1EO7A

Bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMAAVKHMPFGWQKSFMAAVNNYKPVFTFGAWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
molecule tags Transferase
source organism Bacillus circulans
publication title Structures of maltohexaose and maltoheptaose bound at the donor sites of cyclodextrin glycosyltransferase give insight into the mechanisms of transglycosylation activity and cyclodextrin size specificity.
pubmed doi rcsb
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eo7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eo7A01
2P1YA 4ONHA 5DJZB 1JF1A 1ROWA 3ARSA 4XPHL 2RGSA 3PWLB 4NKMB 4QRRD 5E8EA 4BQ5A 2I25N 3X3FL 1HIML 2ORBH 3VXUB 4RMUA 1BPLB 1ZOXA 3NAAH 3ZSTA 2ADGB 4XC3H 3WIFA 4C58B 1MQRA 1TG7A 4AC1X 2CLRB 4LOUC 3PDOA 3GM8A 3KWXA 3QIWA 4IDJL 3GSXA 3B9KB 5F96H 5GGTL 2DQFB 1C5BL 1NEUA 5F9JB 3EBAA 4M80A 5CP3A 2CQVA 4X80L 4GJTB 4WHYG 3RBGA 5HGHB 1UHVA 3G6JE 2XFFA 1ED3B 5HHQB 2CYGA 1GIGH 5DQJA 4K7PH 4X6FA 5HYQA 2EE3A 4XV0A 4R8WL 1AO7E 5I17B 1QNQA 1A0QL 5L7XL 5DD0H 4FNPA 3OTTA 5CAYB 3GJFH 2F58H 1WQVT 3GXFA 3TBWB 5IESL 3SKJH 3WDRA 2V7NB 3ARGB 3V5DB 2UUDH 1LO0L 3DX7B 2GFBA 1T2QH 2QLVB 1U3HC 4CNIA 2JALA 3U7WL 4X0KB 1GZPB 1I1CA 1GZJA 4NZJA 1G6RH 1R87A 3NCFB 4Z95H 4HUKB 3E3QE 4PJHB 3ELAT 1BD2B 4MA1C 3ROOA 3PV6A 5MENB 4NZFA 2PO6B 4N0YH 4PJ8D 3RWJA 1CD9B 5C9JA 2WC3A 4WJ5B 2XFXA 3F7VA 2FO4A 2ZNWA 4G6AC 1S9WA 1QYGH 3H42H 4YO0B 3SBWA 4QHMA 3BUYA 5C07E 1CXEA 4N0UB 3ULVC 2YUWA 5M95B 1JGIA 1MYRA 1NARA 2H3NA 4R27A 4P99A 4KJWD 3O2WL 1JF6A 5EC1A 1CR9H 3S97C 3BUBA 1GQLA 4XVJH 5JR1H 3NTCL 2DQDL 5FM8A 1B3ZA 4H26A 2NXYC 2I5YH 3SGJA 4UQAA 2J8UF 3U83A 3WQVA 3WH6A 1RK0A 3GKZA 2VC2L 4WW1B 5JDSB 1JN6B 4R7NB 1JGVL 3RNQA 1DLFH 1FZMB 4UOQA 1E6RA 3SCOA 5AZ2L 2D3LA 2GIYA 5C6TH 2XM2A 5GGVY 2QBWA 4UQ2B 1JFXA 5IB4A 4PMUA 4K2UL 3VXOA 1G7QB 5D7LD 1SJXA 3W5NA 1LHZA 4DW2H 1HKKA 2IPKA 4FQ1H 1KXVA 5FCSH 5CP7B 1WFTA 2EBNA 4M03A 3E8UL 4XCYA 5IBTL 3V6BR 2Z31B 3WHXA 4X6DA 4F7MB 1EVUA 3NPSC 4G6AD 2HTLD 4LDOB 1QI4A 2A77H 5CILH 3BH8A 1VADB 1E1FA 1MFUA 5KVDL 2X1XR 4K3DH 1TETH 2GUOB 5AAWA 2YPKA 3O6ML 4OCSL 2W5FA 4PSPA 4NZUL 5CMAB 1L0YA 5HYEA 5K9OA 1BGXH 1U91B 2ZCKH 2PCPB 5CSZB 3WF0A 3RILA 5IFTA 4DO5A 1US3A 5JW4M 3GIZL 3VGAC 4MDOA 3RJXA 1BX2B 4Q6YA 3LH2H 5DJ0B 3MLVH 1KGCE 5E0CA 5ADPL 2EDQA 4PYHA 3VSTA 1OSZB 1F90H 4PJIE 1HCVA 1V5JA 3MV8B 3WIHA 3MREA 5IWLA 4FFWC 3WHE0 3WFZA 4M6ML 3RL1B 2WLYA 4PG9A 2H32H 7CGTA 2VDPL 4N9GA 4PMRA 2VDQH 2WAHA 2X89A 3DURA 3HPJB 5IJVB 4GI8A 1T4KB 4KRNA 5C71A 5GGSB 3ULVL 4YDJA 1J8HB 4BK5A 1PSKH 1WEJL 1JZ3A 1D9KD 3SE4A 5DFAA 5BXSA 2D3NA 3FO2B 5IVZA 1EHNA 1U8MB 2P5WD 5K59F 1YYLH 4YJZL 4MAUL 1MAML 1T6VN 2CKBB 4XBPA 4U1JA 2AK4E 4JANA 3PJSB 4IRSB 2CK0L 1G0XA 2VWEC 2ZICA 5BWFA 3VPLA 1AC6A 5C2UB 1XEDA 2AK4A 5E94B 5GRYA 5FYJL 4Q9RL 3RZCC 3FFCA 4TULL 5BV7H 4CCEA 4JAMB 2HT2D 3MBEB 2AEQH 3A3HA 2KDGA 1NC4A 3D18B 1UR0A 3VD7A 3HHRB 3PP4L 2A3BA 1UOKA 3V6OC 3W39B 1PGRB 4TTGA 2YLAA 3GMOB 2RFXA 3F58L 2XN1A 3CK0L 4FQXD 1S7VA 4EXPX 4YX2L 1JDDA 2G75A 3SPVA 1JNNH 1CWYA 1MHHA 2DYPA 2HN7A 4KUCD 2A6JB 4E41B 2ATPA 3K3QA 4JZNB 3D2UA 3AHXA 3GH4A 5IB1B 4KRTA 1TNMA 3IJHA 1HSAB 1NCAL 4L29A 4Z76B 4Z7QE 3HG1A 4ZFOL 1H3PL 3L7FA 3EYUH 1AKJA 1I9EA 15C8H 1CLOH 4MMZC 1HSBA 1J87A 4Y2DD 1BOGB 4ONGH 1E43A 1HJUA 1KPUB 1CICC 4GBXA 3N9GL 5KSAC 3O41A 4QT5A 3LZFH 4HAFA 1ES0B 3UTTD 2WSKA 4Y5YA 3A22A 1AO7D 1BQLL 1BVLA 1FNAA 2BJMH 3I75A 4JKLA 1GVIA 5F1NA 3S35H 4HSQA 3W38A 2FGZA 3S98A 1PZ2A 1KXVC 4X8XA 3BDYH 2OMBA 3MRDB 3HKFA 5JHDD 4OCWH 2DJSA 2YA2A 3FO0L 3NFNB 4FNTA 4NQDE 1G9MC 3Q5YA 3T3ME 3LEVH 4NRYA 1VEPA 3TJHD 4IHOA 4XPFL 3BSZL 3K2UL 4L8CA 3OGSA 1KQZA 5T1LA 1S7TB 2V5TA 3O2LA 2JFEX 1P84J 4JZ5A 1F2QA 3BAEH 4ZXLA 3UESA 4IEFB 4G9FA 4MA7L 4FLRA 3OR6B 1R5WB 1ZHBB 3T8XA 4MXVE 2BVDA 3MMEB 3VFGH 2GK0A 5DRWB 2KL6A 4JY5H 1LWJA 3D39A 3GSRA 3TBVA 3S36H 2XQBH 3C5ZC 3E3QC 3H2WA 3BSGA 3BUTA 3OKLA 2X44D 2X2JA 3OXSB 3KLAA 4CCCA 4BSVA 5D6DC 4GO9A 2UZIL 3AMDA 1KN2H 1E27A 1SM3L 2VH5L 2EDBA 3RZCD 3VMOA 4NO0D 2X0YA 1FNEB 3KPMA 2ZIDA 5KSVB 3UTQB 4TUOA 3HB3C 5DS8A 5KVEL 1AHWC 2NR6D 1ZL1A 2ESVE 3FN3A 2F53B 4LLVB 5BROA 3QT2A 5EO9B 1VACB 1LL7A 2XNAB 4KMTL 4EUPH 2GSGB 4HPHA 2VXSH 4UIMA 5T1KA 1EEZA 3CSYB 2LU3A 1VDGA 1DN0A 1WUNT 5CJXC 4WTZA 5D1ZC 3CZLA 3O2DA 3JBG7 3BT2L 1AIFA 4GZEA 4JQVA 1LEKB 1OTTD 3OKDA 1P4LA 4ZUUA 3TM6A 3W9EA 2R39A 3GSUA 4XC3L 1WO2A 4NGHH 4X4YA 1CGVA 3C5ZB 4NO0A 3FJTA 3RZCA 3QQ3A 4XNZC 1EUTA 3IFPB 1KYOJ 5E6ZA 1CFSA 3GSVA 4MXQD 3PUCA 2VXQH 3UJTH 1B0GB 2PXYA 5KSBB 1RULH 1HHIA 3U1SL 1MQQA 5CJ8A 4KQ3L 3HG4A 1PS3A 3W29A 2BSED 4APQD 3MJ7B 4HKZA 4LCYA 4K94C 1HHJA 4HXBH 4P3CH 5A2JH 5DD3H 2IH3B 4LAQL 1JV5B 25C8L 1WWWX 3IJSA 3ZE2F 1OM3L 1RAMA 3I2CL 3CUFA 1IC5H 1CEOA 4JFED 5C8JA 3OR7A 1KLUA 5HYFA 4M5ZH 2G8ZA 4TQEL 1BZQK 5FF6A 4JQIH 1HYSC 5DK0B 1JPSL 3F7PC 4I4WA 2G5BA 5IMMB 5FUZL 2NX5A 4M1DL 2B5IC 4U31A 4YFLF 1PG7X 5JHDA 5CWSA 2FEEI 3ALGA 1OGAA 4KTEL 5DT7A 1FFPB 2NR6C 4MWFA 3HRZA 3HTLX 1BBJA 3MRNA 3S7GA 5IK3A 1QW8A 1CPUA 1LLOA 1TA3A 2PBGA 5JBFA 3GMLB 4IIQC 1P9MC 4UQ3A 2VX4A 3UDWC 4HPYL 3EO9L 4XX1E 2OJEB 3NZHL 4JFOA 2ARJQ 3H3KA 3C5ZD 2E3ZA 4HWBA 3PZ9A 1G9NH 4XMPH 2OR9H 4RFOH 2NY0B 1YN7A 2AI0H 4JVWA 1AQHA 2EPOA 3R0MA 3MMUA 3O2VL 1BFOB 2HH0L 4DUXA 2DT0A 4J3VA 1TZIA 4NQEE 3DTXA 4DAGL 1GC1H 3SO5A 4L4TE 3AREA 3T4AA 2VXUH 2PYFA 2G60H 5HGBA 5FECB 4S1DD 4WUUB 1DBAL 2AV1A 4HF5L 3UTOA 3TOPA 3BIAX 5E8PA 2MKLC 5JLZB 2VZOA 2YLLA 4IM8A 4JL1A 5LAXB 1EDGA 4JDVB 4L1DA 1SY6L 1MRFL 1LL4A 1C90A 4MDIB 4NN5B 2C26A 1B0IA 3O3UN 5E99L 2VLMD 4Y88A 4W88A 4ODSH 4XUYA 1XYZA 1SJHB 1UYWL 2YD5A 1AQKH 5EH1A 4PGBB 1HKMA 4Z6AT 3O6FD 4IRSC 4U6XA 5E2TL 1IC7L 1OSPL 3FL7A 4KGJA 1H3XA 3MZGB 2FDMA 1WAWA 2I27N 3TA3C 5FO8B 2VLKD 3KXFE 2OYKA 4GIAA 2BNRD 4XNXH 4AD0A 1I8MA 5JIWA 1MI5E 1ACYH 1L7IL 5F1OB 2FHCA 2I24N 5ICZA 5LCVH 3BD5A 1QR1B 3D52A 4KVNL 3ULUF 2XVKA 4CKVX 2BP3A 3V5KB 2O9PA 4OUOA 5KANG 2OSLA 1RZ7H 2DDXA 1FRGL 5HVHB 2XWBA 1EX0A 4XNYH 3BP4B 3WIHH 5ABEA 1ZS8B 2R2BA 1E73M 1DBJH 2Y5TB 5KW9H 1XSKA 4PJXE 3MYJB 1UD3A 2Z4QA 4AEIH 1I7RB 4NO5A 4WHCA 4KY1L 1XF3B 5D1ZA 4Y7EA 1PG7W 2OS7A 4KK5D 5HHPA 4PV9A 3GHEL 2FJGB 1MFBH 3I9GL 4NT6B 2GJ6B 1MW3A 1L6ZA 2Q1EA 4M1GL 4NHCL 4H25A 1KXQE 1OAKH 3QPQC 3S88H 3ILQD 4U0RB 4CCDA 1ZBKA 5B8CC 1NCCL 3MOQA 1Q0YL 4OM1H 1VPOH 2D23A 3JV0A 4JFHE 4OLZH 5CEYB 4AL8L 5ISZE 4HH8A 1SZNA 2EDNA 5GS0H 3HC4H 4KV5F 2Z8VC 4XZWA 4F15B 3X14A 1OLZA 2BC4B 4P2QB 5BZDA 3TYGL 2VTFA 4ALAL 3DHUA 3FO1A 3G6DL 4CVUA 2DQTH 4Y5XB 3UYRL 3EFFB 1KN4L 2F54B 2GITA 1XCTB 5E2WH 3QG7H 4DO6A 2PYEA 5AYBA 1WE5A 2EQDA 4NN7C 3CC5A 4Z7VE 2CK2A 2OYMA 1WBZA 1QA9A 5CG0A 1V03A 2FBOJ 3O3AA 4L4PA 3MCLL 5DYOA 1DLFL 3VXQB 1UVQB 2F74B 3NIDF 2XVLA 5JORA 3UEQA 4XP4L 1N5AA 5FL0A 5HOSA 4YPGB 3ARBA 4JFDB 1MJ8L 4PRHB 5K9QG 3RDTC 3KYMA 1FYHB 5FM4A 2DTML 1IAII 3T08A 1W91A 1IGTA 3KYAA 4HFWA 5D2NE 5JIIA 2UWEE 2R8SH 3BJ91 4U1HB 4WHTB 4AEHH 1S8DA 2ZCLH 15C8L 1P53A 1GAFL 4GRLA 2C0HA 2HFTA 2IAMC 4JPVL 1I3RA 3BYYA 5GSVB 5KVDH 3MODL 2EDXA 3U6RA 5LKNA 5I1DB 1C08B 2W61A 2FJHA 4LYRA 1NUGA 2HFEB 4BH7A 4HWZA 3A4XA 1A22B 3OKNA 4FOMA 1KCLA 8FABA 4I3RL 3RVUD 3WN5A 5DMGC 4YXLL 2DH3A 3FB5A 4MLIA 4RNRB 3DETD 1LP9B 4KMQA 4C54A 5CKAA 2OX5A 5IHUH 2YSSB 2CUMA 4ZPVA 4U1SA 1SJVA 4OUEA 3VGHA 1FHGA 3WIJA 3QFJB 5FHAL 3RWCB 1F90L 2Z1KA 1SYTA 3U7BA 3F5WB 1QSEE 4KI5D 4YHZH 1KEGL 2HTLC 1IJ9A 3G9VA 4LKCA 1HJSA 2IPUG 1KXTA 1I1WA 2LU7A 3HI6H 3RWDB 3P4LA 4PJCF 1FBIH 4ZO6A 4I2XB 3ECQA 1MJJB 4FQXC 1R3KB 4N9OB 2CBIA 1FL6B 3BZFA 4LSUL 3KNBA 3WL9B 2D20A 4GG8A 2J12B 1MFCH 4ELMB 3OAZH 3CXDL 4N0CD 3DVGB 3QNXB 3OKMB 2F54D 3QUYC 4MAUH 4AMXA 1ORSB 2Z31D 3AYSA 5HYSG 1FG2B 5B8CA 4GW1B 3L3HB 2Q76A 1CZ1A 2ZOLB 2Y23A 3FQTA 3QIWD 4P2QD 2R23A 1UQZA 5HHOA 1CLZH 2B1AH 4ZUWB 2APXA 3AQUA 2X4TA 4I18A 3MRQA 3IDIB 4Q9RH 1MH5B 4Z0BH 2VIRA 1DWAM 4QRRA 1F3DJ 3O8XC 3QFJE 1V3KA 4ZMAT 2PNDA 4P5KB 1S7RB 4JDTL 1FORH 3EOTH 2BSSB 5IW1A 2MNUA 1R7OA 1A6WL 5DT1L 4YIQA 3IJ7A 2ZWYA 4WI9A 1EHXA 4F33B 3X3GH 1ZT4A 5D9MA 1W9BM 1RIUL 3OZOA 2BNRA 3AMLA 4OLYH 3IU3A 4ZAKB 1PKQA 2NY2B 2V5RA 5A6KA 3MRPB 3U7YH 3DHPA 4JFTA 3O6FA 4HX1B 2V38A 4W5ZA 4PREA 1NDMB 5CBEB 4A2LA 4UFLA 4MPKA 5FYKH 1XF2B 2J5LB 3SDDB 4ORGA 2DLIA 2EABA 3AS3A 3QI9B 4QXUH 5IVXE 3QISA 4R2GC 3MCKB 2V3EA 3BPNC 2P49B 4RFNB 2OW6A 1AXIB 1JGUL 3EYQC 1C5DB 1C93A 4HIJB 1NWRA 2HG5B 4U33A 3JUGA 5L9DL 3WD0A 2CXKA 4JE4B 2EIEA 1ZVYA 3SDXB 3D39E 2WMIA 2DT3A 4AZ6A 2BY2A 1MQKL 1NUNB 2FD6H 4G8GD 2AXJA 1KCRL 2ED7A 4RMTA 1ZLWH 2WWDA 2AEIT 3TNMA 1I8KA 1UR4A 4G8IA 1H2JA 5A6JA 5TQ2H 1TVPA 4BFIA 4O02H 4EDXA 1LDPH 2XZAL 5F88B 1OAXL 4LL9A 1AGEA 1E4KC 4LCWB 1BJ1H 4LSQL 1G9HA 2MANA 1NGZB 4MAYB 1KJMB 1XSIA 2J3SA 2O5YH 2XRAL 3CLFL 4XT1C 5ESVB 2CKSA 3S5ZA 3BJLA 4M00A 5ALCL 2I26N 3PL6B 1WC7A 3GSWA 2XY1A 2EE9A 1O0VA 4WO4D 2DMKA 1C12B 3AOFA 4XPTH 1HWHB 4E42A 1TR1A 5BMFL 4XCCH 4JKMA 1KBGH 5B38B 5JNYB 5I18H 4XNUH 3VD9A 3MV7E 3P4OB 2A2QT 4IMLA 3UYPA 4JQXC 2YPVL 5FHBH 3MRIA 1FJ1B 4WY7L 1D6EB 1P2CB 3ZO9A 3ARWA 4HULB 4HGWA 4ETQB 5A2LH 3U9UB 1HXYB 1PX4A 5SWQA 1ZHKB 4IMKA 4JFEA 3WJLC 1R3LA 1Q4NX 5F71A 4MNHA 5ILTH 5KSUB 3QCVL 4B15A 2R2CA 4NQTA 1U92A 5F1KC 4AENA 3H6JA 1F97A 1OAYH 3PGFH 1KIPA 1MFEL 2OJZL 1A2YA 5J8OA 4Y4FB 1JNDA 5CJBA 2FB4L 3MMWA 1RUML 1IM9A 2LU4A 4JHZA 1R85A 2IQAB 4RSVA 4BH8A 4XWOD 4GAFB 5D2NA 3QZWA 4KKCC 4F37F 4QOKA 4DWHA 3AIWA 1U93A 3QGVA 4DOHE 3O6AA 5HY9A 5KN5A 1SBSH 5F6HJ 3KDMA 5MI0C 2A3EA 1DUYA 4Z5RA 2DQIH 3SCMA 3WNNA 2EXOA 3BKCL 2XGIA 3CZ8A 2PXYC 4JG1H 3EJTA 1W3JA 1AQMA 4U2YA 4O5LL 1OTSD 3VSVA 3QCUH 4TTDC 4MNGE 4XPAL 1CLXA 1K5NB 1VA9A 2C3VB 2H2PC 3BOVA 4GSDH 5F6IC 3ZHKA 3ULUL 1U3JA 4HUUB 1YDPA 3UZQA 3VWKD 4LAQH 2D7MA 4APQB 3D3VA 3H0TA 3SQOH 3ULVE 3MNZA 1CQKA 4ZODA 2FATL 3BXNA 1W3HA 1BFTA 4UIKH 2D7TL 4X6BA 4OZIB 3MNVA 4LMQI 2EO9A 1DDHB 1CVSC 5EG6C 3MI6A 3MRJB 4R26H 1QEWB 2UWEF 3HE6D 3QNZA 5A3ID 1CD1A 3T65B 3IS0X 2WWMD 3AM8C 1KPRB 3MXVL 3UR7A 1M05B 1MHEB 1E4KA 2K7PA 4Z78B 1JHKH 1ZVHA 4L3AA 1NBZB 4LEXL 1UCBL 3F7YB 4XP9H 4I5BA 1OP9A 4D1IA 4WV1B 3QIWC 4X8JB 5JQ6L 1K6QL 4DM1A 1WNOA 5K93A 2X4NA 3PL6C 3BGMB 4WFED 1N64H 4NCDA 2WWMC 5CGYD 5EBGA 4P9HL 3S96A 3BW9B 3SKOA 1TENA 3FNDA 4XCFH 4UT9H 2D7OA 2OR9L 4RFOL 2BNUA 4E9LA 2GTZB 3IETA 1NFKA 3LCYA 1UH2A 4ZTOL 1NQBA 4RAUA 4RQQB 1AO7A 3BUIA 1ZA6B 1XF5A 4XP1H 1Q9WB 1JPGA 3FTGA 1MWAH 1CG9A 1DVFA 3WJJC 2C8NA 2ICEA 4BQBA 3BHBB 4KWUA 2R1XB 4BFEA 4Y2DA 3NYDA 3S3SA 1S7UB 3WBDA 2DQCL 4LX4A 4LLWB 4PIRF 3QI9C 5DSCA 2F9BT 3W81A 3DWTA 4RISL 1UXWB 4LVNB 5I1AA 4ODHH 3PTQA 3CSBA 5MHSE 4EOWL 4PUBH 2MCPH 3D2UD 3WFDH 4UTAL 1Y0LB 4PGDA 1AQKL 2RBLA 3SGKC 1R0AH 4X6CE 5IVXA 2XXMB 4S10A 4JFQA 1D5BB 2QR0A 4JR9L 2QPUA 3SCPA 3HAEG 2DDQH 2B1HL 2XZCH 4G8FB 5EFIA 5IBLC 1H0IA 4JPVH 2PW1B 2R0KH 3PWNB 4GXVH 3W0KA 1TJGH 4D6GA 1KXQA 3IXTA 1HJQA 3GHBH 3AXXA 3RIAF 4HIEB 1UZ1A 1JVKA 5EPMA 5I19H 5D7JD 4FNUA 2AJXH 3P0YH 2NY1D 1XGYL 5CSGA 5DJ8A 5EUKA 5BVJB 4MSWB 2VXTH 1IC4H 5BJTA 1NC4D 3DROB 5D4YA 2MHAB 2ESVA 1F2XK 3HR6A 3OG2A 1INDL 4NZRH 3EZJB 4KROD 3F6IA 2AK4D 2YKLL 1RZKL 2HJFA 3VG9B 4B9YA 4X99B 1XGZA 1ZLUH 1KELH 3THML 4QP0A 1JZ5A 1S7QB 1S5IL 1MEXH 1ZTXL 3CXHK 2PYEE 3V5HA 5I1EL 1DBKL 1XGPB 3N85H 4Y4KB 1ZHNB 1U33A 1OM0A 2MQ3A 3QUZC 3CX5K 5DUPH 4OLVL 1PQZB 5KANI 5HYIA 3RY6C 5J6HA 3HLAA 3CX5J 1E6SM 2R2EA 4OZ4B 12E8L 3P0GB 1JYVA 2DQJH 1B3XA 5EUOA 3RVWC 4B3KA 4X83A 3WO3B 4K9EL 3BPNB 1U8NA 3V95A 4ZENA 1H15B 2OTWB 3I02B 4BF7A 3DMMD 32C2A 4RAVB 4L4VB 1HQ4A 5HYJB 4LVOB 1AXSB 2VE6A 4PMOA 4MHHG 3QG6A 3LDBB 5EORH 4MD4A 1U95B 3VIPA 2ZOKA 4NQCA 4JO3L 3S37X 1E4XL 5IFJB 3WEOA 3MRFA 1SYSA 3VMNA 5LBSH 4OB5L 4PJEA 4URIA 2FLRT 4P3DA 3RHWK 3HPLA 5DJDB 3H9ZA 3IJYA 4ERSH 1XGRB 2Y6SD 5E2WL 3LMJH 3TC9A 1EA9C 3I6GA 2GQHA 2YMXH 5CD5D 3W27A 3S5LG 5JHDE 3O45B 4TNVF 4Y5VC 5D6CB 1NCWH 1W1PA 4GW5A 5FAAA 1TNNA 1GPOH 4KKBC 4EIZC 3P9MA 4JFUA 3AM8A 1KQYA 1CGSH 4IOFD 3AAZA 4CD5A 4ONOA 1VFMA 5DEGB 5I8EA 3DBXA 4PRBB 5J56B 3L5XL 3CVHB 4DWSB 3DC0A 1JYNA 4J27A 3CHFA 3BZ4B 3QSKB 2ERJB 2XA8L 2BFVH 1Z32X 4TUKL 5I8KH 3VA6A 1A6VL 1VKXA 2A38A 2W07A 3BSHA 2X10A 3U30C 4NKIH 3V7AG 1T22B 3WUFA 5CJ5A 4Z7UE 4MA3A 3GI9H 1H8SA 4FLSA 2P8PA 4UOW1 1MVFA 2A83A 4PD4J 4PRAB 1OT2A 3D69A 3BVWA 2ITCB 1KEMH 4IRJC 4IRZH 4G6JH 2DL2A 4NOFA 1NBYA 2HFGL 1JZ4A 1NCAH 2VVSA 2CKBH 4P48A 5IHUL 1FLRH 4IJ3B 5LG1A 4LDLB 5KS9F 3BXWA 2FYYB 3UR8A 2B4CL 5JXAH 4L8SB 2D03H 4HS8H 2Y8KA 5D7LB 3HMXL 2H9GA 4YHYC 4L9LB 1UEMA 4TVSa 2WINB 3WNPA 4MAZA 1DCLA 1QOKA 1E6JL 3CIQA 4LFHD 3BE1L 1R8LA 4NKDB 3WMCA 3VXNA 1IZJA 4PYSA 3EYFB 3DUUB 4PJHE 1HL8A 2ZX7A 4KJQC 3BN3B 4YHLH 4HIXL 4FQHB 3ZE2E 1XF4A 1A5FH 4GLRH 2IAMB 3MLSL 3SCSA 1W72H 1XR9A 5ANMA 5DJ6A 5FA4A 2HVKB 3MRGA 4RGOL 7FABH 5IMOA 4D9RE 4O58L 1G94A 1GGTA 4WTXA 1RU9L 3CZFA 3B6SA 4XAWH 3T4YA 5HD8D 2B4CC 3DYMA 1PD6A 4NNPL 1GC1C 1UB6B 4N1EA 1ISZA 3KWWA 4PPTA 2ZCHH 5D1XA 4WRLA 4PJ7A 1MLCB 1N3NA 4NJ9H 5DJCB 3S34L 3VXMB 1NM9A 4JQXA 4LSRH 3RM8A 5J7CC 2R4RL 4LPXA 4ZPTB 5IM7B 2MFNA 1L9MA 3P4NB 2P46B 1FGNH 4D0CA 1GRWA 3EJRA 1YMMD 4CMMA 1A1MA 5BZWA 3RUGF 1WAAA 3GO1L 1Q6FA 3ARDD 1T1XB 4FQPA 1RUAL 5DR5L 3SCRA 3NAAL 3QO0A 4XMKH 5AD0B 1FH9A 4PTTA 1WPCA 1BEYL 1AJ7H 4QCEA 4S1RL 1H8OA 4G9FE 4HZ6A 5E4EB 1MCFA 1U8OB 3D25B 1W9DM 4Z7QF 3T09A 1PBGA 3MBXL 3VD5A 5ADPH 4TVUA 3FO9B 3REVB 4P7QA 5M3WA 5IIEA 4NC0B 1KLGB 4MQXD 1K8IB 5HVWA 4YQXL 5D5MA 1EQPA 1UXSA 3GK8H 1CL7H 4F7TB 1H5VA 4KHXL 2VITB 1SHMA 2QKIA 5H35A 4NBXB 5ADOH 2VLRA 3F7QA 1RZIA 4X6CF 1IQWH 3L3OA 4HUVB 1KTKE 4D9LH 4Z7VA 4HAGA 2I07B 5LVEA 4F79A 3V2AR 1EXUA 4Y16A 1P7KB 1E4LA 3T3MF 1EERB 2J8UB 4Z95L 2XZAH 3VRIA 3HZYB 1W72B 1T5XB 5A2IH 3ZO0A 2GJZB 3V4VH 2YJQA 1KTDA 1OM3H 4FABL 1TCMA 5I1IL 2JJSA 4EN3D 1QSFB 2CEQA 2E9WA 3ULUE 1MHCB 4PJIA 3LZFL 4U3CA 1A4JB 2ZG1A 4LCUA 1BAGA 4OI9A 3B2UC 1PBYA 5FYLL 4IUGA 2VLJB 1HKLH 1TQWA 4IDLA 3K0WA 4YUEL 2YL5A 4UT9L 3MSGA 4P2CG 3U0WL 1T1WB 1XT5A 4C7DA 3RKDD 2OWCA 5I2UA 5EC2A 5E2VH 2NXZC 4NSKA 2VDOL 5EWIL 2GK2A 4KTEH 3VM7A 2VRJA 3AIQA 5E03A 1WF5A 2GCYB 1JCKA 3BWAA 1WZKA 4NRSA 2IMNA 5DC4B 1PIFA 3AIRA 3ZE0E 5T3XD 4MNGA 5FM5M 3TJHC 3SE3C 1EO8L 1C8YA 2XFRA 2BHZA 5F93C 1CBGA 1NGXB 1QSEA 5DJXA 3CH1A 4HKXA 1IGJB 3D85B 5EOCL 4KXZH 4WU7A 1S78C 5HI5D 5IFHL 2V5SA 3G6JF 4G6ML 4LNRA 2MCPL 1JGDB 1XMWA 3D50A 5EIIB 4GKZA 4C56E 4P2RE 4TTUA 2DTSA 2VB5A 1H5BA 5FK9A 5BS0D 1ZGLM 4OZFG 2O9OA 1T04A 5ABHA 2NY0C 4K55A 3VWJC 3V52L 2BNJA 3IF1A 2BVQB 3V8OA 2GEEA 6FABL 1U8LB 2G5RA 3ZE1E 3GGWA 5BV7B 1P4BL 4Q2ZB 3VFTB 5EU6A 5IKCA 3U5YA 1K8DB 2AJVH 4ZFZB 3HU7A 3QWRD 1KB9J 4WI5A 4P0DA 2Q20A 5I3DA 2ZNXA 4NQXA 5F7DB 3VFRB 1OAQL 4UV7L 2JTDA 3LSOB 3M17A 3PWPD 4HA3A 1DZBA 3CFJA 1SEBA 1BAFH 2HT2C 4ZOCA 1A6UH 4K23L 1MY7A 2VQTA 1TQSA 1QNZL 5E9DA 1Q72H 4P5MB 3NA9H 4R4NC 1F6FB 2J8GA 1X44A 1OGTA 3QOMA 2FZ3B 4MS8D 4L3CB 5KBNC 4AD2A 3ULVD 3WUGA 4FTVE 1T2QL 4LSSH 4ONHB 4CD6A 1JF1B 2NPLX 3PWLA 3RDTA 4LEOA 1FYTE 3CVIL 5DQDH 1RZ7L 5HVFB 3K1KC 5LA0A 3P30L 3CSGA 4S3JA 2MQ0A 3KPLB 2CLRA 4E41E 1P84K 1DTUA 3B9KA 3I2CH 2DQFA 4PTWA 1PX3A 2RCSL 43CAA 2IFFH 3KVQA 1UD6A 1GOWA 5I9QB 2PWHA 2GT9A 4LHUB 5HHQA 2A3CA 3F6LA 1E4XH 4GXPA 2FIKA 3RTQB 4PBGA 2DQDH 2XN9B 5LGJB 3M7SA 1PY9A 1RIHL 4KJPD 4OD1L 3I84A 4G8EA 5GS2H 3ARBC 5I17A 4KRPB 4UINL 1E5JA 3N9KA 3CK0H 3ZR6A 3TBWA 3U0TA 3ZYZA 1YEHL 3ARGA 2NY5H 3BQUC 3HC4L 3HUJE 4Q58C 2QF8A 1WBYA 2EDWA 3WQ5A 4TNWK 1DBBL 3DX7A 4PTUB 4GS7C 3CX2A 4CNIB 4N8CL 4X0KA 1GZPA 4HKJA 3CZGA 4TOYL 2EEDA 3QR2A 3QZWG 4Q22A 4OIFA 1FFOA 1BD2A 4GKNB 1DQJB 1W0VB 3PV6B 5KVGL 3QXDB 1YPZE 4ML4A 4KJQD 2PO6A 3RWJB 2W9DH 3F7VB 4UDTA 4URTB 3B3IB 4RGND 5L2KB 4F9LA 2FO4B 4PR5B 4YO0A 3L7EB 4NZUH 1OGGA 4QHMB 1DQDH 5D5ME 5GIRB 4N0UA 4D6EA 4UT7L 4QWWC 3S35L 1DBAH 3IFNH 3I6LD 5C0BD 5TE4L 3UO1L 5E2JA 2CBVA 4MQTB 3IJ8A 2QHAA 1JI2A 5K9KB 4H26B 3PE9A 3WHE1 4UNVA 5MP6L 2VL4A 3QULB 4AT6B 1RK0B 3RGVB 2E7LC 1QFPA 5DHYA 4GQPH 3GH7A 5TE7L 4WW1A 3SE4C 2F8QA 5JDSA 2GJPA 4Z2IA 3JUYA 4EI6A 1QBLH 5JUEH 4JFHD 3L4UA 3A6BH 4UQ2A 5IB4B 3NZHH 4PJEE 5TQ0H 3VXOB 1G7QA 2EDHA 3OB0H 4HIIA 2FH8A 3N50A 1YY8B 1ND0A 5CP7A 5FDWA 1MEXL 1ZTXH 2DLEA 3P40A 4JY5L 1DQTA 3RI5K 1ZEAL 4IRJD 2MOVA 3WHXB 4X6DB 3WH8A 5GZOC 4F7MA 1KJ3L 5C0ND 2A0LC 4HJJH 4PJAE 5F9WC 3PZIA 1VADA 1RUKH 3BKJH 5CPQA 3DUSA 1YPZF 2GUOA 3ARYA 3OAYH 3TO4A 3VE0A 3BZEA 5D72H 4LQFH 4AG4H 4B9ZA 3FOMA 4J12A 1OCWH 1MOEA 5K9OB 1U91A 1IGIH 1K3IA 1MCBA 1QFWL 2PCPA 4NC2B 1OVZA 3UTZA 1JHTA 3C5SA 5HHXL 1IKNA 3I3DA 4LPUA 1QI0A 2V9TA 1BX2A 5A2FA 3B8YA 1HHKA 3FQXA 5FFLA 3MROB 4LASH 1OTUC 4OD3H 1FVEA 4LSUH 2IANA 1OSZA 1XIWA 5LBSL 5D1QB 2H45A 2LAAA 3ALXA 3MV8A 5HI3C 4CVWA 1CICD 3MREB 2XUCA 1JYXA 2Q3AA 3RL1A 3IDXH 2R0WL 1UWQA 4Y2DC 3CUPB 4AZHA 2PBOA 2VOTA 3T0ED 5C7XH 4N9GB 1QLEL 5IJVA 1P6WA 4KKLC 5GGSA 4F8QA 4EI5A 1J8HA 1ZJAA 1E4NA 2DQHL 3MRMA 4PRPB 1NLBL 1UYQA 3QIBA 1W32A 5C0JB 3FQRB 4NQDB 5CD3A 3EUUA 4X9FA 2WW5A 2C3XA 2CKBA 4XBPB 4U1JB 4YZFF 3GRWH 2WXDM 2RR3A 3QEGH 4XMLH 1Z9LA 3PJSA 1A6WH 1MI5B 1UWXK 4JDZB 1W8NA 3X3GL 1E70M 3MA9H 5GGTH 3WFBH 4U5IA 1T0NA 2AK4B 1UD8A 3IDUA 3FFCB 2EZ0D 2QHLA 4JAMA 2AKRB 3MCLH 3U82B 5C0NC 3MBEA 3RUGB 1OD0A 4LPVA 1IAIL 3D18A 3TONA 4AJ0A 5FUZH 1IL1B 1D9KC 3C09B 3W39A 3TBTA 3ALWA 3GMOA 3MV9B 2RFXB 4BSWA 4TX6A 3O3BA 1IGCH 1Q9LA 3DX6B 4RBPH 2CKBL 4WUUE 5C07B 4FTVD 3HFML 4NNXB 3WQ8A 1X6LA 2AJZA 1A14H 4FABH 5I1IH 1ACZA 1UM5H 1TJHH 3PHSA 4E2OA 1MLBA 5JW4N 1CXHA 1LK3H 2DYPB 3IKKA 5F9WB 2A6JA 4MVBC 4ACYA 4TUJB 4E41A 4MA7H 1E28B 5J89A 3D2UB 3GB7A 1LQ0A 2O5XL 1YJDL 4GUPB 4JHAH 4PJXA 3STLA 3AI0A 3IJHB 2NY0D 1HSAA 1LEIA 4L29B 2DPEA 1CXLA 2YDQA 5I1HL 3EAKA 3ULVF 3AS1A 1ADQH 4P49A 4KK8D 4PD4K 2FHBA 2EC9T 2NY3C 1KPUA 3QHTC 5HI5C 4GBXB 1BF8A 2P4AB 4HOWA 4QT5B 4H1LH 2IALA 3AS2A 5FHAH 2WZPD 2XPGB 4GI9A 2V2XA 2FECL 4G42A 1RZ8A 3I75B 4P23A 1CK0L 4JREC 2D24A 2G3IA 2NYYC 4YN5A 1WTLA 4OZGF 4XAWL 1NQ6A 2VDLH 1QNOA 2VCBA 4JQVC 4ODXB 1MRFH 1KCVL 2ZG2A 1F4AA 3V0VB 4C56D 1XRVA 1AGFA 4LU5H 1M71B 4J4PC 4U6YA 4EK7A 4OUUA 2IXVA 2ZE0A 1AXTH 1FAIL 3RNKA 5I77A 4IHOB 1B90A 2JIWA 1J1PH 4L8CB 4GAGL 1BM3L 2YL9A 1VBUA 3WENA 2EKSB 2EDLA 5MI0B 2J25A 2NXZD 5T1LB 2J7LA 4KGLA 3QHZL 1RUAH 5DR5H 2FSEB 2O93L 3TIDA 4KAQL 4QRTB 4K3JL 2XIBA 2QQKL 4G9FB 2R29L 3BH9A 4UQCA 1C8XA 3WJLA 3T8XB 5J1SC 1V7NL 3U36A 1JZ7A 2XPKA 3MMEA 2GK0B 4MD0A 3ARVA 2HVJA 2BY0A 1NAMB 1NMCC 3I6KB 3D39B 3GSRB 3HRPA 3TBVB 4U7SA 2AJVL 2DQUL 1Q1JL 4RMRA 4Y4HA 5IQ7H 3KLAB 4GG6E 4NYLA 4BSVB 3RI5F 4HZ8A 4YWGH 1XGTA 3NDYA 3LRKA 3PWUB 4WNQA 1GHFH 1OQOA 2OTUB 1FNEA 4K23H 3BKML 1CZ8L 4G8GE 5KSAA 2X4RB 4AEIL 5KSVA 5C70A 4LPWA 3BRGC 2GDVA 3QNYA 4L4OA 5DS8B 1S3KL 2VR5A 1IFHL 4EEEA 1A7PL 1I3VA 4WDIB 4DN3H 5HPOA 1JHLH 1NP0A 4CADB 2GSGA 1J5OL 5T1KB 4WW2B 1EEZB 4O4YL 3CSYA 1KENH 1QKZL 5FGCB 5L0QC 1OTSC 1QR4A 3NABL 3GBNH 2F53D 2LAGB 3WF2A 1SFSA 4ZUUB 3W9EB 3GSUB 2H6PB 4CVXB 4DKEL 1IRAY 4NO0B 2ZP0T 4XZBA 3WQ6A 3IFPA 3VH8G 1CFSB 3GSVB 3MACL 4N90E 3T0DA 1UKPA 3HZKB 1B0GA 2H1PH 3DRTA 2PXYB 5KSBA 1NUDA 3L3IB 5DI8B 1HN1A 2D7NA 5IGXH 2R0LH 4R26L 1UKQA 3MJ7A 3U7WH 4HKZB 3D0LB 1HHJB 2W0PA 3ZKXC 5TFSH 2ICCA 1D5IH 5I1LB 2IH3A 2XKNA 1GXEA 3S3PA 2WSPA 1JRHL 1IV8A 3O3DA 4OV5A 4QLLA 5IB5A 5IOPA 1AI1H 4ZSOE 5B38G 5C08E 1UD5A 1HEZB 4W87A 3NCEB 2D4DA 1FIGL 1VFFA 4OKDA 3O6FC 3A23A 2C3WA 5FYJH 5AC5A 1YEHH 5FF6B 5L6YH 5DHXB 5DK0A 1DQLL 3KR3H 1OQXA 2JK5B 2DIAA 4I4WB 4PTMA 4WI6A 4OFYD 1IKFH 2BXYA 2G5BB 5IMMA 3WBAA 1YEFL 5E56A 4R7DB 4YE4H 2EDKA 4X6DF 1PX8A 3TTYA 3EZ8A 3DVNA 5HGAB 1D5MA 4OGYL 4H20H 3RX5A 3QXTA 5FHBL 4FFZH 4HEPG 1JGUH 4MWFB 4YHKH 1NPUA 2Y36L 2MQCA 4QHNB 3TFKC 2NTFA 4NXKA 2VCAA 3SDYL 3MRNB 2VXVL 4QNPF 3BVXA 5IK3B 4Z7NE 1U8KB 4KK6D 4GQRA 1TA3B 5BS0E 1NWSA 3GMLA 1B3VA 1FYTA 4RFNC 3NCJH 1CF8H 4LCWD 4YXLH 1R24B 3QDGA 4UFKA 1SVZA 4ODBD 3MU7A 1RZFH 4QWWD 4HQQL 1M7IB 5IG7A 1DL7H 3QHFL 1VCAA 4Q97A 1TZIB 2VCCA 4CL7A 4JKWA 4EOWH 1IQDB 3TVMC 3DTXB 2PR4H 1A3HA 1HIMH 2PYFB 1JWUA 3T0XA 2KQNA 3MRLA 5JOFB 4W8LA 2R56H 4WUUA 5TE6H 3G5VA 4XPTL 2B1HH 3C6LD 1E4JA 2XXCB 2YD8A 3GSOA 4KPHH 5DUMH 5E8PB 3VIIA 3UERA 4JDVA 3QUZB 3UEZA 5CEZH 2I9LA 3L3DB 5TQ0L 1X3DA 2W1NA 3LQMA 4MDIA 4Q7NA 1IGML 3GMRB 5E00B 2NSXA 1TTGA 3S5LB 1OD7A 1UFUA 3WLBB 1SJHA 3CCHA 3TBYA 1GOQA 4XPFH 1CDHA 3QIUD 3CBWA 4J8RB 1D5ZA 4U6XB 3RU8H 4RA3A 2YD1A 1V6VA 3WDPP 5FO8A 1A9EA 1Q9OA 2O9RA 5I75C 1TFVA 1J7VR 1FDLL 4W81A 4DGIH 1G0CA 3SGJC 5ICZB 3DPBA 1EHLH 1OP5H 1SJEB 4KKBD 3V5KA 4N8VB 1V0MA 2JF7A 2G41A 1UJTA 1RUQH 1NSNH 4MA1B 3AJ7A 1IKNC 2OSLB 3C60A 4AEFA 2PTVA 4P2OD 3SKUD 4JRXE 2XWBB 2UWEB 2EEAA 1T3FA 3BQUD 5KS9A 1CDBA 1ZS8A 3ISWA 4MJIA 5GHWL 3TN0D 3THCA 2VH5H 1XH0A 3G6LA 2Y5TA 3WJJA 2XM1A 4PMVA 2XGBA 3LQZA 4IOIB 4DGYH 3H3BC 5D8JL 2Z4QB 3EW3B 4NO5B 1EFXD 3N1AA 4MJIE 3DO3A 3QIUC 1XF3A 5D1ZB 3F5KA 3GMPB 1WFUA 3KYNB 2W9EL 5HHPB 4PV9B 4APQC 2FJGA 4NT6A 1W9VA 3CD4A 1ZLSL 2DQEL 2VXSL 3NJ3A 3HZMB 5DJYB 1CENA 4H25B 2JCCA 4LHUD 3OG4B 1WICA 5E8DL 3AFBA 4KZDL 3NTCH 3BP5B 3ZMRA 2VZ1A 1U30A 3EBVA 4JB9L 1QHOA 5CEYA 4WEBH 2L7UA 2EC9U 3MLRH 2Q86B 4W5UA 1JK8A 4NPYB 2D7TH 1T21A 5E8OB 5EULV 4CAGA 4KDVA 2IBZX 4JFFB 5A69A 2BC4A 5BZDB 4UT7H 4LSPH 3UYOD 4CU6A 3AZTA 4OI7A 3CLEH 4MNQA 4Y5XA 4NHUA 2DQCH 4UILH 2GITB 1MCEA 1XCTA 4LSQH 4NQSB 3ZZ1A 4LXFA 3WN6A 3CC5B 4M6OL 2NY5C 4XXDB 1WBZB 3HFMH 4UTAH 1J0JA 3L9RB 3P11H 5GRJL 3RVXD 4WCYH 2E8ZA 5DYOB 3VXQA 2GUYA 1EOMA 4Z2LA 1BGXL 5ICYB 3SDAA 3ARBB 4MB1A 4JFDA 3IRPX 4PRHA 5I30H 3G6JB 5K59E 5E24E 1VRXA 3TESA 4OCWL 4GRMB 5BRZA 3VFWB 5GGVL 4G6JL 1F4YH 4L4TB 4P46B 4WFHD 4HFWB 5A2AA 2IQ9H 4U1HA 4JRWA 2O61B 4WHTA 3EJPA 3KLKA 5SWSE 3ZYIA 1EO5A 5MERB 3OKEB 5D7SL 3BKJL 3LKOB 1HTYA 3CFKB 1B30A 2HMID 1IAOA 4QHKI 1MAJA 5CCKL 4LQFL 4AG4L 5F6IB 4AZGA 1C08A 1B31A 1RZKH 2D3VA 2FJHB 5J9PA 5EZLB 2AK1L 4HWZB 2E27L 3OKNB 2BVOB 1KELL 3THMH 1G7HB 3PWPE 5A2KH 8FABB 1JDAA 4YGVB 4Y2OA 2R2HA 3RWIB 3WN5B 4HCRA 2YD7A 1GQIA 1RQ5A 3GI8L 5EDXA 1ERNA 2IG2L 4RNRA 4HIHA 1LP9A 2XVNA 2PTTB 3KYOA 1I7TA 4U1SB 1ZB5A 1NGPL 1OARH 1L0QA 4NQEA 4MNKA 4D6HA 4F8XA 2WBJB 3QFJA 1GC1L 3WY4A 3SJVB 5ITBL 2EH7H 4AMKL 1EMTL 5CEZD 4NDMA 1PFCA 4P4KC 3QHZH 1WBXA 5T3XL 5C0AD 5HPCA 1TQBC 3LKSA 3OZ9L 1KXTB 4M81A 4I2XA 3HUJF 4TUFA 1MJJA 2AXGB 1RJYA 4JO1L 1FL6A 3C60C 3BZFB 4HCRL 3KNBB 3OKOA 5F7EH 5F7MC 4GG8B 2GJ6D 3TCXA 1URLA 4ELMA 4PJGE 3DVGA 1BHGA 3OKMA 1ORSA 4NQVB 5IT2L 1WIUA 4PB9H 4GW1A 1Z3GL 3L3HA 1HOCB 4YPJA 5FOBB 2Q76B 4EJ1C 1BJMA 4U6VL 3F58H 1SMOA 5JA8B 1OIMA 4PRID 4ZUWA 3VGAB 3KPSD 1QSFD 3ILPB 1EDQA 1OAZH 2CGRL 2X4TB 4I18B 4P57B 4HH9A 5AC4A 1X5HA 3DI3B 3L4XA 1T5WB 1QRND 4QRRB 3QEQB 3VD4A 1S7RA 2GTWA 1VJZA 5IW1B 4JFVA 3VWKC 1FRGH 5IMKB 3NABH 4YIQB 3L5XH 4PY7B 1LO4L 4A6YB 1MPAL 3FB8A 1Z9SA 1T7WA 4YQXH 3LPPA 5DMIL 3VXSB 2APTA 2BNRB 4HOZA 1I85C 3MRPA 2TAAA 5GSRB 2VRKA 3QH3A 1FZKA 5HDQH 3TVMA 5CBEA 1FL3B 1M7DA 5DJAB 4ZFFB 3S35X 2H8PB 4NHCH 3JTTB 3GMNB 1I9IH 4G5ZL 5BXFA 1XF2A 3SDDA 1RIVL 3FO0H 3QI9A 5C0DB 4YFEA 5TFSL 3MCKA 5IQ9A 1Z9MA 2XI9A 1VEMA 5JHLH 3ZHLA 4OLZL 1N4XH 1T66D 2V6HA 3MFGB 4QRSB 4HIJA 3B9EA 2HG5A 2MWCA 3SGDI 3O6LL 4YHOH 2WMIB 2YD3A 5HDBF 2NLJA 2Z31C 2W62A 1I8KB 2JKXA 3QCVH 3O9WD 4G8IB 5TDPA 5IHBA 3LRGA 1U8QB 4BFIB 4EDXB 2A0LD 4Y1AD 1ISVA 4X5LA 5F89A 1AGEB 3PZQA 3HC0B 1YEDA 4XI5C 2X9YA 3O4LE 3GBEA 2VZTA 5HHMD 1RUMH 2DOCA 3Q3GB 3G5YB 1EPFA 5AYQA 5I1JL 1I7UB 3K8MA 3PL6A 2G60L 3T3PF 4U1KB 5T5NG 1UG6A 1QBMH 1E6ZA 3GDBA 1L6XA 4A6YL 1JNLH 5B38A 3PZGA 3KPRD 2B2XL 5JNYA 1RP9A 4IMLB 3R0NA 1JTOA 2BOCA 4ZD3H 4FMKA 2A9ML 3EFDH 1D6EA 1P2CA 4HGWB 1MCNA 4ETQA 5BW7C 3VFNB 3TA9A 1V0KA 1UH3A 5SWQB 4R4FH 4OKVA 4WKFA 4H5SA 4JFEB 1R3LB 3UJJL 3JWOC 1PVHA 4MNHB 4M9PA 4KPHL 2Y07L 1OP3H 4L8DB 5ALBH 2P8MB 3GUTA 4AENB 3QXAA 4YBHA 3W9DB 2FWOA 5B21A 5BO1H 3QWOA 4U1NB 1JHLL 2F7QA 4Y4FA 4QKXB 4OF0A 1DN2A 4XX6A 1KTCA 1DEEA 3HAEH 2VRQA 2JIXD 4O2EB 4QTHB 1ZVSB 1WWAX 3QZWB 5FO7A 2EO7A 4QOKB 4WV1C 3LEXB 4YC2B 5HY9B 5KN5B 1IC5L 5EOTA 2XN2A 1Q0XL 5DEZA 3KDMB 2DIJA 2G9HA 5F7YC 1UM4L 4QRPD 4Y5YC 4EE9A 3SCMB 4JPKL 3MUZ1 3D51A 2ZCHL 5EN2B 1FFRA 5I8CB 3DJ9A 1GQKA 4UB0L 5F9OH 4YHGA 1AY1H 3IT8D 3MXWH 1W9UA 3IFOB 2ED8A 4I0CC 5C0FA 1OAKL 3LD8B 3VX1A 1Q6EA 1K5NA 2C3VA 4F80A 1D5IL 1ULVA 1LP9E 3L5JA 1EEYB 3CVIH 5DQDL 4LOUD 3H0TB 5CJQH 3MNZB 2K3TA 4ERSL 1AI1L 1KB5H 3O0RH 3BXNB 2YPLD 3VMPA 1FVDA 3QDGE 3O8XD 1UKOA 1JL8A 1MCJA 4HK3N 4UMGA 4OZIA 3MNVB 3MA7B 5DHVB 1MI5D 1DDHA 1U3HA 3QUMB 3FCTA 4M7KL 2J7CA 1RI8A 3MRJA 1FAKT 3NMEA 3G6DH 2DQEH 3QPQD 3WUZA 3QNZB 2IUZA 3NCOA 4Q6IC 1YEIH 1JF5A 2GJJA 4MTVA 2CITA 2VC9A 1B0RA 4JB9H 1NBZA 4W6XB 1A6PA 5BRQA 1CL7L 2Q8BL 3WBEA 3ZKND 1MNUH 1OOAA 1C1EH 4WV1A 3LX9A 2GJ6E 1T6WA 2VUOA 1AH1A 5DO8A 1PKQE 1AR1D 4JR9H 3QAZC 2X4NB 3C2AH 4NP4L 3BN9D 3B4NA 4GXUM 4M1RA 4HS6B 3JV5A 1BPVA 2J7FA 5ITFA 1YY9C 5JO5A 3SKOB 3K7UA 2AJXL 1QP1A 3P0YL 2OLDA 3SE8L 1CF8L 4EUPB 4N8CH 1E6XM 4ODSL 3IETB 3J7HA 3SUSA 3MC0A 2OL3H 4X9IA 1N5YL 2UVFA 3U4EA 1XF5B 4Z7WB 2XSBA 3FAXA 1JPGB 3FTGB 1MF2H 1DVFB 4H8HA 1GOGA 3ZJ6A 3BHBA 1ACYL 2E40A 4Y2DB 1I75A 4P5TA 1CE1L 1H0DB 1TPXC 1BYBA 3MLUL 5JW5B 5CPTA 4C7FA 4HIXH 3CMJA 1UXWA 4X4MA 1P7QD 5I1AB 2AEPH 1F4YL 3CDFA 3UTPD 3L5HA 1U36A 3QUML 5E2UL 4QYOA 2Q6WB 2IMMA 1Y0LA 12E8H 5FCUH 2DQJL 2W0FB 3ME0A 1E4IA 4RGOH 2DSUA 1BZ7A 2Z91B 3RU8L 1KIQA 1D5BA 3L5WB 5DT5A 1KCUL 5SWZA 1BLIA 5EFIB 1RU9H 1A6UL 2PW1A 4XPBH 3RHWF 3DDGA 1QBLL 3C8KB 5ACMA 2WAGA 3IXTB 1HIZA 3SCVA 1VSCA 2PTUA 4PJCA 3WKNA 1VFOA 5EPMB 3OAUH 4KH2A 3S34H 1QO3A 1ODUA 5DJ8B 1KCSL 1P7QA 4ZS7L 4MSWA 1MCQA 1S9VB 3ZL4H 4EDWH 2ESVB 1P1ZA 1WDSA 3WKMH 4RX4A 5H94A 4XMKL 3A4WA 2JJTC 3QP3A 2HJFB 2PF6A 4ZS6C 3ULUD 5BOPA 1G9MH 4X99A 3JXAA 5JZ7D 2X40A 5ILTL 5HHME 1S7QA 3KPRE 4ZO7A 3V5HB 3DMMC 3QFDA 35C8L 1HXJA 3WF4A 2HRPL 5D96B 4KC3B 1RJCA 3B9DA 2EZ0C 4YNYB 5KAQF 4O2FB 2R2EB 1VEOA 1X5ZA 4OZ4A 3W4RA 4R4ND 1OP5K 3RL2A 3KL5A 1WDRA 3M6DA 1UR9A 3P9LB 1HYSD 3CHEA 3MNWA 5FIEA 2XA8H 1U8NB 2R4SH 3N1GC 3ILQC 1H15A 1OGSA 3I02A 3VFPB 4POYA 4QNPE 32C2B 1F4HA 5SX5K 4L4VA 1HQ4B 3BPOB 2WQ8A 5HYJA 2YIHA 2LVCA 1AXSA 2VE6B 4FQQB 1B1YA 3MJ8B 1MRCL 2EO1A 4FG6C 2XWEA 3GSNH 4MD4B 3NFPA 4X5WA 1QHZA 2P5EA 3OF6D 4P4KD 1F5WA 4L4VE 3IFLH 1CDUA 3RTQD 5IFJA 4JIEA 4UFMA 1SYSB 2WIIB 4MQXC 3VCLA 2XWJA 2IGTA 1CLYH 2UVEA 1NAML 1H41A 1A1OB 3I50L 2DSVA 5A6BD 3HPLB 2IANE 5GS1C 1V3MA 1XGRA 3KYKL 3MV8E 3SGKA 2QADD 4JZJC 5DMIH 2CDGA 4O00A 2PI6A 4MXWH 5D6CA 1S78D 1O7VA 2Q7NA 2CUIA 4DOHB 1W9XA 4MD5B 4ELMF 4H7VA 3P9MB 5CQ1A 2PUQT 4EKXA 2HKFL 1GGIH 3T2QA 5I8EB 3DBXB 1NOFA 2CNCA 2XIDA 3CVHA 4YDIL 4YHMH 4DWSA 4S0SD 3BZ4A 1C5CH 3PHQB 4HDIB 1K3ZA 3T0EE 1QVBA 2UUDK 3ARGC 3HB3D 4KKCD 4J6RH 5J1TC 1VKXB 1WCGA 1B88A 3NIGF 1K2DA 2B31A 2ESCA 2NY5L 3IKCA 3QPXL 3LB6C 1ZS2A 1HNFA 4WWKC 4PRDB 4KHTH 1KFAH 2ITCA 1FBIL 5L88H 1BZ9A 3B43A 1NBYB 1HJWA 1YY9D 4ZXBB 3GI8H 2AJSH 3L3JB 3OX8A 6A3HA 2XTJE 3FFDA 5E9AA 4X4XB 1I8IB 2DQGL 1F6LL 5B4MD 4BQ9A 1CD8A 2FYYA 1INEL 3VXTA 4LHQB 4FP8L 2CD0A 3OKKA 2X8RA 2H9GB 3U4BH 2DIBA 1BEYH 4L9LA 3PGDA 3SE9L 4ZFGH 1WWBX 2CRIA 2WINA 4L4JA 3O9NA 1YNLL 4FXLA 3CJJA 4NKDA 1N7MH 1INQA 2I9TB 3DUUA 4JM2D 4MDPA 4LU5L 3QUXA 4FQHA 4I0PD 3BEVB 2Y1VA 4KI5F 4JO1H 4XXCC 4QXTB 3LV3A 2EEBA 5FA4B 2HVKA 4P8XA 4XPHH 3MRGB 4W7UA 3WXVH 4GO8A 1EOKA 4H1LB 2KUTA 3CZFB 1K4CB 4QEGA 3NA9L 3MV9E 4LK4A 3QOKA 1A47A 1R5IB 2ZKHH 1EK3A 5D1XB 1MLCA 5DJCA 3VXMA 1DWHM 3OSKA 1WB0A 4OLUH 4DO4A 4I77L 1AGBA 5DFTA 2NTSP 3OBAA 4HUXA 3JZ7A 5FYKL 4LRNL 4D0CB 4MQSB 4F15C 4CMMB 3N17A 1Q1JH 5BZWB 1OT1A 5B39G 2WBWB 1LWRA 4XRCB 1A3LL 3BD4A 5D7IF 4PTTB 3DSNA 1B3WA 1BVZA 2AQ3A 1OCWL 1U8PA 4LLQB 1QFWH 3BKMH 4BFGA 2A6DA 4DKFL 2B0SL 1S5IH 3ARTA 5HI3D 4L3EA 3O4LA 3UAJD 4JM2B 4LVHB 4TN9A 4PGZA 3QEQD 1P6FA 2PWGA 1I85A 1V7MH 1FZJA 5D93C 4GAJL 3TPKA 1T89A 1J5OH 4JGMA 1T83A 3FO9A 4YUEH 3REVA 5IIEB 4YR6B 5CZXD 2EACA 3HMCA 3VI4F 3CC1A 3OZPA 4PRIB 4PCTA 1G0YR 3NOIA 4HP5A 3D87B 5D5MB 1UXSB 3LDBC 4UINH 5JW3H 1J10A 2Y25A 5JXEA 1IGCL 2HT4C 3TJEH 3BCDA 5H35B 2VLRB 4K71C 5GZND 4DKEH 3QRFM 4XHQA 4XVSH 3HE7B 4PJDA 4D3CL 5DLML 2LTQB 4HUVA 2B20A 4CN4A 3F12B 4HJGA 2J5LC 1EXUB 4Y16B 3MUIA 3S36X 1GSMA 2QMKA 1NBQA 2Y9RT 2J8UA 3Q48A 1IMHC 2X4PB 4X7TA 4J7RA 1T5XA 1IAKA 2VNCA 2GJZA 3SE3A 5KJRL 3NSNA 3FZUD 3A6OA 5HSFA 5A16A 4H0HB 3T2NL 3UDWA 2FECI 4MMXC 1QSFA 2EIZB 3KPSA 3MLYH 5FD0A 3QEUB 1MHCA 4PJIB 1N26A 3H9SD 1FCCA 4HZAA 4IS6B 4S1SH 1A7BA 4UT6H 1MCCA 4LCUB 2GVYA 2H41A 2FBJH 3U5UA 5L6YL 3KR3L 5GJSL 4OF8A 4C57C 2VLJA 4HPOH 4LSTL 1AE6H 1PYWA 1Q94B 1T1WA 1OAYL 2F18A 1NWTA 5CIPB 2BNQA 4OD2B 3C8HA 5L2JB 3FAWA 2G3MA 2BFVL 5EU6E 4GH7B 4FFZL 2XZQH 4XNMA 1QSVA 1UR1A 5FUOH 5ABGA 3ZQ9A 1CVRA 2GCYA 4JLRB 3LHPL 4DK3A 2C7UB 4S1QH 2PF0A 3B2VL 4MNGB 3O6MH 4P4KB 3KL0A 2EXYD 4ZXBD 5EB8A 1H3GA 3W6MA 3ZTJH 1FL5A 1QSEB 2WUBH 4OGZA 5DJXB 3CH1B 2FL5B 1IGJA 3WDJA 3PTKA 4NKOA 4M24A 4CU8A 1F8TH 5DEFA 2ALWA 4HQQH 3CUHA 3RJYA 1JZ2A 4LNRB 3BMWA 5EIIA 4P5TC 1YYML 4P2RD 4U0QB 1H5BB 3X12A 3KJ4C 1RHFA 5D7KE 1MVUB 4TVDA 1T04B 4PB0H 3IF1B 1U8LA 3VGDA 4N5UA 4L5FH 2YBUA 3GGWB 3GEWB 5I1EH 5IMLA 4Q2ZA 2C5DC 3VFTA 5KVFH 5EU6B 5IKCB 3WY2A 5JW4Q 4ZFZA 2E9BA 1A5FL 5BRZD 4M5YL 3ALFA 4R97C 4NQXB 5F7DA 5JUVA 3LSOA 3M17B 4EDWL 4M7LT 5TPWL 4GAGH 1HJVA 1IE5A 3CSPA 3DOSA 4K9EH 1G7IA 1MWAB 4AZ8A 5J13B 1EXPA 1KB5L 3O0RL 4P5MA 1W1VA 4R5EA 1X5XA 3JWDH 1V7NH 4PJ9A 2QEJA 3EOAB 2O9TA 3ZT5A 3ULUC 2A1WL 1HKJA 3SQBA 3WEMA 5BV7L 3WO4C 4OAWB 5I6XC 5F8RC 5I76A 3GBMH 5FV1L 3RDTB 2HJKB 4LEOB 4QAWA 2GKIA 4NM8L 1KXHA 4F58H 4X7SH 4YWGL 3EHBC 1UR2A 3WS3B 4RFEB 5F7NC 5AY7A 5AAMA 3ZTNH 3KPLA 1WCBA 1AJ7L 4M43H 2DN7A 5T3ZH 1I1AD 4XP1L 1FNGB 1RHHA 1FIGH 1QTYT 3KPQA 43CAB 1QWNA 2V9QA 2WVVA 3A47A 5ICXB 4WFHE 3C2AL 4NFCA 2QPSA 1N0XH 1JNNL 4AD4A 4WSKA 4YFDB 1SMAA 5F1IA 3PQYE 4FNQA 2GT9B 4LHUA 3NH7L 2E6PA 2FIKB 3RTQA 3GBNL 2XN9A 5LGJA 2NZIA 5E8DH 2JJUA 1IGFH 3CLWA 4G8EB 4O2CA 4BCEA 3GK8L 4LGXA 4KI5E 3LIZL 3VFSA 4OFIA 4L4VD 1EFXA 1A6VH 3U0TB 1JZ8A 4HXAH 3QIUB 1U2CA 2AABL 2Z92A 4K7PY 1IQWL 3TA3D 1E4WH 4NN7B 2Q8AH 1WBYB 2J8HA 4PTUA 5IGXL 1J05B 1T2JA 5E95B 1O5DT 4HKJB 3IDGA 4UFJA 1CDCA 1NUFA 1G01A 1FFOB 3K1DA 1DQJA 4GKNA 1W0VA 1CI5A 3QXDA 1J11A 3TZVB 4UDTB 3B3IA 4IPNB 3ARXA 5L2KA 3S6TA 4OSUL 3VW3H 2ZXQA 4PR5A 2LFGA 3L7EA 4WU5B 4CVZB 4IJ3C 5GIRA 1JYWA 4EQ2A 2XVPA 1KSRA 3WQ4A 4KROB 3QPXH 5I71B 3L6FA 4QHUB 3MGAA 3M8OL 4OT1L 2CMRL 1L0XA 2AVGA 4G80A 1NCTA 2IPTH 4MYWB 4H88H 4U2ZA 5K9KA 1GVYA 4Z2KA 1RURH 3L3GB 1UWXH 1I1AB 1AXTL 1FAIH 2VDNL 2WHJA 4YHKL 5KSBE 1ISYA 5D7JB 3QULA 4AT6A 3MOBL 3RGVA 1UWTA 5DHYB 4QHKJ 5M5DA 4JO2H 4N8VG 1GOFA 4EI6B 4EIGB 1QPKA 1OAUH 4KAQH 3WELA 3FQWB 3NVQA 5SWZD 1YEKL 3IYLW 4KZEL 5DD1L 1QSFE 3O11B 4HIIB 1YY8A 3ZLQC 1ND0B 5FDWB 4DN4H 1N6QH 4ZE5A 2G3NA 1WZAA 3OGCA 2E5EA 1YMHA 1EZVX 1YUHA 3ARFD 3GXNA 3QDGD 2YK1H 4D9QD 5I16A 1UR8A 4RMVA 2OYPA 1QD0A 1OARL 1NGPH 5D9PA 1Q38A 3DUSB 1T0MA 2WUCL 4LVEA 2CPCA 4LIQE 3TO4B 1GHFL 3VE0B 4AQ1B 1X5YA 3BZEB 2J74A 4KV5E 3FQUB 3LMJL 3FOMB 5E6YA 3UTZB 1V02E 1JIBA 3LN4A 4NUJB 1JHTB 5T3XH 3C5SB 4M62L 1EGZA 1FLTX 4JHWL 2X05A 1HHKB 3FQXB 5MHSD 1QPXA 3C2SA 3MROA 4XZUB 2BRQA 3VUPA 4RWHA 1YQ2A 1FVEB 5C2BH 2IANB 2WLZA 1UWGH 1XIWB 5D1QA 3O8XB 4Z7VF 4WHDA 2A73B 4KDTC 5KSBF 3DI2B 4OCRH 4KUZL 4K07A 1EH9A 4DTGL 5C09E 4KHXH 3CUPA 3QA3A 4Y19D 4Q0XH 1B4RA 2WMHA 4LBEA 4HHAA 2H1PL 4EI5B 1IILE 1QVOA 5C0CD 3MRMB 4M4PA 4PRPA 3REWA 3GJFK 1CECA 4M6NH 3QIBB 4OZGE 5C0JA 3VXRD 3FQRA 4NQDA 5CD3B 2W0LA 3DRQB 2B39A 3QRGL 1MI5A 3C87A 4GAYB 1HH6A 3MLXL 1CXIA 4EAMA 4JDZA 4U05A 1UACL 1II4E 3HCVA 1G1YA 4WFFD 5AYIA 4B5EA 4R2GB 2YBRA 1T0NB 4M1CC 2X4OB 3WYRA 1MFNA 1XIWC 2JELH 5C86A 3DLQR 2AKRA 4JVUA 1MCHA 5LGHH 4Q7DA 3RUGA 3VWKB 3EJUA 5CIPH 3WD2A 1BGGA 4GMTH 1R34A 3WUWA 1IL1A 5DDHA 1KFAL 4K7FB 5A6LA 4R4BA 4DKDC 4N0CC 1KJ2L 3RUGE 3TBTB 3ZDZF 3ZKXB 4BSWB 3MV9A 5A8QA 3O3BB 4MA8H 1Q9LB 3DX6A 2WCSA 2YRZA 5C07A 2GJXA 1G7PB 4NNXA 2DQGH 1I8LA 1LMKA 1NMAL 2AJZB 3MV7B 4YDKL 3TTOA 5CSUA 4KTYA 1MLBB 3A21A 4FQCH 5JBEA 1DP0A 2QQKH 3D0VB 4TUJA 1LG1A 3OLDA 1E28A 4YBQD 2X4UB 3GB7B 1DBBH 3S37H 2JIXA 3BVNA 4GUPA 2ICWJ 4PJXB 3OJDB 3STLB 1R46A 4ZEPA 1LEIB 2BVTA 4MQ7A 3NCCB 1DE4B 4GO6B 5I1CH 1NC2D 5CHNB 1NP2A 5T1DL 4FZEL 5CUSH 4GS7B 3LRLA 3EMQA 4BZ2L 1BJ8A 4J3OC 4XVUC 2M1KA 4P7RA 5C0EA 1NAKH 4NWTH 2IALB 3TO2A 2XPGA 4JRXD 2V2XB 1QLRB 4G42B 1RZ8B 4D6IA 4P23B 4QHLB 2WBJC 3DX9A 5CD5C 4JY4B 4ODXA 5L8JB 3V0VA 3G5ZB 2Y6SC 1AGFB 1J9YA 1F3RB 4LLUB 4R3SB 1M71A 3N12A 4U6YB 2B2XH 1XF1A 2GYSA 3BPLB 2W4XA 4OUUB 1HKIA 3DX1A 3Q1SH 3BLKA 4IOFC 3RNKB 2F19H 4HJ0D 3BAKA 4XBGB 5F44A 3UBXG 4BQ4A 5AYUH 4HS3B 2MPAH 5D7SH 2EKSA 3DNKA 3RX8A 1R3JA 3BVTA 1UH4A 4MJ5A 5C07D 2WHLA 1REIA 2FSEA 4UQEA 5BXRA 3TIDB 4QRTA 2VDRH 3BH9B 2DI9A 9CGTA 3U36B 2YC1A 1OAZL 2CGRH 4CD7A 2W9LA 4MD0B 2HVJB 1F58H 1NAMA 4F57H 3I6KA 4TSCH 1NGWB 1AHWA 4Y4HB 1NL0H 4EBQL 4V1DD 2APVA 4NYLB 4AM0B 1XGTB 3PWUA 4WNQB 1OB0A 3EMZA 2OTUA 3V4VL 1DFBL 3TT1H 3FN0H 4DGYL 1BGAA 5KSAB 3NUKA 2X4RA 3ZM8A 5L7XH 3QNYB 3RBSA 1HI6B 4JZJB 4C4KT 4KK9D 2LE9A 1JWMA 5C08A 4WDIA 4XP5L 4PRPD 5DLMH 4JRYD 4CADA 4UOW0 4M6AA 1JUFB 3FOLA 1JNHB 4WW2A 1VGKA 4RRPA 2A9NH 2YA0A 4G6FB 5FGSA 3TYGH 4RGNE 5AWNH 2NT0A 5K9QI 2ICWB 3ZHDA 2DQTL 3DX8A 3UYRH 4H20L 2WQRA 3WDHA 3T1FA 3AB0C 1A6ZA 4U6VH 2H6PA 1YEGL 1EJ6A 3WIIH 4CVXA 5C9KA 2WWKT 3CZJA 5FB8A 3QDJB 1JPTH 3K2MC 4P46D 4W70A 1JMXA 3ZE1F 1S5HA 3F4VA 3HZKA 1CNVA 3VIKA 3DRTB 3L3IA 3GSQA 5DI8A 3AIBA 5GS2D 2V5DA 1LD9B 3Q5OA 1SEQL 3AREC 1CFVH 1E6NA 4XP4H 4MNMA 1E6OL 3D0LA 1P69B 2ZWLT 1WZMA 5IROC 4JY6A 3Q0HA 5I1LA 2XKNB 4JKKA 4Z9KB 3O3DB 4OV5B 3WD3A 5IB5B 5IOPB 1X4YA 4HFUH 1A0QH 4XWOC 5F97E 3AVEA 5EFFA 1HEZA 1HX0A 3MA9L 2WBJD 4ELKA 1TMQA 5KG9A 4XPGL 2P24B 1LE5A 2X70A 2DF3A 2L4OA 4WFFE 1E4WL 5I1KH 2QMJA 2JK5A 3WH7A 4X6CB 3T77B 4F3FB 1MFAH 3K4AA 1JAEA 2IAND 1A64A 3R8QA 2ZOXA 4Y89A 4BKLA 4R7DA 1IGMH 1NWUA 4JN2B 1XD1A 3DVNB 3FONB 5DGRA 1D5MB 5HGAA 5MP6H 3MUGB 1GOOA 4LGPB 4QHNA 3AHYA 1N4XL 1AGDA 2NTFB 1CD0A 3H3PL 1MCWW 4U1MA 1U8KA 4M7JH 3RGVD 1EDTA 2XJ7A 5K9JH 4PN2A 3TEUA 5ESAB 4ORZC 5FV2A 5CCKH 3OLEA 2WZIA 2VI0A 5JUEL 3OPZL 1G9NC 5DHVH 4YHZL 1G7MA 2FX9H 1FYTB 1V05A 3A5VA 2ZUNA 2F54E 3GKWL 4HUNB 1YJDH 4JHAL 2AERT 1R24A 3QDGB 1N82A 3J8F7 2P8LB 5CS7A 3QHNA 3BIBX 4LSSL 1ZEAH 1M7IA 5IG7B 5BO1L 2D7PA 3I3EA 1CGXA 1J0KA 1IQDA 1KGWA 3S4SB 1DBML 1U6AH 3TN0B 3CFCH 1O7AA 3TF7C 1JWUB 2VC2H 4UQBA 3MRLB 5JOFA 2WVTA 4P9HC 3INUH 3G5VB 5D8JH 3GSOB 2O26U 4ZQKB 1IGIL 3OJVC 3GXMA 1UUQA 5D2LA 4PJ5A 3OA5A 3QUZA 3NPSB 3L3DA 2I9LB 4K2UH 3JWDL 3BDBA 2VDQL 3GMRA 5E00A 4FQ1L 3S5LA 4LIQH 3WLBA 4JFFD 5E08H 2DSZA 3CCHB 1ZBVA 3SCTA 5ID1A 3TBYB 5TD4A 3RVVD 3HZ3A 1U2HA 4J8RA 2YBTA 4IPLA 1D5ZB 2NY2C 1DANU 3LS4H 4XWGH 3WF1A 1A9EB 3BAIA 1I1RA 4OF7A 2J4GA 3MRCA 1HNYA 1Q9OB 3IDXL 3ZTNL 2Y7QB 2A6IA 3WY1A 1LWHA 4IDJH 3KPPB 2ZCKL 3I3BA 4UUJA 5C3LD 4LLYA 3RMEA 1HQRA 1SJEA 2VT0A 1LO3L 3KJ6H 1WWCA 4N8VA 35C8H 2FO1A 2LQRA 1KIRB 2AMGA 4R90L 2X9XA 3C60B 3SCWA 5ISZD 2UWEA 1T3FB 5KS9B 3BESR 2A3AA 4MJIB 4JFEE 1TQCC 3TV3L 1R6VA 3VDBA 5DD0L 3LQZB 4IOIA 1A7RH 4M6MH 3EDEA 3QXWA 3IB4A 1UM4H 3LKQB 1MREH 3GMPA 1PLGL 3VRJA 3IXAB 3KYNA 1OWQA 4C7GA 1AC0A 5D9OA 2WP3T 3V6ZB 3WDIA 3A4AA 3EDDA 4W85A 4N0FB 3BLPX 3HZMA 5DJYA 5KZCB 4D6FA 2JCCB 3EMCA 3BISA 4A4AA 1CLVA 1R5VA 3BP5A 3DVFA 2DM2A 2IBGA 3RWGA 1R47A 3IGAA 3WY3A 1HZHH 2JB5L 3RVTC 2XV6B 2Q86A 4OTXH 1L4IA 1JK8B 5J11B 4NPYA 4E8CA 2QJDA 3VI3F 1T21B 5E8OA 4NIKB 2NY7H 4PLOB 4DFIA 5EBWB 4W93A 4JFFA 4XC1L 3BUDA 3PBGA 5I8OH 3EOBA 3KL3A 4DGVH 1J86A 2AEQL 5FGRA 4NNYB 4TX8A 3W25A 3C60D 4MNQB 2C1PB 3X13B 3PZMA 5IVNA 4NHUB 4PGEA 3ZDYF 3CFBB 5E5MA 4J4PA 4HWEH 4NFBA 4P8UA 5BS0B 4KU1A 1E6QM 4NQSA 1KJ3H 4G6FD 3LRHA 4WEUD 3DSFL 5DZOA 4MADA 5I24A 5FGCE 4XXDA 4PJXF 2PC8A 5KVMC 1RUKL 1QACA 3L9RA 1J1OH 2IBBA 3NCBB 5I0DA 4ETYA 3EIFA 2E9LA 2VLKB 3WMSA 2YS4A 5ICYA 3SDAB 5J11C 3PZVA 5HHXH 3G6JA 2WC4A 5K33A 4GRMA 4RCAA 5BRZB 3VFWA 2K9UA 1VGEH 4L4TA 4XCEB 4P46A 5ERWA 4W7VA 3T0AA 3VFGL 2O61A 2YPLB 2XWTA 5MERA 3OKEA 1J1PL 5HVGB 3LKOA 2NQCA 2VZ3A 3CFKA 3O3EB 1IAOB 5ABFB 3KHQA 4M02A 3UPRB 4K8RH 2WVUA 3H7BA 2DS4A 5J9PB 1SM3H 5EZLA 3BGAA 1MIEH 5GRZA 5F96L 2BVOA 3MSDA 1G7HA 1MCPL 1YECH 4YGVA 3RWIA 3LS5H 2R2HB 1RMFH 1N8ZA 3GNRA 4HIHB 2PTTA 4FZ8L 3EHBD 3KYOB 4FG6D 1I7TB 3QCTH 5E5RB 1YPZB 2J88H 1CYGA 4NQEB 2O5ZL 4ATDA 3DX3A 2WBJA 3MV11 2C1OA 4PJFF 1OPGH 1VJSA 3SJVA 3QHOA 2RHEA 5BV7C 4ZFOA 4R9HA 4NDMB 4PTVA 1WBXB 1I1XA 2Z9TA 2BXZA 3LKSB 3EJQA 4ISVB 1TJIL 1IFHH 4JRXB 3FHAA 2W65B 2NW3A 2AQ2A 2MTPA 3ZE0F 2AXGA 1RJYB 4HMCA 4PGCB 5HDBE 1F58L 5HJ3B 3LMYA 1H3VA 3OKOB 4WGVB 2D31A 3W28A 4LRIA 4HU8A 3UMTA 4NQVA 1DUZB 4YBLC 1MY5A 3MGTB 3MOAL 1UZ4A 1HOCA 1JG9A 5FOBA 1WP6A 5F7KC 3WD5L 1A3LH 1HHGA 1ZV5A 1HE7A 3ILPA 1TZGL 4G43A 3X17A 1Z0MA 3EJZD 4P57A 1KCKA 4MAYC 4HH9B 5EBLA 4M7KH 1NGYB 1T5WA 4XP5H 3QEQA 2CLZA 1H4PA 2GTWB 5C08D 4F8TA 4J3TA 1GQJA 1YEIL 1CBVL 3OAYK 2D9QB 4PJCE 4X5XA 5IMKA 5AWNL 1EZVY 4AIUA 2ZSWB 4PY7A 4A6YA 3LRSA 1BECA 3FB8B 4RMSA 4EANA 3VXSA 4QCFA 6TAAA 4V1DA 4RWYH 2OSXA 2JIEA 1ZWIA 4Y1AB 1Q6DA 1CL7I 5GSRA 3QH3B 3WXWH 1FZKB 3TVMB 1T1YA 1JWSB 1FL3A 1M7DB 3ZOAA 5DJAA 4LPTA 4ZFFA 1PEWA 2H8PA 3GMNA 3JTTA 3MUY1 5L2KE 5BXFB 5DD5L 4LGRB 1TITA 4X7FC 5C0DA 2AV7B 1UJ3C 43C9B 1OCQA 2EDYA 5IQ9B 3E8UH 1ZGLB 1TQTA 4ONFH 1VB9A 4QRSA 1CDJA 2BVPA 3DECA 4HPGA 2XN0A 2EYTA 1GCYA 2RAMA 3X3FH 4AMCA 1INEH 1WV7T 4MXWL 4M7LH 3O2DL 1E3XA 2NLJB 4I0PA 4LCIL 5EZJA 3P4MB 3GJEB 1U8HB 4UT6L 1MJUH 1K85A 4JFZL 2OQJA 2YA1A 5TDPB 1U8QA 2OYLA 2LV4A 4C56B 1TVNA 1TVDA 4LLMB 4PLKD 3F62A 2P48B 3WL1A 4LRIC 1FO0L 2HJLA 4WGWB 5F89B 1ZLVK 2WBGA 4YBQC 3HC0A 1XGYH 1YEDB 1GGBL 1NMBH 3GNMH 4PFEA 5EZOL 1MAKA 1N2RB 2ZX5A 4NZTL 1KJ2A 3SUUA 3Q3GA 3G5YA 4K7PL 3H3PH 1BJ1J 3D3VE 1I7UA 2FEEL 4U1KA 4NQDD 1UKSA 4K3EL 2R56L 4NZRL 3K80A 4PV8A 4WTZG 4YBLB 2VDRL 3SCUA 3OJ2C 1I1YA 3ZJ7A 2D2OA 3FZUC 4C59B 1ISXA 1LF1A 3BAYA 1RJZB 2RQ8A 3ULVH 5C0IA 4PJ8C 2NXYB 1ZKAA 3LOWA 2BOCB 3QDHA 1FO0A 1D7FA 3ZDXE 4LRNH 3TWCL 3VFNA 3NA4A 3DGGA 2EDTA 4OKVB 3U2SB 5D1QD 3BP6A 3OWEA 1QQDB 1NLDH 4FTVB 4H5SB 3U48A 1DQQA 3UG4A 4I13B 3UCQA 1A7OH 2DMCA 4P59L 3AMKA 2OSYA 4QXWA 2YUVA 3PGCA 3L4TA 1UZ6F 5DURD 1QYGL 2FEDD 1LEGB 3H42L 1DWJM 4L8DA 4NN6C 2P8MA 3GUTB 3QXAB 2WMPA 3W9DA 2FWOB 3QWOB 4U1NA 5CFHA 5ACZA 2FX7H 3OV6A 4EZMA 3BRDA 5C0AB 5E08L 5HHOE 1DEEB 4MXVF 4FQIH 4QTIL 2EC8A 4LSVH 3BPLC 4UV4L 1AR2A 3QUXC 4O2EA 4QTHA 5TPWH 1RZJL 5GHWH 4DK6A 1ZVSA 5C6PB 2DSWA 2CJUH 4PRPE 3JWDC 5FO7B 5GRVK 2VMFA 3LEXA 5EOTB 1NCCH 2FNBA 3RM4A 4NCC2 1YEEL 2G9HB 4K9EC 3VA2C 3LPOA 3PF2A 1TQUA 2CETA 5EN2A 3MLPA 5I8CA 3UJTL 5JTWA 4GW4A 3V7AE 1UCTA 1X5FA 2OZ4L 1RULL 2EDFA 2ERJC 3UTSA 3X11B 4PJEF 4WFGE 1FN4A 3TZVD 1I8LC 3IFOA 5C0FB 2NY4D 4DW2L 5LWYL 5GGRB 1ZBCA 2X09A 1EEYA 3DX2A 1GYAA 3SDCA 3SCQA 1F13A 4AZ5A 3SHSA 1CTOA 1H3TA 3OHXA 4OLXH 5GS3A 1FVDB 4DEPC 4F9PC 5KJRH 3VIOA 3HZVB 4DKFH 4FFYL 3H7LA 4LQ1A 1QWUA 3WSQL 2NY3B 3MA7A 4AIEA 4TQEH 5DHVA 5FKPB 2X2HA 1U3HB 3QUMA 3FCTB 1T7XA 5TDOA 3C6LC 4GAJH 4B41A 3VIMA 3CLEL 2CDFB 5GJSH 2P5WB 1IEAA 5IFAH 4DZBA 1GHSA 3UPCA 2AEPL 2W0KA 4BZ1L 4ACZA 1B0RB 5IDIA 3SKMB 1MCWM 1VPOL 4BQ6A 3BSZH 1WZ1L 3ABZA 4U1LB 1HNGA 3FB6A 1R3IH 2E6QA 2OMNA 4M7JL 4UAOB 3V6OE 1H49A 4HW6A 4AD1A 4XPBL 3ARFA 1CICA 2NY7L 4HS6A 5C0BE 4QO1A 4D71A 4FXGB 5ITFB 5JO5B 5I30L 4WO4C 3V6OA 1A3RH 1A6TA 1GOKA 1E6JH 3SGDH 3H9YA 4NRRA 4MJ6A 4EUPA 4X98A 1IGYB 4MCZB 1KG0A 4D0DA 1KCSH 4PJFE 4HT1L 5AZEH 2AI0L 3ETBF 4M56A 1QFOA 1FHDA 2NY6D 5DF0A 4MHHI 4OFPA 4W8BA 3U4EB 3C5JB 4PJFA 1FH5L 4Z7WA 3K4ZA 5D8ZA 3LKPB 2XN9D 1XHGA 3U4BL 4DQOH 2JB6B 2GW5A 5BVPH 4P5TB 4PJAB 2ESVD 1H0DA 2E27H 2LABA 5JW5A 4K7PX 4P8VA 3A6CL 5DQ9B 2ZX9A 5I5RA 5KVFL 1RUQL 5FM5O 1OW0A 4KFZC 2Q6WA 2V2WA 3QJHA 4QYOB 4GKLA 3L3KA 3C08H 4BQ3A 3VX0A 4RGNB 5L2KD 3W6LA 2W0FA 3QO1A 1NFDB 1BZ7B 2Z91A 1KIQB 4WLCA 3L5WA 5SWZB 5EMYA 4TXEA 4ZAKC 3B8SA 2OL3B 3C8KA 2DL9A 2R69H 1GHRA 4PJCB 4JZOB 4NZCA 3MGOA 3ZKMC 3MJ9A 1MCPH 2ZUVA 4I3RH 4FQLH 1QO3B 4OLUL 1ONQB 1P7QB 2MJWA 2YD6A 3B2UD 4WVRA 3U1SH 5HHVH 4FS0A 1S9VA 1P1ZB 4JDTH 3RY5A 1H3PH 4NUGH 1YYMH 5H94B 1JDCA 2D0GA 3PWPB 4KRPD 5DO2D 2FDBP 1KGUA 3TH2T 2G4FA 2DLHA 2B0SH 4L8BA 3QJFA 2K7QA 1RIUH 5HDOA 3QFDB 4AD5A 4ZXOA 4ZS6D 1SY6A 4JFYA 3QUZD 5IJKA 5GS0C 4YNYA 3MLVL 1A02N 4M1GH 4M9OA 4O2FA 4P2RA 3D9AL 3RL2B 2CUHA 2APWA 3P9LA 3MNWB 3WV0A 2IWGA 3V6FA 3MZTA 1HZHL 2JB5H 4J6RL 1TLKA 4KROC 4RMWA 5HGGS 3VFPA 2FR4A 2R1WA 3STZB 5HYSB 1GOMA 1UQSA 4MDJA 3SKJL 4ENEC 1CFNB 1W3KA 4FQQA 4OM0L 4ZUSB 3RY4A 3JV6B 3MJ8A 2Y2WA 4D2NA 1KPVB 1H8NA 4HUMB 1EGJL 4HD9A 3NFPB 4ZTPH 4X5WB 2P5EB 1AY1L 2WIIA 5D7JC 1GGCL 3VCLB 5F9AC 2XWJB 4ZOAA 4QGYA 4NM8H 4YHEA 1A1OA 5FOJA 5A95A 4YK4B 2OCFD 4QRRE 2IFGA 2W59A 1ZLUK 1CS6A 5HHNA 2F7PA 1Z2KA 2CDGB 3NCYS 4OLYL 3PWJB 4RWYL 4V2CB 4UOJA 2VLJD 5F9DC 2EPMX 4TULH 1J1XH 4MD5A 2QTEA 3QDJD 5SV3A 1B3JA 1T89C 4KVCL 3EYVA 3PP4H 4ZDHB 4YDLB 4PJBB 3KLHC 2XY2A 3PHQA 4J2XA 4HDIA 3JVGC 2FJFA 2Q8BH 4KRUA 4PP1C 4P2QE 1OIFA 1K2DB 1CXFA 2KQMA 5E9DD 5GGRY 2VLME 3IKCB 2XKUA 1FPTH 2BCKB 4PRDA 1FP9A 1MJUL 1BZ9B 2M2DA 5D2LF 4ZXBA 4KVNH 4I77H 4D6CA 1YHTA 3L3JA 3OX8B 5JMRA 4HLJA 3FFDB 3GNML 4X4XA 4BFBD 1I8IA 4PJ5E