1EO7A

Bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMAAVKHMPFGWQKSFMAAVNNYKPVFTFGAWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
publication title Structures of maltohexaose and maltoheptaose bound at the donor sites of cyclodextrin glycosyltransferase give insight into the mechanisms of transglycosylation activity and cyclodextrin size specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2000-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1eo7A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1eo7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eo7A01
1E73M 2GITB 4U2YA 4HWEH 2UY2A 2A83A 4WI4A 4QTHA 3U0WH 1UADC 2YXMA 4L4VB 4V2CB 4JO3L 4ACYA 4YHEA 4JFDA 1YEIL 5HGAA 1IBGH 1G9NL 3A0OA 4I4WB 2XZAH 5CJOL 2AGJL 1X5KA 4JRYE 2ZUTA 4NZUH 4K8RH 3ZYZA 2ZOKB 1NWSA 4Q74A 1SHMA 3MLYH 3C60C 4TQEH 1YYLH 2B7DT 1E4KA 1KB5B 3ARDC 1C16A 2BP3A 5L2JA 3HUJB 5DEFB 1WIPA 4L9LC 3MANA 1T1WB 3SDYH 5IVNA 3AU1B 1ZWIB 3JWDC 1ISXA 2Z8RA 1E0VA 1US3A 2J8OA 2DQUL 3MA9H 1JNHB 2BX5A 5CEZD 4RFOL 3G04B 4HX1B 3ZSTA 4H88L 1KTDB 3KL3A 5T33L 5C09B 5D72L 4R2GB 5KVEH 5FL0A 4AL8L 1CD1A 3MREA 4PJFE 5T1DH 1I1AD 3N06B 1E5JA 1WNOA 2V5RA 2CKBH 3PE9A 3KLAB 1V02A 5HHPB 4GPNA 5JNYB 3CPLB 4LP5A 1CLZL 1PX4A 3GMQB 3HG3A 3WLBB 3BESR 1FYTA 2D7MA 2QSTA 4FQ2H 3RY4A 1QA9B 4QRRB 1CDYA 4ATWA 5DGQA 4D6JA 4ZOCA 3AREB 1JGUL 3AZTA 1RUMH 2QKIA 5JXEA 1AFVL 1RZ8B 3CPUA 1B0RA 4LLYA 3NMEA 4OF8A 3MR9A 5AD0B 3MCLH 4QRSA 3S98A 5IMKB 4KJQC 2AV7B 4QF1A 5DYOB 2NY7H 2A3HA 1CDHA 1CGVA 4U1LB 1IAIM 1RURH 2A74B 3V5HA 1FCCA 2BNJA 5INCB 1LD9A 4FOMA 3BUYB 5KVGH 2DIEA 4BH7A 5B38G 4OGXH 5J6HB 3QIBB 3I50H 1RPKA 4RISL 3S5ZA 1QTYT 3ZYJA 5EU4B 5FYLL 5KSVB 1T2QH 2J7FA 1KPRA 1P7KA 5EZOH 1HSAA 5J1AB 4B3LA 2DB8A 1N0XL 3HI6L 4RIRB 3CX5K 3CV5A 5F6IB 3K81A 2YDRA 2EEAA 5I8EA 2H3NB 2IG2L 1AO7E 1N5YH 1E3ZA 4LEXH 1LO3L 1QNSA 2PXYC 4PREA 5D2LA 3LKQB 5F89B 1EEQA 4J2XA 2BSTA 3C09B 4HA3A 3TWCL 2A9MH 4X4YB 5ABFA 3WBEA 3QDJD 4LSSH 1H0DB 5LQBH 3VXMA 3EBVA 3GSXA 4L4TA 4ODWB 4OGYL 4P99A 5MERA 1A6PA 1IT9H 1GGIH 1K9DA 2PWFA 3KPRD 2NLJB 3KJ4C 4QHMB 3EHBD 4KI5F 2CLZB 2V9RA 1U58A 1WIUA 5E24E 3BIAX 1P4BL 5FM4A 3UZEA 4Z5RB 4PJGA 2WLYA 1JIBA 1FSKB 3R06A 4M56A 2Q6WA 2WP3T 3NN8A 4JRXB 5GGQL 1UZ6E 4UZUA 1A1OB 1R7AA 5A6SA 4YHZL 4UFHA 3U30B 2AK1H 2D9QB 3VXUB 4A2LA 3ULVD 5D93B 3MO1B 5CS7A 4QT5A 1UA6H 2NXYD 1GC1H 4EXKA 1T7ZA 3TBSB 1SJXA 3BZ4B 5TDPB 5A2FA 3LZFH 3DX7A 4HG4K 4M5YL 4MJ6B 1CNVA 5B39G 2HRLA 1J12A 4ZOAA 1GYAA 2FIKA 1UCBL 2XN9D 2XQYG 3HLAB 1KIRA 3U36B 4UNIA 1I9RH 1K4DB 5GS3A 2ZCHL 4JKWA 1B4JL 4XVSH 1WBXA 2VQUA 4IPNB 1VHPA 1JRHI 1MHEB 4TOYH 4XZBA 4PBXA 4AQ1B 4FZEL 4MB5A 1XZ0A 2E7HA 1QBMH 3P9MA 3Q6GH 2OWCA 4HSQA 1FOBA 5HHQA 3FN0H 4YJZL 3GMPB 4U33A 4L9DA 2YFOA 1DL7L 1OSZA 4XP6L 3RU8L 5DRXA 2X41A 1NKOA 5F1NB 1MFAL 4Q58C 4KKAD 3OF6A 5C0IA 3QHZH 2CR6A 3VOCA 1T04A 4JY5H 4NKDA 3B43A 3WIIH 3PHQB 3AYSA 1BFTA 1GONA 3GSUB 2YBTA 5E1AA 5GS1A 4NBZB 4RGNC 1JPFA 2AQ3A 2HJKB 5GZOD 2VMFA 5A6KA 1JV5B 4NJ9H 1K9EA 3WIFB 1KIQA 3CFDB 3EO0A 5IFPA 1KJ2H 2PETA 3O4LD 5IEHA 3GMMB 1C5CH 3TM6A 1TQCB 3WEOA 4QOKB 1HE7A 1PGRB 3TA3A 3V0WL 3CMOL 4GZIA 3FZUD 3KPRE 2EO1A 4ONGL 1AI1H 5DO2C 5BV7B 5HPMB 5FA3B 1NGXB 4HK0A 3WMBA 1IM3A 3BCDA 4OLUL 1GGBH 2IPTH 2XZCL 5HY9B 1MNUL 2WK2A 1OAKH 2X1QA 3HRZB 3SCSA 3BEVB 5D1ZB 5HHOE 3LRHA 3MR9B 2M2DA 2DQEH 2F53A 4AEHH 4UNVA 2X4SB 5CBAB 1J5OL 2EABA 1SZNA 5JZ7D 4AWEA 2GJZB 4XMPL 5HYSG 2NY3B 5IB1A 4WUUA 1BOGA 1XR9B 1QFOA 1PBYA 1RZKC 3ZR5A 2FRGP 2P7TB 3QEQD 2FEEL 4PYHA 5E8NA 2NYYD 4WFEE 4ZYKB 4PTUA 4BH7B 2VCCA 4PJ8A 1CXIA 4MQ7B 3WXWL 1LEKA 1EFXB 2AGJH 4KUZL 2GJJA 1IILE 1WCBB 1CFQA 2ITCB 3D39A 3EGSA 2XN9E 3MFFB 2XVKA 4F8XA 3ZDXE 4BELD 2GW5A 2AJVL 4PGBA 1ZLVH 4FG6D 1NAKL 2Q8XA 2GJ6A 3PWNA 3SJVD 2R39A 1SY6A 3I75A 3OZ9L 2OSLB 5FUCC 2DQUH 2BS9A 1I9JH 1U92A 4H88H 2JK5B 2Z4QB 3GSXB 4PJXF 3VIJA 2WCAA 1HQRB 3U82B 4M6NH 4AL8H 3C8HA 4NFBA 1NC2D 4FRWA 4XPBL 1QRKA 2ADGA 3EJRA 5I1IL 1SJHB 3SGEI 4ZFGL 3D85D 1PG7X 1QNZH 2E9BA 5B22A 1W3LA 3MROB 4PJGB 4LLDA 5J11C 2WINB 1ZGLA 3DHPA 1WICA 1B0IA 2B1AL 2HJLA 3IKCB 2UY5A 2QBWA 1UB6A 4M6OH 3NN8B 1CLZH 1XGRB 3FRUA 3WH6A 5DA4A 4HUVB 4FFVC 5LWYH 1XF2B 3MLTB 3RIFK 4DGVH 4MMXC 4M1RA 1NDMB 1FFOB 1ZEAL 4E5XA 3SDDA 2EKSA 1JGUH 4I77L 4RFNC 3DX7B 1ORQA 1ZANH 4GAGL 2VI0A 1KN2L 2Z93A 2D31A 2OWXA 2XWTA 1TQWA 3KYOB 3GMLB 3PXHA 3QIUB 4HEPG 4KRPC 2QQKH 2HWZL 1FDLH 2P49B 3SUWA 5CBEA 2WKGA 4AD1A 2VLRB 3HAEG 2W91A 3UPCA 1QSFE 3QUZD 5JHDA 4ZD3H 1WBXB 3V0AC 4U1JA 3I84A 4NM8L 2P47B 2W65B 5DC4B 4JM2C 3L9RA 3UTZA 1DDHA 1TTGA 1OAZL 3QEQE 3RGVB 3P9MB 4RISH 4K94H 1KXTB 1TCMA 1QPKA 1I8KB 4MA3A 5FYLH 3BE1L 4WJXA 4UQ9A 1A3RH 3SDXF 1MY5A 4GMSH 1UZ8B 5KS9F 4G8GD 4GAYB 2OX5A 1RIVL 1S7WB 2RCSL 1GAFH 4LVEA 1N0XH 5F21B 5C0IB 3SCMD 4M8UA 1E4WL 3OKMA 4LQ1A 3P0GB 4D8PB 1MQKL 3WHE0 2BNRE 1EMTL 2VDKL 2YD2A 5K9OB 2IG2H 4XUYA 3LOWA 5CSGA 1YYMH 3FQNB 2VISB 4GJTB 4L8DA 5E1AB 3VFOB 5CCKL 2CGRL 3F58H 3TWCH 3VXRB 5T1LD 1AGEB 1CD8A 2VDML 1P9MA 3WNKA 5KN5B 3B9DA 1NP0A 1WTLA 4J3UA 3WKNA 3FQRB 1QWUA 5D6DC 1P7QA 2JJWA 1JYXA 1U8PB 4TOQA 5DS8A 4ODXA 3SDCA 1HN1A 4NQED 1IM9B 4CGTA 4EN3D 3HCVB 5C0RL 2I9LB 4M00A 2XKNA 1XH2A 1MRCL 1P4BH 4NN6C 1DBML 1HSBB 3DSFL 4WFFE 4JFQA 5F6HI 1OWRM 5DJYA 2CDEA 4ESKA 3QG7H 1KBKA 3LRSA 3UG3A 2V5TA 1BVLB 2ID5A 4YHZH 1LK3L 4UFJA 1NWRA 4OZFB 2R1WA 2A6JB 4DGYL 4JQXA 1W9BM 3TBVB 1S7SA 1BOGB 2AJUH 1Q6CA 2JCCF 2I5YL 2MWCA 3IFLH 5E8NB 4GI6A 4OJYA 1ULVA 4PJ8B 5IWLA 3LKSB 2FSEB 2WUBL 3L7FA 4PRNA 4BQ6A 4HJJH 1JHLL 1WF5A 2VLLA 3EGSB 4ZNCD 3THCA 4OFYA 2ZCHH 4BCEA 3RDTC 1LO4L 3WSUA 2AEQL 3C6LC 1BYDA 5I2IB 3ARFC 3OGOE 1OT1A 4FZEH 4W93A 4KK5D 3SO3B 1PKOA 4POZD 3W81A 4UAOB 1NGQH 3IXTB 4PJ5E 3LQAC 1JDAA 3VIMA 1FBIL 3FQTA 2VO5A 3PWNB 3SKOB 3VKKA 4PRDA 3I75B 5DVOA 5F3HA 5I8CA 5JPMA 3FNDA 1QEWA 2DIAA 3S35H 1MFAH 1EXUB 2R2HA 3UAJD 2CK0H 2CIIB 1QZ1A 1AQKH 4HUUB 4G8GE 3PWVB 2ICEA 3HS0B 1J8HB 5CKAA 1QNRA 4X7EC 3T65B 2MPAL 4U1IA 3LIZL 4P7LA 3WUGA 1I1CA 1JWSA 4CMMA 3B9KB 1TTUA 3KHOA 4G6AD 2V7NB 4L8BB 1T5XA 3CHEA 2FGLA 3EDDA 4C56A 2F8OA 4YHOH 1Z0NA 4P46D 5CGTA 1I7RB 2X1OA 3LB6D 5LG1A 2J47A 1KJ3L 2OJEB 4LAQH 4NKMA 2E9WA 3GIVA 3OJMB 5DRZA 3ORJA 3V0WH 3CMOH 3OXSA 4FLSA 4NQEE 4A6YL 1MQ8A 1FYTD 3HUJF 1CXKA 1MWAL 5EUOE 4OLUH 2XZCH 4NP4L 2X09A 2AOSA 4IRJD 4YPGB 4Z2HA 2Z93B 1SJVA 4G6FD 3ARDB 1F3JB 1ROWA 2VE6A 5BRZD 1MCPH 4ODSL 4C83A 5KG9A 1J5OH 3W0KA 4R5EA 4PIRF 1BP3B 3BQUD 2EBNA 3N17A 2WIMA 3WBAA 4PJBF 3MJ8B 2O93L 1XGYL 2DBJA 4KWUA 4KFZC 4N0YH 3T2PA 4DUWA 2NY2C 3QUYA 5C07D 2QLYA 5HDRA 3Q3GB 2DQCL 4NOBA 5I8KL 1W1VA 5DUPL 2GQHA 1YMHB 4V1DA 5SV3A 2B31A 3AY4A 3WXWH 4Z7QE 3GXDA 2OLHA 4BYHA 2WNGA 4Q2ZB 4HCRA 2Y8VA 4RDQF 2UZYB 3UDWA 2PF0A 1J18A 5HI4C 2QSCL 2YD6A 3THDA 3M1BB 2AJVH 4MA7L 4I13B 1E1FA 2Z8SA 4UV4L 2X4OB 2O92A 4UNTA 1EEYB 1OW0A 2EIZA 2R1XA 2EYSB 3RFZC 3U9PH 4D6CA 4PJCA 2H9GB 3ZSSA 5KSAA 3F4VA 1QFHA 2XXMB 1ETZB 2XQBL 2C8NA 4JHAL 3B9EA 1OIFA 4KJWD 3QZWB 3D0LA 3FOLB 2W9EH 4GRWB 4RAUA 2WW5A 4P7QA 1RK0B 1KGCD 3K2MC 5I1IH 2VXSL 3VXMD 4I0PB 1JTPA 3T4AB 3ARGA 2D23A 3CSPA 4Y1AB 5H2BB 4NZRL 4EI5A 3BH9A 5KVFH 3NJ3A 1RIUH 2VDPL 1QRNA 5MEND 4UDTB 1TETL 4N0UA 1NMAL 5SX4H 5D9SB 2VQTA 4XVTL 32C2B 4MJIA 3BMVA 1ZEAH 4OD1L 2XZZA 3BPOC 5GIRA 4M4RA 3WENA 3SDAA 5I1DA 1NUGA 2ADJA 3C8KB 3D0VA 3QJHA 4I77H 4OGAD 5FCUH 3WFZA 3IDMA 1ITXA 2FHCA 4P9HH 4LSVH 5FCSH 1R3JA 3BVNB 2HVJA 4HJ0C 4IIQA 3LH2L 4R96A 1KUMA 4MDIB 1W3JA 2HT4D 1P5UA 4Z9KB 5BRZE 3GUTA 1M1SA 4F7PA 2J4GA 4UT6L 3EFFB 1KXVC 3CH8A 4NM8H 4NM4H 4U4BA 5F7FA 3W37A 5AUMB 1YUHA 4U1HB 1A6TB 4LGPB 2AJZB 3ZDZF 4YHPA 1KXHA 2FJFB 1YNKH 1OAUL 4OZHA 1WDSA 3BE1H 1UASA 4PRDB 3GSVA 3OZPA 1E6OL 3NCMA 5K59E 3CCHA 1U42A 3VIHA 2NY5L 3OLEA 1RIVH 2R23B 1YNLL 2FL5B 3WF0A 4K23L 3GM0A 4PP1C 5A8MA 1MI5D 5H37H 3ULSA 4UU9B 2KL6A 4ZUWA 3LKNA 4KK6D 3GBML 4RWHA 1EMTH 4L3EA 5C08B 4U1IB 5B4MD 3JUGA 3OF6D 2NY4C 5D1QC 3H9YA 3PQYA 4GKSA 5CCKH 1DQMH 5EWIL 2E7LA 2SEBB 3UROR 3OKDA 4YBQC 2CLRB 1UR8A 1MFCH 2IQ9L 1HYSC 1AR1D 4ZXBA 4ENED 1TVBA 3OXSB 5C0RH 1KGCE 1I3RA 4OQTA 1MAJA 4MNGE 4UILL 1BF2A 3QA3A 5ANMA 5GGVY 1MRCH 4JFFA 1DBMH 4D9LL 5EIIA 2J8FA 1ONQA 3UZQA 3MV7E 3TA3D 3S5LB 5B21A 4P2OD 5GNZA 1G0DA 5HGDA 4WEBL 1OWQA 1INEL 4JFEB 4WI7A 3BO8B 2QADD 2Z8VC 1LK3H 2EDEA 3O2VL 5A6BA 2XA3A 5JW5A 3BHBA 5MENE 2AK4E 5E09A 4JN1L 2F53D 4QXWA 2WM0A 2O9RA 3T0BA 3HMXH 2YUZA 1FH5H 1T03L 4AW7A 1A9BB 3PNWA 1BVKA 3TH3T 3F5WB 3TCLA 4YFLI 4WUUD 1UKPA 5JDSA 2LAAA 2EE6A 4OV6F 5SWZA 3TJEL 3KS0J 4LCWD 1OTSD 2WUBH 4YWGL 3SOBL 4P7NA 1JFQH 1JHLH 1CQKA 1KCKA 3VFGL 3RMEA 3MRDB 5CEYB 1MJJA 4RGNB 1QBLL 4XNZC 3DHUA 4XPHL 3MRKB 2KPNA 4OLVL 2OR8A 3MV9A 1KPUB 4PJ7A 1YC7A 2CJUH 1W72L 1R47A 2Z31C 2NY1C 4AZ6A 4UQ2A 4NWTL 4MQTB 5D5MB 1IAKB 1FBIH 2HFFB 1T7YA 2XY2A 4PJCB 2NW2B 2IFGA 3QEGL 4NDMB 5F3BA 3TT3H 2YEZA 2J6EA 2JJSA 4KROD 4MQXC 4QRTB 3D0LB 2IPUG 2MPAH 1JK8A 2P24B 1MI5E 4NKOB 2VZVA 1BPVA 5F7WC 5DA0B 4ELKB 2HFGL 3LIZH 1PBGA 3OGVA 5JOFB 4MDPA 1DE4A 3F62A 4F3FA 1W1YA 3OKKA 3C5JB 3WH5A 3GH7A 4ZTPL 3AS1A 1O7DC 1FRGH 3F7YA 1UZ1A 1FPTL 3KS0H 1KJ3H 2FBJL 4TUJA 4U1SB 5I17B 2VURA 4LCYB 3ULUH 2YBRA 4Y4HC 5I77A 1ZBWA 3VGBA 2H32B 4P4KD 5ID0B 4DN3L 2ADJB 4NP4H 3QQNA 1OSPL 4MNJA 4DM1A 4NSBA 4HFUL 1UOKA 2C7UB 3SDDD 2QPUA 1R3JB 5D2LF 1A7PL 3RUGE 2ED9A 2B4CL 1ZLUK 3FRPG 3VGHA 1RJLA 5I1GL 3FOMB 4LCCC 4TULH 1CYGA 1GGCL 2VXQL 4XPAL 5BS0B 5DT1L 4UOQA 2Q20A 5I79A 3DBXB 4FXKB 5IB4B 4QNPE 3U83A 5C0ND 3X3FL 1A21A 3I9GH 2OSYA 1QHPA 3V6OA 1E5NA 5JHDD 1MLBB 5I8KH 5DUPH 4I5BA 2P5ED 3ZT5A 4RMWA 4MNQA 3BAWA 4ODUA 2APVA 1BD2D 2NTFA 4LCWE 4PJGF 2OK0L 4J8RB 5ABGA 3ZTNH 3GSVB 4GRMA 1D9KC 5D1XC 2DT1A 1JF5A 3OPZL 1U8OB 4W85A 1YMMB 4LASH 2VOTA 2QSCH 2XT1B 3IDNA 4KKCD 4RMUA 5J11B 5A69A 4ZUSA 1N2RA 2UZIL 4F7CA 4PRPB 2GTZA 3C6SA 1D5MA 3OJDB 4G80A 3UETA 1BQLH 4Z77A 2OYMA 4L3EB 1R5IA 1T22A 1HHGA 3QQ4A 1EJOL 4GKSB 1ISWA 2DQIL 1BJ8A 1QI3A 3RZCC 1EA9C 3VG0H 2XQBH 2CCRA 5HYJA 4MWFA 3RL2A 4RFNB 3LPGA 4ACPA 4B9ZA 1WJ3A 1E28B 3K74B 3OTTA 1HEZA 3H7BB 3A47A 5ABEA 1MHCA 4PJDE 3L3HA 1JDDA 3MUAA 1Z5LA 1EHAA 1HHHB 4HIXH 4HK3J 4NZRH 4RA3A 3WUBA 1AJ7H 2X9XA 4P23C 4LBEA 1HVQA 1D3CA 5I74C 1TCRB 3O45A 3RWFB 1TETH 2XOTA 4JHWH 3C5SB 4NI3A 3Q0HA 4AC1X 3GJFB 1B1YA 1HILB 1LP9E 3LEVL 5BOPA 5E8EB 3QWOA 3WN6A 1HYRC 4HWBL 5F72S 2X4QB 4OD1H 5BYWA 1OF2B 3EJUA 4KGJA 5I5RA 4BH8B 5BVJB 1U36A 4Z7VE 3UZVB 4CVZA 1FE8L 2B5IC 3CFEA 4I2XB 3LS5L 4OT1L 5E94B 3V5KB 1GPFA 3IRZA 1A14H 4L3CB 5CEZL 4EIZC 2VH5H 1BQCA 2ZXBA 2DRUA 4LNRB 2MOVA 4YPJA 2Q3ZA 3WDHA 4UT6H 3APGA 4Z95L 1IE5A 3CZSA 4G7VH 5ESAA 1J86A 3HMWL 2PYEA 2DLGA 2X4RA 3VXQA 4OFYD 3O2LA 4D71A 3PWPA 5IVXB 4Z0XB 4ODVH 1M05A 1BM3L 4JY4B 4UQ2B 1OAUH 4AZ7A 1RUAH 4AH2A 1U93B 2OTUB 3GKWH 4I48B 1E6OH 1M7XA 4JREB 3AXXA 1BD2E 3IB4A 4NN6B 2HTKC 1BWMA 5DJCB 4HC1L 2ED7A 2NW3B 5K9QI 4UIKL 1CFNA 1FO0B 2Q87A 1JK8B 3V4VH 1UVQB 3VI4E 4UOW1 1YPZE 3DXAA 5KAQG 2ZX5A 3LPFA 4M5ZL 4O2CA 5C0BA 1QHZA 3OKKB 3U4BL 5KSBA 2J8UB 2AABL 1CN4A 4N0CD 4FZ8L 2IQ9H 4JHOA 1J0IA 4ZUTA 4WY7H 3PHOA 1AHWA 3QQ9C 3EDJA 2FH6A 3FQWB 4C56D 1I4FA 5T3ZE 4HZ8A 4HIEB 2YBRB 4XC1L 3UCQA 1EAPB 4Y0GA 1GQIA 3EDEA 5HVHC 4X4XA 3TV3H 5IB3B 3NFSL 3RDTB 2WXDM 1MVFA 4AIXA 2AAVA 2YPVH 4WEBH 1INEH 3GEWB 1HL8A 1HKFA 4PYGA 2WVVB 5JO5B 3WL9B 2NW0A 2YSSA 1K85A 3KYNB 4RBPK 1YEEH 2EADA 1H5BA 3NCOA 5MEQA 4P2QB 1XF4B 3CNKA 5GRYA 4W8LA 2YDQA 4FP8L 2WMGA 5A8QA 1U8IB 3HE7C 1YQ2A 4FXLA 4WKHA 1XIWC 3KPNB 3QUYD 5DHVH 4M24A 1DVFC 4D9QE 1U6AL 4MD4B 5EFIB 3MCG1 2EEDA 1I9IH 2OZ4L 3JTTB 1KCLA 3KPLB 3P3YA 4KMTH 1QBLH 4QXUL 4GSDL 4EIGB 4WLCA 1OIMA 3KLSA 4AEFA 3IJ8A 4ZUSB 1N2RB 4OLVH 1W72H 4LVOB 4F7CB 3N04A 2GTZB 4A2MA 1D5MB 1ZBCA 1W0YT 3N15A 2A9NL 4NWTH 1TZHB 3AAZB 3QQ4B 3GJEB 4KVNH 1F2XK 4CW1B 1EOKA 5GGSY 3INUH 1N8ZA 5HYJB 4FQHB 3ZKMD 2WCSA 4AIOA 3ULVL 1FVCA 1L0PA 5KSAD 2CQVA 1JPGA 1QR4A 2I9TA 4GOSA 2MCG1 1HEZB 1ZA3A 3FFDB 1B30A 1G6RL 1MHCB 3RP1A 4U0RC 5F7DA 1CDIA 1NAMH 1IEHA 4APQA 1LLOA 3AMCA 4NRXB 5AG8A 3ARGD 5ADPH 1TXKA 1J1OL 4EI5D 1RJYB 4ZTPH 2NY2B 1NFIA 3VIKA 4HF5L 4LOUC 3LAFA 4OZGB 3WSQL 4ZS7L 2OL3B 3P40A 1FPTH 5BQ7A 4OUEA 5C9JA 2HLAA 1QRND 2MQ3A 4U1MB 2FBJH 2L4OA 4G8FA 4MD0A 4S1DD 5TFSL 4W5ZA 3D3VD 4MAYC 3G6AB 4DAGH 4X4MA 4MCZB 4DO4A 1UJ3C 3VRLE 3C2AL 3MGOA 4KQ3L 4QRPB 4M48L 4G43A 1Y0LA 4DN3H 3AFBA 5ACZB 3ALFA 1OSPH 1PG7W 4HS6B 4RDQG 4O58L 5FDWA 3SDAD 5TQ0H 2HG5B 1ZLWK 3CTTA 4IS6B 1A7PH 1FL3B 5I1JL 2B4CH 4WV1C 4JO4L 2YR3A 5I1GH 1WEJL 5E9DA 4PG9B 3PL6C 2VB5A 1GGCH 4PFEA 5ESAB 3DHMA 4GRWF 1ZV5A 2YLAA 2PYEB 4IMLA 2X4RB 3O6FA 1OP3K 1G9EA 4POUB 2JF1A 1V6VA 2Y4SA 1M05B 2FR4A 4ZFMA 3O8XA 1GC1C 5ITFB 4Q9RH 1UQSB 1P5VA 3D5OF 1KNOB 2FD6L 3J7HA 3OPZH 1IAOB 4HU8A 4RMVA 3MLRL 4NQCB 3KXFA 4Z2LA 3K8LA 5FHBL 4QHLA 2YD3A 4NT6B 5DVMA 3GNOA 3TYFA 2Z92A 4O2CB 1Q94A 2DQIH 3SGKA 1NC4B 1RP9A 4UT9H 4FQJH 3BPOB 1YY8B 1ES0B 4X5LA 4X8JA 1MWOA 2H8PA 3RI5K 5KSUA 3DVIA 3BKYL 1S9XA 5C0JA 4ACZA 4M4PA 2WBKA 4BFIB 4HUWB 2ZNWA 3QUXC 3HZKB 1DN0B 4LLWA 5JDJA 4BS0A 3BPLB 4H0IA 5DQDH 4ZXBD 3MRBA 1MCQA 4YDLB 2Q8AH 4L8SC 4XPFL 3JV0A 4W81A 3VFVA 1X9QA 3SY0B 5IFJA 2WBGA 4HA4A 4PTWA 3TT1L 5FAAA 4ZXLA 3S96A 4W7WA 1TITA 3TTOA 2Q76A 4D0BB 3MV8B 2CBJA 4Q97A 4Y19A 5J8OA 1FE8H 3DUHA 4OT1H 1BVZA 5C86A 2MTPA 3TO2A 5CEZH 1JYNA 1V8HA 5INDA 4PTMA 3WNMA 4PR5A 2EPMX 2NY4B 3QDGA 3S88H 1AKJD 2DTML 2H2PD 5D1QB 4Z95H 3MRGA 4MDOA 1U8QA 4PPTA 4GFTB 2F1BA 3HMWH 4LKXA 3JV5A 4P7RA 2XQYK 5I75C 1MH5A 2NX5B 5A2CA 4LMQI 3JV6A 3RNKB 1F4WH 4I3GA 3IJHA 3AXLA 3KPSA 1M01A 3H3PL 4HV8A 1RP8A 4CNIB 1XV8A 1KCSL 1K8DA 2HT2D 4TRPH 1AIFA 2JIXB 3CK0H 3MRPA 1AQHA 3VIPA 1JE6A 4OCSH 2A2QT 3BWAB 3KDMA 3TNMA 5GRXG 2NY6D 5F1IA 1OQXA 4YX2L 4KDVA 1OCWL 3L1OL 4XRCB 5T1KB 5GS0D 4OZOA 4GQ9L 3D50A 3PGDB 1ZA3B 3PUCA 4F7MA 3FT2B 1ADQA 4HD9A 4U7MA 2CETA 3E0GA 4JQVA 3FO2B 3I2CL 2OQJB 4GW4A 5IV2B 4NBYB 4R0LA 1T2XA 2VABB 4N8VA 2A0LD 4FZ8H 3HC3L 2Q8BH 2XN1A 5GISH 2WBJC 5GJSL 1D5ZB 5JTWA 4M03A 4R8WL 1TA3B 3MLWH 4FQIH 2G75A 4I18A 3MGOB 1WFUA 5LGKA 3U5YA 5E6ZA 2Q7YA 4NZFA 5FDWB 1R3IH 4ZPTA 4Z2GA 5FKAB 3O2DL 4PJCF 2NY1B 4N5ED 1UXSA 1XR8B 2A6KA 4N0FB 1XYZA 2OP4L 4GKZB 4PJ9D 1BBDL 5E9DB 4PRHD 3WIHL 2Y06L 1T0PB 4QHNA 4EZMA 1UR0A 5L9DL 3ZKQD 4WU5A 5EU3B 3PP4H 1H2JA 3BPCB 3DRQA 3BSZL 2Q86A 3GB7B 5L6YL 1KBBA 4MAUL 3E8UL 2FX8L 3POCA 2HH0L 3VFPB 2ZP0T 2YPKA 2PTUA 1KJMB 2HFEB 2FR4B 2DQJL 1DEEB 1ZHBA 4BSWA 3WD5H 4NX0A 2D7QA 4HU0A 2WMFA 4HKBB 4XVUC 2J8GA 1U6AH 4YBLC 4ATDA 5HDOA 3MXWL 5E6ID 4P8XA 4HDIA 2OZ4H 4U6XB 4HOZA 4UFIA 4MNQD 4I0CC 4GSDH 4QXUH 5F9JB 4R7DA 4I3RL 1L7IH 2C1OB 4OD2A 1OD0A 1WWCA 1S78C 4KKBC 3O4OB 4NCDA 4O4YH 2GI7A 1I7UB 1UWXK 2Z92B 4CVWA 2AKRA 1Q0YL 3ARUA 1U8KB 4Y4HB 2WQ8A 5CP3H 1L7TL 2H8PB 4K94C 4Y5VA 4LRIC 4JKLA 3RPIA 2WMIB 3PWJB 2RR3A 3AYRA 2QTEA 4IISA 3D25A 3JZ7A 1QVOB 4NCC2 1GZPA 4XCFL 4BM7A 1E56A 5CHNA 2W60B 3AS0A 3GSWB 1IKNA 3NFNB 4UB0L 3EW3B 4JZJC 3KPOB 1X5LA 5HD8D 4F9LC 1M53A 3B6SB 3NCEB 3VDHA 5F96L 1NFDE 1T21A 1OB1A 4OZHF 4NO5B 3BYTA 4K9EH 4ZS7H 1PJ9A 3KPMA 2CSPA 3UJTL 3WH7A 1TFHA 3NZHL 1JL8A 1G7JA 2K7QA 2V3FA 1Z9MA 2YRLA 1D9KB 4LSTL 3AQUA 3C2AH 5D1XB 4M48H 3TNNB 3GXMA 1VACB 2VLKB 4K71C 4TSCL 5AYIA 4Y19B 5ETUB 2V5YA 3O81A 3QEHA 3A6CL 5J7CC 2EEBA 2ATPB 5GGRY 5FO7B 2DQGH 4G42A 5I1JH 4X5WB 5T3XE 1JPSL 4JO4H 4NYLA 4U5IA 1WEJH 1VADA 3SCWA 3SCOA 4DJMA 5F7YC 3P4OB 2WMKA 1UFUA 1YEKL 1S7XA 5DD1H 3RL1A 3ZDYF 1NANI 3VWJA 4U6YB 3BAJA 2HKFL 4LKXB 2GYSA 5DD6A 2NY0D 4XNQA 1NGWB 3IVKA 1MVUB 3KPSB 2YMXH 2PO6D 5I66B 1KLGB 1WCQA 5ECUA 4FFWD 4HV8B 3PHAA 1MF2L 4D0DA 4OIFA 4PB0L 4OCWH 4PJEA 3ILQC 2FD6H 5I1LA 4NXSA 2PW1B 1R0AH 4P23B 1HHJB 4HZLA 5K9KB 5EU5A 5I74B 1MW3A 3WO4C 3QUKB 4TSBH 4N68A 3SDXE 4OM0L 4LLMB 5EO0A 4GO9A 3QXUA 3K2UH 5KS9E 4KZEL 4LVNC 4F9PA 2DT3A 3QHTC 2VZ1A 4R0LB 5TE4L 5CP7B 3DXAD 2RB8A 2DM3A 1JGDA 2WWDA 3CLEL 1Q9WB 4WFHD 3BKYH 4XNMA 3VRIB 1E6SM 3X13A 4YGVA 4G3YH 4L4VD 5CD3B 1FL6B 1T1ZA 2B5IB 4FQQB 2DSWA 3AROA 3TN0C 4BA8A 4R90L 2ZXQA 3VW3H 1HINL 2VAJA 1NM9A 4Y2OA 4ZTOH 2G75B 1PZ5B 1F6AB 5DRWA 1DBJL 4PJ7F 2ALWA 2BMKB 5IVXF 3HI5L 3NABH 3TVMB 4F7TB 1DLHB 2Q7YB 1NOFA 4F37K 4PGDB 1VKXB 2ICWA 1FP9A 2VRKA 4XPFH 1QSEB 4TTDD 2YPLA 4AT6A 1WDPA 4OKVB 3KPTA 3P11L 5FB8A 4MA8H 1DSFL 2D3LA 1W8OA 1A7OL 2NPLX 2IPKA 4NNYA 4PY7B 3DRQB 1TZGH 2J77A 3FB6B 3WNLA 5DEGB 1BGXH 2Q86B 3NPSC 1A7QH 1NDGB 5IHSA 3L3IA 3HZVA 1MREL 2X6MA 4F33A 4K3EL 4OZFG 2DTMH 1JHKL 2BVTA 4IOSD 3MRLA 3U2SB 2ZX8A 5E4EB 2EECA 3ZE0F 1R3LA 3OA5A 4WHTB 1INQB 4BUHA 2QF8A 3OG2A 4BK4A 1JNNH 4PLJD 3H3PH 4KV5E 3OLGA 5A6LA 1MQQA 3KPQA 1JUFB 4K7PL 4QRRD 3W0WA 3C60A 3GXIA 3AGVA 3RVVC 3WUWA 3LS4L 1UKTA 4Y5VB 5HVHB 3KYKL 3RPIB 5DO8A 1OCWH 4L9LA 4WI9A 3DUUA 5ICXB 2RGLA 2XTJE 5CJ8A 1H3TA 1HKLL 1UUQA 2D3VA 1WT5A 2CKBB 5CHNB 2HTLC 3L3GA 2EYRB 2C0HA 1BEYL 1ZVSB 5IF0A 3GFUA 1RZ7H 3I2CH 5I16A 4R7NA 4QCFA 4M61A 3O0RL 3HRPA 1K6QL 1JN6A 3OR7A 5J13B 4HKZA 5J89A 5E0CA 1GOGA 4PJIA 1IC4L 5FUZL 4P2RA 2FECI 3BC9A 5HJ3A 3HC3H 3HE7B 2Z91B 3CGTA 2VC9A 1YDPA 3QIBD 1UB5A 4L4VE 1VFUA 1XIWB 4JKKA 4OI9A 2FATL 1PQZB 1DVFB 3S6CA 4MD5A 4QLRA 4HS8H 1P1ZB 3P9LB 4MJ2A 4RBPH 1OTUD 5IK3A 2QQLL 4DZ8A 5J0BA 1J0JA 2VX4A 4PMDA 3O2DH 4LGRB 5DMJB 4ZUUA 3H9HA 4HWZB 5A16B 3HUJE 2OP4H 2VKXA 2IF7A 1BBDH 4PP2B 5DVLA 3WIHH 3MRQB 2NZIA 1JD7A 4K3DH 1G1CA 1H11A 1TQSA 1I85C 2NR6C 4JFSA 3LXAA 1JFXA 3OKLA 3BGAA 4EVNB 1WWWX 5L6YH 3IVKB 2FX8H 3P2TA 3FQXB 3DX6B 2GKIA 4PJBE 4LXFA 1D6EB 1LGVA 3DX9B 4HXBH 5C09E 5GRZA 1GHFL 3QXAA 4U0RB 2EQDA 1UZ4A 3AJ7A 4P3WA 1CLCA 3BUIA 1J0YA 3G08B 1ND0B 3CFBA 4P9HC 3O8XD 5SWSE 2CLVB 4OZGF 1AE6L 3F7VB 5L2KA 1ZU8A 3NACH 1EX0A 5JQ6L 1MFEL 2ZJSL 4JRXD 2IC2A 3KXFD 4C54A 1W91A 2IGFL 4GMTL 1W0WB 1Q0YH 2QR0A 1M7DB 3UBXI 3SCPA 1XC6A 1DUZA 1H0GA 4R4BA 3OGCA 3AIVA 1L0XA 5JIIA 4MYWB 7FABH 3UYRL 4XCFH 4Z0BL 3EAKA 2XTKA 2PXYA 4WV1B 1M71A 2CKSA 2F7QA 2NXZC 4UB0H 3HG5A 3PL6B 3TIDB 3HE6A 4CDGC 2R0WL 4P5TC 4TUOA 5D9PA 1LDPH 4RE2A 1P4LB 2XYLA 1WV7T 5HHOB 2CMRL 3NZHH 2O5XL 1G5AA 2ZSWB 1EERB 1UM4L 4K2UL 3VH8B 1VESA 1OGBA 3OV6A 3Q2CA 5IR1A 4LSTH 2R2EB 3FT3A 5GHWH 1IVLA 1WFOA 3ALGA 3RTQC 2R4SH 1KXQE 1KULA 2W0LA 5FDYA 2ERJC 2AAAA 4CCEA 2FX7L 3GTNA 4UCFA 1G7IB 1JPSH 4LSQH 4F33B 3AS3A 1K2DB 1X7QB 3KL5A 2PTTB 3RVTD 1FIGL 1NL0H 1YEKH 1OP9A 1S7VB 4NQVA 3SQBA 2UWEA 2O9OA 1C93A 1BLNA 4YIQA 2HKFH 4QGTA 2VDRL 4HA1A 3WBDA 3OAZH 1GOHA 1IRAY 3HNSH 1C7TA 4PMUA 4J3XA 3K1DA 4KH2A 4QRQA 1GOKA 3VFUB 5F8RC 4PB0H 3QUXB 1GVYA 2W9DL 3GHEL 3NH7L 1F4YL 3CD4A 1KELL 4FN0A 1I8LC 4XNYL 1FP5A 3ZDZE 5CPTA 1CXEA 1MCOL 1AGFB 3NA9L 4L8SB 1TDQA 3CFJB 2ZXAA 5GNYA 2VZTA 1FFPA 1NCTA 2VIRB 3DWTA 3I6GA 3WDIA 4QXTB 4RQQA 4JRXE 1W9DM 3FB5B 3VO0A 3LQMA 4WO4C 4JY6B 4Q0XH 3EOAA 4NC1E 3D87B 1KJ2B 2NY3D 2YKLH 1I1FA 5FIEA 43CAB 4KPHH 5FHAL 1GOMA 3WH9A 4HKZB 4NO0A 3VXUE 3QFJA 4JFPA 2EH7L 3CLEH 1ZTXL 4PY8J 5IBTL 1EK3A 4AY0A 5IHLB 3MKKA 3DMMC 4YDKL 1LNUA 2NT0A 4Z7UB 4JGUA 5AYQA 2WWKO 4JPVH 4MD5B 1EFXD 4LU5H 3GI8H 4LYPA 5JA8B 2F5BL 3B5HA 1WCGA 3HI5H 4K3JL 3EYFA 3UTTA 3RWEB 4EDWL 4LKCA 1GW1A 3KR3L 3PABA 5DJ8A 3WJLA 4CL7A 5I75B 4LQFH 3WJJC 4UI2A 3AC0A 1A6ZA 3BKMH 4JPWL 3LRGA 3PGFH 4OZ4B 3QI9C 4HGKC 4XBEH 1JDCA 5AAMA 3D51A 4N0RA 1E15A 1DSFH 5CWSB 1MHHA 1NBVH 3O3AA 1A7OH 1H3UA 3RVXC 2DOCA 5C3LD 3ZJ6A 1JI2A 5FYJE 3PTKA 1CICD 3S5LG 2YC1A 4FQXA 3BAEL 4Y88A 5KZCB 1R33A 2Y7QB 2YD4A 3I6KA 5C0GA 1E4IA 3ULUC 1FN4A 4KKLD 2XPGB 4I8DA 2FGWL 2XG5A 3O3DB 1UD2A 5ECJE 2AEPH 5HHVL 4RAHA 3OB0H 4HWUA 1JZ4A 4KK9C 1BJ1J 4Y4FC 5L2KB 3BP5B 4NQXA 4ZPVA 4X9IA 3QWRD 4YHIB 4FMKA 1G01A 3H0TB 3X11A 3VXTA 4J3VA 1SBSL 4MLSA 2IQAB 3LEXA 3GXNA 1J7VR 3FHQA 4QOKE 1DUZB 2A1WL 3L4WA 4MNMA 2C3GA 1LWRA 1KOAA 4JQIL 3QEUB 1R8LA 2X42A 4ZENA 4YUEH 3K46A 3FMGL 1CGXA 3VDCA 1U33A 1BEYH 1UM5H 2D0GA 4OZIA 5D7LA 2IPUK 4LSRL 3O0RH 1K6QH 2XJ7A 4KDWA 2VLRD 2ZUXA 4X6BA 5FUZH 2FO4B 4HEME 2YUXA 4CDHA 1S7RB 2P45B 4LLVB 1XGPB 3MXVH 4XZUA 4MX7A 2VZOA 4GQPH 5EOQH 4YBLB 5FECB 4Y4KA 1FAIH 3LQZB 3MNWA 4GXVL 5JMOC 3D5HA 5E70A 2V38A 5DVKA 1HXYA 1ACYL 3MSPA 4BK5A 1MW0A 4TVCA 1RUQL 2NNAA 4IM8A 1BJ1H 5IKCA 4O2EA 4OQ1A 3HFML 4G5ZL 2BRQA 4IHOB 1IC5L 3VXRD 2Y07L 5C2BH 2CNCA 3EOTL 5CJXC 4Y16C 2Z0BA 1T4KB 1T66D 3LMJL 4KI1A 3VWJD 1WPCA 3H54A 4M7LT 4ZQKA 5JLZA 5EOTB 1IM9D 1MELA 5A2IH 4IRZH 1YY9C 4JZJB 1T7WA 4JR9H 1EXPA 5IJKC 1FYHB 5DJDA 4DOHB 2V2XA 4OLZH 1AE6H 3MBEC 4M93C 5GSVA 4PJGE 3FT4B 5J3HD 2M1KA 5JQ6H 2ZJSH 2XWEA 3AZRA 3BP7A 4YC2C 4RQQB 2IBGA 2DAVA 5DFVC 1TPXB 2IGTA 1S7QA 1P6WA 1DQLH 1AH1A 1EVUA 1PYWB 2X7LA 3IXAA 2PCPA 1VFAB 3QFJB 4K71B 2WC3A 1CI5A 5FK9A 2FLBT 1RJZB 2IAMA 4LPCA 4Z0BH 3MSDA 3BXNA 5EC1A 1R3KB 1FNGA 4F2MB 3V79C 3SE3C 2XIIA 3GSQB 3FTGB 2ATKA 1T0OA 2VLJB 4JO1H 3QQ3A 4PV8A 3SBWC 3UTTB 2E40A 3DYPA 1QKZL 4IUGA 2VLRE 3GNRA 3AMLA 4JB9L 4AENA 2P48B 2UYLA 1O7SA 4CMHC 3LKOB 4RGOL 3NSXA 1TQUA 5D6CB 3P77B 3WQWA 1G7QB 2ZUQB 3S4SB 4NRZB 4X9HA 4XP5L 2O5XH 3D18A 3EYQC 4AD2A 2QL1A 3WUFA 4EAMA 3HPJA 3DTXA 4UQEA 1MFBH 3VXNB 1U3HA 3QG6B 4FQXB 1RZJL 3IDGB 1CBGA 4HQQL 3WE6B 5JXAL 4FTVA 3REWA 2HISA 3I6KB 3IF1A 5A8NA 2FX7H 4D6DA 3HAEH 2CHNA 3AIWA 4RRPG 4XGZA 5DMGD 1MLCB 4N9GA 3RBGA 2HJFA 5J6GA 2WWKT 1SY6H 3BRGC 1AGDA 4OCXL 4GQQA 3TV8A 3PWLA 1FIGH 3EYPA 1EJ6A 2DQFA 4G9FB 3BD4A 4JDVB 3B9KD 4YHKL 2VDRH 5DJ6A 2EE9A 3VXRE 1RVFH 3MCKA 3R8QA 2ZPKL 1NCAL 3W11C 5HVGB 3WYRA 2X4NA 3DI3B 4FF5A 3TN0B 3DV6B 5EO9B 3T08A 3VXTB 3GHEH 3QJFA 2ZG2A 2OTWA 3WF4A 2O9TA 1MFNA 3LEXB 1FNAA 3K4DA 1KELH 3C6LA 4WWID 3ARFA 4NQDB 3UTPD 1JNJA 5D4YA 1MCOH 5B3JF 3NA9H 2X4PA 1S5HB 3UEQA 3C60D 2F58L 4EUPA 5LYRA 4C7FA 3ARDD 3NZ8B 4PMNA 3EJJX 2YK1L 4DWSA 5E0FA 4PJHB 2P5WA 1T2JA 2H41A 3QDMB 4HMEA 4B0MM 3DSNA 3NPSB 3C8DA 2FJHB 5ERWA 5IBTH 2V7HB 4HLZG 2JF6A 3OSKA 5DZOA 1EHLL 1BF8A 4BZ1H 2ARWA 3QXTA 3WNPA 3ZTJH 5EO1B 3K4ZA 4Y4KB 3BPNC 2EPNA 5HDBE 3UPRA 1WAAE 4K3JH 5D2NA 3IKKA 1IGTA 3ALPA 4JIEA 4NQSB 3BDYL 4YR6B 1PKQA 3OKEA 4ETQB 5HGBB 3VWKA 3WFEL 5I6XC 4D94A 3MLSL 5IKCB 4WW1A 2XIDA 3SCQA 1WBZB 3NTCL 1JZ2A 3WFCL 3DVGA 1LO5A 3K1KC 2YD5A 4O9HL 4CCCA 2XWJB 4UDUA 5IEKB 4MJ4A 1XCTB 4PRIB 2GJ6E 3L2MA 3KLLA 1WB0A 2DYPA 1ZB5A 4JZNA 4CAGA 3CUJA 1DP0A 5DQ9A 4HZ7A 4XWGL 4KI5C 1OGTA 1L9NA 4ORZC 3VJ6A 2FGWH 4EUPG 1J8HE 4QLKA 4X7CC 3P4LA 3HG1B 4KJQD 3RM4A 3DUSA 1VPOL 4Y1AD 5HHVH 3UTQA 3WDQA 2XNAB 3LX9A 2B4CC 4NSKB 1N6UA 4ODHL 1N64H 1H49A 4NF7A 3OGSA 3B3IA 5E8DH 4H20L 3RWCB 5MI0C 4M7KL 2Y36H 4RWYH 1WISA 4JCLA 5D7IA 4DW2H 1RUPL 4Z76B 4P4RB 5E5MA 1LHZA 3IFNL 5LXGL 2A1WH 2ZUYA 3D2UB 5BXPA 5E00B 1BAFL 1QFWH 4X6DA 5F71A 1BAGA 1W2VA 3MMWA 3UTPE 3FMGH 5E5UB 3ZKSD 4C4KO 3O6LH 4AYGA 2IANB 3DX0A 3EJYC 1LO0L 4PMYA 1M7IA 2G5BB 4QLLA 4LSRH 1BZ9A 2F54B 2PXYD 3U0PA 2D9CA 4ODBD 4PBVC 3N1AA 5BMFL 2HVKB 3GBDA 3QO0A 4XTRC 4BZ2L 3EO9H 4AENB 2UYLB 4PJEF 5HHMB 3O3BA 4A6YA 4S3KA 3GBLA 5DQJB 1NEUA 3HN3A 4E8CA 1G7LA 1MWAA 5I19H 5DFAA 4E41B 1MEXL 2X70B 1CDUA 3U79A 2RBLA 2FB4H 4LRNH 1ITBB 1EUUA 4Z78A 3VIGA 4OIIL 1ACYH 3WEMA 3PV6B 3MRJA 5TJWK 4PGCB 4FK9A 2GJXA 2JFEX 5F44A 2QJDA 5J6GB 2D03L 3HFMH 1M04A 5F7HA 5C08D 4G5ZH 2G8ZA 1KCUH 3GXTA 5GS0L 1ZXQA 5C9KA 2E7BA 1OGSA 1Y7VA 1MCHA 5H35B 4CADA 4XCEB 2J6EL 1IC5H 3RHWF 5DJ6B 2QMKA 4G7YL 2Y07H 3S36L 3LVEA 4OIAA 3QPQC 2VC2L 3MCKB 3BISA 3LMJH 4U7SA 1DCLA 4WI5A 4WENB 1MYRA 1HQ4B 2X05A 3C5ZA 4GRWE 5I1AB 3QISA 1KYOK 4DQOL 2Q3AA 2NXZB 1SBBA 1C1EL 2DM7A 3UP1A 1ZT1A 4Y1AE 4I1NB 1OAXL 3ZLQC 1NBYA 4JFHD 4JHBA 4OLWL 5C0DB 1GJWA 4JFED 4WJ5A 5ICZB 3RJXA 4AZCB 3NUKA 2FNBA 2VN4A 2GVYA 4AY1A 3U9UB 3FN9A 2RFXB 2BOBA 2ILLA 1XGTA 3BKCL 4Q6IC 5KVDL 3ARBA 2VR5A 4AJ0A 5KANI 3GYCA 3RTQB 5FF6A 5DR5L 5EZLA 1OLZA 2ERJB 3M17B 1CDBA 4NO0D 5DURB 4P59L 5LGJB 3SPVB 3AMKA 3Q6FB 4H1LA 2KKQA 5EZIL 1JGEB 4ZAKC 5DZLA 2G3NA 2EIEA 4JFYA 3DRTB 3VX0A 3IETA 4NGHL 4RGND 3QHFL 2BVOB 4LIQE 4JB9H 1A6AA 1C5BL 1DLFH 3GZAA 3VWKB 3O9WA 5C0CB 1MFVA 3WN5C 4R26L 1UWGL 1X5XA 1RULH 4JHZA 1MY7A 3B5TA 4HCRH 1RH9A 2ADFL 2O5ZL 4U3AA 3PZUA 5JR1L 5HHXL 4GBXC 5HI3C 5DO2D 4NNXA 3GO1H 3KPPA 1PFCA 1E3XA 1UCTA 2J88L 1BZ7A 3HC0A 3MNZA 4JZNB 5AWNH 5JORA 3DVNA 5IIEA 5IESH 2G3JA 3NIYA 5IHBA 3BP6A 4OCXH 4CUCA 1ZLSL 1N5AB 25C8L 1LJYA 4WO4B 4XP9H 5C08E 3QCTL 4ERSL 1RZFH 2LVCA 3TPUA 1DN2A 3RPMA 2DMBA 2MHAB 4H2CA 1RFDL 3EMCA 2LTQB 4XMKL 3UBXB 3WL1A 2GFBB 3OR6A 1MIEL 4JFUA 4RNRA 2C3VA 3DMMB 3KLKA 4FQCL 3IGAB 2B39A 2R9HD 1FV1A 4HKXB 4MCYA 7A3HA 2IJ0C 3PZNA 1IEAB 3W6LA 3F5JA 1IAIH 2KQNA 4UQAA 3H9SA 5HSFA 3SGJA 2E5EA 3EKCA 2D7OA 3VG9C 3T0EA 1EGZA 1NWUA 4JFHE 1FVDA 3VXSA 3SURA 1J10A 2YK1H 4Z7OF 3CVIH 1W1TA 3SKJL 2AMGA 5AYBA 3TFKC 4ZFZA 5BS0D 2XRAL 5DVNA 5DSCB 5D7LD 2PBOA 4IRSA 4PN2A 1NGZB 4GKNB 3W9EA 2VZUA 5L0QC 1EHLH 1T0MB 2X5PA 2JE8A 1CS6A 1LP9B 2XKSA 4ZUVB 3ZZ1A 4U6VH 1A6VH 4V1DE 2WZHA 1CXHA 3MUZ1 5EBWB 4Z78B 2DH2A 3QUML 2R0ZL 1YMMD 3AHVA 4WW2A 3WY3A 1OPGL 1K4CB 3WFEH 1WE5A 5DDHA 2OYLA 5TE7L 3SE9L 3VFRA 5DK0B 4FFVD 3WFCH 3U4AA 1XGUA 4FXGA 4O9HH 4K9EC 2CKRA 1Q4NX 5D5ME 1CE1L 5C0AB 4CADB 3EJTA 3WEXA 1GQJA 4PJCE 1I1WA 1FZKB 3O41A 4FABL 5GZND 3MRIB 3CDCA 4XWGH 3OB8A 2OSXA 1GOIA 1YEGL 4LCCA 3MRCA 1QO3A 5IHUH 3ARVA 2GK1B 3KHQA 4KRPD 3MNVA 2L7UA 1VPOH 1BFOB 3QXDB 4Y2DC 3SCTA 1J9CT 2F74A 4NUJB 3EBAA 5F7KC 1NBYB 3MYZA 3TZVC 4J6RH 1X6LA 4H20H 5D96B 3UTSA 4MSWA 4JM2D 2VDNH 4M7KH 2E8YA 3BIBX 43C9A 1II4E 5E2VH 1JAEA 3W28A 1RUPH 4Z18A 4OQTH 2BOBB 3ZT7A 2UUDK 4FMVA 3E6FA 1OM3L 5SWQA 3ARBB 5IW1A 3ETBF 4WWKB 1FJ1B 1KBGH 2ESVB 3SKUD 1ZA6A 3OQ3B 1N26A 4R6UA 5EZLB 2W92A 2V17L 2XGBA 5LKNA 1RSFA 3VGGA 3VFMA 1RZGA 1T5WB 2VERN 2UWEF 1X4ZA 3VI3E 2CIPA 1J05A 2D73A 2XTLA 1ACZA 4UQ3B 2OR7A 4OCMC 4J1UB 4NO3B 1Q9OA 2PNDA 5D7JA 5IVOA 4JEGB 1OGAB 3TYGL 1DQQB 5E4IA 5FUCE 5BS0E 1ISYA 4UZGA 4Y16B 1I1XA 2XTJC 2BSSA 3G5XA 1KTCA 3WUZA 5JZ7C 2B0SL 5I0ZA 4JRWA 2F7OA 1MEXH 3IAGC 4QWWC 3UERA 2H1PL 3GM8A 4JVWA 3DX8A 3TO4C 4OIIH 3MV01 1UWIA 1R5WA 5E7BA 1BHGA 5GRUL 2YD8A 4OUUA 3MBEB 1YMME 4CVXB 1WITA 5AYUL 4PS4L 3UC0L 4PJFA 2XIBA 4P57A 2CDGB 3MMEB 2BVYA 4IOIB 2QEJA 4F9DA 4PRPE 1QW8A 3STBA 4DKDC 4G6MH 5GS0H 4L3EE 1G0XA 1H9VA 1VGKA 3BZDA 2XWDA 2J6EH 3T09A 1HXKA 1UA7A 4LDOB 4XNXL 3MYJB 2R8SH 2VC2H 3U0TB 4NRYB 4P3DB 4WDIA 3DC0A 4RNRB 2C3VB 1MPAL 4Z2KA 3ZDYE 2AJYL 3ES6B 2XA8L 4MA1B 4DKEL 4UIMB 4PTVA 4HK3N 4WTZA 1JPTL 5EUKA 4J4PC 5J4MA 1FV1B 2GAZA 5CZXD 3V6ZA 2CUHA 1C1EH 1EDGA 1HDMB 1S9WB 3NSNA 3BP4B 1UG6A 2PWDA 4YNYB 4KKNA 3BW9A 5ANME 1NKRA 3STZA 4JFFE 4M7ZC 5BW7C 1UG9A 4OCRL 5CLTA 3C6LD 3FKUS 5DMKA 3R0MA 3ARFD 5E99L 4CMHB 1K8IA 4E0RB 1ZKAA 4QY8A 4AEIH 1NEZA 5M95B 1RK1B 1V6UA 2DPEA 1G7PB 4NO2A 1UYQA 4R2GC 4UQDA 3THMH 1IGYA 5KVDH 4D6FA 1QYGL 4LFHG 1AQDA 5BO1L 4XBGB 4IDLA 4NKQB 1HH9B 4V27A 2BHZA 3ZL4L 1F8TL 5DR5H 1E72M 1RPQA 2AJXH 1CVRA 4YO0A 4K68A 3FAWA 4D3CL 4S2SB 4I2XE 1D5BA 5SWZE 3T2OA 5E08H 5EZIH 4YZFF 1F90L 4ORGB 4BQ9A 1U8HB 2EDNA 1BBJB 2ARJB 4ZDHA 4NGHH 5C8JA 3QHFH 2H26A 3LPWA 3ISWA 4KHTL 3P4NB 1H15A 3LRLA 3BJ91 2E27H 2IH1A 2FZ3A 4HWBA 4Y5XC 1UWGH 1QOXA 5IVXE 5D7KE 1FVEB 3V7MA 4XXDB 3U1SH 4JFOA 3RAJL 2BC4A 5HHXH 4TUFA 3GMRB 2P8PA 4E9LA 1ZHNA 4QP0A 5CUSL 4KTEH 2Z35B 5DHVB 1QHOA 1R24B 5E2UL 4OZIF 5C0EA 3FB7A 4XP4L 3RIKA 4JZOA 4XCCH 1W0VB 3BIKA 1U95A 3A3HA 3S36X 1HT6A 3MRCB 4XNUL 3UO1H 3N85L 2B2XL 1I1AA 3JWNC 3AHZA 4P8VA 5I76B 25C8H 3GMNA 2CIKA 1BTCA 1W72B 1NSNL 1KPVA 1MCBA 2YD1A 5EC2A 4LSPL 4XMKH 2O5YL 1I9EA 4JJ5A 3SCMC 3LKPB 2J8UE 1WAWA 1XAUA 2NY2D 1MIEH 3KWXA 3EYUL 3CFKA 4GG8A 3QT2A 2HN7A 2X2IA 4YHNA 1R87A 1RHHA 3CSGA 2W1NA 4P48A 4HC1A 3VDAA 3GHBH 5SWQB 5F6IC 5ALBH 5BXSA 4TTUA 1WZLA 1D2KA 2A77L 4QRPD 4U31A 1ZA6B 2A73B 5HI4D 3R8BB 1XT5A 1P84K 2BOCA 1XCQB 1CTOA 1NAMB 5I6XB 1A1MB 2YZ1A 1WBYB 2V2TA 2X89D 5MP6L 5FOBA 4RZCA 5H94B 3SKJH 4HPOH 5FV2A 2NZ9D 1X5IA 4DTGH 5CQ1A 2DTSA 5D7JB 1EGJL 1ZMYA 3FFCB 4UUJA 4P2QE 1MJ8H 5CD5D 1EHXA 5EU6B 1XH1A 3I02A 1FSKC 4EOWL 3WQ4A 1DBKL 3VM7A 6CGTA 4PUBH 2WC7A 1E4XI 1UM6L 3EFDL 1F6FB 5ISZD 1CD0A 2DDQH 4KY1L 3NCCB 1JGVL 3HZMB 1F13A 1E0XA 4NC1C 3SE8H 5E2WL 2G60H 3A6BH 2DLHA 4NQCD 3MACH 4KK8D 1OPGH 4OUUB 3KNBB 3MRNA 1QX1A 4NKIL 4EDXB 2ED8A 1O6IA 1YEHH 4U7KA 5JMRA 5BV7L 3CFCL 3IFOA 4H8UA 1OHQA 3SE9H 2AJ3A 4MAYA 3KYMB 3DO7B 1I8MA 1J88A 1UJ3A 5DUBA 5L8LB 3LMYA 2HFTA 1MFUA 4B41A 1CE1H 1YEDB 3SUTA 1LL4A 4KAQL 1DQJB 1IC7H 1YA5A 2YUWA 1KB9K 3GNMH 5HDQH 5MEOB 5HYJE 1IC1A 1ADQL 3MPCA 3V95A 3O11B 1SR0A 4CD7A 3WLWC 1T1XB 4HJ0D 1E4KC 3KPRA 3ZJ7A 1C5DA 5FKPB 3SGDH 3V6ZB 1XEDA 2G3IA 2J7DA 4UTAL 2PW2B 5HPCA 3C5ZD 1L0YA 4AZHA 3JWOL 5J56B 4M1CD 4GUPA 3DDFA 3BUQA 1PX8A 4KXZH 5K9QG 4Y89A 4M1DL 4OZGE 3I3EA 3AISA 1KC5L 4RMRA 1MXGA 4PY8I 2EDWA 3WDRA 2IALA 5FGRA 1KTLB 1I3VA 2FWOA 5CZVH 2CESA 1PS3A 2OJZH 3MV8D 1G6RA 1JNEA 3QBTB 2DQXA 4PP1D 1EHNA 2V17H 2BNQB 2BRRH 1CVSC 2VRAA 3NIGF 2DM2A 4CRPA 2QHLA 4L4OA 1YHTA 1U8LB 2XN9A 5FO8B 3GSOB 2FLRT 2DN7A 5C7XL 5D1QD 1TQCC 4ZDHB 4JPKL 1N3NB 3HG4A 3TBYA 1F11B 3TYGH 3WKML 2NX5D 1MCEA 2VL5A 4YBQD 1HYSD 3Q1SL 2PYEE 5JXEC 1V3LA 1GZQB 5EBGA 2JIXD 3O9WD 4RFEA 3U6RB 2B0SH 3QRFM 5TE6H 1HKJA 3T04D 2H1PH 3BZEB 4DKFH 3AHXA 2X0YA 2P8PB 1LEIB 1I1YA 4UV7H 5GRUH 1CGUA 4LARH 3OAYK 4YHYC 5AC4A 5T1KD 4NQCE 4MPKA 3UC0H 3PHSA 5C3TA 4P2YA 5HYFA 3W4RA 2BJML 1IKFH 1I1AB 5HYQA 5JIHA 3CXHJ 3VH8G 2E9JA 4Q22A 12E8L 3WFBL 5FO9A 4UQBA 4Q6IB 1B3YA 5EC2B 3OXRB 1DQDL 8FABA 4X0KB 5GRJL 4XNXH 4QDMA 1C12A 3MA7A 4H04A 3W26A 3N1GC 4KRUA 1RZIA 1HOCA 3O4LA 3DROB 1A22B 1Q9LA 1MPAH 2KUTA 3CH1A 4H8WL 3SKMA 1B3ZA 2D7TH 3BRDA 4PCSA 1JPTH 5DK3A 2MCPL 2WZIA 2AV1A 3LEYH 1A4JB 4ZAKB 1BYBA 4PRAB 4IBLT 1NJ9B 1LE5B 5HTSA 4ZSOA 1SMDA 3UJJL 5EU7C 2EDYA 5FOJA 3U4EB 3IJYA 4HIJB 5E99H 2F7PA 1OAYL 3KWWA 3H9SD 1HWWA 1CXLA 1AD0B 3WN5B 2Z31D 2NY1D 3IU4H 2VDOL 1JFHA 3LRMA 4XPGH 1SJEB 1QSFA 4ZEPA 5ITBL 2XSAA 1JD9A 1TVHB 4PJXB 5BO1H 4GBXB 1HXJA 3ZL4H 4Z7NF 3QEQA 1DBBH 35C8L 4U49A 3MC0A 4OFIA 2WHLA 3H3BC 3MV8E 4MQXD 1IFHH 3QNXB 2FGZA 4JGMA 3MLUL 4DO6A 5AY7A 4TVPH 1CLYH 1F90H 2O61A 3BZFA 5ESVA 1U8MA 3H9ZA 1XH0A 1W2PA 2P4AB 3BGMA 5D7IF 2PBGA 1E71M 3MRNB 3L3OA 2BNRA 2WBJA 3GNPA 2YLLA 1OWWA 3WQVA 4PLNC 4PD4J 4DVBB 2YZ8A 3O6ML 1KENL 3VSVA 5LAXB 5I1CL 4OCYL 3W2DH 3BEWB 3QIUC 3BN9D 3OGRA 4Y4HD 4MS8C 2YN5A 5DJZB 4Z2JA 2W0FB 3QDJB 3T0XA 3QYCA 4XBPB 1CT8B 1ED3A 4XP4H 1EDTA 3VG9B 3T4YB 4KTDL 2Q7NA 3QNYB 1AQMA 4JFXB 3N85H 1EPFA 3FO0L 3V6BR 1LK2A 3D85A 2IMNA 4YAQA 2FYYB 5HVFB 1NSNH 2EDFA 1HNGA 2V5CA 3PJSA 2DD8L 3T77B 4ZFOB 3W9DA 3WCYA 3TF7C 1QBBA 3BKJL 3EYUH 2F2HA 5ENWA 4LHUA 4G6JH 5IOPA 1UD5A 1N4XH 2ZNXA 3W39A 1RUKL 3UTSD 1TE1A 2QHRL 5GGSA 3LHPL 4M02A 4MXQD 2FX9H 1D9KD 2A77H 5D1XD 3OBAA 2VLKD 3FJTA 5GS1C 4HUXB 1U2HA 4H25A 4E42A 5BXFA 3L6FB 3QULB 1XRVA 1QPPA 3WELA 4N9OB 3D9AL 1JZ6A 5MP6H 5T5NF 3FB8A 1BX2A 3UYOD 4JAMB 5F88A 2HLFC 3ZYOA 5E9DE 4JPIA 4JRYD 3QUZA 3TA3C 15C8L 4PMQA 2Y5TB 4TVPE 3A6OA 3RZCD 5CILL 5AG9A 3SE4C 2YA2A 3FONA 2GSIB 3P4MA 4PJ5A 3ZKXC 1F42A 4WCYH 4OBSA 5CZKA 1F4XL 4KY1H 2CRZA 1CR9L 4Y2DB 4G8GA 2X10A 5E2WH 3HNTH 4LFHD 1IT0A 2JIWA 2VCBA 4P23D 1OLLA 3TZVB 4NKIH 3WIHA 2LU7A 3HKFA 3JVGA 3U57A 3CFCH 1VGEL 4PJ8C 1QUNA 1BOYA 1SYSB 2JCCB 1E27A 3T1FB 1QQDB 3RIFF 1WC7B 4GS7C 2BY1A 3JWDL 4X80H 4H7VA 3AI0A 3EYVB 3SUSA 5A8OA 1HOCB 1ADQH 1D7FA 4O51A 3CH1B 5EPMA 3WMCA 5J57B 5A8PA 4HBCH 4OLEA 4NQEA 4WEUD 1XF3A 2AV1B 4EN3A 2IFFL 2CRYA 5DK2A 3NIFF 1PG7L 5EUOA 1FLRH 4W4OA 4UTAH 3LPOA 1TNMA 5IMLB 4G8EA 3BWUC 4ZSOB 1NCDL 4M6MH 1QSED 2XTJB 3FO1A 4H26A 1KTRL 1WK0A 3VCLB 3RWIA 2AXHA 1N6QH 1IAMA 4PGEA 4GG6A 1KC5H 4MNHB 2Z1KA 4YE4L 2AQ1A 5DI8A 2ZUMA 3DX2A 3N9GL 1QD0A 3CBWA 3LN5A 3DV4A 2HTKD 2VAAA 3P0YH 5EA0H 4OAWA 5DLMH 1LEGB 5EBLA 2VLKE 1BVNP 2ZCLH 1QFWI 4Y19E 3GGWB 2VZ3A 4YXLL 1GUVA 1HJUA 1A2YA 4HLJA 4AIZB 1CLVA 1KIPB 4B15A 2JB5H 3F12A 1LWJA 2C1PB 3MRHA 3GRWL 3PXJA 5C7XH 1KGUA 1B0GA 2P44B 1ODUA 5A43C 1C8YA 1H0IA 2F61A 4L3AA 3WF2A 1YN7A 5EOCL 1YECL 2IBZY 3Q1SH 1QLRB 5F9DC 4ZO6A 1M6OA 4K55A 5BZWB 1CGTA 1H8SA 3KPSE 2ZOLB 5BXTA 1MAML 4MADA 3SJVB 1GCFA 1AO7D 5CSBA 2BHUA 2V2WA 1FG2B 1T0NA 4QCEA 2RHEA 3L3DA 3KJ6H 1ED3B 4IDJH 4M7ZB 5ESQA 5HI5D 3VFSA 4P7OA 3S4SG 1NC2B 2DBLL 6FABL 5B38A 1AGCA 4PJBB 3A4WA 1S7UA 4QRUA 1T7XA 4YAQB 1HIZA 3GJFK 12E8H 3WFBH 3CZNA 4NOFA 5BZDB 5SWSB 2DWEA 2P8MB 5GRJH 5I1EL 3QDAA 4OLXL 2RJMA 4ZOEA 5FYKU 1I1RA 3DX3A 2XN2A 4LIQL 1W8NA 4QTIL 4UOZA 4HFWB 4P46A 5IROC 1EO8L 5IOPB 4HIHB 3UX9B 1XIWD 1DVFD 2C5DC 4WW2F 4RX4D 2JF7A 2P1YA 2XFFA 3UJJH 2P42B 3VINA 3QCUH 4E42B 2OR9H 2F7RA 4IRJA 3RWJA 4QXGL 1OAYH 4M81A 2XACC 1P9MC 2GUOA 3MRFB 1BECA 4NZTH 4Y5XB 3VRJA 5BRZA 2VDOH 1N59B 5JBEA 4JN2A 1QSEE 5CINL 4DEPC 5TPWL 3NCYS 3BQUA 5IW6A 1A3HA 5CMAA 3B5GA 4I3SL 4WUKL 3SDCC 4YXHH 5BJTB 5ITBH 2ZUWA 5JQHC 4I0PC 2WLZA 1S5IL 1QI4A 5C07A 3VFWA 5GSRB 3P4MB 3NCJH 1CFTA 4DVRH 1FA2A 1GOFA 3MLUH 1MRDL 1YN6B 2GT9B 3DIFB 2BNUA 3TP4A 1GPOL 3JV4A 1UHVA 2ICWJ 1AY1L 1HKKA 4JQXC 3TTQA 1D5IH 3SCMB 1ZBVA 1UXWA 5F7UA 1U91A 3RWGB 5J9PA 4UTFA 3IU3A 3F65A 4LOUD 1HJQA 1CLOH 4JG1L 4OI8A 1E6ZA 1HJWA 3SKNA 4K7FA 5TGBA 4BFEA 5B39A 1KENH 4TNWK 2AXFB 4G8IB 4OCYH 1EUTA 4GAFB 1G7MB 2OW6A 4MAYD 5T1LB 3LN9A 3B9VA 1Q72H 2DL9A 3D69A 2WWCA 3GXFA 2E0PA 1YEFH 5K9JL 4S10A 5TDOB 1DANT 3P73A 1U3ZA 4MNGA 3V6FB 1XF3B 1V7NL 3U48A 1V0LA 5E2TL 3PL6D 4YDIL 4EBQH 3T0DA 3TEUA 3ZHKA 1FL5B 1OP5K 2AI0L 1H3GA 4X9GA 2R29H 3V4UL 2G2RB 2KH2B 3WXVH 5MENA 4LF3A 1CL7I 2AK4A 4QHUB 3MLXL 3EJSA 3MRMA 5HHOD 5JPNB 2R2BB 3PIQB 4PGEB 5IB2A 1HCVA 4BQ3A 1EEZA 1NBZA 1PPIA 4IOFC 4CN1A 4PJFF 4S1SL 3DV4B 1T20A 2BK8A 5HGHB 2I07B 5C2UB 3RCNA 1IAII 1Q9KA 4WFED 2JJTA 3D9AH 5JBFA 4DCQA 2OTPA 1MOEA 3D52A 3VIIA 2A83B 4QTHB 3QCVL 3OIHA 3BI9X 1F3RB 4JFDB 3RIAK 1B0GB 5F7MC 5HHNA 1LQ0A 5HGAB 3DGGA 5AZEH 3G5YA 4FQLL 3AIBA 1U41A 3TCXA 1B2WL 1SEBA 1WZ1L 2ZKHL 3V9FA 1QLFA 4OV5A 4P5MA 4K3HA 2VQ1A 1RZKL 3ZT6A 3TIEA 4BQCA 3QUXD 5L2JB 1C16B 1T80A 1TIUA 2VRJA 5HYSA 2C4FT 1CR9H 5L7XL 4X0NA 3WD3A 2V2WB 5GGRA 2Q1EA 1MI5A 3EJZC 3B8SA 4P5KA 4WU7A 3HU7A 4OLYH 4F79A 4J3SA 2WNWA 5IJVA 4N5UA 5GGUA 3WKZA 3CO4A 2W07A 1CD1B 4AD5A 1JRHL 3MREB 3AY4C 4NFCA 5D71L 1XGQA 4WTWA 3KZSA 1TQBC 3ARWA 4Z8FH 3JWDH 5IQ9A 4XP1H 3QIWA 1NWTA 3UDWC 1Q0XL 5FYKH 3KAAA 1A9EA 2AW2A 4KRNA 3QP3A 3QRGL 4HHAA 1AC0A 1R3HA 1S9YA 5A2LH 1PG7H 1MRFL 1OW0C 1FYTB 1H3PH 4NHUA 4R3SA 5T1MA 5TF0A 1B31A 1NCDH 1XHGA 4P2OA 3RUGA 4LPXA 4G6FB 6TAAA 2DQTH 2QKIB 2QQNL 4OF0A 5IFHL 1C08A 1B0RB 1TJIL 1I8LA 3AM8A 4LLYB 3LSOA 1DHKA 5H37G 5IW6B 3CU7A 4QRSB 5DTFA 4QF1B 1QSFD 3K8KA 4EI5C 5C07B 3STLA 3V5HB 4YHYB 4HW6A 1LD9B 5ID1A 4LCWA 5E8OA 2BNUB 1F4AA 4JO3H 3CZKA 4ZXOA 3GRWH 1YEIH 1R85A 1G9NH 5CJOH 5E95B 2G4FA 1KPRB 1PY9A 5F93C 2IUZA 1YECH 1P7KB 1HSAB 4OFPA 1K5NA 3FO9A 5LGHL 2DSZA 1Z9LA 2CO6B 5D8ZA 2BNRD 3CZFA 5LCVL 5I8OL 2WBJD 4IIQC 4BSVA 1V05A 5I8EB 4HS3A 1BIIA 1MJ7L 3HAEA 1NGYA 5HYIA 4PREB 5D2LB 4KRMB 3CZLA 3QI9A 2BSTB 5ABFB 1U8JA 4FLOA 2DBLH 4PJDA 4RFOH 6FABH 3L4XA 2BFGA 2ZCKL 4HUKB 5GPRA 3VXMB 3WFDL 1LG2A 4L4TB 5T33H 5MERB 5D72H 4GKOA 1DUYA 2X2HA 1TJGL 1P7HL 1FH7A 5A1AA 2VKWA 1MCDA 4X83A 4ZMAT 5C6TL 1U58B 4WFFD 2DLTA 4QTIH 3MODL 1V3MA 4E8DA 1EO8H 4NN7C 1INDL 4P2RE 3R06B 4LCUA 1JWUA 5DRNA 2Q6WB 4F57L 2UV3A 5GS2H 1EEZB 4LHUD 3G6JA 4Z7UE 3WIJA 3JTSA 4Y4FA 3VPLA 4P4KA 4NPYA 3UBXG 3ZO0A 3W38A 4ISVA 4QT5B 4QXGH 1UWTA 2E7LC 4LP4A 1S78D 4KKBD 3SN6N 3T2NL 4KGLA 3BX7C 1AFVH 5TPWH 3R1GL 1FO0L 2I26N 1CE6A 1KT2A 2FIKB 3G5YB 1V3KA 2QHAA 4H0GA 5D8JL 1KIRB 1SEBB 4GO8A 3TBTA 4JANA 4UR9A 4D0CA 4Y5YA 3W24A 3AHYA 1OAQL 2X40A 2GDVA 4WGVB 2BHYA 2P5EA 3KLHC 1BD2A 1FNEA 4PJ5D 4N1EA 5DJXA 1XZ0B 4F9JA 2PC8A 3T8XA 3BFOA 5HHQB 4PYSA 1PX3A 1KTKE 1OSZB 4JJHA 4FMFA 3DNKA 1SYVA 5DRXB 4MNKA 4BQ4A 3MJ9L 4F66A 5ICYA 5BRQA 2WWMC 3ULVF 1YPZA 4JG1H 5L2KE 2FEDC 1P4IL 1WLHA 3HI6H 5IJVB 1U8NA 1T04B 4XT1C 1KTBA 1VFBA 1B6UA 4NKDB 4DM2A 4X98A 3PP3K 1LO3H 4W70A 3CUFA 3LQAL 5GS1B 1I7ZA 1JPFB 1A1NA 3TC9A 1KIQB 4ELMA 1ZAGA 3EO0B 2WZPD 4OGYH 1V7NH 4N8PA 1BLIA 1OY3B 1JYVA 2JB6A 1LG1A 5IEHB 5E2TH 4OF3A 3LKRA 2J7HA 2J75A 1AGBA 3TA3B 3L4VA 3MJ7A 5M5DA 3GSRA 4JREC 5CJQL 3OHXA 2BFVL 3NA4A 3RY6A 3BLPX 1RQ5A 1FFNA 3VFTA 4HK0B 2JTDA 3CSBA 1IM3B 3MLXH 1UQZA 2JJSC 3ZKXB 1ZT4A 3F6IA 2XWBA 1WFNA 4JFVA 5GGQH 3MOBL 3ILQD 5I15L 1I3GL 5IJKA 4U1KA 2F53B 2JJUA 4Q9BA 4S1SH 4H0HB 5IVZA 3STLB 1RMFL 3L4TA 1BG4A 5IB1B 4WUUB 5EB9A 1X5GA 1GHRA 3II1A 1AXSA 1EAJA 2VITA 1B0WA 2YKKA 4LMQE 2C7FA 4M5YH 4PTUB 4N8CL 4I0KA 4ZO7A 1A7NL 2GTWA 2ITDA 5ADOL 1X44A 1UCBH 1LEKB 4YEEA 4FQLH 4GS7B 3WMSA 3D39B 1CFQB 1FZMA 2MFNA 2ZKHH 1B4JH 1K5NB 2D3NA 3CZGA 5FYLE 4HXAL 3TN0D 4GW1A 3T0WA 2X1WL 4JFZL 1MCCA 4YFEA 4PLKC 2JKXA 4PGBB 1BIIB 3HAEB 2KQMA 5L7XH 4NQDD 2GJ6B 4AMKL 4X6EA 1DL7H 1ZGLP 4XP6H 5GRWA 3LV3A 3T3MF 3RU8H 1A6UL 4DOHE 1U92B 1CD9B 3V5DA 2CD0A 3DPBA 5IB5A 4TPRL 2DJUA 5D7SL 3V6OC 2EIDA 4UOW0 4MVBC 3HPLA 1DUYB 1JRHH 3LXCA 2ADGB 4H8VA 3MTRA 4M7JL 1KCVL 1TENA 3QFJE 4TSAL 1KQYA 4LLDB 4FLQA 2YS4A 4NFDA 1ZGLB 3BT2L 3QRGH 5DT7A 2HJLB 1J1PL 4LVOC 1KSRA 1UB6B 4XB7A 3VM5A 3FRUB 3G6JB 4LHJB 5EZJA 1MRFH 3JTSB 3K0WA 1OD7A 4P4KB 2VLJE 1FLTX 3SGDI 4CBPA 4ONOA 4M8QA 1JF1A 4ONGH 3UTTE 1FZOA 2J3SA 4E5XB 3EDFA 3SDDB 4DK6A 5MEPA 2EKSB 1MNUH 2QQNH 1ORQB 4HIIA 2D31B 4KXZI 2XWTB 1GXEA 1KLUA 3RVVD 5CBEB 4XCYA 4XMPH 4H41A 2R56L 4X6FA 3QO1A 4OKDA 1P2CA 2ZSVA 5JHDB 1HXMA 4U1JB 2AXGA 4NWUL 1IGCL 1QG3A 3L9RB 3UTZB 1DDHB 2HTLD 1UD6A 4LYRA 3HG1D 4NRRA 1E6RA 4Q6YA 2P8LA 1C8XA 2IBZX 4MA3B 4G9FE 4KUZH 2VDQL 4YZFE 5LGHH 1Q1JL 4KC3B 1E6NA 2NMSA 3CMGA 1LVEA 4M62L 4X6CA 4XCNA 5LCVH 3OKMB 2G9HA 2XYCA 1UWQA 4ZNEE 3BUTA 1VFBB 5B8CA 5CEXA 3S6TA 4X98B 1NAKH 2QQQA 4M43L 1CBVL 2NY0C 3EO1A 2AQ2A 4L8DB 2X44D 2R69L 3OZ9H 4NQDE 1BGGA 2ORBL 3QOKA 4OCNC 5I23A 3VD5A 1UENA 3WFDH 3MUGA 4DEPB 4JFTA 1UD3A 4R4NC 3CX5J 1P7QB 2F54D 4M7LL 4XPBH 5DS8B 4ODXB 2GSGA 3SDCB 4ZFGH 1FH8A 4PUDA 1XCXA 4NC0B 5C6TH 4PJHE 2XXCB 2XKNB 5DJ0A 1ITCA 3QDME 4JL2A 3MV7D 1X4YA 3MODH 1BG9A 1NP2A 4JFQB 5DJYB 1INDH 2CDEB 3LN4A 3BN3B 4JVPA 2B1AH 2VXUL 2ZG1A 4F57H 1NOWA 4WVRA 3D3VA 3LRSB 4E41D 5E9AA 3L5IA 2AK4D 4XAWL 4F8TA 3SUVA 1KACB 4YQXL 2R1WB 1EEUA 3U7YL 1S7SB 3P30L 4M3KB 4KVCL 3SGEH 1NLBL 3S9DB 4GRLA 3IDYB 2VITB 4Q9CA 4AM0A 2FHFA 5A40E 2WMPA 1LDSA 3UXFA 1NFKA 3HNVL 4GAGH 3F5LA 1KN2H 1W9VA 1S8DA 3L7FB 4PRNB 2HWZH 5D8JH 3BPLC 2VLLB 3L5HA 4PRIE 5IG7A 4YDLC 3ME0A 4X5XA 4J3WA 3BGFC 4W89A 5EUOF 4GW1B 1OOAA 1H4PA 1HH6A 4HG4J 4YHLL 1OAZH 2IMMA 2EAEA 1EVTC 2NXZD 3M45A 4X4ZA 3IJ9A 1IL1A 3HZYA 3HG1E 3FQTB 4CCDA 4P5TD 3BH8A 5F3HB 1H5BC 5I8CB 2H45A 1X6NA 5JPMB 1QEWB 4GG6F 1HHIA 2R2HB 4FFYL 2D1ZA 2RCSH 3RM8A 4DFIA 4D9RE 1P4IH 2WIIA 2ICEB 1MCSA 3GBNL 1E4WH 1Q8MA 4CU6A 3QB7C 1MQKH 3HPLB 4IMKA 3X12A 2EPLX 4CD4A 3PWUA 2VDKH 5E8PA 1WO2A 4EUPH 3LQAH 4WI2A 1JWSB 3RTQD 4CMMB 2CGRH 4U6HA 1VCAA 1T5XB 3PDDA 1BQHG 2VDMH 5FGCB 4HKJA 2OLDA 3QIWD 4C56B 1LF1A 2IANE 3PV7A 5F9OL 1ORSA 4URIA 1I8IA 5DRZB 4NKMB 2F54E 3GIVB 2GY7B 1U3YA 4FNQA 2BFVH 4MXWL 1NOUA 5C0CD 3DSFH 4F80A 4PV9A 5HHME 3MU7A 2VWEE 1H3WM 3RPKA 2MANA 3MOBH 2GK0A 2VE6B 1S9KC 1TJHL 4C83B 5KG9B 4E41E 4MDJA 5ILTL 4DGYH 1RMFH 2E9LA 4APQC 2CBVA 1HIML 5DD3L 2CDFA 2XVNA 2I5YH 5L8KB 3QUYB 2H6PA 4KDTA 1OBAA 2OYKA 3EOYG 4AD0A 2OI9C 1AKJA 1LE9A 1A7NH 4WO4D 4V1DB 2C26A 2DQHL 1GHSA 3PZIA 1MXDA 5IMMA 1MIML 1TQBB 3H53A 3VVGA 1EOMA 1T6WA 1LO4H 1BFVL 4HJGA 3RI5F 2AEQH 3DMMD 4HXAH 2XFXA 5IQ7L 3CFIC 1JGLL 3FCTA 3FRPA 4JFZH 3L7EA 4TVUA 5B8CB 2HMID 1HKMA 2EIZB 1YZZA 2R1XB 5BVPL 2ADIA 2A38A 3ZHLA 1HTYA 4HGWA 1PSKL 4L29A 5KSAB 1A6UH 1VA9A 4AD4A 5DD0L 4Y8AA 3O6FC 4TPRH 3AXHA 3AUVA 1S7TA 3QI9D 3NCBB 3MBXL 4ODTL 4ML4A 3VE0A 1CU4L 4RAUB 3O8XC 3MLVL 4X7TA 4I9WD 3RVXD 2ZICA 1NFDA 3OX8A 1NQ6A 4L8CA 1IEBA 3ARGB 1KCVH 3PZMA 4EI5B 3BH9B 5JW3L 3FHAA 1MHPL 3HR5A 3LY6A 4TSAH 5FM5O 5FM5M 4ZFFA 4W88A 3ULUD 3BT2H 1QRNB 2E6PA 2FDBP 3O4OC 1KEGL 2A6DA 1CFSA 5HPOA 3BSHA 2OM5A 4N0UB 1IGIL 1F58L 1IGJA 3SGKC 3HB3D 4MJIB 4OI7A 1FP8A 2X1IA 4A6YH 2EC9T 3JUZA 4KK9D 4Y4FD 5GIRB 3SDAB 5I1DB 1MWAH 3QJHB 3D0VB 4AD3A 3IDMB 5C0CE 4EI6A 4PJ9A 4JDZA 4PRHA 5GRVK 1IGML 3IDUA 2HVJB 4IIQB 4R96B 5DC0A 2YUVA 5C0AD 3GH5A 4ODSH 4NJAL 3RA7L 2WMHA 3O3EA 3GUTB 3BUDA 5DUML 2R56H 1UH4A 3ILPA 4F7PB 2Y9RT 1XGYH 5HVWA 2RAMA 1IGCH 3DETC 1YUHB 2DQCH 1A0QL 1HH6B 3N0PB 1F6LL 1CEOA 3C9NA 3EOBA 1UACL 4YHPB 5E6IA 4E4PA 4DWHA 4OZHB 3RWDA 2ZOXA 3GZKA 1JWMA 4KUCD 1UKSA 1XSIA 2CHOA 3CCHB 3CLFL 4M62H 4N90E 3DO3A 2EZ0C 2V5MA 2X4UA 1RD6A 4NN7B 4LK4A 4EEEA 3ULSB 5IP4A 4MA7H 3LKNB 4ZUWB 4UV4H 3ET9F 2DQDL 5CJBA 3O9NA 2EKJA 3B4NA 1HKIA 2VTFA 3QFDA 1CBVH 4S11A 4NN5C 5ELIA 5D8WA 1FORL 3ARZA 3PQYB 4TVSa 2VZSA 3SO5A 2ORBH 4KJPD 3PG2A 2C3HA 1DWIM 3WL0A 3OKDB 4JHAH 1IBGL 3ECBA 2C9AA 2XZAL 4M7LH 4RA0C 5T3ZD 1K9FA 2A6IA 2VXSH 4ZXBB 1Z9OA 1TVBB 4I9WE 1I3RB 5ANMB 3ROOA 3QA3B 1JHTA 4TQEL 5DC9B 1YYLL 4JFFB 3VXOA 1QSVA 1KG0A 4Y16D 5EIIB 1ONQB 4O5LL 5GGVL 3RVWD 4H1LH 3CXDL 2VDPH 3SDYL 4LLUA 2EDOA 4M6AA 5HGDB 3ULUE 4ZS6C 5CGYC 4XH2A 4PTTA 2DSKA 1NMAH 1YY9D 1CGSL 5JW5B 3BHBB 3WHXA 3GSNL 1XH3A 1XF1A 5KANG 4XVTH 3MUY1 2NQCA 3IT8D 1FZJA 3U7YH 1RHFA 3P30H 3MBED 4KVCH 4R0LC 1NLBH 3VSTA 3WS3A 4KJYA 3X3GL 1ZLVK 5KVEL 5TDNA 1X5HA 2H6PB 3PNWB 1BVKB 3CUPA 3TCLB 5DFVD 5JDSB 1KEML 5SWZB 2QMJA 5C0FA 4D9QD 3LH2H 3U46A 1B88A 2OSWA 1T1YA 1ZSDA 5C0AE 4I18C 2VN7A 1MJJB