1EP0A

High resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
183
structure length
183
Chain Sequence
EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dTDP-4-keto-6-deoxy-D-hexulose 3,5-epimerase from Methanobacterium thermoautotrophicum complexed with dTDP.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Isomerase
molecule keywords DTDP-6-DEOXY-D-XYLO-4-HEXULOSE 3,5-EPIMERASE
total genus 44
structure length 183
sequence length 183
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2000-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ep0A00
1XRUA 3BU7A 1Y3TA 2XL7A 3E5UA 3PLQA 2D5HA 3LWCA 5K8SA 5HI0A 1J58A 4IESA 1UIKA 4BIFA 1UW8A 3IBMA 3LA3A 3NKTA 3H1MA 1O5UA 5I0UA 1X8MA 3OGJA 2C0ZA 4IEOA 4D7TA 3BB6A 5E1RA 3H1YA 4MZUA 2P17A 1ZZBA 2UY8A 3O14A 1TQ5A 3M70A 1QWRA 5I93A 4WBBA 1CAUB 4QM9A 3FX3A 4FT8A 3OF1A 4WVZA 1YFYA 2GC0A 1HW5A 2IXCA 4IEWA 1O4TA 4ORFA 3ES1A 3TNPB 4XFGA 4NVPA 2Y0OA 3HT1A 4L2NA 1NE6A 4O9EA 3MPBA 4ZU4A 2PAMA 2HJIA 4EV0A 5CU1A 1DGRA 4MGIE 1J1LA 1LR5A 1OFNA 1YHFA 1ZZ9A 3E5QA 3NJZA 4O9GA 1CX4A 2FQPA 5I0TA 2Q4SA 3OTFA 5BY5A 3DN7A 5JSOA 3ST7A 3BCWA 4Q0SA 3TNQA 4L11A 4A2UA 3H1WA 4I3PA 3OCPA 3U11A 2B9UA 1YFXA 2XLGA 4MGZE 1VJ2A 3GBFA 4XF0A 3DKWA 1H1MA 3I54A 3CL1A 1X7NA 4IEXA 1J3RA 4YRDA 3RDIA 3U0ZA 1Q5OA 1RC6A 1J3QA 4AQ6A 5FPXA 4PIXA 2PTMA 4BH9A 1CAVA 4XEZA 3PVBB 4I09A 1FI2A 3EO6A 4JTOA 4I0BA 2F4PA 3UKTA 2XKPA 5FCCA 4HSLA 3HIFA 4HZFA 4AVBA 4IEUA 4J1XA 2EVXA 2QDRA 2E9QA 4IEPA 5LRSA 4QGNA 5FQ0B 2OA2A 4BHPA 4IETA 4XFFA 4LA2A 3FFQA 1ZZ7A 1PM7A 2B5HA 3IWZA 5AVPA 2HKXA 3S0MA 2XKOA 1YFWA 3E6BA 4TLFA 4LEJA 4YNIA 4MV2A 1YWKA 3KGLA 1RUNA 4META 4F8AA 2BNMA 5BV6A 5KHIA 2VECA 4MGYE 2QJVA 3SHRA 3WW3A 4LULA 2QNKA 4JVAA 2PYTA 3ES4A 2H6BA 4BYYA 3LA2A 1FXZA 4I0AA 2N7GA 3LZZA 1OD5A 4QMAA 1PMIA 2Z69A 3QOPA 4AXOA 4XF3A 5JSPA 3BALA 2Q30A 2BEOA 4PJYA 2XL9A 4R52A 4Q0QA 3OD0A 1I6XA 1EP0A 2GH2A 1YLLA 4QXKA 1CGPA 3H9AA 2Q0AA 4E2QA 2KXLA 1DGWA 5KHKA 4QGLA 1ZRRA 1NXMA 3I59A 1X8EA 3ACLA 4OLLA 4XF1A 4IEYA 3QACA 1ZZ8A 1SQ4A 1CAWA 4QGMA 3FHIB 3CLPA 1CAUA 3U10A 2O8QA 4IERA 4YSFA 4IEVA 1YFUA 4K8FA 2QCSB 3ROUA 3ZDSA 5I91A 4N9HA 3IDCB 1GQHA 3H7YA 2QVSB 4EROA 4FAGA 3H3ZA 4XFCA 1QY4A 4R8HA 1ZZ6A 5JR7B 4FBFA 4LUKA 3RZZA 2GC1A 1O7FA 4HVOA 4EWDA 3E6DA 2OPKA 4WZCA 5BPXA 1X82A 4UXAA 2GZWA 3MDPA 2BYVE 3NW4A 5FDBA 5I8SA 2PFWA 1O3QA 4N9IA 4YYOA 2XLFA 3NL1A 4QX5A 1ZX5A 1XE8A 2OYZA 1UD1A 5FLIA 3C3VA 2D5FA 1WA4A 2H6CA 3GYDA 3VHRA 1O3SA 1NE4A 5E16A 2BNNA 3UKVA 4X6RB 1XE7A 4HSJA 5I0RA 3D82A 1Y9QA 5J7MA 1LB2A 3FE5A 3HQXA 2IXLA 4Q0VA 4HMZA 2ETEA 2Q1ZB 1EY2A 2D93A 2K0GA 1IPJA 4I2OA 2MHFA 3I7DA 1LRHA 4B29A 4HN0A 5EZWA 4GULA 4XF9A 1G6NA 1O3RA 3FWEA 4KWJA 1V70A 1SEFA 2MNGA 1L3JA 2GC2A 3JZVA 3KMHA 3MYXA 2ET1A 4KU7A 2V09A 5LEJA 4RD7A 3SXWA 4J1WA 4HVRA 2PHDA 4JV4A 4KU8A 3EHKA 5FQ0A 3LOIA 2B8MA 3DV8A 4YARA 1O5LA 5LEKA 3D0SA 4Z07A 2WFPA 3WW4A 1RUOA 3SCHA 3FJSA 2XGXA 1UPIA 5FPZA 2OZ6A 5KHGA 2IXIA 2DCTA 4OFGA 1CAWB 1QXRA 5BXXA 5BUVA 2ZKLA 1IPKA 3SCFA 2CAVA 2FMYA 2O1QA 3D0JA 1RGSA 3R6SA 1ZRCA 3ELNA 4MUVA 2IXKA 3LAGA 3CJXA 2GAUA 3MZHA 5KBFA 2Z2SB 3FZ3A 4XFBA 2CGPA 2PQQA 4QM8A 3EBRA 4XFAA 2IXHA 4EWEA 1J3PA 1EYBA 5I0SA 4HLTA 4AVCA 2EAAA 4D7SA 1UIJA 3RYPA 3I59B 1CAXB 3USSA 4IEQA 5FLJA 2PAKA 1GQGA 1JUHA 3H3UA 5I8TA 4XETA 1NZCA 1VP6A 2BGCA 1U12A 3B02A 5EFUA 1DZTA 3G7DA 4AVAA 2VQAA 1Q43A 1SFNA 2OZJA 2UYAA 3NSTA 2ATFA 1RTVA 3DL3A 4ONUA 4X6QB 4LUMA 2PAEA 3RNSA 5F1RA 4LLOA 4Q29A 4HN1A 3N4MA 1CAXA 1I5ZA 4Q0PA 5FLHA 4IEZA 1FT9A 5C6CA 1H1IA 1ZVFA 3RPQA 2IXJA 2UY9A 2ZCWA 5CADA 3PNAA 4KWLA 3S7IA 1WLTA 4KL1A 3S7EA 5KHHA 2BNOA 3RYKA 3KCCA 3CF6E 2GU9A 3IDBB 3E6CC 1ZRFA 1OMIA 4HBNA 4DINB 3RYRA 4P9GA 2D40A 5KHJA 2PHLA 3NVCA 1WGPA 2I45A 2MPFA 2PA7A 3IIAA 3ETQA 1ZRDA 2K9ZA 2GC3A 3EQEA 3KGZA 4JTNA 1RL3A 2XLAA 5JSRA 1DZRA 1OI6A 2H0VA 3EJKA 4LTAA 4CYDA 4EWAA 5D1IA 4F7ZA 1O3TA 3HT2A 4XFIA 1LKNA 3E97A 3SCGA 1ZZCA 4I02A 1CAVB 2XHKA 3M3IA 1Q3EA 2EA7A 1NYWA 1J59A 5C8WA 4KWKA 2VPVA 4H7LA 2CAUA 4XF4A 1EPZA 2CV6A 4MX3A 4HVQA 3UKNA 2UYBA 5JCTA 5LRRA 1QXJA 3BPZA 4MGKE 4ZU7A 5I8YA 3KSCA 4PIZA 4PIYA 3CEWA 4LA3A 4Z82A 5J3UA 3L2HA 5JAXA 2WC2A 3H8UA 1UCXA 4AQ2A 3WW1A 3H50A 3CO2A 2ET7A 3H7JA 4I01A 4XFHA 5J48A 1YUDA 3SMHA 5CVRA 4ZU5A 5T3NA 1ZREA 4MH0E 4UBHA 3WW2A 3E5XA 4E2GA 4E2SA 4Q0UA 1ZNPA 2IC1A 4FAHA 1VR3A 4UBGA 3LA7A
chains in the Genus database with same CATH superfamily
3AYDA 3SC7X 1W8FA 4Q1PA 4XTMA 1PO11 1W6PA 1QJEA 5JI7A 2HWE3 5A3UA 2DVFA 1J58A 3POEA 4BE3A 4IGOA 3NV1A 4A44A 1VBB3 2WQ4A 2HWD2 1DDLA 3DYPA 2VZUA 4YVWB 4FXKB 4QT6A 5FAXA 4DXSA 1PNGA 1OSGA 3BGAA 3OGJA 4BQ1A 4C1XA 3U07A 1FAYA 3ZSKA 1NT0A 1Z0HA 3WDUA 5LA2A 4IQPA 2BWAA 2ERFA 2VE1A 1W0NA 4MZUA 1UYPA 5IUQA 2RS12 1C57A 2FHRA 3OUJA 1O8SA 4Y20A 2PMWB 3HN1A 2CDOA 3GBWA 1QWRA 1RHI1 1QNWA 4H2AA 2NN8A 1DCSA 4QM9A 5KXEA 4ZKTB 3AYCA 4FT8A 4UFLA 3B9IA 4WVZA 2HEWF 2I07B 5A80A 3ILNA 4RN5A 1HW5A 3HR9A 4ORFA 1OURA 1JMUB 4NN0A 3VDDB 2B39A 1XSRA 1HKDA 2DU0A 2YU2A 3MIEA 3AP9A 3PMSA 4R4XA 5LY2A 3VBOB 3ZXEA 3PHMA 4URAA 1W9SA 2GNBA 1YQ6A 2HWC2 5FFOC 3HNYM 5FK7A 2HJIA 1GNHA 5FBZA 4B7EA 5CU1A 1DQ2A 1DGRA 1NAEA 1O4ZA 1U5XA 2XJUA 2YG0A 4MGIE 3RWNA 4P9JA 2BJSA 4S2GA 3B94A 2Y34A 5LBCA 4FPJA 1VBD3 3MPPG 1TMF1 4RR3A 1BMV2 3NJZA 4O9GA 5I0TA 2IZWA 1UPSA 2RR11 3RVHA 3OTFA 1NLQA 4NAOA 4QB2A 4WV8A 4GXLA 4B4PA 2VNGA 1W2TA 4PQ9A 1VBC2 1ASJ3 2VOKA 3BCWA 4LBQD 3TNQA 5C5TA 4L11A 1I1EA 5F3IA 1QEXA 2B9UA 3AMMA 3NJYA 2AACA 1YFXA 3F95A 1QJU3 1EAH3 3AXEA 3JB4C 4IV3B 4MGZE 4YG6A 5FZ6A 3VKLA 1X33A 5G05L 3CL1A 1X7NA 5LBBA 4BQWA 1RC6A 4AQ6A 4QKBA 4B8EA 3POIA 4NOTA 1F5FA 3WHUA 4XEZA 2D98A 3PVBB 1AJOA 1UYYA 1US3A 3HD8B 3R4SA 4MXVA 4R9CA 1MS5A 4RQPB 1FI2A 5IK8A 3AZZA 1FMD1 3OYWA 5DUXA 4EYUA 4FPEA 4CDXC 5FYBA 3CZJA 2VG9A 3UKTA 3N3HA 3HIFA 1PGL1 2E32A 4BIOA 4CDQA 5JR2A 1LU2A 2AEYA 4J1XA 1N3QA 3W59A 2QDRA 2WNVA 3T3YA 4AG4A 4UYBA 1DGWX 4BQYA 4PDWC 5FQ0B 2Y0IA 4MO3M 3M1HA 2OA2A 3RS6A 4XFFA 2ZHMA 4L8QA 2AEZA 2FDGA 2DTWA 4LXLA 2BPA2 5IWFA 2RS11 3BU0A 3GCWA 3RI9A 3IWZA 2UURA 5ABJA 1GOHA 3O0VA 1JOJA 3S0MA 1QDOA 1PGL2 4XACA 4QPGA 1QH6A 4AQTA 3EXUA 3O5SA 4EE2A 2BFUL 4R9DA 2BNMA 2Y6JA 5CFDB 1HV1A 2DWRA 3TEZA 1A6CA 1ZBE2 2VZOA 3WCRA 3UETA 4YW1A 2VW2A 1CIYA 3LSEA 4MGYE 2W87A 5FXZA 3USUB 4OI2A 2QJVA 4IE5A 1XNBA 5FZ1A 2RS32 4FI9A 1BYHA 4LULA 3GZAA 2XJVA 3PVOA 5GLTA 2ADEA 1RUJ2 4BYYA 1V6LA 2HWC3 3ZMOA 3HEIA 3BVCA 4I0AA 5K7PA 1XU1A 4JGYC 5I0DA 3MGUA 4NHKA 3W58A 4AXOA 3KV4A 3NNLA 4L92A 4XF3A 1PHMA 3VBFC 5L19A 1NCRA 4A4AA 5C8CB 3UESA 1MR5A 2AC1A 4L97A 3U75A 3WHTA 3OD0A 3QLQA 1LCLA 1RUE3 2FDFA 5FMDA 3HQUA 1QU0A 3RJRA 2TUNA 1IKQA 3NMBA 1W6MA 4BPZA 2Q0AA 4Q2FA 3OY8B 1LHNA 2V4AA 4AGVA 2KXLA 4MXWA 1R1A1 4PBOA 4QGLA 1ZRRA 3LDRA 1NCQC 2QFEA 5GLUA 3KB5A 2GNDA 1TNRA 2QDNA 1UZYA 1S0BA 1G8WA 1ZZ8A 2C9AA 4MGTA 1LAJA 1XOYA 2FDJA 4PF1A 3HNBM 4AQSA 1JXNA 1XJAA 4IW3A 4MGQA 1WMDA 2OQ7A 1BK1A 3E1F1 4IL7A 1XYOA 4OUEA 4IEVA 4K8FA 1HX6A 2RG4A 1J84A 5I91A 4N9HA 4MYEA 2JB4A 2Y6GA 1BEV1 1IPSA 3ZN5A 1HXS1 4E4HA 3AP6A 4EROA 2VY0A 4XFCA 3N9MA 2AH2A 1I9RA 2GALA 1ENSA 1RUG1 1L7RA 2XQRA 2VL4A 3D3AA 2GC1A 3LQCA 4KMQA 2W3JA 3GJAA 5FZBA 4BQ3A 4EWDA 5FO8B 3P5BA 2OPKA 3CJIB 3J26N 3SKVA 2ZMNA 3VBSB 1X82A 4UXAA 4KNCA 3IT8A 3OB8A 1OF4A 3DYMA 4Y1ZA 3AZXA 4HL0A 3MDPA 5FZIA 4BB3A 3PL0A 3AL5A 1WBFA 2ZGUA 3CU7A 1ZBE1 2ADDA 1OA4A 4IV1A 3PMEA 4XBNA 2AZ5A 2D6MA 4XW3A 2D3SA 3I3MA 1W6MB 3VDAA 1ACCA 2CYFA 1Q8OA 2ZHKA 1EUTA 3BOWA 4OUMA 4QX2A 2OYZA 2WABA 1ND2B 2VZRA 3ORJA 2VD7A 1GWKA 2WT2A 3NJXA 1H2LA 4B1LA 1FOD2 3C3VA 3NAPA 1J1TA 4OI4A 1IG3A 5FR3A 5L7OA 5LY1A 3VHRA 1C8NA 2BOJA 3OBZA 4V1PA 2ZAHA 3MFAA 4CCNA 4AK3A 5I0RA 1ZRIA 2VBPA 4XJAA 4CDUA 3KHBA 4LJHA 1TNFA 1CZVA 2VOXA 3N7KA 3Q8EA 2RS53 2Y6LA 2GNMA 4WVVA 1UXZA 5AC93 3AZVA 2WFF1 4NHLA 2K0GA 5LK5A 4OHVA 1QXPA 1W6QA 1HJGA 1O59A 1EPWA 1I5PA 1FPN2 5EXOA 2QQUA 4XJWA 3KLSA 4JZRA 2PHUA 5EZWA 1Z7S2 3KQ4B 5A7NA 3ZVXA 1V70A 2BZDA 4DQAA 2UU8A 1L3JA 1MACA 3JZVA 4WM8B 5L7OB 4RYDA 4IV1C 4ZXEA 2XJPA 2HWD3 3ABZA 3MYXA 1YCIA 2EIDA 5IFTA 3WUCA 3GZUC 5LEJA 3SXWA 1JODA 3VZJA 2Z5WA 4J1WA 2BBAA 3WG1A 1B35B 1QOTA 4B4QA 1RYYA 4JV4A 3VKOA 4CEYB 2IFWA 5FQ0A 2ZEWA 1VMFA 3ZFFC 3DV8A 3OG2A 3M8LA 4NHMA 1W8TA 4HXCA 3MIHA 3C7HA 4A7ZA 5LEKA 2WFPA 2W5FA 3UGGA 3NJVA 5JPMB 4AVSA 4PT6A 2ZGNA 2JEMA 4Z8BA 1R1A2 3ACFA 4YG3A 3ZYJB 3ZX7A 5KHGA 1TMF2 1O8PA 5BUVA 5APAA 2ZKLA 4CEWB 3JD72 1RUD1 2VQUA 4GZ9A 1F9KA 2JIGA 3SCFA 2Q5TA 2FMYA 1XBFA 5FZ9A 2WNOA 3RMYA 4NIIA 1RUH3 4R9BA 1ND3C 2ZGRA 1RGSA 4Z2AA 5A33A 4AF9A 5BNNA 3NO8A 1STMA 2XBO2 4N43B 1UZ0A 2BQPA 1GV9A 2VOVA 2W94A 5KBFA 1JYTA 1F5JA 1CD3G 3HBKA 2F4LA 2FDIA 2HBTA 3ZYFA 3KHCA 3BI3A 1RUE2 5CIRA 4QM8A 3ZLIA 1S0EA 1OT5A 1WBLA 1GP6A 3VGIA 1MS1A 1DG6A 5FYMA 1J3PA 1EYBA 5I0SA 2W39A 4YZ4A 4XAAA 2D3RA 3ZN6A 5IFPA 4CCCA 1LULA 1CAXB 2BFUS 1QJX2 5FYSA 1FOD3 1GU3A 2WIIB 2YPJA 4AVVA 1RINA 1H8TA 5KXCA 1AYN2 1NY71 2YGLA 3KT4A 2BGCA 1IS5A 1U12A 2VMHA 1RUF2 3SKJE 4RGKA 1G86A 5C9AC 4KBZA 3WQ1A 5L9VA 1G9AA 5FZDA 4XZUG 1VRH2 3V65A 3HJRA 2QQKA 3I49A 1WCQA 1RTVA 2P6CA 3DL3A 4ONUA 4CTEA 4LUMA 5C7GA 5BNOC 1SFPA 5F1RA 5FTTC 2VNVA 5IATA 4Q29A 1JH5A 2HWE1 1MVEA 1K5MB 4HN1A 2R16A 2X09A 4JRAA 5HV4A 3N4MA 1I5ZA 1MS3A 1BQPA 1P8JA 4DUVA 4TN7A 5ACA1 1TZOA 4OZOA 2DV9A 1QQP2 2CY6A 1W0OA 5FLHA 1UMHA 1R093 5FMOL 3RFRA 3PJYA 3RPQA 3FN9A 1SLTA 4BISA 2PXJA 4AL9A 5DQ0A 5KHHA 1DHKB 2R0HA 2YY1A 1DP0A 3KCCA 1DGLA 2GU9A 2GMPA 5F5CA 4DINB 4ZZ8A 2B9VA 5C4WA 1JYCA 1WGPA 3H8RA 5C33A 4O7XA 4XABA 1WUVA 1SACA 1AYM3 2QBXA 5A3PA 4AAXA 4QPIB 4AHYA 2VUCA 1AR93 4QQHA 1Q8VA 3WDVA 2W08A 4FTEA 5JOWA 3C7EA 2VW0A 2D44A 4GH4A 1POV1 5F5IA 3VBUB 3PU3A 1TME1 1R082 4MHRA 4XE9A 4GQ7A 1JYNA 5JSRA 2XLAA 2BOIA 3POYA 3VKMA 1DQ5A 2B42B 1C1FA 5HBAA 3A21A 4ASMB 1DFQA 4LBQB 3CHXA 1OI6A 1MQTB 1N1YA 4AEJA 1O3TA 1VBE1 3MF9A 3FMGA 5FZAA 1SLAA 4FPHA 4CUGA 2WS91 1LHWA 4XFIA 3B7MA 3K2OA 2XJTA 1SBDA 3VZOA 5FZMA 4AGGA 3AL6A 3FC0A 5FY9A 1Q3EA 2ENRA 2XXZA 2XWJB 3LD8A 1J59A 4UOJA 4NPRA 5C8WA 3RZGA 3CIHA 2CAUA 4XF4A 4CP1A 2JG8B 1GANA 3O1PA 5JZGC 1UX6A 1QJY1 3PU8A 2RDNA 5FP4A 1ODMA 2WWUA 1AR73 3I2JA 2VCCA 4JAAA 5A7OA 5J3UA 2VZTA 2DCZA 3L2HA 2X8KA 3MUZ1 1UZZA 2VU9A 1Y9GA 5F39A 3H8UA 4E8DA 4XTPA 1POV0 1VRBA 4QDRA 4LO6B 5CBLA 5K0UA 1H30A 3TN91 1VALA 3IPVA 3ZYBA 2WT0A 4PI0A 3POGA 3T30A 1AF9A 2ZABA 4K6BA 3HVDA 3O1MA 1J83A 4LBLA 4Q4V1 1D4VB 4C91A 3U4XA 1D0HA 1ZBA3 1GZ9A 1RXFA 3MHZA 5A7SA 2FZ2A 1ZNPA 3OBTA 1GLHA 3WDYA 1VR3A 4UBGA 1QGLA 2VXJA 3HAGA 4M00A 5IVCA 4RR3B 2JDUA 3BU7A 4XYXA 3MIBA 3VZKA 5J98B 2QQJA 1QF3A 3E5UA 4YW6A 5LBEA 3ON7A 4QHBA 2GMMA 5F7UA 4Q4V2 4CCDA 1S0GA 5HI0A 5K8SA 3INAA 4HPKA 4XBQA 2YFZA 3OY8A 4X8PA 4BIFA 1NZIA 2E6VA 3IBMA 4CEWA 2QE3A 3K51A 1ZA7A 1TVGA 5A70A 1WCSA 4PDWA 2Z42A 3H1MA 3UT0A 4FTSA 1MS8A 3OOXA 3SITA 1ULCA 1VBA2 5JOYA 2A6YA 3POWA 1T6BX 1RIRA 1HQWA 1IGOA 4JGZA 4D7TA 3BB6A 5K0UB 1MZ5A 4LNVA 2CNAA 1ZZBA 3VV1A 1UO9A 3K75B 4G3YC 1PX3A 1RMU3 3AKQA 4XPVA 4FTBA 4QXHA 2ZS6B 5I93A 3DECA 4WBBA 1CAUB 5FPAA 1OH3A 2FBEA 5J36A 5FWEA 3OF1A 2ZEZA 4M3CB 4CDWA 1AR91 3AJYA 2IWGB 1C8M2 4L99A 2JG8A 4P00B 5EPAA 3ZXDA 1W6OB 2XDVA 3RGBA 4Y1UA 4XBLA 4CUAA 1ULGA 5FZCA 4Q4W2 1PVC1 5E89A 4LK6A 4O9EA 2QKDA 3AKRA 4BOWA 3AFKA 5JIUA 4K8RB 4AOCA 3WF1A 1TE1B 2QTWB 3VD9A 1H2KA 1K5MC 2PAMA 4BA6A 4CXYA 3TYJA 4LHNA 2W46A 1PO23 3ALQA 3VBFA 5H9SA 5ABJB 1WA6X 1XNAA 3CMGA 1J1LA 4TYSA 3QH6A 4XQDA 4H55A 2J22A 5IYYA 3KQRA 3ZFGA 5BNQA 5D8AA 4M3CF 5CG8A 1YHFA 3ATGA 1ZZ9A 3E5QA 2Q1FA 1WZXA 3GALA 3RWKX 2XWBB 1UKGA 1CX4A 5C3OA 4JRLA 1WW4A 2Q4SA 3MW2A 4QQ2A 4Y5Z0 5FJHA 5D2AA 1N3OA 1WCUA 1XE0A 2YDEA 3DN7A 4AI2A 1W03A 5CKNA 1GQPA 5IVBA 3O1OA 4L0PA 2YFUA 3ST7A 2WAAA 3H1WA 1CN1A 3LFMA 4OHZA 3OCPA 3U11A 5JMCA 2HWB3 4LOTA 3A22A 4SLIA 2UWCA 1REFA 2XLGA 1VJ2A 2W1QA 4KBBA 2RS31 4LKEA 1LOFA 3RDIA 1J3RA 1IS4A 3ECQA 1J3QA 5FPXA 4GA9A 4YG0A 5CB7A 2PTMA 3ZIWA 1JZ7A 2ZA9A 4I09A 4YM1A 4QHZA 3J4UH 1DGRN 1SFYA 2GN7A 3M7AA 4GB33 4JTOA 1K3IA 1GMMA 1HJFA 4I0BA 4M3CA 2X5IC 1CR7A 2ARAA 5FCCA 4XDPA 4HSLA 4HZFA 4V2VA 4N43C 1QOOA 2FCVA 3QD6A 4IEUA 3EMRA 2XG3A 1B09A 1APNA 4IE7A 5H9RA 3ZXGA 4QGNA 5B4NA 2DVBA 3IN9A 4BHPA 1OHFA 4D7YA 2GP5A 4JGZB 1CPMA 2ZZJA 3CKHA 4HK8A 5D8AC 5DUUA 5L36A 5BYNA 2BWCA 1MPXA 5KC5A 5E6HA 5K9YA 5BNOA 1YFWA 1PO13 4TLFA 5A1FA 3LEIA 5ERLA 4COWA 2X53S 3N9QA 4MV2A 4META 1D7PM 3OGVA 4W4ZA 1BCXA 3ZFFB 4E9KA 5BV6A 3DF0A 4PI2A 5KHIA 1UOFA 3LCPA 4NAMA 5TSWA 1V6OA 1SBEA 4TTGA 3ENRA 1V6MA 5A1LA 4P9YA 4SBVA 1V6JA 3WW3A 4YWAA 3I8TA 2JECA 1IHMA 4N53A 2VW1A 4W6XA 4DS0A 4JC1A 4GAZA 4YW4A 1C4RA 2YC0A 1PGW2 2JDNA 1C5IA 1W2OA 2JE7A 3KVBA 1FXZA 3FLRA 5DUVA 5IK4A 4NUBA 5IT6A 3QOPA 1FMD3 1YEWA 2A6ZA 5JSPA 3BALA 5BNNB 1XQNA 1URXA 2XL9A 1AYM1 3WNXA 2NZ9A 4Q0QA 2A3YA 4DXZA 3PTRB 4YW2A 1LGBA 3NV3A 4IGPA 1O6UA 1YLLA 4QXKA 5FV3A 1CGPA 4YVWA 4KH9A 1UY1A 1YI9A 2G9FA 5FPUA 3WINE 4COZA 4CDQC 2XONA 1CX1A 4AAPA 4E2QA 3OSDA 1US2A 1KFUL 3ZFEA 3AZWA 5KHKA 4FOYA 3FL7A 4FQ4A 5T52A 1CZTA 4P5YA 2YYOA 1SLIA 3N9PA 3ZPYA 3BTAA 1SQ4A 4B1MA 2Y60A 4KQ7A 4ARYA 5A6YA 3I2DA 4LPLA 4RFT0 1AUYA 1KJLA 3VZLA 1H6XA 1GFF2 1UQXA 2HYXA 4CUBA 1GICA 4NHYA 5F2SA 3U10A 2WAOA 4IERA 4O65A 4N53C 5IVEA 2QCSB 5HPOA 4OMDA 3ZDSA 4ATEA 2YBPA 3LOBA 3IDCB 5FYYA 1GQHA 4QDSA 1W2UA 4DXRA 4HONA 4FAGA 4BWOA 1LESA 1DIWA 5JR7B 3CJIC 1W6QB 5CKQA 3RQ0A 2D3PA 1JZ6A 1UAIA 1Y4WA 2VTXJ 1RUH2 2ZJCA 1F31A 1LOCA 3ASIA 1NA1B 4H7MA 4QPWA 2IFRA 4QAWA 4LIUA 5IW0A 1JYIA 2VULA 4OHXA 4KGGA 5ANNA 2AGSA 1KD7A 1GR3A 1ND3A 2DBIA 3R4UA 4W6YA 5BPXA 4OHYA 2EXIA 4B3NA 3ZOIA 2JE8A 1U0AA 2C6SA 3LPFA 1POV3 1JHNA 2PFWA 3KD4A 4ASKA 2WZEA 1O3QA 4N9IA 2Y8KA 5FY4A 5FZ7A 5FZLA 5JVVA 2NPIA 1DLCA 1PO22 2BGPA 4GJYA 4M01A 2W2IA 3MW4A 3NL1A 2CTVA 2YB7A 4WZFA 2O0OA 2WUHA 5FPVA 5C71A 4EN8B 4A6SA 3ILRA 5DAPA 3KS7A 5FLIA 1HV0A 1JTZX 1WW7A 2EALA 2D5FA 2P6HA 4GWIA 1NCQB 2WO2A 2WNUA 4OI0A 1O3SA 4BXFA 5E16A 1OD3A 1U5YA 2LUWA 1S0JA 1HB3A 5EP9A 3UKVA 3WV6A 4D94A 2JE9A 3BTXA 2KM2A 2BUKA 3WOGA 3JCIA 4AHXA 5J7MA 2WA4A 1LB2A 1W9TA 3HQXA 1BBT3 2VOTA 2ZXQA 4Q0VA 4RHV3 2D6KA 4P5HA 4U36A 1VRH1 2ETEA 2BVVA 3P1IA 4IE4A 5T5LA 1QJU1 3ZN4A 5A6QA 1LHOA 1OKOA 3K4AA 2BU9A 4UT5A 4GKXA 2Q8OA 3WNLA 3HPNA 3TEXA 2D7FA 2WN2A 1VAMA 3I7DA 1S4CA 4NROA 4PQQA 5JUVA 2EXHA 1PIV3 4GULA 1XSQA 2ARCA 2DCYA 3KF5A 4NR1A 1PGW1 4OHWA 4XF9A 4Y5TA 1O3RA 3AC0A 4ISQA 3WSOA 1MS0A 4INDA 1S2KA 5T50A 1AR92 1LEDA 1NG0A 3PVEA 2ET1A 1S0IA 1TEIA 4E27A 1W3VA 4YVSA 3ZXFA 4RD7A 2J7MA 4XOGA 4KGQA 2ZMLA 4Q4V3 4HVRA 1PNFA 1H9WA 1DZQA 1QOSA 2PHFA 3GNEA 3OUIA 4O61A 5FO7B 5FZFA 3ZXJA 5JWPA 1VB2A 4QX8A 5CFDC 1A3KA 3T4VA 1LHUA 1OOPA 2R1BA 2OQ6A 3NNFA 3RI8A 4B4RA 3BTYA 1UMIA 4Z07A 1N47A 3WW4A 2WNUC 3SCHA 3OUHA 5FJKA 2QUOA 1OQEA 5KXDA 3LDKA 1GWMA 3NNMA 4LKDA 3N9OA 2PQSA 2XPJA 1VBD1 1NKGA 2GNTA 4IXLA 3NNJA 4UW5A 1EV13 1QXRA 5T54A 3LPGA 1AL21 4NIDA 3SLIA 5HV0A 3VKNA 2R32A 4CE8A 5A6ZA 4QX3A 1O91A 4GIQA 5C8CA 2KD7A 1ZRCA 3ELNA 4MUVA 3W21A 5JXJA 3FLPA 4AHWA 4S2HA 3LAGA 3CJXA 4AEDA 3HN3A 3D5OA 4Q1RA 1VRH3 3H3LA 3VDCA 4YLZA 5FZ0A 1YQ2A 4LO5B 2WS92 2JD9A 4CEYA 4XFBA 4UAPA 2PQQA 5FZOA 2YUEA 4XIKA 3K4DA 5AFBA 3HOBA 5B4XA 4EWEA 4CXWA 3K48A 3PIJA 2R49A 4E4SA 4PF5A 1KDKA 4ATFA 5LW9A 1PMHX 1FMD2 3P3PA 3B93A 4GALA 2BBVA 2VC9A 1PZ7A 2VGDA 3USSA 4YGDA 1Z7S3 2P1BA 3LIGA 5FLJA 1GQGA 4Q4Y2 5CFDA 1G7YA 2PHTA 3IMMA 1VP6A 2VBBA 1YIPA 2VUDA 4JHZA 1RUI3 5F5QA 5EFUA 3WQ0A 4JDNA 3TBDA 3G7DA 2VH9A 3AKTA 2CU5A 1R081 1ST8A 2RS13 1SFNA 2GH8A 2UYAA 2VMIA 1PVXA 4HG6B 3AP4A 3J7LA 3JUUA 3THDA 2XBO3 2V72A 3ZFFA 2EIEA 3RNSA 5DMYA 3IB3A 1RUD2 3LIHA 4RGGA 4XUNA 3IDEA 4Q26A 1Y9MA 1HRI2 5DDJ3 5JOZA 2XB6C 1R091 3MFCA 3SH3A 4F3JA 2JKBA 1FT9A 4FPOB 4RHV1 5LATA 3VBOC 3PUAA 5FZGA 1H1IA 4PBPA 1LODA 1ZVFA 2R071 4HK9A 4LQRA 4MLOA 2Q8EA 2VUJA 2ZCWA 5FO9B 2J42A 3ZYHA 4KL1A 3S7EA 4AFDA 3RYKA 1K42A 1AXYA 3CF6E 1AR83 2CSGA 2P3JA 2WNUB 3IDBB 3I3BA 4UW3A 5EYXA 5JOXA 3E6CC 1ZRFA 2ZHNA 4HBNA 4D69A 2D40A 3NVCA 5F9TA 1RMU1 4A3ZA 3T0DA 3KF3A 1QHDA 1S2BA 3KT1A 4CCEA 1R1ZA 4HKLA 4AFCA 2G19A 4K1YA 1R64A 2PA7A 2ZAAA 2HWD1 1XNTA 3I2HA 4IE6A 5E88A 4DMIA 3GJBA 2BERA 1AYN1 1NY72 3WF3A 1OC1A 5CNAA 3IIAA 2VBDA 4DPNA 2JICA 3DKQA 1BBT2 4PHZA 2KR2A 1FOD1 3ACIA 3CBNA 4BK4A 5HCAA 3EQEA 2WZR2 2OKXA 4RL7A 4N7UA 4C0HA 3MEPA 4NIHA 2Y6HA 2D6PA 1YJLA 4CCJA 1YQ5A 2X29A 2WSUA 1JYXA 3VDBA 1PM4A 3FBYA 2DUQA 1KQRA 4UFIA 4KG0A 1CQ9A 1NA1A 4FPYA 2R6QA 1VBE3 2XHNA 2B46X 3K77A 4FFIA 1ZM1A 2TNFA 2XHKA 3M3IA 5T55A 4YZ5A 2EA7A 3QBQA 4YGBA 2VZ3A 4AVTA 4H7LA 2NP0A 5EIYB 1AR63 4QKNA 1EPZA 1HN0A 1RUC2 3J8F3 5EV7A 3VL9A 3POBA 2I74A 4QKFA 4DXTA 2E7QA 2V5YA 1QJFA 3IDAA 2BGOA 4MXWB 4UFJA 5C3QA 4HETA 3ZMNA 3CEWA 3H42B 1LHVA 4LA3A 5DG2A 2C24A 3C8XA 3RZLA 3KV6A 1HXS3 2WBKA 1GOFA 2WFF3 1W06A 1W2AX 1UCXA 4Y4RA 1S0DA 4LK7A 1OPMA 3WW1A 4BCUA 2ET7A 3RZKA 4WM7B 1PIV2 2R30A 5T3NA 4ZU5A 3IPVB 3RMXA 1ZREA 4MH0E 4UBHA 3KCXA 3WW2A 1TME2 2A5ZA 2JKXA 2XVKA 2K2SA 3MBWA 2MEV2 4E2GA 2JXAA 2JDHA 1BLZA 1MS4A 2UWAA 1XNCA 2JDKA 4FCAA 3ZYGA 3ZR6A 1PVC3 2DTYA 4QB1A 1UL9A 2VM9A 4FAHA 3WG4A 4HFSA 4M0NA 3LA7A 4RS5A 5FYVA 1NA1C 2VMEA 3GHMA 3F2ZA 1WMEA 3T0BA 2A7AA 1XRUA 4LMFA 4YM0A 4D3WA 1GWLA 1Y3TA 4FPGA 1AL0G 2XL7A 2ZHLA 3HNMA 1JN2P 2QQVA 2D5HA 3PLQA 1H9PA 3LWCA 4W8JA 3THTA 3T08A 1DBNA 4FXGB 2VTFA 4IESA 1ULEA 1ODNA 3N9LA 5FZ3A 5F37A 3I2GA 1MEC1 5GZCA 3A4UA 1JZ3A 1NX9A 4HANA 1QJY2 2RVAA 2ZGQA 3NKTA 1HB4A 4N53B 2MEV3 2ES3A 3POFA 1WCKA 4CA9A 1O5UA 1H4HA 2G9GA 5I0UA 1X8MA 1RUJ1 4COUA 5EHDA 3ITQA 3V0AB 2ZX2A 1KJRA 3AFGA 4CSWA 2ZX4A 2ZGMA 1V9U3 2CDPA 4G9SB 4FFHA 4JQTA 1CPNA 2UY8A 4LHKA 5E1RA 3VB9A 3VN4A 1TQ5A 3M70A 1EAH1 3WEZA 1H0BA 2XJRA 3WZ1A 3WNNA 2ZX3A 5FP9A 5FZHA 4CDQB 5L9RA 5LA0A 4MG2A 1OH4A 5C3RA 1QNYA 4GMP0 3GHNA 3I2KA 4C1WA 1SPPA 2GC0A 2WZR3 4FPCA 4BMEA 4CP9A 4R4ZA 3OPZA 1WLCA 4IEWA 5FZKA 1AR62 4Q4W3 4YVSC 3T1LA 4XFGA 5FIXA 3TOJA 5C3SA 5BNNC 4UW4A 5LWBA 1COV1 3HT1A 1CIWA 4L2NA 5FZ8A 4D6RA 2BTVC 1VBB2 1GBGA 2P5BA 1XNKA 4TZDA 2NLRA 3UK9A 2YGMA 1JUIA 1WW6A 1JZ2A 1DF0A 4WVMA 2QQWA 2WQ8A 5ISLA 5J37A 2WS93 4GJZA 1T6GC 3WF0A 3OGGA 1REDA 3WF2A 4EN0A 2EXJA 4ZZ5A 2A75A 1UWWA 1PK6B 2R041 4QXCA 2ZGOA 1K12A 2WKKA 1HIXA 4K40A 4LE4A 4I30A 2NMOA 5C9AA 1VBB1 1F2NA 2LROA 5GLZA 3WQBA 5JSOA 1VB4A 4OI1A 1W6NB 1HXS2 4KG8A 1V00A 1WD3A 2VUAA 5DDJ2 5FY8A 2WLQA 4I3PA 1V9U1 5C70A 3GM8A 4NO4A 1DQ4A 4FP3A 3VHNA 2E53A 4TLGA 4GKYA 5JXHA 3WNMA 4BLJA 5D8AB 1LOBA 4IEXA 4YRDA 2QQIA 2R063 4JGZC 2YV8A 4FSJA 5CFCA 4PIXA 4R9AA 3B69A 4BH9A 2RR12 1CAVA 2GN3A 4HT1T 3A23A 4ITCA 4AI8A 1LOFC 5FP3A 3EO6A 3JBG3 3BIEA 2YU1A 1LECA 2F4PA 1IS3A 4Q4W1 2XKPA 3WR0A 2NYYA 1SLLA 2JG9A 4XDQA 5C4WB 2Y64A 4N8MA 1VBE2 2E7TA 2RJKA 2X5IB 5A3LA 1O4YA 1T2XA 2F6BA 5A3MA 2E9QA 3LE0A 2AYHA 3ZXAC 4CDUC 4D8MA 1RUF1 4IV3A 4N43A 2EIGA 1YO8A 3WD5A 4CPBA 3J9SA 5A33B 1HB1A 4YGCA 4AI0A 3FFQA 4XQ4A 2P3YA 1N1TA 1GP5A 3PJQA 2W9XA 1W28A 1OXCA 1ZZ7A 4M4RA 1DYKA 2B5HA 2C5DA 2DCJA 3DGTA 2E33A 1ASJ2 5AVPA 5FXWA 5AFEA 1OLQA 4FOVA 2ZGKA 3MIDA 3SEPA 1K5MA 3GF6A 1YWKA 3KGLA 1RUNA 3WNOA 4F8AA 4AEMA 3TEYA 3NWKA 4U2AA 3VD4A 2VECA 1C5HA 1NCRC 4DUXA 3QH7A 5AVAA 1UOGA 2DFBA 2OUHA 1KEXA 1UZWA 3CQOA 1BKZA 3KZ4C 2W1UA 1VAKA 3SHRA 3BUCA 2PLV2 1Y7BA 2FD8A 3ES4A 3KV9A 1AR81 2H6BA 2WQZC 4OCTA 4DNYA 4LHLA 5ABJC 1IZ3A 1DYOA 3DUIA 1GNZA 2O8OA 3A0KA 3LA2A 2DCKA 1E5IA 4HPKB 1XYNA 1W6NA 3ZSEA 4CXXA 4YW7A 3LZZA 2TBVA 4QDQA 4DY5A 1OD5A 3VD3A 1GYKA 1RUG3 2BP6A 4Q8KA 1OOPB 2ORZA 4HKWA 5IVJA 2UWBA 5JIAA 1VIWB 2DVAA 1SHWB 3AB0A 4BM8A 1LTEA 2HLEA 2R7EB 2Q30A 2BEOA 2RM22 4UF0A 3UJOA 3I2IA 4PJYA 2DUOA 2RE9A 2EXKA 4R52A 2CL2A 4BLIA 1W05A 1COV3 1JZ5A 5F6KA 4ET7A 2GH2A 1EV12 2DURA 5IVVA 3MUY1 5CISA 4COVA 2AR6A 4E8CA 1V9U2 3FUQA 3KT7A 1COV2 1A8DA 1D4M2 4MOAA 5IK7A 1HB2A 2ID4A 2XUMA 4LBKA 2DFCA 1NXMA 5FYUA 4X8NA 1W90A 3I59A 1X8EA 4OLLA 3WX5A 4S2FA 2PHWA 4XF1A 5K0UC 3C2UA 3GZTB 4IEYA 3WQ7A 1VPHA 1GZTA 4QGMA 3TWIA 5IAXA 2ZTNA 4FFGA 4AI1A 1EV11 4IGQA 3IAPA 1VMHA 3CLPA 2XH6A 4XCAA 4YSFA 3OPWA 2VMCA 4W50A 1RUJ3 2RR13 2ZX0A 1YFUA 4DEVA 1D4M1 3AJZA 4A45A 4CP2A 3ROUA 2A71A 5FYHA 1BVP1 2XVGA 4QQPA 5EQUA 4G4FA 3WDTA 4A7KA 1GUIA 1NXD1 1D2QA 4BJ0A 4NIGA 1CESA 1QY4A 2L9LA 2R061 1ZZ6A 4R8HA 5H9QA 3ILFA 4RR3C 2A3XA 3RZZA 5A32A 4QX7A 1DU3D 4HVOA 4D6QA 2G9ZA 4XUQA 2ZBJA 1MQTA 3CJIA 2RDRA 5J09A 3V0BB 3GCXA 3IMNA 1W9YA 3MO4A 2BYVE 1UX7A 3NW4A 4NPLA 4UWDA 5FDBA 1AYN3 4AEDC 4Q4X1 4IDZA 5I8SA 4DFSA 5CEHA 4GWJA 1JHJA 4JKMA 3WCSA 4CCMA 3BN6A 3Q8AA 2WWSA 5FRAA 1YQ8A 3N7JA 3T4HB 2PLV1 4RA0A 1JYVA 5AC92 3ZXKA 3G6JB 3LFIA 1ZX5A 1H6YA 1F4AA 1M4WA 1XE8A 4YGEA 4AFMA 5BNPC 4DIQA 4P9IA 2E63A 1IS6A 1YYNA 4DO0A 1IQAA 1FV3A 3PUQA 4XXAA 2PHXA 2HWF2 5E8AA 1JBCA 1VE0A 4KWUA 3T2TA 4K20A 2H6CA 1DLLA 3GYDA 3M3CA 1KFXL 2ZX1A 1AX2A 2QQNA 1JYWA 1W3XA 1AXZA 3D4KA 4OUSA 4YZ3A 5SV5A 4ASLA 5JZGB 1XE7A 5IJRA 4TXWA 2JG8C 3NAPB 2C26A 5FREA 3D82A 1L7LA 1D4M3 1Y9QA 5F5AA 4ES9A 3FE5A 3VBHA 2VR4A 2IXLA 3N7LA 5FZOB 2P2KA 4CCLA 4HMZA 5F3GA 3OGRA 2A3WA 2Q1ZB 5F32A 1UU6A 3TEWA 1AR71 2P4EA 1EY2A 3ACHA 4Y1YA 4A3XA 4I2OA 2MHFA 1UU4A 2J1VA 1LRHA 1MQTC 1RJ7A 2FMDA 4LORA 3O12A 1FATA 4AZZA 5KC6A 1G6NA 4YZ1A 3J7NA 3I3QA 4L9BA 2J1EA 4KWJA 1OQDA 3VBSA 1H4GA 2MNGA 4JHTA 5LA9A 2GC2A 3VBRC 3OGSA 3KMHA 2IUWA 2VVDA 4GB31 3LGRA 3VBUC 1MZFA 3D8CA 4KU7A 2QQMA 2HEYF 1JOBA 4NWWA 3NNGA 1S0FA 4P9XA 2V73A 4QPIC 3WG2A 5IHRA 2VVFA 1CVNA 2PHDA 3VZNA 1ZA4A 3R0RA 2PLV3 4P02B 2VMFA 3WDXA 2ZGSA 4UI9L 1W8ZA 1N3PA 1O5LA 3AZYA 2QQLA 2DVGA 4YM2A 3THPA 2XBO1 1RUOA 1BVVA 3J7HA 3FJSA 4QB6A 2H0BA 1LOEA 2SBAA 2Y26A 3OPTA 1YJKA 4QPYA 1W8UA 4YPJA 5FPZA 2XOMA 2OZ6A 1DQ6A 5FPBA 3V0BA 4QPGB 3MIFA 4LKFA 2WO1A 2ZEXA 1GP4A 3I3EA 4XURA 2BRTA 3JB8A 3KV5A 4P9WA 3AM2A 5EWSA 2O1QA 3GBGA 3QCWA 1RXGA 4XCBA 3R6SA 2JENA 1RVF2 2IXKA 2VTXA 2XMLA 4DB5A 2GAUA 2SLIA 3LB9A 3VBHC 1GOGA 1LOAA 1W9FA 1ULDA 1MEC2 3RRDA 5AC91 1JU3A 5F3CA 4OMCA 5BNOB 5A3TA 1AJKA 1QDCA 1AVBA 2VCMA 2Z2SB 3B00A 3FZ3A 4MVTA 4XJZA 3FLTA 2ZOEB 5DZFA 3BKZA 3KCYA 3T1MA 2IXHA 4ES8A 3O0XA 4NPMA 4PLMA 5C9AB 4XXPA 3WT3A 2WN3A 4AEKA 1YRZA 1S55A 5DG1A 4YM3A 4D7SA 1H2NA 3O1SA 3I59B 4GMP1 3O1TA 1HQNA 4CUCA 3LEGA 3THCA 2GP3A 4F83A 2HWF3 2JG9C 4ZY9A 1EAH2 4LOSA 3PUIA 1LGNA 4GH4B 1LNSA 5DXDA 5GLVA 3VBUA 1HLCA 1NQJA 4LBMA 4XETA 5I8TA 1RUE1 3RZJA 3VLBB 2GSYA 1F15A 2XQXA 1GNYA 3BYWA 2OZJA 3S6PA 2ATFA 2ZZQA 4A41A 5KWRA 4X6QB 4NE9A 4UF0B 4CP9B 4AFBA 1JZ4A 3ME2A 1W8OA 2C9KA 3P3NA 2JJ6A 4A42A 3OJBA 2JDAA 3IKWA 3FHAA 1ND3B 1KRIA 4Q0PA 3UV9A 3ZPOA 4YFWA 2J1AA 2JDMA 4IEZA 1KITA 5C6CA 2RS51 3JQWA 1C3HA 4QQOA 5CKMA 4CEWC 2W0XA 2UY9A 3PNAA 2WNEA 1KS5A 3Q8FA 2VCAA 3ZFGC 1WLTA 3VBOA 1AR82 4EQVA 5IVFA 2BNOA 5F8PA 2OXBA 3AMPA 3X29B 3M2MA 1HRV3 1PMJX 2XJQA 2VZ1A 1OA3A 2CGOA 3EYPA 3I2FA 3M4FA 4M4PA 3RG0A 1FYUA 1OMIA 1W8NA 2LS6A 5FKCA 5DAVA 3WY6A 2LALA 2PHLA 1BZWA 5DN2A 1BHGA 1UOBA 2I45A 3WXPA 2MPFA 3FHQA 2YPDA 4LITA 4RQPA 3SH5A 3N7MA 4CEYC 3WG3A 4CU6A 1B35C 2HYKA 3S57A 1G9FA 1Z7S1 1ZBA2 2V5DA 4Y20B 5LBFA 4XIOA 5FZ4A 2HH9A 3ETQA 1SBFA 1W6OA 1H8TB 1REEA 4IV1B 2GC3A 4WM8C 2C1FA 4JTNA 4CDWB 1RL3A 5L7OC 1LEMA 1DZRA 2G4IA 5T5OA 4RS5B 2VNOA 4FFFA 2CWSA 2VZPA 1D0GA 4H14A 4MGSA 5FUPA 3EJKA 2H0VA 4LTAA 2LW8A 4K1ZA 4COYA 3KM5A 1UU5A 3MV01 5FUIA 1ENXA 1OA2A 4UFMA 2A70A 2R043 3O1UA 4AI9A 2EICA 4AGRA 4UW6A 1LKNA 2X10A 2OT7A 1ZZCA 1CAVB 5JMOA 2XR4A 2ZGTA 2ZEYA 1NYWA 2R072 3DXUA 4KWKA 1VBA3 2VPVA 1XPWA 2CV6A 4NRQA 1SDWA 2R073 4MX3A 3NV2A 2VZQA 1ASJ1 1Z78A 3UKNA 4HVQA 2JIJA 2WT1A 1AXKA 1K5JA 1QXJA 3BPZA 5EJ3A 5G04L 5LRRA 3JQXA 5B2GB 3O0WA 3KSCA 4I3GA 4LBJA 4PIYA 2ILMA 4QKDA 4DOUA 1QMJA 4Z82A 1CZSA 2RS33 1RVF1 3AP7A 4NWVA 1RMU2 5GKAC 5JAXA 1HN1A 2P3IA 2DVDA 2WC2A 5LASA 3ZKYA 3UNPA 1S2EA 1M06G 1ND2C 1AX1A 3S5AA 4KI5M 4AQ2A 2OVUA 5A32B 5CFCB 5CFCC 3H50A 3CO2A 4LR4A 5J1XA 3H7JA 1W39A 5J48A 1YUDA 2BDRA 2J1RA 1NLSA 1PK6A 3L9JT 1AX0A 2AREA 5FYZA 4OVEA 1U5ZA 3T0AA 5CAZA 1IKPA 1RITA 4K3UA 4GMP3 1W0PA 1VBC1 5FBJA 3ZIXA 4ZHNA 4WVMB 3M3EA 2RS52 4XAEA 2WJSA 2JDYA 2Y6FA 4Q0UA 3SNMA 2IC1A 1FNZA 3VBSC 4EN9B 2HEVF 1UXXX 5LK7B 1GZWA 4M0HA 1N1VA 3NQHA 1RUC3 1ULOA 1SG3A 3J8F2 1X9PA 2K46A 2VZSA 2WDBA 1HRV2 3M3QA 2YBSA 2W95A 3OD4A 5T5PA 1WWYA 2YC2A 4JKLA 4E4DX 3AYEA 2E31A 3H8XA 1AZDA 1CONA 1UIKA 1H2MA 4BU2A 1UW8A 3LA3A 5BNPA 3DYOA 2HWE2 1W6PB 3VL8A 4RS5C 2XVLA 3WF4A 2E7AA 4CDWC 4HOOA 5LA1A 1G9DA 1Y43B 5FUNA 3J8F1 4XQWA 3USUA 1IQDC 1H8TC 4P08A 5CYYA 4LHSA 5L73A 2NM1A 4CP0A 4N90A 1Q56A 2C0ZA 3RZHA 3V0AA 1Q8SA 3PUHA 3L2YA 4IEOA 2WSVA 5H9PA 3DCQA 4MSVA 2HWB1 1KXGA 3H1YA 4XJUA 2FCUA 5D21A 2P17A 1PIV1 3O14A 3UGHA 1PVC2 1FPN1 5C3PA 3WUDA 2WWJA 3ZDVA 1QJX1 4CRQA 4EN6B 4LBQA 3K3OA 2LTNA 5L9BA 1ND2A 1FNYA 3FX3A 1CJDA 5JXGA 2A6XA 4XVHA 4CCKA 5SV8A 4TWTA 1YFYA 1W8WA 4B7KA 5DABA 1WCDJ 2IXCA 4ISRA 1O4TA 4A7YA 3ZFGB 1XB9A 1UYZA 1UY0A 3ES1A 5DAQA 1W04A 3CZUA 3TNPB 3T09A 3ZYIB 5FOJB 2Q8CA 5C8CC 5JPNB 4NVPA 2Y0OA 1OPOA 3VBFB 4Z92B 1NE6A 2A6WA 4TSVA 3O1VA 3MPBA 4DY3A 3B9CA 5FY5A 2DBNA 2JD4A 1SLBA 4JGYB 4ZU4A 4LIVA 1V6KA 3R4DB 2ARBA 2YBKA 3T2OA 2QQPA 4EV0A 1HRI3 2ZACA 4LO4B 1C8M1 4NIAA 1ONAA 2ZKNA 3DXTA 2VO5A 4IUGA 5JDBA 3C7FA 1S0CA 3WNKA 1LR5A 1OFNA 2JB8A 1RUD3 4J6GA 3URFA 3PURA 1AL22 3K4ZA 3ZYRA 4FOQA 2A73B 2FQPA 2DYCA 5BY5A 3IAQA 4URTA 2YROA 4RFRB 3WNPA 2MEV1 3WP4A 3N36A 4GH4C 4JCKA 3B5LB 4JQRA 4Q0SA 2JG9B 4A2UA 5GZGA 1BXHA 3EB7A 4JGYA 3SH4A 3NV4A 2YMZA 3GXUA 5FPLA 2PN5A 3K46A 4XF0A 3GBFA 4BZ4A 3DKWA 1H1MA 3I54A 3U0ZA 1HRV1 3I2OA 1Q5OA 4OYUA 1HQLA 3TAYA 5C5UA 1DQ0A 5GALA 1QJU2 4PDWB 1UOJA 2P34A 1RJ8A 1SCSA 2B7YA 1AR72 4Q27A 5FYTA 3I4IA 3TN92 3VBHB 4AVBA 3TB0A 3WP6A 4CU7A 1YC61 3LEKA 5FK8A 4Q4Y1 3HMYA 4CDXB 2EVXA 2OX0A 4IEPA 3ZN6B 4RQPC 3P6BA 5LRSA 4BQ4A 4C0BA 3S30A 1X36A 3DPRA 4IETA 3APBA 2OIIA 4LA2A 4Y5SA 1V6IA 1ENRA 2R042 2WO7A 4QX1A 4QPGC 2WLPA 1A34A 1PM7A 1RUC1 1VLNA 3AVSA 4IV3C 4FOWA 2HKXA 2IVJA 2XKOA 3E6BA 4DRVA 3ZR5A 1MEC3 4LEJA 4YNIA 1OBNA 3J7MA 5ACA2 4XC9A 4Y33A 5FYIA 1WKYA 1E5HA 4S2DA 2TEPA 1N1SA 2RHPA 5IAVA 2FCTA 3MW3A 4BMBA 3PDQA 4UFKA 1NLRA 4A6OA 4CVUA 1AR61 4Y4YA 4CZSA 5J96B 2JWPA 3C7GA 5A3NA 3D6EA 1AYM2 1JU4A 2QNKA 3W5MA 4JVAA 2PYTA 2O14A 3ZO0B 3AYAA 3U37A 1H8VA 1GZWB 3VBRB 1LU1A 1UY2A 4PCRA 3JBG2 3HBZA 1Q8PA 2N7GA 3MLJA 4EJRA 1F4HA 1WLWA 4QMAA 1XXNA 1QQP3 1PMIA 2Z69A 1LJ7A 2R062 3LEMA 3MF6A 3PIGA 2VZVA 1F35A 1K45A 5A1AA 2Y33A 1WMFA 3JXSA 4QD2A 3V56A 1OLME 1MZEA 2J1SA 1PZ9A 1NQDA 2E26A 3VDDC 1I6XA 2I2SA 1PO12 1EP0A 1VBC3 2VQTA 3PTYA 1SZBA 1V0AA 2GDFA 4ZXKA 2D43A 4J25A 5DUWA 3UGFA 1LENA 1MZ6A 3H9AA 2HBUA 1H1AA 2CWMA 3NAPC 3N35A 4BK5A 5CZKA 5M0TA 1RUF3 2DUPA 2VCBA 4NRMA 1DGWA 2J1UA 2WYFA 1VBD2 2F17A 1UKRA 3RSJA 4QHOA 4Z1VA 5T5JA 2ZGPA 5A6XA 1FV2A 4CCOA 5FY1A 3ACLA 3LDBA 3LF7A 3QACA 4W6WA 5DAXA 1CAWA 1ENQA 2VNRA 4LKSA 3ZYPA 3PUSA 4QPIA 1KS4A 5BNPB 4AE2A 1SLCA 3AMNA 3OEBA 1RUH1 3KWVA 3FHIB 4XUPA 1CAUA 4XUOA 3ZSLA 1MVQA 2O8QA 4YVWC 1YNAA 3Q8BA 4BXSV 3VUOA 5A3OA 2BV4A 3BOPA 1ZYBA 4AEDB 2JDZA 3AX4A 4P14A 3U14A 1A78A 1ULFA 2QVSB 3H7YA 3UYJA 3BTZA 3AVRA 1TG7A 5GZDA 5FY0A 1FPN3 1V6NA 3H3ZA 5HCBA 1JI6A 5HXVA 1RVF3 2OW4A 1W9WA 3VD5A 1QQP1 4GWMA 1OF3A 2W91A 4GD4A 2QQOA 4LUKA 4FBFA 3RZMA 2RMU3 3IZOA 5DPNA 3T2PA 2WFF2 1O7FA 4Q5OA 4DRRA 3E6DA 3JD71 4WZCA 3W5NA 1OVPA 1JZ8A 5IVYA 3JD73 3VHOA 3LKJA 2RDSA 3FUOA 2P37A 1RUI2 2GZWA 4Y22B 1QJZA 3BPSA 4JDOA 3A0NA 1VMJA 3ZFEB 3B01A 4XMIA 4Y26A 4XHBA 1UMZA 4YYOA 4QU1A 3B3QE 2WNVC 4FO9A 2EF6A 5GLWA 5JZGA 3VZMA 3O7OA 2XLFA 3OBAA 1OQ1A 4QX5A 1OUSA 2WO3A 1XYPA 3WVJA 1R1A3 4ZS3A 1HDKA 2XJSA 5LZ6A 4ZONA 1UY4A 4K7JA 1UD1A 5FOBB 2YHJA 2YC4A 1G9BA 3MI8A 4BQ5A 1PZ8A 3NRUA 2X05A 2W1SA 1HRI1 3KVAA 1WA4A 1BK0A 3Q9OA 3POJA 1NE4A 1UF2C 2BNNA 5GZEA 3ZSJA 5FMBA 1OVSA 4X6RB 5JLVA 2V4VA 2CGNA 1FX5A 4HSJA 4BQXA 4CPBD 5JI9A 2X5IA 3Q8CA 2DF7A 5FMCA 3POSA 3WP3A 3M3OA 3R05A 1VBA1 4JDMA 2CHHA 4AI3A 4CU8A 2D97A 4Q8LA 4CU9A 4PLNA 2QZ2A 3S5QA 2ORXA 4XMAA 3SISA 1PGSA 3CDZB 1SDDB 4W65A 4Z2WA 2AUYA 2D93A 2VOWA 1BEV3 4OZXA 2GMEA 3WDWA 1IPJA 1UY3A 3BIWE 5JXIA 3VKFC 2RMU1 5FKBA 4HN0A 4B29A 4K21A 1JW6A 1OOPC 3IM0A 4Y22A 1UNBA 3GDBA 5LCWL 1QJX3 2FDHA 3FWEA 3JBG1 4RGAA 1RHI3 3W20A 4XILA 2Z79A 1SEFA 1NCQA 3AMQA 3GZEA 4JX0A 2QZ3A 2WINB 1W2NA 2D6NA 2DDUA 2WZR1 2V09A 4AHZA 4LBNA 4I0WB 2XUEA 4C8DA 5A7WB 4GWNA 3H0OA 4WM8A 1NCRB 4Q4Y3 4KU8A 3U4SA 2VMGA 4BQ2A 3EHKA 3LOIA 2RJ2A 2B8MA 5LB6A 2LRPA 2WR9A 2DU1A 4EN7B 5FMOS 4YARA 3I97A 4LT5A 1OKQA 4NHXA 5DAWA 2VQ0A 3D0SA 1C8M3 5HCFA 5GJ6A 4DEQA 3ACGA 1WMXA 3V64A 2XGXA 1UPIA 4MADA 1MS9A 2FZ1A 4LLFA 2ARXA 4XUTA 2IXIA 2DCTA 1QIQA 4OFGA 4PLOA 3BODA 5HXMA 1CAWB 4H3WA 5BXXA 2D6OX 4AW7A 4LE3A 1IPKA 4Y3OA 5FXXA 1TMF3 4LO7A 2CAVA 2RDQA 4C90A 3AKSA 3W9AA 4XDOA 4CDUB 2Y38A 1BBT1 4QXBA 2ZPXA 3MLKA 1L7QA 3D0JA 3MICA 4LO8A 3OBRA 3DPRB 2JDPA 3AP5A 4AR2A 4Q4X2 1W8HA 2VMDA 4BDVB 4E4ZA 1DYPA 5FP7A 4EZHA 2NQYA 3MV11 2LM3A 5C4WC 1X50A 2RM21 4YZ2A 3MZHA 5ANQA 1WW5A 4FQZA 3CNAA 1YI7A 2KA3A 3SEEA 3VHPA 3T2QA 2CGPA 4OQ9A 2IVIB 2VVEA 3EBRA 3VD7A 1IG0A 4XFAA 2WRAA 4GB32 5A7PA 2EIBA 3A7QA 3HQRA 4HLTA 4AVCA 3AXDA 2Q8DA 1LOGA 2EAAA 2Z4FA 2YXSA 1UIJA 2C4XA 3RYPA 3ZKUA 5FXVA 5A3WA 2RV9A 1Q8QA 1ZBE3 4IEQA 3ETPA 2PAKA 1LGCA 5A7QA 4LBOA 1JUHA 1RUI1 3H3UA 1ZBA1 1POQA 2WYSA 1NZCA 4XJ9A 5GZFA 3VBRA 4WVWA 3B02A 4K9SA 1DZTA 4OULA 1A8MA 2B4KA 4AVAA 5IK5A 2VQAA 3AKPA 5EJZB 2W52A 5CA6A 3AK0A 4QU2A 4D0QA 1PO21 1Q43A 3IIIA 4IE0A 4ZS2A 3ZXLA 3NSTA 4MHUA 1QH7A 1PK6C 2RMU2 5KR7A 3MLLA 2PAEA 4UFHA 2R1DA 2JX9A 1U5IA 3JU9A 4LLOA 2PHRA 3U1XA 1EUUA 3WLUA 1CAXA 4YFZA 3K3NA 1BEV2 3UJQA 2Y6KA 3DPRC 1GSLA 5EYYA 5K4LA 5FWJA 1E57A 1XC6A 1E5RA 1RUG2 3GGLA 1OLRA 1QJY3 4HKOA 5F6LB 2IXJA 2ZMKA 5FP8A 5CADA 2NMNA 4YVSB 4KWLA 2RM23 4YW5A 5CG9A 3S7IA 4M3CE 1BJQA 5HCHA 1S1AA 4WM7A 4DZGA 4RSUA 5FY7A 4YW3A 1RHI2 4CDXA 2AENA 1CJPA 3ZM8A 5ACA3 1DQ1A 1SCRA 3RYRA 4P9GA 5KHJA 1QKQA 3FFZA 3TN93 1R092 2A6VA 1AHSA 1NUKA 1C1LA 1UZVA 2E51A 4FPKA 1GKBA 3H8OA 4NRPA 1PX4A 1OLMA 1VAVA 2WL1A 1XNDA 2PELA 3DEMA 3FBMA 2BVBA 5KXBA 2BW8A 1G9CA 3VDDA 3I3DA 1TME3 1JOPA 3AMHA 5GM0A 2HWF1 3UL2A 4Q4X3 5DZEA 1ZRDA 2K9ZA 3N9NA 3KGZA 4FVVA 2W92A 1NOVA 4AWDA 2HWB2 4QX0A 2VJXA 1R083 5FYCA 1SMVA 5F3EA 2A1XA 4P9LA 5DZGA 1KGYA 1GZCA 2VXRA 1ALYA 1W99A 1WLDA 1XU2A 4CYDA 1YXWA 4ARXA 4EWAA 5D1IA 1D2SA 1B35A 3OEAA 2ZGLA 4D6SA 4Y1XA 3HT2A 4F7ZA 3TRSB 2WZ8A 5FZEA 2YZ4A 4V2WA 2D6LX 4QQLA 1YIFA 2P3KA 1AL23 4OQ8A 1RB8G 4Y1VA 3E97A 3SCGA 1ULPA 4I02A 3WP5A 4XJ8A 1E5SA 5DDJ1 2OPWA 2WA3A 4AFAA 2RJLA 4EZ4A 4JKKA 2UYBA 4FP2A 5JCTA 1SPPB 4QWNA 4MGKE 4ZU7A 3ZSMA 4Y24A 4NJ4A 5I8YA 3C7OA 4PIZA 1OUXA 4FPLA 3RJ2X 1UN1A 2HWC1 4FPFA 1I3HA 5F2WA 2OUJA 2G1MA 1CWPA 4XZPA 4WM7C 2FDKA 3HWJA 2OS2A 3MIGA 1YQCA 4I01A 4XFHA 3SMHA 5CVRA 1BMV1 2R0FA 3PVNA 2WNVB 1F8VA 2W1WA 4N7IA 1IOAA 3E5XA 3NKGA 3ZFEC 4ZPIA 1UYXA 4DUWA 4NMIA 1OFSA 3LSDA 1JS9A 1WD4A 5A7WA 4RHV2 2EAKA 4E2SA 2Q1MA 3OYWB 1X9TA 4XHXA 2WZPP 1C28A 2J1TA 1KDMA 2B45X 5EJ1B 2W47A 3U78A 3SQOA 2VAUA 4AYUA 2W68A 3O1RA
chains in the Genus database with same CATH topology
3AYDA 4Q1PA 4XTMA 1PO11 1W6PA 5JI7A 2HWE3 2DVFA 1J58A 4BE3A 3NV1A 1VBB3 2WQ4A 2HWD2 1DDLA 4YVWB 4FXKB 4QT6A 5FAXA 1PNGA 1OSGA 3OGJA 4BQ1A 4C1XA 3U07A 1FAYA 3ZSKA 1Z0HA 3WDUA 4IQPA 2BWAA 2ERFA 4MZUA 5IUQA 2RS12 1C57A 2FHRA 4Y20A 3HN1A 3GBWA 1QWRA 1RHI1 1QNWA 2NN8A 4QM9A 5KXEA 4ZKTB 3AYCA 4FT8A 3B9IA 4WVZA 2HEWF 2I07B 3ILNA 1HW5A 3HR9A 4ORFA 4NN0A 3VDDB 2B39A 1HKDA 2DU0A 3MIEA 3PMSA 3AP9A 4R4XA 3VBOB 3ZXEA 3PHMA 2GNBA 2HWC2 5FFOC 2HJIA 1GNHA 5FBZA 4B7EA 5CU1A 1DQ2A 1DGRA 1O4ZA 1U5XA 2XJUA 3RWNA 4MGIE 4P9JA 4S2GA 3B94A 4FPJA 1VBD3 3MPPG 1TMF1 4RR3A 1BMV2 3NJZA 4O9GA 5I0TA 2IZWA 1UPSA 2RR11 3OTFA 4WV8A 4GXLA 4B4PA 2VNGA 4PQ9A 1VBC2 1ASJ3 2VOKA 3BCWA 4LBQD 3TNQA 4L11A 1I1EA 2B9UA 3AMMA 1YFXA 3JB4C 1QJU3 1EAH3 3AXEA 4IV3B 4MGZE 4YG6A 3VKLA 1X33A 3CL1A 1X7NA 1RC6A 4AQ6A 4B8EA 4NOTA 1F5FA 3WHUA 4XEZA 2D98A 3PVBB 1AJOA 3HD8B 3R4SA 4R9CA 4CEWA 4MXVA 5BNQA 1MS5A 4RQPB 1FI2A 5IK8A 3AZZA 1FMD1 3OYWA 5DUXA 4FPEA 4CDXC 2VG9A 3UKTA 3N3HA 3HIFA 1PGL1 4BIOA 4CDQA 1LU2A 4J1XA 1N3QA 3W59A 2QDRA 2WNVA 4AG4A 1DGWX 4PDWC 5FQ0B 2Y0IA 3M1HA 2OA2A 3RS6A 4XFFA 2ZHMA 4L8QA 2DTWA 2BPA2 2RS11 3RI9A 3IWZA 2UURA 5ABJA 3S0MA 3O0VA 1JOJA 1QDOA 1PGL2 4QPGA 1QH6A 4AQTA 3EXUA 3O5SA 2BFUL 4R9DA 2BNMA 5CFDB 1HV1A 2DWRA 1A6CA 1ZBE2 3WCRA 4YW1A 2VW2A 3LSEA 4MGYE 3USUB 4OI2A 2QJVA 1XNBA 2RS32 1BYHA 4LULA 3GZAA 2XJVA 3PVOA 5GLTA 1RUJ2 4BYYA 1V6LA 2HWC3 3ZMOA 4I0AA 5K7PA 1XU1A 4JGYC 3MGUA 4NHKA 3W58A 4AXOA 4XF3A 4L92A 5L19A 1PHMA 3VBFC 1NCRA 5C8CB 1MR5A 4L97A 3WHTA 3OD0A 3QLQA 1LCLA 1RUE3 1QU0A 3RJRA 2TUNA 1IKQA 4BPZA 1W6MA 2Q0AA 4Q2FA 3OY8B 1LHNA 4AGVA 2KXLA 4MXWA 1R1A1 4PBOA 4QGLA 1ZRRA 1NCQC 2QFEA 5GLUA 3KB5A 2GNDA 1TNRA 2QDNA 1UZYA 1S0BA 1G8WA 1ZZ8A 2C9AA 4AQSA 1JXNA 1WMDA 1BK1A 4IL7A 1XYOA 4IEVA 4K8FA 1HX6A 5I91A 4N9HA 4MYEA 1BEV1 3ZN5A 1HXS1 4EROA 3AP6A 2VY0A 4XFCA 2AH2A 1I9RA 2GALA 1ENSA 1RUG1 2GC1A 4EWDA 5FO8B 2OPKA 3CJIB 3J26N 3VBSB 2ZMNA 1X82A 4UXAA 4KNCA 3IT8A 4Y1ZA 3AZXA 4HL0A 3MDPA 3CU7A 1WBFA 2ZGUA 1ZBE1 1OA4A 4IV1A 3PMEA 4XBNA 2AZ5A 2D6MA 4XW3A 2D3SA 1W6MB 2CYFA 1Q8OA 2ZHKA 3BOWA 4OUMA 2OYZA 1ND2B 2WT2A 1H2LA 1FOD2 3C3VA 3NAPA 1J1TA 4OI4A 5L7OA 3VHRA 1C8NA 4V1PA 2ZAHA 3MFAA 4AK3A 5I0RA 4XJAA 4CDUA 1TNFA 2VOXA 3N7KA 2RS53 2GNMA 4WVVA 5AC93 3AZVA 2WFF1 4NHLA 2K0GA 5LK5A 4OHVA 1QXPA 1W6QA 5EXOA 1EPWA 1FPN2 4XJWA 3KLSA 5EZWA 2PHUA 1Z7S2 3ZVXA 1V70A 4DQAA 2UU8A 1L3JA 1MACA 3JZVA 4WM8B 5L7OB 4IV1C 2XJPA 2HWD3 3MYXA 1YCIA 3WUCA 3GZUC 5LEJA 3SXWA 3VZJA 2Z5WA 4J1WA 3WG1A 1B35B 1QOTA 4B4QA 4JV4A 3VKOA 4CEYB 2IFWA 5FQ0A 3ZFFC 3DV8A 3M8LA 4NHMA 3MIHA 4A7ZA 5LEKA 2WFPA 5JPMB 4AVSA 2ZGNA 2JEMA 4Z8BA 1R1A2 4YG3A 3ZYJB 5KHGA 3ZX7A 1TMF2 5BUVA 4CEWB 2ZKLA 3JD72 1RUD1 3SCFA 1F9KA 2Q5TA 2FMYA 3RMYA 1RUH3 4R9BA 1ND3C 2ZGRA 1RGSA 5A33A 4AF9A 5BNNA 3NO8A 2XBO2 4N43B 2BQPA 1GV9A 2VOVA 5KBFA 1F5JA 1CD3G 1RUE2 5CIRA 4QM8A 1S0EA 1WBLA 3VGIA 1MS1A 1DG6A 1J3PA 1EYBA 5I0SA 2W39A 4YZ4A 2D3RA 3ZN6A 1LULA 1CAXB 2BFUS 1QJX2 1FOD3 2WIIB 2YPJA 4AVVA 1RINA 1H8TA 5KXCA 1AYN2 2YGLA 1NY71 3KT4A 2BGCA 1IS5A 1U12A 2VMHA 1RUF2 1G86A 5C9AC 3WQ1A 1G9AA 3V65A 1VRH2 4ONUA 1RTVA 3DL3A 4CTEA 4LUMA 5BNOC 5F1RA 5FTTC 4Q29A 1JH5A 2HWE1 1MVEA 1K5MB 4HN1A 2R16A 4JRAA 3N4MA 1I5ZA 1MS3A 1BQPA 5ACA1 2DV9A 1QQP2 2CY6A 1W0OA 5FLHA 1R093 5FMOL 3PJYA 3RPQA 1SLTA 5KHHA 1DHKB 2R0HA 2YY1A 3KCCA 1DGLA 2GU9A 2GMPA 4DINB 5C4WA 1JYCA 1WGPA 5C33A 1WUVA 1SACA 1AYM3 4QPIB 4AHYA 1AR93 4QQHA 1Q8VA 3WDVA 2W08A 4FTEA 5JOWA 2VW0A 2D44A 4GH4A 1POV1 3VBUB 1TME1 1R082 4XE9A 4GQ7A 5JSRA 2XLAA 3POYA 3VKMA 1DQ5A 2B42B 1C1FA 5HBAA 4ASMB 1DFQA 4LBQB 1OI6A 1MQTB 1N1YA 4AEJA 1O3TA 1VBE1 3MF9A 3FMGA 1SLAA 4FPHA 2WS91 1LHWA 4XFIA 3B7MA 2XJTA 1SBDA 3VZOA 4AGGA 3FC0A 1Q3EA 2ENRA 2XWJB 1J59A 4NPRA 5C8WA 2CAUA 4XF4A 4CP1A 2JG8B 1GANA 5JZGC 1UX6A 1QJY1 1AR73 4JAAA 5J3UA 2DCZA 3L2HA 2X8KA 1UZZA 2VU9A 3H8UA 4XTPA 1POV0 5CBLA 4LO6B 5K0UA 1H30A 3TN91 1VALA 3IPVA 2WT0A 1AF9A 2ZABA 4K6BA 4Q4V1 4LBLA 4C91A 1D4VB 3U4XA 1D0HA 1ZBA3 1GZ9A 2FZ2A 1ZNPA 3OBTA 1GLHA 3WDYA 1VR3A 4UBGA 1QGLA 3HAGA 4M00A 4RR3B 3BU7A 4XYXA 3MIBA 3VZKA 5J98B 1QF3A 3E5UA 4QHBA 2GMMA 4Q4V2 5HI0A 1S0GA 5K8SA 3INAA 4HPKA 4XBQA 3OY8A 4X8PA 4BIFA 2E6VA 3IBMA 2QE3A 3K51A 1WCSA 4PDWA 2Z42A 3H1MA 4FTSA 1MS8A 3SITA 1ULCA 1VBA2 5JOYA 2A6YA 3POWA 1RIRA 1HQWA 1IGOA 4JGZA 4D7TA 3BB6A 5K0UB 1MZ5A 4LNVA 2CNAA 1ZZBA 3VV1A 4G3YC 4XPVA 1RMU3 3AKQA 4FTBA 2ZS6B 5I93A 4WBBA 1CAUB 2FBEA 5J36A 3OF1A 4M3CB 4CDWA 1AR91 3AJYA 2IWGB 1C8M2 4L99A 2JG8A 3ZXDA 1W6OB 4Y1UA 4XBLA 1ULGA 4Q4W2 1PVC1 5E89A 4BOWA 4O9EA 2QKDA 3AKRA 3AFKA 5JIUA 1TE1B 1H2KA 1K5MC 2PAMA 4BA6A 3TYJA 4LHNA 3ALQA 1PO23 3VBFA 5H9SA 5ABJB 4XQDA 4TYSA 1J1LA 3QH6A 4H55A 3KQRA 3ZFGA 5CG8A 5D8AA 4M3CF 1YHFA 3ATGA 1ZZ9A 3E5QA 3GALA 2XWBB 1UKGA 1CX4A 4JRLA 1WW4A 2Q4SA 3MW2A 4QQ2A 4Y5Z0 5ACA3 1N3OA 2YDEA 3DN7A 4AI2A 3ST7A 3H1WA 1CN1A 4OHZA 3OCPA 3U11A 5JMCA 2HWB3 4SLIA 2UWCA 1REFA 2XLGA 1VJ2A 4KBBA 2RS31 1LOFA 3RDIA 1J3RA 1IS4A 3ECQA 1J3QA 5FPXA 4GA9A 4YG0A 5CB7A 2PTMA 3ZIWA 2ZA9A 4I09A 4YM1A 3J4UH 1DGRN 1SFYA 2GN7A 3M7AA 4GB33 4JTOA 4I0BA 4M3CA 2X5IC 1CR7A 5FCCA 4HSLA 4HZFA 4N43C 1QOOA 3QD6A 4IEUA 2XG3A 1B09A 1APNA 5H9RA 3ZXGA 4QGNA 2DVBA 3IN9A 4BHPA 1OHFA 4D7YA 4JGZB 1CPMA 2ZZJA 4HK8A 5D8AC 5DUUA 5L36A 5BYNA 2BWCA 5KC5A 5K9YA 5BNOA 1YFWA 1PO13 4TLFA 4COWA 2X53S 4MV2A 4META 1BCXA 3ZFFB 4E9KA 5BV6A 3DF0A 5KHIA 3LCPA 5TSWA 1V6OA 1SBEA 3ENRA 1V6MA 4P9YA 4SBVA 1V6JA 3WW3A 3I8TA 2JECA 1IHMA 4N53A 2VW1A 4W6XA 4DS0A 4JC1A 4YW4A 1C4RA 2YC0A 1PGW2 1C5IA 2JE7A 1FXZA 3FLRA 5DUVA 5IK4A 5IT6A 3QOPA 1FMD3 2A6ZA 5JSPA 3BALA 5BNNB 1XQNA 1URXA 2XL9A 1AYM1 3WNXA 2NZ9A 4Q0QA 2A3YA 4DXZA 4YW2A 1LGBA 3NV3A 1YLLA 4QXKA 1CGPA 4YVWA 4KH9A 1YI9A 2G9FA 3WINE 4COZA 4CDQC 4E2QA 1KFUL 3ZFEA 3AZWA 5KHKA 4FOYA 4FQ4A 5T52A 2YYOA 1SLIA 3ZPYA 3BTAA 1SQ4A 4KQ7A 3I2DA 4RFT0 1AUYA 1KJLA 3VZLA 1GFF2 1GICA 3U10A 4IERA 4N53C 2QCSB 3ZDSA 4ATEA 3LOBA 3IDCB 1GQHA 1W2UA 4FAGA 4BWOA 1LESA 1DIWA 5JR7B 3CJIC 1W6QB 3RQ0A 2D3PA 1UAIA 1RUH2 2ZJCA 1LOCA 1F31A 3ASIA 1NA1B 4H7MA 1JYIA 2IFRA 2VULA 4OHXA 4KGGA 2AGSA 1KD7A 1GR3A 1ND3A 3R4UA 5BPXA 4W6YA 4OHYA 2EXIA 4B3NA 1U0AA 1POV3 1JHNA 2PFWA 3KD4A 1O3QA 4N9IA 5JVVA 2NPIA 1PO22 4M01A 3MW4A 4WZFA 3NL1A 2CTVA 2O0OA 4EN8B 3ILRA 3KS7A 5FLIA 1HV0A 1JTZX 1WW7A 2EALA 2D5FA 1NCQB 2WNUA 4OI0A 1O3SA 5E16A 2LUWA 1U5YA 1S0JA 4D94A 3UKVA 3WV6A 2JE9A 2KM2A 2BUKA 3WOGA 3JCIA 4AHXA 5J7MA 2WA4A 1LB2A 3HQXA 1BBT3 4Q0VA 4RHV3 2D6KA 4P5HA 4U36A 1VRH1 2ETEA 2BVVA 5T5LA 1QJU1 3ZN4A 1LHOA 2Q8OA 4GKXA 2D7FA 1VAMA 3I7DA 2EXHA 1PIV3 4GULA 2DCYA 4NR1A 4XF9A 4OHWA 1PGW1 1O3RA 4ISQA 1MS0A 4INDA 1S2KA 5T50A 1AR92 1LEDA 1NG0A 3PVEA 2ET1A 1S0IA 1TEIA 4E27A 4YVSA 3ZXFA 4RD7A 4XOGA 4KGQA 2ZMLA 4Q4V3 4HVRA 1PNFA 1H9WA 1DZQA 1QOSA 2PHFA 3GNEA 3ZXJA 5FO7B 5JWPA 1VB2A 5CFDC 1A3KA 1LHUA 1OOPA 2R1BA 3RI8A 4B4RA 4Z07A 1N47A 3WW4A 2WNUC 3SCHA 2QUOA 1OQEA 5KXDA 2XPJA 1VBD1 2GNTA 4IXLA 5T54A 4UW5A 1EV13 1QXRA 1AL21 3SLIA 3VKNA 2R32A 1O91A 4GIQA 5C8CA 1ZRCA 3ELNA 4MUVA 3FLPA 4AHWA 4S2HA 3LAGA 3CJXA 4AEDA 3D5OA 4Q1RA 1VRH3 4YLZA 4LO5B 2WS92 4CEYA 4XFBA 2PQQA 2YUEA 4XIKA 5AFBA 4EWEA 3K48A 2R49A 4E4SA 4PF5A 1KDKA 4ATFA 1FMD2 3P3PA 3B93A 4GALA 2BBVA 1PZ7A 2VGDA 3USSA 4YGDA 1Z7S3 5FLJA 1GQGA 4Q4Y2 5CFDA 1G7YA 2PHTA 1VP6A 1YIPA 1RUI3 5F5QA 5EFUA 3WQ0A 4JDNA 3TBDA 3G7DA 2VH9A 3AKTA 1R081 2RS13 1SFNA 2GH8A 2UYAA 2VMIA 1PVXA 3AP4A 3JUUA 2XBO3 3ZFFA 3RNSA 1RUD2 4RGGA 3IDEA 4Q26A 1HRI2 5DDJ3 5JOZA 2XB6C 1R091 3MFCA 3SH3A 4F3JA 2JKBA 1FT9A 4FPOB 4RHV1 3VBOC 1H1IA 4PBPA 1LODA 1ZVFA 2R071 4HK9A 4MLOA 2VUJA 2ZCWA 5FO9B 4KL1A 3S7EA 4AFDA 3RYKA 1AXYA 3CF6E 1AR83 2P3JA 3IDBB 2WNUB 4UW3A 5EYXA 5JOXA 3E6CC 1ZRFA 2ZHNA 4HBNA 4D69A 2D40A 3NVCA 5F9TA 1RMU1 1QHDA 1S2BA 3KT1A 1R1ZA 4HKLA 4AFCA 4K1YA 2ZAAA 2PA7A 5E88A 2HWD1 4DMIA 1AYN1 1NY72 5CNAA 3IIAA 4DPNA 2JICA 1BBT2 1FOD1 5HCAA 3EQEA 2WZR2 4RL7A 4N7UA 4C0HA 3MEPA 1YJLA 2D6PA 2X29A 2WSUA 3FBYA 2DUQA 1KQRA 4KG0A 1CQ9A 1NA1A 4FPYA 2R6QA 1VBE3 2B46X 1ZM1A 2TNFA 2XHKA 3M3IA 5T55A 4YZ5A 2EA7A 3QBQA 4YGBA 4AVTA 4H7LA 2NP0A 1AR63 1EPZA 1RUC2 3J8F3 5EV7A 3VL9A 2I74A 2E7QA 2V5YA 4MXWB 4HETA 3ZMNA 3CEWA 4LA3A 1LHVA 5DG2A 1HXS3 2WFF3 1UCXA 1S0DA 1OPMA 3WW1A 4BCUA 2ET7A 4WM7B 1PIV2 2R30A 5T3NA 4ZU5A 3IPVB 3RMXA 1ZREA 4MH0E 4UBHA 3KCXA 3WW2A 1TME2 2A5ZA 2XVKA 4E2GA 2K2SA 2MEV2 2JXAA 4FCAA 1MS4A 2UWAA 1XNCA 3ZYGA 1PVC3 2DTYA 1UL9A 4FAHA 3WG4A 4HFSA 4M0NA 3LA7A 4RS5A 1NA1C 3GHMA 1WMEA 2A7AA 1XRUA 4YM0A 4D3WA 1Y3TA 4FPGA 1AL0G 2XL7A 2ZHLA 3PLQA 1JN2P 2D5HA 1H9PA 3LWCA 3THTA 1DBNA 4FXGB 4IESA 1ULEA 5GZCA 1MEC1 3A4UA 4HANA 1QJY2 2ZGQA 3NKTA 4N53B 2MEV3 2ES3A 1WCKA 1O5UA 1H4HA 2G9GA 5I0UA 1X8MA 1RUJ1 4COUA 3V0AB 2ZX2A 1KJRA 3AFGA 2ZX4A 2ZGMA 1V9U3 4LHKA 4G9SB 5E1RA 3VN4A 1CPNA 2UY8A 1TQ5A 3M70A 1EAH1 1H0BA 2XJRA 3WZ1A 2ZX3A 4CDQB 1QNYA 4GMP0 3GHNA 4C1WA 2GC0A 2WZR3 4FPCA 4BMEA 4R4ZA 3OPZA 1WLCA 4IEWA 1AR62 4Q4W3 4YVSC 3T1LA 4XFGA 3TOJA 5BNNC 4UW4A 1COV1 3HT1A 1CIWA 4L2NA 2BTVC 1VBB2 1GBGA 1XNKA 4TZDA 2NLRA 3UK9A 2YGMA 1JUIA 1WW6A 1DF0A 4WVMA 5J37A 2WS93 1T6GC 3OGGA 1REDA 4EN0A 2EXJA 2A75A 1PK6B 2R041 2ZGOA 2WKKA 1HIXA 4K40A 4LE4A 4I30A 2NMOA 5C9AA 1VBB1 1F2NA 5GLZA 5JSOA 1VB4A 4OI1A 1W6NB 1HXS2 4KG8A 1V00A 1WD3A 2VUAA 5DDJ2 2WLQA 4I3PA 1V9U1 4NO4A 1DQ4A 4FP3A 3VHNA 2E53A 4GKYA 4BLJA 5D8AB 1LOBA 4IEXA 4YRDA 2R063 4JGZC 2YV8A 4FSJA 5CFCA 4PIXA 4R9AA 3B69A 4BH9A 2RR12 1CAVA 2GN3A 4HT1T 4ITCA 4AI8A 1LOFC 3EO6A 3JBG3 1LECA 2F4PA 1IS3A 4Q4W1 2XKPA 3WR0A 2NYYA 1SLLA 2JG9A 4XDQA 5C4WB 1VBE2 2E7TA 2RJKA 2X5IB 5A3LA 1O4YA 2F6BA 5A3MA 2E9QA 2AYHA 3ZXAC 4CDUC 1RUF1 4IV3A 4N43A 2EIGA 1YO8A 3WD5A 5A33B 3J9SA 4YGCA 4AI0A 3FFQA 4XQ4A 3PJQA 1N1TA 1ZZ7A 1DYKA 2B5HA 2C5DA 2DCJA 3DGTA 1ASJ2 5AVPA 5AFEA 1OLQA 4FOVA 2ZGKA 3MIDA 1K5MA 3GF6A 1YWKA 3KGLA 1RUNA 4F8AA 4AEMA 3NWKA 4U2AA 2VECA 1C5HA 1NCRC 3QH7A 5AVAA 2DFBA 2OUHA 1BKZA 3KZ4C 1VAKA 3SHRA 2PLV2 1Y7BA 3ES4A 1AR81 2H6BA 2WQZC 4DNYA 5ABJC 4LHLA 1IZ3A 3DUIA 1GNZA 2O8OA 3A0KA 3LA2A 2DCKA 4HPKB 1XYNA 1W6NA 3ZSEA 3LZZA 2TBVA 4DY5A 1OD5A 1GYKA 1RUG3 4Q8KA 1OOPB 4HKWA 2UWBA 5JIAA 1VIWB 2DVAA 3AB0A 4BM8A 1LTEA 2RM22 2Q30A 2BEOA 3UJOA