1EP0A

High resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
183
structure length
183
Chain Sequence
EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-6-DEOXY-D-XYLO-4-HEXULOSE 3,5-EPIMERASE
publication title Crystal structure of dTDP-4-keto-6-deoxy-D-hexulose 3,5-epimerase from Methanobacterium thermoautotrophicum complexed with dTDP.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Isomerase
total genus 44
structure length 183
sequence length 183
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2000-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ep0A00
1GQGA 1CAVA 1QXJA 3FX3A 3SCHA 5FPXA 4IEVA 3OD0A 1YHFA 5I8SA 3DN7A 3I59A 5CU1A 1QXRA 2PAEA 1VR3A 3ELNA 3LA3A 4HN0A 1CX4A 2WFPA 1O5LA 4Q29A 1J3RA 3S7EA 4CYDA 4PJYA 3CEWA 3KGLA 4Z07A 5LEKA 4PIZA 4XFAA 4Q0SA 3EO6A 4Q0QA 3NVCA 1X8EA 5JCTA 4JTOA 4KL1A 1XE7A 1YFUA 1DGWA 2ETEA 1J3QA 4ONUA 1ZRDA 3PNAA 1NYWA 2C0ZA 1H1IA 3FJSA 4N9HA 2IXIA 2IXLA 1LB2A 4WZCA 4FBFA 3VHRA 2N7GA 4O9GA 4FAHA 1QY4A 1IPKA 2FMYA 2ET1A 1UIKA 4MGKE 4I01A 3CO2A 4LUKA 3IDCB 1Y9QA 5I8TA 4F8AA 2PHLA 1J59A 1ZZ9A 1FXZA 2OA2A 4E2GA 4L2NA 2PAKA 3M70A 5JSPA 2P17A 2MHFA 3HQXA 2PAMA 1UD1A 1WGPA 5I0UA 5KHKA 1O4TA 2Y0OA 3D0SA 3RYRA 2GC3A 4I0AA 4AXOA 1ZREA 3UKTA 4LEJA 4Q0UA 3H3UA 3EQEA 4X6QB 1X8MA 1NZCA 1OMIA 1VP6A 2ZKLA 5J3UA 3MZHA 3OGJA 2GC2A 3TNPB 2XL9A 1ZRFA 5E16A 1RL3A 4MGYE 4BHPA 2EA7A 4MZUA 3ES4A 1X82A 3WW3A 2FQPA 5FLIA 3CF6E 1Q43A 1ZX5A 4AQ6A 3WW1A 4IESA 3BU7A 3G7DA 1I5ZA 3IDBB 2QJVA 4I09A 4H7LA 3S0MA 5I0RA 2F4PA 3KGZA 2KXLA 3E6BA 1RGSA 3E5QA 4Q0VA 4EWDA 4XFCA 4K8FA 5KHIA 4R52A 5E1RA 5FDBA 4OLLA 1YUDA 3JZVA 3HIFA 2MNGA 4JTNA 3ACLA 1H1MA 1EP0A 3IBMA 3FHIB 3H1WA 4MX3A 5C6CA 3EBRA 4QX5A 1EYBA 1Q5OA 1HW5A 3H50A 3MPBA 1JUHA 4HLTA 4FAGA 4YSFA 4HVRA 4XFHA 4J1WA 3LA7A 2OYZA 3H1YA 4IEWA 5J48A 2IXJA 3IIAA 5BXXA 2XLGA 3LZZA 2OZJA 2B9UA 2PA7A 3H1MA 1Y3TA 4EV0A 2ET7A 3RYKA 2D93A 2DCTA 3KSCA 4ZU7A 2UYAA 2BYVE 1YFXA 5I8YA 4MH0E 4IEZA 4XF3A 3GYDA 4FT8A 3BPZA 1FI2A 2O8QA 1U12A 2UY8A 3OF1A 3E6CC 5F1RA 1QWRA 2K9ZA 3QOPA 2XL7A 4QM9A 3N4MA 1ZVFA 4F7ZA 4DINB 3E6DA 2Q1ZB 1DGRA 1RUOA 3S7IA 1DZTA 2D5FA 4QGLA 3DV8A 3SMHA 5K8SA 2VPVA 4XETA 3ROUA 4X6RB 5I0TA 1XRUA 3FWEA 4ZU4A 3OCPA 2B5HA 3FE5A 5KHGA 5JSOA 1X7NA 2BNMA 2EAAA 2O1QA 3EHKA 5AVPA 3HT1A 2PHDA 4P9GA 4LUMA 2BNNA 2VQAA 5JR7B 4KWKA 3H9AA 4LTAA 3E97A 3CLPA 1WLTA 4AVCA 4AVAA 4XEZA 1O3QA 3NW4A 1ZZ8A 2E9QA 4KWJA 1YWKA 2CAVA 2PFWA 3OTFA 4IEOA 4XF9A 3LAGA 2Q0AA 3KCCA 2GZWA 2XLFA 3UKNA 3RPQA 2QDRA 3BB6A 5JAXA 2QVSB 2XKPA 1ZZCA 1WA4A 1FT9A 2GAUA 3E5XA 5J7MA 4B29A 3U0ZA 1CAWA 2D40A 2V09A 3NL1A 2OZ6A 2XHKA 2VECA 1V70A 2BNOA 4TLFA 2H6CA 3ZDSA 1RTVA 1YFWA 1ZRCA 5BV6A 3DKWA 4GULA 4IEUA 1CGPA 3PVBB 4HZFA 1NE6A 1UCXA 5FCCA 3RYPA 2GC1A 1RC6A 5I91A 2OPKA 3C3VA 2BEOA 3ETQA 4IEYA 4JVAA 3I54A 1UIJA 1Q3EA 5C8WA 2B8MA 1J1LA 2QCSB 5I93A 1L3JA 3WW4A 4XF1A 4JV4A 3LOIA 3O14A 3DL3A 1UW8A 4LLOA 4PIYA 4ORFA 1OI6A 4RD7A 4BYYA 3MDPA 4WBBA 3I7DA 3M3IA 4I02A 2XKOA 4Q0PA 3H8UA 1O7FA 3CJXA 4E2QA 5HI0A 4XF4A 4HSJA 3NSTA 2QNKA 5D1IA 5T3NA 4E2SA 1NXMA 1EPZA 4UXAA 1G6NA 3B02A 2Q30A 4IETA 1TQ5A 1YFYA 5FLHA 2CV6A 2I45A 4MGZE 5FLJA 3WW2A 4PIXA 1O3SA 4A2UA 2GC0A 3USSA 3SHRA 4MUVA 4UBHA 4N9IA 4EWEA 2EVXA 2H0VA 1UPIA 4LA2A 2BGCA 4Z82A 1LR5A 3CL1A 4D7SA 3ES1A 1NE4A 1CAXA 5EZWA 4IEXA 2IC1A 3UKVA 5KBFA 5LEJA 3NJZA 4XFIA 1CAWB 5KHHA 3H7YA 4QXKA 1SFNA 4AQ2A 2UY9A 3H7JA 3BALA 4QM8A 4J1XA 5EFUA 4D7TA 1J58A 5I0SA 3RNSA 4IERA 4R8HA 4XFFA 4NVPA 2XGXA 2Z2SB 1RUNA 4XFGA 3U10A 4YRDA 3E5UA 3R6SA 4AVBA 3NKTA 4LULA 1J3PA 1SEFA 3D82A 2PQQA 1O3RA 4HVOA 1ZZ7A 4YYOA 5CADA 4WVZA 3QACA 3U11A 4IEQA 5FQ0B 5KHJA 2K0GA 2GU9A 5FPZA 2ATFA 4IEPA 2H6BA 4HMZA 3SCGA 4YNIA 1GQHA 4EWAA 1LKNA 3ST7A 4I2OA 1CAUB 1PM7A 4QGNA 4HBNA 5BY5A 4QMAA 2HKXA 3EJKA 4XFBA 3SXWA 4EROA 1O5UA 2D5HA 2IXKA 4QGMA 1ZZ6A 3MYXA 4HSLA 1I6XA 4L11A 4BH9A 3SCFA 1OFNA 4O9EA 1ZZBA 2IXHA 3LA2A 3BCWA 4HVQA 1LRHA 2PTMA 5BPXA 3FZ3A 4KWLA 1DZRA 3KMHA 5LRRA 2UYBA 3FFQA 1CAVB 4XF0A 3RDIA 2MPFA 5CVRA 4MGIE 3GBFA 1EY2A 4ZU5A 5FQ0A 2CAUA 2XLAA 3I59B 4META 3H3ZA 4KU7A 1YLLA 4BIFA 2CGPA 4YARA 1PMIA 2ZCWA 1VJ2A 1IPJA 1CAUA 3HT2A 1CAXB 2HJIA 3IWZA 2GH2A 3PLQA 2Q4SA 4I3PA 1SQ4A 2WC2A 5LRSA 3LWCA 5BUVA 1O3TA 4OFGA 3RZZA 4KU8A 4I0BA 4LA3A 1OD5A 3L2HA 2PYTA 2IXCA 1XE8A 4MV2A 2Z69A 3TNQA 1ZRRA 5JSRA 1ZNPA 4HN1A 3D0JA 4UBGA
chains in the Genus database with same CATH superfamily
3WDWA 5FBZA 1OOPC 1YRZA 2XDVA 1VAVA 2GP5A 2LS6A 3FX3A 1HQNA 4LBQA 3SKJE 4XDPA 3PHMA 1H2MA 3UESA 3GDBA 2VD7A 1WD3A 5I8SA 4Q4W3 3RMYA 5A7SA 4AI9A 3MV11 1QXRA 1UXZA 2XUEA 3P3PA 4GH4B 2PAEA 4ISQA 3WCSA 4CSWA 3RZMA 3O1OA 3ELNA 1W8NA 2A7AA 1CZVA 3LA3A 1KFUL 2V5DA 1C8M3 4HN0A 2WFPA 1V00A 3SLIA 3FLPA 4PBOA 2WSUA 3S7EA 5K4LA 1QJZA 4XILA 3O1VA 1GYKA 2QQIA 1PX3A 5J37A 4Z07A 4B3NA 4PIZA 1ZM1A 4XFAA 4CRQA 4Q0SA 1GKBA 1HQWA 2C1FA 2RDNA 3EO6A 4TYSA 4CUAA 5DDJ3 1WW5A 4JTOA 3ABZA 3MLJA 3GBGA 4IV1C 4E4SA 2WYFA 4L97A 3O12A 3VBUC 2Q8OA 1NYWA 1N1SA 3MO4A 4OI4A 5JPNB 1IHMA 3Q8AA 4NRMA 1R091 5JXHA 4N9HA 4E9KA 4MGSA 2IXIA 2IXLA 3VBHC 5A3TA 3ZN5A 4FBFA 1RINA 5FY8A 1AX0A 3RZHA 3JD73 4K7JA 3VBRA 2WR9A 3TEXA 1LNSA 3BGAA 4FCAA 4O9GA 1VBD1 1B35C 1UMZA 2D6KA 1RITA 2PN5A 3PUQA 3RZLA 2FMYA 2ET1A 1XXNA 3I4IA 3ORJA 1YYNA 3JQWA 4I01A 1JZ4A 4LUKA 1AX1A 1I1EA 1M06G 3VKOA 4PQ9A 1PNFA 2SLIA 2PHLA 3A21A 1KRIA 1J59A 1RUJ1 2NPIA 2OA2A 4L2NA 2A3YA 2WS91 2VZUA 3BI3A 3RZJA 2P17A 5FMCA 2MHFA 3HQXA 3WDTA 1GZTA 1BEV3 1HXS2 1XSRA 1WGPA 2DWRA 1B09A 1VRH2 4TXWA 4I0AA 2VMDA 1BZWA 1NCRB 2FCTA 3UKTA 1GP4A 4UAPA 1VBD3 1DHKB 4NR1A 1N47A 3R4UA 1LULA 5ABJC 3JXSA 3POJA 4OUSA 4AEDC 3OGJA 2XVKA 3TNPB 3VZKA 1RUJ3 2XL9A 1RL3A 2HWF3 3T3YA 2FHRA 4BHPA 5DUXA 4YW5A 2ZXQA 4RQPA 4JAAA 3T0BA 4MHRA 3IT8A 2Q8CA 3T0DA 3CF6E 5BNPA 2QQLA 3QD6A 4AQ6A 5JXIA 3WW1A 4IESA 3HOBA 2CSGA 1R081 3OGSA 4GWNA 3K48A 4DXSA 2XQRA 5FY4A 3RZKA 4Q5OA 3G7DA 3IDBB 5DZEA 4IE4A 4XZUG 2ZS6B 3GM8A 3MFCA 1I9RA 3MGUA 3UETA 2R042 4JGYA 2KXLA 1W8UA 3E5QA 3FFZA 1VALA 4XCBA 1XYPA 4RS5B 1ZYBA 4FPJA 1GZWB 3T2QA 4QPGB 3I49A 2JG9C 1XNTA 3AKSA 5E1RA 2J1VA 4Q4V1 3SC7X 4BQ1A 1W8FA 2IZWA 1F5FA 3LDKA 4MLOA 4EQVA 4XE9A 5HBAA 1VAMA 1R083 3JZVA 3WNXA 2HYKA 2MNGA 3D5OA 4GQ7A 2Y60A 4L99A 4AK3A 3IBMA 1Z7S3 2EALA 5C6CA 5C7GA 1EYBA 3D3AA 3IPVA 5F5CA 4GWJA 1SDDB 3TOJA 4P9XA 5FRAA 4DEVA 4FPOB 4FQ4A 5LBBA 5C33A 1CX1A 1FOD2 1SLCA 1AL23 1H0BA 3NNMA 1LHNA 4YW4A 5A32B 4P08A 4CDUC 2GDFA 1S0EA 2VTFA 3ZXKA 3AP4A 1Y43B 1ZBA1 3ZFEC 2OYZA 1C3HA 2IXJA 2XHNA 1L7LA 3LZZA 1REDA 2PA7A 4O7XA 4CCCA 1RUD1 1Y3TA 2JENA 3WF4A 5JZGA 4D6RA 4M3CB 4KH9A 5EIYB 2AACA 3POGA 1OC1A 4Q8LA 3FMGA 2XG3A 1CR7A 2EIDA 4HONA 3LCPA 2Y6KA 1UYPA 2BBVA 5IK8A 4OHXA 5F3EA 4ZU7A 5C8CC 4D7YA 4ET7A 4GD4A 4YW1A 1NOVA 3Q9OA 4LBOA 5BNOA 4LE3A 3R4DB 3VDDA 1DQ0A 2QQUA 1LU1A 1QDOA 4FSJA 1U12A 4JKLA 4XMIA 1NY72 1RUD3 1SLIA 3HQUA 4IGOA 5FP9A 1UO9A 3LSEA 2K9ZA 3QOPA 4LK7A 3FC0A 3N4MA 2DCYA 1J83A 4F7ZA 5FWJA 3AYAA 5LCWL 1F4HA 1IQDC 4CTEA 2Y6FA 4QKFA 3PL0A 1R1A1 5A33A 4COVA 3ZFFB 5FZAA 3RFRA 2Z42A 1W90A 3DV8A 3ZYGA 4DIQA 4Y24A 4CP2A 4XETA 4X6RB 5I0TA 4AG4A 4COYA 3V0BB 3J26N 1BBT2 3KWVA 4ZU4A 3BTAA 1TG7A 3OCPA 1GWKA 5FZ8A 2W94A 4XUPA 3J8F2 2JDAA 3SQOA 2RR12 4QHOA 5KHGA 4LT5A 5JSOA 2BNMA 1LOAA 1PGW2 2XBO2 5JUVA 3NJVA 5A7PA 3CZUA 4FOQA 3HT1A 1CWPA 2A73B 3HVDA 4H14A 3MPPG 2BGPA 1H2KA 1V0AA 5LBEA 2BNNA 3OYWB 4AOCA 2EF6A 4X8PA 4AYUA 5FP8A 3ZO0B 4LTAA 3E97A 1QMJA 2WT0A 2CHHA 1MEC1 3DPRC 3ZKUA 2WT1A 3LFIA 3F2ZA 4HL0A 5T5PA 1HX6A 1DGRN 3OSDA 3IN9A 2JDHA 1RUC2 2VOKA 4E8CA 4XIKA 1LOFC 1ZZ8A 3I8TA 4JHTA 2E9QA 2GNDA 4NOTA 4QX2A 3OUHA 5CYYA 5AFBA 1RVF2 2K46A 3ZMNA 2W95A 2A6WA 1V6MA 5D8AC 4FXGB 2NZ9A 4XF9A 3LAGA 5GZFA 4PF5A 5IVVA 5HPOA 2Q0AA 1W3VA 1VBA2 2GZWA 4Y20B 1R64A 5HCBA 3B69A 4IV1B 3UKNA 3T0AA 2DCZA 2XQXA 5FZHA 4FPEA 3DECA 3WNOA 2WABA 3U37A 3GZAA 1WA4A 3MIHA 1FT9A 2J1EA 3E5XA 3NQHA 5GLTA 4NPRA 2ADEA 2D40A 2V09A 1PM4A 5JLVA 2UWBA 2TEPA 1PO22 3OGGA 2OZ6A 2WIIB 2P3KA 5J98B 5KWRA 3OEBA 2RJKA 1CN1A 2B42B 1ZRFA 1B35B 3N9NA 1QKQA 3PUAA 1SBDA 5FZOB 3J7NA 2XJPA 3AZYA 3WP6A 2OW4A 1PVC3 5AC92 4Y4YA 4FXKB 1W3XA 1Y4WA 2VUCA 3C8XA 1HJFA 4ARYA 4GULA 2VZPA 4XQ4A 1VMFA 4IEUA 4XUNA 2F4LA 1RUG1 3PVBB 3ALQA 2FD8A 4XBQA 1MVQA 1OQDA 1S0GA 1C1LA 3EXUA 3M2MA 3VZJA 1EAH2 1LODA 1BJQA 5CA6A 4Y5Z0 1UKRA 4PDWC 3NKGA 4QX7A 1MPXA 4CCLA 3C3VA 1IS3A 1MS8A 2BEOA 2WFF1 3ETQA 4JVAA 4HFSA 2NM1A 1RUF2 5FUIA 4F3JA 1S0CA 1Q3EA 5C8WA 1IG3A 2B8MA 3W59A 1SMVA 4YVSC 4AVTA 2R071 4IGQA 4XF1A 4AEDB 4OCTA 1W0NA 2YZ4A 4A6OA 1FATA 2W68A 4JV4A 3O14A 4LBLA 4CDWA 1OI6A 1DYPA 5CFDC 4G4FA 1QJY2 4FTSA 1H8TC 4P9LA 4YVWA 1K45A 1OVPA 3I7DA 4XBNA 3O1TA 3APBA 4PQQA 1L7QA 3WR0A 4LO5B 4K8RB 1PMHX 1IOAA 2HWC3 4K21A 1YEWA 5IVYA 4EJRA 4B1LA 1O7FA 1W6MA 5FZBA 2RMU3 2CYFA 3VHOA 3ZX7A 1A3KA 1VLNA 2WZPP 1NCQC 2UURA 2ZHNA 1VMJA 1ODMA 3KLSA 4LKDA 5DAQA 4AI8A 3KQRA 1UXXX 5T3NA 4LBQD 4QX1A 1VRBA 3HN1A 4CCOA 1BCXA 4WVMA 2XJUA 1LTEA 5C71A 1W03A 3WEZA 4CDXB 5FZCA 2WNVC 5JXGA 2PHXA 1O3SA 3KT1A 5H9RA 1G9BA 4GKYA 4LMFA 1I3HA 4QXCA 3USSA 4UBHA 4XC9A 2EVXA 3ITQA 5A6QA 5A80A 1LJ7A 5C9AC 2R061 4LA2A 3THDA 2UWCA 4XYXA 2RJ2A 1ASJ2 2YC2A 1VE0A 4CEWC 1UQXA 1NE4A 3BU0A 1UZWA 1KQRA 3C7HA 4U2AA 2WS92 2LRPA 5DABA 5FZIA 2W46A 3VDBA 5GLVA 2Y8KA 2X5IC 2ZGUA 2JWPA 1C5HA 2BP6A 1KEXA 4DXZA 2VNRA 4CU8A 4HETA 2ZACA 4CEYC 3CDZB 4QX8A 5A1AA 5J96B 4CDUB 1JZ8A 3I2FA 2RS32 4QXBA 4AI2A 2ZGPA 4QXKA 2VOTA 3A22A 2HWB1 4IE6A 4YGDA 3ZFEB 1SFNA 1ULDA 1TMF3 1LENA 2AREA 1ONAA 2DV9A 1SCSA 2R063 1LESA 2UY9A 4J1XA 5EQUA 1TE1B 1J58A 3VBOA 1A78A 1RHI3 1TEIA 4Y5TA 5A3OA 2QTWB 2X09A 4R8HA 4XFFA 3WXPA 4DNYA 2XGXA 1ND2B 1US2A 2DFBA 5B2GB 2BOJA 1D2QA 5TSWA 4AQSA 4RA0A 3WDYA 3U10A 3C7OA 1H9PA 4FOVA 5C8CB 3LPFA 3D82A 1GZCA 1QJU1 2CNAA 2ID4A 3T4VA 2ARAA 2VZRA 1W6NB 1AR81 2VGDA 1UU4A 3ZYRA 4S2HA 2JDZA 3AP7A 3JBG2 3T4HB 2JDPA 3QACA 3TWIA 1MQTA 3IMNA 3OBZA 1CVNA 4N43C 3AKTA 5FPZA 3PIGA 3DGTA 2E7QA 5IJRA 3SCGA 5T54A 3C7GA 5IVFA 3POEA 4URTA 1LKNA 4EWAA 5JOYA 2VBPA 4HBNA 5AVAA 1QJU3 2BBAA 4NRPA 1PK6B 3EJKA 1IGOA 3DYOA 4XFBA 3WUCA 2UU8A 3PVNA 5DG1A 2WT2A 1TME1 1W39A 1O8PA 3SXWA 4K3UA 5CNAA 1ZZ6A 1YXWA 2XWBB 1I6XA 4KG8A 2W2IA 2I74A 4A3ZA 2VE1A 4O9EA 1ZZBA 4AHWA 4ATFA 1V6IA 5KXEA 1K3IA 2R7EB 1HB3A 2PHUA 1C4RA 2F6BA 1HRV1 4GMP0 3QCWA 5FY0A 1OKOA 2UYBA 5FZFA 1FAYA 4XDQA 1AL0G 4BPZA 1Q8QA 5CVRA 1PGL2 1ZBA2 2LROA 4MGIE 2Q8DA 1MACA 1NA1C 1C28A 2JDKA 1RYYA 1N3QA 3B9CA 2CAUA 1SDWA 3I59B 5F2WA 3O1RA 1YLLA 4BIFA 3RGBA 2GALA 4QPWA 5KR7A 3IDEA 2HWE2 3GZUC 2CGPA 4AAPA 5D8AB 1NCRA 5CKNA 1S0DA 4YARA 1PMIA 2ZCWA 3O0WA 4NIAA 3T09A 1LCLA 5H9QA 5JIUA 1XC6A 5GZEA 3ZSMA 2VVFA 1CAXB 4PI2A 3W21A 3PLQA 4BMBA 1KXGA 4I3PA 1VBE1 2JIGA 4W6YA 5IK5A 1OBNA 2XH6A 4XJWA 1GWLA 4XVHA 1DYKA 2LUWA 3UL2A 3NJXA 4XJ9A 4ZONA 4PLOA 1HXS3 2G9GA 4OHWA 1XE8A 3MF6A 5GALA 3ZFGB 3TNQA 5A3UA 2O0OA 1E5RA 2VW0A 1ZNPA 2VZ1A 3J7MA 1CZTA 4KNCA 1AR61 3I3BA 1QJX1 2WKKA 4OI2A 3H0OA 5A3WA 1CAVA 3IB3A 4SLIA 1F9KA 5EYXA 4UF0B 1R1A2 4BU2A 3Q8FA 1YQCA 1HN1A 1EPWA 4CCMA 4ZZ8A 5A6XA 5CU1A 1VR3A 1ZA7A 4DQAA 2HH9A 2RM21 4KGGA 4CDQA 1W9WA 4PDWB 4RS5A 5FMOL 3ZYFA 1GZWA 1UY0A 4QPGA 1CX4A 4UI9L 5B4XA 1O5LA 3CJIA 1J3RA 1AYM2 3ZXJA 3HWJA 1JZ2A 2YV8A 5LWBA 1OVSA 1ZBE2 4RGGA 2WLQA 3CEWA 1LGCA 4YVSB 3ZXDA 4L8QA 4Y1ZA 1D4M1 1BQPA 1K12A 1XU2A 5FXXA 2EXJA 2YG0A 3IAPA 3VBSC 4DXTA 3I3QA 1MEC2 2VVEA 1W8OA 4Q0QA 3UGHA 4N53C 4DS0A 1YJKA 5JPMB 1UOGA 3FBMA 5CFDB 1YFUA 2OXBA 1AXYA 1KJRA 1QQP2 3VL9A 2RM23 1UOFA 4GB32 1MR5A 2ZGKA 2WAAA 5C4WB 3HEIA 1WWYA 2WL1A 4KG0A 1H1IA 3WSOA 5A32A 2PHTA 2VQ0A 2IFWA 2XJSA 1OHFA 3ACGA 4NHYA 4DRRA 4IE0A 2VCMA 4AGGA 4IV3C 3J4UH 5DAPA 3BOPA 1NCQB 1GMMA 1J1TA 3AK0A 3UGGA 4BXSV 1QY4A 4W8JA 1IPKA 2ZMKA 1HRI1 4XTPA 4MGKE 3K51A 2YBSA 2WNUC 5DUVA 4M3CA 2WZ8A 1UX6A 2CY6A 1JYVA 1HLCA 4V1PA 3TBDA 4YM0A 1Y9QA 4YG3A 5I8TA 1PO11 2WNVB 2QBXA 1SFYA 2R6QA 5D21A 1ZZ9A 2ORXA 2J1AA 3M70A 5JSPA 5LZ6A 4YM1A 2YBKA 2PAMA 2ZA9A 2C26A 4EE2A 3W5MA 1UD1A 1XQNA 1NLQA 3N7KA 5KHKA 5J36A 2PHWA 3D0SA 5C9AB 4JQTA 4AXOA 1UL9A 5FPVA 4L9BA 1ZREA 1W9SA 4LO7A 4JC1A 3H3UA 2VMHA 4CEWB 1RXGA 4X6QB 4YW7A 3OEAA 1CD3G 1DP0A 3W9AA 1BK0A 3HJRA 4A6SA 1D4VB 1SFPA 4WM7A 3K3OA 1JZ5A 1FV3A 1W6PB 1RUH1 1GNZA 2VW1A 1JI6A 1CIWA 1WUVA 4CEYB 4ASLA 4IL7A 1UKGA 3IM0A 4YW3A 3KF3A 1FPN2 4MGYE 2EA7A 5FO7B 1JTZX 3ZFFA 2AENA 2VO5A 3ZN4A 4MZUA 3KF5A 3U78A 3RI8A 3ES4A 1X82A 3AL6A 4UW3A 4YGBA 3WW3A 4BQ2A 5FLIA 4EYUA 1Q43A 1ZX5A 1BMV2 4RR3C 2BU9A 1BHGA 4EN7B 1W8TA 5JOWA 1I5ZA 2E53A 2DYCA 2NYYA 4NAMA 5FY7A 4B4RA 5DZGA 1U5YA 1SPPB 4H7LA 1RUH3 1WW4A 4XJAA 4FFGA 1XYNA 3SNMA 3S0MA 2JXAA 5I0RA 4R4XA 5T5OA 4K40A 3E6BA 3KM5A 1RGSA 2JKBA 3N9OA 2E7TA 3ACHA 3P6BA 3Q8BA 4LBJA 5IHRA 5G05L 3N9MA 4XFCA 4YPJA 4GWIA 3TN92 3LOBA 2E51A 4M0HA 5LB6A 3GJAA 3A0NA 1YNAA 1BBT3 3AMMA 1ND3B 1V6NA 3KZ4C 3ZM8A 4TTGA 2RS53 2RR13 1LHUA 3ZIWA 3PUIA 3RSJA 4D0QA 5ISLA 4GKXA 1D2SA 4N43B 3SITA 5F3CA 4IDZA 2VM9A 3ACLA 1X9PA 2Q1FA 4FTBA 1H1MA 1OD3A 1U5XA 3H1WA 5T50A 3EMRA 1PZ7A 3AZVA 3WG4A 3LB9A 3EBRA 5HXVA 2ZX0A 1GV9A 4Y20A 1Q5OA 2V4VA 1HW5A 4IV1A 1C8M1 4J25A 3MPBA 1MZFA 4HLTA 1YCIA 1RUC3 4CZSA 4FAGA 4FPGA 1GOFA 4XFHA 5FKCA 5A7WB 3ON7A 1FX5A 1SHWB 4XHXA 3ZYJB 3LA7A 5JI9A 2A1XA 2VVDA 4H55A 4UYBA 4EZ4A 3H8RA 1TZOA 5BXXA 3W58A 2DCKA 5FZEA 2B9UA 4LORA 5FPUA 2ZKNA 3H1MA 4Q26A 5DDJ1 2J22A 3MIDA 5FZOA 2KR2A 1D0GA 1ACCA 4EV0A 1O59A 2VMIA 3O1MA 1NA1B 1S0FA 2YFZA 3N9LA 4OHZA 2DCTA 3VBFC 1X36A 1GNHA 2A6VA 3O0XA 1YFXA 5IFPA 5FMDA 1PO23 2RDQA 1Q8OA 2V73A 3JD71 5CFCA 1XPWA 2BERA 3FHAA 3H8XA 1RMU3 3UJOA 1UMIA 1HJGA 4FT8A 1KJLA 5DMYA 3OF1A 3RRDA 5AC93 5F1RA 4RGAA 2XPJA 1IS4A 5FV3A 2DUQA 3VN4A 2A71A 4GIQA 1AXZA 2BWAA 1NLRA 4KWUA 4NPMA 1S2EA 5L19A 3E6DA 4N7IA 1XU1A 4XJUA 4HKOA 3ZXLA 1AR82 1BEV1 1N1YA 4P9JA 5FOJB 3ZYHA 4Y4RA 3JB8A 4MXWB 2D5FA 4QGLA 4QDRA 5E88A 3JB4C 4Z1VA 2WZR2 3ROUA 4PCRA 4Q27A 1PX4A 3ME2A 3FWEA 3PTYA 4RHV2 1S0JA 1UZZA 4QT6A 2GMPA 5K0UC 2JDMA 2B5HA 3LQCA 3FE5A 3WVJA 4KGQA 5FY9A 3VGIA 1X7NA 2ENRA 1NUKA 2FCUA 5A1LA 2XJTA 3FBYA 4FQZA 4K1ZA 4P9GA 2ADDA 1XOYA 2HWF1 1UYZA 1QJY3 1SLLA 1TME2 2VQAA 2ZHLA 3GBWA 3H9AA 4JDNA 3N7JA 5FZ6A 1H4GA 4CDXA 4R4ZA 1WLTA 4ZXEA 4OI1A 1AXKA 3M3QA 3M1HA 3ACIA 4W6WA 3SEPA 1F5JA 4AVCA 1O3QA 4YM3A 3NW4A 2DTWA 1VIWB 5C70A 3JQXA 1K5MB 4M00A 5DXDA 2VMCA 2E33A 4E27A 4LXLA 1YWKA 1KDKA 2QZ2A 2BZDA 2MEV2 3VBSB 3OTFA 1AUYA 1D7PM 2P37A 2B39A 2D3RA 4GAZA 4N53B 2XB6C 1POV3 2ILMA 3ZMOA 4NE9A 4HPKB 2OX0A 1YIFA 4WZFA 2XLFA 2UWAA 3CU7A 3N9QA 2YDEA 1DGWX 2X10A 1BVP1 1OFSA 2C9AA 4H2AA 4AHXA 4YM2A 5J7MA 4ZXKA 3U0ZA 2FBEA 5LATA 2VZ3A 1FNYA 1BKZA 1ASJ3 1XBFA 1Z7S1 2XHKA 1Y7BA 1G7YA 2EIGA 4NIDA 1VBE2 1JMUB 2BNOA 4OMDA 4TLFA 1WCQA 2VQTA 5C3OA 1HB2A 2WNUB 3OOXA 4QKBA 1ND2A 5BV6A 3VHPA 2Y0IA 4QQHA 4YW2A 1AL21 5FYSA 4AI1A 3VBRC 2C4XA 3OGVA 2RJLA 4COUA 2W5FA 4JKMA 1OLQA 1JYNA 4LHLA 4WM8A 1UN1A 1YI7A 2DVFA 5LA2A 5IFTA 3VD9A 1IS5A 3GXUA 1JOJA 1QJFA 3N7MA 1PIV2 2PHRA 4YLZA 1RC6A 3R4SA 3VLBB 2E6VA 4AAXA 4AHYA 4BQ3A 1W0PA 4ZS2A 5F3IA 5F7UA 2Y26A 3O1UA 3KHBA 4FPLA 1JZ7A 2XJRA 2VG9A 3E1F1 4XOGA 1UYXA 1O8SA 5L9VA 4AFBA 3DYMA 3N3HA 3RVHA 5HV4A 5FJHA 1C1FA 1J1LA 1Q8VA 1W8ZA 2AH2A 2QCSB 3NAPC 3MBWA 3OGRA 1OA3A 4AL9A 4B4QA 2X29A 4JHZA 3MUY1 4IGPA 1Y9GA 2ZZJA 3A23A 1LU2A 1UW8A 5GZGA 4ORFA 2VMFA 4RD7A 4P02B 4FOYA 5JWPA 3MDPA 1BXHA 2WA3A 3NV1A 4LO8A 4WBBA 2BFUL 1OURA 1PK6A 5GLUA 2XVGA 5CEHA 2Z4FA 3JBG3 4N8MA 5DUWA 1FYUA 1OUSA 3M4FA 1UPSA 2XKOA 2RHPA 4ITCA 4Q0PA 4RR3B 3B00A 1FNZA 1DQ2A 3CJXA 2GN3A 2PXJA 4E2QA 1S0IA 4HSJA 4RQPC 3NSTA 3UNPA 2WBKA 1A6CA 2KD7A 4BQ5A 2DBIA 3AXDA 4DY5A 3ZSJA 5BNPC 4AR2A 4Y33A 3TB0A 4E2SA 4A7YA 4FI9A 4K20A 2ZMNA 1UOBA 1EPZA 2PELA 3KV4A 4UXAA 1G6NA 3O7OA 1SLTA 2G19A 1TQ5A 1YFYA 2CV6A 1JODA 1AR73 1SBEA 5CAZA 1AR92 4MGZE 4PIXA 2NQYA 1W8WA 4OYUA 2XMLA 2GC0A 4AZZA 4O65A 5ACA1 1HB4A 4JGYC 4F83A 4MUVA 4N9IA 1QGLA 2JG8B 2B9VA 1XB9A 5K7PA 2BGCA 2VQUA 1H9WA 4NUBA 4Z82A 1LR5A 1UU6A 2PLV2 3S57A 3KHCA 4D7SA 3ES1A 3OD4A 3T1MA 3I2OA 4TZDA 3AMPA 3B3QE 3RI9A 3WP3A 1CAXA 4WV8A 1E5SA 2WJSA 4C1WA 4IEXA 4P5HA 5CB7A 5L7OA 1UX7A 4A42A 5HV0A 5LEJA 4OUEA 1RJ7A 3VZMA 5ACA3 1BVVA 2OVUA 1KFXL 1HKDA 4XFIA 5KHHA 2HWE3 4AQTA 4EN0A 4XQWA 1OOPB 5B4NA 3WF1A 5DQ0A 2QQWA 4CP1A 3R05A 3RWKX 2OT7A 3H7JA 3ZFGA 3PMSA 5EFUA 1VBB1 2FDFA 3O1SA 5I0SA 1RUI1 2WNOA 4NVPA 2ORZA 4QQ2A 1RUE2 2Z2SB 3QH7A 1RUNA 3AP6A 4UF0A 4GJZA 1QNWA 2ZEYA 2VMEA 4XFGA 3VBFB 2VL4A 2QQJA 3E5UA 4AVBA 1ZRIA 2E26A 3NKTA 1R1ZA 1REEA 1SEFA 5LBFA 5JZGC 1W6OB 1COV2 3QBQA 4XAAA 4TWTA 4YWAA 5FMOS 1UY3A 4YYOA 1HV1A 4QKDA 3JCIA 4AVSA 5CADA 2NLRA 1C57A 2L9LA 4Q4Y3 1KS5A 2V72A 1VBB3 2QKDA 3U11A 4AEJA 1MZ6A 4KQ7A 5C5TA 1PVC1 1RUI3 5BNOC 2GN7A 2ATFA 1EV13 3RZGA 4N90A 2P5BA 2H6BA 3KS7A 5FXVA 3VB9A 3VBUB 4BWOA 5DG2A 2D3PA 4YNIA 1UZ0A 3GJBA 1CAUB 4PT6A 2VCAA 4QGNA 5APAA 3OG2A 3VBHB 5BY5A 5H9PA 3FLRA 3OUJA 4SBVA 5C4WA 3DF0A 1WBFA 1YJLA 2D5HA 1U0AA 2OUHA 4FPFA 2DDUA 2QZ3A 3I2DA 4XUQA 1OPOA 1UZYA 4L11A 5K0UB 3BTYA 4Q4W2 1NQDA 2DVDA 5BNNA 4UFJA 2W92A 2DU0A 2IXHA 1FMD2 2E63A 4QWNA 4V2WA 4D6SA 2ZJCA 2GP3A 4XZPA 4RSUA 3V64A 3VKNA 4UFIA 5FZ4A 3OPWA 3ZN6B 1I5PA 1ENRA 3FZ3A 1DZRA 3NNLA 4Q4X2 4BOWA 5LRRA 3FFQA 5FK8A 3J9SA 1QQP3 2WO2A 4GB33 3ZIXA 4XF0A 1JOBA 3MW3A 5FYMA 2D6MA 2DU1A 1IG0A 1LHOA 1EY2A 3H8OA 2HWC1 2CL2A 3K3NA 2KA3A 1W05A 3VZLA 2CGNA 5FR3A 5FQ0A 3DCQA 5ABJB 2RMU1 2YU2A 1QIQA 1A34A 1GICA 3CBNA 3MUZ1 5DDJ2 4B7KA 3NV4A 4JZRA 2YYOA 2ZX4A 1GWMA 4FPCA 2WAOA 4URAA 1C5IA 1H30A 2VY0A 2CGOA 3IWZA 1QXPA 3CZJA 2B45X 3LKJA 5A3MA 1LGNA 3LWCA 2KM2A 3PVEA 5GM0A 5BUVA 4OFGA 4XXPA 4UFLA 2ARXA 5J09A 1AYN3 1KD7A 2QQKA 4Z2WA 3UJQA 1SCRA 4NIHA 4DEQA 1GOGA 4MG2A 2OQ6A 2WQ4A 1JYTA 1IPSA 3L2HA 2ZGSA 2GNMA 1OQ1A 4UW5A 1ZRRA 5JSRA 1E5HA 1V9U3 4ARXA 1JHNA 4Y1XA 5F2SA 2HWD3 3D0JA 4UBGA 1WMDA 1PVXA 1GQGA 1QHDA 1R092 1PHMA 2V4AA 4Y1YA 3SKVA 4BQ4A 1BEV2 4EZHA 3SCHA 4A7ZA 2QUOA 3VBRB 4IEVA 1SPPA 1QJEA 2XR4A 1VBC1 3OD0A 2JG9B 1QDCA 5KC6A 1OA4A 2RS11 2P2KA 2OQ7A 4ZS3A 1YHFA 1FPN3 3DN7A 4FO9A 4Y1UA 1VBD2 2R32A 1TMF1 2YC0A 1G9AA 2ZABA 3I2HA 5FZMA 1JZ3A 4BQYA 1ND3A 1RHI1 3QLQA 1NT0A 3J7LA 2CDPA 1RUJ2 4E4ZA 1OSGA 4OHVA 4W6XA 2X05A 4JGZA 2HWF2 2ZGLA 3K46A 3NAPB 5IATA 3HD8B 3ZLIA 1CESA 2WQ8A 2VBDA 1NLSA 1VBC3 4AVVA 4CCEA 2RS13 3LEGA 2WA4A 2EIEA 3NVCA 3FUQA 4FFIA 4E4DX 5JCTA 4FFFA 4KL1A 1XE7A 3TN93 1DGWA 1G8WA 1SACA 2ETEA 1J3QA 4FPYA 1GANA 3CMGA 3T08A 1ZRDA 2C0ZA 1YIPA 1MS3A 5FZ1A 5K9YA 3FJSA 5DUUA 1OH4A 4P9IA 4CDWC 1O4ZA 1DG6A 1YQ2A 4WZCA 3AZWA 4YVWC 3VHRA 4RQPB 4MSVA 4LHKA 4COWA 4E8DA 4XHBA 5F6LB 3B7MA 5BNPB 5J1XA 2TNFA 3VKLA 4K6BA 1UIKA 4GH4A 4QD2A 4J6GA 2Y6HA 4HANA 2VOVA 3WNNA 1R082 2WN3A 3IDCB 2VZTA 4R9DA 2AR6A 4QQLA 4QPIC 4A45A 1WLWA 5DN2A 2BWCA 4JGYB 1Z7S2 2LALA 3AL5A 5A7NA 5FYZA 1H2LA 3AFKA 3WG1A 4ES9A 1SG3A 1O4TA 2Y38A 2Y0OA 1GNYA 4RYDA 3RYRA 2GC3A 1YQ8A 1F4AA 2ZEZA 4AW7A 2QQOA 4LEJA 1AL22 2VUJA 2VZVA 4YGEA 2YMZA 3EQEA 3VV1A 2P1BA 2W91A 1OMIA 4Q4V2 4A4AA 2WDBA 2ZKLA 5J3UA 1O6UA 1NZIA 5E8AA 2BOIA 1H2NA 2GC2A 4LHSA 2VW2A 3IKWA 4AEMA 1F8VA 2D43A 1CONA 2W08A 4QB1A 4XPVA 3L9JT 2Y64A 3I2JA 2DURA 1ULCA 2D6LX 4HK9A 5FP4A 4NWWA 3LSDA 2YGMA 4BIOA 2D6NA 3GCWA 4FFHA 5JIAA 2VZSA 2CTVA 5FUPA 3BU7A 2RVAA 2QE3A 4UFHA 5JVVA 4Z92B 3DPRB 5FREA 1ODNA 2VTXA 4MGTA 3M7AA 3VBOC 1H6XA 2VOWA 1N1VA 1HXS1 2NMOA 3DUIA 5ANQA 3KGZA 5JZGB 2ZGMA 4Q0VA 4QDQA 2Z5WA 2W47A 2WZR3 1RUD2 3OY8B 4EWDA 5C3QA 4NHLA 1LHVA 4M3CE 4BA6A 4CCKA 4QQOA 3K77A 2IUWA 1PGSA 3WD5A 1DGLA 1T6GC 3W20A 4YG6A 1AX2A 1YUDA 5F37A 1K5MA 3HIFA 4HK8A 4JTNA 4XTMA 2JE7A 1EP0A 1KS4A 2VOXA 4Q1PA 2HLEA 1A8DA 1SZBA 4K9SA 4S2DA 1MQTC 4N53A 4QX5A 3IMMA 5CKQA 1V6JA 3R0RA 4XXAA 1F35A 2A6ZA 1VRH3 4HPKA 4LKSA 4UW6A 2P3JA 3WDVA 1JUHA 3MIFA 4E4HA 4AHZA 3POBA 4TLGA 2E32A 4DUWA 1NKGA 5T5JA 2WWJA 2D3SA 2VUAA 5FYUA 4HVRA 2B46X 4J1WA 3KV5A 3AB0A 3Q8EA 3NJYA 1DQ1A 2BPA2 3AJZA 3H1YA 4IEWA 2MEV3 3NMBA 2YROA 4CXXA 1E5IA 2DBNA 2J1UA 2R041 1EUTA 4LNVA 3MV01 5DZFA 3WLUA 1OLRA 2WO7A 3THCA 1ENXA 3K4ZA 4BDVB 1NQJA 3GZEA 3MEPA 4V2VA 4B7EA 4NIGA 1W0OA 3LFMA 3USUB 1JYCA 3RYKA 2D93A 3AVSA 3K4AA 4LJHA 1JYWA 3AM2A 4BCUA 4NWVA 3VD3A 2IVJA 4MGQA 1HN0A 3NWKA 2W1WA 5F39A 4PLNA 4OHYA 2ERFA 1JBCA 4MH0E 2R043 4Q2FA 4ISRA 3I3MA 1FI2A 2ARBA 2O8QA 2UY8A 2P34A 5EJZB 3E6CC 1FOD1 1YQ5A 1QWRA 2R1BA 3KVBA 4D69A 4AFMA 4YZ2A 2XL7A 1H8TB 3WCRA 2BUKA 3GALA 1ZVFA 1W8HA 4P00B 3WP4A 2RDRA 3HQRA 5FKBA 2D6PA 2Q1ZB 3F95A 1LOBA 2R49A 1M4WA 1IQAA 1PIV3 2WWSA 1HV0A 4P9YA 1RUOA 2YGLA 1DZTA 2BFUS 1NG0A 5G04L 2G9FA 5EHDA 5K8SA 3NV3A 3VHNA 1H4HA 4QU1A 4RR3A 4O61A 2DFCA 4TN7A 3AYEA 1FOD3 4OZXA 4MXVA 3MHZA 4XJZA 4BB3A 2EAAA 2D6OX 3N7LA 4NHMA 4KMQA 4CUGA 3GNEA 4LK6A 2PHDA 5FO8B 5JR7B 4KWKA 4Z8BA 4DO0A 5IWFA 1UY1A 1UYYA 3HNYM 2YY1A 3CQOA 3SH3A 2FDKA 4D8MA 4LLFA 3CLPA 3PUHA 3WDUA 1AJOA 4XJ8A 4INDA 3ZYPA 2ZX3A 5EJ1B 5FZ0A 1RUG2 1OLME 4BJ0A 3ZSEA 2R16A 2JG8A 3ILNA 4CDQC 2OUJA 2X5IB 4NO4A 4RS5C 1LOEA 2CAVA 4QPGC 1XNKA 2D98A 3MLKA 2IWGB 3AJYA 1ULPA 1GP5A 3S6PA 4BZ4A 5FPAA 3CJIC 3B93A 2WFF2 3LD8A 3MI8A 4WVWA 5A70A 5JOZA 3KCCA 4YGCA 4UW4A 3UGFA 3WNMA 1AR93 3BB6A 3HNBM 2RMU2 4QHZA 1BBT1 5EXOA 2JD9A 4XW3A 2XKPA 5JAXA 3V0BA 2RS51 3J8F1 3U07A 2R072 2RR11 1XNDA 2LM3A 4P5YA 5T52A 1W28A 4CDWB 1PGW1 3EB7A 4NPLA 1CJPA 3DXTA 1OOPA 3NL1A 1DLLA 4YVWB 3UK9A 3HBKA 3LEMA 5FWEA 1DQ4A 2VECA 3MIBA 1OQEA 3ZDSA 4QX3A 2ZGOA 1VB4A 1RTVA 3OYWA 1W6MB 1YI9A 3RS6A 1HB1A 4JRAA 3ZVXA 5IAVA 1RUC1 4QPIB 3J8F3 1P8JA 1NE6A 4HZFA 4CPBA 4CP9B 3VUOA 1UCXA 1ULGA 1Q8SA 3DXUA 3RYPA 2FDGA 5IVBA 2XBO3 1CZSA 2JKXA 1HQLA 5A3NA 2QQPA 1X50A 4R9CA 1W6QB 4GWMA 1VBA1 5EYYA 3AKRA 2JECA 2VNGA 3CIHA 4JDOA 2YC4A 4GA9A 1SBFA 1F2NA 5L9BA 5I93A 3WW4A 2Q8EA 1DLCA 5LY1A 3K2OA 3MIEA 3VBUA 3LOIA 2VCCA 2R062 4LR4A 3N9PA 1MZ5A 2DUPA 1XJAA 1F15A 3DL3A 4LLOA 3VZOA 3LDBA 2ZBJA 1RVF3 4BYYA 1PO21 5I0DA 3VBHA 2VMGA 1K42A 1OF3A 4WM7C 1RMU1 5FPBA 2Y33A 3M3IA 2G9ZA 1ALYA 4I02A 1B35A 1S4CA 2ZHMA 1VBA3 3WUDA 4CXWA 5AC91 2X8KA 1BLZA 3OBTA 1T6BX 1UY2A 5LASA 4YZ1A 1C8NA 3VKFC 5HI0A 3HMYA 2PQSA 2QNKA 1WMFA 5A6ZA 5F3GA 5FPLA 2HWB2 3RG0A 3VBOB 1OLMA 4FTEA 1EAH1 3KV6A 1UY4A 3H42B 3KCYA 3WHUA 1POQA 3FLTA 3ZOIA 3CKHA 3LIGA 3K4DA 2Q30A 4NRQA 5FLHA 1OT5A 2DCJA 5C3PA 3WX5A 2I45A 1RUF1 3WW2A 3OBRA 4LKFA 4A2UA 3B5LB 1BK1A 4CXYA 1GSLA 3C2UA 4HT1T 4GJYA 4ES8A 5ABJA 3URFA 1F31A 3S5QA 1FMD3 3DEMA 3POYA 1T2XA 1QJU2 4AEDA 1LEDA 1LGBA 2I2SA 4BISA 1DCSA 4QX0A 2VNVA 4Q4X3 2FDJA 3CL1A 1EAH3 1JHJA 1QJY1 1MQTB 5SV8A 3GF6A 3RMXA 4YZ5A 5KXDA 2WRAA 3BODA 4AFDA 3U4XA 1QEXA 1W9TA 1MS0A 5EZWA 1WLCA 2HEWF 2C5DA 1O4YA 2PHFA 2W9XA 1RUF3 1DZQA 3I2IA 4PLMA 2ZGQA 1CPMA 2VC9A 2FCVA 3SH5A 2NN8A 1CAWB 3H7YA 3INAA 4ZZ5A 1UU5A 3GGLA 3NRUA 4NIIA 2JEMA 1JH5A 3BALA 3OPZA 2JX9A 4M0NA 3AYDA 3WHTA 1O91A 3PTRB 1POV1 4AE2A 4PF1A 3D8CA 4H7MA 3T30A 5IVJA 1W99A 3FL7A 4M4RA 1ULOA 1WA6X 1MS9A 4QKNA 1UOJA 1EUUA 3DYPA 5FP3A 4DFSA 5LBCA 4A41A 2A70A 2JG9A 4YRDA 1KGYA 2HBUA 2ZEWA 4LIVA 4UFKA 2J1TA 2RG4A 3AMQA 2AEYA 4QDSA 2B4KA 4RGKA 4YW6A 3U4SA 1HRV2 4C0BA 2BVBA 4HVOA 3BTZA 1ASJ1 1ZZ7A 3LE0A 3ZPOA 2EICA 5GJ6A 3SH4A 4MADA 4WVZA 3VKMA 3MW2A 5BNQA 5KHJA 1R093 4LBNA 4Y22B 4AI0A 2EXHA 4OI0A 1CQ9A 2K0GA 2YPJA 3ENRA 1FV2A 3NAPA 4IEPA 4JX0A 5CFCC 2DF7A 4HMZA 5DAWA 1GOHA 5E89A 4I30A 4BQWA 5JI7A 3ZKYA 2RS31 5FP7A 1GQHA 4DY3A 5JR2A 1XNBA 2DVAA 3AP5A 4CDUA 4I2OA 4CA9A 1PM7A 1RXFA 1UZVA 2ZHKA 4IV3B 1DU3D 4S2GA 4QMAA 3ZFEA 3LEIA 5D2AA 4JDMA 3PUSA 5BYNA 3WY6A 1UNBA 2VXRA 5C5UA 2YHJA 2NMNA 2WS93 2XONA 3PVOA 4QPYA 1H8VA 5EV7A 1OFNA 1TNRA 4BMEA 5FK7A 1BYHA 3U14A 4CU7A 4HVQA 1LRHA 2EXIA 3OB8A 2RS33 1ULEA 5BPXA 3LDRA 5C8CA 3I2GA 3KMHA 3POFA 1WW6A 1QH6A 3AFGA 1CAVB 3RDIA 3JBG1 2MPFA 1W6NA 1AR62 4HG6B 1QJX2 3HNMA 4BQXA 2H0BA 4ZU5A 3WNLA 3TEYA 2YBPA 4FPHA 1DFQA 3ZR6A 4META 2WO3A 2EXKA 2ZPXA 2WYSA 2JB8A 5IVCA 5E16A 2AEZA 3BOWA 3WP5A 3PJQA 4CDQB 4CDXC 4NN0A 2P6CA 3FUOA 1DQ5A 5DAVA 2RM22 1DBNA 2VNOA 1IS6A 1STMA 2Y6JA 3CJIB 2ARCA 3D4KA 3RWNA 4LIUA 3HT2A 1OA2A 2HJIA 3M3OA 1AR71 2LTNA 2R0HA 1G9CA 5CG9A 4LKEA 2Q4SA 3CNAA 2WC2A 1VPHA 1OKQA 4HKLA 4R9AA 4H3WA 2YU1A 1D4M2 4KU8A 3PURA 3HR9A 4I0BA 3ZSLA 4QXHA 4ZPIA 2ZAAA 4LA3A 1OD5A 5F5IA 3WG3A 4MV2A 1MS4A 1J84A 1MS1A 2XWJB 2P3YA 4M4PA 1US3A 4CUBA 2JIJA 3QH6A 4GALA 1G9FA 4HN1A 4Q4V3 5CIRA 4C1XA 1PGL1 5E6HA 1ENQA 4F8AA 4QAWA 1QXJA 3DPRA 4IW3A 5IVEA 3O0VA 3X29B 5FPXA 1RB8G 5FYBA 3VD5A 1YQ6A 2NP0A 4DOUA 2W52A 1S1AA 4KBBA 3WF2A 3I59A 2HWE1 1PMJX 1LOFA 1ND2C 2O8OA 1HRI2 3WF3A 3OY8A 2A3WA 1XNCA 5C3SA 5LW9A 1WMEA 2HBTA 3H3LA 3WF0A 3ZXEA 5D8AA 3V0AB 1PO12 4YZ3A 4BM8A 2XVLA 4Q29A 3NNGA 1Y9MA 4WM8C 4CYDA 4PJYA 2ZTNA 1ZBA3 5F8PA 3C7FA 3HN3A 1DYOA 1WW7A 2BDRA 2GNTA 2VH9A 3ETPA 3IAQA 3KGLA 4AFCA 5LEKA 3U1XA 2Y34A 5IYYA 2J1RA 1OXCA 3AVRA 4L0PA 2A3XA 3TYJA 5A6YA 1X8EA 1KDMA 4FPKA 4LHNA 1JU4A 3ZXGA 4D94A 5FFOC 5FMBA 4BK4A 3SEEA 4OQ8A 4WM7B 3PJYA 4ONUA 4Q4Y1 3PNAA 5GKAC 1JU3A 4LO4B 4AGVA 1RUH2 4KBZA 3V65A 2VULA 2J1SA 4QB6A 4ZKTB 5IAXA 1LB2A 1EV11 3MIGA 5EWSA 1PK6C 5FZKA 4CU6A 5JMCA 4TSVA 2N7GA 4G9SB 3AX4A 2P4EA 4FAHA 3I97A 3O1PA 3M3CA 5FZDA 5HCFA 1IKPA 3IZOA 2JB4A 2RS52 3N36A 4XCAA 3CO2A 4C91A 1XYOA 4PDWA 1MVEA 4W4ZA 3SISA 2ZEXA 3IIIA 4UOJA 4YFWA 3USUA 1AYM1 1FXZA 1PZ8A 2E7AA 3P5BA 5LY2A 1WCSA 1PNGA 4E2GA 1S0BA 2PAKA 1ZBE1 4EN9B 1G86A 4CP0A 2AZ5A 1HDKA 1R1A3 2BTVC 2ZGNA 4HOOA 5EPAA 5I0UA 3VDDC 4JCKA 4YVSA 5FXWA 2D7FA 3L2YA 1W06A 3HPNA 1UF2C 2DUOA 4Q0UA 3PDQA 4P14A 2AYHA 4PHZA 5EP9A 5CZKA 2TUNA 3K75B 1QQP1 1VMHA 4B1MA 5CFDA 1X8MA 4GB31 1NZCA 2SBAA 3M8LA 4RFT0 5L36A 1VP6A 3RQ0A 1H8TA 2EAKA 3MZHA 3RJRA 1S2KA 4HKWA 2A6YA 5FY5A 1AYM3 4XQDA 4A44A 5IUQA 3VD4A 2W1UA 3THTA 1ZBE3 2C6SA 4LO6B 1GU3A 2PMWB 2YUEA 3GCXA 4LE4A 1ENSA 2XJVA 3FHQA 4C90A 1K5JA 1NCQA 5AFEA 2Y6GA 1MEC3 1W04A 3AMNA 2FQPA 1AHSA 1JOPA 1LOGA 2WUHA 5L7OC 1C8M2 3BIEA 2QQMA 2VBBA 5KC5A 1IZ3A 2QJVA 2BQPA 4I09A 2WNVA 4MO3M 4LBQB 5FOBB 5KXBA 3C7EA 3ZFGC 1UMHA 4D6QA 5FO9B 1AYN1 5HCAA 1IKQA 1RMU2 2F4PA 1SLBA 3KCXA 3NV2A 3WQ0A 1TNFA 1V6KA 1N1TA 3AP9A 4ZHNA 3WNKA 4CPBD 2GMMA 2RE9A 2JICA 2W87A 5C9AA 1LECA 3P3NA 4K8FA 1AZDA 5A7QA 2ZX1A 4R52A 1V9U1 5SV5A 5KHIA 4NAOA 2HWD1 2HYXA 2WQZC 5FDBA 5LA1A 4OLLA 4CEWA 1SLAA 2AUYA 3POWA 4UT5A 1GUIA 3HBZA 4Y1VA 4DB5A 5CFCB 4YG0A 3MF9A 2X5IA 1W2TA 1W6PA 3AZXA 2JDNA 3BIWE 3FHIB 2BVVA 3JD72 3UV9A 4MX3A 2E31A 1FPN1 5FZGA 5LA9A 4DUVA 2FMDA 4CEYA 3WV6A 1NAEA 1QF3A 4RFRB 3VDAA 4XUOA 3JUUA 5JOXA 4BE3A 3H50A 4XUTA 1BMV1 2W1SA 3NO8A 4CCNA 2VZOA 3A4UA 2ZX2A 1RUG3 4YSFA 2A6XA 1D0HA 5KXCA 5A3PA 1W2UA 3POSA 3ZYIB 3FN9A 4K1YA 2Q5TA 5J48A 3IIAA 2DTYA 2XLGA 3WNPA 1ULFA 5F5QA 5CG8A 3T2OA 5C4WC 2OZJA 5F5AA 2K2SA 2WFF3 1G9DA 5ANNA 3S30A 1UWWA 5FJKA 2R30A 4LOTA 1U5IA 3TN91 1AF9A 1ST8A 2BJSA 5BNNC 2ET7A 2R073 1URXA 4QPIA 4CU9A 3KSCA 4N7UA 3WDXA 5ERLA 4CP9A 5L73A 1RIRA 2UYAA 2BYVE 1GBGA 2I07B 3LEKA 2OS2A 3GHNA 5I8YA 2F17A 4N43A 1V6OA 4ATEA 2JE8A 3BVCA 4IEZA 1W6QA 2JJ6A 4XF3A 3OPTA 3GYDA 3BPZA 1APNA 1CJDA 5JXJA 2OKXA 4ASKA 5IW0A 3U75A 4AWDA 4QM9A 4PBPA 2Y6LA 4DMIA 4UWDA 4DINB 4HXCA 1E57A 5GLWA 1DGRA 5A7WA 3S7IA 4I3GA 1WKYA 4FVVA 4MHUA 3SMHA 2AGSA 2FZ1A 2VPVA 1GR3A 1XRUA 4IQPA 1S2BA 4PI0A 3LGRA 3BUCA 4CCDA 2VU9A 2ZGRA 1A8MA 4DPNA 1Q56A 4NROA 4Z2AA 1LEMA 5A1FA 4BXFA 4BLIA 4IUGA 2O1QA 3EHKA 4LPLA 2J7MA 4DXRA 1JXNA 1WLDA 5DPNA 3KB5A 4Q1RA 5AVPA 1NA1A 3RJ2X 3WINE 4AEKA 5LA0A 5A3LA 2WNEA 2A75A 4LUMA 4XAEA 4JQRA 3MFAA 4LOSA 3TAYA 4XIOA 1W2OA 3I3DA 1DDLA 2XJQA 4AVAA 3BN6A 4XEZA 4WM8B 1L7RA 5T5LA 3VD7A 3AKPA 2LW8A 2WZEA 3WQ1A 3WT3A 2WLPA 2HWB3 3PMEA 4KWJA 5F6KA 5FIXA 4QU2A 2DVGA 2PFWA 3V56A 1ND3C 4XACA 4IE5A 4OZOA 3T1LA 4IEOA 2WINB 3ATGA 5FZ7A 1Q8PA 4NMIA 5FYYA 2WZR1 3IPVB 4MXWA 4JGZC 4M01A 3RPQA 2QDRA 4RHV1 4AFAA 3EYPA 4AI3A 2QVSB 3JU9A 1ZZCA 4BLJA 5LK7B 5CKMA 2GAUA 1U5ZA 3AYCA 4S2FA 3A7QA 2VXJA 3I3EA 4B29A 1CAWA 5FZ9A 1JS9A 2W3JA 4Y5SA 1X9TA 4LITA 2BW8A 1AR83 2TBVA 1AR72 1V70A 3BTXA 2V5YA 2JDYA 3WOGA 2H6CA 2CU5A 2WN2A 1VRH1 1YFWA 3ECQA 4Q8KA 1ZRCA 2VUDA 2IFRA 3LF7A 3DKWA 2XUMA 4LBMA 4RHV3 1CGPA 1DF0A 2G1MA 5FCCA 4IE7A 5JDBA 4GH4C 5BNOB 2HEVF 1XE0A 2MEV1 2GC1A 1GZ9A 2RV9A 1OUXA 2EIBA 3VDDB 4BK5A 5I91A 2OPKA 4XURA 1PZ9A 5LK5A 3VBSA 1LAJA 4GZ9A 2WSVA 4NHKA 2G4IA 5H9SA 4IEYA 1TME3 4YFZA 2ZAHA 5CBLA 3KD4A 2OIIA 3I54A 3MICA 4Y22A 1UIJA 2QDNA 5M0TA 5ACA2 1OF4A 2JD4A 3CHXA 1UAIA 2CDOA 2CWSA 4OVEA 1L3JA 2ZGTA 4P9WA 2P6HA 4B4PA 3UT0A 4EN6B 2VCBA 3AKQA 3ILRA 5FZLA 1JN2P 4PIYA 1HRV3 5A33B 4COZA 3MLLA 1QOOA 1GP6A 4IV3A 1CPNA 5IK4A 2W39A 2D97A 5FYTA 1WCKA 2P3IA 4LBKA 4AF9A 1VAKA 3OUIA 3POIA 5L7OB 2XOMA 2ZMLA 2R1DA 5JMOA 3H8UA 2WNUA 5CISA 5FBJA 5GZDA 3IDAA 4XF4A 4DZGA 5FYCA 5D1IA 4W50A 3WZ1A 1PIV1 4Q4Y2 1NXMA 1VBB2 2VR4A 3B02A 3A0KA 4QHBA 4CUCA 4IETA 3BPSA 1RUI2 2ES3A 5FXZA 1AVBA 1VBE3 3B01A 5FLJA 1EV12 1AJKA 2C9KA 1WCDJ 3BYWA 3LIHA 2VTXJ 3SHRA 4EWEA 4M3CF 2Z79A 3AC0A 2H0VA 1MS5A 3OBAA 1N3PA 1YO8A 2X53S 2IVIB 5FTTC 1UPIA 3UYJA 4DUXA 1NCRC 1QH7A 5EJ3A 3AXEA 2HEYF 3WQ7A 1JUIA 1WZXA 2BGOA 3PU3A 4JRLA 3ZXFA 1KITA 4JKKA 4Y3OA 1GFF2 2JE9A 4B8EA 1JYIA 1AR63 1K5MC 3NNFA 1QJX3 1WCUA 2Q1MA 1PVC2 2IC1A 3KT4A 3BKZA 4GXLA 3UKVA 4XMAA 5GZCA 5KBFA 1N3OA 2O14A 4ASMB 3NJZA 4C0HA 4EN8B 4LQRA 1CIYA 3VDCA 2VZQA 1QU0A 2QFEA 2VAUA 4FP3A 4AQ2A 2B7YA 2VJXA 3ZSKA 4D3WA 1GLHA 4QM8A 1W2NA 3OJBA 4D7TA 1QNYA 5GLZA 3RNSA 4IERA 4GMP1 4IXLA 2JDUA 2C24A 1JW6A 1AR91 2AC1A 4MOAA 5IK7A 1QOTA 2YPDA 5BNNB 4NHXA 3ILFA 3GHMA 1NY71 2W1QA 1Z78A 1D4M3 5FYVA 5FYIA 3R6SA 1TVGA 1W9YA 4QB2A 2GMEA 4LULA 1J3PA 1O3RA 2PQQA 5T55A 1H6YA 4AGRA 5FY1A 2QQVA 2PLV1 5F32A 1ZA4A 3G6JB 2J42A 2YXSA 3MW4A 3V0AA 4OULA 5FUNA 4X8NA 4IEQA 5FQ0B 4MVTA 3ZPYA 4GMP3 2HWC2 2CWMA 2GSYA 1AYN2 3T2PA 2GU9A 2OPWA 3PU8A 1XSQA 3KQ4B 2D44A 3TEZA 3J7HA 3THPA 2WWUA 4XDOA 3KT7A 2FDIA 1MZEA 2GH8A 2ZZQA 1VB2A 3ST7A 2XBO1 1HRI3 1V9U2 3ASIA 5L9RA 4OMCA 3VZNA 2HWD2 3I2KA 2HKXA 3NNJA 1Z0HA 2PLV3 4CE8A 3TEWA 1PO13 3N35A 5FAXA 5HXMA 3HAGA 2QQNA 4EROA 1O5UA 2IXKA 4QGMA 5F9TA 1RUE1 1QOSA 4ZY9A 3MYXA 3P1IA 4HSLA 1NXD1 1LHWA 3SCFA 4BH9A 4FOWA 1W9FA 1WBLA 3WG2A 2FDHA 2FZ2A 1X33A 4KI5M 2BV4A 2W0XA 3LA2A 2XXZA 3VBFA 3BCWA 3WQBA 1COV1 4W65A 1POV0 2PTMA 4G3YC 4R9BA 1RVF1 4KWLA 3B9IA 1W6OA 3LPGA 1W2AX 1S55A 4WVMB 2GNBA 4C8DA 5HCHA 3VL8A 4RN5A 3AZZA 3W5NA 4OUMA 4RL7A 3ZR5A 3GBFA 3S5AA 4MYEA 1OH3A 1NX9A 1H1AA 1RUE3 2XLAA 1VBC2 3ACFA 2YB7A 3H3ZA 1LOCA 2RS12 4KU7A 3ZYBA 3AMHA 4OQ9A 4U36A 1RJ8A 1YC61 3KV9A 4Y26A 4XABA 4CVUA 2A5ZA 3Q8CA 1DIWA 1TMF2 1V6LA 4YZ4A 1GQPA 1JZ6A 3M3EA 1COV3 1REFA 1VJ2A 5IT6A 1IPJA 1WD4A 1JYXA 1CAUA 4A3XA 1RHI2 2R0FA 4DRVA 3GZTB 2JG8C 4JGZB 2GH2A 5A7OA 3ZDVA 1XNAA 5DAXA 3PIJA 1SQ4A 4A7KA 4CCJA 5LRSA 3KVAA 4WVVA 2BRTA 2DVBA 2ZOEB 1O3TA 3RZZA 4NJ4A 1WMXA 4Q4W1 3DKQA 5K0UA 4I0WB 1DQ6A 2YFUA 4FP2A 4L92A 3O5SA 3ZFFC 1FMD1 3ZXAC 4XBLA 5FZ3A 2RDSA 3T2TA 2PYTA 2IXCA 3D6EA 3TRSB 2Z69A 2WO1A 5C3RA 4Q4X1 4QQPA 4UFMA 1HIXA 1OPMA 3ZN6A 5FYHA 3B94A
chains in the Genus database with same CATH topology
3WDWA 5FBZA 1OOPC 1YRZA 1VAVA 3FX3A 1HQNA 4LBQA 3PHMA 1H2MA 1WD3A 5I8SA 4Q4W3 3RMYA 1QXRA 4GH4B 3WCSA 3P3PA 2PAEA 4ISQA 3ELNA 3LA3A 2A7AA 1KFUL 1C8M3 4HN0A 2WFPA 1V00A 3SLIA 3FLPA 4PBOA 2WSUA 3S7EA 1QJZA 4XILA 1GYKA 5J37A 4Z07A 4B3NA 4PIZA 1ZM1A 4XFAA 4CRQA 4Q0SA 1GKBA 1HQWA 2C1FA 3EO6A 4TYSA 5DDJ3 1WW5A 4JTOA 3MLJA 3GBGA 4IV1C 4E4SA 4L97A 3O12A 3VBUC 2Q8OA 1NYWA 1N1SA 4OI4A 5JPNB 1IHMA 1R091 4N9HA 4E9KA 2IXIA 2IXLA 3VBHC 3ZN5A 4FBFA 1RINA 1AX0A 3JD73 4K7JA 3VBRA 4FCAA 4O9GA 1VBD1 1B35C 1UMZA 2D6KA 1RITA 2PN5A 2FMYA 2ET1A 1XXNA 3I4IA 1YYNA 3JQWA 4I01A 4LUKA 1AX1A 1I1EA 1M06G 3VKOA 4PQ9A 1PNFA 2SLIA 2PHLA 1KRIA 1RUJ1 2NPIA 2OA2A 4L2NA 2A3YA 2WS91 2P17A 2MHFA 3HQXA 3WDTA 1BEV3 1HXS2 1WGPA 2DWRA 1B09A 1VRH2 4I0AA 1BZWA 1NCRB 3UKTA 1VBD3 1DHKB 4NR1A 1N47A 3R4UA 1LULA 5ABJC 4OUSA 4AEDC 3OGJA 2XVKA 3TNPB 3VZKA 1RUJ3 2XL9A 1RL3A 2HWF3 2FHRA 4BHPA 5DUXA 4YW5A 4RQPA 4JAAA 3IT8A 3CF6E 5BNPA 3QD6A 4AQ6A 3WW1A 4IESA 4GWNA 1R081 3K48A 5DZEA 3G7DA 3IDBB 2ZS6B 3MFCA 1I9RA 3MGUA 2R042 4JGYA 2KXLA 3E5QA 3FFZA 1VALA 1XYPA 4RS5B 1ZYBA 4FPJA 1GZWB 4QPGB 2JG9C 5E1RA 3AKSA 4Q4V1 4BQ1A 2IZWA 1F5FA 5HBAA 4MLOA 4XE9A 1VAMA 1R083 3JZVA 3WNXA 2HYKA 2MNGA 3D5OA 4GQ7A 4L99A 4AK3A 3IBMA 1Z7S3 2EALA 5C6CA 1EYBA 3IPVA 3TOJA 4P9XA 5FRAA 4FPOB 4FQ4A 5C33A 1FOD2 1SLCA 1AL23 1H0BA 4YW4A 1LHNA 5A32B 4CDUC 2GDFA 1S0EA 3ZXKA 3AP4A 1Y43B 1ZBA1 3ZFEC 2OYZA 1C3HA 2IXJA 3LZZA 1REDA 2PA7A 1RUD1 1Y3TA 2JENA 5JZGA 4M3CB 4KH9A 4Q8LA 3FMGA 2XG3A 1CR7A 3LCPA 2BBVA 5IK8A 4OHXA 4ZU7A 5C8CC 4D7YA 4YW1A 1NOVA 3Q9OA 4LBOA 5BNOA 4LE3A 3R4DB 3VDDA 1DQ0A 1LU1A 1QDOA 4FSJA 1U12A 4XMIA 1NY72 1RUD3 1SLIA 3LSEA 2K9ZA 3QOPA 3FC0A 3N4MA 2DCYA 4F7ZA 3AYAA 4CTEA 1R1A1 5A33A 4COVA 3ZFFB 2Z42A 3DV8A 3ZYGA 4Y24A 4CP2A 4XETA 4X6RB 5I0TA 4AG4A 4COYA 3V0BB 3J26N 1BBT2 4ZU4A 3BTAA 3OCPA 3J8F2 2RR12 5KHGA 4LT5A 5JSOA 2BNMA 1LOAA 1PGW2 2XBO2 4FOQA 3HT1A 2A73B 4H14A 3MPPG 1H2KA 2BNNA 3OYWB 2EF6A 4X8PA 4AYUA 3ZO0B 4LTAA 3E97A 1QMJA 2WT0A 1MEC1 3DPRC 2WT1A 4HL0A 5T5PA 1HX6A 1DGRN 3IN9A 1RUC2 2VOKA 4XIKA 1LOFC 1ZZ8A 3I8TA 4OI0A 2E9QA 2GNDA 4NOTA 5AFBA 1RVF2 3ZMNA 2A6WA 1V6MA 5D8AC 4FXGB 2NZ9A 4XF9A 3LAGA 5GZFA 4PF5A 2Q0AA 1VBA2 2GZWA 4Y20B 5HCBA 3B69A 4IV1B 3UKNA 2DCZA 4FPEA 3GZAA 1WA4A 3MIHA 1FT9A 5GLTA 3E5XA 4NPRA 2D40A 2V09A 5JLVA 2UWBA 2TEPA 1PO22 3OGGA 2OZ6A 2WIIB 2P3KA 5J98B 5KWRA 2RJKA 1CN1A 2B42B 1B35B 1QKQA 1SBDA 2XJPA 3AZYA 3WP6A 2OW4A 1PVC3 5AC92 4Y4YA 4FXKB 4GULA 4XQ4A 4IEUA 1RUG1 3PVBB 3ALQA 4XBQA 1MVQA 1OQDA 1S0GA 1C1LA 3EXUA 3M2MA 3VZJA 1EAH2 1LODA 1BJQA 5CA6A 4Y5Z0 1UKRA 4PDWC 3NKGA 3C3VA 1IS3A 1MS8A 2BEOA 2WFF1 3ETQA 4JVAA 4HFSA 2NM1A 1RUF2 4F3JA 1S0CA 1Q3EA 5C8WA 2B8MA 3W59A 1SMVA 4YVSC 4AVTA 2R071 4XF1A 4AEDB 2YZ4A 1FATA 2W68A 4JV4A 3O14A 4LBLA 4CDWA 1OI6A 1DYPA 5CFDC 4G4FA 1QJY2 4FTSA 1H8TC 4P9LA 4YVWA 4XBNA 3I7DA 3APBA 3WR0A 4LO5B 2HWC3 1IOAA 4K21A 4EJRA 1O7FA 1W6MA 2RMU3 2CYFA 3VHOA 3ZX7A 1A3KA 1VLNA 2WZPP 1NCQC 2UURA 2ZHNA 3KLSA 4AI8A 3KQRA 5T3NA 4LBQD 3HN1A 1BCXA 4WVMA 2XJUA 1LTEA 4CDXB 2WNVC 2PHXA 1O3SA 3KT1A 5H9RA 1G9BA 4GKYA 1I3HA 3USSA 4UBHA 2EVXA 1LJ7A 5C9AC 2R061 4LA2A 2UWCA 4XYXA 1ASJ2 4CEWC 1NE4A 1KQRA 4U2AA 2WS92 5GLVA 2X5IC 2ZGUA 1C5HA 4DXZA 2VNRA 4HETA 2ZACA 4CEYC 5J96B 4CDUB 2RS32 4AI2A 2ZGPA 4QXKA 4YGDA 3ZFEB 2HWB1 1SFNA 1ULDA 1TMF3 1LENA 2AREA 1ONAA 2DV9A 1SCSA 2R063 1LESA 2UY9A 4J1XA 3VBOA 1TE1B 1J58A 1A78A 1RHI3 1TEIA 4R8HA 4XFFA 3WXPA 4DNYA 2XGXA 1ND2B 2DFBA 5B2GB 1D2QA 5TSWA 4AQSA 4RA0A 3WDYA 3U10A 1H9PA 4FOVA 5C8CB 3D82A 1GZCA 1QJU1 2CNAA 1W6NB 1AR81 2VGDA 1UU4A 3ZYRA 4S2HA 2JDZA 3AP7A 3JBG2 3QACA 3TWIA 1MQTA 3IMNA 1CVNA 4N43C 3AKTA 5FPZA 3DGTA 2E7QA 3SCGA 5T54A 4URTA 1LKNA 4EWAA 5JOYA 4HBNA 5AVAA 1QJU3 1PK6B 3EJKA 1IGOA 4XFBA 3WUCA 2UU8A 3PVNA 5DG1A 2WT2A 1TME1 1W39A 3SXWA 4K3UA 5CNAA 1ZZ6A 1YXWA 2XWBB 1I6XA 4KG8A 2I74A 4O9EA 1ZZBA 4AHWA 4ATFA 1V6IA 5KXEA 2PHUA 1C4RA 2F6BA 1HRV1 4GMP0 3QCWA 2UYBA 1FAYA 4XDQA 1AL0G 4BPZA 1Q8QA 5CVRA 1PGL2 1ZBA2 4MGIE 1MACA 1NA1C 1C28A 1N3QA 3B9CA 2CAUA 1SDWA 3I59B 1YLLA 4BIFA 2GALA 3IDEA 2HWE2 3GZUC 2CGPA 5D8AB 1NCRA 1S0DA 4YARA 1PMIA 2ZCWA 3O0WA 1LCLA 5H9QA 5JIUA 5GZEA 3ZSMA 2VVFA 1CAXB 3PLQA 4BMBA 1KXGA 4I3PA 1VBE1 4W6YA 5IK5A 2XH6A 4XJWA 1DYKA 2LUWA 3UL2A 4XJ9A 4PLOA 1HXS3 2G9GA 4OHWA 1XE8A 3MF6A 5GALA 3ZFGB 3TNQA 2O0OA 2VW0A 1ZNPA 4KNCA 1AR61 4OI2A 1QJX1 2WKKA 3H0OA 1CAVA 4SLIA 1F9KA 5EYXA 1R1A2 1EPWA 5CU1A 1VR3A 4DQAA 2RM21 4KGGA 4CDQA 4PDWB 4RS5A 5FMOL 1GZWA 4QPGA 1CX4A 1O5LA 3CJIA 1J3RA 1AYM2 3ZXJA 3HWJA 2YV8A 1ZBE2 4RGGA 2WLQA 3CEWA 1LGCA 4YVSB 3ZXDA 4L8QA 4Y1ZA 1D4M1 1BQPA 3VBSC 1XU2A 2EXJA 1MEC2 2VVEA 4Q0QA 4DS0A 5JPMB 4N53C 1YJKA 3FBMA 5CFDB 1YFUA 1AXYA 1KJRA 1QQP2 3VL9A 2RM23 4GB32 1MR5A 2ZGKA 5C4WB 2WL1A 4KG0A 1H1IA 5A32A 2PHTA 2VQ0A 2IFWA 2XJSA 1OHFA 4DRRA 4AGGA 4IV3C 3J4UH 3BOPA 1NCQB 1J1TA 3AK0A 1QY4A 1IPKA 2ZMKA 1HRI1 4XTPA 4MGKE 3K51A 2WNUC 5DUVA 4M3CA 1UX6A 2CY6A 1HLCA 4V1PA 3TBDA 4YM0A 1Y9QA 4YG3A 5I8TA 1PO11 2WNVB 1SFYA 2R6QA 1ZZ9A 3M70A 5JSPA 4YM1A 2PAMA 2ZA9A 1UD1A 1XQNA 3N7KA 5KHKA 5J36A 2PHWA 3D0SA 5C9AB 4AXOA 1UL9A 1ZREA 4L9BA 4LO7A 4JC1A 3H3UA 2VMHA 4CEWB 4X6QB 1CD3G 3W9AA 1D4VB 4WM7A 1FV3A 1W6PB 1RUH1 1GNZA 2VW1A 1CIWA 1WUVA 4CEYB 4ASLA 4IL7A 1UKGA 3IM0A 4YW3A 4MGYE 1FPN2 5FO7B 2EA7A 3ZFFA 1JTZX 3ZN4A 2AENA 4MZUA 3RI8A 3ES4A 1X82A 4UW3A 4YGBA 3WW3A 5FLIA 1Q43A 1ZX5A 1BMV2 4RR3C 4EN7B 5JOWA 1I5ZA 2E53A 2DYCA 2NYYA 4B4RA 5DZGA 1U5YA 4H7LA 1RUH3 1WW4A 4XJAA 1XYNA 3SNMA 3S0MA 2JXAA 5I0RA 4R4XA 5T5OA 4K40A 3E6BA 3KM5A 1RGSA 2JKBA 4LBJA 2E7TA 4XFCA 3TN92 3LOBA 2E51A 4M0HA 3A0NA 1YNAA 1BBT3 3AMMA 1ND3B 1V6NA 3KZ4C 2RS53 2RR13 1LHUA 3ZIWA 3RSJA 4GKXA 1D2SA 4N43B 3SITA 4FTBA 3ACLA 1H1MA 1U5XA 3H1WA 5T50A 1PZ7A 3AZVA 3WG4A 3LB9A 3EBRA 5HXVA 2ZX0A 1GV9A 4Y20A 1Q5OA 1HW5A 4IV1A 1C8M1 3MPBA 1MZFA 4HLTA 1YCIA 1RUC3 4CZSA 4FAGA 4FPGA 4XFHA 1FX5A 4XHXA 3ZYJB 5JI9A 3LA7A 2VVDA 4H55A 5BXXA 3W58A 2DCKA 2B9UA 2ZKNA 3H1MA 4Q26A 5DDJ1 3MIDA 1D0GA 4EV0A 2VMIA 1NA1B 1S0FA 3VBFC 4OHZA 2DCTA 1X36A 1GNHA 2A6VA 3O0XA 1YFXA 1PO23 3JD71 1Q8OA 2V73A 5CFCA 1RMU3 3UJOA 4FT8A 1KJLA 3OF1A 3RRDA 5AC93 5F1RA 4RGAA 2XPJA 1IS4A 2DUQA 3VN4A 2A71A 4GIQA 1AXZA 2BWAA 1NLRA 5L19A 3E6DA 4N7IA 1XU1A 4XJUA 4HKOA 3ZXLA 1AR82 1BEV1 1N1YA 4P9JA 5FOJB 3JB8A 4MXWB 2D5FA 4QGLA 5E88A 3JB4C 4Z1VA 2WZR2 3ROUA 4PCRA 4Q27A 3ME2A 3FWEA 3PTYA 4RHV2 1S0JA 1UZZA 4QT6A 2GMPA 5K0UC 2B5HA 3FE5A 3WVJA 4KGQA 3VGIA 1X7NA 2ENRA 2XJTA 3FBYA 4FQZA 4K1ZA 4P9GA 2HWF1 1QJY3 1SLLA 1TME2 2VQAA 2ZHLA 3GBWA 3H9AA 4JDNA 3N7JA 1H4GA 4CDXA 4R4ZA 1WLTA 4OI1A 1AXKA 3M3QA 3M1HA 4W6WA 4AVCA 1F5JA 1O3QA 4YM3A 3NW4A 2DTWA 1VIWB 3JQXA 1K5MB 4M00A 5DXDA 4E27A 1YWKA 1KDKA 2QZ2A 2MEV2 3VBSB 3OTFA 1AUYA 2P37A 2B39A 2D3RA 4N53B 2XB6C 1POV3 2ILMA 3ZMOA 4HPKB 1YIFA 4WZFA 2XLFA 2UWAA 3CU7A 2YDEA 1DGWX 1BVP1 1OFSA 2C9AA 4AHXA 4YM2A 5J7MA 4ZXKA 3U0ZA 2FBEA 1FNYA 1BKZA 1ASJ3 1Z7S1 2XHKA 1Y7BA 1G7YA 2EIGA 1VBE2 2BNOA 4TLFA 2WNUB 1ND2A 5BV6A 3VHPA 2Y0IA 4QQHA 4YW2A 1AL21 4AI1A 3VBRC 2RJLA 4COUA 1OLQA 4LHLA 4WM8A 1UN1A 1YI7A 2DVFA 1IS5A 1JOJA 3N7MA 1PIV2 2PHRA 4YLZA 1RC6A 3R4SA 3VLBB 2E6VA 4AHYA 1W0PA 2Y26A 4FPLA 2XJRA 2VG9A 4XOGA 4AFBA 3N3HA 1C1FA 2QCSB 1J1LA 1Q8VA 2AH2A 3NAPC 5F9TA 1OA3A 4B4QA 2X29A 2ZZJA 1LU2A 1UW8A 5GZGA 4ORFA 4RD7A 4FOYA 5JWPA 3MDPA 1BXHA 2WA3A 3NV1A 4LO8A 4WBBA 2BFUL 1PK6A 5GLUA 2XVGA 3JBG3 5DUWA 1FYUA 3M4FA 1UPSA 2XKOA 2RHPA 4ITCA 4Q0PA 4RR3B 3B00A 1FNZA 1DQ2A 3CJXA 2GN3A 4E2QA 1S0IA 4HSJA 4RQPC 3NSTA 1A6CA 3AXDA 4DY5A 5BNPC 3ZSJA 3TB0A 4E2SA 4A7YA 4K20A 2ZMNA 1EPZA 2PELA 4UXAA 1G6NA 3O7OA 1SLTA 1TQ5A 1YFYA 2CV6A 1AR73 1SBEA 5CAZA 1AR92 4MGZE 4PIXA 2NQYA 2GC0A 5ACA1 4JGYC 4F83A 4MUVA 4N9IA 1QGLA 2JG8B 5K7PA 2BGCA 1H9WA 4Z82A 1LR5A 1UU6A 2PLV2 4D7SA 3ES1A 3OD4A 3T1MA 4TZDA 3AMPA 3B3QE 3RI9A 3WP3A 1CAXA 4WV8A 2WJSA 4C1WA 4IEXA 4P5HA 5CB7A 5L7OA 5LEJA 1RJ7A 3VZMA 5ACA3 1BVVA 2OVUA 1KFXL 1HKDA 4XFIA 5KHHA 2HWE3 4AQTA 4EN0A 4XQWA 1OOPB 4CP1A 3R05A 3H7JA 3ZFGA 3PMSA 5EFUA 1VBB1 5I0SA 1RUI1 4NVPA 4QQ2A 1RUE2 2Z2SB 3QH7A 1RUNA 3AP6A 1QNWA 4XFGA 3VBFB 3E5UA 4AVBA 3NKTA 1R1ZA 1REEA 1SEFA 5JZGC 1W6OB 1COV2 3QBQA 4TWTA 5FMOS 4YYOA 1HV1A 4AVSA 3JCIA 5CADA 2NLRA 1C57A 4Q4Y3 1KS5A 1VBB3 2QKDA 3U11A 4AEJA 1MZ6A 4KQ7A 1PVC1 1RUI3 5BNOC 2GN7A 2ATFA 1EV13 4N90A 3KS7A 2H6BA 3VBUB 4BWOA 5DG2A 2D3PA 4YNIA 1CAUB 4QGNA 3VBHB 5BY5A 5H9PA 3FLRA 4SBVA 5C4WA 3DF0A 1WBFA 1YJLA 2D5HA 1U0AA 2OUHA 4FPFA 3I2DA 2QZ3A 5K0UB 1OPOA 1UZYA 4L11A 4Q4W2 1NQDA 2DVDA 5BNNA 2DU0A 2IXHA 1FMD2 2E63A 2ZJCA 4XZPA 3V64A 4RSUA 3VKNA 3ZN6B 3FZ3A 1ENRA 1DZRA 4Q4X2 4BOWA 5LRRA 3FFQA 3J9SA 1QQP3 4GB33 3ZIXA 4XF0A 3MW3A 2D6MA 2DU1A 1LHOA 1EY2A 2HWC1 2CL2A 2KA3A 3VZLA 2CGNA 5FQ0A 5ABJB 2RMU1 1GICA 5DDJ2 4B7KA 3NV4A 2YYOA 2ZX4A 4FPCA 1C5IA 1H30A 2VY0A 2CGOA 3IWZA 1QXPA 2B45X 3LKJA 5A3MA 1LGNA 3LWCA 2KM2A 3PVEA 5GM0A 5BUVA 4OFGA 4XXPA 5J09A 2ARXA 1AYN3 1KD7A 4Z2WA 3UJQA 1SCRA 2WQ4A 3L2HA 2ZGSA 2GNMA 1OQ1A 4UW5A 1ZRRA 5JSRA 1V9U3 1JHNA 4Y1XA 2HWD3 3D0JA 4UBGA 1WMDA 1PVXA 1GQGA 1QHDA 1R092 1PHMA 4Y1YA 1BEV2 3SCHA 4A7ZA 2QUOA 3VBRB 4IEVA 5KC6A 3OD0A 1VBC1 2JG9B 1QDCA 1OA4A 2RS11 2P2KA 1YHFA 1FPN3 3DN7A 4FO9A 4Y1UA 1VBD2 2R32A 1TMF1 2YC0A 1G9AA 2ZABA 1ND3A 1RHI1 3QLQA 1RUJ2 4E4ZA 1OSGA 4OHVA 4W6XA 4JGZA 2HWF2 2ZGLA 3NAPB 3HD8B 1CESA 1NLSA 1VBC3 4AVVA 2RS13 3NVCA 2WA4A 3FUQA 4E4DX 5JCTA 4KL1A 1XE7A 3TN93 1DGWA 1G8WA 1SACA 2ETEA 1J3QA 4FPYA 1GANA 1ZRDA 2C0ZA 1YIPA 1MS3A 5K9YA 3FJSA 5DUUA 4P9IA 4CDWC 1O4ZA 1DG6A 4WZCA 3AZWA 4YVWC 3VHRA 4RQPB 4MSVA 4LHKA 4COWA 4XHBA 5F6LB 3B7MA 5BNPB 2TNFA 3VKLA 4K6BA 1UIKA 4GH4A 4QD2A 4J6GA 4HANA 2VOVA 1R082 3IDCB 4R9DA 2AR6A 4QQLA 4QPIC 1WLWA 2BWCA 4JGYB 1Z7S2 2LALA 1H2LA 3AFKA 3WG1A 4ES9A 1O4TA 2Y38A 2Y0OA 3RYRA 2GC3A 4AW7A 4LEJA 1AL22 2VUJA 4YGEA 2YMZA 3EQEA 3VV1A 4Q4V2 1OMIA 2ZKLA 5J3UA 5E8AA 1H2NA 2GC2A 2VW2A 3IKWA 4AEMA 1F8VA 2D43A 1CONA 2W08A 4XPVA 3L9JT 2DURA 1ULCA 2D6LX 4HK9A 4NWWA 3LSDA 2YGMA 4BIOA 2D6NA 5JIAA 2CTVA 3BU7A 2QE3A 5JVVA 4Z92B 3DPRB 5FREA 3M7AA 3VBOC 2VOWA 1N1VA 1HXS1 2NMOA 3DUIA 3KGZA 5JZGB 2ZGMA 4Q0VA 2Z5WA 4EWDA 2WZR3 1RUD2 3OY8B 4NHLA 1LHVA 4M3CE 4BA6A