1EO7A

Bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMAAVKHMPFGWQKSFMAAVNNYKPVFTFGAWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of maltohexaose and maltoheptaose bound at the donor sites of cyclodextrin glycosyltransferase give insight into the mechanisms of transglycosylation activity and cyclodextrin size specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eo7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eo7A01
3F6LA 2CDFB 3P0YH 5TPWH 2WQRA 2NZ9D 3MJ8B 1D5MA 4GW1A 3QIUA 1XGPA 4Z7VB 2BK8A 3NZ8B 1J0KA 4WCYL 4XPFL 2E9LA 3HG2A 3HPLB 2JCCF 3EBAA 5FO8A 4GQ9L 1MFCL 1V7NH 4JZOA 4FQQA 3TT1H 4N1CA 3HNSH 3M17A 4XCNA 4L3CB 3FQWA 4R5EA 2JLLA 3H42H 3P0VH 4POZC 3VIPA 1NC2A 4LAJH 1VEPA 3IJ7A 1W9UA 4NQSA 5I1EL 4NZRH 2OTUA 5C09A 5TFSH 4YDIL 2E8ZA 4OQ1A 3QDJA 3EJYD 3ZDZF 2YJQA 1YEHL 2YA0A 4XCYA 5CGYC 2OYPA 1U8HB 3DI3B 1P7KA 5HGAA 4PTWA 1U8MA 3MMEA 4I1NB 4U1NA 2HLFD 2PTTA 2UZXB 4WW2A 5KVEL 3DPBA 4BSJA 2N1KA 1NKOA 1X5IA 1XH3B 4J3VA 4EN3B 5E6IB 2NY1B 1IAIL 3VXSB 1P7QA 3G6AB 4NT6B 5DHYA 3X11B 1BD2E 4I4WA 4IMKA 2HVKB 3FT2B 4LKCA 1Z5LB 4NUGH 2WSKA 4F7MB 5JNYA 3N50A 3CH9A 43CAA 4ACZB 5GSVB 1A21A 2ARJB 2DQFB 2X1WL 4MXWH 3DNKA 5GS1C 3HRZB 1TENA 1SEBB 4XAKE 2GK2A 3G5VA 5FHAH 3TBSA 4DTGL 3HUJE 1K2DA 2CO7B 3KL3A 4FQ2L 4PCTA 1S5IL 3LV3B 5EWIL 3ZO9A 3W39A 5HVHB 2NLJA 3PXHA 5HHXH 3QNYB 2WV3A 3AAZA 3NYDA 4R0LC 5IMKA 2O26U 3SE3A 2WNWA 1DQJB 4JQVA 1OGAA 2AK4A 1NEZB 1MQKH 3OG4B 1I1AA 1BREA 3AMKA 2X89A 4BM7A 5EU6E 3QXWA 1RUPH 2ED7A 1R3LB 4HLJA 3BMWA 3HZ3A 2OSWA 1HNFA 4JFWA 1R8LA 4DZ8B 1HI6B 4E41E 2X05A 1CD9B 5HHQB 1MCNA 5IFAL 5C07B 2NY3B 1AR1D 3MPCA 1VKXA 5GGUA 3WIHL 4Z7WF 2CYGA 4N5ED 4DVRH 6FABL 1MCOL 2F5BL 3VIIA 2GTZA 2HJKB 43C9B 3DUHA 4AH2B 3ALXA 3DUUB 1WICA 3PGDB 4XRCB 3DSNA 4WEBL 1NC4B 4PRAA 3FO0L 5HTSA 4JGMA 4HTYA 3C60A 3OG2A 4F58L 4NC1C 1GIGH 3SBWA 3HCVA 2WWCA 4RMRA 4GAYB 3V7AG 2Q8AH 1MWAB 5JXED 2J12B 1QD0A 3QXUA 1LO3H 3CC5A 1QKZL 2IAMB 3IF1A 1QFHA 5ESAA 3JWDC 5D2LE 1QFWH 5E6ZA 2A3AA 4MPKA 3BOVA 4XMPL 5JXAH 3BDYL 1UWEH 4WWKC 3BZFB 3MRNB 2A9NH 2RHEA 1NGQL 3AOFA 2O5YL 4ZO7A 5BVJB 1EDQA 5TF1H 3M1BA 3DX8B 4F8QA 1I7ZA 1UENA 3DIFB 1T1YA 5TDPA 1JP5A 3TV8A 1XGPB 4Q9CA 4N5EC 3RJYA 1KFAH 4ZXOA 2CGRL 5TFSL 5DD3L 4PRPE 4PG2A 1X7QB 1YHTA 4NQCD 1NC2B 4O2FA 4W7VA 2R56H 4P5TB 3ZKMC 1IT9L 4RISL 5JW4R 4PRPA 3RM9A 5F9OH 1RUAL 3LRSB 4QHMB 2ZCKL 5I8OL 4Z0BL 5DWUH 2XNAB 1UR9A 2X70B 4TUOB 4WFGE 3NDYA 3MR9B 3O4LB 5GZOC 3IU3A 8A3HA 3GM8A 2ZIDA 4KHTH 3ELAT 1YYML 2FIKB 3DMMA 5D7KD 1XD1A 4LKCB 4KI5C 1H3PL 2WIIB 4QLLA 2IGFL 4QNPE 5DHVH 5E7BA 3S5ZA 1A1MA 2VDNH 5DFVD 3TV3H 2Z31A 5FK9B 3F7QA 3MRQA 2FECI 3Q1SL 1JWMB 1MHCB 5DD0H 5D9PA 3GSUA 1ZHBB 1LO2H 4YFLF 3LSOB 1CLZH 5FECB 3AZRA 2VL5B 1IKFH 5T1KD 3U82B 2RAMA 4ZODA 3MGOB 3MXWL 4FQIL 5CWSA 3AAZB 4XNMB 5FYLD 3C9NA 2ORBH 4M62H 4LPVA 3S6TA 1I85A 1XF3A 1DQJA 1WBZB 5C0CA 2YD3A 4HWEH 3QT2A 4OLXH 1DHKA 1M03A 3T04D 1XCTB 1XF1A 5MI0B 4NWUL 1EMTL 1HILA 3H6JA 5DT7A 2J7EA 25C8H 4LRNL 1CBGA 3AREB 4M93C 3WY4A 4CVZB 4JQIL 1GJWA 1KGCD 1AY1L 1YEJH 4QO1A 4TUFA 2OZ4L 2PYFB 5D96B 3N1MC 1V0LA 5F1SA 1LK2B 3WDIA 4JVWA 3Q6GL 2OL3A 3ILPB 4FNQA 3JWNC 3QEQB 4G7VH 2QADB 2VRKA 2WYSA 4P7QA 3GMNA 5ENWB 1VAHA 1R3IH 4Q6YA 3GRWA 2J7CA 4JRWA 5DJ8A 4ENEC 4NRRA 4KTDL 4URIA 4XP6H 4GAYA 1BLIA 1W1VA 1DUZB 2AQ3A 2ESCA 5DEZA 4I18B 2R0WL 4J6RH 5KVGL 3RPIB 4OGXL 2E8YA 2XWJB 2E27L 2X2YA 2PKDA 5EORH 3TO4A 3J7HA 2DMBA 2DM4A 2X2HA 4H41A 2G2RA 3G6DL 4XX1E 2P8MA 4MXQC 4M6MH 4K7PL 4JFFA 3QNZA 4Q0XL 4QRUA 4MHHI 4NM8L 4HP5A 1D6EB 4QF1A 2DDQL 4BELD 1MF2H 2X4QA 4PJ5A 1NGXB 4F2MB 1UQYA 4BS0A 1T1XA 2HT3D 4X6CA 4BSWB 2J7BA 2Y7QA 3SCMA 4WO4D 2YDSA 4KUZH 4J3TA 5I1JH 2IADA 3P4MB 3AHYA 2FJFA 1WTGT 3P73A 1X7QA 2JEQA 4X6CE 1AH1A 2OWCA 4R9HA 3UZVB 1ZJAA 1QYGL 5FGCB 1M7IA 3BKCH 1AO7B 4OZIA 2WHKA 3FQTA 5CXPA 4ZS7H 3PDGA 4XX6A 4YHEA 5EU5A 3GNMH 2NNAA 2NW0A 3FL7A 3LPOA 1BJ8A 3ABZA 2SEBB 3JV6A 4IJ3B 2F54D 5M03A 4TUOA 3K4AA 1TMCB 3FJTA 3CMOH 1TQBB 4PJEF 1JVKA 3FHAA 3MLYL 4UNUA 1T83C 3RDTA 2D7OA 4QT5A 1A6VH 1D5BA 4P9MH 3L4XA 4UV4H 1VIWA 2GJXA 2HT3C 2BNUA 1KB5L 4FQCL 3MV9E 3SY0A 3NCJH 3D3VE 4HGWB 4KJPD 4YHZH 5JUEH 1OINA 5JBFA 1BZ7A 5F1NB 4NNPH 2N4IA 4ODUB 3VNZA 1KPUA 3OKLA 4K68A 4WI2A 4L4VE 5SWSB 1KB9J 1FFOB 2KUTA 3SDDC 2IEPA 5JPNB 2Q8XA 2BSRB 5SWZB 4FNUA 1UCBL 4MB5A 1W1TA 4WIWA 3KG5A 1DQML 3GXFA 2YUZA 4NN7B 3RDKA 5F3HB 4S1SH 3THCA 5I73B 4BQ8A 1H3PH 5B38B 4JZOB 1L9MA 3CVHH 5FUOL 4PD4K 3W0WB 4O58L 1AI1L 1F3JA 1MFBL 1JPFA 1P4LA 2NY4D 5ANMA 3VXTB 2Y06L 1CDGA 2R0KL 2PYFA 4DJMA 2Z35B 3QDJB 4FZ8L 4PRBA 4HLZH 5AEAA 2DBLH 4LMQE 4PJHF 3RWCB 1WTLA 5IW1B 2EEAA 3CZEA 2WBJC 3QWQB 2R0KH 1S7QB 1AD0B 3RZCC 4GKNA 4N5UA 3KJ4C 3REWA 3WFHA 4GI8A 1T22B 2VDPL 2GJRA 1E0OB 2V17H 5BXFB 1OBAA 1YECH 4LYQA 1A0QH 1UZ6E 3C08L 3DXAB 4PB9H 5F1IA 5KVMC 2V6HA 2GJ6A 1LDPL 3O2DH 1QP1A 4GW5A 2XM2A 3L1OL 4JG0L 2VDLH 5DHXB 5HDQL 2NW2B 3N9KA 1WKYA 3PWJA 4PRIE 2CLZA 3VFSB 5ICZA 2Z0BA 1FFNA 2F53A 2HT2D 1JGDB 4WFEE 3P9MA 3C6SA 1N7ML 1MPAH 3T2OA 3HKFA 5D7JA 3C5JA 1IVLA 4FLQA 3LVEA 2MMXA 4ZO6A 3W2DH 1H8OA 4EDWL 5DGQA 5A2JH 2OTWB 1KN2L 1R3JA 3TJHD 2ICEA 1G9EA 3G04B 4PJFF 1I8MA 4ZFZB 4OT1L 1DE4B 1R24B 2WUCH 3NCYS 2DL2A 4QYOA 5DJ2A 1YMMB 1U8NA 1M7IB 1G9HA 1GGUA 2R1XA 2EE3A 3GJEB 5CILL 3FQTB 2E27H 5J4MA 3VX0A 3LEXA 5LGHL 3LD8C 1MIMH 3X14B 3L4UA 4DEPC 3WD3A 2B1HH 3RWDA 2FHBA 2Q76B 4HA3A 4HKXA 4K23H 5D2LA 4B9ZA 1GQJA 4LLDB 3WUGA 3CUFA 1BQLH 1P5VA 2BX5A 5E2JA 3O3DA 1H5BC 4ALAH 2YD4A 2P5EE 2D7MA 1E56A 1CDUA 4XWGL 3KXFB 5GZNC 1D5XB 5I1JL 3FFDA 4LOUC 4QRPA 5DRWB 3DX1A 1QQDA 3H9SE 4IRJD 3II1A 4LPCA 2P7TA 3VFVA 4ZUVA 5KN5B 5FYKE 2Q86A 5CJXC 3BHBB 3I75A 4P46D 1A6TB 4BKLB 1XD0A 4X6FB 1U3ZA 1FP9A 2MANA 2AJSH 2TAAA 1KELL 4L4TD 3MO1A 3QDHA 1WAAF 1PVHA 5JPNA 3FB7B 2EYSB 1LWHA 4U1LB 1J1PL 1NFDB 1Q6DA 4G8GA 3DIFA 5LCVH 4WNQA 3MREA 4Y5YA 1MCKA 2FATL 4XNUL 4RGMC 3TT3L 3A5VA 1QPPA 5ACMA 2R2BA 3MRIB 4XCEB 2QL1A 3BVNB 1FL6B 2VZVA 4GW1B 2FDMA 5C0AA 3UX9B 3ZDYE 5I71B 3MRKA 4TUKL 1MVFA 2X7LB 2R39A 1HOCA 4PRPB 4FQQB 3U7AA 2GSIA 2M8XA 5BO1L 4HH8A 2DS4A 1MFNA 4LPWA 1QFWM 2PF6A 3RWCA 4LX4A 4PJ7B 5D7IE 4QXTB 1RURL 1S7QA 3UTZA 4GI6A 4GAFB 3PTMA 3W0KA 3H54A 1CL7H 4OF3A 2X09A 2D7NA 4LNVA 1BIIA 1FG2B 2B1AL 4HK0A 4MDJB 4MSWB 1NOFA 3VJ6B 2PTTB 4HKJA 3RHWF 5D8ZA 2E7CA 4NWUH 1MJJB 4ZO9A 4CNIA 1Z9LA 1BWWA 4JHAL 5DD5H 4KTEL 1OSPL 3FT2A 1NANH 2H45A 5F7HA 2AXGB 1ADQA 2FGZA 1DL7H 4HUXB 3WD5L 2HKFH 4Z2GA 1A7RL 1A7PL 3HFML 2WMIA 1JGDA 1L6ZA 1LEGB 1WLHA 1BVLB 1W3LA 5D7IB 1T66D 4N8VG 5IP4A 1NC2D 4I9WE 1JTTA 4XNMA 3LV3A 3VW3H 3B8SA 5FFLA 1HVXA 4CCEA 4KY1L 3MSDA 2NLJB 1BOYA 3BWAB 4D0DA 3GXTA 4GT7A 1BF8A 4J3UA 5CINH 5HI3D 1FN4B 1ND0B 1FVEA 1QO3A 5C0RL 2OR9L 3QOKA 3MRBB 4KQ3L 1LDPH 1NEZA 4JO1L 3CK0H 3MA7B 1NCUA 3DTXA 1H3TA 3HU7A 3SCRA 4XBPA 5GGRA 4D6JA 3LKQA 3X14A 3GJFB 4UBDC 4OZGF 4DZ8A 5IK3B 2ZCKH 3F6IA 2BNQA 3O0RH 2VMFA 2R0ZH 1XF5B 1EH9A 4OCSH 1M53A 2AJYL 2I24N 3VWJC 1NCBL 3S96B 1JNNH 3VIMA 1ZLWK 4LCWE 4R6UA 4Y4FA 5EC2A 3QIWC 1AKJD 4PJHE 2ADGB 2WWKT 1TVPA 2FX9L 3UEQA 4DM1A 3TA3D 4NZTL 1CLYL 3CH1A 4PRAB 4LL9A 3ME0A 1UKOA 3O9WB 4AD3A 1MFUA 4NDMA 2AJVH 5GIRB 2XY2A 3OR6A 2Q86B 3BZEB 3C6LA 3DSFL 5HI3C 5GGQH 4LHUG 2XTJD 4I0PA 3CPUA 3QUML 2F7RA 3ULUE 4GFTB 5AYQA 2NTSP 3RL1A 4MJIB 2KBGA 3O6FA 5F9JB 2YPVH 3KE0A 1I3UA 3BCFA 2VDPH 3EOTH 4HQQH 3KR3L 5BVPL 5IXEA 3PV7A 3RU8H 3QH3B 1F3DJ 4X6CB 4KKAD 1E71M 4PTUA 1UXWB 4GRLD 1UXSB 4NQEA 4HZLA 3FN9A 1WDPA 4PJCB 1FO0H 2X7LA 4TNWK 1KEGL 1QLRA 5A69A 1F11A 4PJFA 1GAFL 3BI9X 4TRPH 4I77L 1RUQL 1MPAL 2J7DA 1BAFH 1EJOL 1X5GA 3RX7A 3IRZA 1L0PA 3RMEA 3D0LB 1S78D 5IHUH 2CXGA 2X9YA 1DZBA 3IAGC 2ZWZA 4G6MH 2XVPA 1XSJA 1JGIA 3F12A 5D2NB 5DHVB 3GBLA 3VFTA 1I9JH 3WEXA 4WI7A 1NJ9A 2C7FA 4UILL 3WD1A 3ZLQC 5DYOA 1TA3A 1A4KA 5DK0A 4CVXA 1PX4A 1B2YA 2OM5A 4RDQG 5I9QB 4OZ4B 3RWIA 2AI0H 3O8XC 5C0DA 4KRTA 4UFMA 3SGJC 2E6PA 4OJFH 4AD2A 1QA9A 2AV7A 3MRCB 3CDCA 5F1NA 5FM5M 1E4XI 4OZFH 4OI9A 4QRPE 4TUJB 4U5IA 4D1JA 3WL0A 1QI2A 4OV5B 5ID1A 1VSCA 3UPAA 2IANE 3UAJC 4W87A 4AY1A 1RU9L 5C0JA 1IFHL 5GS0H 3BWAA 3VGDA 1K8DB 4NNXA 4F8TA 4MWFB 2ZX7A 4AT6A 3W0WE 4YHPB 2C4XA 4JCMA 2V5YA 2IC2A 1AGFA 1A6PA 1XF3B 4MNJA 2NX5B 4K3DH 3OLGA 3W0WA 2QPSA 2D3VA 4ZS7L 5GRYA 1HILB 3P11H 1HH6A 1FORL 1I1FA 1FE8L 2HA1A 3H2WA 4DGYH 1P53A 4GXUN 4G7VL 4CKQA 2DQDL 4D71A 5JA9A 1YY8B 1AHWC 2DMCA 2P47B 4GBXD 4LKXA 3B9DA 5GGVL 1R33A 5I23A 4TULL 1RFDL 4LEOB 3S96A 4Y89A 1GW1A 3IFNH 1MQRA 3VOCA 5IB4B 3FZUC 2CD0A 4NQXB 2C26A 2WBGA 4GAGL 1KBGH 3TT1L 3MV9B 4OLZH 3V7MA 3JV4A 2IQ9L 3CSPA 3QUYC 2LQRA 4I9WD 3RWGB 3VXOB 1KB9K 4ODBD 4AK1A 1PBYA 1ZJBA 5DJ8B 4YXLL 2NTFB 3TESA 4BCEA 1AD9B 4LQFL 3OR7B 2VIRA 2EICA 3EOBB 4DAGL 3CDFA 3DX9B 5IBUG 5CHNB 5IB3B 1MW2A 1OAYH 2XZQH 4ZSOE 1ONQA 5LKNA 1BZQK 1FFNB 2F53B 5IB1A 4DZBA 3V5KA 5LJYH 2VQ1A 4UQ9A 3QIBA 1UYQA 1P69B 3BIKA 4ZSOA 6FABH 1HKFA 1QSFD 3QQ3A 3CLFL 1ZS2A 4QOKA 3C5JB 4WK9A 3DYMA 4NFBA 3NPSC 2ZG3A 4JJ5B 4N1HB 1UD8A 5FEBA 4GI9A 2B0SL 5JLZB 3STLB 1IAMA 3X17A 4PP2A 3RAJL 1KFWA 5D6CA 5DRNA 1F42A 1L7TH 1GNXA 3GI8H 3IKKA 2HKFL 4BQ3A 1NGYA 3E0GA 1EDTA 1ODAA 4XMKL 1V02A 1CCZA 3BAXA 2NY7H 1W0VB 4XXDA 5TDOA 5TQ0H 3QPQC 4RZCB 4ZTPL 1EERB 5EU5B 4PP1C 5FUCC 4PSPA 4C4KT 1DQQB 3AXLB 3QCUL 2VTFA 3BZ4B 5EPMB 5ISZA 1ED3A 2BVYA 1T20B 1T0MA 4BZ2L 3PHSA 2VLRE 4PJAF 5DURD 4EQ3A 5T1DH 3SQBA 5C70A 2GK0A 2P5WE 3P4NA 4UTBL 2XYCA 2V9QA 4EXPX 2NXYB 2GTWB 1KXTB 1KJ2A 3S37X 4Z7NE 4PJHA 5ID0A 1KOAA 3MRGA 32C2A 3QDMA 3B9VA 2PYED 2EDNA 3QHFL 3TZVD 3OLIA 4M8QA 5JW5A 1KQYA 2F15A 4DCQB 5BMFL 4TOQA 5F9DC 1JHTA 4MA8L 1F00I 3OX8A 2UWEB 1I1CA 4O5LH 1Y6NR 3EJPA 1KPVA 5GZND 3ROLB 1MFVA 4Q2ZB 4G8GB 5CJ8A 3IANA 2XWEA 1FFOA 4WNQB 4HWBH 1EGZA 4BK4A 1OF2A 1WBXA 3RUGE 5DFAA 3OKDA 2NX5A 3RNQB 5J1SC 1NFDF 3PG2A 4HU8A 4HG4J 4QTIH 2VZ3A 3GSNH 2E7LA 1GZPB 3KYOA 1W3KA 4IOFC 3TVMB 5DA4A 3U0TA 3JVGA 3W5MA 3I85A 1J1XH 4Y16D 4Y4HA 5BVPH 4LKXB 3UTZB 5IFJB 2YL8A 2ENSA 1KFAL 1NMAL 2Z4QB 3VRIA 1XGYL 3W9EA 2QBWA 2R23B 5FL1A 5D71L 4N0CC 2V5SA 3S88H 2FR4A 2IBGA 4GKNB 1MCIA 5ILTL 3A22A 1V7MH 5HBFA 4KROC 4JKLA 5CEZL 5KSAC 4LLQA 5D1XD 1QSEB 3LX9A 1PDKA 3VXPB 2GJ6B 1A47A 3V6FB 4M5YH 4OIIH 5DVNA 4N9GB 4RGOL 5C7XH 3KPNA 3LKNB 5E4EB 1NUGA 5AG9A 3FT4B 5D72L 1L0QA 5D7IA 2Z8VC 1OP5K 1A4JA 3VIGA 5HHNB 1OTUC 1XH2A 1MJ7L 4RMVA 4OLUL 4YFDB 2K7PA 4D8PB 1J1OH 1N8ZB 3CFBA 3OZ9H 4PGCA 4JJ5A 4BH8A 2ZX8A 1VDGA 5I3DA 4Q6IB 1DN2A 4GAGH 3STLA 3BLPX 4PJXF 1T2QL 2XA3A 4ACPA 3D3VA 3FT3B 2J6EH 3L3IB 3GUTB 5T3ZL 3CVHL 1X9QA 4DVBB 1I8MB 1ZHNB 3LKPA 3AFLA 1MOEA 3BSGA 4H1LG 5CZXC 4JN2B 2ATKB 2WVVB 2WZPD 4P8WA 4U4BA 2FZ3A 5FHBL 5HGDB 5TF1L 5JQHC 3ZZ1A 4Y1AD 3BKYH 3VGBA 3MQIA 5C3TA 2Q76A 3THML 3NABL 5D2LB 1B6DA 5FA4A 1CLOL 4YHMH 3TO4C 5K9JH 5H37G 4FQCH 1BX2A 4NO0D 5I6XB 5EU7E 3CH1B 4U31A 1CLVA 5D7JD 3O9WA 5ICXA 4PJHB 5ID0B 2NZ9C 3C6LB 4CKVX 3NA4A 2YD9A 5TPWL 2YPLD 4KKNA 4EVNA 3SUWA 3KWXA 2G3IA 5CPTA 3EDJA 4FABH 2DT1A 4Y2OA 1LG1A 3PE9A 1QLFB 2OMNA 2YS4A 4Q2ZA 4FQXD 3IS1X 3O6LL 2VLRD 2EO7A 3EJYC 3E8UH 1V3KA 1ORSB 2VWEE 3DO3A 1TCMA 2BNRA 2JFEX 1YPZA 3UETA 1OTTC 3MREB 4Y5YB 3ZE2F 4J8RA 4HHAA 1E27A 5J11B 1DFBL 3HPLA 4YUEH 4AY0A 1MFEH 4XBGA 2CRMA 3QXTA 4AZ8A 1F11B 1FL6A 4PBGA 4I3RL 3CUGA 3ZIZA 5EO0A 2ICWA 3L95A 1T6WA 3ZKXB 3S7GA 4ISVB 4ZUSA 3WE6B 5D7JC 1LE5A 4R3SB 3PZNA 3MBXH 4OGYH 3QDAA 3VO0A 4NZJA 4AMCA 4X6DE 2QLYA 4HWEL 3O81A 4JFXB 5DHVA 4YDJA 3U2SB 4AYSA 1CICC 1MREL 3OZOA 4FQXC 5DHYB 1V3IA 3WSUA 2BXYA 2X4PB 1QSFE 3L3JA 4LLQB 4M8VA 5DYOB 1W91A 1TA3B 1M01A 2NXZD 1S7TA 3O3EB 3VFRA 3AIRA 4M02A 5IEHA 3WH6A 2VDKL 43CAB 4ACZA 5D6DA 4ZXBD 3T77B 4RWHA 2DQHH 2AXGA 4G8EB 4L29A 3I50L 3NGBB 5GJTL 3FONB 3VGAB 4D9QD 5D1QD 1NAMH 3BYYA 4D8PA 3SJVD 2J6EL 3MUZ1 4Z7UE 4P9HC 1HXKA 4OZGB 2PO6A 5HVWA 3KLAA 5AWNL 3O8XD 3V6OA 3VFMB 4BFGA 2PB1A 2EEBA 3JUYA 3L4ZA 1AGFB 4DGIH 1BQUA 1CQKA 1I1AB 4GG8A 3WNKA 1GGIH 2R0ZL 4OCSL 3CD4A 4M9OA 5F1OB 5GGSB 3SKUD 2QQKL 2FL5A 1M04A 1I1FB 4CU8A 3LB6C 3UAJD 1IC4L 1P5UA 3VXUD 4RGOH 5CMAB 3MBEA 3DTXB 5E6ID 3GTNA 2DIAA 5D4YA 3L3HA 3CLEL 3WUFA 3EO9H 1VKXB 4OUEA 4AZ5A 4JRXA 3UO1L 3JV0A 1I3VA 1JWUA 2WLZA 5FA4B 5CZVH 3MACH 3IAPA 5E56A 3SGDI 3EDEA 4G9FD 1LWRA 1O7VA 3MV9A 3FQRA 3SPVB 3QJFB 1AXSB 2VAAB 4B50A 3L5HA 3KJ6L 4P23A 3LQZA 5T3ZH 1W32A 1BJ1J 1E4WL 3DX9A 4PMXA 3AYRA 1FNSL 3OAZH 4QCEA 1AIFA 3I84A 2VABB 2VQ1B 2J47A 1A6WL 3TTSA 4I0PB 5FGBC 3AI0A 3N1QC 3HZMA 2D0FA 3N9GL 4RGNC 3LB6D 5AZ2H 5C8BB 5JMRA 5F6IB 1JJUA 2XSAA 4UFIA 3PZGA 4EOWL 2CERA 4RRPG 5INDA 4CGTA 4UIKL 3VMOA 3VD7A 1T1YB 2VKWA 5TDPB 2ZXQA 4E0RB 1XGRA 1HXJA 5I1DB 3F7RA 2QEJA 1UXWA 4KKBC 3GXMA 2ZE0A 4BUGA 4J3OC 1YEFL 5JDJA 3MOBL 4G5ZL 1MJUL 4O2FB 4R3SA 1NL0H 4PJFB 3RA7L 1S7XA 4J23A 5L7XH 1K9FA 3RO8A 2L7UA 5IHRA 3HPJA 1EAPA 3KAAA 1K9EA 3CX5K 2WC7A 3KLDA 5DFVC 2X70A 5A6MA 1OD7A 3DHMA 12E8L 3NIGE 3QG7H 5EG6C 2VQTA 2YZ1A 4OAWB 3BVWA 3TYGL 1T0MB 4LSUH 3DX4A 1OM3H 2HH0L 3BGAA 3FFCA 4HK3J 2G5BA 2DTML 3U4BH 1W1PA 4CDHA 3D0VB 2G3MA 4RAVB 4AZ7A 2YMXL 4Z6AT 1A4KB 5DK0B 1HHKB 4ZTOH 4AD1A 4OM1H 4MAYA 2A73A 4P4KC 4S10A 2R2HA 3G08A 5T3XE 3IDNA 2JIWA 2N56A 1OQXA 3MRCA 1NFIA 5I17A 5MP6L 5IWLC 3UZEA 4M7LT 1CLOH 3RIAF 5HXMA 4X9IA 4KQ4L 1HJXA 5H2BB 1AFVH 2PO6B 35C8L 3ARYA 2VL5A 1FA2A 1MVUA 1WFNA 4PGEB 1UADC 1UD4A 2NZIA 4ZOEA 1C93A 4LCWD 1Q1JL 5EZLA 4OOZA 2F74A 2R1YA 1ZBWA 4Q9RL 1C3FA 2GK1B 5K9OB 3EZ8A 3BLKA 5ECUA 4UFHA 3C5ZC 4GXVL 1LDSA 3MV8E 1GZPA 2ICES 3ZO0A 1FVCA 3ULVL 3IJ9A 4F7PA 1BZ9A 1JCKA 1YEIL 5FGBA 1HXYA 4ENED 3QPXL 1UR0A 4W84A 9CGTA 3W37A 3MFFB 3NJ3A 2O5XL 4MXVF 3IXTA 3WMSA 3N1AA 4JFEB 1E28A 4M1DL 3QEHB 4P8VA 1ZGLA 3VXMB 2F1BA 4G6KH 5I8KL 2H2SD 4G6FD 5T1LA 2ITDB 4O51A 4CD4A 4LEOA 2FR4B 3QEQA 2EXYD 2AOSA 1T7YA 3W38A 3V6ZA 3GEWB 2VAAA 3GMNB 5ENWA 4NQXA 3HR5A 3QHZL 3IS0X 4P23B 5TQ2L 2BDNH 2WQ8A 3CUIA 1N2RA 5EC1B 1BGAA 3IDIA 3FY1A 3WH7A 1DUZA 3MUHL 3PN8A 5SX5H 3JWDH 3RPIA 4N9GA 1G0CA 4X83A 4N0CD 2BY3A 4JPKH 2DM7A 5C0EA 2Y72A 5F89B 2G2RB 1TZHA 1OTSC 4LGRB 4AL8H 2I5YH 1P7QD 3QIBB 2VISA 1NKRA 3NTCL 4Z2KA 3G5XB 4GKSA 4OGAD 5ETUA 2O9TA 4PRHE 4Y7EA 4OZHA 3ALGA 5D1XC 1GCYA 4MA1C 3UJTL 4Q7NA 5SX4I 3SKOA 1ZLVK 2XQBH 4OCYH 2XICA 1INDL 2AJXH 1FFRA 3NN8B 1G9NL 3GMRB 3TN0A 1A3QA 1TXKA 3HG4A 5DXWA 3P73B 2CPUA 3CZLA 3MANA 3CFCL 2VWEC 4R27A 2W9DH 5D6CB 5DRNB 2WVVA 5L2KB 1G9NH 1T0NB 1MCBA 1S7XB 2F8VA 5IBLD 2ZSVB 3KVQA 3C60C 1WT5A 1CTOA 2OBGA 3ZE1E 4HULB 2AEQL 4ELMF 3QUXD 1R5VB 1RH9A 3WBAA 5DUML 3AMCA 1MCHA 2SEBA 5DLML 5C1MB 4Z7UB 1JZ3A 2H41A 4YEFA 5IV2A 1I1AD 1I9RL 2ZSWA 4ODWA 4YBLB 1EX0A 5D8WA 1KYOK 4YHYB 3FQNB 4XZBA 5C2BH 4QHKJ 5F7MC 2G5BB 3OB8A 4FXLA 1PAMA 3ARBC 4LVHB 2AJUH 2BC4A 3D2UD 4U33A 1ESWA 5KANG 3SKJH 1L0YA 1TNMA 4PTMA 4YEEA 4NWTL 2BNQD 2VXVL 5JDSA 4NZUL 1FZOA 5FYKD 2X0YA 2DQEL 3QZWB 3EDDA 2PYEB 3TZVB 5C08B 3GM0A 3OKLB 3LKSB 2X4RB 1OAKL 2GCYB 4LSSL 1QACA 2UWEA 3C60D 1EMTH 4PJXE 3GSNA 3PHAA 5K59E 5CG0A 4APQD 4GQQA 2P5ED 4QEGA 4X7TA 1YC8A 4LSUL 1JDDA 2HG5B 1MELA 3KYNB 4X9YA 1SBSH 2WAHA 3L4VA 1DP0A 3IJHB 2B39A 1AC6A 1FVCB 4XP5L 1DVFC 2A3BA 4D9RE 1N6QL 3L95B 3PP3H 2IF7A 2VDNL 5KOVC 1OOAA 2VYRE 3VXMA 1F13A 3MLVH 5SWSE 3BKJL 4Y4HB 3EFDL 3N18A 1FP8A 1U58B 1RZ7H 4G3YH 5M95B 3E2HC 4F3FA 1H4PA 5CSUA 4JFXA 1WZLA 1CD8A 4R8WH 2MPAH 4GRMA 4RE4A 5E5UB 3EYFB 1BFNA 4Q0XH 1MHHB 1KJMB 4X0KA 5FYKL 1G7IA 1QBLL 1FYTE 5A2IH 3CFDA 2QQKH 5DJ0A 4WWID 3MLWH 4LCIH 1F97A 3R0MA 2D7PA 1XFPA 1U92B 2DQIH 5C9KA 3PWJB 3K80A 4HWNA 1A3LH 1REIA 2ITCA 3BKMH 4M9PA 5ELIA 2OQJB 3BEVA 4XXCA 4TX8A 4F8XA 5LBSH 2OCFD 1L7TL 3C6SB 5FF6B 4FLOA 2EAEA 1U8IB 2B2XH 2LU4A 3V5HA 1IEBB 2W60A 2LE9A 3OSKA 5DJ6B 3S3PA 3TBWA 5C0GB 2OTWA 4GG6E 4ZXBC 1BBDH 3SDAB 3V8OA 1YEGL 5JZ7C 2EECA 3H55A 3G04A 4NM4L 1HQ4A 2B2XL 1CPUA 3BQUD 1BIHA 4FFYL 2AJZB 5FCZA 1F58H 4ZD3L 5FM8A 5L2KA 1TJHH 1SYSA 1TVHB 1XF2A 5CMAA 5T1KA 4LFHD 1XGQA 4HS3A 3MXVL 1HCVA 4CN1A 1SJHA 3MRHB 4KRUA 5LVEA 5F7KC 4JM2B 4RFNB 1UM6H 3RWDB 3SGEI 3GO1L 4OIAA 5HGDA 3UBXG 2WW5A 4QXGL 3U7BA 2N7AA 3EOYG 2VUOA 4HW6A 3NA9L 3G5ZB 4MCZA 1F4XL 1UM6L 2APBA 1RUAH 3T0ED 3SE8H 3DUSA 4YNYB 2DBJA 1AXSA 1W9PA 1LO5A 3FMGH 3VWKB 3F65A 1YQ2A 4BSVA 1WZMA 3GI8L 5A40E 5F97E 2X8RA 3F62A 1A8JH 5I8EA 3W29A 3OJDA 3LN5B 1G1YA 4HKBA 4F9JA 3I50H 1HL9A 3A47A 4K3HA 3MO4A 3D3VD 3MJ9H 3QZWA 4GW4A 5HYEA 4QRSA 4BKLA 5JW3L 3SCQA 1AGBB 5IMLB 3CUPA 5EZOL 5HI4D 3LKSA 1MCWM 3HZMB 5A2LH 3N04A 4I2XB 3VD3A 3MO1B 5CP7B 2CK0H 5IFHH 1B0RB 2Q7YB 2P46B 4GO6B 4KK6C 1R5WA 1F02I 3RNKB 4M3KB 4PPTA 4GS7B 5AYUH 3RUGF 2OI9C 4L9LC 4Z0XA 5HHXL 3CXDH 3D69A 1V0MA 1WIPA 3LY6A 2HAZA 1YNTB 2F54E 3JV5A 3T3ME 2DWDB 2FJHB 5D7LB 5IVZB 1ZLSH 2EDTA 1IEAA 1HOCB 4H8UA 4YXHL 3N12A 2EPMX 1DEDA 4EIZC 4U5KA 1R6VA 4M7JL 4TSAH 4TTDD 5DC4B 1NP0A 4L4OA 5F7DA 5BS0B 2NY4B 3BSZH 1WWWX 4PJ9D 3UROR 2AK4E 2WHMA 3A24A 1FZMA 2DWEB 1UGNA 4TSBL 3ZJ7A 4OLEA 3WIHH 5JO5A 4HWUA 4PJGA 3BGFB 4KK5D 3VJ6A 5IF0A 2CKBL 2JJSC 1UWTA 3FFCB 3TGXA 4Z9KB 1RULL 2A83A 1R85A 5SX5K 1XEDA 4XP5H 5HVHC 2NR6C 1NCAL 2X9XA 2VE6A 4KHTL 4MAYB 5IGXH 4FTVA 5BZWA 3UTTD 3QZWG 3CVHB 2ZJSL 5KBNC 3H3PH 3D4YA 3LIZH 5F3BB 2A3EA 1LEGA 4HF5H 1GRWA 1XRVA 4QCFA 1FP5A 4UOZA 3D2UB 3V5HB 3WS3A 3HR6A 5AG8A 4OZGA 7CGTA 5DR5H 2UY7A 3ZKNC 1J0HA 5I5RA 4XBEH 1XIWD 4PJAA 3EJRA 2OLDA 3IJYB 3ZM8A 2VXVH 2VAJA 5GXBB 2V9TA 4ZNEE 2XVLA 3AXXA 1IBGL 5J12C 3SKMA 4LNRA 1KG0A 3HE6C 3QUKB 1KJ3H 4UOJA 3MRHA 1SJHB 2EDOA 2Z92A 3GJFA 5EH1A 3RVWC 2FL5B 4AIUA 1S9VB 2XFYA 1GHFL 4FQJL 1QI3A 3BESR 1GGTA 3MBEB 3QEHA 3PP3K 4P49A 1KB5B 4Q7DA 1ZBVA 1SVCP 4BQ9A 3VTRA 5EOCL 2OTUB 2ADFH 4R90H 2ITDA 1ZAGA 4M3JA 2IAMC 2XI9A 2XWTB 4JCLA 5FYLE 3V6ZB 4Y4FB 2EIBA 4GO9A 1QFOA 3MLXH 4BA8A 3SCOA 3KYKL 3VXME 2IH1B 4WWKB 4AW7A 5MENE 5E1QA 5EUOB 2X1PA 3FOMB 4NDMB 4FQ1H 1BQCA 3ZKND 1WAAE 3BZEA 3IFPA 3LEVH 4O2CB 4ZTPH 4QRSB 4B7IA 3OGRA 3NUKA 4JPIB 1UCTA 1DQLH 2BVDA 5F93C 2DQJH 4OJYA 1PYWB 3I9GL 4WUKL 3UYRH 1S7SB 2WZEA 4GKSB 3WJLA 1AP2B 2VURA 3OAZK 5D7KE 1T21B 1K4DB 1LO2L 5I15H 3Q6FB 5B39G 3GIVA 4A2LA 4Q9RH 4Y2DB 3OQ3B 1S78C 4KFZC 1WC7B 2BCKA 3DV4B 4IPLA 4X5WA 1BFVL 4E0RA 1RJZA 1LL7A 2E4TA 5BV7C 3FQUA 2PWHA 2WZHA 5FDWB 2BY2A 5GJSH 3UTSE 1IEAB 3SHSA 2OJZH 3D9AL 3G5YB 4FABL 1DEEA 1KBKA 3PWPA 4G6JL 4W70A 3VG0L 3OJVC 3K8MA 5CUSH 5DA0B 4PRPD 3BT2H 4Z77B 1FZMB 4CN4A 4YHNA 2X1IA 2ZPKL 3WDPP 3GXPA 3MV8A 3OLDA 1JI2A 1IARB 3HUJB 1OSPH 3JUGA 5KW9L 3BQUB 1HSAA 2YN3A 1FZKA 4GLRI 4OAWA 1WDQA 1ULVA 3EZJB 2BZDA 5H94B 2XVKA 4XNZB 2CNCA 3FO9B 5ALCH 4LCUB 2VXSL 2W59A 4EI5C 4P5TD 1RIHH 3OXRB 4ETQB 4YDLC 3NH7H 3ISWA 4JB9L 2DSZA 4PLOB 1UM4H 4Y1AA 4P3DA 1JYXA 3GI9H 4LDOB 3HCVB 5GHWH 2VDML 4IBLT 2X1QA 3UG4A 5IVXF 1NGPL 1HK6A 5D71H 1HHGA 1S5HA 5HDQH 1Z3GH 3QXDA 4NO5A 1QNZH 5F96H 5I1AA 3WS3B 3AMGA 5CIPA 2HWZH 2RFXA 2Z91B 3BZFA 1VACA 3WEZA 1A7QH 1F6AA 3BFOA 1ISWA 4KKCC 3HNVL 1IM9A 2YSSB 4OF5A 3UTQB 1HYSD 4AT6B 1RHHA 3M1BB 3N1FC 2J4GA 2R1YB 4LU5L 1CWVA 2IFFL 1VADA 4OFVA 4XWOD 1JPSH 1KELH 1MRCL 5C0CD 5CJ5A 3QUKA 3ZYZA 1MFDH 4JQXC 5E2WL 5GRWA 4PR5B 1EHAA 4APQC 1BZ9B 3QFJE 1CICA 3HAEG 4TPRH 4TSCH 5HDBE 3W53A 5HGBA 2HKHH 2YRPA 4P5TA 1M7DA 5I75B 5D93C 4O58H 4UDTA 5DD0L 2XA8H 1FNSH 1A7OH 4TOYL 2WMFA 4LF3B 5BOZG 1X1NA 1RPQA 2LVEA 3V8CA 5KSBA 2IH1A 4WWKA 4O51B 3EYFA 2ESVD 2A1WH 1JXJA 2VDOL 2FHCA 2VRAA 2IG2L 3IDXH 3EGSB 4EUPB 4MNQA 4E2OA 1CVRA 4HS8L 4JPWH 3CLFH 4MNGE 4UAOB 3W81A 1JUFA 3BUTA 1HQRA 3DMMB 3IFPB 1OAQH 4V1DD 4Z2JA 3MUGA 5EC1A 1P4BH 3IDIB 4OIBA 1ONQB 1FNGA 1RZIA 1YECL 1UH2A 4U3CA 5F9WC 1FIEA 3BEVB 3V4UL 2XN9B 2X44D 5ADOL 1CXHA 1IFHH 5GS0L 5DD5L 1O6IA 1YYLH 1T21A 1K4DA 4QOKB 1U8IA 3LRLA 4P2QE 1KEGH 1X5HA 1BBJB 3UTPD 3E6HA 3G5XA 5C0GA 5ETUB 3TBWB 3TCLB 4JPVL 2J7FA 5LWYH 1UB5A 5JLZA 1YMME 4M1GL 3AY4C 2WINB 3JTTA 3BD3A 4IJ3C 4X6BB 3F58H 1MI5E 2ICWI 3GMRA 2EDDA 3TN0B 1MRFL 4GRLB 4WO4A 3AJ7A 4N8VA 3C8HA 3PHOA 3H8NA 4HCRL 1TZIA 1NAML 4XCCH 1NGYB 5IWLA 3GNRA 3PL6A 4W6YB 5C9JA 3HJEA 4JZ5A 5EO1A 2O92A 1MEXL 2UWEF 4MDIA 4L5FL 2MQ3A 1WFOA 1F4WL 2DI7A 1MHEB 4K07A 4KV5E 4OTXH 4RZCA 5IROA 3WKML 3E8UL 2E3VA 4IDLA 1GOKA 1CD0A 4FFZL 1Q9OB 4NKQB 4ZAKA 4WUUA 4NQDA 5TE6L 2F7QA 5CEZE 5AD0A 2YFOA 4ZS6C 4XPTH 3VWKA 5TE4L 3ZTJG 4WJ5B 4U1GB 3PJSB 2KDGA 4PJ8C 4AZIA 3WL1A 3FTGB 5CJBA 3AS1A 2XPGA 2NY5C 4Y1AB 4P3DB 1UWUA 4QXGH 1FO0L 1JF6A 2PN5A 4WFHE 1UD5A 1HJUA 5HJ3B 1INQB 4DO5A 1J05A 5I73C 4Y4FD 4MXWL 3ZE0E 4ZENA 5FUOH 3O6ML 4FFWD 4LLMA 3SE9L 3VRJA 2ALWA 5DJYB 3O3UN 5DJZB 1K6AA 2H3NB 3ROLA 3HI1B 3T8XA 4HXAH 2EPLX 3WO4C 3SCTA 1E4XH 4O4YH 3MC0A 3VH8G 2NY0C 4JFFB 2ZKHL 4Z0XB 1FORH 3C6LD 4P2OD 4V28A 1C8XA 2J79A 4NNYA 3QUMH 3KLSA 4IOIB 3WEMA 3RNQA 1QRNA 2ZUUA 1UM5L 2YL5A 4Z2LA 2ZUYA 2O93L 3KYNA 3AROA 1EO8H 1ZLUK 2WAGA 3B8YA 3EIFA 3AHXA 1CDIA 5J13C 1WSST 2DT2A 5JW4Q 2LAGB 4M7LL 3F5WA 1WIUA 4KK9C 3TIEB 1FSKC 5MP6H 3IDYC 2RGLA 5CILH 2MWCA 4X7CC 2VJXA 4OD2B 4ONHB 3VXRA 2DI9A 3CVIL 3LRKA 4W8BA 1NBYA 2PBOA 3TPKA 1E6JL 4WLCA 5CSYA 2Y6SC 4Y4HD 1YPZE 5C0BD 2J4WL 2D03H 5E9DA 4R4BA 1ZHKA 4H26A 4WO4C 2WCAA 1KCVH 5CBEB 2ICCA 4NPYB 1UT9A 2Y4SA 3RL2A 3RWHB 3QJHA 3UDWA 4PJ9C 1NC4D 1A3RL 1YJDC 3VXPA 1UWIA 3QEGH 4QT5B 4M8UA 3BEWA 1G7LB 3NTCH 1AMYA 5BZWB 1I7UA 5DQJA 2GJXB 2G3NA 3KPNB 3LKNA 3N1GC 5I1HL 1X5JA 1KLGB 4O2EA 1KBBA 3F5KA 2DICA 4KK9D 5FO9B 2VCBA 4FQHB 4IEFB 4KVCL 3AU1B 5IVXA 1SMAA 2A3HA 4BH8B 3GKWH 1RJYB 1MH5A 3F7PC 1O7SA 1XCXA 1UB5B 3K2MC 3ZE2E 5HOSA 1JFXA 4UFKA 2BDNL 3BN3B 3SDXF 1PBGA 3NACH 1AXTL 2X4TB 3GUTA 5JQ6H 4HCRA 1X5LA 1HHJA 1MUJA 2V5MA 3PL6B 1KG0B 3TNNB 4X7FC 1H3XA 3N0PB 1AXTH 2ATPB 2DH3A 3N9GH 1E6PA 2Y9RT 5L0QC 1I9IL 4LLYA 2XRAL 4M5YL 4OIIL 4OZOA 1IQWH 5TE4H 1KB5A 2DSWA 1RZFH 1YUHB 5FA3B 2FX8L 2E9JA 2BOCB 1KPRA 2MCPL 2X6MA 4PRBB 4Y5XC 3NSMA 1ZK9A 2ZXAA 4CD5A 2NY6C 2CLVA 1B9ZA 3PJSA 4MA7L 5DUPH 1UCBH 3OKNB 3WIFB 3MKKA 5B3JF 2HFEA 2RB8A 4ELKA 3SE4A 3MLSL 1T22A 1ZT7B 2A6JA 2CJUH 2CUHA 2Y24A 3ARDB 4N8PA 2HLAA 1YEDB 3WN5C 5EOQL 4BFBD 3FB5A 2FGWL 2BHYA 1J05B 3CIVA 2IAMD 4FA8A 4RGMB 3GSOA 4A6YA 4RA3A 5E8DH 4NKMA 3H9HA 4YLQT 5D70H 5HPMB 5IDIA 5HI5C 4P2RE 4K3EL 2WBJD 2H3NA 3HI1A 1IL1A 4FQ2H 2UY5A 3B2UC 3ZDYF 5MEQB 3VIHA 3GH5A 4V1DB 3L5WB 1OAUL 1ORSA 1XT5A 1RUKL 4JFOB 1YN6B 3RIAK 5EFFA 5L9DH 1HKLH 4JFDB 5HDOA 3ALFA 5C0BE 2CBVA 1R3KB 1NCDH 1U3JA 3NVQA 1DEEB 4W4OA 3QI9D 4F80A 4QYOB 4PRWA 3F5LA 2GIYA 4H1LB 3GSRA 3WSQL 1LE5B 3BH4A 4J7RA 3V0VB 2R1XB 3VXRB 1G0DA 2GDUA 4ONFL 4YHNB 1D9KA 5D1ZA 3P11L 4DWHA 1FV1A 1Q9WA 5D7SH 5E9DB 4R4BB 3TJHC 1OD8A 4K2UH 4HZ8A 4DKFH 3PQYA 1FL5A 1E72M 3K81A 3SDCA 3MLRL 1J1OL 3L3JB 3OZ9L 1TVBB 3CTTA 4WI8A 3F7VA 4JY6A 3C09C 1IKNA 4X4YB 3AIVA 2VLRB 2OZ4A 1SVZA 4H25A 4YHIA 4DKDC 3DROA 5KANI 1FHDA 5ALBL 4RFEA 4O2EB 2E7LC 3UTTB 4EKJA 3ZR6A 5JUVA 3QISA 3WLWC 3QI9C 1AQHA 4WY7L 5LXGL 3K2UH 2P5WA 4OLYH 4X8JA 2ERJC 3KPPB 3SKJL 3D2UA 3VFMA 1G9NC 3SKNB 3FB6B 4I8DA 4CD8A 1TQCC 4N68A 5D1ZD 2OXGA 3ET9F 4ALAL 4JM4L 3O8XA 4JO4H 5EU3B 4K3GA 1GPOL 2JKXA 4NN5B 3DX7B 1T80A 2ATPA 1NCDL 4P46C 4NBZB 4I48A 4UUJB 3IDJA 3U7VA 5C0AB 4H8HA 1I7RB 4XHJC 4OUUB 1J88A 3SE8L 4TRPL 3MRJB 1KPRB 3O9WC 4JRXB 1I8LC 2XG9A 4E9LA 4PTTA 1P7KB 5HGAB 4U1KB 4CMHC 2D31A 1KN2H 2OP4H 2VN7A 4RGND 2VERN 3PGCA 3OKNA 4FZ8H 3LDBB 1UA6L 4ODSL 4ODXA 3WIFA 4JREB 3KPTA 1FG2A 4EN3A 5D2LF 2DYPB 5E8DL 1AGCB 1RMFH 2DSUA 5EFDA 4I4WB 1QI0A 3U1SL 4ESKA 2XWBA 5DD6B 3IETB 1MJJA 4CNIB 1WEJH 3AVEA 3FOMA 5D1ZC 1OLZA 5JNYB 1XIWA 2A6KB 1J9CT 3N85H 2GHWB 3KEHA 5HPMA 1DLFH 2XN9A 1JYWA 2GDVA 5FHBH 4WW1B 3RTQB 5I18L 4G42B 2H6PA 4TUKH 2C3VA 3BO8B 4MD4A 1D5ZA 1TJIL 2CR3A 4Y0GA 3L3OA 4YHLH 5D5ME 5IBTH 1G9ML 2YBUA 1HJVA 3WXVH 1XGRB 2H32B 3KPOB 5IMKB 3SDXE 4JFDA 3OTTA 5J89A 4NF7A 1MFDL 2HFGH 5M5DA 3GHBH 1CDCA 5I1KH 1TZIB 2DQCL 2W9EL 4BQBA 1S8DA 5D9SA 1PG7W 4PB0L 1V08A 2E9BA 2WHLA 4XMLH 4DO6A 4FQXA 4C56E 4WIQA 4M6AA 2BSSA 5EBMB 1QHOA 4RMWA 1XR8B 4ZAKB 3FO2B 2A6IB 2FJGB 3QFJD 3S9DB 3DX0A 2Y5TB 1YNKH 1FBIL 1XF5A 1VERA 1G84A 5HGGS 2IWGA 4AH2A 1GGBL 3MI6A 2VLME 3BIAX 5GGSY 3FTGA 3NFSH 3F4VA 3WH9A 4GOSA 3OIHA 3F7YB 3CZNA 4JFZH 5EN2B 1OM0A 3GB7B 4YHIB 2DEPA 3GMPA 3B5HA 1WEJL 4UBDD 1RZFL 1E4KA 4YDIH 2A73B 1DQLL 3INUH 4PJCE 4LAQL 3CC5B 4D9LH 2D9QB 1GC1H 3IDNB 4X9HA 2H2PD 2BSED 4MB4A 2XPKA 5DDHA 1SJEA 3WQ6A 1F90H 2CKRA 1IZJA 5JUEL 3W11C 4YHZL 3KL5A 3D5HA 1JF1A 4PJ8D 5H2BA 5HY9A 5I2IB 3U7WH 3DOSA 3EYUL 4AEHL 5BVJA 1DBJH 4QOKE 5SWZD 4PGEA 5ITBL 5CIPB 3SJVB 1F90L 2J8HA 2ZZUT 2VLKA 3ZDZE 2WCGA 1E4NA 2VLMD 3O0RL 1PSKH 3W2DL 1AI1H 1MCOH 2BVUA 3ZSTA 2CDFA 3EHBC 3ZE1F 1XCWA 1XV8A 5DEFA 2JJUA 1BFTA 3QWRA 1D6VL 4YHKL 1HJSA 4AD4A 1NCTA 3R4DA 4NSKB 5LGJB 2WBKA 4HUWB 1E6ZA 5FO8B 4C56D 4FQLL 1QLRB 4H20H 2DQHL 3DSFH 3P9WB 1WPCA 4DUVA 1ISZA 3VXUB 5HGBB 1UZ4A 1ZGLB 3LRSA 4MQSB 5CBAA 4R4FL 1KWKA 3JWDL 2D3NA 3D0LA 1R34A 3UTSD 3B5GA 2Q6WB 2Y36L 4XBEL 3RGVC 1W0WB 2EH7L 1U8MB 2DGAA 1EBPA 2DYPA 3X3FH 5CBEA 2E7HA 3GZKA 4TSAL 1ZVSB 1ZVYA 2JELL 3DXAD 3KPSB 1QPKA 2BNJA 1I9EA 1Z0NA 4AIZB 4L1HA 2C3HA 5E6IA 1EFXB 5F21B 2EPNA 2A6KA 5BRZB 3MUGB 2HMID 1Y6MR 4PJDB 5JBDA 1INDH 5B4MC 4XI5D 5F89A 4D9LL 3RZCA 3MJ7B 3WXVL 2WKLA 5FK9A 3MRQB 1XR9B 1YEIH 2J7GA 2I26N 5F72S 1A7QL 1P1ZA 4XP1H 5JIPA 3O3BA 1T4KA 4JFFE 3MGOA 2H32A 1G0XA 3E6HB 1VPOH 3SDDD 2EKJA 4RGNE 1KIUA 5MEND 1TTGA 5E8EA 1O7DC 4RE3A 5D1QA 4L3AA 5EU6B 1U6AL 1S8DB 3HE7C 1D6VH 4YHKH 4MVBC 4HOZA 4ZDHB 4JIEA 3TYFA 3ARBD 4OB5L 1S9YA 4PGZA 1UWEL 5HDBF 4CVZA 4QRRE 1CYGA 2GT9A 1XR8A 4IRSC 4NHUB 2NXYC 1QOXA 3BUBA 1U3HA 3I3EA 3KPQA 3L3DB 4ZTOL 1H2JA 1OAUH 5H8DA 1Z6JT 1Q9OA 2D7TH 4OKDA 2YUWA 1SM3H 5I78A 2VLJB 2B1AH 1NDGB 5KSBF 3F7YA 3TO2B 2YLAA 2A6JB 4WJ5A 4OFPA 3FOLA 1JE6A 4RIRA 4L8SB 4LIQH 3CU1A 2HLAB 5DC9B 1UOKA 5BJTA 5CLTA 2XWJA 3O3AB 4OD3H 2RR3A 1DVFD 3H9HB 1NL0L 4EDXB 3TFKD 2A3CA 3MTRA 1JZ8A 3BUPA 1FE8H 5DUPL 3UTTE 1NMBH 4Y5VB 1YNKL 3TP4A 2H26A 1QBMH 4BYHA 5DJZA 3L5WA 2OYKA 3MRNA 4X7TB 1MYRA 4OQTA 2X4QB 2YKLH 4PJ5B 3S34L 1RIHL 4WVRA 1II4E 4MNQE 3O2LA 1IILE 2KZWA 2V2WB 4NQDE 2CUMA 2IADB 5HI5D 3P4MA 1E4LA 3VDHA 5T5FH 2YL9A 1P84J 2FLRT 4EOWH 4PP2B 1NLDL 1QX1A 3A21A 3V95A 1AO7A 3VDCA 4Q9QH 3H9YA 3IU4H 2X2JA 3MV7E 1B0IA 4OCRH 1W0VA 1CXKA 1E4IA 1OAQL 4M00A 5MERB 2CGRH 2DPEA 3APGA 3RILA 2J8FA 4OV6F 5K33A 4F3FB 4QP0A 3BMVA 4M82A 1W0WA 1EVUA 5JOFA 4D0BB 3BZ4A 4X98A 1Q1JH 3MR9A 2XN0A 3CFDB 2DKSA 4JZNA 5I79A 4QHNB 5CKGA 5A2CA 2Q20A 4NPYA 3T4AA 4Q6IC 3P2TA 4OZHF 3DGCR 1N5YH 4MJ4A 3SY0B 2WIIA 1FNLA 4LPTA 3MODH 4IRJC 4K9EC 1G7LA 4HA1A 4MAZA 5LWYL 4B0MM 1U2HA 4MNMA 3QIUC 2XTJB 4HJGA 4WSJA 1JNDA 3BXWA 1PY9A 2ZUQC 3BE1H 3O3BB 5EZIH 5FO9A 1HWWA 4K71C 1VJZA 5I8KH 2PUQT 4DW2L 3AU1A 5IVXB 5A16A 1DCLA 4HFWA 4HAGA 3MA9H 4JHOA 2IPKB 1WBXB 1P4BL 1BECA 5DD3H 5FM5O 4YHML 1V6VA 3HMWL 1E6SM 3WLWD 3RVVC 1JHKL 5A2KH 1WBZA 1R7AA 1EQPA 1I7RA 4XCFH 2V2TB 2AJUL 2EH8H 4X4XB 1HIML 1CFNB 3IDUA 1CGUA 4WI9A 3U6RB 3CCHA 3HMCA 1MCPH 1EZVY 1PLGL 1YMHB 5LBSL 3CLWA 4JZJA 4MAUL 4G7YL 4YNYA 1L9NA 4ODXB 4X6DB 2A0LC 5FGSA 5GS1A 3BXNA 1ORQA 3F5JA 1N6UA 5IM7B 4W85A 4N1EA 3J8F7 4KK6D 1I75A 4AMXA 3WD2A 4PB0H 4MNKA 1X6LA 2IPUG 4X99B 2XFRA 3L7FB 3BISA 4FZEL 4GW4B 4BZYA 4B5EA 3KYKH 3BDXA 2YKLL 4G42A 1VENA 1GPFA 2DT0A 2FHFA 1KGWA 4AMKL 3D85D 2YDQA 5IMOA 3LXBA 1WT5C 4AWEA 3DO7A 5DVLA 5KVDH 4UINL 3A6CL 4URTB 4I2XE 4V1DA 3GBML 1J0IA 2FBJL 4YGVA 1D6EA 2W92A 4B9YA 4M43L 4QAWA 1XF4B 1ACYH 4F2MA 3LPGA 4U2ZA 5DK3A 3WIJA 1HWGB 1CFTB 4RQQB 5HHPB 1YEHH 1BYDA 1AQKL 4FQXB 1SY6L 2LU3A 1SJVA 2XRAH 5ANME 3UJIL 5E0CA 3O6MH 4H1LA 2BSSB 3GSRB 1ERNA 1RZGA 3U30C 1E40A 4OZIB 1JRHH 3GK8L 2VKXA 5F6HI 4H2CA 3LPFA 3MRFA 2OP4L 4LARL 3VVGA 1OGTB 3O2WL 4ODHL 2W9EH 4D9RD 1JRHL 1WCBA 3GK8H 5D72H 4HF5L 4JZNB 5E4IA 4MD0A 2ZXBA 1ZEAH 4Y16A 3SDCB 3VRLF 2J5LC 2B5IB 2PXYD 5DRWA 4Z7QF 4ZFMA 4LCCB 2XKNB 4WENB 1U8PA 4FNTA 2AABH 5I30L 4ONGH 4H25B 5AAWA 2Y07H 2VCAA 1TETL 3CMJA 3BHBA 3I75B 1K6QH 5F3BA 4KZEL 1A22B 4HGWA 4EVNB 4DUWA 1WF5A 4HJGB 3ZT6A 1JF1B 2AABL 1NARA 1PG7X 2HLFC 1BWMA 1EK3A 4JDZA 3KPLB 1IAKB 4W6WB 3FB7A 2BNQE 3O2VH 4ODUA 4PG2C 4UNIA 1EEUA 5A6BA 4RBPK 2F7OA 2I9LB 4PMNA 3KPPA 3RCNA 1N64L 2BSRA 2F53E 1A6AB 2H2PC 1OD0A 4PJIF 2R2BB 2AEIT 3MRIA 3NFPB 3JZ7A 4L8DB 4XCEA 2W5FA 4XAWL 3W11D 5C3LD 1KTKE 4NRYA 4E8DA 4HUWA 4NRSA 1U8KA 4LCIL 5DI8A 2Z92B 1H49A 1YYLL 4JFHD 5AC4A 4ZOBA 2B7DT 3TF7C 3H3KA 2EDWA 3VXUA 4DWSB 4ISVA 3MLZL 4ZUSB 5EBLA 4FXGB 4DGVH 1K4CA 4A4AA 1DLHA 1M05B 3WFZA 4KTDH 1FPTH 4ZXLA 2AAVA 2HRLA 4KUCD 3UERA 1CFVL 4JRXD 5DD1H 1EO8L 3B6SA 5GGRY 5TDNA 4XZUA 4QLJA 3ZYJA 4HK0B 5E24E 2XGBA 3CSBA 4U1KA 3CJJA 1YMMD 5CINL 1AD0A 4LSTL 1ZVSA 2P4AB 2W0PA 1YEGH 3KPSA 1M6OB 1MEXH 5EZOH 2AXHA 3BP7A 1VFOA 3UTPE 3OLEA 1TTUA 5BS0E 1FNAA 3CUHA 3VGGA 1GONA 5I16A 5GQBA 1ZVHA 3DRTA 1RIUH 4PRHD 1KJVA 3DLQR 1ZS8B 2X4NB 4WV1C 4WTWA 1XIWB 2Y1VA 2D03L 3IRPX 1MJ8L 1W2KT 1S7SA 3EJSA 5DK2A 5ITBH 4G8EA 4L29B 3FO1A 1Y0LA 2LTQB 3GIZH 2BRRH 2H6PB 4MXQD 4V1DE 3RTQD 2DQCH 2YA1A 3VFUA 5CIPH 5I1GL 4Y2DA 4RAUB 2MJWA 3DV4A 1WWAX 4EIGB 1OIMA 2ESVE 2ZUNA 3DJ9A 3TH4T 5L88L 5CFHA 1FN4A 1ND0A 1JNEA 1N5YL 1URLA 4MQXC 3MRBA 2FGWH 3NIGF 2YPKB 3KS0J 3GNML 3MZGB 2B8OT 3U0WL 1RULH 3PWPB 1YMMA 1RZGB 4U2YA 3FW6A 3MJ9L 2OSLA 1MCLA 4GXUM 2Z8RA 1FHGA 4JHWH 3TVMD 5FYJH 1U3HB 1FYHB 3KPQB 3D48R 3L3DA 4I3SH 3S8WA 1LEIB 3TH2T 5EBMA 3HUJA 2GFTA 2N7BA 5C0CE 2ZUVA 2E3ZA 1EHNA 3MROB 2V7NB 1J0JA 1JI1A 4LLUA 1KN4L 3MV8D 5DUMH 3FZUD 4MB3A 3SCSA 4LCUA 4NRZB 4ZUUB 3ZT7A 4K3JH 4OFIA 4Z95L 1V05A 2XKNA 3BUDA 4AD5A 4ZFFB 3QUYD 1I8LA 4Y2DD 5JHDA 1KXHA 1VGKA 5FYKH 1DJSA 1GGIL 1EJ6A 4K3JL 3R8QA 3GBNH 3WF3A 4JRYE 3EDFA 3AGVA 2V5DA 4DFIA 2GJ6D 4NYLA 1AIFB 4HWBL 1S5HB 5T3XD 1ZANH 3FRUA 3S3SA 4G7YH 4YHGA 3RL1B 2GSGA 4PCSA 4YHLL 3ZHDA 3MSPA 3BDBA 3QWOB 4PFEA 1CGXA 2CJUL 4WGVB 5IUSA 2YSSA 4ETYA 3SQOL 3UTQA 3LPPA 5DJAB 5B39B 1OP9A 1YNLH 4PTUB 4MLIA 2BJMH 4PYGA 2C4FT 2VXTL 5HYSG 4QWWC 4MZ3A 4Z7VA 5E0QA 1PEZA 3WNNA 3CZFB 1CBVL 2O5YH 3CGTA 5DD1L 4U6VH 1JGLH 4JB9H 3DVGA 1EXPA 4UT7L 3WFDL 4FXGA 1K4CB 1RUKH 4UNVA 1T89C 1AGDA 1WCQA 2GSIB 3U4AA 1MW3A 1RK0B 3HI6H 1NLBL 1OY3B 3A6BL 1OP5H 1YEKL 3GH7A 2NY2C 4QXTA 3GO1H 4HH9A 1A6WH 4X98B 4GG6A 3UTSB 4WW2B 3V4UH 4OGYL 2R56L 4WHTA 4KKBD 2AVGA 3AC0A 5KS9F 3V9FA 2HTLC 4JY4B 4HKJB 1KXQA 2W0KA 5D1XB 1WO2A 4OZ4A 5DQ9A 1EFXA 1IGJB 4MCYA 1QW9A 4GKOA 3LH2H 1QA9B 1G6RL 5BRZA 4J28A 2IH3B 2DN7A 1HHKA 1BFVH 4UQ2B 2HT2C 1U91B 4W7WA 1NEZG 2D1ZA 1S46A 1FDLL 4OV5A 1CFVH 4JHZA 3N11A 4C83B 3WDHA 4DQOH 2DKMA 2F1AA 3KL0A 3NOIA 1DWGM 4KH2A 5LAXA 2DQGL 2WINA 4NN6B 4YHPA 2EDRA 4JDTL 4D6EA 1S5IH 3QQNA 1OGAB 4G9FE 4Y88A 1BYCA 1WDRA 4P59H 1R46A 2H9GB 3WYRA 1LVEA 1MWAL 4KGLA 1EDGA 1OQOA 3U6RA 3TYFB 4MQTB 3D51A 4EN3C 3ARBB 3MA7A 1MCSA 3LXAA 3HAEB 5IESH 4XBPB 5GGRB 4Z18A 5JR1L 5BRQA 4FHBD 3VXUE 1C8PA 3HG3A 3IFOA 1W0YT 3MROA 1F2QA 3NCYP 4JZJB 1U8LA 4Z7QE 4ODVL 2Y5EA 3T09A 1J8HA 4WEMB 5AZEL 1WK0A 4NRZA 3MJ6A 5IT2H 4JR9L 1BJ1H 2VH5H 2VLJA 3LKOB 4PV8B 3RWGA 5IBUB 1T7WA 5KS9E 2GFBB 3GRWL 5ESQA 1IV8A 1U0QA 2NTFA 3KHQA 4L8SA 4TYUA 3L7FA 4PJIB 4OZHE 5K9KA 4NOBA 3MLPA 3OKYA 3SJVE 4G8FA 3WS6A 4YGAB 2WB5A 5IB1B 4D9QE 2H8PA 2I25N 2UY2A 1C5DB 5TE7H 1GUVA 3HC4H 5IMOB 2HJLA 2WMPA 3HG1E 1G94A 4P5KA 1IGTB 4EN3D 1V5JA 3V4VH 3Q0HA 5F88B 2H26B 4G6KL 3CZSA 3DX8A 5FYLH 1UUQA 4IOIA 3ECBA 2E9WA 2CLRB 2BVTA 4MDOA 1BGXL 3CZFA 2YOCA 2AK4D 3F5WB 4PJBA 1F4YH 2IBZY 3IJSA 4ZD3H 1QR1B 1DWHM 3OZPA 2YC1B 4JPWL 4UR9A 2W1NA 2GUOA 1TR1A 3BIBX 4YZFE 1CXIA 2IG2H 2FX7H 2ZSVA 4DOHE 3BSHA 1AR2A 4KJWC 1KC5H 3C08H 4PB9L 3HG1A 2HRPL 3RVXC 3O41A 4PGDB 5DGRA 1GAFH 3X3GL 3PWPD 5DVMA 3WD5H 2WKGA 4NJ9L 4Q22A 3AFBA 3K8KA 4NQTA 1VEMA 2XVGA 1UWGL 3WEXB 3KLHC 3BEWB 4TVSa 2DMKA 1XZ0A 1L0XA 3DMMD 5HHOE 2AJSL 4RMUA 5JDSB 4M8QB 3RWIB 2W07A 2OYMA 3DRQA 4UT7H 4QRTA 1KLGA 1VB9A 4YPGB 3U7YL 2WMHA 1A6UH 1RZKL 3KPLA 3R0NA 4XMKH 4HS6B 2YPLE 3GSUB 4HWZA 3EUUA 1FAKT 4I0PD 4UDUA 4JO1H 5ABDE 5INCB 3MUY1 2I9LA 2I60L 3GSNB 1V3MA 5ILTH 3MGTA 4UT6L 3O6FD 3PBGA 4S2SB 4U1IA 3DC0A 5BXSA 3C9NB 4OCMC 4CRPA 1JNJA 3T0EE 4HC1A 1FCGA 3BCDA 1K8DA 3QHFH 2R8SH 1UQZA 1QR4A 4BFEA 4M7ZC 1FLRL 3C2AL 1Q9KB 2PBGA 4UT6H 1FOBA 4GMTL 5DI8B 4K23L 4IIQB 4KU1A 2ENYA 4PUEA 2XGIA 2XIBA 1QFWI 4I77H 1DANT 1MF2L 1KLUA 4LVNB 2BOCA 5JA8B 5IFJA 3M45A 2BVPA 5E94B 2Q8AL 1GOWA 5E2WH 3B4NA 2FEDD 1HX0A 4G9FB 3S98A 2O5XH 4N0FB 4GXPA 5LA1A 5IB4A 3LKOA 4W7UA 4ELKB 3TBTB 1ORQB 4NJ9H 2ZWYA 3ZE0F 2GFBA 5ESQB 1OWWA 5I16B 3TPUA 3MZTA 2WBWB 4NCC2 3PZOA 1YEDA 2YUXA 1RFDH 1N0XH 3KJ6H 3VXOA 1HL8A 3V6FA 2NXZC 1UM5H 1U92A 1TZ7A 4JQVC 4WUUD 3JXAA 3QNXA 5IB3A 5A2FA 1SYVB 1IGCL 1IL1B 1M71A 2KQNA 1FGNL 5E1HB 3VWKD 1IGTA 2APTA 4PLJC 3VFUB 2K9UA 3O2DL 2YFNA 1FYTD 1MQKL 3OHXB 3QQ3B 3VXQA 3MRRB 3ALPA 1NGXA 1IEBA 2CLRA 2W60B 3EJUA 4Q9QL 2G75B 2Y7QB 3SCMB 2FEDC 3D3VB 4Z0BH 3N13A 5I76B 3QEUA 2J7LA 2DRUA 4QXWA 1ZHNA 4FK9A 4PJBB 1NEUA 1OSZA 4XVJH 4GQPH 1GIGL 2IFFH 2QADC 4OBSA 1C91A 4P7OA 2F8XC 5I19L 1C12B 1ZT1A 4DKFL 1BJMA 1IJ9A 1DSFL 1FGVH 1XGQB 1SR0A 5EFIA 3VGFA 3WF2A 4NUGL 1OGAD 1QRND 1J11A 2ADFL 4R90L 5JZ7D 4AYFA 4HFUL 3GFUA 4ZQKB 1VBUA 4U1MA 1CD1B 3T2NL 3BWUC 4JEGB 3CSYA 5C0BB 3NIFF 1NFKA 1ED3B 1HKIA 3F7VB 2V7HA 4JY6B 4MD0B 1AKJB 4H20L 3SCPA 2QQNH 1VGKB 4Y16B 1JPGB 4ZAKD 3BDYH 3SDCD 1ZTXH 1F4YL 4YDVA 3B9KA 5ITFA 2PXYB 2A9NL 3V6OC 1CFSB 5C6PB 2VXSH 4H5SB 2GTWA 4QRTB 1GZQB 4BQCA 1LG2A 1BZ7B 1CXLA 2VDQH 3DETC 2AEPL 1J0YA 5IQ7L 2WWDA 2GSGB 4JRYB 4MA3A 5JW5B 2QHAA 4X8JB 1OP3H 2ID5A 4I2XA 4JDZB 1IAKA 2ADJB 5ACZB 3QIBD 2BVQB 4X5LA 5ADOH 3D87B 3VINA 1Y6KR 1T5XA 2D4DA 3SKNA 2P5WD 2VZTA 3MBEC 2BNRB 1R5WB 3K1KC 1I3GL 2AJXL 3U46B 1QFUL 5EB8A 2ZP0T 5GGTA 4HX1B 3RPMA 1R7OA 2DT3A 3ZMRA 1ZB5A 4KDTA 1S9KC 4QLRA 1BYBA 3UC0L 1T2JA 5I8CA 1NCAH 4GMSH 3C2SA 3MMWA 2EDLA 1KJ2L 3K0WA 4NKOB 1F3JB 4I3SL 1JPFB 2R9HC 4Y4KC 5C0IA 1R0AH 2NW3B 4CMMB 1L6XA 3L3GA 3RWEA 5C6WH 2UVFA 4JFED 5IOPB 1RUML 3BH9A 3VILA 1AQDB 4OZFB 4M24A 5EBLB 2CDGB 2WP3O 5DT1H 5A3HA 2QQLH 4TVPD 3WN5A 1M05A 1PZUB 4KK8D 1H0DB 1ECEA 3SGJA 3R1GH 5L2KE 3PGCB 5TDNB 4WHTB 5J56B 5DJCB 1B3ZA 3TCXA 5JO5B 3TBTA 1MNUL 4HJ0C 4KWUA 2OMBA 3ZKMD 2ZG2A 1PIGA 1MW0A 4YK4B 3WY1A 3WXWH 3BP7B 4ORGB 2YMXH 2BS9A 3GZAA 2BRRL 4FMFA 2AMGA 5E8OA 2ZWLT 5IQ9B 3WXWL 3X3FL 2YEZB 2CLZB 1M71B 2I9TB 5IQ7H 4LRIC 4CADB 3GXDA 3CZ8A 4ZMAT 1B3XA 1QNZL 5F96L 1Y0LB 3ZKXC 2I5YL 3R8BB 5D7JB 2ZXDA 1LJYA 2HN7A 2IQAB 1JZ6A 5EB9A 2UY3A 3VIFA 1W9XA 2ICEB 3QEUB 4IOSD 2Z31D 1DE4A 2H9GA 3CXHK 5DJ2B 1EPFA 1JF5A 2JJSA 2PNDA 4TNVK 2NX5D 4GRWF 3MLZH 1AC0A 3IGUA 3LEXB 4KMQA 4F15C 2HJFB 4HPOL 1RV6X 2D3LA 5L8JB 3UCQA 2Y5TA 1JZ5A 4KRPC 3VKKA 4YPJA 1PFCA 3VFOB 1HJWA 1OW0C 4P59L 2BNRE 3NGBC 2XXMB 3FQRB 4O02L 1H15B 3ZR5A 4MB1A 4LLUB 3WNMA 1GGCL 5IR1B 4NZUH 3W0WD 5CS7A 2V7HB 1JYNA 1UR1A 3GBEA 3MMUA 4E4PA 2MOVA 3KXFA 1FNHA 1C5BH 3WHE0 1QTYT 3GB7A 3QA3B 3RVWD 2IAND 5FCUH 1P6AB 1RURH 2C1PA 3KYMA 4ONOA 3IVKB 2R69H 4M03A 5J3HD 4QRPD 1KF9B 4JRYA 2R0LH 3S4SA 2V9RA 3A4WA 2VXTH 4J1UB 4P5KB 4H88L 1IC1A 3CFJA 5HDLA 3RHWK 4M29A 1U93B 4XPBL 1AP2A 3WMBA 5J1TC 2VLKB 4YFLI 3UC0H 1EXUA 3UO1H 1YQVL 3OAUH 3HTLX 3PUCA 1L7IH 1J1XL 4UB0L 5I1DA 2CIIB 2FO4B 4PLKC 3T3PE 1ZHLA 5DMGC 3VIJA 1DBKL 1QLEL 4X5WB 3ARVA 1MWOA 1RJZB 1B3VA 3MYZA 3IXAB 2J74A 1YEKH 4LEXH 4XBGB 4EEEA 2IPTH 2NW3A 1IC5L 3D85A 3P0GB 3QWRD 3N15A 5DFWH 3PTKA 3BH9B 4K55A 3EYVB 5C0AD 4EK7A 1A5FH 3ROOB 4OLZL 2RCSL 4LPUA 4F9DA 1EAPB 3GMMB 4M7LH 4ZE5A 1WZKA 4QXUH 3K1DA 5D9NA 1HHHA 3W26A 1JHLL 1QG3A 5FDYA 1PX3A 2XZZA 2FGLA 3FRPG 2BVOA 1SEQL 2VZ1A 2APXA 2WUBL 1DLFL 1ZU8A 3KPRD 3RUGA 3TLRA 3RA7H 5H94A 5GISL 5CEXA 4PUDA 3DECA 1SEQH 2XWDA 3WQWA 3D0VA 4NP4H 1XZ0B 4LASH 4C55A 1NQ6A 4O9HL 5DQ9B 3DRQB 5I66A 1CLCA 4Y19A 5EBWA 4MVBD 1XR9A 3ULUD 1K9DA 3TBVB 4WHDA 1KSRA 2DQUL 3T77A 5I17B 4CADA 3K74B 4HWZB 3BPOC 4GSDL 4GUPB 1E5JA 4CCDA 1OTUD 1U91A 5GRVL 5INCA 4F57H 3LRMA 3LMYA 2MQCA 1JAEA 1MVUB 2DTMH 2XUCA 2HN7B 2IQAA 3VUPA 1OB1A 4IRSD 1AQMA 3ZDXE 4PRNB 4FNLL 1OP3K 3D39B 4R2GC 3UDWC 3GHEH 2JF7A 1I4FB 4FLRA 1IGFH 4PMDA 1IKFL 1OPGL 4IIQA 5E5MA 4PRDA 3NIDE 1KTCA 4LDLB 4RX4D 2PF0A 1CE6B 4OM0H 3OJMB 3VXSE 1N6VA 2QPUA 3O6FC 2J8OA 3L9RB 1YPZF 5IK3A 5A8MA 3V0WH 5HPCA 1CG9B 2F7PA 4KPHH 2BVPB 2DD8L 3ZJKA 5D8JH 3OL2A 1CVSC 1TG7A 4KAQH 4GZEA 3TFKC 3SCUA 3PHQA 3O4LE 1HYSC 4N0FA 1UZ8B 1NAMA 1NUNB 5FCUL 3BRFA 2VVSA 2J3SA 4JQIH 4Y19D 2IALA 3IAQA 4I5BA 3QR3A 2B4CC 3LKRA 2PC8A 4WU5A 3TO2A 4JANA 4RMTA 3RKDD 3WF4A 5JMOC 3OAYH 4N42A 4RCAA 3EGSA 4EUPA 4R2GD 5BJTB 5K93A 5GS0C 3LQZB 3ULUH 3E1F1 3O3AA 4JE4B 5C6TH 2J25A 1KBGL 4G8FB 3DBXA 1FNGB 2PTUA 3EJZD 3IKCB 2VISB 1ZLVH 1U93A 3ARFA 3U5UA 4I3RH 1PKQA 1NGWB 5ACLA 2I07B 4GZJA 1JTPA 2WIMA 3FFCE 3ZSSA 4NQEB 5KVEH 4JPKL 5D7LD 5HVFB 1K6QL 5FV2A 3VD4A 3IXAA 3GI9L 2B1HL 4GRLA 1V8HA 3D85B 4WO4B 1ZT1B 1YC7A 4FMVA 3WFLA 2AK1L 5J0BA 4KMTH 2V17L 4TTGA 2CRYA 1G1CA 5GPRA 2C0HA 3FQXA 2GUOB 2FECL 1JNNL 2M2DA 2DIJA 4G8IB 3HPJB 5IV2B 1UYWL 5CJXA 1X6NA 1DBJL 4P48A 4WUUB 4NQDB 4M7KL 3FXYA 3O41B 5C0BA 2QADD 1ZGLM 3S35L 3PNWA 2NY7L 2XOTA 3RX8A 1MY5A 3AM8A 3JUZA 3SDYL 1PKQE 3GSXB 1BVKB 4J3XA 4WTZA 5MEOB 3RX5A 4MA1B 3B9KB 5ITFB 2XPGB 1EIBA 2V2XB 5E7FA 4L4TE 1EZVX 1FZOB 1IGCH 1CXFA 1OCWL 1U2CA 4LGXA 5C0RH 4G6FB 4MS8C 1OLLA 3T0XA 5C0FB 4F7EA 1IGYA 4D72A 2R2HB 3G08B 4PS4H 4OFYD 3DYPA 1NFIB 4LLMB 1OB1B 4PYHA 5L0QB 1RZJL 1UACL 4PJDE 3NIYA 4OLVL 5IROC 2XHYA 2COQA 2CH8A 4NNPL 1Z32X 4PJXB 5I77A 1T0PB 5EUOE 4X0VA 1KCVL 3DETD 5GNYA 4QHUA 4Y5XB 4J3WA 3U7WL 5IB2A 3RVUD 1CE6A 1F8TL 4Y1AE 5C0IB 4YBHA 3V6BR 2ADIA 5E6YA 1DBAL 4OLXL 4LU5H 5JOEA 2CBJA 1IAOA 3MBED 1BD2B 3TJEL 2AXJA 3HZVA 3HN3A 1Q0YH 1KLUB 2AS5M 3WN5B 1CR9L 1F6LL 4XV0A 2GJZB 3QG7L 5E94A 4P2OC 4MJ5A 2P8LA 3UBXI 1I9JL 1MIEH 4PJ7E 5GS1B 3BXNB 3LEYH 3BAYA 4WU5B 1P2CB 5GGQL 3RJXA 1I8IA 1KJMA 4X0KB 3DX3A 3UR7A 1MIEL 3WQVA 1LK3H 3HR5B 5E09A 2ZKHH 1G01A 2OK0H 4KZDL 1NM9A 4WFED 4P2RA 1FAIL 5CHNA 3DBXB 4PGBA 2R2EB 2ZOLA 4XNUH 3TT3H 3NCCB 1E73M 3GMLA 2WC3A 3MX0A 1DVFB 4BZ2H 4PRID 3V52L 2NQCA 2J8UA 5FF6A 1PKQB 4FQHA 2XQYK 5I74B 4FF5A 1QSFA 3FCTB 4MJIE 1HQ4B 3WCYA 2V3DA 4PJ5D 4Y8AA 4XNQA 4PJEE 4P2YA 3ZDXF 4CD6A 4K2UL 2EBNA 2DLTA 3HMXL 4LHUA 3L5IA 3POHA 2CUIA 4YIQA 2QHLA 2G8ZA 1GHFH 4FQJH 4JM2A 5MEPA 3RM4A 1C12A 2AXFB 4G8IA 4DKEL 1E4XL 4O4YL 5FA3A 3AXIA 4XB7A 1CLYH 4NQEE 3MJGX 4R0LB 3U0WH 5EPMA 4W8LA 2W67A 1FH9A 5KVFL 2OW6A 1QHPA 4WY7H 5LXGH 4PJ7F 3LXCA 5BRPA 1KLFA 1G7QB 4QHLA 1H0GA 1UASA 3CSYB 4QLKA 1MFCH 5E8NB 4DW2H 2GK0B 2YDRA 2ZOKB 4LCCA 4XPFH 3OJDB 3ALWA 3JSSA 3ARRA 3IVKA 3L5JA 1WZ1H 2NY3C 4WU7B 5FOOA 3SDAC 3ARDA 1W9DM 3NACL 3HI6L 4YDVB 5D5MB 5KSVA 1ISVA 4P8UA 5C08E 4AEEA 1AGBA 2PYEE 5FD0A 3RU8L 1T7VA 2W61A 1JHTB 2YN5A 1KEML 3GSOB 4HKZA 4A6YB 1WAWA 3CXHJ 5GGTH 5A8NA 5ABFB 3MV9D 2PYEA 3TZVA 3TA3C 5CEZH 2FWOA 4U6HB 2X4RA 5HNNA 1E1FA 5D7SL 1KXVC 2ZX6A 3AB0B 4MA8H 1T5XB 2CIIA 2FO4A 5CAYB 1NAKH 2NMSA 3GSQB 2JK5B 3P77A 4Y5XA 3NFPA 1N0LA 4L8DA 1G6RH 1MFAH 3C5ZD 2HG5A 4MA7H 3U79A 2PR4H 2YHGA 5IB2B 4NRYB 1KCSH 2W63A 4LIQE 4IM4A 4U1SB 2BFGA 1KCUH 3OPZL 3RBSA 3LRGA 3TN0D 3VE0A 1A7OL 1RMFL 4XX1G 1FJ1B 3EYVA 4NKDA 5F7EH 3I6KB 4NKIL 5ALBH 3GMMA 1BEYL 4KKAC 4TSCL 1XGUA 1JGUH 1TJGH 4LLWA 3RIFF 5HD8C 4MJ5B 3B6SB 2Z4QA 1FV1B 3VRIB 3GH4A 3RTQC 1JFHA 1HP4A 1NDMB 3HLAB 1IM3A 3WFDH 1E6OL 5CLWA 5FYJE 2EYRB 2MTPA 4XC1L 5HVGB 2OLHA 1ZBCA 1N64H 3AIUA 2J1KA 1ZTXL 4LGSB 5F44A 4P5TC 1MHHA 2EXOA 1MLCA 1WIOA 1FHLA 2WWKO 4HS8H 4R97B 1UR2A 1Q6CA 4PGBB 5EBWB 4BFIB 1IRAY 4FP8L 5D8JL 5IQ9A 1E6NA 3DURB 5IFAH 3C5ZA 5CZVL 1Q0XH 5A8QA 3FO1B 5MI0C 1H5BA 3KNBA 1A4JB 1G6RA 4JFTA 3WHXA 3TVMC 4NC2B 1VFMA 4H0GA 4RDQF 4KKCD 1AHWA 2XM1A 4OQTL 3CFEB 5JHLL 3ULUL 4YZFF 2ZUXA 3PZ9A 4GQ9H 2X40A 4ODHH 1W3JA 3WLBB 1OHQA 1A6VL 5D70L 1AE6L 2DSVA 5JOPE 3IK2A 4K3EH 4I0CC 4HZAA 1C8QA 5T1KB 4AISA 4XPGH 2HJFA 2UUDK 4H8WL 4X5XA 2CIKB 3FN0L 3ORJA 3INUL 3BP4A 3KWWA 1PPIA 2CKSA 4F79A 1HF6A 4U7MA 5AY7A 4XVTL 4GMTH 1LD9B 5FKPB 1BVZA 4C54A 3TIDB 1A14L 1FC1A 1MJUH 3UEZA 2R0LL 2WMJA 4XP4H 5DQDL 1AGCA 3MLTB 5KAQG 4ODVH 2X9WA 4O2CA 5I8EB 5D5MA 3S6CA 5KSVB 2KH2B 3WF1A 4UOQA 5L2JA 1IBGH 3PQYE 5D96C 3LN5A 5J9PB 3O9WD 5E08L 1BAFL 8FABB 4X0NA 1BQHG 1RJCA 2PCPB 1YZZA 3RKDC 4J1UA 2W38A 4PJ8A 3BO8A 2VNCA 2VOTA 3CFJB 3O2WH 3L3KB 2IXUA 2YIHA 1WC7A 3EYQD 2EPOA 1V0KA 2VLKD 1XH1A 4J8RB 4CL7A 1CLXA 4I18C 3BP6B 4TULH 5C0ND 3KYAA 5DF0A 3D69B 5FDWA 4WFGD 4M48H 4JFYB 1QSEE 3R1GL 5EO0B 1FJ1A 4LSPL 4KQ3H 3VI3E 2XVNA 3O9NA 3LHPL 2NSXA 4KPHL 5D9SB 3WE6A 3BKYL 3OG6B 2YRLA 3QRFM 1QBAA 2VDLL 1MXDA 3K4DA 2ZCHL 4PTVA 3MJ9A 1HIMH 4N8CH 1KTRL 5GRUH 4XNXH 3BVUA 1TZGL 3WY2A 4HH9B 3V4PH 4OFDA 3UYRL 1KB3A 1JGEA 2YK1L 4P7NA 1NDMA 3HLAA 4JFDE 1HHHB 1PKOA 3B2VH 3U48A 5HDRA 1A9BB 1LE9A 3N06B 4YDJB 4TN9A 3VFNA 4ZS6D 2BVOB 4UQAA 1LHZA 1OGGA 2VLLB 3OXRA 3NCOA 3EYOB 5KAQF 5D1XA 25C8L 4LRNH 5BQ7A 4AIXA 4AC1X 5CEXB 2DQXA 1H3VA 3QPQD 3GSNL 3LQAH 4CJ1A 1UYWH 4JHAH 3S37L 3EMQA 5I1CL 2XTJE 5C0FA 4F7EB 2HFGL 4OFKA 3VIOA 5J11C 3HE7B 5E2TH 4HXBH 3T3MF 3QXDB 4NO5B 1UFUA 4OB5H 3NCMA 5DRXB 5J1AB 1VGEH 3U5YA 5MHSE 2FD6L 4DN3L 4Y4KA 5EIIB 1NCWL 3KLAB 5HY9B 1OT1A 4WDIB 3HC0A 1CTNA 2UWEE 4PJXA 5LAXB