTOA 2JFFA 5H83A 1SEPA 1WXDA 1ZK1A 5JLAA 1A9YA 4K26A 3HDHA 3M2PA 4NBTA 3WGTA 4J49A 4F6LA 3OEWA 1E92A 3JQ7B 3VZQA 1EVYA 4XKJA 3AM3A 1K89A 4YQYA 1GYQA 1QMGA 4TQGA 4YT4A 1HYGA 2J3KA 3QQPA 2QW8A 5JYEA 4XJSA 4WK6A 4DMMA 6ADHA 1ZFNA 3GFBA 4II2A 4XCVA 3AU9A 1Q0LA 3W4IA 4PVDA 2JHGA 3JD3A 4XR9A 1TEHA 1ZH8A 4L4RA 4XJTA 3IUSA 5KKCA 1XCBA 5HBRA 2HUNA 3PGJA 3U4IA 2FMUA 4L4SA 1HL3A 4TVOA 1DRUA 4ZQEA 1E3WA 3JD0A 4LVUA 4JJGA 4CMEA 5BSGA 3UICA 3GZNA 1LI4A 3LSYA 5B1YA 4NJMA 3N58A 5COAA 3ZNQA 5TT1A 3G3EA 1TLTA 4XGKA 2PGJA 4Q3NA 4RLSA 3VH4A 3BMNA 3F6YA 4IXTA 3FHLA 3U9LA 4B8ZA 4GKVA 4IMPA 4AJOA 1LSSA 4HKTA 3I9NA 3UFXA 1KVUA 4XEHA 1LSOA 1E5LA 2WDZA 1XYGA 4NK5A 2BMAA 4JJFA 1SPXA 3JQGB 1GV0A 3V8BA 3DAFA 3HB5X 4OSPA 4Y6SA 5MGBA 3JQBC 4WCFA 5KJ6A 3KV3O 4XIJA 3KUXA 5FYDA 1DFIA 2WE8A 5ICSA 3W1VA 3VH1A 4DWVA 4YWJA 5DBIA 1NX6A 3FTPA 1F17A 1KEVA 4BV8A 1J0XO 4BKUA 4CM9D 3H9QA 2I99A 2HRBA 4R16A 1Y8RA 3GNSA 2ZQYA 1GAEO 1NQ5A 2X9VA 3VH3A 5JO0A 2Y05A 1JVSA 2NU7A 3D64A 2CVOA 5IN5A 1J49A 3ZWNA 3QHAA 3HJAA 2HK7A 1L1FA 1HLPA 1DJQA 4BNFA 4P8RA 1NTOA 4LW8A 1U28A 5A04A 1R4MA 3DMTA 1JDJA 3ZWBA 1ADFA 4ZA2A 1QXSA 4RQUA 1JKJA 5BT9A 3EC7A 3IS3A 4DIBA 1MUUA 3G1UA 2VZ9A 2QRLA 1UZMA 1DAPA 3JQCA 2NQ8A 1JQBA 5JXWA 4FFNA 4E2XA 1GTMA 4RORA 4GGPA 1MA0A 2P4QA 2IZ0A 3TZKA 4DQVA 1T4DA 1RM5A 1VE9A 3ADOA 4FFLA 4FB5A 1L7EA 1PS9A 2V6GA 4WJZA 4YDRA 3V1YA 1BXGB 3M6IA 2WSBA 2Q45A 3JYNA 4M86A 3NX4A 5CDYA 3LZ6A 1QV7A 4J43A 1CWUA 5JMPA 4MP8A 3LK7A 4KQXA 1Z74A 2XXJA 3EZLA 3WNQA 5T6BA 2Z95A 4NJOA 5TNXA 3W8EA 2OMEA 2FOIA 2PZMA 3D3EA 1IHYA 3PQFA 1X14A 4GWKA 1Y8QA 2E6UX 1Y1PA 2UAGA 5AYVA 3VVBA 2Q4BA 3UF0A 3VZSA 3WOHA 4IJKA 3OF2A 3GVXA 4MINA 1LX6A 4ID9A 3PYMA 3GEMA 5KJ1A 3JYPA 1HWYA 3IL2A 3KTDA 4TRNA 3WGIA 3NGXA 4CPDA 1YS4A 5BQFA 2RAFA 1JWBB 4CJXA 2E48A 1NXQA 4FGWA 4IDGA 1OAAA 1X15A 5JDCC 1LNQA 3TWOA 3QVXA 1PGJA 3ZDFA 1JVBA 2CF5A 2HMVA 5F21A 3T7EA 1V8BA 3WLEA 4L75A 4INAA 3I5MA 4W9NA 2C5AA 1E0DA 3MJ4A 3CTMA 4YAEA 2W4QA 4CR8A 2DC1A 4OIMA 1YB5A 2BFMA 2X1HA 4QUKA 2O50A 5HTOA 1X0VA 1CQJA 3NDRA 2GDZA 3VC7A 2VOJA 3BTSA 3AJRA 3GDOA 2W2KB 1Y8RB 4ITUA 1PGOA 2CVZA 1UJMA 1GV1A 1I8TA 1QLJA 4YJHA 4B4VA 4RPLA 5G4KB 3FSRA 4D42A 4M55A 5HS4A 3Q9NA 1U3VA 1BDBA 1AXEA 4JP3A 4J3FA 3WYBA 4YJDA 4PLTA 2YZ7A 1DFGA 2DBZA 2FR0A 3PQEA 3RC9A 4CL3A 4MVJM 3QJ5A 5L45A 3CPSA 4MVJA 4UUOA 2V6BA 5K0ZA 1CEQA 2PNFA 3WIDA 3OJOA 2FN7A 3V5NA 5LDHA 2DT5A 2OFPA 5B4TA 4RPKA 1MGOA 4P22A 1T1SA 5CFZA 4CQMD 3Q2KA 4R4JA 1IYZA 1GCUA 5EN4A 4XQEA 1T26A 4JXKA 3ASUA 3MWDB 4WLVA 4NDNE 3RJ9A 5DCWA 2NNLD 1ULSA 2O2YA 3PJDA 3VPGA 1OZAA 2VHWA 3DBLB 3N7UA 1B7GO 3ONEA 4JNKA 4A7PA 3GOHA 2P9EA 4I1IA 3H5RA 3NV9A 5FFFA 1ZBQA 1FF9A 4RVUA 1BXGA 3DZHA 3L6DA 4E30A 2GZ3A 2X5KO 3ENNA 2J5KA 4AJEA 1RKXA 1QKIA 2P4HX 2Q49A 4B3HA 2CDAA 3IP3A 5BSEA 4FIZA 3GRKA 2NTVA 3O9ZA 3F5QA 4UEKA 1AHHA 2GERA 4CV2A 2VWPA 1R15A 3Q0EA 1A72A 1ISGA 3GVPA 1EVIA 3IKTA 1Y8QB 1ZCJA 4Z6KA 3EYWA 4PLZA 3AI1A 3OICA 2FWMX 4JROA 3WGOA 2Q3EA 3ADPA 4DLAA 2D4AA 1P1HA 1H0KA 1C14A 1LRKA 3B1JA 4HY3A 1Y9AA 3GUYA 4XR4A 5DT9A 4AJIA 1YBVA 1F0YA 2GLXA 1E6WA 1FDWA 1UXHA 3T4XA 1U7HA 4QECA 4W4TA 3TN7A 2GNAA 4AJHA 2JD1A 5KTKA 1I3LA 3GRPA 1KY5A 3K96A 2HAEA 1DBVO 4LCEA 1K2WA 4R69A 4D0RA 4NHEA 3ROPA 2DVMA 3WICA 4PRKA 1QP8A 3WMXA 4QFCA 3OJEA 1BW9A 2ZB7A 3E9NA 4IDEA 5TLSA 4R1SA 2YV3A 4BGUA 4DLLA 3CE6A 1J5PA 2DFDA 3LLSA 4WNIA 1B26A 3DAGA 3MJVA 4BS9A 2EJVA 1SBYA 5K6AC 3D5QA 3P2YA 1NWCA 3VH2A 5CPBA 4MKZA 4A73A 1H9AA 5TQVA 4H15A 4IM7A 1PJ3A 2DAPA 1X13A 2YDXA 3DQPA 4LVCA 4RDIA 2B37A 2VWGA 3PJEA 4BKPA 5HM8A 4E0BA 3L0DA 4U8GA 1KVSA 4UUNA 3ZV3A 4WKGA 3SEFA 5MDHA 3CEAA 2C2XA 3BHMA 4WPGA 5A06A 4DIOA 4U0KA 3AW9A 1I3NA 4QO7A 2O3RA 1VJ1A 1ARZA 3O8QB 2GGSA 3VAZA 1ENYA 4JK3A 2PZJA 4YR9A 1QG6A 4Q3EA 5A5FA 4FOOA 2NADA 1E3SA 4TROA 1DLIA 1F06A 3FN4A 3P5SA 1IZ0A 3BMCB 3FNHA 3VPSA 1GUZA 1LLDA 2FPPA 2VRBA 3FD8A 4J4HA 3PHLA 3RU7A 4EYEA 3GUCA 4BO4A 4YACA 2ET6A 4E6PA 1EQUA 5U1PA 4D79A 1XELA 2J3IA 3Q3CA 4NK4A 1UDBA 4MPDA 3CXRA 1CRWG 2RBEA 3C1AA 4L76A 5ER9A 2RHCA 4TSKA 1PTJA 1A4IA 4HFRA 2BKAA 4XWYA 5ES3A 2NV6A 2P9CA 4ALJA 2V6FA 3GEDA 4UVEA 4KUEA 1AE1A 2VYVD 1KOLA 3WLFA 5B12A 1C0KA 1YL6A 2FSSA 4OXYA 3WQRA 4YRAA 2G17A 1GD1O 1X1TA 3ORFA 1HT0A 2ZB3A 3EGOA 1H6DA 5CDTA 2JD0A 1NBOA 3PIIA 1Q1NA 4PLWA 2VN8A 1GEEA 5IDWA 1H94A 1WDMA 1NPTO 4HNHA 1BVUA 1EEHA 5CHEA 3PHIA 4HFNA 3I83A 1YL5A 3MCVA 4UREA 2DTDA 1XG5A 2QRKA 1J4AA 5JCJA 1QYWA 4XB2A 3ZNOA 3IJPA 1VI2A 3ANLA 2O7SA 4FFPA 4BO3A 1DIAA 3P7MA 2W90A 3E03A 4CM9A 3A9WA 1KC1A 3WJ7A 3RC7A 1VM6A 3RCBA 1M6WA 4RGBA 2Y93A 1N7GA 3LLVA 4BO5A 5CEJA 5JFOA 3DBRB 4KUGA 4UUPA 5FI3A 4TZKA 3KSUA 1ZO8A 3WXBA 3OHSX 4GGOA 1X7DA 2HMWA 1P1KA 2X0IA 4CMBA 1WMBA 3KB6A 1GPJA 2X5JO 4EDFA 1D7OA 2X58A 1DJNA 4DXHA 3C1TA 4D3DA 4RL6A 4AG3A 4J4BA 5I9MA 2X5OA 3KOUA 1XIVA 2Q1WA 3OJ0A 3I3OA 1VL6A 1EUZA 1U9JA 3D4OA 1B8VA 1ZKMA 4RLHA 2NU6A 4WCFB 1XLTA 2X23A 1KIFA 2A92A 4OOFA 4F3YA 3QE3A 4EW6A 4I9NA 3WFIA 1AN9A 1QYVA 3S2IA 2VUUA 3GG9A 1QRRA 3EVTA 3N74A 5KNLA 4BMSA 3B1KA 4RF4A 3HG7A 1E3EA 4RVDA 3ZU3A 4CUKA 4BO2A 3DAPA 3G49A 3GA0A 4CR6A 2BRUA 3QVTA 1EUDA 3D7LA 1LLUA 5ICMA 2ZK7A 4IQ8A 3DHYA 1KY4A 1XGKA 5KVVA 4YCAA 5ITVA 4F6CA 2IRWA 3KYDA 5JAMA 2EKQA 3BA1A 3FCOA 1QYDA 4NFHA 1JU9A 1HRDA 3NJ8A 3S55A 1HDOA 3G17A 4D45A 4GVXA 4IS2A 4CLRB 2AE1A 2EKPA 3QSGA 3A28A 4D41A 2EGGA 1SB8A 3UHAA 3CIFA 3DOCA 4JQCA 3JQBA 1K6IA 1T2AA 3RI3A 5EL0A 4DPMA 3DO5A 3PHGA 4CMIB 3GQVA 4EUFA 1GEGA 5DOVA 5A9SA 4B4WA 3C7AA 1KETA 1NFQA 1WDLA 5ER6A 1GZ3A 8ADHA 2HO5A 1NHGA 1ZUD1 4KOAA 3NKLA 4NFSA 1ENZA 4CMHA 4DYVA 2UV8A 1PJCA 2ZQZA 2NVBA 4NG5A 1CIVA 1T2CA 2F1KA 1P1IA 2Q99A 2XOXA 3WNVA 3UW3A 3IKVA 4HWKA 1FDSA 4Q3CA 4BNGA 1I24A 4GSKA 1EVJA 1LDMA 3H3FA 4YT8A 3HADA 3ICCA 2B69A 4U6SA 1K0UA 3TOXA 1OFGA 1UXKA 2VYNA 4WLFA 2EG9A 3LC2O 2HU2A 2D5CA 4JBGA 1DC5A 1HE3A 2LDXA 3TZCA 2AW5A 2ZTUA 1GUYA 4U5QA 2PV7A 1E3WB 1R66A 1LSJA 3KEQA 3AOGA 1WZIA 5G0SA 1LC0A 3D3WB 1HYHA 2XF8A 4DC0A 2NACA 3E9QA 1IL0A 3DZFA 1E7WA 1VL8A 2CNBA 4WNCA 2Y68A 2BFAA 1ADBA 4NMHA 4XB1A 1E3IA 2Z1NA 2JCYA 4EGFA 3GN1A 4EEXA 2AQ8A 3AUTA 3JQDA 2OBYA 2BGLA 3KETA 3QWBA 3AY7A 2A35A 2QZ9A 3VZRA 4FW8A 4FJ1A 4BOYA 3UXYA 4E33A 3VVCA 1M76A 4R1NA 4CV3A 2PKQP 2VNSA 1SOVA 4ND5A 4R3WA 5HWSA 5AXBA 2Q1TA 4LK3A 2WTBA 4Y6PA 4M89A 3RUHA 5CDUA 4O5OA 3FF4A 3NUGA 4KQWA 3OECA 4CQMA 4M1QA 5TX7A 1V9LA 1TVEA 4BNWA 3LDHA 5A5EA 1LQUA 4CM1A 4PG5A 1BVRA 3BTVA 1D1TA 1OBFO 1SZJG 1TT5A 2OHXA 2G0TA 2FZWA 3WYEA 5JCJD 3Q1LA 3LT4A 5IAAA 1ML3A 2GN4A 2X9NA 1IHXA 1UUFA 2I5PO 1D4FA 5U9CA 4KTVE 4YQZA 1UR5A 2BI8A 2VT3A 2P5UA 1UP6A 1FK8A 1H6AA 2HKIA 1XR3A 3PJGA 5T8KC 1Z73A 1E1MA 2JJYA 3PJFA 3ZW8A 1BTOA 2GSDA 3U49A 4MDHA 3GT0A 3TZHA 1ZNQO 3HN7A 4Q3AA 3DTYA 4KUHA 4WUVA 2OGUA 3K31A 1CF2O 2OL4A 3E5MA 2GASA 3NTQA 3EDMA 3G0OA 3PLRA 5JBIA 1MC5A 1U1IA 4KZPA 2JCVA 3MJTA 1KBZA 4CLOA 1PZEA 2VHYA 5DOZA 3VTZA 1YE3A 3FR8A 3ITKA 2BI7A 2HDHA 3B70A 4CMIA 3DL2A 1ZK3A 2FZEA 3U4DA 4B7XA 2Z5LA 3JQFA 2JL1A 3GVIA 3MOIA 3WB9A 3RFXA 3DFUA 4J1NA 4RVGA 5IDQA 1RPNA 1P31A 2GD1O 3ZCXA 3R3JA 1MB4A 3MTGA 4AJ2A 1HYEA 3HN2A 3PXXA 5TSDA 5T57A 2VOEA 2EP5A 3WGYA 2UUOA 3DEYX 2VYVA 1LA2A 4J2HA 3RUAA 1UP7A 1R6DA 3ZNNA 3AOEA 1PWXA 3RUIA 1NAIA 1SCUA 3L4BA 5B4VA 4J91A 2YDYA 3E5RA 1DAOA 4YJGB 4LMRA 2IDZA 3FWZA 5GZ6A 9LDTA 4YAJA 3C24A 2PKQO 4CL8A 3PEFA 1NQTA 5B4UA 1PIWA 3U0BA 4UULA 3R6DA 4CMJA 4A5OA 2YJZA 3HSKA 4MVJI 2O2SA 2OZPA 1S7CA 1O5IA 1M6HA 3RBZA 2V7PA 4AJPA 5AXAA 1RWBA 4XZ3A 2R6JA 3I23A 3I9KA 4Y6RA 3K73O 4NU6A 5KJEA 1X7HA 2B5VA 3ANNA 1LBEA 4CMKA 1GYPA 4PZEA 5H81A 3S8MA 2J8ZA 3VHRA 4F46A 3GC6A 3TOZA 1RJWA 3H65A 5BNIA 1U5AA 4EZBA 3X2FA 3ITDA 2BF7A 2HLPA 3NTOA 5JPIA 4BKQA 2O48X 5JS6A 4OXKA 3WTBA 1FDVA 5JW6A 3R3SA 1C1XA 4FPXA 4BGIA 4IJVA 4E2YA 1PZGA 1W4ZA 3HE3A 1HXHA 4C4OA 1ZEJA 1E6UA 3AFNA 1MG0A 3GAZA 3AK4A 4CM3A 3FWNA 3JD2A 1NVGA 4YB8A 4EUEA 3WBBA 2FSVA 4HFJA 2ZJ0A 4CLXA 4FDAA 4Q3DA 2EF1A 1YGYA 1EK5A 2UUPA 3CZMA 5TJHA 2ZYAA 1R0KA 4GSLA 3CMCO 3EAGA 4ALMA 1B14A 2YHIA 5L7YA 3SLKA 1X0XA 2Y1OA 3ETGA 2D2IA 2VYND 3LVFO 1YJQA 4ESOA 3ZWOA 4FFRA 4R01A 4BNKA 1P45A 2UVDA 4JX8A 3GDGA 2PY6A 4Z3KA 4GQAA 4E12A 5GZ1A 1B3BA 2GPTA 2VHXA 2XAAA 3G79A 4WCDA 2D3TA 1JLLA 3KXDA 5JCXA 2ZYDA 1ZEMA 1PGNA 2BGKA 5DDIP 1Z82A 4CUZA 3M1AA 2C07A 1U8XX 1ZZEA 5DULA 3FNFA 4IGEA 3WX0A 3ENKA 2HK8A 3BTUA 5C7OO 1PJ4A 4XQGA 5JE8A 4Z0PA 5A03A 2TMGA 1NM5A 3INRA 4OH1A 3DBHB 3K30A 2WWRA 4CUJA 1I3MA 3E82A 1HTBA 1UXJA 1Z75A 4EJ6A 5BR7A 3ZWWA 3WQQA 1ISFA 1HSZA 2W2LA 1WW8A 1I32A 4RZHA 4DYDA 5BSHA 1K6XA 1GCOA 3P19A 1EE9A 3ZN2A 1HZZA 4OAQA 1ZK0A 4K9DA 4J90A 5THQA 4IQGA 3VKVA 1HDXA 1I30A 2YFQA 3HHPA 4PIVA 4IS3A 4XQCA 1R16A 4Z9XA 3L9WA 4M54A 3ZW9A 3I1JA 3AFMA 4WLOA 2PFGA 1V3UA 2HJSA 4ILKA 1R0LA 2VNAA 3DOOA 4W9NC 4LISA 4CQLB 5JSFA 2RH4A 3JQAB 1DEHA 1PJQA 4J0FA 2VQ3A 3IUPA 2Q1SA 1NP3A 3PP8A 7ADHA 2PWZA 4OO3A 5AOVA 3CZRA 2F00A 5ENVA 2J3JA 1E1LA 2IZZA 2FR8A 1SNYA 1KEPA 3KO8A 2Y1GA 3DXFA 3KHUA 1JAXA 1LQTA 4F45A 1ADGA 5EESA 3NDIA 3H8VA 2ZKLA 1DRWA 1DHTA 3V2GA 2Q2QA 3CSDA 1ID1A 3Q6IA 4XYMA 4W7IA 2H63A 4WOJA 2RHRA 2B83A 4PG8A 4U6QA 4IJUA 3RKUA 4M8SA 5G0UA 1A7KA 2GN8A 1H6BA 1QORA 2OORA 4OYRA 3GZNB 3S1LA 2GYYA 3ZV6A 2C54A 4DQUA 2O4CA 1M67A 3NRCA 1BXKA 1EFKA 3ETEA 1EFLA 3I6IA 4W82A 1P9LA 2VWQA 1O6ZA 4NBUA 4GX1A 1AHIA 1YBAA 2VUTA 1WWKA 2CDBA 1C0LA 3D1LA 3D5TA 2NVUB 5AXCA 4WGGA 5L53A 4OQYA 1JKIA 4FOSA 3INGA 2E49A 1V35A 2DFVA 5DP1A 5JC8A 3RUEA 5DP2A 3KSDO 1SMKA 3EK2A 2P9GA 1WDKA 1SO8A 4BQRA 3NT4A 4CMCA 3BAZA 2BD0A 4MVJP 4CMEC 2H6EA 4CQMB 3LQFA 4BB5A 3JYOA 3MOGA 2YW9A 5IF3A 1PJBA 5F5LA 5CDGA 4MVJD 3K6JA 4BB6A 2IEBA 4RPGA 8LDHA 2HSDA 1GQYA 3K2EA 4Z9FA 3ICPA 4LRTB 4XGNA 5FWNA 1JKFA 5I7EA 2AEFA 3AI3A 4BL5A 2ZCUA 3L77A 2H5LA 1FDTA 4HX5A 3NDJA 4ND3A 3PQDA 5JY6A 3I6QA 1E3JA 1E7QA 3DC2A 4RPJA 4CLDA 4ZJUA 1T24A 2IXBA 3ZZNA 2B4RO 3VPFA 4A0SA 4JP2A 3EHEA 1EE2A 2G5CA 5T5QA 5IDYA 1FJHA 4R5MA 5I8ZA 2HMUA 1F8GA 1EUCA 1WP4A 3AUUA 3KRTA 3GVHA 3EMKA 3TNLA 3H6KA 4A26A 4E3ZA 7MDHA 5IFLA 1VJTA 2PR2A 1B0AA 4XD2A 3FRJA 5IXSA 1Q0HA 3SC4A 3GLQA 1BW9B 1O0SA 4PLVA 2C7GA 5HA5A 4QQRA 4IBOA 4N5NA 3I9LA 1PZFA 2JCXA 4IUYA 3ULKA 1QSGA 4R54A 4DUPA 4N5MA 1RM4A 2Y0EA 2FY8A 2HQ1A 3ROMA 3H9UA 1H9BA 4AVYA 5AVOA 2WYWA 4AFNA 3HZZA 3LC7O 4B3JA 3KYCB 3H5AA 3ZI0A 3CMMA 2X8LA 4GKBA 4ZVVA 4XDZA 3V2HA 3ZHBA 4D3SA 2R2GA 2J5QA 3ZV5A 2D5AA 4PN3A 1HSOA 1H93A 2DLDA 1PQUA 1GUFA 4R51A 3GPIA 1ZSNA 1RM0A 2BH9A 3DBRA 1DIHA 3QWHA 4TZTA 4YBZA 3V2UA 3L07A 4MVJE 4GX5A 5TIIA 3B20A 1ZVMA 1IE3A 2C7VA 3OMLA 5LCXA 3GGPA 1M2WA 2O3UA 4MKXA 5DNAA 3I52A 2AHRA 3Q11A 3JQEA 4FCCA 4N5LA 3T4EA 2O3JA 4O63O 4BMVA 3H2ZA 3KYDB 1NPYA 5DCUA 3DR3A 2Y99A 3WWZA 1KVRA 3PI7A 4B4OA 4S1VA 4M49A 2P2SA 1Y81A 2I67A 4I5DA 3UOGA 3OJLA 1ZMTA 4J1SA 1OC4A 4MJLA 2EWMA 5EJ2A 2PD6A 3DZJA 3RASA 4Y98A 4ZQHA 4PZCA 1T4BA 2FR1A 4P4LA 1HEUA 4QSMA 2G82A 3TZQA 2D8AA 4J4TA 3CH6A 2I76A 1PR9A 1K5HA 4M87A 5G0TA 3FPLA 1C1XB 1CJCA 1NPDA 5G4LA 3K5PA 2BFOA 1ENPA 4CQLA 2IE0A 2WD8A 4P4GA 4K6CA 2C2YA 4Z9YA 1LDNA 1U3WA 1Z7BA 5G4KA 4CMGA 1ZIDA 4KDFA 3U4CA 4YJFB 2B35A 2WM3A 1ONNA 5ITWA 4CV1A 2C0CA 3QVOA 4FR5A 3RBVA 3WBFA 2JAPA 4YVFA 1WVGA 1BRMA 1LTHR 2IXAA 2CSUA 1M75A 1UDCA 1DOHA 3DOJA 2RCYA 4UUMA 5IXYA 5HRUA 3GN2A 5H82A 1QV6A 2B36A 3LT0A 2X7HA 3GZ4A 4R1UA 2EJWA 2O3SA 3INTA 2ZB8A 3NGLA 4I9UA 1T1RA 3PWKA 5JC1A 2VZ8A 2YQ5A 2DQ4A 4J1QA 4YEDA 1YVEI 1G6KA 4I8XA 4OSOA 3RIHA 3HB4X 2VCYA 3SJUA 1P1RA 2AE2A 3WSWA 3UN1A 4MVJG 2GZ1A 3SLGA 4KP7A 5A9RA 3IMFA 1G0OA 4GLOA 2EP7A 5BSFA 1HDYA 2YHIB 3AWDA 5ILGA 5KVSA 1A5ZA 1GU7A 1KVTA 3DB2A 4ALLA 4IPTA 1YKFA 3D4PA 1H2HA 4GH5A 1KS9A 1PWZA 1A7AA 1XSEA 3E8XA 1MXFA 4B4UA 1PQPA 1O9BA 2VUSA 2ZYGA 1I5RA 1SAYA 2D0IA 3CINA 4FN4A 4TRRA 1YQGA 3WG9A 1PJLA 1XHLA 4GLLA 3DBHA 1EVZA 5KWEA 4KWHA 4NNJA 1SC6A 4C7JA 4UEJA 4QO8A 5FEUA 2FPGA 1E7YA 2FRDA 5EINA 3EY4A 3H9JA 4KMSA 4BNNA 4YXFA 2BGMA 4IINA 2DBQA 3L6OO 2PLAA 4TWRA 3U5TA 2DU8A 3PZBA 1IUKA 1NFFA 4CM8B 1QYXA 1RM3A 2VZ0A 3M1LA 4Y9DA 5DCYA 4RVSA 4TRMA 1EBFA 3E48A 1ULUA 3B6ZA 3F47A 4L9RA 1ZJYA 1T2DA 3JQAD 4MP3A 3AM4A 1XEAA 2PZKA 2PD3A 3C7DB 1RYDA 3W4JA 1W8DA 3JQ6A 4DREA 6LDHA 4NBWA 3EZYA 4U0JA 2CUKA 1B16A 3ONDA 4EEZA 1P0FA 5K9ZA 4B79A 1HLDA 1I10A 2EW8A 3HDJA 3HFGA 2VT2A 1BWSA 5ILOA 4E5NA 3K2BA 1DB3A 3ZNPA 5CG2A 4J7CA 2R00C 3KLMX 4CODB 5KIAA 5T64A 1GADO 3IP1A 4BNVA 3QY9A 4AJKA 5GZ3A 1MP0A 3D0OA 2YYYA 3MTJA 1Y5MA 3K92A 5CDSA 1GZ4A 2O4UX 2WE7A 3IOYA 3PWSA 5I7FA 1KERA 3GDFA 5JY1A 4XX0A 5KJFA 2POQX 5FF9A 4BNHA 1U4SA 2NU9A 5BNFA 2H9IA 1PGQA 4HFMA 3ZU5A 4B7UA 5KVCA 3PGXA 2YFHA 3HWRA 1IY8A 3AUSA 3W8FA 4IDFA 1ZK2A 4PLFA 2YUTA 3WYCA 1N9GB 4JBHA 4IJWA 3IC5A 4A03A 1PGPA 4FFOA 1PJ2A 4DMLA 2X22A 1PS8A 2VTEA 3QVSA 3BXXA 4PZDA 4PLPA 1U2DA 4NJMB 5A05A 1U4OA 4I5FA 3FBTA 2AQKA 3JCZA 2QRJA 1H6CA 3L9XA 1NVTA 3F4BA 5I9LA 2BHLA 5J23A 4PLYA 2PTGA 1PU2A 2JFGA 3FBGA 3IAHA 4RDHA 5TF4A 2NU8A 4BKRA 1VRWA 4UVHA 1S6YA 1Y9EA 4EI2A 1M66A 3S2EA 1O94A 1WNTA 3D4NA 4E2WA 2BELA 1LDGA 1Z7EA 3KVOA 3JQAA 1GL3A 1P1JA 2BLLA 3WGGA 5A1TA 3O26A 5G0WA 4ONEA 4OHUA 5JAZA 4TVBA 1HKUA 4XDYA 3QWFA 1LJ8A 3STHA 3RVDA 2EERA 1C0PA 3DDNA 3BMOB 5EMHA 4GMGA 2IYPA 1ZSYA 2W2LD 3HQ4O 3GMDA 2I3GA 1NASA 1WMAA 2X6TA 2QQ5A 2PKRA 2AQHA 1V3VA 3A06A 1GYRA 3TL2A 3WS7A 1V6AA 3OSUA 2VHVA 2DTXA 4GX0A 1UAYA 1DIGA 3S2GA 4BUCA 1N1GA 5GMOA 4EJ0A 1MFZA 5COBA 3GHHA 4ALKA 3DFZA 2QIOA 5DF1A 2IYOA 4BNJA 3UGKA 4Q9NA 3ROKA 5L4NA 1HE2A 4UVGA 1HDCA 1E7SA 4NR0A 2GRAA 3DZGA 3MJSA 3FI9A 4AJJA 1CDOA 2E82A 4W6ZA 4BNMA 2CFCA 1UAGA 4BNUA 4FC6A 1C1DB 1O89A 4EBFA 5C5IA 3JV7A 2GN6A 3ROQA 3SBOA 5THKA 1TB4A 2DM6A 1UXIA 4I5EA 4WECA 1Z6ZA 1AGNA 3K9QO 4OMUA 3R0IA 3WGZA 4RV9A 5IN4A 4J7XA 1NYTA 4JIGA 5KKAA 5TS3A 3DWFA 4IIUA 3O4RA 2DTEA 1O95A 3JQ9A 5JDIC 3L4SO 2ZTVA 3TQHA 3WGHA 1N8KA 4DIFA 1Y5RA 2QHXA 5IZCC 2YV1A 3DONA 5TC4A 3SJ7A 1Y7TA 2AQIA 2EHDA 4O0LA 4XYGA 4ZRMA 1UXGA 5KVQA 1GZ6A 5I9NA 3TFOA 1CQIA 2DPGA 2I66A 2O3QA 4RVFA 4D44A 1IZ9A 1GQQA 4TRJA 4O59O 1BG6A 4YA6A 3AOEC 4J9UE 5DZSA 2NQTA 2OBNA 2CF6A 2PGLA 1VKNA 2W8ZA 1BDMA 1YRLA 3D3WA 3TJRA 2X0RA 2ZJ1A 5ENDA 3TZ6A 3OQ6A 1TI7A 1VSUA 5A9TA 1HE5A 2J5RA 3C1OA 4TKMA 3DTTA 2IZ1A 3H7AA 3FTNA 1A27A 1T25A 4JCOA 4MVJF 4PG6A 4L0QA 1DO8A 3BMCA 1VSVA 3I9MA 4G2NA 4R9RA 1PQWA 2QYTA 3V1TC 4A2CA 3QVWA 3E18A 2JKVA 4AICA 3GGOA 3PYXA 4IZHA 1ZK4A 4IGFA 4NBVA 2JHFA 3KEOA 1MV8A 4WCFC 5EPOA 4D3FA 1N5DA 3H9EO 3NJ4A 4DQXA 4ZQBA 5BNTA 3UVEA 2HMTA 3JQGA 4HXYA 3RD5A 3JQ9C 5JDIA 1BMDA 1VPDA 2V65A 2B5WA 1WLYA 3ST7A 5JNLA 3PFWO 4HP8A 3OQBA 3I9OA 3PK0A 1HDZA 1Q7GA 1UZNA 4K28A 4WEQA 4D0SA 5L40A 1PEDA 4HUJA 2YV2A 4YT5A 3RFTA 1N2SA 4DPKA 1Q2XA 2GZ2A 1IOLA 5TGDA 1B8PA 3CKYA 4RJTA 2J6IA 4L4XA 4JLWA 2AG5A 3LYLA 2CZCA 5ADHA 1P0CA 1SB9A 1LXCA 4H16A 4BNTA 4LSMA 1I01A 5F1OA 4R1TA 1X7GA 4S3MA 5L4SA 3BMOA 3A4VA 4Y67A 4ALNA 1NVMB 4RF3A 2GCGA 1ADCA 1NWHA 3KZVA 5L95A 4H7PA 3GR6A 3QWAA 1EDZA 1T2FA 1LLQA 1NAHA 3FNEA 2A9FA 1NHWA 4YT2A 4YJGA 3PVZA 1DFHA 3MJEA 1TT5B 3IQDB 1U2GA 5CAEA 4CM5A 1Z45A 2IODA 4MO2A 3RROA 1JN0A 2I6TA 2I3AA 1OI7A 2W2KA 1LRJA 3DHEA 3B1FA 3E9MA 1E1KA 4PRLA 2ZCVA 2HK9A 4W7HA 3PZRA 3ANMA 3G1TA 4WEOA 1H5QA 1YDWA 4YYZA 2G76A 5L9AA 1YOVA 3ZV4A 2XXBA 2HMSA 3ZHZA 3QLJA 3I4FA 5IJZA 1GQ2A 3OIDA 2ZTLA 1JWAB 4PG7A 1ISIA 1E3LA 3HFSA 4E5PA 1PL7A 4YJFA 3WMWA 5B37A 2ILTA 3QW2A 2Y1FA 1ZW1A 2RIRA 1LEHA 1GFSA 2J3HA 4FBGA 1FXSA 4NFYA 4E13A 3GFGA 2B0JA 3AY3A 5A4DA 1OC2A 2GR9A 2PH5A 4Q3BA 4CLOB 1PZHA 2SCUA 3BZUA 4RCVA 2CMDA 5C37A 2V6MA 5IZCA 4E5MA 2EIHA 4AJLA 4DPLA 3H3JA 1QYCA 2OO5A 3IJRA 3U62A 5K6AA 4RZIA 3F46A 4BVAA 4W99A 3TSCA 2VRCD 2QZZA 1KVQA 1DIRA 3A14A 5TRTA 3RWBA 4ZICA 1R12A 3ZHXA 4XYBA 4NZ9A 1HDRA 4U7WA 4ND2A 1P77A 4YAKA 5C7IO 2EKLA 1LDBA 1YL7A 3GK3A 2O3TA 4N18A 2AG8A 4ZRNA 1Q0QA 3LF2A 1B2LA 3AUAA 4JJIA 5T67A 1DPGA 4JGBA 4DVJA 3WGQA 4GWGA 4NI5A 1OOEA 1U5CA 4OOEA 5IDXA 1EZ4A 2VWHA 4IXWA 1ZSVA 3E6AA 3EVNA 4BNYA 3UH1A 4JN6B 4WASA 3DBLA 3BMQB 3COSA 4ZGWA 3OJFA 4URFA 1W73A 3Q2IA 3L6EA 2NM0A 3RU9A 1G1AA 3C3XA 4J16A 4R41A 4R68A 3OQ1A 1DHRA 3E1KA 5L7WA 4HADA 3C8MA 4XIYA 4YPOA 2G1UA 4OQZA 1JA9A 3H4VA 3OA0A 4QTZA 1MXHA 2WJPA 5GY7A 2DUUA 3VDRA 4NIMA 1WPQA 3TDKA 3RUCA 5L3ZA 4Q39A 3ZWMA 3NYWA 4YRDA 4J7UA 2D59A 2LDBA 4FS3A 1T2EA 1LDYA 4E4YA 2ZIZA 4Z0HO 4MIYA 3M2TA 4CM8A 1BGVA 2GO1A 2AXQA 4QEDA 4CLRA 4OKIA 1DDOA 3ZWAA 4CM6A 1TT7A 5F5NA 1ISJA 5EQDA 1HE4A 3RC1A 3KBOA 2EV9A 4MOWA 2W98A 5F1PA 4QX6A 3AI2A 3OA2A 2NWQA 4DGSA 4G81A 3VPXA 3JQFC 4CV0A 2JD2A 4FQ8A 2WMDA 4OKNA 3F3SA 4GI2A 1P1FA 4G65A 2VTDA 1ZMOA 3PDJA 4H3VA 4MVJH 2C5EA 1N1EA 2X0JA 1WAMA 2XPCA 3ZGYA 2NTJA 4FFMA 4PLGA 2QG4A 3KYCA 1PJSA 5KJCA 3DZKA 1PL6A 5I7SA 4DA9A 3T7CA 3GEGA 3VZPA 5CP8A 4DL9A 3TFQA 1N92A 1YDEA 1PX0A 5EQFA 3ZWVA 2Y1CA 4CM4A 1YB4A 4B8WA 5C3MA 3DHNA 2EEZA 3WR5A 4BNLA 1YB1A 2QYSA 2YY7A 4LSWA 2CVQA 4O1MA 5IZ4A 1W6UA 2GF2A 4XQ9A 4ND4A 3ZWCA 4QXMA 4WLNA 3UCXA 1YO6A 5AXDA 1AXGA 3MZ0A 4WLEA 1VC2A 2P91A 3BHJA 1PSDA 3O8QA 4AJNA 9LDBA 1LSUA 4O6VA 1KYQA 4IIVA 4AJ4A 3UUWA 4RQTA 4BO1A 2O7QA 4BMNA 5CG1A 4IDCA 2JFHA 4RF5A 3ZU4A 4ZHSA 2I65A 2A94A 4UVIA 2Y0CA 2NVWA 3BMQA 1QLHA 4NPCA 2R00A 3NT5A 3OIFA 3OFSA 3RUFA 2CDCA 3HNPA 1A9ZA 4XRGA 4PG4A 1A71A 1MLDA 4CLEA 3V1UA 3QA9A 4RVHA 1YOVB 1YH3A 1UDAA 2X86A 5TJ9A 3GY0A 1NR7A 1XDWA 3C7CB 3H9GA 3NAQA 4I9HA 2B4QA 2Q46A 4PGFA 4Z0TA 4E2ZA 1I0ZA 3JQ8B 4UVDA 4BO8A 3WIEA 3JQ7A 3I9JA 1HETA 1I33A 1VJ0A 2ZB4A 4YTEA 4ZU3A 3ZWXA 4KTTE 5COQA 1F8FA 4P4NA 4R9SA 3MEQA 5I8WA 2EGHA 4RO0A 2YQ4A 5JAIA 1F14A 4KDEA 5EERA 1XU7A 4TMFA 4PFJA 5G0VA 1J6UA 5C7LO 1E7RA 3UCFA 4CLHA 4DC1A 4BKOA 3GHYA 3WQSB 1FDUA 4LRSB 3WJAA 1DIBA 2EXXA 5G2OA 5L51A 3WSVA 3VPHA 3PPIA 4XYEA 4OJNA 3WDSA 2UDPA 2E37A 1R0SA 2C20A 2WYUA 1CETA 1I36A 4ZN6A 2X0NA 3R1IA 1AUPA 1K3TA 2WD7A 1DXYA 2Y1EA 3BIOA 4C7KA 2HJRA 3OM9A 4IQ0A 4AL4A 4J0EA 1C0IA 1O8CA 2Z1MA 3SXPA 1DC3A 3QIVA 4RF2A 3W8DA 2NSDA 3GNTA 1LLCA 5F3RA 4ZQFA 2ZTMA 4ZQGA 3VDQA 1NQOA 4UEOA 1I2CA 4BO0A 4K6FA 2C29D 3RC2A 2CY0A 3O03A 4GVLA 4FJ2A 2NVUA 4CM4B 3O38A 3UKOA 1XA0A 4RPHA 3AM5A 4IY1A 1GPDG 1ONPA 3NEPX 1ZJZA 4GPD1 4IMRA 3RAJA 4I5GA 2ZATA 3KYBA 3P2OA 1JAYA 3JTMA 3ZH2A 3TRIA 1DLJA 5KOIA 1R4NB 3FR7A 3KM0A 4J9VA 1LDEA 4IZIA 1YBMA 1KEUA 4QFDA 4YRBA 4JBIA 4D46A 4MIEA 4BNXA 4R5HA 4FSHA 3JYLA 2DPHA 4FJ0A 2TMDA 3WWYA 1I2ZA 3GVCA 3ASVA 1Y6JA 4XRRA 5EIOA 2C59A 4L74A 2DBRA 4TKLA 4A27A 4G5HA 4HV4A 1D3AA 3A1NA 1TA4A 3PFFA 1CERA 2E4AA 1ZXBA 3RKRA 2Q4EA 2OXIA 2C82A 1ONOA 4LCJA 4LGVA 4DTIA 1IPFA 2IEDA 3GMSA 1H2BA 4YAIA 2DBVO 3PRJA 3JYQA 5DBGA 5IG2A 4Y8VA 4NH4A 4BIIA 4YAGA 1B15A 3TL3A 2FHSA 1U7TA 5JO9A 2Y1DA 3CUKA 1XQ6A 4J1TA 4MIOA 4N54A 4E21A 3W6ZA 4XA8A 1MG5A 1NNUA 2Y66A 4K1LA 1WZEA 4P38A 4DRYA 4E5YA 1ISMA 3F9IA 3JD4A 4AJ1A 4I08A 1U8FO 3DZIA 4GL4A 4IDBA 5CEEA 4BO9A 4OL9A 5T8KA 2GN9A 4OM8A 1XQ1A 1NFRA 2VRCA 4GX2A 4BGEA 2YHUA 1BHSA 3OEYA 5F1KA 2PD4A 4CM7A 2X4GA 5FI5A 1YQDA 1IB6A 1BSVA 3ETDA 2VHZA 4WE3A 3U4HA 3S2FA 3F1LA 1ZXLA 1U3TA 3MWEB 1HDGO 1YJ8A 3C85A 3OIGA 3ON5A 4J2OA 2NUAA 2OP0A 2Q2VA 1K6JA 4UAGA 1XKQA 4ROSA 4GMFA 5LDGA 2P5YA 1A4UA 1IULA 3BMNB 3LF1A 1GY8A 3QRWA 4HNGA 3W6UA 5AQ1A 4NU5A 4PVCA 2AEJA 1KC3A 3JSAA 1F12A 5TT0A 5A3VA 5JDCA 3OP4A 3DBVO 1KEWA 3Q9UA 3LU1A 3DMYA 3GAFA 4OGWA 4OXNA 4B3IA 3ZWPA 1MC4A 3QWIA 1UZLA 3JQ8A 4PLHA 1SOWA 2Q2WA 1ISHA 3ONFA 3K8ZA 4BNIA 2UYYA 3VTFA 4ND1A 1G0NA 1DC4A 3TF5A 1IPEA 4LMPA 4IDDA 5JYDA 4NBRA 4FC7A 3F4LA 1YQXA 4ALIA 4J6FA 2FPIA 4BQPA 1EBUA 2X9GA 5KCZA 4XYLA 1XWFA 2EW2A 1NQAO 1MFPA 3F5SA 3U3XA 3H2SA 4BO7A 4N7RA 1PS0A 4Z3DA 5CPFA 3AU8A 3EUWA 2B4TO 3PHJA 4CR7A 2JAHA 1PR3A 4BO6A 3OETA 1PJTA 2PZLA 2OP1A 2FP4A 1VLLA 4BV9A 4E31A 4PCVA 1YXMA 4FGSA 4MKRA 1E77A 4B7CA 3KSZO 5A9SB 3SC6A 3HUDA 2RH8A 1XU9A 4D43A 5DBFA 2HRZA 1JW9B 1Q7CA 4DBVO 3F1KA 2AEMA 1EDOA 3ZWYA 2GUGA 3U09A 4GAEA 5L4LA 1RYEA 1I2BA 3VOSA 3LT2A 5L7TA 3QV1A 2NTNA 2OUIA 4MP6A 5CEFA 3PDUA 3HDYA 2Q50A 4EJMA 1R4NA 1E7MA 1U3UA 1VKOA 2AMFA 3PYLA 3NTRA 5JAQA 3RBXA 4EUHA 4WLUA 3ZU2A 3QP9A 1VL0A 1GR0A 3RJ5A 4BHTA 3PHHA 2A4KA 4HBGA 2DUWA 4PLCA 1N9GA 4ZD6A 4L73A 2DKNA 1CYDA 3GF4A 4LN1A 4QT0A 3OH8A 4XGIA 1E5QA 2WD7B 1V0JA 3UCEA 2QX7A 1B8UA 3RQSA 4X54A 5JMWA 4FD3A 3RSHA 3RUDA
chains in the Genus database with same CATH superfamily
4WNAA 4II3A 4QTTB 1T6NA 3LT1A 2AZ4A 5KDLA 1OYWA 8AT1A 3FRHA 5CA1A 3KSMA 3TPCA 1FXUA 2QTWB 3FPCA 1GDHA 2HGZA 3REQB 1C9DB 1EK6A 4GGMX 3T7SA 3FUXA 3BMXA 4HTFB 4YLEA 3OIYA 3SDSA 4WJKB 3VJRA 3SF0A 5A5DA 1OMOA 2C4TA 2YIDA 1P74A 1J0BA 3H5TA 1Y7PA 4I9GA 5KYXA 2WWWA 1KPIA 4WX2B 4YP6A 4Q6BA 1E6EA 1GTSA 1AK1A 3DBOB 3MJCA 2BLNA 3VKUA 5HS6A 4IDAA 3SR4A 3SX2A 1Z88A 5EJEA 2ZYVX 4AMZA 4OSEA 3U1TA 1OH5A 1QP0A 2AA3A 1N4AA 2R66A 1IQPA 2VDOB 1R4MB 3DW1X 1NJ6A 5JD5A 1ORVA 4HDRB 5EJ6A 1XNJA 2VNIA 1E2KA 1AZLA 3PTLA 1BGWA 1E1NA 5IUNC 3DTVB 1F38A 1ORRA 4M3NA 1EMDA 2YC4C 1BX3A 3QE0A 4CEJB 4O08A 1J7KA 1M8GA 2WSSA 2ZIXB 1Q1BA 1VLQA 3AUYA 1LU9A 4LQDA 1Q50A 1KI8A 1R6TA 2XUIA 3MELA 1W581 4RKRA 4BTVA 1OLSB 4E32A 4LEIA 4UKDA 4UNQA 3V4LA 5JRDS 4MV9A 4HC4A 4G5FA 1Z68A 3SVTA 3MTQA 3EJ6A 4HQNA 4DXDA 2KQUA 3N7TA 4R9NA 1UH5A 1VJCA 1Q7BA 3RS0A 2WVHA 2WMYA 1U8YA 1I7PA 2BMEA 3U81A 3EW7A 1JHMA 1J9ZA 3N0VA 4KE7A 5A02A 5AI8A 1DQZA 3PTZA 1EQ2A 1IRIA 5LYJA 1JH9A 3GEEA 5CA0A 4Z7QB 1TXGA 3IRVA 2QXUA 2WQ6A 4QUIA 1P44A 3PWZA 1M54A 3CG0A 4IEEA 4QA9A 1FU8A 3H5NA 3GLUA 1RHRA 3A1EA 3DVSX 3EXHA 2HCTA 2V7BA 3HCCA 3IIEA 5KOHA 1VXRA 1N0VC 3CNLA 5CTAA 1MX3A 5DVZA 1X1EA 3PNQA 3R8CA 3VR1A 1QTRA 1PUJA 5MF6A 1SEPA 5CJJA 5IJ9A 1PTJC 2FQQA 1LK5A 1PT5A 2BFFA 3BVPA 4K26A 5JCOC 1XMXA 2JLWA 4NBTA 4Q1VA 3T3DA 2FGJA 1XVUA 4PX2A 4W8OA 2IPNA 3NFRA 2FG5A 4F6LA 3A3OA 3R5TA 4L5YA 5EWMA 3KCQA 3HFJA 1QMGA 2WAYA 1J25A 2F3SA 2PGIA 1Q74A 3T4PA 2QW8A 3Q7RA 2JJQA 3UV7A 4DG9A 1W5AA 4L3VA 1YZLA 3TO5A 3QTTA 2FUG6 3AB7A 4W5JA 1C3XA 1Q0LA 3CKMA 4PVDA 3RS5A 4B3CA 3LUAA 2NU9B 1V1MA 4TOIA 2CJYA 5FPTA 3AW8A 3WLKX 1UKZA 4NU0A 4DLWA 3IUSA 5KKCA 1K86A 1KJ9A 2ZRMA 1N8SA 5HE8A 2CMKA 3FHCB 4MA5A 4WFIA 2LP4Y 5IH3A 1RP7A 2G9NA 4L4SA 1CHDA 1P91A 1G42A 3HCRA 4RSRA 4RWEA 4TVOA 3V32A 1E2MA 3T1NA 4BWVA 1EFCA 4DR1B 4L8YA 5LIRA 3IQZA 3LVQE 5CH3A 4US2R 1AU9A 3RBAA 4CMEA 1CE8B 5BSGA 2JI9A 2NVOA 5EKSA 3IQGX 5B3AA 3RIMA 3G2MA 4G07A 2BE9A 5DBOA 2YIVX 5D5QA 5FTMA 5E2IA 5B1YA 5COAA 5BWLA 2IOFA 2XSZD 3B5EA 3HPRA 4XGKA 4UCXA 1CNFA 1PO7A 2LUOA 4DFDA 4IXTA 3FHLA 4B8ZA 2Q41A 3IOMA 3MGKA 5UKDA 1LSSA 2WOOA 3U40A 1SG6A 1P9WA 4TKVA 3VYTB 2V54A 1YRQA 2X9QA 5F76A 2J0VA 3HR8A 1KSFX 3NBQA 4XEHA 2ZJ4A 1E5LA 2B7CA 1U81A 2WDZA 1U8TA 3HCOA 1ZH0A 3QUBA 5DLDA 1Y4DE 4YMWA 1W36C 4YFVA 1WMDA 1GV0A 3N5KA 4G8BA 1BH6A 3HB5X 4OSPA 1AX9A 1XMJA 3UT0A 1E62A 4N8SA 4BCBA 4HWRA 4WCFA 4FHFA 1RIIA 1CUEA 3H75A 1QIGA 3TG8A 1UMBA 3L4KA 1OBHA 5ICSA 2F4VB 1T5OA 5DBIA 2JIMA 4DR6B 4JB0A 3FTPA 1F17A 2JLCA 4BV8A 1J0XO 4BKUA 4CG1A 1UAAA 1ELOA 4KRYA 4R16A 2CB0A 1Q0SA 5IVPA 4RFSA 3GNSA 2BCEA 4PR0A 2GKSA 2X9VA 1WP9A 4KR0A 3LBNA 1JVSA 2NU7A 5BYJA 3I37X 1HRKA 2NUBA 4M46A 4WBSA 1J49A 3ZWNA 1QO0A 4ZO4A 1L7OA 3BH7A 2LXNA 1Y6QA 1CF9A 1HLPA 1NKTA 5DGDA 1T9GR 4DLPA 3VMFA 4JJ7A 3UHFA 1NTOA 3MTBA 1R4MA 2G7MC 2OYCA 3ZWBA 4C4TA 5KYVA 4Q48A 1ADFA 4HX2A 2J9XB 2OTCA 4ZA2A 5BT9A 1Q2UA 4JP8A 3V9PA 4C0AC 1HH4A 3E3AA 1Z47A 2QJOA 2WQZA 3G1UA 2VZ9A 4PX3A 4BQQA 1QMPA 2HA5A 3FSGD 4LDJA 1DAPA 4Q1DA 1WXEA 4JI5B 1FNNA 1MJNA 1H2FA 1JQBA 1OV6A 3B51X 4LSGA 4K8RB 5IARA 4GGPA 2X2OA 4HYYA 4MICA 3AIKA 4UMEA 5JWRA 2IZ0A 5ALWA 3TZKA 3B8EA 5EVCA 1T4DA 2QV0A 2WV9A 1KMHA 4FB5A 1SC9A 1L7EA 2QMHA 5EMJA 2BTEA 2X15A 4ECEA 4YDRA 5ECGC 5E9WA 3CZ5A 4MHSA 1EX1A 2Q45A 3JYNA 4P3PA 2GCEA 5AW7A 3ESXA 4JL5A 4W5WA 4H4EA 5CJPA 3T3HA 1QV7A 1WE2A 4J43A 2Y9MB 1ILWA 1YS6A 1CWUA 5FOVA 1TO2E 3ZX5A 5KTYA 1TUEA 3AF2A 4WY2A 5AVJA 3BGOS 4FXOA 3V8VA 5T6BA 2Z95A 1O4WA 5TNXA 1FFXB 2F1HA 2R65A 2GPNA 2QRVA 2HTEA 2Q4DA 4G8JA 1ODCA 2CKMA 2JATA 5JV5A 1IHYA 1ZA1A 4GECA 1MOPA 2O2CA 1JT9A 2PIDA 2QAJA 2QG6A 3D6UA 3PQFA 3S7TA 3UG6A 2WHXA 2E6UX 2CFRA 2PXHA 1FFSA 1L8LA 2NXCA 3MT7A 3VVBA 3VZSA 5IFKA 3AHJA 5C35A 4BY9E 2AC2A 3C6XA 1RBMA 3GVXA 1VE3A 3PYMA 4ID9A 1Y3IA 4MWOA 3P9IA 5JQGF 4HDAA 1UANA 5E4JA 3B1XA 2P2DA 1ZX1A 3G2KA 3LP6A 4IZOA 4ZCTA 3VI3B 3PEEA 3NGXA 5KNBH 1YS4A 3V2IA 5AMXA 4K8OA 4LECA 2PN1A 1G8HA 4FYXA 1TJ4A 1CJKC 3ZVRA 4E88A 1M2OA 2ODPA 4M37A 5JDCC 5CD1A 1T3ZA 3I53A 2ORED 2HF2A 3HNOA 3AF6A 4WZAB 3WLEA 1CQPA 1AS3A 1VGRA 2VSXA 3P1JA 2OSBA 4LDPA 4MS4A 4INAA 4PPYA 4W9NA 2FWAA 4X6LA 5AK0A 2GCNA 3MJ4A 3Q2OA 4LZNA 3ZJYA 4BFWA 4JXJA 1AK2A 4BP9A 1GFWA 5TE9A 5LUBA 4U2FA 3ZDCA 3N05A 1J0DA 1EXNA 4QUKA 3BWDD 1RAHA 4LF7B 1XVTA 3OD5A 4M0KA 3NDRA 4AYWA 4D2IA 1PF7E 3T1HB 2GDZA 2RGYA 4LXQA 2VSNA 1X42A 3I6MA 4G9BA 1JXOA 4UEQA 4A16A 2WKQA 1E4EA 2XUFA 3LA8A 5LOVF 3IPYA 1Z0KA 1UJMA 1QLJA 2NXWA 3PVCA 1GO2A 4HRYA 4DA6A 1EK0A 4RPLA 5F7JA 4B4VA 5IP5A 5HS4A 4ZVKA 1PEAA 2GARA 1ZXXA 2C2KA 2XX3A 3TW0A 3VGPA 4TL7A 1AXEA 5IPFA 5A4JA 4J3FA 3WYBA 4C1BA 5BQ3A 1DAGA 1X7WB 1K5GA 3ZQ6A 2YZ7A 3CVXA 3OEEA 3IEVA 2IUEA 1AO0A 1NG1A 1ORDA 3QJ5A 4MUAA 4Q93A 3WOVA 1IZYA 2QAGB 4JA0A 3HKDA 1DI0A 3J80A 3ZG6A 3CH5A 4I1OA 4DHWA 3LKBA 4KYTA 2ZR7A 1U31A 2ZFUA 3UC9A 3UV6A 1JG7A 4YV2A 2XMGA 5WRFA 4XI9A 1LD3A 5IDQA 4CQMD 5M04A 3CX6A 1OI4A 4R4JA 4JKYA 1X1CA 4WLVA 5AW5A 4DADA 4NDNE 4YO8A 3RJ9A 3TRDA 2NNLD 5DXFA 4H1VA 4KQIA 2IK8A 1YA8A 3I62A 1UOOA 5I7UA 3FI0A 3N7UA 2ATVA 1KJJA 2FFHA 2HH9A 2P9EA 2WA1A 3NV9A 1FF9A 2VJNA 4HLQB 4RVUA 5FFFA 1XTQA 3WV4A 4KMOA 4OFXA 4DILA 5FQNA 1DWQA 3D8TA 1Z63A 4MQEB 2PJDA 4U7TB 3EXFA 1QKIA 4RS3A 1FMTA 5JS2A 2P4HX 2Q49A 3X1MA 1VL1A 2R7KA 3WMGA 2IHNA 1T10A 2FE4A 4C9BA 1P5FA 1JHZA 2E55A 1PWYE 1K3FA 4FIZA 4G0WA 1UJ5A 3GRKA 1NMYA 1N0IA 1LI5A 2P79A 3RV4A 4UEKA 1AHHA 1Y3FE 2H0QA 5MFZA 4ED9A 5IU6A 1E0SA 3Q0EA 1ZNZA 2F67A 3SHOA 1XL1A 3G5LA 3JVDA 1X7ZA 4D4LA 5LLDA 1EFUA 1EVIA 2GTHA 2ZVPX 4W9RA 4ZI7F 3CF6R 3DS8A 3E1GA 3KB2A 4Z6KA 2B94A 2Q3HA 2CMFA 3PEYA 2IPMA 4YS6A 1T6BY 3OICA 1NW5A 5CVEA 1VP9A 3QW4B 4KXFB 3VQTA 3TD9A 2Q3EA 3TRKA 3ENQA 1J0EA 2XYPA 4KGZA 3EPHA 1P1CA 4OD0A 4DCUA 3IQXA 5LKRA 1YBVA 4JGIA 1UEXC 4WRRA 3K1YA 1J00A 3FKSD 1KO4A 2BFEB 4M1KA 4QDTA 4X65B 1AV6A 3WJ1A 4MTLA 1EG7A 4R2JA 3LI2A 4HG2A 2QE6A 3N6RA 3U7IA 2XTMA 2Z4TA 2QL5A 2JD1A 5KTKA 3GRPA 3MLEA 1TLFA 3ZZMA 1UKYA 2CYCA 2W2TA 1MAWA 3K05A 4FT4A 1K2WA 4LNHA 2GBCA 4QYWA 3GYBA 3HBNA 4LGCA 1BX1A 1ODJA 3MWGA 3ZTYA 5LP6F 4MQ5A 1XMQB 3L46A 1QP8A 3WMXA 4JLSA 3PJRA 4JUAA 3E9NA 2OMKA 3LUKA 1KGDA 5SYAA 1D2GA 1IXZA 3TGPA 2XB2A 3BGIA 4JXZA 4BLWA 1E5DA 2CEAA 2PMKA 1P62B 4GOLD 4UM8B 1TPYA 3K5WA 1CLUA 1UKCA 4WNIA 1G291 1GA1A 1Z5PA 1FYFA 2AXNA 1N9KA 2MINB 3DAGA 1Q1ZA 4LOIA 4OATA 4FGLA 1JHOA 5K6AC 1GGHA 3EEYA 2C1XA 1NWCA 3PUWA 4L78A 1HR0B 1IM5A 3FVVA 3HU5A 5DIFA 3RGWS 2ZUFA 4MKZA 1Z39A 3CF4G 4NAVA 9MHTA 3F8WA 4PHGA 4OHYA 1GOTA 2F3PA 1R7RA 3GDWA 1KDRA 1ZCZA 3GGJA 1PW5A 4WDQA 4WAUA 4QBHA 1KEEB 3WA6A 2VWGA 3PJEA 5AFSA 4C0JA 3ZHSA 2I4TA 3RLFA 1I0LA 3ZV3A 1NOKA 1S2LA 4WKGA 1JDUA 5FA5A 1IAVA 2C2XA 3BHMA 3EVCA 2Q4OA 3RLIA 4XGQA 5ECDA 5CLQA 1SHKA 1VJ1A 3GYGA 1ARZA 2FMIA 2M2IA 3VAZA 1V41E 5JQGB 5IK2A 4Y0VA 1E3SA 3CEMA 3UJBA 1DLIA 1WXHA 1F06A 3AHDA 4FLFA 4NZNA 3ZR4B 2ZUCA 1PI3A 1ODFA 2RHHA 4NKRA 3FNHA 1LLDA 1AUOA 2N9UA 1MEEA 2ZAOA 3KD2A 4FYMA 3E8MA 2ADFA 4KODA 1PG5A 4F1WA 2IOFK 2AB0A 2W58A 5JVDB 1CG6A 1G5TA 1Z0SA 3S28A 1EQUA 5U1PA 1U02A 4HNVA 2HT1A 3TE6A 3RTEA 1ZDMA 4ZFNA 4MPDA 3I09A 3MMZA 3CXRA 1J07A 1CRWG 2RBEA 5ER9A 1R4AA 4UQPA 4I5IA 3BJIC 2GK4A 2CCGA 5JS7A 2NV6A 2J7PD 2V6FA 3GEDA 4ZK6A 4KUEA 3O2NA 1JGTA 1ORTA 1G5RA 5CVVA 3LGSA 1JG6A 2OVBA 3ETCA 3FETA 5C1IA 5HF6A 4JI6B 3IH5A 1KOLA 3TINA 4IVQA 3DM5A 3FRIA 2NUTB 1QQAA 5IH7A 1DRJA 1GD1O 4RMHA 1HT0A 2OCXA 3EGOA 1CFJA 2Q3LA 3WLAA 1J1IA 4G1UC 4EKNB 3ZW7A 4QEKA 1C7IA 3PIIA 2HEIA 3G23A 4I14A 2VN8A 4LJLA 3X2SA 4AO7A 1NRWA 2F48A 3ZVLA 3TIXB 3FDJA 1FPQA 1Z5GA 3PHIA 3QPCA 1KH1A 4V02A 4XXHA 3NETA 2JRLA 5CT4A 3OJWA 1XZIA 3IKJA 1T8UA 3DWGA 4E07A 5FTLA 3IE1A 2RGDA 3LUGA 4MHTA 1W0KA 3PKZA 3UWDA 4FUTA 2YWHA 4GLFA 3LE8A 1PFVA 2WU0A 2IYEA 3RG2A 3NYRA 3CGWA 4BO3A 1IVYA 1GQFA 3FY4A 1F9EA 5TF0A 3ACCA 1SBTA 2W90A 4OFWA 2I7TA 3IT1A 3RC7A 3RFCA 3T9AA 3TCNA 3MT0A 1RWWA 3V97A 4MITA 4DR3B 4F71A 3H9CA 3OURA 2XUHA 1RZ3A 1EKXA 4OQXA 3TMKA 4EKDA 3WHPA 2Y93A 1N7GA 3LLVA 2AX3A 3PE4A 3DBRB 3UA3A 3TB6A 4C08A 4IXMA 1CR2A 2HSGA 1QOPB 1TMYA 1ES9A 1X7DA 2QN7A 4GGOA 2XUGA 2X0IA 4CMBA 1E2IA 4FYIA 3GAMA 2C9YA 2XCOA 4BEVA 4EF5A 2JW5A 4EDFA 1BE0A 3CS3A 1JSRA 4H08A 1G41A 3ORQA 5DTEA 1DJNA 2VPZA 3C1TA 2QVYX 3K7EA 2LZ0A 1O03A 5I9MA 5DHPA 1H1LA 3EA0A 3HA5A 3LUPA 4BFYA 3WV5A 1ZRNA 3OJ0A 1MV5A 2R87A 1SHJA 3I3OA 4UC0A 5L8VA 1EUZA 5ICEA 1ZM3A 1W49A 2ZROA 3PCRB 4MYHA 3UJ9A 1QZUA 1ZKMA 3I9FA 3KOZA 4LPSA 4Z9BA 2XZDA 3UJDA 4EG7A 2QTAA 3KKZA 5BQPA 2A1TR 1CUHA 1KIFA 3D43A 4H3KB 1P19A 2HV9A 3CCBA 3OZVA 4DA8A 4P0TA 2YVQA 4OI2A 1TYBE 1IONA 2NNWB 3HLKA 5DNUA 1U7DA 5I51A 4OYYA 1LH0A 1X7ZB 2FUKA 1QYVA 3E58A 2JIOA 3M89A 3N74A 3R5FA 4B6OA 4BAZA 4ARZB 2P78A 5KDDA 4RF4A 2IYSA 5I6DA 1KYTA 4DZZA 4AQDA 3GA0A 1ZGBA 1QHHA 1E9VA 3JPWA 4C3ZA 3NOQA 3D8SA 1NXOA 3EZ9A 2V9ZA 3KOOA 5ICMA 3EQ2A 3L8GA 3PRHA 1L6IA 1NG9A 1JG2A 2R5NA 2JBAA 1KY4A 2Y8EA 3MJFA 2GEDA 3N0RA 2B61A 4HLUC 1INLA 2VDWA 1CDEA 2ZSDA 3UANA 4QHYA 4JASB 4RGVA 3KYDA 3OFJA 4G89A 4DUZB 3BA1A 3OZRA 4NFHA 4PGMA 1J09A 3NJ8A 4DJFC 1YQQA 1HDOA 3G0HA 2ZYTX 2B98A 5C7YA 3IFSA 4TWAA 4GVXA 4F04A 1YE5A 3ER9A 3QSGA 2EKPA 1EH5A 4R2XA 4D41A 4QLOA 1T2VA 2G8LA 4E14A 4M83A 1DO0A 2YZGA 4B4KA 3DOCA 5A4IS 3H8WA 4UNIA 1WMSA 2B25A 3FCYA 7GPBA 1T2AA 1TJ3A 5T7BA 5EL0A 3WLQA 3QX8A 1C9NA 3UA4A 3BQNB 1PLJA 3EQ7A 3GQVA 4JLOA 3E27A 4F3RA 4CCYB 1GEGA 1H1DA 4P53A 3LHFA 1ICEA 2Q4TA 3C7AA 4EHIA 4ZTZB 1B23P 3Q12A 1NW7A 2AYZA 4CWAA 3K70B 2BDUA 3ZGZA 1GZ3A 2G07A 1NHGA 4RTRA 4OQMA 1ENZA 4TKUA 2ZIVB 4AS1A 1FVFA 3AHEA 2UV8A 4XIFA 3AKYA 5TGTA 1I4TD 2IKQA 1T2NA 2ZQZA 3RB8A 3VR5H 4JELA 3IA7A 4P98A 3N1UA 3W9YA 4IRUB 2Z5GA 3WNVA 5HE9A 4DHEA 2XDYA 1HFWA 1LPBB 1FDSA 3BRWD 3RYFB 4Q3CA 1ABEA 5DIZA 3QXCA 1LDMA 1XNRB 2FW7A 3T9DA 2FETA 3L0OA 1PBNA 1ODSA 1QHHB 2FQXA 2RKWA 1P5RA 3DAHA 3Q72A 3GPBA 3E9EA 2VYNA 4JEMA 3S0JA 3SSOA 3C6BA 4OJQA 2XNDA 1JQ3A 4DQDA 1MGPA 2HU2A 9GPBA 1HE3A 1Q3TA 5LIPA 1C30B 1XZGA 1XPOA 1UWCA 4GPBA 2QR2A 2VDPB 2MU1A 3KFVA 2V7QD 4MI9A 4S1WA 1GIAA 1RI2A 4Z7OB 3LP8A 5G0SA 3A36A 4LQ4A 4DJDC 5CXUA 3LJKA 2ZI5A 3GOQA 4QGAA 1WO8A 1XQYA 2W83A 4XIGS 2J4DA 3DZFA 4WK2B 1SKYB 2QUIA 1VL8A 4IGKA 4C2BA 1XL0A 2CNBA 5JZVA 5BVHB 1DJOA 2BFAA 2OQ2A 3I4LA 2XUQA 4NXMB 1U3CA 1G8KA 1P4AA 5FQOA 3UJHA 4Y2QA 3ZTWA 4CIYA 5LZ9A 1RXUA 3GN1A 3DMHA 2X8JA 2DJIA 2DY0A 1QAMA 4RD1A 1NBHA 2J07A 2XYRA 4HTFA 4CFZA 3KETA 1AG9A 3FROA 3CX7A 3AY7A 4ZOLA 2Q9BA 3VZRA 4FW8A 1MHPA 1TUGA 3NB0A 3UXYA 4C29A 1M76A 1TTPB 1WEKA 3HBAA 1XNQB 1IBKB 2VTBA 1J1UA 4YJ2B 3QEMB 4FXPA 1YD7A 4R1NA 2W6OA 3WQBA 1A4XA 2XNSA 2H06A 2Q1TA 4LK3A 2QN1A 2WTBA 5E7QA 5AXBA 5AM1A 4PC3A 5CA0F 1JP7A 4HNSA 4M89A 1DNPA 1IHUA 4NTZA 4RIGA 4RZXA 3WA7A 1KQGA 4LRXA 2PJRA 2FN9A 1VMEA 1WHSA 5TX7A 4CQMA 1N2CE 3LDHA 4HQOA 1LQUA 1P8AA 4M7OA 3ENZA 4KBFA 2WIGA 5LZ5A 1BVRA 1KPHA 4FE7A 1K68A 1Q95A 3BTVA 3H2YA 1QCDA 2XE7A 1SZJG 4DRZA 1XUOA 3W1WA 2G0TA 1TIKA 1Z0AA 5B7PA 1HA3A 1PHRA 3KPUA 4JI4B 2GN4A 1IHXA 4GF5A 1PD0A 2H08A 2WKWA 5KJCA 4MULA 4AC9A 4MQ6A 3M6FA 4F4HA 2VT3A 5FB3A 4B0PA 1FUIA 4DSOA 1EWQA 2HKIA 5MFPA 2IS1A 2VHQA 3PC8A 1E1MA 3OSZA 1F2UA 3U7JA 4LJ4A 4M1WA 2O0LA 4MCJA 5EJMA 3E8SA 1DC7A 4WNAB 1ZHHA 1WUYA 3THOA 5CDFA 1NDQA 5IVHA 4ZOEA 3QMWA 3TZHA 3GLKA 3ZD6A 3HN7A 2Q28A 4F3TA 1E94E 5DISB 1VOTA 4KUHA 3AFGA 5CB8A 1N2JA 1DJLA 4HYEA 1CF2O 4KU4A 1QH8B 3PLRA 5ELLA 3ZTTA 3ZVKA 4H1UA 2KPOA 4GI7A 1MC5A 1TKRA 4B2LA 4ARAA 3SBXA 3OTHA 2ZSJA 2PZGA 4S05A 4O2RA 3AF1A 2LPMA 3ILHA 4XFDA 3UPDA 4XWOA 3RH0A 3VTZA 1MOSA 2BI7A 3MRVA 4V0QA 4CMIA 1ZJ6A 3DL2A 2BHRA 1G66A 2VH1A 3TTWA 3K71B 1BGXT 1E9FA 1J20A 2ATCA 1P18A 2Z5LA 3EZFA 1FTNA 3EWIA 3FGPA 2AEEA 3I04M 2C5GA 3BF8A 1JQLB 3WB9A 4EY7A 3DF9A 5AESA 1VYVA 3W2FA 2OY0A 1GPBA 3RS2A 1TYZA 3ZCXA 5E8RA 2AJDA 2QRGA 3MTGA 4AJ2A 1OIXA 5T57A 2VDNB 2EP5A 1Z36A 1UPCA 2EQBA 1C3OB 3DEYX 1VE1A 4J2HA 1Z5UA 2FN4A 3AOEA 3C8HA 1IQUA 1T34A 3PNBA 1GPMA 4NAHA 1H0SA 5CVCA 2A5JA 3R7AA 5AOBA 2ODWA 1EHIA 3E5RA 2Q0HA 3GDHA 1KK2A 3G82C 4LMRA 2GN2A 2MYUA 2F9LA 4J7AA 3JYHA 4OGGA 4RMGA 5GZ6A 4EUNA 3OQPA 2OFXA 4YAJA 1H2ZA 2SHKA 5CLJA 3TW6A 4HB2A 1PIWA 2XVXA 3F6RA 4UULA 2ODEA 4RW0A 1I4EB 2G88A 2YJZA 3HSKA 5C31A 1GNRA 2OZPA 1S7CA 1FTQA 1KYIA 2GSWA 5A71A 5H80A 4AP6A 1SIWA 1U1GA 3L06A 2XR1A 1JFSA 1Z4JA 4UTNA 4AJPA 1CY6A 2AFHE 4EP1A 1RWBA 2Q3FA 3H4MA 4DG8A 1AKQA 1Y1LA 3I23A 1I1OA 4NU6A 2ATEA 3NYQA 4AUKA 5KWIA 4HBZA 1RYZA 2B5VA 1FFAA 4J1TC 1GYPA 4PZEA 5J47A 1FRQA 2WPDD 3FAZA 2ZSUA 3LVRE 3GC6A 4AF8A 1X80B 1Y34E 3KZKA 4B47A 3H65A 4EZBA 3LCUA 2BF7A 2HLPA 1E1QD 3NTOA 5JPIA 2O48X 3RJTA 5KQRA 5L3QB 4IX9A 3G7SA 1OIWA 2E85A 3N2NA 5B58C 1AKVA 1KFEB 3T1YB 3AVYA 2I4RA 3NGMA 2FQWA 3T6KA 4XOIA 4E2YA 5JS8A 4UBLA 1W4ZA 1B1CA 5GVSA 2YQZA 3HE3A 3M1YA 3D5EA 1P7VA 3OTGA 3NIDB 4FMCB 4DLSA 5JEEA 1KK0A 4ZGGA 1SVOA 3PX2A 3AK4A 3AEKA 1NVBA 5KWJA 1XFDA 2FSVA 2WUFA 4HFJA 1FNBA 1W47A 2QTVB 3GBPA 5H0IA 4CLXA 1E89A 4EQ6B 5JJKA 3EXHC 1FBNA 3A6LA 1C41A 2CHGA 1IK6A 2EF1A 1JBEA 1N6RA 4G0YA 4O29A 1EK5A 5LZ8A 2ZRKA 1Q0RA 1K0FA 3DCJA 4KO2S 5TJHA 2V7UA 3CMCO 2BUBA 2FZ4A 2ZR8A 1JR3E 2YHIA 3EAGA 2P2YA 5EFOA 1E4VA 1EJ0A 1R18A 1VGVA 2N3ZA 2Y1OA 3M9XA 4QUHA 3ETGA 3ZGXA 3LVFO 3IR6A 4H1HA 1JF8A 3U5ZB 5EC8A 2PMEA 3M0EA 2QX9A 4W8GA 2BR3A 1LK7A 3FNQA 1NNSA 4JLDA 4RLFA 4Q24A 4WIAA 5FBRB 1G7TA 3GDGA 1PCXA 2JGDA 4KSBA 4Q37A 5CYPA 4GPAA 2ZU6A 5K99A 1PUXA 1T0JB 1GU0A 4B6PA 1VIYA 2VHXA 2XTZA 3DE0X 2AFIE 5CXQA 2KBEA 1LW7A 2JKZA 5A3RA 5KWEA 1Y7LA 3BRCA 3PPYA 3KXDA 1ZEMA 3GUHA 1DBSA 4DLNA 1E66A 1JHVA 2CL6X 4FDMA 4LWZA 5EJ7A 3M1AA 2D4HA 1KSHA 4LYGA 2CL7X 3WX0A 1QRAA 2DHRA 2P2NA 1D6SA 1X1QA 2OV3A 5DO9A 5B7NA 3QENA 4YRSA 1PJ4A 4XQGA 4Z0PA 3FJOA 3O3MB 4DCTA 4J0KA 5E9AA 5JSZB 3B1YA 5BV2P 5J2UF 4X1KA 4QRIA 4CDRA 3DBHB 1M2EA 3OJCA 5KC8A 4B3DA 1AZTA 4CUJA 4R2IA 4ZDKA 1V8ZA 2UZ0A 2ZWPA 3R3UA 4RE5A 1TCUA 2V7GA 2XDAA 5KVAA 1UEIA 5FORA 4G0QA 4NEQA 3TUIC 1NUSA 2W2LA 3L84A 4FGKA 1ZRHA 4KNVA 1Z37A 1QH0A 3K9BA 4WTOA 5CM9C 1BD3A 4UE2A 4ZVMA 4KWTA 3D6HA 3FOBA 4HAOA 4X8LA 1DWPA 1Y8AA 2GRJA 2X7JA 4PPFA 4B48A 2W9XA 1RC8A 2BJWA 4PNZA 3ZN2A 1HZZA 1BNCA 3T54A 3TQRA 2RGBA 1Z5ZA 3Q6NA 4M9SA 4AMGA 1HDXA 5JRJA 2YFQA 3GFOA 3IHKA 3IT0A 4FZVA 1NKVA 4OF4A 5JFTA 3IELA 2CNWD 3MTAA 1IK4A 4XQCA 1J8YF 4I4TB 2P3QA 4F5WA 2H1WA 3FKJA 4M54A 3ZW9A 3I1JA 4PYMA 1POWA 1V3UA 3BSSA 4AUNA 1SCKA 1JALA 1CUGA 1XALA 4FN5A 3GFPA 1MJFA 2RH4A 4A36A 4A23A 1QOZA 1OCEA 1OLXB 2QI9C 2JFUA 2XIJA 4G0MA 5KAMA 4FGJA 2PSHA 4JLUA 1FVHA 3PP8A 4L95C 7ADHA 2PWZA 1JWLA 4CL2A 4YR7A 5AOVA 3A3PA 3NC4A 4UUQA 1C8LA 2F00A 3BXOA 4KQ9A 1QF6A 5IM4A 1JSXA 1RJDA 1WD5A 2EKDA 2J3JA 4MW0A 4CU2A 4RX1A 3GD7A 3U4QB 1SCIA 1TVKB 2XQKA 4XH9B 2CJXA 1D03A 4X7MA 1R8YA 3UJAA 4L7QA 4F45A 1LQTA 3V80A 3HWX1 4Q9KA 2OT3B 1ODLA 3EFEA 3H8VA 3D2AA 3V2GA 5FUQA 3CSDA 1T36A 1ID1A 3LA6A 2FMHA 4W7IA 3MC1A 2PPLA 2Y6VA 4XARA 4YK7A 5D3QA 2HC9A 4KACA 4EY5A 1TE2A 1QTQA 5IVDA 3VZDA 4IJUA 3TLCA 3CZ4A 2GF9A 2NYUA 5G0UA 4W5QA 1Y9DA 2FKAA 2OORA 2QX4A 2XZOA 2G04A 3GWGA 2GZRA 4IDNA 3V3TA 4PZPA 4JLKA 4EX6A 3GLGA 2E5FA 2W6NA 3HVKA 4KC0A 1SQ5A 2BBTA 5DYGA 1UF9A 1DUSA 3HKCB 3I6IA 2YVKA 3L7IA 4CYMA 4NBUA 2VWQA 1O6ZA 2ZAYA 1UDRA 2UYOA 4LK2A 4GX1A 1F2UB 1ESZA 1SD1A 3BD8A 1ABFA 5AIBA 3NHBA 1QS0A 1XRNA 5FPPA 4HXGA 3W0LB 5JZBA 1OTXA 3D5TA 4RKEA 4TMXA 3T06B 4D4IA 5HKLA 2FX3A 2ZBRA 2PYZA 3D3KA 4RIFA 2GKOA 5L53A 3INGA 2G08A 1PHPA 2FWPA 2DFVA 1BMFD 5DP1A 1AQNA 1ZVJA 4ZT2A 1OBCA 3NDPA 1G2PA 3KSDO 4C0BA 3EK2A 4BQRA 3AIMA 1WDKA 1SO8A 3EGXA 1ZHOA 1UBSB 1KFCB 3OFVA 1FXWA 4GMHA 1NXPA 4N3NA 4DLKA 2YY5A 1MENA 2HD4A 1XXHA 4KGVA 1VI6A 1QFMA 2V98A 3N2IA 4NV3A 3PQ6A 5BSMA 1Y1QA 5F5LA 3CNNA 3DDUA 5CDGA 1QZTA 4BN4A 4EHHA 3MHPA 3A1VA 1X8XA 2YFYA 4ME6A 2IEBA 4UMVA 4BQSA 4RUKA 8LDHA 2HSDA 1GQYA 3GXBA 5ES4B 1QGOA 5ED0A 3SFVA 1XCMA 1QK4A 1PR5A 1V25A 2AEFA 2OESA 2ZCUA 4ZVQA 1QU2A 2AVDA 3L77A 4YUYA 1IEQA 1T13A 2X5NA 1YASA 2QPOA 4HX5A 3PQDA 3UGQA 1QZ3A 1E7QA 3I6QA 121PA 1H5UA 1KRHA 4Q6WA 1AD2A 1T24A 2IL1A 2WA2A 2HBZA 1M9NA 3KFLA 5FPHA 3ZBQA 4AY6A 1QGYA 3KE8A 1UKEA 4C2UA 1OTHA 2ZB2A 2VHUA 2YYZA 2PSSA 3NAZA 1WULS 3T5CA 2GVNA 1EUCA 1WP4A 3TNLA 3K4PA 1ZJJA 2VVTA 1Q7TA 3FPKA 3H6KA 4A26A 3L8CA 4E3ZA 3EEBA 4MAFA 4PZ0A 3SC4A 2IU6A 3G2JA 3TLYA 4I3GA 4B5LA 1SKMA 5JNWA 3FMIA 1DC8A 1KPGA 4HD8A 2BEVA 3Q15C 2HFJA 4HATA 3M5CA 3IKLA 2HSJA 3ROTA 4R54A 4NBNA 4C21A 1A8PA 1J21A 4DUPA 2C61A 4OHOA 1UC5B 1V45E 2M32A 3BFVA 4N5MA 3H0KA 1GRVA 3E22A 4XWKA 5IT5A 5K4HA 1WB5A 3W5DA 2HQ1A 3O1IC 1H9BA 2RONA 1GKLA 1N6PA 1P4SA 1VZ3A 2QUJA 4INJA 2CWDA 3DF7A 4UMDA 1U2SA 2WYWA 2B30A 2PKXA 5AVOA 4AFNA 3VNUA 1T9AA 4ENUA 4JR1A 5DV9A 2IY7A 3EMBA 4P84A 2QRMA 2X8LA 1L5RA 3I76A 4CQJA 4XDZA 4LF4B 4BUJA 3TDNA 1II9A 1HSOA 1Q0UA 3MWKA 4G37A 2DLDA 1GUFA 4R51A 1TZCA 3EA5A 3R7WA 1IM8A 4IHKA 2Z5VA 3QXJA 1ORWA 3AJ9A 4P5PA 4ZDJA 2H4FA 5C1OA 4GX5A 5AW3A 5TIIA 3B20A 1ZVMA 4N01A 3QIAA 1DXOA 1SZCA 1HG0A 2AJTA 2REBA 1M0TA 3OMLA 4KRGA 5DE3A 5LCXA 5K3EA 3BJMA 1RJ9A 3PSHA 1YBFA 2AHRA 3K0BA 3OCWA 3PS9A 4CTMA 3PGMA 4FCCA 1QFZA 4RA9B 5EOVA 1YJCA 3H99A 3LXXA 4O63O 1M8JA 4BMVA 4ENTA 1BKYA 3BT7A 3EXFB 4HUQB 1T4CA 5F4BA 8ATCA 4YRPA 5B3JC 4I5DA 3ZCPA 2BF4A 3OJLA 3BWVA 4J1SA 4MJLA 5ALYA 3L1JA 2QSUA 3IHLA 3MSCA 3OMWA 1AMNA 2GDJA 4Y98A 4ZQHA 3WRWA 3MWJA 4LV6A 2XUKA 4HGQA 2JLYA 4Y9SA 1N7IA 3RABA 2Z09A 1S3SA 3KEGA 4MH0R 3ESCA 3QZUA 3HSSA 4AMYA 5KOJA 3OQHA 3G9XA 5H1YA 4B6EA 2PUCA 2BEJA 4OHFA 5FBQB 4X6YA 1BXRB 1K5HA 2VJLA 3DHVA 4M87A 2XXAA 2OYRA 1M3SA 1VSTA 3E9DA 5IVKA 1UBHS 1IBSA 2G1JA 4EFNA 2OBLA 1XQWA 3UYLA 1ENPA 3CU5A 1A9XB 2WD8A 4P83A 3T41A 2QR3A 4Z9YA 1FY2A 1LDNA 5G4KA 4EY3A 4PSKA 1VIDA 3KXLA 1ULTA 2Q5QA 3OESA 4KDFA 2PUAA 4JL6A 3EFOB 3M49A 5I7WA 3CKLA 4RBNA 1OFUA 4G0VA 3SMQA 6Q21A 1ONNA 2C0CA 3RBVA 3RWOA 5EJ4A 1UQUA 5IKXA 3WO0A 1SBNE 2HIGA 3TW8A 1E64A 5AKLA 5T3UA 3AHCA 2IXAA 3BBPA 3IBFA 1UDCA 1MKYA 2P2LA 3IXQA 4ECAA 2GCPA 3TIVA 4KOEC 2V5AA 3T7AA 4WD3A 3AWIA 3QTLA 2X7HA 3CZ9A 5JNRA 4R1UA 4EGSA 1VHQA 3N8HA 1SUPA 2EJWA 4TS1A 1KY2A 3VO2A 3NGLA 5JUWA 4O1IA 3ZKAA 4B85A 2EJCA 4J1QA 4YEDA 3SEZA 3GLGB 1GRQA 3RRJA 3X3HA 3ZX4A 4D26A 1PLLA 4I8XA 3D6AA 3MINA 2P35A 1GKIA 3GQBA 2C5LA 3C6MA 3ZDQA 1P1RA 2P69A 3WSWA 4CEIB 1N6IA 2CLMB 2JRCA 4FI3F 4OV6B 3UK7A 3FZYA 2HBRA 4G5OA 2R8OA 3DOIA 5AHRA 4C04A 5CX1A 1FL9A 2FG7C 4PX9A 3E4CA 4JOQA 3RF7A 1PWHA 1GU7A 4Y6GB 3WLJA 2O2ZA 4L4UA 5GADl 1JR2A 3DB2A 2J0QA 4IPTA 1I4LD 1WZUA 3NNSA 3FUWA 1CQXA 4UOZA 1NNEA 5KDOA 2PUBA 4OU4A 2XDQA 1T1GA 1OFVA 4MS1B 2RGRA 1XTZA 4PYQA 4TTJA 3IEPA 2OAP1 2BGWA 3H1BA 1YQGA 1N2GA 3BWEA 3BJRA 3KQYA 3WG9A 1HYQA 1PJLA 1WQ4A 3TJMA 1ZOPA 4JQOA 1FFGA 4GLLA 4Y2PA 3BL6A 4N8DA 4DV4B 4C7JA 2VKTA 3A1CA 4UEJA 4IYRA 4QO8A 4TM7A 2IX9A 3HU3A 1E7YA 4O4LF 1VYTA 2FN3A 3IODA 1IOZA 4QIHA 4LBYA 4MW9A 5H7XA 2J3MA 1E9SA 2XJ9A 3OCYA 1V5EA 1T5TA 1H5NA 3QH4A 4PIPA 4YXFA 2DBQA 2JGEA 1U04A 3QKSA 1E59A 4MPPA 4OMFG 3DHWC 1M72A 4RADA 4C0SA 2KMLA 4HQFA 3EC2A 2ZT6A 3ZDZB 2NMVA 2DU8A 1QGED 3PZBA 2HL6A 1NFFA 3CSUA 3VDMA 3ZQ4A 4DCMA 2R47A 1U8ZA 4R2KA 3M1LA 4Y9DA 4L5CA 2DPXA 5DCYA 6REQB 1YAHA 3EULA 5F2OA 4HEHA 4F9FA 2JCBA 4GXNA 4PZZA 3UJCA 5J2TF 3A4LA 2XKBA 1ZR2A 3PUZA 4K7JA 3NBUA 3GGSA 2AKYA 1QM5A 1T2DA 1Z15A 4HH4A 2FFAA 1F0PA 5SZKB 3C7DB 3CE9A 2QORA 3W5AA 2I1LA 4P7FA 5FXMA 4ZCSA 3TOVA 4FOPA 1B16A 1GKKA 2D13A 2PWYA 1UFVA 1P0FA 3P20A 4Q7EA 2QEQA 3ND7A 3D6FA 4QBTA 2XWPA 4YJ2F 4FP9A 2BT4A 4YY3B 2H00A 1SUDA 4ZDWA 4HUQA 4K9OA 1TO1E 4MQLA 4E5NA 4GE0A 1JBKA 3REOA 1DB3A 1DGQA 1Q92A 1U1DA