1EO6A

Crystal structure of gate-16
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GOLGI-ASSOCIATED ATPASE ENHANCER OF 16 KD
publication title Structure of GATE-16, membrane transport modulator and mammalian ortholog of autophagocytosis factor Aut7p.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 35
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1eo6A00
4B6WA 5IAAC 2J0MA 3WANA 1A5RA 4ICVA 1YIWA 3DPDA 3JYUA 1JRUA 2KLCA 3T8MA 2BKFA 2CHWA 3V60A 4DK5A 1IP9A 4BVUC 2JRHA 2CU1A 4WQOB 4M8NA 5DPRA 4MJSB 2FCMA 4II3B 3AI5A 1Z2MA 4W9CA 2LUEA 2QHOA 3SDLC 1OGWA 2D10A 4DHZE 3M3JA 3UQBA 2DYOA 3VXWA 2LZ6A 3NS8A 2N9XA 1SGHA 2GBNA 2O2VB 3QARA 4A20A 1ZGUB 1EO6A 4LJOB 4MSQB 1QZEA 3UINB 2IYDB 2IBIB 2C7MB 2G3QB 3JVZX 5DCNA 4KVGB 2KHWB 3L16A 2KO3A 4W9HA 1Z5SB 2HD5B 3CF6E 5CTRC 2CS4A 2AWTA 1V5TA 1LM8B 4TV3A 2KFJA 1E8YA 3B08A 3C0RB 2ZCBA 1XD3B 2KDBA 1XT9B 1WFYA 3EFUA 1C1YB 4IM2A 2RPQA 4BKSA 3NZUA 2KOXA 3RYTA 4A3PA 2KJRA 1LXDA 3A9KB 3WA0A 1KM7A 4XC2A 3VDZA 4J6IA 3PHWB 5LLIA 1GC7A 4FN2A 3T9LA 3ZIMA 3A9KA 2M0XA 2HJ8A 2MSED 2NR2A 3DDCB 3ML9A 2WYQA 3I3TB 3M95A 3NOBA 3ZTCA 5E6NA 4ICUA 2UYZB 2KN5A 1WJ4A 2RSUA 1P9DU 4IG7B 3DCGA 4LDTB 4KZ0A 2BYFA 3APDA 3VUXA 4IWOA 2KJ6A 4GDLB 1WX9A 2KQSA 3TBLD 3L10B 3PZDA 3QIJA 4DHZB 5IA7A 2KWCA 2JT4B 2N9EB 4GDLA 2BKRB 3APCA 3ZNGC 3VUYA 3HM6X 3H9DA 1C3TA 1J8CA 2G45B 2LGDA 2IO2B 1WX7A 4W9LA 5JZEB 2D11A 4OVUA 2K8BA 2PPHA 1RFAA 2KQ7A 2ZCCA 4HVBA 1D3ZA 2JUOA 4GN1A 3IFWB 2MBHA 2ZPNA 4HPLB 4MGIE 5CHWA 2NBWB 2B3AA 4K7UA 1X1MA 2LRUA 2BYVE 2C60A 3B0AA 4ASWC 3ALBA 4WAAA 4NAWA 3ZRCA 3VVWB 1S1QB 4EOYA 1HE8A 2WX0A 4ZRIA 2DZIA 2LJ5A 2M17A 3OJ4B 3U8ZA 3VTUA 5LXHA 1Y8RC 4JGHB 1WXMA 4F7ZA 4IC7B 4B95A 3NHEB 4DHJB 3RUIB 5L83A 2M8SA 2K6QA 2R2QA 2XBBC 3DBRI 2MA9B 3SHQA 1EUVB 2L3ZA 2KK8A 1V80A 3X23A 3LJ3A 5C23A 3HIZA 1NI2A 1SE9A 3ONSA 4KDLB 4ZRJA 3QX1A 3ZNID 2MX2A 1V5OA 1WH3A 1WYWB 1WF9A 4AP4C 2KMAA 4YL8A 3H6NA 1KJTA 4DBGA 3WAOA 4FHKA 2KJHB 2NS5A 2N1VA 4IWPA 3N3KB 2N4FA 2DENB 2FCNA 3KUZA 1LQBA 5G2NA 4F8CB 2LVQA 2ZVNA 4A3OA 3EHVA 3PPAA 4GB9A 3VH3B 4BBNF 3BY4B 3V6EB 1WGRA 2V1YA 2JPHA 1K8RB 2KDEB 2R2OA 3HHMA 3QAQA 3RCZA 3N32A 1TBEA 2PE6B 4FBJB 2MLBA 4GXBA 3ZO5B 1WR6E 2OOBB 3DOWA 4URKA 3RZFA 3WAMA 3MJWA 2KX3A 2FUHB 3KUCB 1S3SG 3AXCA 3QQ8B 1WZ3A 2LWPA 2HTHA 1WX8A 3PRZA 3S2AA 4TKNA 1V86A 1E7UA 3PHXB 2L00B 1WRDB 1V81A 5D6JB 3AULA 2AEHA 2G4SA 3Q3JA 2JRIB 4EZLA 4I6PA 4W9JA 5D2MB 5TR5A 3ZDTA 3ZNZB 2N7EA 2I1KA 2XK5B 4KSLC 2LXCA 4EUTA 4WWOA 4GGQA 2O6VB 2XK5A 1I35A 4N9F4 4I6NB 1ISNA 1WMHB 2O6VA 4RMAA 1WMHA 4WWNA 5KHOA 2IY0B 2K8CA 4HDQA 2GMIC 4MGKE 3RD2A 4IM0A 2FNJB 2LVPA 5LXIB 4BKSD 3DVNV 3ZTDA 2OJRA 5CHVC 1ZW7A 2KX0A 2IO1B 2M1MA 1P0RA 4W9IA 3ZNHB 2KWVB 3R66C 1FXTB 3VHTC 1WGDA 1UGMA 3QK0A 1E90A 2RD0A 2CKHB 3QCAA 1AARA 4PYUA 2MWSB 2KD0A 2J7QB 1WM3A 1YD8U 3PS6A 1Q0WB 2K39A 3AU5A 3DVGX 3KUDB 3VFKA 1UZXB 1F9JA 5AZFA 2GBKA 4MGYE 4ANWA 2MBQA 4G50A 3VH4B 1L7YA 2G4DB 4LDTD 3ZLZA 2KVRA 4HDOA 2K25A 4WJNA 3V62A 1GG3A 2N9PC 4EFOA 4KDIC 3OLMD 4KIKA 4FADA 2BWES 2M4NA 2ZZPB 3PTFC 4HJKA 4ANVA 2NBUA 2KC1A 2C7HA 2L76A 3DVNU 3PLVA 1H4RA 1WJ6A 4BKTA 4DDID 1UELA 2XEWA 1P98A 2PEAA 1E8WA 2JZ3B 4BBNC 1VD2A 2KLGA 4KSKC 4HPMB 2RR9A 2MP2B 4NQKE 4XZ4A 2K1FA 2JVCA 1R4MI 3UF8A 1GUAB 4NAWB 2PE9A 2Z59B 2MP2A 4PS7A 4E3CA 4EZJA 4K81A 2BGFA 2DAFA 2KDIA 4BOZB 1WZ0A 1RAXA 4MH0E 4MEMA 1UBQA 2DAJA 3VTVA 4EZKA 5L95C 1OQYA 4TQ0A 4ZDVA 2MRPA 3L13A 3NY5A 4K1RB 3VUWA 4ANXA 4F1SA 1J19A 1YX5B 1OTRB 3A1QB 1I42A 3WAPA 4DHJD 2ZVOA 1UH6A 4M0WB 2LI5A 3U30A 2KFKA 3PGEA 3A1QA 4G11A 2FIDA 1V49A 3HK0A 2GBMA 5C1ZA 1V9JA 4EEWA 2MBEA 3BINA 3DBHI 5DPTA 2DX5B 1P3QU 1WXVA 2KTFA 2NPTB 2D2QA 2MBBB 3PREA 3JW0X 1WI0A 2NPTA 5GMVA 2DYMA 4CHKA 2KANA 1IYFA 3TIXA 3ECIA 4DDGD 4G3XB 3ENEA 2CHXA 1Q1OA 5JH5C 2MQJA 1Q5WB 4GOCA 2HE7A 2NBVB 3IG3A 1TGZB 3GZNI 4ZRKA 4HCNB 2AL3A 2MBOA 3L0WB 3WALA 5KHQA 1U4AA 2BYEA 1WJNA 2DZJA 3B1LX 2L8JA 1OEYJ 2ZNVC 3ML8A 4G0NB 5FR6A 3V6CB 2AL6A 1BT0A 5AZGA 4GMVA 2NCNA 4X57B 4OVVA 3TJPA 2ASQA 3APFA 5AEKB 4WJOA 3H7SA 3ZW3A 3L17A 1WR1A 4NY0A 2FAZA 1E8ZA 2FCSA 3MHSD 4XX5A 3KYDD 3UIOB 3H7PB 3ZKJC 1YJ1A 3DQVA 4W9DA 4FA6A 1TZ1A 3PV1A 2K6DB 1CMXB 2D3GA 3H7PA 3QC8B 4II2B 1E8XA 3TL5A 5JHAA 3DVGY 3K9OB 1WXAA 3TCAA 3UGBB 2WDTB 1WGYA 3A4RA 3L54A 2I1JA 2IZVB 2EMTA 5HKHA 4JIOU 2FCQA 4HLEA 2CR5A 4NJ6A 1YQBA 4TUUA 2GOWA 4PYZA 2V3SA 1V2YA 2AYOB 4HXDA 1TTNA 1WY8A 3LDZE 4BKGA 2O6VD 1WIAA 2IO0B 4LJPB 1G6JA 2ZNVB 2LVOA 3ZVVA 4RM9A 1IPGA 3CMMB 4KZCA 5E6PA 1VCBA 1NBFC 4ZYNA 4IM3A 3N30A 3RT3B 2UWQA 4AUQC 4MSMB 2MW5A 4PS3A 3SU8X 1E5WA 2K8HA 4W9EA 2IO3B 2ZEQA 1WM2A 3U7DA 3A9JB 3VAWA 4K7SA 3QHTA 2KKCA 3R3MA 1WXSA 4MJSA 2YVCA 3L08A 1L2NA 2REXA 1GC6A 3A9JA 1V6EA 5BO4B 5J17A 4FJYA 4MGZE 2O2VA 3R7QA 2BF8B 4LCDE 3EECA 3Q3FA 2GBJA 1T0YA 4BOSC 4DWFA 2NVUI 2L0TA 3RULA 4KIKB 4AJYB 1UD7A 3W1SC 4JQWC 1WE7A 2LRWA 2ZJDA 3PVLA 4B9KA 3PSEB 3KW5B 3R7RA 4BFRA 4AOFA 2RGFA 3SD5A 4W9KA 5E6OA 4FJZA 3KH0A 4NNJB 4JL9A 3OAWA 4AJWA 2V4LA 3RZWC 2J0JA 2LGYA 2WX1A 2VRRB 1WJUA 4HCPB 4IUMB 1H8CA 1SIFA 5CHFA 2LXAA 4K7WA 3IHPC 4ANUA 4JLCA 4I6LB 4MELA 4MDKE 4NPNA 1GJZA 4W9FA 4HWIB 2C5LC 2Z0EB 1R4NI 4IW0A 2A5UA 1XQQA 2CHZA 3P2BA 2BWFA 3EC8A 4TQ1A 1J0GA 3OJ3A 3DBSA 2J0KA 2EKEC 3HM3A 4WJPA 3VQIA 2KFKB 4FJVB 2YLMA 1OEYA 1PQSA 3KYCD 3W1SA 1RRBA 2JY6A 1WGGA 2KNBA 4FHJA 2DZKA 1MG8A 1E7VA 2JWZA 2KWUB 2KTRB 3W1YA 3WIMA 3QJZA 3PT2B 4DXAB 3KVFB 4IWQA 2FIFA 2KTRA 3PLUA 4WJQA 4PS8A 3D32A 3X0WA 4NQLB 1WE6A 2L0FA 3DBLI 2EMSA 2ZPYA 1M94A 3A33B 2Y5BB 2LASA 3H1UA 3IBEA 3MTNB 4FLHA 4MM3A 1YX6B 5D94A 4HK2A 5J18A 2C7NB 1UBIA 3PRMB 2JZZA 3QWZB 5G55A 4AWJA 4CYEA 5DPWA 1P1AA 2DHZA 3PRPB 2KXJA 2N1WA 4FULA 1WGHA 4W9GA 3K9PB 2LD9A 5D7GA 4P7IA 5AZHA 4M8MA 3UQAA 3QA8A 1GNUA 2KZRA 1LFDA 2A4ZA 1EF5A 2GBRA 3GOEA 3ZDMC 2IY1B 1ZKHA 4GIVA 5EDSA 3TMPB 4EKUA 2WWZA 3ZUNA 2KC2A 5CX3A 1RLFA 4GU2A 3ZRFA 2JF5A 1KOTA 4WWPA 4NJ7A 2D07B 2DZMA 1EF1A 4E74A 4E71A 2BPSA 1KLVA 3CSTA 4GDKB 3VTWA 1NDDA 2PJHA 3A4SC 3CSFA 2LGXA 4GDKA 2JXXA 2KMCA 3AU4A 4GSWA 2KDFB 5DPSA 3M63B 2C9WB 4CO7A 2W9NA 3JSVB 3O65B 2Z0DB 3UIPB 3NZSA 2L05A 3IVFA 3JSVA 2DYBA 2N7DA 5JHBA 4RM8A 3V61A 2L7RA 3M62B 4KV2A 5J2RA 2MCNB
chains in the Genus database with same CATH superfamily
4B6WA 2BTEA 2J0MA 3MP9A 3BVMA 3DPDA 3ZJTA 1F1HA 2KLCA 2CHWA 1VJKA 1VZ6A 4BVUC 1NI3A 1QKZA 4EE2A 3P1MA 3AI5A 2LUEA 3AEAB 1OGWA 1JRPA 3BK1A 3UQBA 2LZ6A 2N9XA 1MVKA 2GBNA 3UINB 2IYDB 3Q3OC 2C7MB 3L16A 3P4SB 4W9HA 2CS4A 1V5TA 1PGXA 2FE8A 1LM8B 2JQRB 3N20C 4TV3A 2ZCBA 1XD3B 3AE8B 1XT9B 1WFYA 4XE0A 2RPQA 3C8YA 1LXDA 1KM7A 3PZ7A 2HJ8A 1TS3A 4ICUA 1WJ4A 1KLGD 2Y5CA 1DOIA 3APDA 3Q6BA 3TBLD 2E3TA 3L10B 4IOIE 5IA7A 2WU5B 3AN1A 2BKRB 2YEPF 3ZNGC 2J42A 3H9DA 2WXRA 1UWXA 2IO2B 2D11A 2PPHA 2EKIA 1D3ZA 1I7HA 4HPLB 4UDUC 5CHWA 2NBWB 2B3AA 1AN8A 2OEDA 2LRUA 3ALBA 4WAAA 4NAWA 1NVID 1Y8RC 4C80A 4RF0A 2K6QA 3RPFC 2MA9B 4KX6B 1DGJA 1L6UA 1YMHE 2M0AA 4ZRJA 1SE3A 4AP4C 4YL8A 4DBGA 4ACFA 2WS3B 2N1VA 1D5ZC 2DENB 5GXGB 5G2NA 2Z8LA 2LVQA 3LYYA 4LNKA 3EHVA 1WGRA 1JMLA 2V1YA 1ZE3D 4M01A 2R2OA 5EE9A 1XF5L 3N32A 4FBJB 4GXBA 4US9A 1WR6E 2KX3A 1FIQA 1ZDXA 3PRZA 4TKNA 3PO0A 1E7UA 3VRAB 1MI0A 3AULA 5D6JB 2AEHA 4EZLA 5TR5A 3ZDTA 3VRBB 4KSLC 4BAXA 1WWTA 2WXHA 3NVVA 1K52A 4TMAB 3W5UB 3RD2A 1IUEA 2IJ0A 4NAMA 4A55A 4C7YA 4BKSD 5CHVC 1P0RA 2VZKD 1UUPA 2IPKD 2D3AA 2KWVB 4XWTA 2V0GA 3VHTC 1WGDA 5AUKA 4R3DA 3B2GA 1E90A 2RD0A 2CKHB 1SJED 2J7QB 1Q0WB 4LNFA 3DVGX 2WXQA 3AM9A 4MGYE 4ANWA 4G50A 4HDOA 2K25A 2RMMA 1L5PA 2CU3A 4ANVA 2NBUA 2C7HA 4ITKA 3AV8A 1P7FA 1WJ6A 4BKTA 1P98A 1E8WA 2WXJA 4NQKE 1E6EB 3DWGC 4P1CC 4NAWB 2MP2A 1RM6C 2J4XA 3HVDA 1T6BX 1YJJA 5L95C 4P16A 3DHHC 2MRPA 3VUWA 4F1SA 4ANXA 1YX5B 4YSZB 1WRIA 3WAPA 4DHJD 1LO5D 2ON8A 4M0WA 3AE5B 1JALA 2L1AA 3DBHI 1C78A 2AX5A 1FNWA 1N6ZA 1FCLA 3ECIA 2K0PA 2CHXA 1KTKA 4GOCA 3IG3A 1TGZB 3GZNI 2UU7A 3KWVA 3N1YC 4G0NB 1NYQA 2AL6A 5AZGA 5BYRA 4OZBA 4WJOA 3H7SA 3ZW3A 3L17A 4NY0A 1DOXA 2ZW1A 3MHSD 3ZKJC 4W9DA 3PV1A 1XXGA 1CMXB 2D3GA 1E8XA 1WXAA 3A4RA 3L54A 2I1JA 4HKQA 1WXQA 3V05A 1V2YA 2AYOB 4WH4A 1Q10A 1WY8A 3HUIA 3LDZE 2O6VD 1WIAA 2IO0B 2WDVB 1K51A 2LVOA 4KZCA 1CK1A 4QAYA 3SEBA 1I4GA 3N30A 1ZP0B 3KQ4A 3T3NA 2MW5A 1EWCA 1L4ZB 3DBLB 2BB5A 4W9EA 3VAWA 4MJSA 2REXA 1GC6A 2W82A 3A9JA 5J17A 2O2VA 3U7ZA 4LCDE 3GZNB 1HZ5A 4AJYB 1UD7A 3W1SC 1UWMA 4JQWC 1JWAD 4BFRA 1T0RC 2MJ3A 3RZWC 1SE2A 2WX1A 4RGMA 4IKGA 4HCPB 4IUMB 3BK2A 1H8CA 2LXAA 1UGJA 2ICIA 5EE3A 3FKYA 4JLCA 4W9FA 3L4PA 2Z0EB 4MACA 1R4NI 1E0ZA 1QOGA 2INNE 3OJ3A 2J0KA 1V97A 4LNOA 1RRBA 4HKZE 4FHJA 2L52A 4XWWA 1E7VA 2KWUB 2KTRB 3KVFB 4IWQA 3PLUA 1WE6A 4C56C 2JYTA 1M94A 4FLHA 4MM3A 2L83A 4HK2A 2JZZA 5D3IB 5G55A 3IAM1 1PFDA 2WXGA 2DHZA 2N1WA 5D7GA 1EF5A 2MJEA 2I2YA 1UF0A 1L0XB 3ZDMC 1FRDA 1ZKHA 4EKUA 2IGDA 2CJNA 5CX3A 3MFGA 2W3RA 2PMVA 4GU2A 1EF1A 3U2SC 2XNAC 3CSTA 3ZGZA 4WQMA 3PZ8A 2X38A 2JXXA 4GDKA 1N5XA 3JSVB 2MEKA 1FCCC 1R4NB 1QOFA 2K22A 3IVFA 1ET9A 1F2RI 3CWIA 2N7DA 4C4VB 3TEYA 4RM8A 4ZHPA 4KV2A 2MCNB 1OQRA 1RWSA 3WANA 1A5RA 2N0SB 3T8MA 3V60A 4DXFA 3Q8CA 4WQOB 2INDC 4MJSB 3HRDD 2FCMA 2FBWB 4II3B 2QHOA 3SDLC 4DHZE 2D10A 2DYOA 3E9SA 3NS8A 3VXWA 2O2VB 2GB1A 3RNGC 4MSQB 4LJOB 3Q2AC 2IBIB 2G3QB 5DCNA 4KVGB 5CTRC 2WHIA 5FK9C 2KFJA 1E8YA 1JWBD 1F2RC 2KDBA 2VZKB 4YWGG 2KOXA 3SFDB 2AQ2B 1TY0A 4A3PA 2KJRA 4XC2A 4J6IA 3PHWB 5LLIA 2M0XA 2G9HD 2MSED 4S17A 2GRIA 3ML9A 3NOBA 4LLGM 3AH7A 2RSUA 4KZ0A 2V4IB 4YTMB 2RDBC 4IWOA 4DHZB 4XDCA 2G45B 3AE1B 1AW7A 1ROEA 4W9LA 4AS1A 4N6EB 1RFAA 2KQ7A 4L23A 4JPSA 3IFWB 1SIJA 1NEKB 2HDEA 3MHZA 4LK0M 2BYVE 2JX5A 3O13A 3Q3MC 4DXGA 2BT6A 1S1QB 1HE8A 2WX0A 3RNAC 2DZIA 3OJ4B 1WXMA 3Q14C 4DHJB 3RUIB 2M8SA 3DBRI 4ZHOA 1NI2A 1SE9A 2DNFA 4ZYSA 3QX1A 3ZNID 2MX2A 1EM7A 1WF9A 4B0MA 3H6NA 1KJTA 1FFVA 1ZXIA 3KWLA 3WAOA 1T0QC 2KJHB 3IAS1 3N3KB 5HHDG 2WDRB 2PTLA 2FCNA 4A3OA 3BY4B 1GB4A 3QAQA 4B0EA 2PE6B 3BWUD 1PGBA 4YSYB 3MJWA 2FUHB 3IT4B 3ETRA 2LWPA 3NVZA 1V86A 1HA5A 5FR3A 2G4SA 3Q3JA 4W9JA 1MJDA 2XK5B 2LXCA 4WWOA 4GGQA 2O6VB 1I35A 3MC0B 1WMHB 1GB1A 3I57A 2QEJC 3I5JC 3DBRB 2DLBA 4HDQA 2HJ1A 3B9JA 2QDFA 4IM0A 2FNJB 3ZNHB 2OJRA 1ZW7A 2M1MA 1FXTB 2K3UA 1UGMA 2WLBA 3QK0A 3QCAA 2KN4A 3VR9B 2G1EA 3KUDB 1XCQL 1UZXB 1F9JA 2MBQA 3ZLZA 1VZ8A 2KVRA 3RI7C 2N9PC 4KDIC 2BWES 3PTFC 3UI3A 2KYWA 3PLVA 2KDMA 4J3OD 2XEWA 4BBNC 1K50A 1VD2A 3RNEC 4KSKC 2RR9A 3BVZA 5G5GA 2R61A 2K1FA 1R4MI 1HXYD 2Z59B 4K81A 2BGFA 2DAFA 2KDIA 1RAXA 4MH0E 3VTVA 1GOZA 2BBCA 5TSSA 1V1PB 1OQYA 2DBYA 4TQ0A 3BVGA 1J19A 4RF1A 1I42A 1UH6A 4ARCA 1RFKA 2KFKA 3PGEA 4LTUA 2FIDA 2GBMA 1V9JA 4EEWA 5DPTA 1P3QU 1WXVA 2KTFA 2NPTB 2D2QA 3JW0X 3TEWA 2DYMA 4G3XB 2D3BA 1Q1OA 1Q5WB 1WGKA 4HJGE 2NBVB 4HCNB 1MHXA 2AL3A 3L0WB 3WALA 5KHQA 2L8JA 2ZNVC 4GMVA 4X57B 4OVVA 3APFA 3RNBC 2LEKA 1WR1A 3Q3NC 1E8ZA 2FCSA 3UIOB 4XDDA 3H7PB 3EGRA 3LXFA 4FA6A 3QC8B 2WXMA 4YT0B 3K9OB 3UGBB 2WDTB 1R4MB 2CR5A 4TUUA 3NJTA 1TKGA 4BKGA 4KGRA 1XLOA 4OVZA 1G6JA 2ZNVB 3ZVVA 4C7ZA 3GS2A 3AB5A 4ZYNA 4IM3A 2LUMA 2V9HA 3FAHA 1QOAA 1TS4A 1C79A 2UWQA 3AEFB 3AE7B 1KFYB 4K7SA 5IN7A 1FEHA 3J9CA 3AMZA 1L0YB 3DHGC 3OWEB 1DYQA 1JQ4A 2BF8B 3EECA 2GBJA 1FPYA 4YXDB 2L0TA 3P63A 2LRWA 1VRAB 1VDVA 2ZJDA 2KAJA 2NTSA 3SD5A 4W9KA 5E6OA 2JU6X 4FJZA 3KH0A 4AJWA 2V4LA 2J0JA 5AUIA 1WJUA 3MC9A 1SIFA 5CHFA 2PIAA 5C2TB 1XLPA 4MDKE 1STEA 4NPNA 4HWIB 4HROA 3RNCC 1XLQA 2BWFA 3DBSA 2KFKB 4FJVB 1K53A 3W1SA 1WGGA 4LNIA 2DZKA 4USAA 2JWZA 1ET6A 3WIMA 3QJZA 4JWUC 2BVCA 1J7AA 4XGAB 4DXAB 4P1BC 2GI9A 2KTRA 3D32A 3DBLI 2Y5BB 2DWQA 2WU2B 5J18A 3QWZB 2H89B 5DPWA 4FULA 2LHDA 1WGHA 1HTOA 3K9PB 2LD9A 1TZOA 3UQAA 1GNUA 2KZRA 2A4ZA 2GBRA 2Q5WD 3C19A 1FXIA 2W54A 3GOEA 4K3CA 4ZRQA 4GIVA 3TMPB 2WWZA 3ZUNA 1RLFA 3CIRB 4WWPA 4NJ7A 2DZMA 2OHFA 1V1OA 3RMKC 3VTWA 3A4SC 2LGXA 2KDFB 3TEXA 5DPSA 1IGCA 1XLNA 3KLSX 2C9WB 2E6XA 2W9NA 2Z0DB 3AE2B 3JSVA 2DYBA 1IGDA 4MT5A 2W55A 4C4VA 1CQVA 4ICVA 1HEZE 3JYUA 2H88B 4DQOC 2EELA 2JRHA 4OW0A 1Z2MA 2WXOA 1SGHA 3QARA 1ZGUB 1EO6A 1QZEA 1C76A 2PW9A 4WWMA 3NVWA 3CF6E 3AECB 1T0SC 3B08A 3C0RB 3EFUA 2X8XX 1ZDVA 4IM2A 2Y5PA 4BKSA 3NZUA 4P6VF 4CQNA 3RYTA 1DOYA 3A9KB 1KRHA 3VDZA 1GC7A 1JWSD 2NR2A 3I63C 2JSVX 2WYQA 3I3TB 2LGSA 3ZTCA 5E6NA 2UYZB 1P9DU 3ZXRA 2MH7A 3ZXVA 1UNSA 1YQ3B 4GDLB 1WX9A 3PZDA 3QIJA 2N9EB 1YN4A 4FXCA 3APCA 2WNMA 1C3TA 1WX7A 3TSSA 2K8BA 3BYTB 2JUOA 3URYA 1I4XA 1C4AA 2ZPNA 4K7UA 2ONQA 2C60A 3B0AA 4ASWC 1EU4A 4EOYA 1YQ4B 4ZRIA 3VTUA 4F7ZA 1SJHD 2Y3AA 4IC7B 2QILA 2R2QA 3SHQA 3TEZA 1EUVB 3R2TA 2KK8A 5C23A 3HIZA 4KDLB 3FILB 1WH3A 1HZ6A 2QC8A 1AYFA 2SAKA 4FHKA 2NS5A 4IWPA 3Q69A 3KUZA 1LQBA 3BYYB 4GB9A 3V6EB 4WURA 5IOIA 4ARIA 1K8RB 2KDEB 3N1XC 4A90A 3RCZA 1YN3A 1TBEA 2MLBA 4TSSA 3DOWA 4ZOHC 1ACCA 3WAMA 4URKA 1BMLC 1NENB 3MJ5A 3KUCB 1S3SG 3QQ8B 3W5VB 1WZ3A 1QF6A 2HTHA 1WX8A 3S2AA 1PUTA 3EA6A 1I4HA 3NUHB 1WRDB 3P4RB 4AQ7A 2JRIB 3GE3C 4I6PA 3P42A 5D2MB 3R8BA 2AQ1B 1E10A 3GP7A 2I1KA 4EUTA 2MHJA 2XK5A 1KF6B 4WAFA 4I6NB 2M19A 3N1ZC 2O6VA 4OHJA 4RMAA 1WMHA 4KGTA 2WQYB 5KHOA 2IY0B 2K8CA 2GMIC 4MGKE 3DWMA 2K9XA 3Q8AA 2LVPA 3HVZA 3MC8A 2BW2A 3DVNV 3FC4A 3ZTDA 2KX0A 3N9YC 3R66C 2KMMA 5BMHA 3LB8C 4PYUA 2KD0A 1QILA 1WM3A 2YEPB 2K39A 3SFEB 4Q2JA 2GBKA 3VH4B 1L7YA 4LDTD 4NZLB 4WJNA 1FXAA 3V62A 1GG3A 1TKYA 3OLMD 4FADA 2M4NA 1JCKB 3DVNU 4ZRPA 1UELA 3Q8EA 2PEAA 2JZ3B 4RGTA 3GB1A 4BZAA 1C4CA 2J52A 4PS7A 2PE9A 4EZJA 1WZ0A 1BXTA 1UBQA 2DAJA 4MEMA 4EZKA 2MJDA 2KACA 3H8HA 1ZPSA 4ZDVA 3RN9C 4K1RB 1V1PA 1YJIA 2ACZB 1N62A 3A1QB 2LI5A 3U30A 1V49A 4XYCA 3BINA 2KQ4X 2DX5B 1Y56A 1FRRA 2MBBB 2NPTA 2WXLA 1FFUA 2KANA 3TIXA 1E9MA 1TYGB 5JH5C 2MQJA 4MH8A 1SEBD 2W3SA 2JXTA 4ZRKA 2RPVA 2MBOA 2BYEA 2HTME 2DZJA 1L6VA 1OEYJ 1BT0A 1EU3A 3R2IA 2NCNA 5H8YE 3Q8BA 4K3BA 3IXSA 2FAZA 3KYDD 3DQVA 2K6DB 3H7PA 4II2B 1SSNA 3OG5A 1FD6A 1T3QA 5LNK1 2OJWA 1F77A 2IZVB 2EMTA 5HKHA 1SB3C 4JE3B 2LFIA 1YQBA 4PYZA 4HXDA 2WDQB 4D2KA 2XN9C 4JX1C 4HEA1 1LGRA 4LJPB 1IPGA 1VLBA 4JWSC 4A6QA 4AUQC 2QCZA 1N5WA 3NVYA 4PS3A 3SU8X 1E5WA 3U7DA 2ZEQA 1WM2A 3QHTA 4C00A 2KKCA 3R3MA 1WXSA 3L08A 1V6EA 1QOBA 5BO4B 2VH2A 3BIID 4MGZE 1CJEA 3R7QA 1TS5A 5EE1A 1T0YA 2NTTA 4DWFA 3U4EG 1WE7A 4B9KA 3PSEB 3NZ3A 3KW5B 1VR9A 4AOFA 2RGFA 2WXPA 1V8CA 4JL9A 5HFYA 3I9V1 1RYJA 3T3OA 1TKEA 2VRRB 1C77A 4IDIA 4K7WA 3IHPC 4MELA 2LHEA 3AEDB 3ZQ4A 4M00A 4IW0A 2A5UA 2CHZA 3P2BA 3HM3A 3VQIA 2WXNA 1OEYA 3KYCD 2JY6A 3B2FA 1MG8A 1JWMD 1QLBB 3PT2B 3GE8C 4NQLB 1JROA 2L0FA 2EMSA 2AQ3B 2ZPYA 1N61A 2N9KA 3A33B 3H1UA 1WSPA 1YX6B 5D94A 1UBIA 2PVGC 4KKJA 1IBXB 2PVOD 3PRMB 3V3XA 4AWJA 1P1AA 1JWUD 3NS1A 1C9FA 4P7IA 5AZHA 4M8MA 1B9RA 2N7JA 2JYEA 3ZYYX 2IY1B 4GLSC 4H2AA 1OFFA 2KC2A 3ZRFA 2D07B 4E74A 1L4DB 4E71A 5IO9A 2WXFA 1KLVA 1TJEA 2D5GA 1NDDA 3CSFA 2KMCA 3AU4A 3M63B 4CO7A 3O65B 3UIPB 5HI1A 4KGSA 1AWDA 2BYTA 4WIPA 1VZ7A 2BS3B 5JHBA 2WP9B 5J2RA 2BQQA 3M62B 1J7BA 4US8A 5IAAC 1YIWA 1JRUA 4HRSA 2RDGA 2BKFA 1MHHE 4DK5A 1IP9A 1E7PB 5JXVA 1FM0D 2CU1A 4M8NA 2JWUA 5DPRA 1L0VB 5MPOA 4W9CA 3M3JA 4A20A 4OZCA 2LJIA 3JVZX 1GPXA 2KHWB 4REZA 2KO3A 1Z5SB 2HD5B 2AWTA 4YSXB 1ENFA 1C1YB 1HTQA 4NJCA 3NG0A 3WA0A 4FN2A 1C4PA 4OZAA 3T9LA 2TSSA 3A9KA 3ZIMA 3DDCB 3M95A 2KN5A 4A8XC 4IG7B 3DCGA 4LDTB 1FO4A 2BYFA 3VUXA 2KJ6A 2KQSA 2FUG1 5IP4D 2KWCA 2JT4B 4GDLA 3VUYA 3HM6X 1J8CA 2LGDA 3EUB2 2V3NA 5JZEB 4OVUA 1MFWA 2ZCCA 2NMQA 4HVBA 3DHIC 4GN1A 2MBHA 4MGIE 4M02A 1D4BA 1X1MA 1N63A 4RFBA 1PDXA 2ZW0A 1PYWD 3ZRCA 3VVWB 2LJ5A 2M17A 3U8ZA 4PK1A 5LXHA 4JGHB 2VH1A 3RFZB 4B95A 3NHEB 2SEBD 5L83A 2XBBC 2QIEB 2L3ZA 3X23A 1V80A 3LJ3A 3ONSA 3AE6B 1V5OA 1WYWB 2KMAA 3FILA 1I4PA 1FNVA 1FMAD 2QMTA 3EFCA 2N4FA 2K5PA 2KWDA 2CJOA 4F8CB 2ZVNA 3PPAA 3VH3B 4BBNF 2JPHA 1SF0A 2JZPA 1F0ZA 3HHMA 2M56B 1WYGA 3ZO5B 2I38A 2OOBB 2BS2B 3RZFA 1TT5B 5I4DA 3AE4B 4RNAA 3AXCA 2IGHA 2IGGA 4YTPB 3PHXB 1YOVB 2L00B 1V81A 1HQRD 1P7EA 3ZNZB 1N60A 2N7EA 3AE9B 1MG4A 4N9F4 3E56A 1ISNA 1ZXHA 5HG2A 4WWNA 1XO3A 1QQRA 4RGNA 1TY2A 5C3JB 5LXIB 3DBHB 2KVZA 2IO1B 4W9IA 2N9LA 1B1ZA 1SXTA 1AARA 2MWSB 3VR8B 2WXKA 1YD8U 4LNNA 3PS6A 3AU5A 3VFKA 5AZFA 2G4DB 4N59A 4EFOA 4KIKA 4KKIA 2ZZPB 4HJKA 3NRZA 2KC1A 2L76A 3TUOA 1H4RA 4DDID 2KLGA 3W2DA 4HPMB 2MP2B 1ZUD2 4XZ4A 2JVCA 3UF8A 1GUAB 4E3CA 4BOZB 5EE0A 3ZJVA 1CZPA 5BYSA 3L13A 3NY5A 4PT5A 1OTRB 2ZVOA 3BZDB 4M0WB 3A1QA 4G11A 3HK0A 5C1ZA 2MBEA 1TS2A 3PREA 1WI0A 4RH6A 5GMVA 1XEEA 4CHKA 1IYFA 4DDGD 3Q8FA 3ENEA 1SE4A 2HE7A 1D5XC 1XCTL 5T8IA 1U4AA 1WJNA 1PGAA 1MPEA 2WGSA 5BMIA 3B1LX 5FR6A 1D6EC 3ML8A 3V6CB 5H92C 3TJPA 2ASQA 2BS4B 5AEKB 3RNFC 4XX5A 3ABVB 1I4RA 3IT6B 1YJ1A 1YNTE 1TZ1A 3TL5A 5JHAA 3DVGY 5BYQA 3TCAA 1WGYA 2QJLA 2RDHA 4JIOU 2FCQA 4HLEA 4NJ6A 2GOWA 2PKOA 2V3SA 1A70A 2WXIA 3AE3B 1TTNA 2V3PA 2BB6A 1R7SA 4RGOS 4RM9A 1OQQA 3CMMB 1ESFA 2LMCA 5E6PA 1VCBA 2QSDA 1NBFC 3RT3B 5D3DA 4MSMB 3W9CB 1BUIC 2K8HA 2IO3B 3A9JB 1KLUD 1QT9A 2YVCA 4L2YA 1L2NA 3ZJUA 4FJYA 1T5XD 1TIFA 3Q3FA 4BOSC 1F52A 2NVUI 4HPPA 3RULA 3SR6A 4KIKB 3PVLA 5FKAC 3R7RA 2KT7A 2GLSA 4NNJB 3OAWA 3AEEB 2LGYA 2B76B 1J7CA 4ANUA 4I6LB 1GJZA 2C5LC 1KH0A 2D3CA 5E6JA 1XQQA 1J0GA 3EC8A 4TQ1A 2INCC 2EKEC 4WJPA 5BMGA 4O1NA 2YLMA 1PQSA 2KNBA 2PLPA 5G5HA 1JW9D 3W1YA 2FIFA 4WJQA 3X0WA 4PS8A 4MM3B 2LASA 3IBEA 3MTNB 1NYRA 2C7NB 4CYEA 1IBXA 3PRPB 4N58A 2KXJA 4RCOA 4L1BA 1EWYC 3AEBB 4W9GA 1ZOYB 2IDYA 3P4QB 3QA8A 4S0RA 4A9AA 1LFDA 1I4QA 1SBBB 5EDSA 1GAQB 2JF5A 1M4VA 1KOTA 1FNUA 2BPSA 1D5MC 4GDKB 2PJHA 3P4PB 1YN5A 3AEGB 4GSWA 3WCQA 2L32A 4YTNB 3NZSA 2L05A 5IKCM 3U52E 2LGIA 2INPE 3V61A 2L7RA 2J53A
chains in the Genus database with same CATH topology
4B6WA 5IAAC 2J0MA 3WANA 1A5RA 4ICVA 1YIWA 3DPDA 3JYUA 1JRUA 2KLCA 3T8MA 2BKFA 2CHWA 3V60A 4DK5A 1IP9A 4BVUC 2JRHA 2CU1A 4WQOB 4M8NA 5DPRA 4MJSB 2FCMA 4II3B 3AI5A 1Z2MA 4W9CA 2LUEA 2QHOA 3SDLC 1OGWA 2D10A 4DHZE 3M3JA 3UQBA 2DYOA 3VXWA 2LZ6A 3NS8A 2N9XA 1SGHA 2GBNA 2O2VB 3QARA 4A20A 1ZGUB 1EO6A 4LJOB 4MSQB 1QZEA 3UINB 2IYDB 2IBIB 2C7MB 2G3QB 3JVZX 5DCNA 4KVGB 2KHWB 3L16A 2KO3A 4W9HA 1Z5SB 2HD5B 3CF6E 5CTRC 2CS4A 2AWTA 1V5TA 1LM8B 4TV3A 2KFJA 1E8YA 3B08A 3C0RB 2ZCBA 1XD3B 2KDBA 1XT9B 1WFYA 3EFUA 1C1YB 4IM2A 2RPQA 4BKSA 3NZUA 2KOXA 3RYTA 4A3PA 2KJRA 1LXDA 3A9KB 3WA0A 1KM7A 4XC2A 3VDZA 4J6IA 3PHWB 5LLIA 1GC7A 4FN2A 3T9LA 3ZIMA 3A9KA 2M0XA 2HJ8A 2MSED 2NR2A 3DDCB 3ML9A 2WYQA 3I3TB 3M95A 3NOBA 3ZTCA 5E6NA 4ICUA 2UYZB 2KN5A 1WJ4A 2RSUA 1P9DU 4IG7B 3DCGA 4LDTB 4KZ0A 2BYFA 3APDA 3VUXA 4IWOA 2KJ6A 4GDLB 1WX9A 2KQSA 3TBLD 3L10B 3PZDA 3QIJA 4DHZB 5IA7A 2KWCA 2JT4B 2N9EB 4GDLA 2BKRB 3APCA 3ZNGC 3VUYA 3HM6X 3H9DA 1C3TA 1J8CA 2G45B 2LGDA 2IO2B 1WX7A 4W9LA 5JZEB 2D11A 4OVUA 2K8BA 2PPHA 1RFAA 2KQ7A 2ZCCA 4HVBA 1D3ZA 2JUOA 4GN1A 3IFWB 2MBHA 2ZPNA 4HPLB 4MGIE 5CHWA 2NBWB 2B3AA 4K7UA 1X1MA 2LRUA 2BYVE 2C60A 3B0AA 4ASWC 3ALBA 4WAAA 4NAWA 3ZRCA 3VVWB 1S1QB 4EOYA 1HE8A 2WX0A 4ZRIA 2DZIA 2LJ5A 2M17A 3OJ4B 3U8ZA 3VTUA 5LXHA 1Y8RC 4JGHB 1WXMA 4F7ZA 4IC7B 4B95A 3NHEB 4DHJB 3RUIB 5L83A 2M8SA 2K6QA 2R2QA 2XBBC 3DBRI 2MA9B 3SHQA 1EUVB 2L3ZA 2KK8A 1V80A 3X23A 3LJ3A 5C23A 3HIZA 1NI2A 1SE9A 3ONSA 4KDLB 4ZRJA 3QX1A 3ZNID 2MX2A 1V5OA 1WH3A 1WYWB 1WF9A 4AP4C 2KMAA 4YL8A 3H6NA 1KJTA 4DBGA 3WAOA 4FHKA 2KJHB 2NS5A 2N1VA 4IWPA 3N3KB 2N4FA 2DENB 2FCNA 3KUZA 1LQBA 5G2NA 4F8CB 2LVQA 2ZVNA 4A3OA 3EHVA 3PPAA 4GB9A 3VH3B 4BBNF 3BY4B 3V6EB 1WGRA 2V1YA 2JPHA 1K8RB 2KDEB 2R2OA 3HHMA 3QAQA 3RCZA 3N32A 1TBEA 2PE6B 4FBJB 2MLBA 4GXBA 3ZO5B 1WR6E 2OOBB 3DOWA 4URKA 3RZFA 3WAMA 3MJWA 2KX3A 2FUHB 3KUCB 1S3SG 3AXCA 3QQ8B 1WZ3A 2LWPA 2HTHA 1WX8A 3PRZA 3S2AA 4TKNA 1V86A 1E7UA 3PHXB 2L00B 1WRDB 1V81A 5D6JB 3AULA 2AEHA 2G4SA 3Q3JA 2JRIB 4EZLA 4I6PA 4W9JA 5D2MB 5TR5A 3ZDTA 3ZNZB 2N7EA 2I1KA 2XK5B 4KSLC 2LXCA 4EUTA 4WWOA 4GGQA 2O6VB 2XK5A 1I35A 4N9F4 4I6NB 1ISNA 1WMHB 2O6VA 4RMAA 1WMHA 4WWNA 5KHOA 2IY0B 2K8CA 4HDQA 2GMIC 4MGKE 3RD2A 4IM0A 2FNJB 2LVPA 5LXIB 4BKSD 3DVNV 3ZTDA 2OJRA 5CHVC 1ZW7A 2KX0A 2IO1B 2M1MA 1P0RA 4W9IA 3ZNHB 2KWVB 3R66C 1FXTB 3VHTC 1WGDA 1UGMA 3QK0A 1E90A 2RD0A 2CKHB 3QCAA 1AARA 4PYUA 2MWSB 2KD0A 2J7QB 1WM3A 1YD8U 3PS6A 1Q0WB 2K39A 3AU5A 3DVGX 3KUDB 3VFKA 1UZXB 1F9JA 5AZFA 2GBKA 4MGYE 4ANWA 2MBQA 4G50A 3VH4B 1L7YA 2G4DB 4LDTD 3ZLZA 2KVRA 4HDOA 2K25A 4WJNA 3V62A 1GG3A 2N9PC 4EFOA 4KDIC 3OLMD 4KIKA 4FADA 2BWES 2M4NA 2ZZPB 3PTFC 4HJKA 4ANVA 2NBUA 2KC1A 2C7HA 2L76A 3DVNU 3PLVA 1H4RA 1WJ6A 4BKTA 4DDID 1UELA 2XEWA 1P98A 2PEAA 1E8WA 2JZ3B 4BBNC 1VD2A 2KLGA 4KSKC 4HPMB 2RR9A 2MP2B 4NQKE 4XZ4A 2K1FA 2JVCA 1R4MI 3UF8A 1GUAB 4NAWB 2PE9A 2Z59B 2MP2A 4PS7A 4E3CA 4EZJA 4K81A 2BGFA 2DAFA 2KDIA 4BOZB 1WZ0A 1RAXA 4MH0E 4MEMA 1UBQA 2DAJA 3VTVA 4EZKA 5L95C 1OQYA 4TQ0A 4ZDVA 2MRPA 3L13A 3NY5A 4K1RB 3VUWA 4ANXA 4F1SA 1J19A 1YX5B 1OTRB 3A1QB 1I42A 3WAPA 4DHJD 2ZVOA 1UH6A 4M0WB 2LI5A 3U30A 2KFKA 3PGEA 3A1QA 4G11A 2FIDA 1V49A 3HK0A 2GBMA 5C1ZA 1V9JA 4EEWA 2MBEA 3BINA 3DBHI 5DPTA 2DX5B 1P3QU 1WXVA 2KTFA 2NPTB 2D2QA 2MBBB 3PREA 3JW0X 1WI0A 2NPTA 5GMVA 2DYMA 4CHKA 2KANA 1IYFA 3TIXA 3ECIA 4DDGD 4G3XB 3ENEA 2CHXA 1Q1OA 5JH5C 2MQJA 1Q5WB 4GOCA 2HE7A 2NBVB 3IG3A 1TGZB 3GZNI 4ZRKA 4HCNB 2AL3A 2MBOA 3L0WB 3WALA 5KHQA 1U4AA 2BYEA 1WJNA 2DZJA 3B1LX 2L8JA 1OEYJ 2ZNVC 3ML8A 4G0NB 5FR6A 3V6CB 2AL6A 1BT0A 5AZGA 4GMVA 2NCNA 4X57B 4OVVA 3TJPA 2ASQA 3APFA 5AEKB 4WJOA 3H7SA 3ZW3A 3L17A 1WR1A 4NY0A 2FAZA 1E8ZA 2FCSA 3MHSD 4XX5A 3KYDD 3UIOB 3H7PB 3ZKJC 1YJ1A 3DQVA 4W9DA 4FA6A 1TZ1A 3PV1A 2K6DB 1CMXB 2D3GA 3H7PA 3QC8B 4II2B 1E8XA 3TL5A 5JHAA 3DVGY 3K9OB 1WXAA 3TCAA 3UGBB 2WDTB 1WGYA 3A4RA 3L54A 2I1JA 2IZVB 2EMTA 5HKHA 4JIOU 2FCQA 4HLEA 2CR5A 4NJ6A 1YQBA 4TUUA 2GOWA 4PYZA 2V3SA 1V2YA 2AYOB 4HXDA 1TTNA 1WY8A 3LDZE 4BKGA 2O6VD 1WIAA 2IO0B 4LJPB 1G6JA 2ZNVB 2LVOA 3ZVVA 4RM9A 1IPGA 3CMMB 4KZCA 5E6PA 1VCBA 1NBFC 4ZYNA 4IM3A 3N30A 3RT3B 2UWQA 4AUQC 4MSMB 2MW5A 4PS3A 3SU8X 1E5WA 2K8HA 4W9EA 2IO3B 2ZEQA 1WM2A 3U7DA 3A9JB 3VAWA 4K7SA 3QHTA 2KKCA 3R3MA 1WXSA 4MJSA 2YVCA 3L08A 1L2NA 2REXA 1GC6A 3A9JA 1V6EA 5BO4B 5J17A 4FJYA 4MGZE 2O2VA 3R7QA 2BF8B 4LCDE 3EECA 3Q3FA 2GBJA 1T0YA 4BOSC 4DWFA 2NVUI 2L0TA 3RULA 4KIKB 4AJYB 1UD7A 3W1SC 4JQWC 1WE7A 2LRWA 2ZJDA 3PVLA 4B9KA 3PSEB 3KW5B 3R7RA 4BFRA 4AOFA 2RGFA 3SD5A 4W9KA 5E6OA 4FJZA 3KH0A 4NNJB 4JL9A 3OAWA 4AJWA 2V4LA 3RZWC 2J0JA 2LGYA 2WX1A 2VRRB 1WJUA 4HCPB 4IUMB 1H8CA 1SIFA 5CHFA 2LXAA 4K7WA 3IHPC 4ANUA 4JLCA 4I6LB 4MELA 4MDKE 4NPNA 1GJZA 4W9FA 4HWIB 2C5LC 2Z0EB 1R4NI 4IW0A 2A5UA 1XQQA 2CHZA 3P2BA 2BWFA 3EC8A 4TQ1A 1J0GA 3OJ3A 3DBSA 2J0KA 2EKEC 3HM3A 4WJPA 3VQIA 2KFKB 4FJVB 2YLMA 1OEYA 1PQSA 3KYCD 3W1SA 1RRBA 2JY6A 1WGGA 2KNBA 4FHJA 2DZKA 1MG8A 1E7VA 2JWZA 2KWUB 2KTRB 3W1YA 3WIMA 3QJZA 3PT2B 4DXAB 3KVFB 4IWQA 2FIFA 2KTRA 3PLUA 4WJQA 4PS8A 3D32A 3X0WA 4NQLB 1WE6A 2L0FA 3DBLI 2EMSA 2ZPYA 1M94A 3A33B 2Y5BB 2LASA 3H1UA 3IBEA 3MTNB 4FLHA 4MM3A 1YX6B 5D94A 4HK2A 5J18A 2C7NB 1UBIA 3PRMB 2JZZA 3QWZB 5G55A 4AWJA 4CYEA 5DPWA 1P1AA 2DHZA 3PRPB 2KXJA 2N1WA 4FULA 1WGHA 4W9GA 3K9PB 2LD9A 5D7GA 4P7IA 5AZHA 4M8MA 3UQAA 3QA8A 1GNUA 2KZRA 1LFDA 2A4ZA 1EF5A 2GBRA 3GOEA 3ZDMC 2IY1B 1ZKHA 4GIVA 5EDSA 3TMPB 4EKUA 2WWZA 3ZUNA 2KC2A 5CX3A 1RLFA 4GU2A 3ZRFA 2JF5A 1KOTA 4WWPA 4NJ7A 2D07B 2DZMA 1EF1A 4E74A 4E71A 2BPSA 1KLVA 3CSTA 4GDKB 3VTWA 1NDDA 2PJHA 3A4SC 3CSFA 2LGXA 4GDKA 2JXXA 2KMCA 3AU4A 4GSWA 2KDFB 5DPSA 3M63B 2C9WB 4CO7A 2W9NA 3JSVB 3O65B 2Z0DB 3UIPB 3NZSA 2L05A 3IVFA 3JSVA 2DYBA 2N7DA 5JHBA 4RM8A 3V61A 2L7RA 3M62B 4KV2A 5J2RA 2MCNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6W A;  5IAA C;  2J0M A;  3WAN A;  1A5R A;  4ICV A;  1YIW A;  3DPD A;  3JYU A;  1JRU A;  2KLC A;  3T8M A;  2BKF A;  2CHW A;  3V60 A;  4DK5 A;  1IP9 A;  4BVU C;  2JRH A;  2CU1 A;  4WQO B;  4M8N A;  5DPR A;  4MJS B;  2FCM A;  4II3 B;  3AI5 A;  1Z2M A;  4W9C A;  2LUE A;  2QHO A;  3SDL C;  1OGW A;  2D10 A;  4DHZ E;  3M3J A;  3UQB A;  2DYO A;  3VXW A;  2LZ6 A;  3NS8 A;  2N9X A;  1SGH A;  2GBN A;  2O2V B;  3QAR A;  4A20 A;  1ZGU B;  1EO6 A;  4LJO B;  4MSQ B;  1QZE A;  3UIN B;  2IYD B;  2IBI B;  2C7M B;  2G3Q B;  3JVZ X;  5DCN A;  4KVG B;  2KHW B;  3L16 A;  2KO3 A;  4W9H A;  1Z5S B;  2HD5 B;  3CF6 E;  5CTR C;  2CS4 A;  2AWT A;  1V5T A;  1LM8 B;  4TV3 A;  2KFJ A;  1E8Y A;  3B08 A;  3C0R B;  2ZCB A;  1XD3 B;  2KDB A;  1XT9 B;  1WFY A;  3EFU A;  1C1Y B;  4IM2 A;  2RPQ A;  4BKS A;  3NZU A;  2KOX A;  3RYT A;  4A3P A;  2KJR A;  1LXD A;  3A9K B;  3WA0 A;  1KM7 A;  4XC2 A;  3VDZ A;  4J6I A;  3PHW B;  5LLI A;  1GC7 A;  4FN2 A;  3T9L A;  3ZIM A;  3A9K A;  2M0X A;  2HJ8 A;  2MSE D;  2NR2 A;  3DDC B;  3ML9 A;  2WYQ A;  3I3T B;  3M95 A;  3NOB A;  3ZTC A;  5E6N A;  4ICU A;  2UYZ B;  2KN5 A;  1WJ4 A;  2RSU A;  1P9D U;  4IG7 B;  3DCG A;  4LDT B;  4KZ0 A;  2BYF A;  3APD A;  3VUX A;  4IWO A;  2KJ6 A;  4GDL B;  1WX9 A;  2KQS A;  3TBL D;  3L10 B;  3PZD A;  3QIJ A;  4DHZ B;  5IA7 A;  2KWC A;  2JT4 B;  2N9E B;  4GDL A;  2BKR B;  3APC A;  3ZNG C;  3VUY A;  3HM6 X;  3H9D A;  1C3T A;  1J8C A;  2G45 B;  2LGD A;  2IO2 B;  1WX7 A;  4W9L A;  5JZE B;  2D11 A;  4OVU A;  2K8B A;  2PPH A;  1RFA A;  2KQ7 A;  2ZCC A;  4HVB A;  1D3Z A;  2JUO A;  4GN1 A;  3IFW B;  2MBH A;  2ZPN A;  4HPL B;  4MGI E;  5CHW A;  2NBW B;  2B3A A;  4K7U A;  1X1M A;  2LRU A;  2BYV E;  2C60 A;  3B0A A;  4ASW C;  3ALB A;  4WAA A;  4NAW A;  3ZRC A;  3VVW B;  1S1Q B;  4EOY A;  1HE8 A;  2WX0 A;  4ZRI A;  2DZI A;  2LJ5 A;  2M17 A;  3OJ4 B;  3U8Z A;  3VTU A;  5LXH A;  1Y8R C;  4JGH B;  1WXM A;  4F7Z A;  4IC7 B;  4B95 A;  3NHE B;  4DHJ B;  3RUI B;  5L83 A;  2M8S A;  2K6Q A;  2R2Q A;  2XBB C;  3DBR I;  2MA9 B;  3SHQ A;  1EUV B;  2L3Z A;  2KK8 A;  1V80 A;  3X23 A;  3LJ3 A;  5C23 A;  3HIZ A;  1NI2 A;  1SE9 A;  3ONS A;  4KDL B;  4ZRJ A;  3QX1 A;  3ZNI D;  2MX2 A;  1V5O A;  1WH3 A;  1WYW B;  1WF9 A;  4AP4 C;  2KMA A;  4YL8 A;  3H6N A;  1KJT A;  4DBG A;  3WAO A;  4FHK A;  2KJH B;  2NS5 A;  2N1V A;  4IWP A;  3N3K B;  2N4F A;  2DEN B;  2FCN A;  3KUZ A;  1LQB A;  5G2N A;  4F8C B;  2LVQ A;  2ZVN A;  4A3O A;  3EHV A;  3PPA A;  4GB9 A;  3VH3 B;  4BBN F;  3BY4 B;  3V6E B;  1WGR A;  2V1Y A;  2JPH A;  1K8R B;  2KDE B;  2R2O A;  3HHM A;  3QAQ A;  3RCZ A;  3N32 A;  1TBE A;  2PE6 B;  4FBJ B;  2MLB A;  4GXB A;  3ZO5 B;  1WR6 E;  2OOB B;  3DOW A;  4URK A;  3RZF A;  3WAM A;  3MJW A;  2KX3 A;  2FUH B;  3KUC B;  1S3S G;  3AXC A;  3QQ8 B;  1WZ3 A;  2LWP A;  2HTH A;  1WX8 A;  3PRZ A;  3S2A A;  4TKN A;  1V86 A;  1E7U A;  3PHX B;  2L00 B;  1WRD B;  1V81 A;  5D6J B;  3AUL A;  2AEH A;  2G4S A;  3Q3J A;  2JRI B;  4EZL A;  4I6P A;  4W9J A;  5D2M B;  5TR5 A;  3ZDT A;  3ZNZ B;  2N7E A;  2I1K A;  2XK5 B;  4KSL C;  2LXC A;  4EUT A;  4WWO A;  4GGQ A;  2O6V B;  2XK5 A;  1I35 A;  4N9F 4;  4I6N B;  1ISN A;  1WMH B;  2O6V A;  4RMA A;  1WMH A;  4WWN A;  5KHO A;  2IY0 B;  2K8C A;  4HDQ A;  2GMI C;  4MGK E;  3RD2 A;  4IM0 A;  2FNJ B;  2LVP A;  5LXI B;  4BKS D;  3DVN V;  3ZTD A;  2OJR A;  5CHV C;  1ZW7 A;  2KX0 A;  2IO1 B;  2M1M A;  1P0R A;  4W9I A;  3ZNH B;  2KWV B;  3R66 C;  1FXT B;  3VHT C;  1WGD A;  1UGM A;  3QK0 A;  1E90 A;  2RD0 A;  2CKH B;  3QCA A;  1AAR A;  4PYU A;  2MWS B;  2KD0 A;  2J7Q B;  1WM3 A;  1YD8 U;  3PS6 A;  1Q0W B;  2K39 A;  3AU5 A;  3DVG X;  3KUD B;  3VFK A;  1UZX B;  1F9J A;  5AZF A;  2GBK A;  4MGY E;  4ANW A;  2MBQ A;  4G50 A;  3VH4 B;  1L7Y A;  2G4D B;  4LDT D;  3ZLZ A;  2KVR A;  4HDO A;  2K25 A;  4WJN A;  3V62 A;  1GG3 A;  2N9P C;  4EFO A;  4KDI C;  3OLM D;  4KIK A;  4FAD A;  2BWE S;  2M4N A;  2ZZP B;  3PTF C;  4HJK A;  4ANV A;  2NBU A;  2KC1 A;  2C7H A;  2L76 A;  3DVN U;  3PLV A;  1H4R A;  1WJ6 A;  4BKT A;  4DDI D;  1UEL A;  2XEW A;  1P98 A;  2PEA A;  1E8W A;  2JZ3 B;  4BBN C;  1VD2 A;  2KLG A;  4KSK C;  4HPM B;  2RR9 A;  2MP2 B;  4NQK E;  4XZ4 A;  2K1F A;  2JVC A;  1R4M I;  3UF8 A;  1GUA B;  4NAW B;  2PE9 A;  2Z59 B;  2MP2 A;  4PS7 A;  4E3C A;  4EZJ A;  4K81 A;  2BGF A;  2DAF A;  2KDI A;  4BOZ B;  1WZ0 A;  1RAX A;  4MH0 E;  4MEM A;  1UBQ A;  2DAJ A;  3VTV A;  4EZK A;  5L95 C;  1OQY A;  4TQ0 A;  4ZDV A;  2MRP A;  3L13 A;  3NY5 A;  4K1R B;  3VUW A;  4ANX A;  4F1S A;  1J19 A;  1YX5 B;  1OTR B;  3A1Q B;  1I42 A;  3WAP A;  4DHJ D;  2ZVO A;  1UH6 A;  4M0W B;  2LI5 A;  3U30 A;  2KFK A;  3PGE A;  3A1Q A;  4G11 A;  2FID A;  1V49 A;  3HK0 A;  2GBM A;  5C1Z A;  1V9J A;  4EEW A;  2MBE A;  3BIN A;  3DBH I;  5DPT A;  2DX5 B;  1P3Q U;  1WXV A;  2KTF A;  2NPT B;  2D2Q A;  2MBB B;  3PRE A;  3JW0 X;  1WI0 A;  2NPT A;  5GMV A;  2DYM A;  4CHK A;  2KAN A;  1IYF A;  3TIX A;  3ECI A;  4DDG D;  4G3X B;  3ENE A;  2CHX A;  1Q1O A;  5JH5 C;  2MQJ A;  1Q5W B;  4GOC A;  2HE7 A;  2NBV B;  3IG3 A;  1TGZ B;  3GZN I;  4ZRK A;  4HCN B;  2AL3 A;  2MBO A;  3L0W B;  3WAL A;  5KHQ A;  1U4A A;  2BYE A;  1WJN A;  2DZJ A;  3B1L X;  2L8J A;  1OEY J;  2ZNV C;  3ML8 A;  4G0N B;  5FR6 A;  3V6C B;  2AL6 A;  1BT0 A;  5AZG A;  4GMV A;  2NCN A;  4X57 B;  4OVV A;  3TJP A;  2ASQ A;  3APF A;  5AEK B;  4WJO A;  3H7S A;  3ZW3 A;  3L17 A;  1WR1 A;  4NY0 A;  2FAZ A;  1E8Z A;  2FCS A;  3MHS D;  4XX5 A;  3KYD D;  3UIO B;  3H7P B;  3ZKJ C;  1YJ1 A;  3DQV A;  4W9D A;  4FA6 A;  1TZ1 A;  3PV1 A;  2K6D B;  1CMX B;  2D3G A;  3H7P A;  3QC8 B;  4II2 B;  1E8X A;  3TL5 A;  5JHA A;  3DVG Y;  3K9O B;  1WXA A;  3TCA A;  3UGB B;  2WDT B;  1WGY A;  3A4R A;  3L54 A;  2I1J A;  2IZV B;  2EMT A;  5HKH A;  4JIO U;  2FCQ A;  4HLE A;  2CR5 A;  4NJ6 A;  1YQB A;  4TUU A;  2GOW A;  4PYZ A;  2V3S A;  1V2Y A;  2AYO B;  4HXD A;  1TTN A;  1WY8 A;  3LDZ E;  4BKG A;  2O6V D;  1WIA A;  2IO0 B;  4LJP B;  1G6J A;  2ZNV B;  2LVO A;  3ZVV A;  4RM9 A;  1IPG A;  3CMM B;  4KZC A;  5E6P A;  1VCB A;  1NBF C;  4ZYN A;  4IM3 A;  3N30 A;  3RT3 B;  2UWQ A;  4AUQ C;  4MSM B;  2MW5 A;  4PS3 A;  3SU8 X;  1E5W A;  2K8H A;  4W9E A;  2IO3 B;  2ZEQ A;  1WM2 A;  3U7D A;  3A9J B;  3VAW A;  4K7S A;  3QHT A;  2KKC A;  3R3M A;  1WXS A;  4MJS A;  2YVC A;  3L08 A;  1L2N A;  2REX A;  1GC6 A;  3A9J A;  1V6E A;  5BO4 B;  5J17 A;  4FJY A;  4MGZ E;  2O2V A;  3R7Q A;  2BF8 B;  4LCD E;  3EEC A;  3Q3F A;  2GBJ A;  1T0Y A;  4BOS C;  4DWF A;  2NVU I;  2L0T A;  3RUL A;  4KIK B;  4AJY B;  1UD7 A;  3W1S C;  4JQW C;  1WE7 A;  2LRW A;  2ZJD A;  3PVL A;  4B9K A;  3PSE B;  3KW5 B;  3R7R A;  4BFR A;  4AOF A;  2RGF A;  3SD5 A;  4W9K A;  5E6O A;  4FJZ A;  3KH0 A;  4NNJ B;  4JL9 A;  3OAW A;  4AJW A;  2V4L A;  3RZW C;  2J0J A;  2LGY A;  2WX1 A;  2VRR B;  1WJU A;  4HCP B;  4IUM B;  1H8C A;  1SIF A;  5CHF A;  2LXA A;  4K7W A;  3IHP C;  4ANU A;  4JLC A;  4I6L B;  4MEL A;  4MDK E;  4NPN A;  1GJZ A;  4W9F A;  4HWI B;  2C5L C;  2Z0E B;  1R4N I;  4IW0 A;  2A5U A;  1XQQ A;  2CHZ A;  3P2B A;  2BWF A;  3EC8 A;  4TQ1 A;  1J0G A;  3OJ3 A;  3DBS A;  2J0K A;  2EKE C;  3HM3 A;  4WJP A;  3VQI A;  2KFK B;  4FJV B;  2YLM A;  1OEY A;  1PQS A;  3KYC D;  3W1S A;  1RRB A;  2JY6 A;  1WGG A;  2KNB A;  4FHJ A;  2DZK A;  1MG8 A;  1E7V A;  2JWZ A;  2KWU B;  2KTR B;  3W1Y A;  3WIM A;  3QJZ A;  3PT2 B;  4DXA B;  3KVF B;  4IWQ A;  2FIF A;  2KTR A;  3PLU A;  4WJQ A;  4PS8 A;  3D32 A;  3X0W A;  4NQL B;  1WE6 A;  2L0F A;  3DBL I;  2EMS A;  2ZPY A;  1M94 A;  3A33 B;  2Y5B B;  2LAS A;  3H1U A;  3IBE A;  3MTN B;  4FLH A;  4MM3 A;  1YX6 B;  5D94 A;  4HK2 A;  5J18 A;  2C7N B;  1UBI A;  3PRM B;  2JZZ A;  3QWZ B;  5G55 A;  4AWJ A;  4CYE A;  5DPW A;  1P1A A;  2DHZ A;  3PRP B;  2KXJ A;  2N1W A;  4FUL A;  1WGH A;  4W9G A;  3K9P B;  2LD9 A;  5D7G A;  4P7I A;  5AZH A;  4M8M A;  3UQA A;  3QA8 A;  1GNU A;  2KZR A;  1LFD A;  2A4Z A;  1EF5 A;  2GBR A;  3GOE A;  3ZDM C;  2IY1 B;  1ZKH A;  4GIV A;  5EDS A;  3TMP B;  4EKU A;  2WWZ A;  3ZUN A;  2KC2 A;  5CX3 A;  1RLF A;  4GU2 A;  3ZRF A;  2JF5 A;  1KOT A;  4WWP A;  4NJ7 A;  2D07 B;  2DZM A;  1EF1 A;  4E74 A;  4E71 A;  2BPS A;  1KLV A;  3CST A;  4GDK B;  3VTW A;  1NDD A;  2PJH A;  3A4S C;  3CSF A;  2LGX A;  4GDK A;  2JXX A;  2KMC A;  3AU4 A;  4GSW A;  2KDF B;  5DPS A;  3M63 B;  2C9W B;  4CO7 A;  2W9N A;  3JSV B;  3O65 B;  2Z0D B;  3UIP B;  3NZS A;  2L05 A;  3IVF A;  3JSV A;  2DYB A;  2N7D A;  5JHB A;  4RM8 A;  3V61 A;  2L7R A;  3M62 B;  4KV2 A;  5J2R A;  2MCN B; 
#chains in the Genus database with same CATH topology
 4B6W A;  2BTE A;  2J0M A;  3MP9 A;  3BVM A;  3DPD A;  3ZJT A;  1F1H A;  2KLC A;  2CHW A;  1VJK A;  1VZ6 A;  4BVU C;  1NI3 A;  1QKZ A;  4EE2 A;  3P1M A;  3AI5 A;  2LUE A;  3AEA B;  1OGW A;  1JRP A;  3BK1 A;  3UQB A;  2LZ6 A;  2N9X A;  1MVK A;  2GBN A;  3UIN B;  2IYD B;  3Q3O C;  2C7M B;  3L16 A;  3P4S B;  4W9H A;  2CS4 A;  1V5T A;  1PGX A;  2FE8 A;  1LM8 B;  2JQR B;  3N20 C;  4TV3 A;  2ZCB A;  1XD3 B;  3AE8 B;  1XT9 B;  1WFY A;  4XE0 A;  2RPQ A;  3C8Y A;  1LXD A;  1KM7 A;  3PZ7 A;  2HJ8 A;  1TS3 A;  4ICU A;  1WJ4 A;  1KLG D;  2Y5C A;  1DOI A;  3APD A;  3Q6B A;  3TBL D;  2E3T A;  3L10 B;  4IOI E;  5IA7 A;  2WU5 B;  3AN1 A;  2BKR B;  2YEP F;  3ZNG C;  2J42 A;  3H9D A;  2WXR A;  1UWX A;  2IO2 B;  2D11 A;  2PPH A;  2EKI A;  1D3Z A;  1I7H A;  4HPL B;  4UDU C;  5CHW A;  2NBW B;  2B3A A;  1AN8 A;  2OED A;  2LRU A;  3ALB A;  4WAA A;  4NAW A;  1NVI D;  1Y8R C;  4C80 A;  4RF0 A;  2K6Q A;  3RPF C;  2MA9 B;  4KX6 B;  1DGJ A;  1L6U A;  1YMH E;  2M0A A;  4ZRJ A;  1SE3 A;  4AP4 C;  4YL8 A;  4DBG A;  4ACF A;  2WS3 B;  2N1V A;  1D5Z C;  2DEN B;  5GXG B;  5G2N A;  2Z8L A;  2LVQ A;  3LYY A;  4LNK A;  3EHV A;  1WGR A;  1JML A;  2V1Y A;  1ZE3 D;  4M01 A;  2R2O A;  5EE9 A;  1XF5 L;  3N32 A;  4FBJ B;  4GXB A;  4US9 A;  1WR6 E;  2KX3 A;  1FIQ A;  1ZDX A;  3PRZ A;  4TKN A;  3PO0 A;  1E7U A;  3VRA B;  1MI0 A;  3AUL A;  5D6J B;  2AEH A;  4EZL A;  5TR5 A;  3ZDT A;  3VRB B;  4KSL C;  4BAX A;  1WWT A;  2WXH A;  3NVV A;  1K52 A;  4TMA B;  3W5U B;  3RD2 A;  1IUE A;  2IJ0 A;  4NAM A;  4A55 A;  4C7Y A;  4BKS D;  5CHV C;  1P0R A;  2VZK D;  1UUP A;  2IPK D;  2D3A A;  2KWV B;  4XWT A;  2V0G A;  3VHT C;  1WGD A;  5AUK A;  4R3D A;  3B2G A;  1E90 A;  2RD0 A;  2CKH B;  1SJE D;  2J7Q B;  1Q0W B;  4LNF A;  3DVG X;  2WXQ A;  3AM9 A;  4MGY E;  4ANW A;  4G50 A;  4HDO A;  2K25 A;  2RMM A;  1L5P A;  2CU3 A;  4ANV A;  2NBU A;  2C7H A;  4ITK A;  3AV8 A;  1P7F A;  1WJ6 A;  4BKT A;  1P98 A;  1E8W A;  2WXJ A;  4NQK E;  1E6E B;  3DWG C;  4P1C C;  4NAW B;  2MP2 A;  1RM6 C;  2J4X A;  3HVD A;  1T6B X;  1YJJ A;  5L95 C;  4P16 A;  3DHH C;  2MRP A;  3VUW A;  4F1S A;  4ANX A;  1YX5 B;  4YSZ B;  1WRI A;  3WAP A;  4DHJ D;  1LO5 D;  2ON8 A;  4M0W A;  3AE5 B;  1JAL A;  2L1A A;  3DBH I;  1C78 A;  2AX5 A;  1FNW A;  1N6Z A;  1FCL A;  3ECI A;  2K0P A;  2CHX A;  1KTK A;  4GOC A;  3IG3 A;  1TGZ B;  3GZN I;  2UU7 A;  3KWV A;  3N1Y C;  4G0N B;  1NYQ A;  2AL6 A;  5AZG A;  5BYR A;  4OZB A;  4WJO A;  3H7S A;  3ZW3 A;  3L17 A;  4NY0 A;  1DOX A;  2ZW1 A;  3MHS D;  3ZKJ C;  4W9D A;  3PV1 A;  1XXG A;  1CMX B;  2D3G A;  1E8X A;  1WXA A;  3A4R A;  3L54 A;  2I1J A;  4HKQ A;  1WXQ A;  3V05 A;  1V2Y A;  2AYO B;  4WH4 A;  1Q10 A;  1WY8 A;  3HUI A;  3LDZ E;  2O6V D;  1WIA A;  2IO0 B;  2WDV B;  1K51 A;  2LVO A;  4KZC A;  1CK1 A;  4QAY A;  3SEB A;  1I4G A;  3N30 A;  1ZP0 B;  3KQ4 A;  3T3N A;  2MW5 A;  1EWC A;  1L4Z B;  3DBL B;  2BB5 A;  4W9E A;  3VAW A;  4MJS A;  2REX A;  1GC6 A;  2W82 A;  3A9J A;  5J17 A;  2O2V A;  3U7Z A;  4LCD E;  3GZN B;  1HZ5 A;  4AJY B;  1UD7 A;  3W1S C;  1UWM A;  4JQW C;  1JWA D;  4BFR A;  1T0R C;  2MJ3 A;  3RZW C;  1SE2 A;  2WX1 A;  4RGM A;  4IKG A;  4HCP B;  4IUM B;  3BK2 A;  1H8C A;  2LXA A;  1UGJ A;  2ICI A;  5EE3 A;  3FKY A;  4JLC A;  4W9F A;  3L4P A;  2Z0E B;  4MAC A;  1R4N I;  1E0Z A;  1QOG A;  2INN E;  3OJ3 A;  2J0K A;  1V97 A;  4LNO A;  1RRB A;  4HKZ E;  4FHJ A;  2L52 A;  4XWW A;  1E7V A;  2KWU B;  2KTR B;  3KVF B;  4IWQ A;  3PLU A;  1WE6 A;  4C56 C;  2JYT A;  1M94 A;  4FLH A;  4MM3 A;  2L83 A;  4HK2 A;  2JZZ A;  5D3I B;  5G55 A;  3IAM 1;  1PFD A;  2WXG A;  2DHZ A;  2N1W A;  5D7G A;  1EF5 A;  2MJE A;  2I2Y A;  1UF0 A;  1L0X B;  3ZDM C;  1FRD A;  1ZKH A;  4EKU A;  2IGD A;  2CJN A;  5CX3 A;  3MFG A;  2W3R A;  2PMV A;  4GU2 A;  1EF1 A;  3U2S C;  2XNA C;  3CST A;  3ZGZ A;  4WQM A;  3PZ8 A;  2X38 A;  2JXX A;  4GDK A;  1N5X A;  3JSV B;  2MEK A;  1FCC C;  1R4N B;  1QOF A;  2K22 A;  3IVF A;  1ET9 A;  1F2R I;  3CWI A;  2N7D A;  4C4V B;  3TEY A;  4RM8 A;  4ZHP A;  4KV2 A;  2MCN B;  1OQR A;  1RWS A;  3WAN A;  1A5R A;  2N0S B;  3T8M A;  3V60 A;  4DXF A;  3Q8C A;  4WQO B;  2IND C;  4MJS B;  3HRD D;  2FCM A;  2FBW B;  4II3 B;  2QHO A;  3SDL C;  4DHZ E;  2D10 A;  2DYO A;  3E9S A;  3NS8 A;  3VXW A;  2O2V B;  2GB1 A;  3RNG C;  4MSQ B;  4LJO B;  3Q2A C;  2IBI B;  2G3Q B;  5DCN A;  4KVG B;  5CTR C;  2WHI A;  5FK9 C;  2KFJ A;  1E8Y A;  1JWB D;  1F2R C;  2KDB A;  2VZK B;  4YWG G;  2KOX A;  3SFD B;  2AQ2 B;  1TY0 A;  4A3P A;  2KJR A;  4XC2 A;  4J6I A;  3PHW B;  5LLI A;  2M0X A;  2G9H D;  2MSE D;  4S17 A;  2GRI A;  3ML9 A;  3NOB A;  4LLG M;  3AH7 A;  2RSU A;  4KZ0 A;  2V4I B;  4YTM B;  2RDB C;  4IWO A;  4DHZ B;  4XDC A;  2G45 B;  3AE1 B;  1AW7 A;  1ROE A;  4W9L A;  4AS1 A;  4N6E B;  1RFA A;  2KQ7 A;  4L23 A;  4JPS A;  3IFW B;  1SIJ A;  1NEK B;  2HDE A;  3MHZ A;  4LK0 M;  2BYV E;  2JX5 A;  3O13 A;  3Q3M C;  4DXG A;  2BT6 A;  1S1Q B;  1HE8 A;  2WX0 A;  3RNA C;  2DZI A;  3OJ4 B;  1WXM A;  3Q14 C;  4DHJ B;  3RUI B;  2M8S A;  3DBR I;  4ZHO A;  1NI2 A;  1SE9 A;  2DNF A;  4ZYS A;  3QX1 A;  3ZNI D;  2MX2 A;  1EM7 A;  1WF9 A;  4B0M A;  3H6N A;  1KJT A;  1FFV A;  1ZXI A;  3KWL A;  3WAO A;  1T0Q C;  2KJH B;  3IAS 1;  3N3K B;  5HHD G;  2WDR B;  2PTL A;  2FCN A;  4A3O A;  3BY4 B;  1GB4 A;  3QAQ A;  4B0E A;  2PE6 B;  3BWU D;  1PGB A;  4YSY B;  3MJW A;  2FUH B;  3IT4 B;  3ETR A;  2LWP A;  3NVZ A;  1V86 A;  1HA5 A;  5FR3 A;  2G4S A;  3Q3J A;  4W9J A;  1MJD A;  2XK5 B;  2LXC A;  4WWO A;  4GGQ A;  2O6V B;  1I35 A;  3MC0 B;  1WMH B;  1GB1 A;  3I57 A;  2QEJ C;  3I5J C;  3DBR B;  2DLB A;  4HDQ A;  2HJ1 A;  3B9J A;  2QDF A;  4IM0 A;  2FNJ B;  3ZNH B;  2OJR A;  1ZW7 A;  2M1M A;  1FXT B;  2K3U A;  1UGM A;  2WLB A;  3QK0 A;  3QCA A;  2KN4 A;  3VR9 B;  2G1E A;  3KUD B;  1XCQ L;  1UZX B;  1F9J A;  2MBQ A;  3ZLZ A;  1VZ8 A;  2KVR A;  3RI7 C;  2N9P C;  4KDI C;  2BWE S;  3PTF C;  3UI3 A;  2KYW A;  3PLV A;  2KDM A;  4J3O D;  2XEW A;  4BBN C;  1K50 A;  1VD2 A;  3RNE C;  4KSK C;  2RR9 A;  3BVZ A;  5G5G A;  2R61 A;  2K1F A;  1R4M I;  1HXY D;  2Z59 B;  4K81 A;  2BGF A;  2DAF A;  2KDI A;  1RAX A;  4MH0 E;  3VTV A;  1GOZ A;  2BBC A;  5TSS A;  1V1P B;  1OQY A;  2DBY A;  4TQ0 A;  3BVG A;  1J19 A;  4RF1 A;  1I42 A;  1UH6 A;  4ARC A;  1RFK A;  2KFK A;  3PGE A;  4LTU A;  2FID A;  2GBM A;  1V9J A;  4EEW A;  5DPT A;  1P3Q U;  1WXV A;  2KTF A;  2NPT B;  2D2Q A;  3JW0 X;  3TEW A;  2DYM A;  4G3X B;  2D3B A;  1Q1O A;  1Q5W B;  1WGK A;  4HJG E;  2NBV B;  4HCN B;  1MHX A;  2AL3 A;  3L0W B;  3WAL A;  5KHQ A;  2L8J A;  2ZNV C;  4GMV A;  4X57 B;  4OVV A;  3APF A;  3RNB C;  2LEK A;  1WR1 A;  3Q3N C;  1E8Z A;  2FCS A;  3UIO B;  4XDD A;  3H7P B;  3EGR A;  3LXF A;  4FA6 A;  3QC8 B;  2WXM A;  4YT0 B;  3K9O B;  3UGB B;  2WDT B;  1R4M B;  2CR5 A;  4TUU A;  3NJT A;  1TKG A;  4BKG A;  4KGR A;  1XLO A;  4OVZ A;  1G6J A;  2ZNV B;  3ZVV A;  4C7Z A;  3GS2 A;  3AB5 A;  4ZYN A;  4IM3 A;  2LUM A;  2V9H A;  3FAH A;  1QOA A;  1TS4 A;  1C79 A;  2UWQ A;  3AEF B;  3AE7 B;  1KFY B;  4K7S A;  5IN7 A;  1FEH A;  3J9C A;  3AMZ A;  1L0Y B;  3DHG C;  3OWE B;  1DYQ A;  1JQ4 A;  2BF8 B;  3EEC A;  2GBJ A;  1FPY A;  4YXD B;  2L0T A;  3P63 A;  2LRW A;  1VRA B;  1VDV A;  2ZJD A;  2KAJ A;  2NTS A;  3SD5 A;  4W9K A;  5E6O A;  2JU6 X;  4FJZ A;  3KH0 A;  4AJW A;  2V4L A;  2J0J A;  5AUI A;  1WJU A;  3MC9 A;  1SIF A;  5CHF A;  2PIA A;  5C2T B;  1XLP A;  4MDK E;  1STE A;  4NPN A;  4HWI B;  4HRO A;  3RNC C;  1XLQ A;  2BWF A;  3DBS A;  2KFK B;  4FJV B;  1K53 A;  3W1S A;  1WGG A;  4LNI A;  2DZK A;  4USA A;  2JWZ A;  1ET6 A;  3WIM A;  3QJZ A;  4JWU C;  2BVC A;  1J7A A;  4XGA B;  4DXA B;  4P1B C;  2GI9 A;  2KTR A;  3D32 A;  3DBL I;  2Y5B B;  2DWQ A;  2WU2 B;  5J18 A;  3QWZ B;  2H89 B;  5DPW A;  4FUL A;  2LHD A;  1WGH A;  1HTO A;  3K9P B;  2LD9 A;  1TZO A;  3UQA A;  1GNU A;  2KZR A;  2A4Z A;  2GBR A;  2Q5W D;  3C19 A;  1FXI A;  2W54 A;  3GOE A;  4K3C A;  4ZRQ A;  4GIV A;  3TMP B;  2WWZ A;  3ZUN A;  1RLF A;  3CIR B;  4WWP A;  4NJ7 A;  2DZM A;  2OHF A;  1V1O A;  3RMK C;  3VTW A;  3A4S C;  2LGX A;  2KDF B;  3TEX A;  5DPS A;  1IGC A;  1XLN A;  3KLS X;  2C9W B;  2E6X A;  2W9N A;  2Z0D B;  3AE2 B;  3JSV A;  2DYB A;  1IGD A;  4MT5 A;  2W55 A;  4C4V A;  1CQV A;  4ICV A;  1HEZ E;  3JYU A;  2H88 B;  4DQO C;  2EEL A;  2JRH A;  4OW0 A;  1Z2M A;  2WXO A;  1SGH A;  3QAR A;  1ZGU B;  1EO6 A;  1QZE A;  1C76 A;  2PW9 A;  4WWM A;  3NVW A;  3CF6 E;  3AEC B;  1T0S C;  3B08 A;  3C0R B;  3EFU A;  2X8X X;  1ZDV A;  4IM2 A;  2Y5P A;  4BKS A;  3NZU A;  4P6V F;  4CQN A;  3RYT A;  1DOY A;  3A9K B;  1KRH A;  3VDZ A;  1GC7 A;  1JWS D;  2NR2 A;  3I63 C;  2JSV X;  2WYQ A;  3I3T B;  2LGS A;  3ZTC A;  5E6N A;  2UYZ B;  1P9D U;  3ZXR A;  2MH7 A;  3ZXV A;  1UNS A;  1YQ3 B;  4GDL B;  1WX9 A;  3PZD A;  3QIJ A;  2N9E B;  1YN4 A;  4FXC A;  3APC A;  2WNM A;  1C3T A;  1WX7 A;  3TSS A;  2K8B A;  3BYT B;  2JUO A;  3URY A;  1I4X A;  1C4A A;  2ZPN A;  4K7U A;  2ONQ A;  2C60 A;  3B0A A;  4ASW C;  1EU4 A;  4EOY A;  1YQ4 B;  4ZRI A;  3VTU A;  4F7Z A;  1SJH D;  2Y3A A;  4IC7 B;  2QIL A;  2R2Q A;  3SHQ A;  3TEZ A;  1EUV B;  3R2T A;  2KK8 A;  5C23 A;  3HIZ A;  4KDL B;  3FIL B;  1WH3 A;  1HZ6 A;  2QC8 A;  1AYF A;  2SAK A;  4FHK A;  2NS5 A;  4IWP A;  3Q69 A;  3KUZ A;  1LQB A;  3BYY B;  4GB9 A;  3V6E B;  4WUR A;  5IOI A;  4ARI A;  1K8R B;  2KDE B;  3N1X C;  4A90 A;  3RCZ A;  1YN3 A;  1TBE A;  2MLB A;  4TSS A;  3DOW A;  4ZOH C;  1ACC A;  3WAM A;  4URK A;  1BML C;  1NEN B;  3MJ5 A;  3KUC B;  1S3S G;  3QQ8 B;  3W5V B;  1WZ3 A;  1QF6 A;  2HTH A;  1WX8 A;  3S2A A;  1PUT A;  3EA6 A;  1I4H A;  3NUH B;  1WRD B;  3P4R B;  4AQ7 A;  2JRI B;  3GE3 C;  4I6P A;  3P42 A;  5D2M B;  3R8B A;  2AQ1 B;  1E10 A;  3GP7 A;  2I1K A;  4EUT A;  2MHJ A;  2XK5 A;  1KF6 B;  4WAF A;  4I6N B;  2M19 A;  3N1Z C;  2O6V A;  4OHJ A;  4RMA A;  1WMH A;  4KGT A;  2WQY B;  5KHO A;  2IY0 B;  2K8C A;  2GMI C;  4MGK E;  3DWM A;  2K9X A;  3Q8A A;  2LVP A;  3HVZ A;  3MC8 A;  2BW2 A;  3DVN V;  3FC4 A;  3ZTD A;  2KX0 A;  3N9Y C;  3R66 C;  2KMM A;  5BMH A;  3LB8 C;  4PYU A;  2KD0 A;  1QIL A;  1WM3 A;  2YEP B;  2K39 A;  3SFE B;  4Q2J A;  2GBK A;  3VH4 B;  1L7Y A;  4LDT D;  4NZL B;  4WJN A;  1FXA A;  3V62 A;  1GG3 A;  1TKY A;  3OLM D;  4FAD A;  2M4N A;  1JCK B;  3DVN U;  4ZRP A;  1UEL A;  3Q8E A;  2PEA A;  2JZ3 B;  4RGT A;  3GB1 A;  4BZA A;  1C4C A;  2J52 A;  4PS7 A;  2PE9 A;  4EZJ A;  1WZ0 A;  1BXT A;  1UBQ A;  2DAJ A;  4MEM A;  4EZK A;  2MJD A;  2KAC A;  3H8H A;  1ZPS A;  4ZDV A;  3RN9 C;  4K1R B;  1V1P A;  1YJI A;  2ACZ B;  1N62 A;  3A1Q B;  2LI5 A;  3U30 A;  1V49 A;  4XYC A;  3BIN A;  2KQ4 X;  2DX5 B;  1Y56 A;  1FRR A;  2MBB B;  2NPT A;  2WXL A;  1FFU A;  2KAN A;  3TIX A;  1E9M A;  1TYG B;  5JH5 C;  2MQJ A;  4MH8 A;  1SEB D;  2W3S A;  2JXT A;  4ZRK A;  2RPV A;  2MBO A;  2BYE A;  2HTM E;  2DZJ A;  1L6V A;  1OEY J;  1BT0 A;  1EU3 A;  3R2I A;  2NCN A;  5H8Y E;  3Q8B A;  4K3B A;  3IXS A;  2FAZ A;  3KYD D;  3DQV A;  2K6D B;  3H7P A;  4II2 B;  1SSN A;  3OG5 A;  1FD6 A;  1T3Q A;  5LNK 1;  2OJW A;  1F77 A;  2IZV B;  2EMT A;  5HKH A;  1SB3 C;  4JE3 B;  2LFI A;  1YQB A;  4PYZ A;  4HXD A;  2WDQ B;  4D2K A;  2XN9 C;  4JX1 C;  4HEA 1;  1LGR A;  4LJP B;  1IPG A;  1VLB A;  4JWS C;  4A6Q A;  4AUQ C;  2QCZ A;  1N5W A;  3NVY A;  4PS3 A;  3SU8 X;  1E5W A;  3U7D A;  2ZEQ A;  1WM2 A;  3QHT A;  4C00 A;  2KKC A;  3R3M A;  1WXS A;  3L08 A;  1V6E A;  1QOB A;  5BO4 B;  2VH2 A;  3BII D;  4MGZ E;  1CJE A;  3R7Q A;  1TS5 A;  5EE1 A;  1T0Y A;  2NTT A;  4DWF A;  3U4E G;  1WE7 A;  4B9K A;  3PSE B;  3NZ3 A;  3KW5 B;  1VR9 A;  4AOF A;  2RGF A;  2WXP A;  1V8C A;  4JL9 A;  5HFY A;  3I9V 1;  1RYJ A;  3T3O A;  1TKE A;  2VRR B;  1C77 A;  4IDI A;  4K7W A;  3IHP C;  4MEL A;  2LHE A;  3AED B;  3ZQ4 A;  4M00 A;  4IW0 A;  2A5U A;  2CHZ A;  3P2B A;  3HM3 A;  3VQI A;  2WXN A;  1OEY A;  3KYC D;  2JY6 A;  3B2F A;  1MG8 A;  1JWM D;  1QLB B;  3PT2 B;  3GE8 C;  4NQL B;  1JRO A;  2L0F A;  2EMS A;  2AQ3 B;  2ZPY A;  1N61 A;  2N9K A;  3A33 B;  3H1U A;  1WSP A;  1YX6 B;  5D94 A;  1UBI A;  2PVG C;  4KKJ A;  1IBX B;  2PVO D;  3PRM B;  3V3X A;  4AWJ A;  1P1A A;  1JWU D;  3NS1 A;  1C9F A;  4P7I A;  5AZH A;  4M8M A;  1B9R A;  2N7J A;  2JYE A;  3ZYY X;  2IY1 B;  4GLS C;  4H2A A;  1OFF A;  2KC2 A;  3ZRF A;  2D07 B;  4E74 A;  1L4D B;  4E71 A;  5IO9 A;  2WXF A;  1KLV A;  1TJE A;  2D5G A;  1NDD A;  3CSF A;  2KMC A;  3AU4 A;  3M63 B;  4CO7 A;  3O65 B;  3UIP B;  5HI1 A;  4KGS A;  1AWD A;  2BYT A;  4WIP A;  1VZ7 A;  2BS3 B;  5JHB A;  2WP9 B;  5J2R A;  2BQQ A;  3M62 B;  1J7B A;  4US8 A;  5IAA C;  1YIW A;  1JRU A;  4HRS A;  2RDG A;  2BKF A;  1MHH E;  4DK5 A;  1IP9 A;  1E7P B;  5JXV A;  1FM0 D;  2CU1 A;  4M8N A;  2JWU A;  5DPR A;  1L0V B;  5MPO A;  4W9C A;  3M3J A;  4A20 A;  4OZC A;  2LJI A;  3JVZ X;  1GPX A;  2KHW B;  4REZ A;  2KO3 A;  1Z5S B;  2HD5 B;  2AWT A;  4YSX B;  1ENF A;  1C1Y B;  1HTQ A;  4NJC A;  3NG0 A;  3WA0 A;  4FN2 A;  1C4P A;  4OZA A;  3T9L A;  2TSS A;  3A9K A;  3ZIM A;  3DDC B;  3M95 A;  2KN5 A;  4A8X C;  4IG7 B;  3DCG A;  4LDT B;  1FO4 A;  2BYF A;  3VUX A;  2KJ6 A;  2KQS A;  2FUG 1;  5IP4 D;  2KWC A;  2JT4 B;  4GDL A;  3VUY A;  3HM6 X;  1J8C A;  2LGD A;  3EUB 2;  2V3N A;  5JZE B;  4OVU A;  1MFW A;  2ZCC A;  2NMQ A;  4HVB A;  3DHI C;  4GN1 A;  2MBH A;  4MGI E;  4M02 A;  1D4B A;  1X1M A;  1N63 A;  4RFB A;  1PDX A;  2ZW0 A;  1PYW D;  3ZRC A;  3VVW B;  2LJ5 A;  2M17 A;  3U8Z A;  4PK1 A;  5LXH A;  4JGH B;  2VH1 A;  3RFZ B;  4B95 A;  3NHE B;  2SEB D;  5L83 A;  2XBB C;  2QIE B;  2L3Z A;  3X23 A;  1V80 A;  3LJ3 A;  3ONS A;  3AE6 B;  1V5O A;  1WYW B;  2KMA A;  3FIL A;  1I4P A;  1FNV A;  1FMA D;  2QMT A;  3EFC A;  2N4F A;  2K5P A;  2KWD A;  2CJO A;  4F8C B;  2ZVN A;  3PPA A;  3VH3 B;  4BBN F;  2JPH A;  1SF0 A;  2JZP A;  1F0Z A;  3HHM A;  2M56 B;  1WYG A;  3ZO5 B;  2I38 A;  2OOB B;  2BS2 B;  3RZF A;  1TT5 B;  5I4D A;  3AE4 B;  4RNA A;  3AXC A;  2IGH A;  2IGG A;  4YTP B;  3PHX B;  1YOV B;  2L00 B;  1V81 A;  1HQR D;  1P7E A;  3ZNZ B;  1N60 A;  2N7E A;  3AE9 B;  1MG4 A;  4N9F 4;  3E56 A;  1ISN A;  1ZXH A;  5HG2 A;  4WWN A;  1XO3 A;  1QQR A;  4RGN A;  1TY2 A;  5C3J B;  5LXI B;  3DBH B;  2KVZ A;  2IO1 B;  4W9I A;  2N9L A;  1B1Z A;  1SXT A;  1AAR A;  2MWS B;  3VR8 B;  2WXK A;  1YD8 U;  4LNN A;  3PS6 A;  3AU5 A;  3VFK A;  5AZF A;  2G4D B;  4N59 A;  4EFO A;  4KIK A;  4KKI A;  2ZZP B;  4HJK A;  3NRZ A;  2KC1 A;  2L76 A;  3TUO A;  1H4R A;  4DDI D;  2KLG A;  3W2D A;  4HPM B;  2MP2 B;  1ZUD 2;  4XZ4 A;  2JVC A;  3UF8 A;  1GUA B;  4E3C A;  4BOZ B;  5EE0 A;  3ZJV A;  1CZP A;  5BYS A;  3L13 A;  3NY5 A;  4PT5 A;  1OTR B;  2ZVO A;  3BZD B;  4M0W B;  3A1Q A;  4G11 A;  3HK0 A;  5C1Z A;  2MBE A;  1TS2 A;  3PRE A;  1WI0 A;  4RH6 A;  5GMV A;  1XEE A;  4CHK A;  1IYF A;  4DDG D;  3Q8F A;  3ENE A;  1SE4 A;  2HE7 A;  1D5X C;  1XCT L;  5T8I A;  1U4A A;  1WJN A;  1PGA A;  1MPE A;  2WGS A;  5BMI A;  3B1L X;  5FR6 A;  1D6E C;  3ML8 A;  3V6C B;  5H92 C;  3TJP A;  2ASQ A;  2BS4 B;  5AEK B;  3RNF C;  4XX5 A;  3ABV B;  1I4R A;  3IT6 B;  1YJ1 A;  1YNT E;  1TZ1 A;  3TL5 A;  5JHA A;  3DVG Y;  5BYQ A;  3TCA A;  1WGY A;  2QJL A;  2RDH A;  4JIO U;  2FCQ A;  4HLE A;  4NJ6 A;  2GOW A;  2PKO A;  2V3S A;  1A70 A;  2WXI A;  3AE3 B;  1TTN A;  2V3P A;  2BB6 A;  1R7S A;  4RGO S;  4RM9 A;  1OQQ A;  3CMM B;  1ESF A;  2LMC A;  5E6P A;  1VCB A;  2QSD A;  1NBF C;  3RT3 B;  5D3D A;  4MSM B;  3W9C B;  1BUI C;  2K8H A;  2IO3 B;  3A9J B;  1KLU D;  1QT9 A;  2YVC A;  4L2Y A;  1L2N A;  3ZJU A;  4FJY A;  1T5X D;  1TIF A;  3Q3F A;  4BOS C;  1F52 A;  2NVU I;  4HPP A;  3RUL A;  3SR6 A;  4KIK B;  3PVL A;  5FKA C;  3R7R A;  2KT7 A;  2GLS A;  4NNJ B;  3OAW A;  3AEE B;  2LGY A;  2B76 B;  1J7C A;  4ANU A;  4I6L B;  1GJZ A;  2C5L C;  1KH0 A;  2D3C A;  5E6J A;  1XQQ A;  1J0G A;  3EC8 A;  4TQ1 A;  2INC C;  2EKE C;  4WJP A;  5BMG A;  4O1N A;  2YLM A;  1PQS A;  2KNB A;  2PLP A;  5G5H A;  1JW9 D;  3W1Y A;  2FIF A;  4WJQ A;  3X0W A;  4PS8 A;  4MM3 B;  2LAS A;  3IBE A;  3MTN B;  1NYR A;  2C7N B;  4CYE A;  1IBX A;  3PRP B;  4N58 A;  2KXJ A;  4RCO A;  4L1B A;  1EWY C;  3AEB B;  4W9G A;  1ZOY B;  2IDY A;  3P4Q B;  3QA8 A;  4S0R A;  4A9A A;  1LFD A;  1I4Q A;  1SBB B;  5EDS A;  1GAQ B;  2JF5 A;  1M4V A;  1KOT A;  1FNU A;  2BPS A;  1D5M C;  4GDK B;  2PJH A;  3P4P B;  1YN5 A;  3AEG B;  4GSW A;  3WCQ A;  2L32 A;  4YTN B;  3NZS A;  2L05 A;  5IKC M;  3U52 E;  2LGI A;  2INP E;  3V61 A;  2L7R A;  2J53 A; 
#chains in the Genus database with same CATH homology
 4B6W A;  5IAA C;  2J0M A;  3WAN A;  1A5R A;  4ICV A;  1YIW A;  3DPD A;  3JYU A;  1JRU A;  2KLC A;  3T8M A;  2BKF A;  2CHW A;  3V60 A;  4DK5 A;  1IP9 A;  4BVU C;  2JRH A;  2CU1 A;  4WQO B;  4M8N A;  5DPR A;  4MJS B;  2FCM A;  4II3 B;  3AI5 A;  1Z2M A;  4W9C A;  2LUE A;  2QHO A;  3SDL C;  1OGW A;  2D10 A;  4DHZ E;  3M3J A;  3UQB A;  2DYO A;  3VXW A;  2LZ6 A;  3NS8 A;  2N9X A;  1SGH A;  2GBN A;  2O2V B;  3QAR A;  4A20 A;  1ZGU B;  1EO6 A;  4LJO B;  4MSQ B;  1QZE A;  3UIN B;  2IYD B;  2IBI B;  2C7M B;  2G3Q B;  3JVZ X;  5DCN A;  4KVG B;  2KHW B;  3L16 A;  2KO3 A;  4W9H A;  1Z5S B;  2HD5 B;  3CF6 E;  5CTR C;  2CS4 A;  2AWT A;  1V5T A;  1LM8 B;  4TV3 A;  2KFJ A;  1E8Y A;  3B08 A;  3C0R B;  2ZCB A;  1XD3 B;  2KDB A;  1XT9 B;  1WFY A;  3EFU A;  1C1Y B;  4IM2 A;  2RPQ A;  4BKS A;  3NZU A;  2KOX A;  3RYT A;  4A3P A;  2KJR A;  1LXD A;  3A9K B;  3WA0 A;  1KM7 A;  4XC2 A;  3VDZ A;  4J6I A;  3PHW B;  5LLI A;  1GC7 A;  4FN2 A;  3T9L A;  3ZIM A;  3A9K A;  2M0X A;  2HJ8 A;  2MSE D;  2NR2 A;  3DDC B;  3ML9 A;  2WYQ A;  3I3T B;  3M95 A;  3NOB A;  3ZTC A;  5E6N A;  4ICU A;  2UYZ B;  2KN5 A;  1WJ4 A;  2RSU A;  1P9D U;  4IG7 B;  3DCG A;  4LDT B;  4KZ0 A;  2BYF A;  3APD A;  3VUX A;  4IWO A;  2KJ6 A;  4GDL B;  1WX9 A;  2KQS A;  3TBL D;  3L10 B;  3PZD A;  3QIJ A;  4DHZ B;  5IA7 A;  2KWC A;  2JT4 B;  2N9E B;  4GDL A;  2BKR B;  3APC A;  3ZNG C;  3VUY A;  3HM6 X;  3H9D A;  1C3T A;  1J8C A;  2G45 B;  2LGD A;  2IO2 B;  1WX7 A;  4W9L A;  5JZE B;  2D11 A;  4OVU A;  2K8B A;  2PPH A;  1RFA A;  2KQ7 A;  2ZCC A;  4HVB A;  1D3Z A;  2JUO A;  4GN1 A;  3IFW B;  2MBH A;  2ZPN A;  4HPL B;  4MGI E;  5CHW A;  2NBW B;  2B3A A;  4K7U A;  1X1M A;  2LRU A;  2BYV E;  2C60 A;  3B0A A;  4ASW C;  3ALB A;  4WAA A;  4NAW A;  3ZRC A;  3VVW B;  1S1Q B;  4EOY A;  1HE8 A;  2WX0 A;  4ZRI A;  2DZI A;  2LJ5 A;  2M17 A;  3OJ4 B;  3U8Z A;  3VTU A;  5LXH A;  1Y8R C;  4JGH B;  1WXM A;  4F7Z A;  4IC7 B;  4B95 A;  3NHE B;  4DHJ B;  3RUI B;  5L83 A;  2M8S A;  2K6Q A;  2R2Q A;  2XBB C;  3DBR I;  2MA9 B;  3SHQ A;  1EUV B;  2L3Z A;  2KK8 A;  1V80 A;  3X23 A;  3LJ3 A;  5C23 A;  3HIZ A;  1NI2 A;  1SE9 A;  3ONS A;  4KDL B;  4ZRJ A;  3QX1 A;  3ZNI D;  2MX2 A;  1V5O A;  1WH3 A;  1WYW B;  1WF9 A;  4AP4 C;  2KMA A;  4YL8 A;  3H6N A;  1KJT A;  4DBG A;  3WAO A;  4FHK A;  2KJH B;  2NS5 A;  2N1V A;  4IWP A;  3N3K B;  2N4F A;  2DEN B;  2FCN A;  3KUZ A;  1LQB A;  5G2N A;  4F8C B;  2LVQ A;  2ZVN A;  4A3O A;  3EHV A;  3PPA A;  4GB9 A;  3VH3 B;  4BBN F;  3BY4 B;  3V6E B;  1WGR A;  2V1Y A;  2JPH A;  1K8R B;  2KDE B;  2R2O A;  3HHM A;  3QAQ A;  3RCZ A;  3N32 A;  1TBE A;  2PE6 B;  4FBJ B;  2MLB A;  4GXB A;  3ZO5 B;  1WR6 E;  2OOB B;  3DOW A;  4URK A;  3RZF A;  3WAM A;  3MJW A;  2KX3 A;  2FUH B;  3KUC B;  1S3S G;  3AXC A;  3QQ8 B;  1WZ3 A;  2LWP A;  2HTH A;  1WX8 A;  3PRZ A;  3S2A A;  4TKN A;  1V86 A;  1E7U A;  3PHX B;  2L00 B;  1WRD B;  1V81 A;  5D6J B;  3AUL A;  2AEH A;  2G4S A;  3Q3J A;  2JRI B;  4EZL A;  4I6P A;  4W9J A;  5D2M B;  5TR5 A;  3ZDT A;  3ZNZ B;  2N7E A;  2I1K A;  2XK5 B;  4KSL C;  2LXC A;  4EUT A;  4WWO A;  4GGQ A;  2O6V B;  2XK5 A;  1I35 A;  4N9F 4;  4I6N B;  1ISN A;  1WMH B;  2O6V A;  4RMA A;  1WMH A;  4WWN A;  5KHO A;  2IY0 B;  2K8C A;  4HDQ A;  2GMI C;  4MGK E;  3RD2 A;  4IM0 A;  2FNJ B;  2LVP A;  5LXI B;  4BKS D;  3DVN V;  3ZTD A;  2OJR A;  5CHV C;  1ZW7 A;  2KX0 A;  2IO1 B;  2M1M A;  1P0R A;  4W9I A;  3ZNH B;  2KWV B;  3R66 C;  1FXT B;  3VHT C;  1WGD A;  1UGM A;  3QK0 A;  1E90 A;  2RD0 A;  2CKH B;  3QCA A;  1AAR A;  4PYU A;  2MWS B;  2KD0 A;  2J7Q B;  1WM3 A;  1YD8 U;  3PS6 A;  1Q0W B;  2K39 A;  3AU5 A;  3DVG X;  3KUD B;  3VFK A;  1UZX B;  1F9J A;  5AZF A;  2GBK A;  4MGY E;  4ANW A;  2MBQ A;  4G50 A;  3VH4 B;  1L7Y A;  2G4D B;  4LDT D;  3ZLZ A;  2KVR A;  4HDO A;  2K25 A;  4WJN A;  3V62 A;  1GG3 A;  2N9P C;  4EFO A;  4KDI C;  3OLM D;  4KIK A;  4FAD A;  2BWE S;  2M4N A;  2ZZP B;  3PTF C;  4HJK A;  4ANV A;  2NBU A;  2KC1 A;  2C7H A;  2L76 A;  3DVN U;  3PLV A;  1H4R A;  1WJ6 A;  4BKT A;  4DDI D;  1UEL A;  2XEW A;  1P98 A;  2PEA A;  1E8W A;  2JZ3 B;  4BBN C;  1VD2 A;  2KLG A;  4KSK C;  4HPM B;  2RR9 A;  2MP2 B;  4NQK E;  4XZ4 A;  2K1F A;  2JVC A;  1R4M I;  3UF8 A;  1GUA B;  4NAW B;  2PE9 A;  2Z59 B;  2MP2 A;  4PS7 A;  4E3C A;  4EZJ A;  4K81 A;  2BGF A;  2DAF A;  2KDI A;  4BOZ B;  1WZ0 A;  1RAX A;  4MH0 E;  4MEM A;  1UBQ A;  2DAJ A;  3VTV A;  4EZK A;  5L95 C;  1OQY A;  4TQ0 A;  4ZDV A;  2MRP A;  3L13 A;  3NY5 A;  4K1R B;  3VUW A;  4ANX A;  4F1S A;  1J19 A;  1YX5 B;  1OTR B;  3A1Q B;  1I42 A;  3WAP A;  4DHJ D;  2ZVO A;  1UH6 A;  4M0W B;  2LI5 A;  3U30 A;  2KFK A;  3PGE A;  3A1Q A;  4G11 A;  2FID A;  1V49 A;  3HK0 A;  2GBM A;  5C1Z A;  1V9J A;  4EEW A;  2MBE A;  3BIN A;  3DBH I;  5DPT A;  2DX5 B;  1P3Q U;  1WXV A;  2KTF A;  2NPT B;  2D2Q A;  2MBB B;  3PRE A;  3JW0 X;  1WI0 A;  2NPT A;  5GMV A;  2DYM A;  4CHK A;  2KAN A;  1IYF A;  3TIX A;  3ECI A;  4DDG D;  4G3X B;  3ENE A;  2CHX A;  1Q1O A;  5JH5 C;  2MQJ A;  1Q5W B;  4GOC A;  2HE7 A;  2NBV B;  3IG3 A;  1TGZ B;  3GZN I;  4ZRK A;  4HCN B;  2AL3 A;  2MBO A;  3L0W B;  3WAL A;  5KHQ A;  1U4A A;  2BYE A;  1WJN A;  2DZJ A;  3B1L X;  2L8J A;  1OEY J;  2ZNV C;  3ML8 A;  4G0N B;  5FR6 A;  3V6C B;  2AL6 A;  1BT0 A;  5AZG A;  4GMV A;  2NCN A;  4X57 B;  4OVV A;  3TJP A;  2ASQ A;  3APF A;  5AEK B;  4WJO A;  3H7S A;  3ZW3 A;  3L17 A;  1WR1 A;  4NY0 A;  2FAZ A;  1E8Z A;  2FCS A;  3MHS D;  4XX5 A;  3KYD D;  3UIO B;  3H7P B;  3ZKJ C;  1YJ1 A;  3DQV A;  4W9D A;  4FA6 A;  1TZ1 A;  3PV1 A;  2K6D B;  1CMX B;  2D3G A;  3H7P A;  3QC8 B;  4II2 B;  1E8X A;  3TL5 A;  5JHA A;  3DVG Y;  3K9O B;  1WXA A;  3TCA A;  3UGB B;  2WDT B;  1WGY A;  3A4R A;  3L54 A;  2I1J A;  2IZV B;  2EMT A;  5HKH A;  4JIO U;  2FCQ A;  4HLE A;  2CR5 A;  4NJ6 A;  1YQB A;  4TUU A;  2GOW A;  4PYZ A;  2V3S A;  1V2Y A;  2AYO B;  4HXD A;  1TTN A;  1WY8 A;  3LDZ E;  4BKG A;  2O6V D;  1WIA A;  2IO0 B;  4LJP B;  1G6J A;  2ZNV B;  2LVO A;  3ZVV A;  4RM9 A;  1IPG A;  3CMM B;  4KZC A;  5E6P A;  1VCB A;  1NBF C;  4ZYN A;  4IM3 A;  3N30 A;  3RT3 B;  2UWQ A;  4AUQ C;  4MSM B;  2MW5 A;  4PS3 A;  3SU8 X;  1E5W A;  2K8H A;  4W9E A;  2IO3 B;  2ZEQ A;  1WM2 A;  3U7D A;  3A9J B;  3VAW A;  4K7S A;  3QHT A;  2KKC A;  3R3M A;  1WXS A;  4MJS A;  2YVC A;  3L08 A;  1L2N A;  2REX A;  1GC6 A;  3A9J A;  1V6E A;  5BO4 B;  5J17 A;  4FJY A;  4MGZ E;  2O2V A;  3R7Q A;  2BF8 B;  4LCD E;  3EEC A;  3Q3F A;  2GBJ A;  1T0Y A;  4BOS C;  4DWF A;  2NVU I;  2L0T A;  3RUL A;  4KIK B;  4AJY B;  1UD7 A;  3W1S C;  4JQW C;  1WE7 A;  2LRW A;  2ZJD A;  3PVL A;  4B9K A;  3PSE B;  3KW5 B;  3R7R A;  4BFR A;  4AOF A;  2RGF A;  3SD5 A;  4W9K A;  5E6O A;  4FJZ A;  3KH0 A;  4NNJ B;  4JL9 A;  3OAW A;  4AJW A;  2V4L A;  3RZW C;  2J0J A;  2LGY A;  2WX1 A;  2VRR B;  1WJU A;  4HCP B;  4IUM B;  1H8C A;  1SIF A;  5CHF A;  2LXA A;  4K7W A;  3IHP C;  4ANU A;  4JLC A;  4I6L B;  4MEL A;  4MDK E;  4NPN A;  1GJZ A;  4W9F A;  4HWI B;  2C5L C;  2Z0E B;  1R4N I;  4IW0 A;  2A5U A;  1XQQ A;  2CHZ A;  3P2B A;  2BWF A;  3EC8 A;  4TQ1 A;  1J0G A;  3OJ3 A;  3DBS A;  2J0K A;  2EKE C;  3HM3 A;  4WJP A;  3VQI A;  2KFK B;  4FJV B;  2YLM A;  1OEY A;  1PQS A;  3KYC D;  3W1S A;  1RRB A;  2JY6 A;  1WGG A;  2KNB A;  4FHJ A;  2DZK A;  1MG8 A;  1E7V A;  2JWZ A;  2KWU B;  2KTR B;  3W1Y A;  3WIM A;  3QJZ A;  3PT2 B;  4DXA B;  3KVF B;  4IWQ A;  2FIF A;  2KTR A;  3PLU A;  4WJQ A;  4PS8 A;  3D32 A;  3X0W A;  4NQL B;  1WE6 A;  2L0F A;  3DBL I;  2EMS A;  2ZPY A;  1M94 A;  3A33 B;  2Y5B B;  2LAS A;  3H1U A;  3IBE A;  3MTN B;  4FLH A;  4MM3 A;  1YX6 B;  5D94 A;  4HK2 A;  5J18 A;  2C7N B;  1UBI A;  3PRM B;  2JZZ A;  3QWZ B;  5G55 A;  4AWJ A;  4CYE A;  5DPW A;  1P1A A;  2DHZ A;  3PRP B;  2KXJ A;  2N1W A;  4FUL A;  1WGH A;  4W9G A;  3K9P B;  2LD9 A;  5D7G A;  4P7I A;  5AZH A;  4M8M A;  3UQA A;  3QA8 A;  1GNU A;  2KZR A;  1LFD A;  2A4Z A;  1EF5 A;  2GBR A;  3GOE A;  3ZDM C;  2IY1 B;  1ZKH A;  4GIV A;  5EDS A;  3TMP B;  4EKU A;  2WWZ A;  3ZUN A;  2KC2 A;  5CX3 A;  1RLF A;  4GU2 A;  3ZRF A;  2JF5 A;  1KOT A;  4WWP A;  4NJ7 A;  2D07 B;  2DZM A;  1EF1 A;  4E74 A;  4E71 A;  2BPS A;  1KLV A;  3CST A;  4GDK B;  3VTW A;  1NDD A;  2PJH A;  3A4S C;  3CSF A;  2LGX A;  4GDK A;  2JXX A;  2KMC A;  3AU4 A;  4GSW A;  2KDF B;  5DPS A;  3M63 B;  2C9W B;  4CO7 A;  2W9N A;  3JSV B;  3O65 B;  2Z0D B;  3UIP B;  3NZS A;  2L05 A;  3IVF A;  3JSV A;  2DYB A;  2N7D A;  5JHB A;  4RM8 A;  3V61 A;  2L7R A;  3M62 B;  4KV2 A;  5J2R A;  2MCN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...