1EO7A

Bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMAAVKHMPFGWQKSFMAAVNNYKPVFTFGAWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of maltohexaose and maltoheptaose bound at the donor sites of cyclodextrin glycosyltransferase give insight into the mechanisms of transglycosylation activity and cyclodextrin size specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eo7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eo7A01
3S9DB 4LGSB 4JZJC 3IDMB 4RIRB 3AISA 4OCYH 5C0EB 2DD8H 3GXPA 2VXTL 2YUZA 4MJIE 4W70A 3BAEL 4J3UA 3C09B 4LSUL 4MJIA 3VCLA 1RZ7L 4O02H 1X44A 4Z95L 4IEFB 3N13A 5AD0B 5DEZA 1KC5L 5D7LA 2ILLA 4WFFD 1KSRA 1P5UA 1FL5B 2J88L 1QI3A 3BYTA 1DN0B 1K9EA 4G9FA 1B9ZA 4WFFE 4JVWA 2W0PA 4X6FA 3W0KA 3UJTL 5HVFB 4LVHC 2YKKA 5DUPL 3RRQA 1EFXB 3CMOH 3QQ9D 1GVYA 3MGOA 1T1YB 1S9YB 2IGTA 3PZOA 2F58H 1Y6NR 3TZVC 3WFEH 1OQOA 4LCWD 5HYSG 2Q8XA 3C5SA 4RDQG 5FDWB 3D51A 3BKML 3CX5J 3B9KC 5IKCB 3PDGA 3LDBB 5IMOA 4KJPD 1NWUA 2G5BB 1L7IH 1DBML 2EPNA 2Q3ZA 3WMBA 4QF1B 1O7VA 5C6WH 4G5ZL 3GI8H 2D3VA 5FB8B 2RR3A 4FQQB 5ANMA 5C07A 3RPMA 2HT2D 1SQ2N 2C1OB 4RX4A 5DGRA 1HKIA 3WDRA 2HAZA 1QNPA 5EU4B 4HUXB 5M5DA 1GGTA 4MCZB 1YEHL 4ODHH 4ALAL 4TVSa 4B16A 3QWRA 1QNQA 5HGAB 3FFCB 5C0ND 2J6EH 2G4FA 1A7PH 4RGMC 4MDJA 5GGQL 1MCQA 2GJ6E 1HWHB 1CS6A 1XGQB 3VFVA 2BNRD 1ECEA 2VCCA 5JW5A 4KRTA 3GMQA 4PJXE 3RVUD 3RWJA 1BYCA 4D0BA 4ZFFA 2IEPA 3IU3A 5D5MA 1DQQB 3LN5A 1CLYL 2FYVA 4PRDB 4JDVA 2V9QA 2E27L 3SGKC 2UWEF 1RZ7H 2YPVH 3ULVH 5EOCL 1GORA 5ICXA 1RIVL 4K8RD 5BV7H 2G5RA 2R9HC 4PYSA 3SDAD 2GSJA 4HJGA 4PGCA 3LPWA 2JKXA 1XGTB 5IG7A 3TNNB 1BD2B 1QD0A 1T83A 4EUPH 1HILA 3O11A 3UR7A 1NFDA 3UJTH 4IM8A 4N5UA 1FO0L 4XWGH 3UTTD 3QRFM 4UFMA 1WZMA 5DRZA 4EDWH 2D3LA 3A6BL 2AEWA 3SGEH 1U91A 3MJ9H 4OLZL 5GRJL 1DTUA 4HS8L 3OTTA 5F9JA 1WEJH 3VFOA 4Z2IA 4JHBA 2DT2A 2VWEC 3FFDB 1R7AA 1BQCA 2BMKA 1FG2B 5E7FA 2WZHA 5D1ZA 1OB0A 3RWGB 1SM3H 1P7KB 4KKCD 4M5YL 1QI5A 4GG8A 5K9KB 5FO7A 4NQXB 4KXZI 4OLWH 3U36B 2HTLC 1E3ZA 4WJXA 3GJEB 4PR5B 2QQLL 3MNZA 5CWSA 1UWGL 3WH6A 1FA2A 2ZUMA 4MA3B 3ECBA 5E9DE 5T5FH 1R5IA 1BM3H 2BS9A 2AXFA 3HZMB 3WXVH 4OZ4A 4KPHL 4O2CA 4NSKB 4YH6A 2PI6A 3NSMA 4R4BA 4AD3A 1WWBX 2PC8A 4DAGH 1T7YA 3GMRB 4FQ2L 2A3AA 1NCCH 5B38A 3QEQD 2NY0D 4WENB 1ZT1B 5DO2D 5M17A 4FQ2H 3IDXL 4MAYB 2R9HD 4XRCB 1QNZH 4Q0XL 1WBYB 2BNRB 3QDGA 4KROB 1X4XA 3W6LA 4AD0A 4P4RB 4C55A 1RQ5A 3OL2A 2BSRB 3BP7B 3HS0A 1U91B 3HMWL 4M80A 2VO5A 1NAMH 1JJUA 4FOMA 5KVEH 1YNTB 4L9LA 2Z93A 4LLWA 1ZGLP 1UJ3B 3RGVD 3BAYA 1G6VK 4XPBH 5DQJA 4E8CA 1B30A 3CIVA 3C5JB 1GW1A 1RUMH 3KLDA 1UZ8A 4W4OA 3F5KA 1ND0A 3GMRA 3VTRA 1B2WL 2FX8H 4XP9L 1UWUA 2XWDA 4ODXB 3OF6A 1B90A 3QZWA 1ONQB 1AO7A 3KPMB 1MELA 1VENA 1MH5A 2HFGH 4HUUB 2HTLD 5DQDH 4MXVF 2QQLH 3CUIA 4HGMA 3QUML 1FQ9C 2NZIA 4I0PB 4PRIA 5KG9B 1GOMA 3BAKA 2P5EE 2OTWB 3V6FB 4R0LC 5E0FA 3SGDI 4K9EH 2RGSA 1K6QL 3FB5B 2SEBB 1HHJA 5CJQL 3UEQA 2FHCA 4JKLA 1MVFA 3U0TA 4U1KB 1KEGH 4S3JA 1U8MA 4YXLL 4X7SH 1QFWM 3UG4A 1NCBL 1AP2B 1RUAH 2A74A 5LWYH 3X3GH 4QCIA 3QZWB 2P45B 3GGWA 3RKDC 2J6EA 3MLUL 1RZ8B 4OUOA 5FM4A 3SE9L 1ODZA 4CW1B 2YL6A 1OF2B 1PFCA 2XFXB 4JFTA 1KR0A 1N3NB 3CDGA 4POYA 1XV8A 4LKCB 4G6JL 2AJVL 2P1YA 4YHYC 3GKWH 4CD8A 1BZ7A 2PB1A 1KCVL 5JPMA 5AY7A 3NIFE 1DQDH 4F3FA 4LEXH 4QRRE 2GFBB 1HHJB 1PSKH 2CDGB 2M8XA 4OUUB 3ZDYF 2IMNA 4U6YA 5FYJE 2QHRH 1G9EA 1FNAA 2XG5A 3UPRB 3JV6B 4NKIH 4IM4A 2O5YL 2O9PA 4OQTL 2IAND 2A6IB 5ANME 5C07E 3HFML 5IMKB 5E2VL 2YRLA 1AI1H 5C7XL 3PL6D 4JFFD 2XWBB 3O2DA 4KAQL 2YD9A 2XFYA 3NIDE 1NCUA 1OAUL 1H0IA 1XF2A 5BRZB 4F9LC 4Z7WE 5C0BA 4HULB 3G5XA 3MLYH 2X4QB 2VZ3A 5FKPB 3FKUS 4PJEB 4FQLL 3TONA 3GSRB 3FQXB 1A7NL 2QBWA 2FL5B 3D0VA 4MJID 4Z7OE 1GHFH 1I85C 2OS7A 1PBYA 1ZMYA 3G5VB 1KJ2L 1TETL 1TTUA 2X5PA 4KMQA 4GOSA 3GIZH 4LFHG 3VXQA 1SJXA 1KCUH 1KTKE 3BP5B 4G8EB 3FOMB 3NACL 3MRLB 4XNMB 3IAGC 3EO9H 4GRLB 3C6LA 3WHE1 1MLBB 1NBYB 3MRGA 1YNLL 3MTRA 4P23B 1NGZA 2VDML 4KUZH 1EGJL 3WUBA 1C08B 1AD0A 5CJBA 1Z3GL 4QHKJ 3W11C 1HH9A 1QWUA 3A6OA 4UTFA 4OLXH 1FFQA 4P9HL 4P2QE 2AI0L 3ZT5A 5ISZD 3O41A 2YD2A 4K23H 4AZBA 3UJJL 4J1UB 3PZ9A 2HFGL 2CDFB 5EO1A 4H1LG 3H7LA 1PVHA 2P5WD 3G5VA 5F6HJ 3HZVB 3F65A 4YHIA 2WZIA 1RJZB 5EU5A 2BNUB 4LLVA 4NDMB 4M43H 3CFJB 4LU5L 5D96B 1CG9A 3MBXL 3MCLH 1JGUL 3G5XB 3CZJA 5LQBL 2WBJD 3U4EB 1LE5A 1QR1B 4MJ6B 2CDEA 4ZS6C 4MJ5B 2H3NB 4M9OA 4WRLA 2H1PL 2X2HA 2YZ1A 5JO5B 1S5HB 4U2ZA 4BQ6A 1RVFL 3QDJB 2IG2H 5D7JB 4W7WA 1NFDE 4L4OA 2VN4A 3CFKA 3QNYA 3VGDA 4H8WC 5F96H 5I8OL 4IJ3C 4GXUN 4TQEL 3H9SA 4UT7H 3BN9C 2PWEA 3MRLA 4XNMA 1SEBB 2I9LA 5F7WC 5HGBB 5KG9A 3EOBB 3VH8B 3WJJA 1U3HC 1SFSA 1EXPA 2OTPA 4XV0A 4QHMB 5LAXA 3SE4C 2WXDM 4OFVA 2COQA 1JPST 3VXOB 5HYJE 3KPNA 5IB1B 3AXHA 1XD0A 4WEBL 3VSTA 2PW1A 3POHA 3T77A 4S1SL 1KJMB 4F7MB 4BQBA 3BO8B 1SJHB 3TBSB 3CUHA 3BWAB 5JPNA 3N1FC 4Q97A 5D1XC 5C0GA 1XGPA 3WFHA 4HT1H 5I16A 4JPIB 5HYQA 3DROA 3FTGB 3M17B 4KV5E 5IF0B 5DD6A 4AENA 3WJJC 3UR8A 4OZFG 3OZ9L 5T3ZH 4NO0A 4NRRA 2VVNA 5E09A 4JN1L 1FN4B 1N4XL 1J86A 1QI2A 2X1OA 5HXMA 2YBTA 2VLJB 1NGYA 1MCWM 1IM9B 5CGTA 5DJDB 1OM3H 5I1AA 3K4DA 5F7UA 3SO3B 4OF8A 4Z5RA 3WUFA 3HNSH 1VJSA 3ISWA 3N50A 4I77H 1J7VR 2FHBA 5TE4H 3GH4A 2HVKA 5GISL 5D7LB 3BWAA 4DM1A 3L5WA 5I2IB 4LSSH 1N0XL 1CQKA 3DRQB 4UDTB 4HG4J 2V2WA 2Q8AH 5DK0B 5EUOE 1YEEH 2W60B 1PZ5A 4PV8B 4OBSA 1I9RH 3TBVA 1FSKC 5L8KB 2GYSA 3CZNA 4IS6A 5CKAA 3EOTH 2NX5D 3MGOB 1R46A 5L2JA 4Q6YA 4I3SL 4P46D 4MNHA 2JELL 3ZYOA 3W39B 2P48B 4XBEH 4IDJL 1S7RB 1DUZA 3FQTB 1BAFL 1P9MC 1SEQH 4LPVA 3RX7A 1MCSA 1BYBA 4OFPA 5EZOL 4JFOB 2J8UA 1AXTH 1DR9A 1DN2A 5CHNA 4K8RL 4H26B 3MODH 5C8JB 1CIUA 3Q48A 5C2UB 5E95B 3EYVB 1UG6A 5T1DL 4APQB 4NX0A 5CG0A 3K4AA 4Y16C 3DUUA 2ZWZA 1R8LA 3PV7A 1RZFL 2H45A 4X8XA 1Z5LA 2EIZA 2PETA 2YXFA 4QYOA 1LDPH 3P9LB 4HIJB 5DUPH 3SCNA 3T1WA 3DO7B 1S7UB 3ARDA 2Y5EA 4WF7A 5K9QG 5J06A 4H1LB 3BRGC 5DSCB 2ZUVA 4Q6IB 3BH8B 4GW1B 2VMFA 4YPGB 3GMPA 3AMLA 2RGMA 4NZCA 5IQ7L 4P9HC 4Y4FB 1P7QD 5EO9B 4EI5A 5HPMB 4JO4L 1CK0L 1UEYA 5EU6B 5D2NC 2XTJC 2X41A 3KNBB 4UINH 5BVPH 5I6XB 2FYYA 3L7EA 4YEEA 3TZVB 1C7TA 2VSDA 3I6LE 3W5MA 2ENYA 3HZKA 4QRPE 5F1OB 3QJHA 4E4PA 1UADC 2VXUL 1I8LC 1RURH 1N6QL 2FD6H 5FO8A 3BEWB 2DL9A 4FLSA 1NC2A 3JWOH 5AYQA 1YN6B 4B9ZA 4NFDA 2J47A 3EGSB 3THDA 1CD1A 3WUWG 5I71C 4N9GB 3LB6D 1FH5H 3IGAB 2RIKA 2E6JA 3WFCH 1EGJA 4PV9B 4DGVL 1SVCP 2XTKA 3DECA 4Y1AD 2WZPD 3Q5YA 3QWOB 1GQKA 1ZL1A 4X6DB 5F9JB 1RUPL 2DIBA 5T3XD 1GL4B 5E6ZA 1KULA 3RDTB 5J89A 4PLJD 1MI5E 1J1PH 2CKBH 4M3KB 5CLTA 2FNBA 3IJ7A 2ZUUA 4RA3A 3NPSB 4Y5VB 3L5JA 5FOBB 4N1HB 3OB0K 2BSSA 4JM2B 2VLKE 4ZTPH 4N0FB 5ITFB 3HR6A 5JOEA 3NZ8B 3GIZL 4UQ9A 1ODAA 4I5BA 2D4DA 3VFUB 2WVVA 4M48H 3VXUD 3S2CA 1WE5A 1DANU 3C5ZB 3A4AA 3I6GA 1IM3B 2ZUWA 3PWPE 1FZMB 2LAAA 5C0DA 1NDMA 2BVUA 3UTZB 1DQLH 2JCCF 1NKRA 1KN2L 5J3HD 4S1RH 5CQ1A 4EKJA 2QR0B 2CIKB 5DEGB 1NEUA 4FMFA 1QRND 3QJHB 4MJIB 4M56A 1FJ1B 4TX6A 4S0SD 1Q0YH 4E0RB 5D2NB 4XMKH 3BGMB 1HL8A 2X4PA 3ZTJH 1EEYA 3GZAA 1F3DJ 3HI6L 4LSDA 3SDYH 1MSPA 3SIMA 3TO4C 3SDXB 1HX0A 1D9KC 3S35L 2AXGB 3QCVH 2MHAA 1Z2KA 5IBTL 4HS3A 3LIZH 1QQDB 1A6ZB 4G6JH 3SKNA 3TVMD 5C6TL 3O6KL 4PBWD 2EYTA 4P5MA 4QXWA 3MGTB 5FHAH 4ORGA 2GJXB 4IPLA 5ITBH 4WV1C 5HY9A 1OB1B 5CCKL 3LMJH 3LKQB 4BH8A 1MCNA 5EMYA 2IQ9L 3PWJA 1U2YA 2EDWA 5JW3H 1ZGLB 2ARJB 2PWFA 1ODUA 1K2DA 2FO4A 2FBJH 1JWMB 2VR9A 3NPZB 5CJOH 1OT2A 4CVZB 2YC1A 4YHZL 1BFVL 1H09A 2R2BB 3BUBA 4URTB 3P0GB 4P2OD 1HOCB 1P4BH 4G6FB 2WVTA 5JNYA 3ULUC 3ARGD 3GK8H 2A3EA 1C12B 1JFQH 3UG5A 5DYOB 4PMNA 1U36A 2EJ1A 5EUOB 4HIEB 4JO2H 5LG1A 4J7RA 3IU4H 2OTUA 4MA1C 2DIEA 1WAAF 3U7BA 3BGAA 4I9WD 4GT7A 2XWTA 2YBRA 3L3HA 3DC0A 1ORSA 4PY7A 3KYMB 2Z31A 3I9GL 1T89C 1GIGH 5DUMH 2KQNA 3QXUA 5DUBA 5HYJA 3GJFA 1NFIB 2JLLA 3FL7A 5D1ZC 3EYOB 2EZ0C 3WIHL 2NY6B 2ADIB 2N7BA 3O8XC 4MXQC 5AYIA 4JRYA 3U36A 4NO0D 3P4LA 3I75A 3VXPB 3UBXI 4O00A 4QHKI 1NLBL 3H0TA 5JIWA 1MJJB 3JWOC 1WFNA 1S7WA 3LRHA 4QHUA 1Q1JL 5SWSA 1QBLL 1A9EA 3BZEB 3G5ZA 3D4ZA 1VGEL 2RJMA 2MCG1 2IPUG 1ZGLA 4Z0BH 5D1QA 1CT8A 4D6GA 3GNML 4GKOA 4E41B 2RCSL 4KI5C 1OD7A 4JJ5A 3E2HB 4NM4H 5I8CB 1J9CT 3E8UH 2R2BA 2ESVE 2HT4C 4QRSB 1QG3A 1U92B 1QPPA 2HJLA 2ITDB 5KSBE 2NR6D 1WBYA 2PUQT 4DWHA 3MBEC 1IQDB 4Y4KC 2Z9TA 3HNTH 4MCYA 1I4FA 3D2UA 1GOKA 2A3CA 5EWIL 3ARWA 3QPQD 2ZPKL 4NKOB 5F89A 1N2RB 2F53D 4V27A 3V6ZB 4X9FA 3FO9A 1G1CA 4JCLA 1EX0A 1IGJA 4FQJL 5T5FL 1M7DA 3BJ91 5GS2H 5HYSB 2NW3B 3CVHB 3FAWA 4AT6B 3WY4A 3D39B 4M7KL 1G0DA 4YDIL 4MDJB 3A67L 4WFEE 4W4OC 2VLLA 4YLQT 1I1YB 1NARA 3CFDB 3NA9H 2X70B 4Z77B 1JFQL 1T5WB 1B3VA 3X11B 3TWCH 4Z9KB 3RWJB 3VRLE 1QYGH 2X2JA 1HHGB 3QI9B 5KBNC 4OZFA 2K7PA 4XNUH 3WY1A 4TUJB 2YPVL 1ZS8A 3RX8A 1V5JA 5EH1A 1JFXA 4PBGA 1V3JA 1Y0LA 1Q9OB 2C7UB 3GSUB 2X4TB 2XTJE 4NZFA 2EPKX 1H5BC 1C08A 5HHOA 3VU2A 4NBYB 4NKMB 1NANI 4MNQE 4BSJA 1IGML 2AEPH 4R2GB 4LBEB 2Y24A 5A2AA 1Z6JT 5BXFB 1JK8B 4P5TC 4HKJA 5D4YA 4R26H 5C2BH 3A6BH 4DOHB 3MFGB 4X6BB 3PZGA 4H88L 2YLLA 4OCXH 4LU5H 1KB5A 1W1VA 3VGFA 4W6YB 4X7FC 3UYRL 4R7NB 2HH0L 2Z8SA 3LHPH 5D2LB 3QEQA 4ONOA 4HFWB 5F9OH 3LPPA 1BD2D 4MSWB 2XVKA 3A4WA 4LKCA 3O6LL 2BZDA 3OF6D 4QHNB 1KGCE 3DXAD 2ZXAA 2CLRB 1BVKB 1VJZA 2RAMA 1T2JA 43CAB 5IOPB 2D2OA 1A7PL 3RVWC 3AY4A 3GBNH 1ADQL 3VXUA 3BRFA 1HOCA 1GGUA 5DS8A 1IQWL 2FDBP 4HKJB 4HXBL 1A14L 1CGVA 1S78D 5EU6D 1G0CA 2PKDA 4UFLA 1J1OH 4FN0A 4RGNE 3MJGX 4JZJA 4L4VD 4LLDB 4PRPB 3U57A 1XCQA 3NCOA 5DYOA 1S7QA 5ETUA 3A22A 4HIEA 2Q3AA 4YHLH 5EBMA 4FTVA 2AEQL 3NCMA 5CEZH 4FLQA 2YDSA 3L5HA 4FMKA 5KSAB 4H7VA 2UVFA 3WE6B 4B53A 3FB5A 4B5EA 1MWAH 1FNGB 2WNGA 3OZOA 1CDJA 3KLKA 3MSPA 1Q0XH 1MJ7H 2EKJA 4HPOH 5AWNL 3Q6GH 3HPJA 3CXDL 3NCCB 1YPZB 3U7YL 3D4YA 2VOTA 4EZMA 1PKQE 2AEIT 2B4CC 3DBXA 3AFBA 5IMLB 2JJTC 3T0DA 1XSIA 3EYFB 1CLZL 2P5WE 3RWCA 4N8CL 3V5DB 4KDVA 2AJUH 4FQCH 4PYGA 3ULSA 3FT4A 4JFVA 5T1LB 1ZANH 3NFNB 2JJUA 2QHRL 1NCWL 3HHRB 4Z7WA 4RAUB 5CSGA 3KPLB 3AIEA 5EBMB 1M1SA 2BJMH 1OPGL 3KWWB 4H0HB 5HHQB 1HCFX 3DV6B 4Y4HA 2YBUA 2Y9RT 4L8SA 3CZ8A 3DYPA 4OUUA 2VQ1B 3VXSD 2GSGA 1IGFH 5KSBB 2YL5A 3P4OA 2UY4A 4RE4A 1HI6A 4FFWD 5DJ6A 2HJLB 1INQB 2ITDA 4ZO7A 1ZLUH 4U1GB 5MEPA 4TOYL 1FP5A 2BNRE 2QHLA 1OTSC 4ELME 3MYJB 1WDSA 1U6AH 3GBML 3BZ4A 2HFEB 2NYYD 4UDTA 5M03A 5IQ9A 4HMCA 2LU3A 5ABFB 3GO1H 5F88A 4W7UA 1SYVA 3MRPB 4QY8B 4DZ8A 1DWJM 1HYRC 1KEGL 4QHLA 2ID5A 1LQSR 2EABA 3SURA 1KIRA 4PJ8C 5HYJD 4UNIA 2YFNA 3ULVD 1E72M 5ESQB 4K94L 2J12B 4V1DD 2VQUA 3U9UA 1PEWA 2J7LA 4PJXA 1D9KB 3OG6B 1KENH 1AE6H 3RWHA 5T3XH 4XGZB 1I1AB 5CIPB 4XHJD 3TYGH 4X6CF 1M05A 5DMGD 2VRAA 1DLHB 3T1FB 1JG9A 3AHVA 1BQLH 2KPNA 1WWAX 1KIUA 4LEOA 4GBXA 4U1LA 5DDHB 4X4ZA 3S5LG 2OW7A 1JRHL 1R0AL 4EE9A 3WMSA 4MDPA 4AZ6A 2HH0H 1AGFB 2DM2A 3KYKH 1MAML 1FE8H 5A6MA 3BWUC 3IYLW 2XQBL 3FMGH 3ZO0A 4TUKH 1DLFH 4X7TB 2DSKA 1U8LA 3GXMA 1TCMA 3F7VA 5ACZB 1H3VA 5BXFA 3CUPB 3O6FA 1J0YA 5GPRA 5T1KD 2NNAA 3RWDA 4A3YA 2VC9A 4JDZA 1S7VB 4X6EA 2EXYC 2EPMX 3LEYH 1W9DM 3BUPA 4KZDL 1FSKB 4W5UA 3MUZ1 3SDXF 3AHTA 5EBLB 1DE4A 3FT2A 4J4PA 3RL1B 1PLGL 1HSBB 2APFA 5F44A 4EAMA 3OIHA 8CGTA 5HNNA 3CU7A 4RE3A 1HDMA 4FZEH 4YHMH 2AABH 1J01A 4FQXD 4UOW0 3SGJA 3O2VL 2M2DA 1P6WA 4NIKB 3CSPA 1BVKA 1R5WB 1AO7D 4UQCA 5AC5A 5SWQA 1N7MH 3JVGC 1D9KA 4R4FL 1DDHA 4F8XA 4OKVB 4OZIF 4WEBH 5I1LB 1JF6A 3VWKC 4P5KB 5F7YC 1Q8MA 4DEPB 4A3HA 1BFTA 5GGTA 3LV3A 1G7LB 4MQ7B 1XF5B 2IBZX 1ZHNB 1XMWA 1QFWI 4ZOCA 1YZZA 4OD2A 3WHE0 4WDIA 4JHOA 3IVKA 3ARFA 4ZPTB 1X5LA 2UY3A 1G7HA 3F7VB 4TSBL 4X80H 5ICXB 5IFTA 3M8OH 3QFJD 1B0RB 5KVFL 4N8VB 3O8XD 5F7NC 3LEXB 4PIRF 4ETQB 3OKYA 5H37G 3QEUB 5FUCE 4R96B 4I18B 5INDB 3DYMA 5LBSL 4Y4FD 4P5KA 3MOBH 4CMMA 2NCMA 1OTUC 4XWGL 4FNLH 4JZ5A 5L7XH 5I8EB 4OZOA 4TVPH 4MAUL 2YL8A 3VXNA 5FAAA 2OI9C 1A6WL 2AJZB 2X7LB 4KI5E 4QRPD 1J10A 4F2MB 3BH4A 1KNOB 4GAYA 4IOIB 1FPTL 1YMMD 1RJLB 1KJ2A 3M07A 4PJBA 4QFUA 1AP2A 1J0ZA 2Q86A 4OCWH 3MRQB 2WM0A 1D5ZB 3RUGA 1U93A 1R87A 2F5AL 4GRMA 3BH8A 1D6EB 1A1NB 5F3HB 5D4QA 2Y2WA 3S36H 3OLGA 5KOVC 1MI5D 4R3SB 2V2XA 4UQ2B 5DJYA 5IR1B 1BM3L 2R1XB 2XWEA 1YEJH 1K5NA 3V7MA 5DD1L 2Z8RA 4Y2DC 1BZ7B 3W25A 3KLAA 1TQTA 1NKOA 3D52A 3CJJA 3BW9A 3OGCA 1E5NA 1OW0C 3EOAA 1A6AA 4HS6A 4PYHA 4CCDA 4DWSD 4OCSH 2DQTL 3O2WL 1QPXA 5A8QA 5DHVH 5DJZB 1R6VA 2I07B 3W37A 2XZZA 4HH9B 4H26A 4PJBB 1W0VB 2CD0A 3NTCH 5IHUH 1QW8A 4NJ9H 1I3RB 3BIAX 2VISB 4D9RD 1GRWA 4MD5A 1S9KC 3MLVL 1PX8A 3WQWA 4JFFE 4UT6L 2XZCL 3QXVA 4GBXC 2XG9A 3Q6GL 4QDMA 2YPLA 2R4SH 4K7PX 4P4KD 1L7IL 3E6HB 2R1WA 4F9PA 3ARRA 4MGXA 3DOSA 4MNJA 3BH9A 2NY2C 3WFEL 1TZHA 4CDGC 1UT9A 3VXME 1N6QH 4CAGA 3BGFC 1NGPH 3L6FA 4KVNL 3SCRA 3B3IB 1HVQA 1AQKH 3SE8L 3HCVA 3VIMA 4OCWL 4NCC1 2HRPL 2FB4L 3EYPA 5JA9A 4EXKA 1I3RA 3TO4A 4OF0A 1DQTA 2EE2A 3CC1A 1CXLA 1VGKB 1YEIL 1BBJB 4JN2B 4LQFL 2HN7B 3BZFA 1NBQA 5M7QA 3AS3A 1D2KA 1PZ3A 1XGTA 4YR6A 3E6HA 5EBAA 5IB4A 3ALPA 5HVGB 1CIDA 3D18B 2ZNXA 1MHCA 3SN6N 4DUXA 3HAEH 4FZ8L 3L1OH 5HDOA 1S7XB 1W32A 1IC4H 4U1JA 4RGNC 3RI5K 1I75A 4M29A 4UIMB 3B8YA 5D5ME 1QFOA 3U1SH 4OIIL 2PYED 1P2CB 3S37L 2CLZB 5CJQH 5CD5D 4JIEA 4AD4A 1W72A 4G43B 4UFIA 1XGQA 3BIBX 5F6IB 1ZGLM 1N26A 3F7QA 2L7JA 3ZKND 1IKFH 5JPMB 2VH5H 4BSVB 2HLFD 4M5ZH 4JQVA 3ZM8A 2KQMA 4PJAE 1RURL 4YPGA 2UY2A 3CO4A 1ITBB 3CFKB 4U1JB 1JXJA 3O3AB 4Y5VC 3B2VH 2A6IA 3OKDA 5DVOA 1SHMA 5I66A 5J6GB 1YJDH 2YA0A 3SKOA 4Z0XA 5IHBA 5B39A 4F7PA 1HH6A 3GBLA 1B3YA 1MHPL 3D5HA 1R3HB 4F2MA 1F3JB 4U6VL 1KNOA 4OI8A 1JMXA 2D9CA 2BNQB 5HGHB 4Y5XA 3MREB 3CTTA 4N0UA 4JFXA 5AG8A 1B2WH 1QA9A 3QHZL 1JUFB 4HK3N 2ESVD 1H8OA 3OG2A 1HNGA 3EYOA 2UWEB 3FONA 5HDQH 5IT2H 4P3CH 4UV7L 3PZQA 3IFNL 1QSFB 1MFCL 5BS0A 3R06A 1QSEB 1B3WA 1Q9WB 5IT2L 4MXVE 5E08H 4QGYA 2X4RB 3RGVC 1MW0A 4YBQC 4PJCE 4PTUA 4P23A 1CFSA 5E8OA 3R8QA 4D6CA 4QOKB 5DJ0A 5ADPL 3E6FA 4PJXF 3AIBA 2CERA 2AMGA 3EJTA 3VWJC 1H2JA 1GOQA 4WSKA 3F4VA 3BPOC 3KLLA 4OLVL 5HHXH 4OTXH 3QHTC 2BHUA 1TJHL 4K94C 3QQNA 5I2IA 1RZGA 3LKSB 3SE3A 4RMTA 1AFVH 1E28A 2CXGA 4XP5H 5DR5L 2OR9H 1PZ5B 3WSUA 3IDXH 3NABL 3CHFA 3RQ3A 1I1FA 3C2AH 1ZSDA 2J5LB 3RZCD 4PJ5A 4LCCA 1AE6L 5FM5O 4LCYB 1I7ZA 1QHOA 1U8PA 5F1NB 1BGGA 1D5MA 5EN2A 1JHKH 2DTML 2BSRA 3BP7A 3CMGA 3ZE2F 1R0AH 1UR4A 5CP3A 5E6ID 1AO7E 3UTTB 3MROB 2IQ9H 3T4YA 3L3OA 3OAZK 1O7SA 3WIIH 5C08D 4AIEA 2ZUXA 2K7QA 1CE1L 1S5HA 5ITBL 1BFVH 3RVVC 1FO0B 3AOFA 1QACA 1JN6B 4WFHE 5HY9B 4ZXBA 2VR5A 4PTTB 5AYUL 3IRZA 1NCDL 1XC6A 2NR6C 4K71B 3QEQE 4D94A 3MRFA 4ZO6A 1UM4L 4GLRI 1KQZA 3LEYL 4HEPG 4QHMA 4TOYH 1CFTB 3H3BC 4KKLC 4OQ1A 2E27H 4FFYH 4FNUA 1V02E 3MANA 1MFCH 4RAHA 1DHKA 2ICEB 1H3WM 2EO9A 2B4CH 2IH3A 3VD9A 1KCUL 2CK0H 3K81A 4ZUVB 5DJAB 3LKPA 4PUBL 5H2BB 2HVJA 2VDQH 3B2UD 2W63A 4PGEB 3F7RA 3VFSB 2X2YA 1I1FB 4I0PD 1Q94B 5J3HC 3S8WA 2C4FU 2WC4A 4OOUA 5ECUA 2DSUA 4IHOB 3DO3A 5CZXC 3X17A 4TYUA 4HPOL 4N42A 4GRWH 4JRXB 3SCVA 3HN3A 1EGJH 3DWTA 1QPKA 1BOYA 2H32B 1BVNP 2F7RA 2H2PD 3T0EE 2Y4SA 4BK4A 5CEZL 4NZUH 4FA8A 4JPWL 1HHGA 5FCZA 3REWB 4NJAH 5J11C 1IBGH 4I4WA 5F3BA 1KBGH 3PBGA 5A16B 3AY4C 4DKDC 3ZE1E 4MNGB 3O3AA 4GKNB 4Y5YA 3UPAA 2GVYA 1F13A 3EAKA 1MLBA 3MRGB 1VADB 1ACYL 3BKCH 4XAKD 1U3ZA 5E4EC 1AI1L 4ZFZA 4LEXL 1QOXA 1FYTA 1U6AL 2VDKH 5FGSA 3G9VA 2XYCA 4L4TA 3UZQA 3ZSSA 1VFMA 5D9NA 1XGYH 2ZX8A 4Z2KA 3RVWD 1EERB 4X4YB 1W72H 2N4IA 1E4NA 2MQ3A 5KSVB 3FO1B 4X7EC 5E2UH 5IVZB 3QR3A 4E42A 2Q7YA 3I85A 2V3DA 3L4UA 2GTWA 2JB5H 3GBNL 1BYAA 1HCVA 5LXGH 1JTPA 3DMMA 3LN5B 1MCHA 1QUNA 4CVXA 1CQYA 2OBGA 5FKPA 1X5GA 1W1TA 1O6IA 4F37K 3VG9B 4AY1A 5GGTH 4HJGB 4OIBA 2GITA 3CFDA 3O4OB 1T7ZA 1I8KB 4P9HH 3SBWA 1DL7L 5K9QI 4H8UA 1XR9B 3BSHA 3UDWA 1FP8A 4YHEA 1AHWA 3PL6A 4JFFA 7CGTA 5A2IH 1F42A 2D20A 5FM8A 3TIEA 3VINA 3IETA 1V0LA 1ZVSB 3TT1H 2CITA 2Q76A 2NY1C 1PW3A 4MJ2A 3LPOA 3G6DL 2OJEB 3W9EA 5ABFA 3CSYA 1RZFH 4HA4A 5KVDH 1Q9OA 2XVPA 1BP3B 3QEHA 3OJDB 4YBHA 4JFHE 3POCA 5ESVA 4QCEA 4FQIL 1SYSA 1ZLWH 1I85A 2PW2A 5D70L 2D0GA 4QOKE 4JFHD 3VSUA 2CKSA 4F15C 4N8VA 1HKJA 5HHMD 1C8PA 3PGDB 1WNOA 2IMMA 2CLVB 5JHDA 3V8OA 1NH6A 5E8EA 2A1WL 2BY2A 2I9TA 4ZE4A 1WLHA 3ARBD 2OX5A 5F9AC 4PGBB 3MS8A 4L8CB 2BVPB 4N1EA 4UQDA 4R4FH 2IPTL 3C6LD 1X3DA 1N8ZB 2UYLB 1E6ZA 3RDTD 4KK9C 4KJYB 4WO4B 3DX9B 1U3HD 2WQRA 2VLRA 3EYQC 4MA7L 2XN9E 2CSPA 1MCKA 4IRSA 5J1TC 1HJSA 4PRAA 1HI6B 4J4PC 1E55A 2J79A 1X1NA 3V4PL 4ZE5A 1I7TB 3AHYA 4F9JA 5IW6A 3BISA 5DFWH 3EYSL 4V2CB 3QGVA 3E0GA 4QXGL 2AVGA 4IOSD 3EYSH 1QOKA 2R0WH 5E9DA 3BLKA 1BBDH 3MA9L 4MA8L 5JDSB 1T89A 2Z31C 1G7MA 2EDKA 4L8CA 1INDL 4GRWF 1XH2A 4JQIH 1DSFH 2V2XB 2EYSA 4Y16A 2QR0A 4X80L 1E4WH 5DEGA 4DN4L 1VPOL 5IB5B 1NBZA 4ZFOB 5E8DH 3PIQB 1F4XL 4PJCA 5L7XL 1MCWW 4LPUA 3OZ9H 2P4AB 5JR1H 4FNQA 3GNPA 5F3BB 4HEME 4NN5C 2HISA 5DVLA 1U42A 1G94A 4NZJA 3P4MB 2A6JB 3KPOA 1AGEA 1G7PA 3FB8A 5DRWA 3MXVL 5C0JA 2KH2B 1TA3B 2WQ8A 3FAXA 3JBG7 1H5BB 3MSDA 3O6KH 1BJ1J 4R0LB 2ALWA 4BQ8A 2BCKB 4UDUB 2C3VB 5TDPA 2LABA 3NCJH 1EHLH 4JFPA 1G7IA 1YPZE 4J3WA 4KI5D 3U0TB 2EQDA 5HHVL 4Q7DA 4P46C 3RIAK 5CZVH 3SOBL 2EACA 1H9VA 1Z0NA 4NCC2 3DIFA 4O9HL 4P2OB 3PTQA 1MYRA 1T5XA 1NCAL 5JW3L 4IUGA 4JFEE 3DTXB 4N0YL 2X1QA 3F5JA 3AZRA 4POUB 3ROOA 3WUZA 4CCCA 3M45A 3QUYB 4GKLA 2ESCA 5GIRA 2JE8A 3EO1B 5JDSA 5CSUA 4PREB 5TF1L 2PTVA 3UEZA 3MRRA 1OAKL 4G8FB 1BSIA 25C8L 2XGBA 4KK6D 2YMXH 3H3PH 4U1HB 2Q6WB 3IJSA 3DHJA 2CYGA 4OD3H 1OGAB 1A3HA 5IHRA 4UOJA 3MFFB 4P57A 4MVBD 1NLDH 1SMOA 4X8JA 1MCJA 4ZDHB 4QT5A 5GSRB 4MA1B 3MCLL 3TN0B 1JDCA 1A7RH 1W0WB 1L0QA 3MGAA 4KY1L 5GGRA 3IXAB 1JZ5A 2AJUL 2QV4A 4JAWA 3FB6A 3HE6A 4M6NH 1BGXH 4AQOA 3IVKB 3WDIA 5BW7C 3CD4A 3KJ6H 3QJFA 4GXPA 1IGIH 1X5ZA 3X12B 5HYEA 3SCTA 3BUDA 2NY6C 1UVQA 1S7SA 1FC2D 1NOFA 2QHAA 1U8LB 1LD9B 4PGDB 1YN7A 1R5VA 3BD4A 3CDYA 4D0DB 4ZXLA 2R69L 5TDNA 2UZXB 4GW1A 1KWGA 5GGUA 3IKKA 3TH2T 4D0BB 2R4SL 2ZG2A 2FEDD 4M7LL 3AMCA 3R4DA 2I07A 3T2OA 5EU6E 3KL3A 5D9PA 4B15A 1GHFL 1OP5K 2H8PB 5E03A 2HYMA 2W9EL 2G3MA 4BFIB 1I4FB 4TNWF 4AH2B 3V2AR 2YIHA 1JV5A 4WO4A 3MJ8B 4WU5A 2VURA 3FJTA 5DD0H 2Y8KA 3V5HB 3DX6A 4ZOAA 2PR4H 1BG9A 3GBDA 1KB5H 2EXWC 3OHXA 4G9FE 4M93B 5FL1A 2Y06H 3MV8D 4G9FD 3QUXB 3PTMA 4ORZC 3MRDA 1WAWA 2W0FB 4GQ9H 1A1MB 3QWOA 2WP3O 1FHLA 5JUVA 2FJFB 4OCYL 1KC5H 2W61A 3H9SD 4XX6A 1OAYH 3WF3A 3HCVB 4HJJL 1IGTA 2FX7L 2W9DH 1M4KA 5H35A 4KY1H 3G9AB 5CSZB 4OD3L 3WNMA 1TVBB 3MRCB 5A3HA 3GSVA 2YRPA 1XEDA 5GGSB 5I2UA 3ARXA 5MENE 3SPVB 3GRWH 4L4PA 4X99A 2E7LA 1JWUA 5E6YA 3MMEA 4ZNCD 5MEND 1EBPA 1CVRA 1U33A 4BA0A 3O4LB 1MPAL 4PJCB 5FDYA 4D71A 2OK0L 4NKMA 4GUPB 4QWWD 1IV8A 4HUUA 4ONHB 5BZWB 5DURD 3KR3H 2I25N 4WI6A 3GKZA 4QAWA 1A4KB 4OZHE 1UXSA 3SO5A 3MV7E 3WD2A 1YY9D 1YHTA 3BDBA 2EPOA 2D03L 4XCFH 3FNDA 4IDJH 5HI3C 3BSGA 3SE8H 5AYBA 4I3RH 4V2BA 1UJ3A 3BGMA 4W85A 3GB7B 4GXUM 3BMVA 2YD6A 3B9KA 3FFCE 5E08L 5A8PA 2YK1H 2BNRA 1H15A 2R0KH 4C7GA 1OT1A 3WFHB 1T2XA 2AW2A 1RI8A 3T65A 1MCOH 3VXTA 4CJ0A 5TDOB 1CXHA 4M02A 4F80A 4XMLL 2WPGA 2VUOA 4H25B 3TVMB 1D6EA 1OB1A 3S5ZA 1VFFA 3IDGA 3T0WA 2XIBA 1TNNA 3VNYA 2HN7A 2J3SA 2OM5A 1AH1A 5BJTA 3QUZD 1UR9A 5TFSH 5DMKA 4TPRH 2Q6WA 3ZR6A 4PP1D 1A0QL 3N1MC 2GJ6A 3C2SA 1X5KA 1VBRA 3LAFA 1HKLL 1JZ8A 3C60B 1PYWA 4J28A 1NUNB 3I50H 5IMMA 3TESA 4PMVA 1U8MB 1C12A 3JWDH 5D1XA 1BBDL 1IEAB 3MA9H 4HUMB 1J0JA 2DRUA 4M1CD 4QCIB 1WCQA 2P8MA 4P7LA 2C3WA 3FN3A 4DN3L 1PS3A 3NGBC 4HIXH 2YPKA 1T0OA 3G6AB 1B0GA 3NZHL 5J6HB 4XUYA 2A6KB 3WH5A 2CETA 1TJHH 4KTDL 1K9DA 4YXKL 5L2JB 1EHXA 1RZKL 4OLEA 4PTUB 2AOSA 1R5WA 1NGQL 3I02A 5HD8C 5BQ7B 2VLMD 5KSBA 5GS1C 1MEXH 1C16B 2ATPA 1NJ9B 3ZE2E 4OZFB 5HD8D 4XPFL 1LVEA 5FF6A 3IDGB 4TUJA 2VLRE 3SKOB 3QT2A 1KTCA 1A5FL 1K8DB 1AD0B 4NXKA 2AS5M 1T0PB 2OI9B 4JPVH 1R85A 1IZKA 4AZ5A 1FGVH 1MREH 1W3KA 1VRXA 2BNQA 4XP6H 4KTYA 4CVUA 1GOOA 4FQXC 3GHEH 1UR0A 1HXMA 5K9OA 4PJDA 1BEYH 4ELKA 3KWXA 4ESKA 4EOWL 3QR2A 1E4IA 5TE7H 1GOHA 2XQYK 3RTQC 1WBZA 4EUPA 3QNXB 4TX8A 2D3NA 1JI2A 5FXCH 1CICD 3F7PC 4JLRA 2DLEA 3BDYH 2FR4A 1AGBB 3GMPB 1YDPB 1RZKC 1EO8H 2J4GA 2WIMA 2BX5A 3L3KB 3WKMH 4N0CC 1ZT4A 4PJ5E 3S35H 3KNBA 4UNTA 4H0GA 1U8IA 4G43A 2W1NA 2G8ZA 5HI4C 1I1AC 3OKOA 3DX2A 3REVB 1OGBA 3HG1B 2XXCB 1C8YA 1RHHA 3M6DA 3HRPA 1QBLH 2DWDB 2EAEA 4C83B 4L3ED 2AJ3B 4YAQB 5HHNA 5MEQB 3VILA 3V8CA 5IFAH 5I76A 4LNVA 1IGCL 1MCOL 1U8JB 4XPGL 5L6YL 3SKJL 4D9QD 3L5WB 4BFEA 2QV2A 2XN0A 1ZLWK 1X5XA 5CIPH 2D7TL 1CBVH 4JZNA 1ZANL 4M3JA 2W60A 1KIQA 1HP4A 3D85B 4GZJA 15C8L 5GNYA 5IHSA 3GK8L 1NGWA 4HXBH 4Y2DA 3QEHB 2WWKT 1FL6B 4KRNA 1R75A 1EQPA 2ZICA 5D7SL 2JFEX 4OGAC 4JPKL 4HZ8A 3LQMA 1DVFA 3B83A 1J1XL 1A6AB 2GY5A 3EOAB 4PRNB 4P2RA 3MRJB 3IK2A 5EFDA 1DDHB 1RFDH 5F7KC 3EDDA 4LNRA 2NTFA 4XNQB 2FWOA 4L3CB 4U6XA 3GSWB 3SCMD 2V5TA 3ULUE 3KHOA 4G6ML 5F1IA 4F37F 3VI3F 1MCBA 4HIHA 2XWJB 1MIEL 2CHNA 2EIDA 3VD3A 2PTTA 3PABA 4OZGF 1OLLA 3E2HC 5SX4I 1S9XA 1KIQB 1MWAL 1PG7X 1ZLVK 1KPVB 2AERT 2H2PC 5D2NA 2LQRA 4WUUB 2R1YA 2YPLD 4RFNB 2XN9B 1CZ1A 4ZYKA 1VBUA 3C60A 4XBPA 3T77B 4UQBA 3CUFA 1LO2L 4XVJL 5JOFB 5E0CA 1EJOL 2VLKA 3SE9H 1QSED 3MYJA 2DGAA 4FK9A 3O6MH 4AEEA 4F79A 4GZEA 4GSDL 3PGCB 4FTVD 3STBA 4NO3A 3VRIB 4ACZA 1FIEA 5HYQB 3WE6A 2VL4A 3QG7H 5JXEA 3O0RH 4BCEA 5FGBA 1KF9B 4K7PY 2HKFL 2APWA 4NO0B 2PYEA 2WKLA 3OKKB 35C8H 1CU4L 1HNFA 1WITA 4AZ8A 1F58L 5D2LE 4NM8L 4RMSA 5CINL 3WD1A 4OI9A 3MZGB 15C8H 4MAUH 1CLOL 2CUHA 5EU3A 1SJHA 3TBSA 3ULUL 4OAWB 3SDAA 1XIWD 4KK5D 3MSGA 2VDKL 3QH3A 1R3KA 4JPKH 1CECA 1QNOA 2JF6A 1E6SM 3N04A 2PO6A 5ELIA 1C1EL 2BRRL 4I2XB 1FCCA 3DMMD 1UZ1A 2AGJL 1MAKA 3WL0A 5FYKH 3LEVH 4K3JH 4WO4C 2YUWA 5E7BA 5I17B 1C5BL 3NH7H 1AQDB 3QQ3A 1F4WH 4NKDA 4CDHA 1KYOJ 5J12C 3O3EA 3GSXA 4KRMB 1GPOL 2G60H 43C9A 5ALCH 3VXSA 4I3SH 3SGJC 1MQQA 4GAGH 4HUVB 4AZHA 3DVGB 3C9NA 1U8QA 5JORA 5MERA 5AZEL 2EO7A 4XHQA 1KJ3L 4G8IB 1V0MA 1AKJB 2DOCA 4MA8H 4X4XB 4E5XB 5DFTA 5GS0D 4YNYB 2ARWA 1G01A 5DQ9B 2NW2B 1BZQK 4L29B 4PB9H 5ABHA 1TMQA 4M1CC 1WCBA 3QCUH 5L6YH 1R3IL 1LP9E 4JFEB 2CXKA 4JY4A 1TQCB 2AXHA 1FZOA 1M6OB 4DZ8B 1HSBA 1A8JH 3ZQ9A 1BWMA 4FQPA 1VSCA 1BPLB 2NXYC 1NLBH 1HHIB 1E4WL 5FO8B 1HJXA 2HTKC 1P69B 4U5KA 5KS9F 1R3HA 4XHJC 3W27A 2XQBH 3FMGL 3FRUA 3EYUL 3NSNA 4NCDA 3BQUA 4R8WL 4C54A 5LGJA 3KPSA 4EVNA 5MP6L 1E6OH 3DX3A 1V7MH 1NWRA 4Q2ZB 2DM4A 7TAAA 4FP8L 5AAMA 4QTIL 2E7HA 5MENB 3RDTA 3FFCA 1AD9A 3BN9D 4U0RB 2CRIA 5C3TA 2QLYA 3G6LA 4XT1C 1WICA 4NYLB 5JTWA 2MKLC 32C2A 1FO0H 4M7LT 2VKWA 4NHCH 3MRNB 2DQXA 4KI5F 3FRUB 5FYKL 4Z2JA 3DARA 1U8NB 1YPZF 2ESVA 2BVPA 4XXDA 4LCCC 4JFSA 1WDPA 2OSWA 3W81A 4QRTB 2V5YA 1T80A 4UIMA 1XGRA 4HU8A 2A73A 1BVLB 4GS7B 5GGTL 2O9TA 4GG6F 3HPLB 3CVIL 3IFPB 4HUXA 4NUGH 5IBLD 1ZBWA 2PBOA 3UCQA 1KR1A 3S37H 4OKVA 4NP4L 1LEGB 1MRCH 5FD0A 5DZNA 1D5MB 1TQSA 1IZJA 4KV5F 3ETBF 1J9YA 2CMRH 3MR9B 3QDGE 4G9FB 4HIIA 3SKNB 4Q9RL 4YZFF 3OGVA 2O61A 4ZUWA 2R23B 4WHTB 4S0TD 5EOTA 2D0FA 3ZDYE 5FECA 1ZVSA 5GISH 4R7DA 1PLGH 3LXBA 3K7UA 5DFVC 1WCGA 3AS0A 3C08L 3U7WL 2VLRD 5GIRB 1S9YA 2DH2A 1E3XA 3GMLA 4XCEB 1XSJA 3CDCA 5DVNA 5K9KA 3G5ZB 1E5JA 5HHOD 2YC1B 3H6JA 3SUUA 2EDNA 3DXAA 3HI6H 4OAWA 4C59B 4RWYL 4M6AA 4KWUA 3BKMH 3OR6A 1OSZB 4HJ0C 4LCUA 5DC4B 1G9NH 5FHBH 2FGLA 4OSUL 4TVCA 3MKKA 3FZUC 3BVUA 1SYTA 2IG2L 2VISA 4W88A 3DUSA 1OSPL 4QNPF 4AEHH 1WVZA 2A73B 1DBAH 2W91A 3FZUD 4LPCA 2ADFH 1QFHA 4C4KT 4U6TA 4NKQB 2EC9U 3IT8D 2NLJB 3VG0L 4CJ1A 1K9TA 3MRMB 3DX4A 4OZGA 3TM6A 4NN5B 3MUGA 3ZSTA 4AZIA 1N64H 5I18H 2WW8A 5E1HB 4Q7NA 1LWJA 5I15H 1YYMH 4W68A 1UD8A 4K68A 2BXYA 4AMXA 4ODXA 2D24A 1UM6H 4PJGA 1X4ZA 1FNFA 3NSXA 4FXKB 1A1NA 5F3HA 5BV7L 2H26B 5GRZA 3F5LA 1OSZA 4Z7UA 4F33A 4I2XE 4MNGA 3OGOE 3U5UA 3D69A 5CP3H 3EFDH 3U83A 3HC0B 1AC6A 1MF2H 3BW9B 3OGCB 3S88L 5KVDL 5CILH 4P4KC 3T4AB 3WH8A 2NX5B 1FNHA 4W81A 3OKLA 5F9DC 1YMHB 3RWFA 2W9DL 5CUSH 4MAYA 4V1DA 4LBEA 3SGDH 3VD4A 1FL5A 2VXUH 3C60D 2V9TA 4XRCA 4MMXC 1E27B 4J6RH 5L9DL 4MB5A 2E0PA 4XP1H 1T1XB 2B0SH 2NXYB 1P4LB 2MCPH 4I1NB 1BJ8A 1NC4A 1S78C 4KVNH 5ACLA 1MXDA 1OWQA 3RTQB 4R4ND 1HJUA 3M46A 2X10A 5H35B 1S7WB 3IS1X 3A0OA 2BY0A 3RWGA 4HX1B 4NC1E 1NC2D 2DM3A 5M95B 32C2B 3WFDL 3OA5A 4X5XA 4LIQL 2OP4L 4W84A 4KI1A 2AJXL 3GXIA 4L8SC 3ILPA 1OSPH 2FJHA 4AEHL 3G08A 1OAZH 3DTXA 2GHWB 1A1OA 2VZUA 3VMPA 2WCAA 4V1DB 1C16A 4B3KA 5BXRA 1D5BA 1NCTA 3TO4D 4PMXA 2X4UA 1BLNB 5F97E 3X3FH 1E4XH 3BE1H 3UJIL 5TGBB 5L0QC 1U2HA 2Q76B 4NOFA 1MI5B 2FCBA 1JFHA 1YYML 5B39G 2FATH 1ZT1A 3RM9A 5D6CA 1HH6B 2CPUA 2E9MA 3AIVA 1EBAA 2ZCHL 4U1MA 1OGAA 4S2SB 4MQXD 5ADOL 2WVSA 2OWCA 1ORQA 4PJEA 4RWYH 5INCB 5E56A 3QIWB 2FD6L 4EBQL 4R97C 4F57L 3CVHH 3BD5A 2Q1EA 4XNYH 3G5YA 1IAIM 4WGVB 1WBZB 5J1SC 2XFFA 5BROA 3NGBB 1XGUA 5ACMA 4WKAA 1NUDA 3MRIB 4FHBD 4NFBA 5MI0B 1J05A 5I23A 1KXTB 1INEL 2G3IA 2X4UB 3QOMA 4Y4KD 5EUOF 1XAUA 3P11L 1AGCA 1RV6X 1LEKB 3CHEA 1MVUA 3RJDA 2A0LC 3SDDC 1XIWC 4K7PL 4KK5C 4X5XB 1MCRA 4U7SA 2C9AA 4U1MB 3U9PH 1CFQA 3CIQA 1FZJB 3RDKA 3UESA 3RI5F 4ETYA 4WI5A 1Y6KR 5KN5A 2V7NB 2Y6SC 3V7AG 4U4BA 5LGKA 4NRYA 5AYUH 1L6ZA 4KPHH 3V0VA 3RWIA 4EOWH 1E43A 2UZIL 4JEGB 1J0IA 5IQ9B 2FO1A 2VXSL 4I9WE 2GY7B 1MW1A 2WWDA 2YOCA 3GUTA 1CCZA 3GJFK 4MQTB 5CJOL 4P8VA 3ZZ1A 4HUWB 2B1HL 2EEBA 1OOAA 4K9EL 2FATL 3WKNA 2E7MA 1QHZA 5DHXB 4P46B 3KAAA 1JF1A 4GG8B 5JW4M 4XB8A 2ZOLA 3ARGA 4CMHB 1JDAA 4A6YB 5IVXE 4OBRA 1WZKA 3S3SA 4CW1A 5E6IC 5D7JA 4QLKA 2MQCA 1JPGA 4L4VB 4PRPD 4DK3A 1UH2A 5IB3A 1OTTC 4XNQA 3L3IB 5CZXD 3MACL 4M62H 4PJ9C 1EMTH 4PRPE 2VH5L 2ZNWA 4HCRH 4OCNC 3TIEB 4EKXA 4ZXBB 5HHQA 1AFVL 5KANG 4OD1L 3RWIB 1RU9L 2AK4A 3DRTB 4QXUL 5CPQA 3MYZA 4XNXL 3ZE0E 5A8MA 3ZJ8A 5ALBL 4PMRA 2WK2A 3HE7B 4N68A 1MCDA 5C0IA 2VDOH 3VUPA 4JANA 1S7TA 4OT1L 5FM5M 1CXIA 4GAJL 3WUWB 4PJ9A 1NAKH 1L0XA 1FRGL 4XP4L 1W9BM 2W92A 4PD4K 3PP4L 2XHYA 1CYGA 5DMIH 3ZO9A 1T6VN 1GUVA 2W5FA 2QADB 1U3JA 3FT4B 5E8NB 5FYJH 1DFBH 5IB1A 2ZJSH 1VB9A 1YQVH 3ZE1F 1KJVA 5BMFH 4LHUB 1ITXA 2B5IB 7FABL 1K5NB 1ND0B 1TETH 3BEVB 1YPZA 3CZSA 2YK1L 3DBXB 1IGFL 2E5EA 3W0WE 1J0HA 3VFPB 5C0RH 1YEHH 4ALAH 4OLWL 2QSCL 3MOQA 3W0WD 1E1FA 3VI4E 3LEVL 3M17A 4K3JL 4C57C 3NFSH 3DYOA 4LEOB 4U1LB 1URLA 1II4E 4KUZL 1CPUA 3QDJE 4L1DA 4OM0H 1MQ8A 1V3LA 4M61A 2HWZL 2DQJL 4NQUA 2NY7L 4PJCF 4BQ5A 4S3KA 5CXPA 1OTTD 5DEFA 1N64L 5I18L 1OTUD 2XTJB 3TH3T 4R9HA 1A6TB 4LSVL 3WD3A 2A9NL 5B8CB 4M00A 5AUMB 4MNQD 4CCEA 3C6SB 2DICA 4UT6H 5F71A 3O41B 1UWQA 4Z7NF 5MERB 4IMLB 2CBVA 2JJVA 4J3SA 4DK6A 1LLOA 1R7OA 3Q5TA 2D0HA 2NW2A 5CINH 1ZHLB 4I0PC 2HFEA 1ZHKA 5F9WB 1KFAH 1I8MB 3L3KA 1JD9A 3F58H 2BNUA 3RGVB 3H42L 4UIKL 2DQUH 2P8MB 5D8JL 5C3LD 2XZAH 4JY4B 3CUGA 4PMOA 2BSTB 5I1DA 1NSNL 1B0GB 2DQUL 4G8GD 3BVNB 5KSAC 2V5SA 1QKZL 2WP3T 2FHFA 2ZOKB 3L7FB 3U4EA 5IWLC 4UQEA 5A6AA 2WUBH 1HHIA 2LU4A 2X40A 3I2CL 5E2UL 1N59A 3QIBB 4R0LA 3SJVE 1OPGH 5HGAA 1ZA6A 5C0NC 4WUKH 4ZTPL 5I76B 1S7UA 1JDDA 4CBPA 3DX7B 1HINH 5ILTH 3LV3B 3AZTA 1AXIB 1T0NA 1VA9A 3DUHA 1AQMA 1S7VA 4X6EB 1HINL 5ILTL 3V7AE 3LHPL 1EFQA 4IIQC 5I73C 5DO8A 3TLRA 2EC8A 4Q2ZA 2F9BT 3RIFK 1UKQA 2KUTA 1K8DA 2HP4A 1B4JL 3ZYIA 1EFXD 1P2CA 1TJIL 4JDVB 1MLCB 5CKGA 1K6QH 2UY6A 2PYEB 3RY6A 4HTYA 3RY6C 4P2QA 1HXMB 4PRHB 5J1AA 3GSRA 3P4NB 4H1LA 3MJ6A 4G42B 4YHOL 4P2RD 5I16B 2DYPD 3JV0A 3MBEB 3T8XA 2Z8WC 4P2RE 4CGTA 4HS6B 3C2AL 3W82A 2QMJA 1JD7A 3SUTA 1GAFH 1AGBA 1F90H 1WTLA 3L3IA 4KVCL 4AMKH 1RUPH 5CD5C 2VYRE 4K3GA 2EECA 2HG5A 3AS1A 1J87A 3BAJA 5C8JA 4LHQB 4MCZA 2NTSP 3V5KB 3WS6A 4MQXC 2DLFL 4C56B 1FDLL 4IRSB 1DCLA 4APQA 4ZYKB 4OV5A 4TTDC 2Z35B 1A7OH 2Q86B 4HUVA 2Q8BL 4S1QH 1HP5A 4WFGE 2FGWH 1YEKH 4H8WH 3D25B 4AEFA 3MMWA 4J1UA 5FO7B 5DURB 3WY2A 3LPGA 3B9VA 1A6WH 1UM4H 4XC3H 1CD8A 4ZUWB 3AU1A 4R4NC 3O9WA 4M1DH 4KAQH 1WCBB 5C6PB 8FABA 4I0KA 2VX6A 3EMCA 2ZWYA 4OCRH 4KRUA 2JEQA 3IJYB 3KJ4B 1JF5A 4P49A 2X4OB 5E2WH 5JLZB 4QRPB 5HVHC 3EJZC 5DD5L 3SDAB 4JHAH 4LDOB 4KKBC 4M7ZB 3ZLQC 3MLSL 2F7OA 1FFOB 1U9KA 4ZOEA 4D9LH 2P43B 4B0MM 3VWJB 4AIZA 5FK9B 1QBML 3RAJH 1BFOA 4WHCA 2Z92A 2YA1A 1AXTL 4KKAD 4M61B 3RZWA 3VG0H 3QUMB 4KQ3L 5A6LA 2OXHA 3SGKA 1LDPL 4PJEF 8FABB 5CP7B 3MLUH 3V5KA 5BS0D 2EH8H 1ZLSH 1FBIL 3VCLB 1E6NA 5DQJB 2QSTA 4HZLB 3SDDB 3RNKB 1XGZA 1IAOB 1DBKL 2ICWJ 1MAMH 3MNWB 5IW6B 3NABH 3KYAA 3HZ3A 2MHAB 1QBAA 3RMEA 1RJLA 1D5IH 4AQ1B 4BZYA 2GK2A 3SEPA 4DTGL 1U95B 4D6IA 3MROA 1MY5A 2BSSB 3FTGA 4RQQA 4G6AD 5GRVK 5FK9A 2VLME 1ONQA 4NO3B 3VRIA 1JHLH 5EWIH 4W6WB 4K7FA 1FZMA 5C0DB 3WFLA 4LDLB 4G8GB 3WBEA 1JNHA 4HJ0D 3LS5L 4B7LA 2XN9D 4KK9D 4NUJA 3QFDB 2X1XR 3O4OC 2EIEA 4XXCC 4W6XB 1ADQA 3MFFA 1I9JL 2V2TB 2ZX9A 1ISYA 1TQBB 1NM9A 2F61A 3KPSB 4E0RA 1R47A 3BSZH 3WL9A 5TQ0H 1XH3B 2HKHL 5D9SA 4N9GA 5AZ2H 4ZDHA 4F8TA 4YIQA 1T6WA 3MUY1 5A2KH 3F12B 4EDWL 2XIDA 3QNXA 4PBXA 1A4JA 3MV9A 2WBGA 1P9MA 5HI5D 3D9AL 1Q38A 4I3RL 1V6UA 4LLYA 4LRNL 1QQDA 2ICES 5FECB 2ED7A 3CPLA 3FO2A 3QUZB 1U8KB 3QCUL 4KQ3H 3QIBC 5E1AA 1G5AA 4PRBB 1T20B 2D22A 4ATDA 4N8VG 1LD9A 2R0KL 2IALB 5SX4H 1HXKA 3REVA 1V8HA 2K9UA 2DI9A 2JEPA 5FYJU 1DBKH 1RJYA 3KPMA 4PJ9D 4L3EE 2R0LL 3HI5H 1LL4A 4P8UA 1BZ9A 1MCFA 1NMAH 4MWFB 4I0CC 4OB5H 1AMYA 1JZ6A 1OGTB 4JAMB 4G8GA 5B39B 1IEAA 1OW0A 1QSVA 4NJ9L 2VCBA 1MRDL 3VIJA 1M7DB 2XRAL 5IUSA 4OZFH 1J8KA 1HILB 3O11B 2WHJA 4U2YA 3AB0C 1YUHB 3CMOL 3ABZA 4HIJA 3HRZA 3P9LA 5EU7E 5IV2B 3NAAH 1OCQA 4PCSA 5L8JB 3HG2A 3QIWA 2PNDA 3QOKA 5HGGS 5F72S 2FL5A 3D0VB 4GI6A 4YWGH 1UHVA 3IXAA 3A24A 3FO1A 1NFKA 4BSVA 2DKUA 3KR3L 3V6ZA 4YUEL 4YN5A 2BOCB 1GGYA 1Q6DA 5FYKU 5GJSL 2QQQA 2J7GA 4IRZL 1FCGA 2N56A 2CLZA 4LQ1A 4JAMA 4D3CL 3BESR 2HJKA 2CKRA 4PGDA 4DQOH 3KYNA 4ODTL 4XCCL 1EZVY 3EJUA 1UB5A 4D3CH 4NHUA 3ZYZA 1PD6A 1EXUA 4OUEA 1FYHB 1WC7B 3GSOB 5IROA 3L2LA 4ZUTB 4Q22A 2O5ZH 5DXWA 4DWSA 4YC2C 4PBVC 2BC4B 3AS2A 4G3YL 3TTYA 3ZL4H 4F7EA 2Z92B 4GQ9L 2DQDL 3S5LB 5I0DA 2C1OA 1T7XA 3PHSA 5TE7L 2DPEA 4JREC 2NY4D 1V7NH 1AXSB 3CZKA 1UKOA 2Y25A 3AI0A 4NT6A 1NCBH 2NLJA 3CMJA 3AIRA 4HLZG 2FX9L 3SDAC 1QSFA 5BS0B 1RK1B 5CD3A 3O2DL 2DD8L 1GH7A 3WUEA 3LQZA 4NWUH 1WK0A 2WAGA 2VC2H 2PW2B 4ZPVA 1QA9B 1T21B 4Z18A 2NY7H 3BAIA 3MCG1 1CD0A 3GEWB 3PWUA 4KHXH 2ZCKL 3C6LC 2NY5L 3RA7H 1H1NA 4UAOC 3GRWA 4Y1AA 3QDMA 1KGUA 1JPSL 4PSRA 1JHKL 2DTMH 4WO4D 3WO4B 1G6RL 4RFOL 5K59E 3TA3C 1T1ZA 4LLAA 2ZE0A 5TD4A 4JZNB 1NGZB 3W53A 2Q87A 4NKIL 5E8OB 3WEXA 4D6JA 43C9B 3ARGC 5F7DB 4KXZH 4U5IA 1HWWA 1DBAL 4HOXA 4JM4L 1HXJA 3C5ZC 5TF1H 1S3KL 2DMKA 4KDTC 4HA1A 4X6CB 3IJ9A 1UR2A 1BWWA 1XCQB 5I30L 2B1AL 1U3YA 5I9QB 1AJ7L 3H9SE 2QKIA 5FKYA 2QPSA 5IF0A 3LKOB 5EZLB 1PIGA 5A94A 5FKAA 4UZUA 4CVXB 1ZSDB 3HZYA 1BEYL 3CH1B 3I9GH 1OGAD 4R27A 4MS8C 3KLHC 4HGKC 5BOZG 3BOVA 4WUUD 4X7DC 3LRSB 1BQHB 4WUUE 4L8DA 2VXVL 1CE6A 1D9KD 4UT9L 2K3TA 2HT3C 1FG9C 4XVTH 4EN3D 2WWMD 4K2UH 3WN5C 2F1BA 4ZFGH 4JFQB 4JQVC 2N7AA 1JPFB 4HZAA 2NW0A 4BUGA 3CLFH 4X9HA 5A2LH 4S1DD 5EOCJ 3BJLA 1FVEB 2OSLA 1SY6L 3OLEA 2ERJB 2R29L 4U7MA 3O2VH 2NXZB 3O4LD 1D5IL 3BYYA 4UUJB 3OJDA 4JRYD 1EAPB 3FFCD 4WGWB 4EN3C 3P11H 3WH9A 3HLAA 4P46A 1A3RL 1B0WA 4IMLA 2DBJA 1DBJL 1NDGA 2EEDA 2ICEA 4NQEB 5L2KA 2JCCB 3CBWA 5LQBH 1T5XB 2YN5A 3T0XA 5HI5C 1T1XA 3NZHH 3DMMB 1I8MA 2B8OT 3C8KA 2BOCA 2BY1A 1W2KT 2ZPKH 3RUGE 5J6HA 1TPXB 3DI2B 5D1QD 5J0BA 5KJRH 4PRID 1PJ9A 4MNLA 1XYZA 5D71H 5EC2A 3HC4H 1T04B 5KZCD 3WEOA 3WFBL 1TITA 3O3EB 3V6BR 1UB5B 4WKHA 3GMOB 4ISVB 2GK1A 5I1AB 3ULVF 5DD3H 3HG1A 4L8DB 5FUZH 3VDHA 1QLEL 3ZKXC 1BFSA 1J5OH 3WHXB 4YEFA 3FRPG 3WIFA 5BV7B 3QDJD 3VSVA 3N18A 4X4XA 1EQCA 5E8PA 4DJMA 3X3FL 2DB8A 3IETB 4BQ9A 1FZKA 4MCYB 3BP5A 4G8EA 5DJ6B 4FZ8H 4PJIE 3STZB 3D2UD 5IVZA 4F57H 4OF3A 3QQ9C 4Y4FA 5HPMA 1H8SA 3WNKA 2XTJD 3M1BB 2VZSA 1XF1A 2WINB 5D6CB 3EDEA 4G9DA 5ADOH 5GNZA 3SCOA 5GS0H 1XR8B 1G7MB 5DC9B 4GG6A 3QXWA 4L4TB 1HNYA 4MNQB 3KEHA 1UR1A 1F4HA 3WQ6A 5DA4A 2IAMA 4MPKA 3V4VL 3OKEA 4XWOC 2OZ4A 5D93B 3G6DH 5IB5A 1RD6A 5EO0B 2D31A 1FC1A 3SKMA 1YDPA 2R4RH 3AIUA 1F4AA 2NY1B 3AM8C 4GW4A 1DUYA 4KTDH 3GI8L 4FLRA 3KL5A 2X4NB 2EH7H 3CDGB 1IC1A 2EDYA 3QNZA 2HA1A 3TBTB 3UROR 2VLRB 3E1F1 4LHUD 2AK4E 1QFUL 1QX1A 3UTSE 4MJ6A 1CFVH 4U05A 4G8GE 1TG7A 2ZIDA 5E2TH 3DXAE 4I18C 4OFKA 4U6HB 2QPUA 1J8HA 5LKNA 3MX0A 2F19L 4KK6C 2F8VA 3QWRD 4JDTL 1JRHI 4PJ9B 2X42A 2X09A 4G6KL 3CC5B 4Y5YC 1H0DA 2A9ML 2MFNA 3MLYL 2O5YH 3B43A 5EOQL 4XX1E 2DT3A 3WO4C 1L0PA 4WWKB 1A64A 3KXFD 4URIA 3PJSA 1AY1L 4R7NA 4UMGA 2ZSWA 3AM8A 2DQHH 3O9WB 1OP3H 5I1IL 3MRPA 4QY8A 1NBVL 4J3VA 4QHLB 3BLPX 3BE1L 5EG6C 1QSFE 3ZJ7A 3QNZB 4C7FA 1RHFA 4LCWE 2CRYA 4ONGL 1B3JA 4IRJC 1EDGA 3BT2H 5ISZE 1A3LH 3TA3A 2HLFC 2VZOA 1RPQA 3QDGB 2ZUNA 3VM5A 4K8RH 5AWNH 3GI9L 1IC5L 1F90L 3VXQB 2NT0A 5D8ZA 4XVJH 4HFUH 4I2XA 4MNGE 5DRWB 3ZJKA 2R56L 2W38A 5DEFB 2BVOB 4Y1AE 1UH4A 1UG9A 2FB4H 3JUYA 3TBTA 2EH7L 5F7EL 3F6LA 3EJYD 3VX0A 5LCVH 3C5JA 1CGSH 4YX2H 1B31A 5IR1A 4PJFF 4XPGH 5DA0B 3TFKC 5J57B 2QADD 4WDIB 2NYYC 4QRQA 1BIIA 5I1EL 4YX2L 5JOFA 4BQ2A 1WF5A 5D7IB 4ZQKA 2L7UA 1FAIL 3OLIA 1LDSA 5FGBC 1RK0B 3D50A 4FFZH 4D0DA 1FAKT 5ABDE 1BREA 3RBGA 1RFDL 2XN2A 5EBLA 3MBEA 3T8XB 4F7CA 5CJXA 3MLVH 2IBZY 1NGXB 4R96A 2VWEE 4UINL 3DJ9A 4OF6A 3QHNA 1MWOA 3ECBB 4W8AA 3D39D 3NCYP 3S36X 2PWGA 3VFGH 4N90D 4HQQH 2GJPA 5E5UB 4FNRA 4M7ZC 3DVIA 3EHBD 1FH5L 4N8PA 4NSKA 1HYSD 4Y4KA 2VB5A 3O6LH 1VEOA 3BGFB 1CXKA 1JCKA 3QO1B 3WL1A 4F9DA 1L6XA 5B38B 5GSRA 3WN6A 1RIUH 1JVKA 3UO1L 3WHXA 4PJ7A 4YK4C 1WIOA 1ZEAL 3D9AH 3O3BA 3TH4T 2A3BA 5EBWB 4PJDF 4ZS6D 3WXWL 3GSQA 4DEPC 2MSPA 4EVNB 5I19L 1NCCL 2JCCE 1E15A 3PZTA 3ZKSD 5LVEA 2GK0B 5KSUB 4KJPC 4N0UE 2B4CL 4Z7VB 3TTSA 2EE9A 5TPWH 4LLYB 3H0TB 3CSBA 4WHYH 1G7HB 1WV7T 3EO1A 4QXTB 3DVGA 3V6OC 1FVDB 1GNXA 1LG1A 1DLFL 1KG0A 4WW2F 2FBOJ 3CDFA 5ID0A 2BCKA 1P7KA 2CGRH 4PJFB 4G42A 4NQXA 4L8BA 3IF1B 1PG7H 1XCXA 3RNQA 1UM6L 3LEXA 1T2QH 4AD2A 3FN9A 2D31B 2I24N 2WLYA 1BOGA 4HLZH 1FH8A 3CV5A 5EZIL 1KPUA 3F7YB 2R8SH 5EO9A 1REIA 2P8PA 2XOTA 2CESA 4WKFA 1IKNA 1FFPB 1E0XA 5MP6H 4M6OH 4QRTA 4W87A 3MOBL 2FDMA 2ZCLL 2NY3C 1UA3A 4Y19B 4Y4KB 4MD5B 5BRZA 1TQBC 1X5IA 5IFHH 4KKCC 2XTLA 2W65A 3FO9B 2Y6SD 1BAFH 1SEQL 3QIBA 4LMQE 2D23A 3EGSA 1L9NA 3TV3L 2JIWA 4LVOC 2HVKB 5CEYB 4U1KA 4CD7A 5T33H 5I77A 4YHML 3GBMH 3ZTNL 2NY3D 1WAAE 3H9HB 4EJ1C 3JTSB 4OGZA 3QAZB 5E4EB 4K94H 3FOMA 1GGCH 4QGTA 4Z7QF 4LLQB 1EO5A 4BQCA 4Z76A 1HHHB 4NZRL 4E2OA 1TENA 3TGXA 5DD3L 1LILA 2GCYA 4QRUA 1R3IH 5ICZB 4ZXBC 1TVDA 5I19H 4NZDA 1IM9D 3LKRA 1HN1A 2VRKA 3VFWB 3QXDB 1S7RA 3FCTA 1I1AD 3IAPA 3K1KC 3VE0A 4P3CL 2DI8A 1U92A 4AMKL 4BQ4A 3KL0A 1TFHA 4W5ZA 2BVOA 5K33A 3N85L 2FGWL 4YHIB 3PNWA 3IDUA 4J3XA 5T3ZL 5IMKA 5DF0A 2K1MA 2ZCHH 1K4CA 2MANA 4N9OB 1HSAA 5EORL 5IROC 1SVZA 5I8KH 3O3DA 4QLLA 1W3LA 1TVBA 3MRCA 3ESVF 3BIKA 2GW5A 4XVUC 4Y2DD 1F11B 4Q9BA 4HWBA 3WUGA 1ES0B 1OAUH 4B41A 4HWNA 2BVQA 2CHOA 5SWZA 2VTFA 3FONB 1K8IA 3HUJA 5C0FA 1PY4A 4FF5A 2RFXB 2YRZA 3D3VD 2VNCA 4P2RB 1WWWX 1MNUH 2H26A 1N5AB 1D6VH 1ZS2A 1W8NA 3TIDB 3ZKQD 3MV7B 3UPCA 4M1RA 3AMDA 1ZHBA 5IJVA 2NT1A 2HLAB 1LGVA 1HEZA 2DJUA 3LN4A 4HF5L 3L4VA 4KDWA 1IC4L 4LQFH 1DVFC 4U1SA 1F2XK 2YD8A 3JWOL 5HHOB 4HF5H 4LVNC 1UM5H 3TT3L 1EEQA 4PJIA 5GS2D 2BFVH 2NZ9D 3WFDH 1F3JA 1M7IA 1H3UA 5BZWA 5CEXB 1E56A 1KB5L 1X4YA 5IVXB 4PJBE 3B9KB 3HS0B 1XZ0A 3PWPD 1D5ZA 4PLKD 3RUGB 4TXEA 1S8DA 4D9RE 4EUPB 1KPRA 3HI1A 4NQVA 1CLYH 2MJWA 4LLWB 2BXZA 4J3OC 3T65B 4Z95H 4L4VA 3UTOA 2C0HA 4JO4H 3QP3A 1UYWH 2DQCH 1FN4A 1QRNE 4R3SA 4UQ2A 5FYLD 4PJ5B 5GS3A 1B4RA 3N12A 1PQZB 4PJFA 3TZVD 1KGCD 4QRRA 3SUWA 3NYDA 4HBQA 3SBWC 5E4IA 5BOPA 1PDKA 4YZFE 5GZNC 4A2LA 3EJYC 4U1SB 2KBGA 4UBDC 2FX9H 1HIMH 1NJ9A 1LL6A 2DS4A 3EFFA 1AQKL 4LVEA 2R39A 4KHXL 3RA7L 1IL1B 3O2DH 3W38A 4WW2A 3MV7A 3UDWC 1XF3B 3SQOL 1JL8A 3BZEA 1E6JL 3LKSA 4Z7WF 3EBVA 4LDEB 3L3GA 1BX2A 4F7PB 4HD9A 4HGWB 3SQOH 4OFYA 4XMPH 4YFDB 1BG4A 1SEBA 5T5NG 1J11A 4HPYL 4GI8A 1MLCA 2WSPA 4TSCL 3WDPP 1YMHA 3RWFB 4L5FH 3HMXA 4XPAL 4UOZA 1YQVL 2ZUTA 5SV4A 3CZGA 1E27A 2VR4A 2R2EB 1UM5L 4IIQA 2FGZA 3L6FB 2WMIB 2LTQC 5ESQA 1RMFH 3ESUF 3F6IA 4MD0A 5D1XB 5F70A 3X14A 4LAQH 1Z9MA 3RTQA 1J05B 4X0NA 3CFJA 5FYLL 3AZSA 2BNJA 5C07D 2CBJA 5ADPH 3EO0A 3QWQB 4X9BA 3CZLA 3TT3H 2W0KA 4DW2L 1ZA3B 3GHEL 5EOQH 5D1ZD 4QWWC 1W9PA 3LKRB 5FL0A 3U4BL 4BS0A 3BQUC 4FG6C 4X4YA 3KPSE 1ETZA 3HTLX 3M8OL 3GNRA 4ZODA 4MD4A 4X6CA 1KXVA 2A77L 4MX7B 2EKSA 1KCSH 1YJDC 3WIHH 4OZIB 1XRVA 3CLFL 1DQDL 1DANT 3VIPA 3MLZL 5MENA 3MACH 4M62L 3L7EB 3TZVA 3F58L 1DJSA 5L8LB 3QG6A 1CXEA 3O2LA 1S9VA 3SKJH 5FKAB 4XNXH 1SJEB 3BO8A 4AJ0A 5A3ID 1T4KA 1TZIB 5H94A 4PMQA 4YK4B 2H32A 4P99A 1P5VA 4L3CA 4U6XB 4YE4H 5SWSD 5JW4N 1CGUA 4OIFA 4LP4A 3ARQA 4KROC 3G6MA 4OIAA 3T1FA 4TVUA 1UQSA 4EI6A 2VSCA 1UWEL 1FNEA 5IJVB 2OQJB 4YDIH 3MLPA 4LRNH 2Y1VA 4OLUH 1PKOA 3RUGF 4UZGA 3EYVA 4WUUA 4BH7A 4HKXA 4APQC 5CCKH 2VZTA 1PX3A 4LASL 2F54E 5DS8B 4OF5A 3VO0A 1XHGA 4FNTA 2P8LB 3HJEA 2P42B 1DWIM 2XT1B 1TVPA 2E6QA 3MR9A 5GS0L 3X13B 1GZQB 3MOAL 1S7QB 5ETUB 3CZEA 2EZ0D 3IXTB 3I6GB 3VI4F 3VFSA 1X7QA 3A6CL 4KTEH 5D6DC 4PPTA 4JFEA 3V6OE 1UQZA 2WWMC 1MFUA 2NY5H 5JXEC 1WGOA 1WWCA 5H8DA 2P44B 1N5YH 1VGEH 3EKCA 2BV9A 3PN8A 1CL7L 4FQXB 1TZIA 5JBDA 3DHPA 1WPCA 5HHOE 2V7HA 5TF0A 2CLVA 2NY2B 5JHDB 2J25A 3BUYA 5DJCA 4CKVX 3D3VB 1I1CA 3HUJE 5D7KE 3BEWA 3SDXE 5IB3B 5I1LA 4ZUUA 3NFNA 4PY8I 1I8KA 5CBEB 1TZ7A 3PWNA 5E8PB 4P9ML 3IDIA 5KAQG 1E4KA 2AJXH 4CNIA 1U93B 1FLRL 4BELD 3T0BA 1K6AA 2V5RA 3MUHL 1E6PA 2ZUQB 4PUDA 2CKBL 1P4BL 4YQXH 3ZIZA 3O81A 5EN2B 3DX0A 3ULUH 1C5BH 1TDQA 4NYLA 4RMVA 4M6OL 2A1WH 4P0DA 3BCFA 3ALWA 4M1DL 1C5CL 1EJ6A 1MQPA 3QSKB 5DK2B 1M6OA 3ALFA 2DIJA 4U3AA 1GC1H 2EYRA 3ORJA 3TN0C 5FB8A 1E0OB 1QBMH 4CMMB 1NC4D 3QEQB 5FGRA 3NIYA 5EFFA 3O6AA 5JQHC 4PG9B 3L7FA 4ISVA 4H1LH 4IISA 2EEXA 2V17L 2CBIA 3C5SB 4U0QB 5FDWA 4MZ3A 2ARJQ 4CADB 3VOCA 1LO0H 3U9UB 4UV4L 3HG1E 4E9LA 5GGRY 3EFDL 3TOPA 3TT1L 2GJZB 1TFVA 5LXGL 1KTLA 3P40A 3ZJ6A 3FQNB 5CILL 2AJVH 3OKNA 5IBTH 1GOIA 4KJQC 3QULB 4U49A 1QKZH 4YHKH 1OIMA 4YHGA 4FQHA 4JZJB 4LLDA 5JUEL 1MJUL 2HVJB 1AGFA 2QQNL 1WFTA 5FHAL 2R4RL 4X9IA 2DM7A 5F7EH 2J7BA 3CCHB 3RHWF 4GFTB 3VFTB 2C3VA 5TDPB 4HWZB 3QISA 3NCBB 5F9WC 3U7YH 2JTDA 1UA6H 4MNHB 3R1GL 3PUCA 4LPWA 3CHDA 5EIQA 1CL7I 3G04A 3ROOB 2X1IA 2DT1A 1X9QA 2OR8A 4MLSA 4O51B 3WS6C 4HUKB 1N6UA 5KSAD 3G6JA 2D7QA 3GIVB 3MRRB 3MV9B 1J88A 3PWPB 3Q6FA 1ISWA 1N2RA 4JO3H 5HPOA 2IXUA 2F58L 2XXMB 5EDXA 3L4TA 2XVNA 1R24A 1A14H 4AT6A 5SWQB 1J1XH 3BVTA 2YS4A 1A7QH 1AD9B 3KYMA 1TR1A 5GS1A 1LO4H 1OP5H 3MODL 5A43C 4YHLL 4NGHH 5IGXH 4UV4H 4ZQKB 4PJ7E 1HWGB 1VACB 4NUGL 1MQKL 3QI9A 4AZCA 3S36L 3KPQB 2FJGA 4WHDA 2QL1A 1A22B 4XXCA 4J8RA 4Y16B 4ZENA 2BFVL 3VXRB 2AAAA 2X9WA 1YYLH 3MRKA 1NAKL 5CMAB 1JNJA 1JWMA 2BOBA 4WI9A 3TA3B 3QFJB 3WEXB 3HC0A 5ISZB 2MOVA 3OR6B 5DRNB 1MFAH 4XC1L 5IB4B 1NSNH 2DJ4A 2G5BA 2ADJB 4LF3A 3VGAC 4K3HA 1Z9SA 5E0QA 4EANA 2QEJA 5CBEA 4NI3A 2R0ZH 4OFDA 4GBXB 5DDHA 5C0AB 1A02N 2VITA 5BXSA 3QUMA 5I1HL 2A9MH 1IGIL 4I77L 2ZCLH 3GXFA 5D2LF 5D1XD 4V2XA 1JHLL 1IGTB 5HHVH 2XYLA 3NDYA 4NQDE 1HIZA 1V7ML 1K4CB 4OSUH 4TUOB 3HNTL 5A2CA 3ZDZE 2IUZA 4L9DA 2MPAH 4W8LA 3MUIA 3H53A 2WW5A 1KJ2B 1NEZB 3MRDB 3T08A 2CLRA 2VDLH 3FB7B 1LP9A 3VFRB 4ELMA 3HNVL 5FUOH 3U46A 5ITFA 1DBBH 4M8VA 2DYPA 5FUZL 1KXHA 1K8IB 5C0FB 4PG2C 4ZOBA 3ARED 1RULH 3AJ7A 1R3LA 2EH8L 2ICWA 4I3GA 2BC4A 1YNTA 4L9LB 2YMXL 4PJAB 2FJGB 2A6DA 3W24A 3RM8A 4DN3H 1WAAA 4RFEA 4MAVA 5GRYA 5C0CA 2F53A 3UTQA 1I7RB 5T1KB 4QEGA 4WU7B 4X6DF 3W9DA 4Z7QE 3ARUA 3H7BA 3BQUD 5GZOC 3H54A 4WU5B 1BD2A 4GKSA 2BNQD 4IMKA 3BI9X 4C56E 5AD0A 4JRYE 4HOZA 1MH5B 5FYLH 2PN5A 5INCA 3L4WA 1C90A 4S11A 1B3ZA 3O9WD 4XC3L 2FZ3A 5EO1B 4AIOA 1V6VA 2Y23A 1JAKA 3WDQA 5EFIB 4P3DB 4R8WH 3JTTB 5E9DB 3QJFB 4HK0B 1CBGA 4GXVH 4M7JH 4AYGA 1HKMA 3VX1A 1E6QM 1WBXB 1CL7H 4LSSL 3PE9A 4U7KA 4LLQA 4NWUL 3MNWA 3MRBB 4LHUA 1YN7B 3QIBD 4U33A 4O2FB 3RKDD 1I7RA 5T1KA 4XAWH 5KSBF 1F97A 3B2VL 3G08B 4LCIH 2GFBA 4JHWL 4GQQA 1DWAM 1MFNA 4KROD 1CLOH 5CZKA 4X0VA 4N5EC 4IMKC 2ADGA 4PMDA 3OB8A 4YFEA 3M7SA 2QQKH 1DVFD 3LQAC 3G6JB 3N17A 1FZKB 1IAKA 1FVCB 1QLFA 1OL0A 4AY0A 3AHZA 3TBYB 1IJ9A 3CK0L 1KXQA 1F4YL 2I9LB 3GSNL 5HGBA 4J2XA 1WQVT 2AAVA 2XKNB 2W65B 3BZFB 4XPAH 3QHMA 4WU7A 3LKOA 5EZLA 2AJZA 3MC0A 5I6XC 2GT9A 3I3DA 3FQUA 4JFPB 1JK8A 5FGCB 4DQOL 1A6VH 2XY2A 3ZHLA 1NMCB 1BGAA 3FQRA 4OZGE 2DH3A 2I5YH 5CFHA 3OAYK 4NWTH 2JIEA 1FNSH 1WFOA 2CGRL 3LS4L 4XVSL 5IBUG 1ES0A 2XKSA 1FBIH 3AAZA 2DDXA 4CD6A 2VE6A 4DN4H 3PZUA 4P59L 4MNKA 1WZLA 3PGFH 3RGVA 4AISA 1DL7H 5E1AB 4WFHD 2Y07L 5JXED 3THCA 3JUZA 4S1RL 2A6KA 2R56H 1IAKB 1W72B 2J4WH 3BX7C 3NAAL 4TULH 5AC4A 5IWLA 3B5TA 5GGQH 1OCWL 2BOBB 3L4ZA 3LXCA 3QFJA 3MRFB 3WD4A 2G3JA 1HJWA 1U8HB 1WC7A 5K9OB 5TJWK 4ZUTA 5L88H 4F58H 1MPAH 2DSVA 1FHDA 1TJGH 5DT1H 1QO3A 1GCYA 2EDDA 1XIWA 4O5LH 2IAMC 3U7VA 2GSGB 2XJ7A 3VD5A 5ENWB 1H49A 1MW3A 5I79A 4KQ4L 3G5YB 2XZCH 4YDLC 1NBYA 3S35X 4ZD3H 1MI5A 4HC1L 1H41A 4PLJC 2H32H 4PJDB 1ZVHA 4XCYA 5CAYB 5K59F 2E9JA 2VDMH 2X9XA 3OPZH 5KW9L 5DZOA 5IV2A 2FIKA 1W3JA 1A6UL 4A6YL 3DSNA 4P2QB 3HUJB 5TDNB 2W9EH 3BEVA 4ZS7H 2JJSC 3FHAA 4OLXL 2OR7A 5CEYA 3U2SA 2HVMA 5C71A 3VXTB 4HP5A 2D03H 3V95A 2NY2D 3SDCB 4QNPE 4I4WB 2BVYA 4DGIH 1NMAL 2HJFB 5BZDB 1YEJL 2PO6D 1UENA 5FO9A 3KXFA 1FORL 2IANB 3BPCB 6FABH 3V52H 3KPLA 1R34A 3CH8A 2HLAA 2VDRH 3ZKMD 1ITCA 2J78A 1YC7A 1YNKL 1T1ZB 2EDFA 2VC2L