1ENWA

Elongation factor tfiis domain ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
b'GSHMPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR S-II
publication title Elongation factor TFIIS contains three structural domains: solution structure of domain II.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2000-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 1enwA00
2LW4A 3NDQA 4BXXX 2DMEA 4BY7X 4BY1X 1ENWA 3GTMS 3PO3S
chains in the Genus database with same CATH superfamily
4OR5B 4Y72B 2PMIB 3TW7A 4F6WB 3HB9A 2DPPB 3BG5A 2UZLB 5DQVA 2DD5B 5HBHB 2WHBB 4BCMB 3BG9A 3QYEA 4EC9B 3DOGB 2X1NB 2C5OB 3M03A 1H26B 2R7GA 1OIUB 4F6SB 4JX6A 4F7NB 2G9XB 2PHGA 2DD4B 1UNLD 5IDNB 3QWLA 4F70B 3QYBA 3DDQB 2QQ8A 3BLRB 3KHIA 5LQFB 4BBSM 5CEIB 4MFEA 4ELLA 2PK2A 1TFBA 4BCPB 4HLQA 4BCGB 4NSTB 3QYHB 3PO3S 4IMYB 5IHYA 2DMEA 1VYWB 4EC8B 2BS4A 4NC6A 3BG3A 2PK9B 2WXVB 3K7AM 2C4GB 3TNHB 3GTMS 3A8MB 2WIPB 2KMGA 1N4MA 3DTOA 4YOOA 1GH6B 1UGRB 2ZCFB 2G77A 4MFDA 2C6TB 2ZPBB 1AD6A 5LMKB 4BY7X 5FGKB 4G6LB 1W98B 1C9BA 4BCNB 4OB1B 2QDYB 1P5EB 1AHJB 2CJMB 2KR6A 1AISB 4CFXB 5IDPB 3BHVB 2W9ZA 2WJ9A 4Z6YA 2ZPIB 4BCHB 1H4LD 4BCOB 2CCIB 3BLHB 4EONB 4KRDB 3HO8A 2D0QB 2CCHB 4OB2B 1GUXB 4BCFB 3TNWB 1H1RB 5HQ0B 1FVVB 1ZP2A 2ZPFB 5EJCA 2WFYB 1E7PA 3QYGB 4YC3B 5ICPB 1UNHD 2F2CA 2UZBB 4HNTA 1H1PB 3POMA 4ELJA 5HNBB 4BCKB 2I40B 1H28B 2CYZB 4ROEA 3A8HB 2DXBB 2WMAB 3TNIB 2QF7A 3BHUB 4EOSB 2WEVB 1OI9B 2UUEB 3BHTB 3EJ1B 4BCIB 4BCND 1OKWB 5EFQB 1V29B 2QGSA 2BPMB 3HBLA 5HVYB 2AHJB 4BBRM 2CZ0B 2W2HA 3X24B 5IF1B 3VKHA 4F7SB 2ZPGB 4AI6A 2ZPHB 3DDPB 1H1QB 1VOLA 3HHTB 3B57A 4JX5A 1UGSB 4KRCB 4I3ZB 3EIDB 4ZGJB 2LW4A 4EOPB 1G3NC 2W9FA 3QZ9B 3QZ5B 2CZ7B 2WPAB 1OIYB 1UGQB 4CFWB 4EOMB 3LQ5B 5HBJB 2WMBB 2CZ1B 2C5XB 4FX3B 4TTHA 1PKDB 3X26B 1O9KA 1JSTB 1OL1B 4CFUB 3RGFB 1JKWA 1F5QB 4EOIB 3HZJA 3A8GB 4EOKB 4YOSA 3O0GD 3EOCB 3NDQA 3BLQB 3MIAB 1URCB 2QFZA 4EOQB 4OB3B 4RODA 4BXXX 1QLBA 2ZZDB 3DJBA 4ROCA 1BU2A 4CFVB 5BNJB 5DQWA 2C5VB 3DL1A 1FINB 3X28B 2PJQA 3QHRB 2BKZB 1FKMA 4BCJB 1E9HB 4CFNB 3TW6A 2WIHB 2QDJA 4BCQD 1H24B 3QHWB 4EOLB 3F5XB 4EORB 3VYGB 1O9KB 2C5NB 2IVXA 5I5ZB 4CRLB 4QSHA 4CFUD 1ENWA 4AKIA 3MI9B 1TD6A 3TN8B 4ZGEB 1UNGD 2I53A 2ZPEB 2BS2A 5CYIB 3WVDB 4EOJB 1H27B 2EUFA 3H4CA 1GUXA 3WVEB 3QXEB 4OGRB 4YOZA 4MIMA 1UGPB 4M6VA 2CZ6B 4FM4B 2IN3A 1IREB 4ZGDB 3MY5B 1OKVB 4CXAB 1VINA 5L2WB 3X20B 2V22B 3X25B 2DXCB 1H1SB 1D3UB 4UN0A 2IW8B 4BCQB 1OGUB 1H25B 2UZDB 1GY3B 3G33B 4BCMD 3A8OB 5ACBA 2W99A 4OB0B 1OL2B 4F6UB 2IW9B 4HL4A 3VKGA 4EOOB 3MY1B 4F7LB 2JGZB 4HNUA 2BS3A 1JOWA 2IW6B 4F7JB 2W96A 4AKGA 4LOCA 1KXUA 3A8LB 4BY1X 1QMZB 4JX4A 5HBEB 3VYHB 1JSUB 1XO2A 4CFMB 4AKHA 4HNVA 2B9RA 2UZEB 4II5B
chains in the Genus database with same CATH topology
2LW4A 3NDQA 4BXXX 2DMEA 4BY7X 4BY1X 1ENWA 3GTMS 3PO3S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW4 A;  3NDQ A;  4BXX X;  2DME A;  4BY7 X;  4BY1 X;  1ENW A;  3GTM S;  3PO3 S; 
#chains in the Genus database with same CATH topology
 4OR5 B;  4Y72 B;  2PMI B;  3TW7 A;  4F6W B;  3HB9 A;  2DPP B;  3BG5 A;  2UZL B;  5DQV A;  2DD5 B;  5HBH B;  2WHB B;  4BCM B;  3BG9 A;  3QYE A;  4EC9 B;  3DOG B;  2X1N B;  2C5O B;  3M03 A;  1H26 B;  2R7G A;  1OIU B;  4F6S B;  4JX6 A;  4F7N B;  2G9X B;  2PHG A;  2DD4 B;  1UNL D;  5IDN B;  3QWL A;  4F70 B;  3QYB A;  3DDQ B;  2QQ8 A;  3BLR B;  3KHI A;  5LQF B;  4BBS M;  5CEI B;  4MFE A;  4ELL A;  2PK2 A;  1TFB A;  4BCP B;  4HLQ A;  4BCG B;  4NST B;  3QYH B;  3PO3 S;  4IMY B;  5IHY A;  2DME A;  1VYW B;  4EC8 B;  2BS4 A;  4NC6 A;  3BG3 A;  2PK9 B;  2WXV B;  3K7A M;  2C4G B;  3TNH B;  3GTM S;  3A8M B;  2WIP B;  2KMG A;  1N4M A;  3DTO A;  4YOO A;  1GH6 B;  1UGR B;  2ZCF B;  2G77 A;  4MFD A;  2C6T B;  2ZPB B;  1AD6 A;  5LMK B;  4BY7 X;  5FGK B;  4G6L B;  1W98 B;  1C9B A;  4BCN B;  4OB1 B;  2QDY B;  1P5E B;  1AHJ B;  2CJM B;  2KR6 A;  1AIS B;  4CFX B;  5IDP B;  3BHV B;  2W9Z A;  2WJ9 A;  4Z6Y A;  2ZPI B;  4BCH B;  1H4L D;  4BCO B;  2CCI B;  3BLH B;  4EON B;  4KRD B;  3HO8 A;  2D0Q B;  2CCH B;  4OB2 B;  1GUX B;  4BCF B;  3TNW B;  1H1R B;  5HQ0 B;  1FVV B;  1ZP2 A;  2ZPF B;  5EJC A;  2WFY B;  1E7P A;  3QYG B;  4YC3 B;  5ICP B;  1UNH D;  2F2C A;  2UZB B;  4HNT A;  1H1P B;  3POM A;  4ELJ A;  5HNB B;  4BCK B;  2I40 B;  1H28 B;  2CYZ B;  4ROE A;  3A8H B;  2DXB B;  2WMA B;  3TNI B;  2QF7 A;  3BHU B;  4EOS B;  2WEV B;  1OI9 B;  2UUE B;  3BHT B;  3EJ1 B;  4BCI B;  4BCN D;  1OKW B;  5EFQ B;  1V29 B;  2QGS A;  2BPM B;  3HBL A;  5HVY B;  2AHJ B;  4BBR M;  2CZ0 B;  2W2H A;  3X24 B;  5IF1 B;  3VKH A;  4F7S B;  2ZPG B;  4AI6 A;  2ZPH B;  3DDP B;  1H1Q B;  1VOL A;  3HHT B;  3B57 A;  4JX5 A;  1UGS B;  4KRC B;  4I3Z B;  3EID B;  4ZGJ B;  2LW4 A;  4EOP B;  1G3N C;  2W9F A;  3QZ9 B;  3QZ5 B;  2CZ7 B;  2WPA B;  1OIY B;  1UGQ B;  4CFW B;  4EOM B;  3LQ5 B;  5HBJ B;  2WMB B;  2CZ1 B;  2C5X B;  4FX3 B;  4TTH A;  1PKD B;  3X26 B;  1O9K A;  1JST B;  1OL1 B;  4CFU B;  3RGF B;  1JKW A;  1F5Q B;  4EOI B;  3HZJ A;  3A8G B;  4EOK B;  4YOS A;  3O0G D;  3EOC B;  3NDQ A;  3BLQ B;  3MIA B;  1URC B;  2QFZ A;  4EOQ B;  4OB3 B;  4ROD A;  4BXX X;  1QLB A;  2ZZD B;  3DJB A;  4ROC A;  1BU2 A;  4CFV B;  5BNJ B;  5DQW A;  2C5V B;  3DL1 A;  1FIN B;  3X28 B;  2PJQ A;  3QHR B;  2BKZ B;  1FKM A;  4BCJ B;  1E9H B;  4CFN B;  3TW6 A;  2WIH B;  2QDJ A;  4BCQ D;  1H24 B;  3QHW B;  4EOL B;  3F5X B;  4EOR B;  3VYG B;  1O9K B;  2C5N B;  2IVX A;  5I5Z B;  4CRL B;  4QSH A;  4CFU D;  1ENW A;  4AKI A;  3MI9 B;  1TD6 A;  3TN8 B;  4ZGE B;  1UNG D;  2I53 A;  2ZPE B;  2BS2 A;  5CYI B;  3WVD B;  4EOJ B;  1H27 B;  2EUF A;  3H4C A;  1GUX A;  3WVE B;  3QXE B;  4OGR B;  4YOZ A;  4MIM A;  1UGP B;  4M6V A;  2CZ6 B;  4FM4 B;  2IN3 A;  1IRE B;  4ZGD B;  3MY5 B;  1OKV B;  4CXA B;  1VIN A;  5L2W B;  3X20 B;  2V22 B;  3X25 B;  2DXC B;  1H1S B;  1D3U B;  4UN0 A;  2IW8 B;  4BCQ B;  1OGU B;  1H25 B;  2UZD B;  1GY3 B;  3G33 B;  4BCM D;  3A8O B;  5ACB A;  2W99 A;  4OB0 B;  1OL2 B;  4F6U B;  2IW9 B;  4HL4 A;  3VKG A;  4EOO B;  3MY1 B;  4F7L B;  2JGZ B;  4HNU A;  2BS3 A;  1JOW A;  2IW6 B;  4F7J B;  2W96 A;  4AKG A;  4LOC A;  1KXU A;  3A8L B;  4BY1 X;  1QMZ B;  4JX4 A;  5HBE B;  3VYH B;  1JSU B;  1XO2 A;  4CFM B;  4AKH A;  4HNV A;  2B9R A;  2UZE B;  4II5 B; 
#chains in the Genus database with same CATH homology
 2LW4 A;  3NDQ A;  4BXX X;  2DME A;  4BY7 X;  4BY1 X;  1ENW A;  3GTM S;  3PO3 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...