1EP0A

High resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
183
structure length
183
Chain Sequence
b'EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-6-DEOXY-D-XYLO-4-HEXULOSE 3,5-EPIMERASE
publication title Crystal structure of dTDP-4-keto-6-deoxy-D-hexulose 3,5-epimerase from Methanobacterium thermoautotrophicum complexed with dTDP.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Isomerase
total genus 44
structure length 183
sequence length 183
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2000-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ep0A00
4LA2A 4NVPA 4QGMA 1YFXA 4ORFA 2FMYA 2BNOA 4ZU7A 1DGWA 2XHKA 3D0JA 2IXKA 3HQXA 1L3JA 2PFWA 2UY8A 1ZRCA 4I3PA 2PAKA 2H6CA 4IEOA 3ZDSA 1CAUB 5AVPA 5K8SA 3E6CC 4FT8A 4XF1A 1ZZ9A 2PQQA 3ES4A 5FQ0B 2BEOA 3VHRA 4I0BA 1Q43A 1FI2A 4LULA 4MGZE 4BIFA 3H7JA 4EV0A 3PNAA 2QDRA 1J3RA 1O4TA 3D0SA 1Q3EA 4FBFA 2GC2A 4XFCA 3NVCA 1JUHA 2UYAA 4IETA 4HSJA 3IDCB 1RUNA 3MZHA 4LUKA 4IEVA 1SQ4A 2D5HA 2EAAA 4MGKE 5I93A 1X82A 3WW1A 3C3VA 1QWRA 3GBFA 4QM8A 4YNIA 3RDIA 5KHGA 3LOIA 3MYXA 3U0ZA 2OZJA 3E97A 3NSTA 2VQAA 1X7NA 1CAVA 2QCSB 3E5QA 4AVCA 3N4MA 5J3UA 2XLGA 3FX3A 4N9HA 4YARA 1VJ2A 2ATFA 4MGYE 4Q0VA 4HBNA 5E16A 1H1MA 4IERA 4F8AA 2O8QA 5EFUA 5JSPA 2OA2A 5I8TA 2V09A 2FQPA 5BUVA 4IESA 3MDPA 4R52A 1UD1A 3NKTA 2D40A 4E2QA 3SMHA 1O3TA 1YHFA 2IXJA 4XF9A 4AXOA 2ZKLA 1FXZA 1ZNPA 3IIAA 4JVAA 4FAGA 3S0MA 4R8HA 3TNPB 3D82A 3HT1A 3E6DA 4RD7A 1O3QA 2UY9A 5KBFA 5C6CA 3H9AA 2BYVE 1FT9A 4KU8A 1OMIA 1TQ5A 3I59A 2PA7A 4HMZA 1YFUA 2QNKA 4I01A 3RNSA 1DZTA 2XLFA 1J1LA 3BU7A 4KU7A 4Q0QA 4AVBA 4HLTA 1QY4A 3GYDA 3M3IA 4IEWA 2XL7A 1EYBA 2Q30A 3HT2A 5I8YA 5CVRA 4IEPA 2GH2A 2HJIA 2IXIA 3MPBA 3PLQA 3UKVA 1PMIA 3LA7A 3R6SA 4QGNA 3RYKA 3RPQA 5J7MA 4XFBA 4K8FA 4L11A 4WVZA 4IEQA 2OYZA 1CAXA 2D5FA 4JTOA 4JV4A 5LRRA 4GULA 3HIFA 5HI0A 4OLLA 5C8WA 1Y3TA 1RGSA 3E6BA 2WFPA 3WW3A 3DN7A 2B9UA 4WBBA 2C0ZA 2Q1ZB 1X8EA 2GC1A 3TNQA 3BPZA 3U10A 5BV6A 5JSOA 3E5XA 3CJXA 4DINB 4IEYA 1XE7A 1O3SA 4I09A 4Q0PA 5I91A 4EWDA 5LEKA 5KHHA 3NW4A 4FAHA 5FPXA 3OF1A 1WLTA 1DGRA 3RYPA 4J1XA 1CAUA 3LA3A 1RL3A 4TLFA 4UBGA 1ZRFA 3EQEA 2PYTA 4LTAA 3SCHA 1CAWB 3FZ3A 1UPIA 3ACLA 5FLHA 1ZZ7A 1SFNA 5FQ0A 4IEZA 3JZVA 3ELNA 3G7DA 1YLLA 4QXKA 3SXWA 3H1YA 2XKOA 3FFQA 3EBRA 4E2SA 1WGPA 4I0AA 4Z82A 1G6NA 4XF3A 3CLPA 3BALA 1QXJA 2I45A 5KHIA 3QACA 3EJKA 3H3UA 4LLOA 2OPKA 3OCPA 4CYDA 2B5HA 4LUMA 4XFFA 2XLAA 2BNNA 3NJZA 1RTVA 2D93A 2CAVA 2K9ZA 5T3NA 1YUDA 1YFWA 3H50A 4MH0E 3UKNA 2UYBA 5D1IA 4BYYA 1ZZ6A 4KWJA 1I5ZA 1O5UA 4Z07A 4P9GA 3RYRA 5CADA 2GAUA 5JAXA 1UW8A 4HN0A 3B02A 3ETQA 4LA3A 3RZZA 4YYOA 5FPZA 3DL3A 3LZZA 1WA4A 1SEFA 3LA2A 3IDBB 4EWAA 3H7YA 3CO2A 1NYWA 3SHRA 4D7TA 2EA7A 2F4PA 2H0VA 1HW5A 4Q29A 5I0SA 1O3RA 2MHFA 4MZUA 3FJSA 3KMHA 1ZZ8A 2GZWA 5JR7B 4MV2A 2OZ6A 4KWLA 3S7EA 2Q4SA 1ZZBA 3OTFA 1VR3A 3NL1A 1DZRA 2PAEA 4HSLA 4LEJA 3OD0A 4PIZA 4HVQA 4H7LA 2ETEA 1IPKA 2Y0OA 2VECA 1LKNA 4QGLA 2XL9A 4EWEA 1ZRRA 2MNGA 4XF4A 2ZCWA 3SCFA 3LWCA 1ZX5A 1NE4A 2ET1A 3E5UA 4MX3A 1J59A 4IEXA 1J3PA 2PAMA 1LRHA 1GQGA 1X8MA 4MUVA 5FCCA 1O7FA 3KGZA 1UCXA 1RC6A 1ZRDA 4XF0A 4I2OA 3DKWA 1NXMA 3ST7A 2GC0A 5CU1A 3UKTA 4A2UA 4ZU4A 3ES1A 2EVXA 1XRUA 4KL1A 1CX4A 2H6BA 4ONUA 2K0GA 3OGJA 1OI6A 3BB6A 2P17A 1J58A 2CAUA 3IWZA 4XFGA 1XE8A 2IXCA 4QM9A 2BGCA 4O9EA 4UXAA 4META 4YSFA 3EO6A 4YRDA 1EPZA 1Q5OA 1UIKA 2PTMA 1NE6A 3CEWA 1CGPA 4QX5A 1OD5A 2GC3A 3CF6E 4MGIE 3EHKA 1O5LA 2O1QA 4I02A 1ZZCA 4XETA 2KXLA 4WZCA 3H8UA 5E1RA 5FLJA 1U12A 2N7GA 3IBMA 1QXRA 1V70A 4AVAA 4BHPA 4BH9A 1J3QA 4PJYA 5BXXA 3USSA 1ZVFA 2GU9A 3O14A 1CAVB 1CAWA 5I0RA 5KHJA 5I0TA 4QMAA 5I8SA 5BPXA 4JTNA 3I54A 4F7ZA 1UIJA 2CV6A 2Z2SB 2DCTA 2WC2A 5I0UA 4AQ6A 3WW2A 1GQHA 2MPFA 4X6RB 3H3ZA 5JSRA 3U11A 4J1WA 2HKXA 1ZREA 2IXHA 3FHIB 1VP6A 2QVSB 4XFAA 1NZCA 1LR5A 4N9IA 3SCGA 3KCCA 3FWEA 4HN1A 2Q0AA 4B29A 5JCTA 1YWKA 1IPJA 1YFYA 4D7SA 3S7IA 4Q0UA 5EZWA 1PM7A 5F1RA 1OFNA 2QJVA 3I59B 3KSCA 2ET7A 2B8MA 4XFIA 2XKPA 5J48A 5FLIA 2IC1A 3WW4A 3PVBB 2BNMA 4KWKA 4IEUA 3ROUA 4PIYA 4O9GA 3I7DA 4XEZA 1I6XA 4UBHA 3QOPA 1EY2A 4OFGA 2IXLA 4AQ2A 4PIXA 4HVRA 2Z69A 4X6QB 3FE5A 3CL1A 3KGLA 4L2NA 4E2GA 3DV8A 3M70A 1Y9QA 1CAXB 1H1IA 4XFHA 2PHLA 2E9QA 3H1MA 5FDBA 1EP0A 3BCWA 5LEJA 2VPVA 5BY5A 2CGPA 4ZU5A 3H1WA 2XGXA 4HZFA 3L2HA 3LAGA 2PHDA 1LB2A 5KHKA 5LRSA 4EROA 1RUOA 4HVOA 4Q0SA
chains in the Genus database with same CATH superfamily
3TN93 5IVEA 4LA2A 3VGIA 2VCMA 4NVPA 4ES8A 5K4LA 4TTGA 3RJ2X 1AR63 1JUIA 1BEV2 4AVVA 4S2HA 3OY8A 2D6NA 4AI0A 2FMYA 4CDXC 3N3HA 3BVCA 2YBKA 1GYKA 2V72A 2OKXA 2XHKA 4FFFA 4UFJA 2IXKA 3ASIA 2UY8A 3IKWA 3DECA 1UU5A 3JQXA 4DPNA 1WBFA 3NQHA 1LOFA 2WA4A 2WS93 5AVPA 1IQAA 2RS12 4JC1A 4XF1A 3IPVB 3I49A 2YY1A 3WNOA 1ZZ9A 2XJQA 4E4SA 4PQ9A 2JECA 1CN1A 5FZMA 2HLEA 1AYN2 1RUC2 4L99A 2LM3A 3B00A 4IE4A 1BBT2 1LENA 1F9KA 4Y1YA 4D8MA 2FDGA 1JW6A 1T6GC 3MW4A 4OZOA 2WFF2 1PVC2 4QQPA 5DUXA 4CEYA 1B35C 3LCPA 4JDNA 4EV0A 2BZDA 1J3RA 2QDRA 1O4TA 1QJX2 1W3VA 3D0SA 1MS0A 1Q3EA 4TXWA 3TOJA 2AACA 2RJ2A 1IZ3A 2GN3A 4YZ2A 5JOWA 1LHNA 1JUHA 1MS9A 1OHFA 4FOQA 4ASMB 5A80A 2AH2A 3IDCB 4HSJA 3VD3A 1GR3A 3VBRA 1EV12 4IEVA 5CFDA 4E27A 3AZVA 1BHGA 4AGGA 3K48A 3OUHA 2YC4A 1LHWA 1FYUA 1X82A 4D69A 1S0FA 3C3VA 3GBFA 4CCDA 1TME3 4Q1PA 2VTXJ 1OKQA 2VTFA 3VBOA 1DG6A 1QGLA 3O7OA 4NO4A 1F15A 2YGLA 3RDIA 5D21A 4DB5A 4GZ9A 5KHGA 2WINB 3PTRB 2PXJA 2X53S 3MI8A 4E8CA 2OZJA 4XHXA 3ZYPA 3IMNA 1O6UA 2VQTA 1RUE2 1X7NA 2OT7A 4UW5A 1L7RA 1W9TA 2QCSB 4DRRA 5A70A 4V1PA 1OOPB 1DQ2A 1JTZX 3H0OA 5D2AA 4Q0VA 1SCSA 1FMD1 1ULOA 4X8NA 1AYM3 3LDKA 1ALYA 1Z78A 4QX3A 2DV9A 5JXIA 4UW3A 4F8AA 1DLLA 4XQDA 1AL22 5T55A 5JSPA 4FPEA 2JG9B 2Z5WA 2WO1A 3I2HA 2V09A 2FQPA 3UGHA 1UY1A 3IAPA 4IESA 5FYMA 1N1SA 3GGLA 5EJ3A 1IG0A 2ZEWA 3PU8A 5A7SA 5DPNA 1DCSA 3JXSA 1UD1A 4GKXA 3PJYA 5A1LA 5C5UA 1R091 3FMGA 4H7MA 4EN0A 1S0JA 1COV3 3SMHA 2YB7A 3SITA 2VNRA 2HYKA 1FOD3 1FXZA 3WNXA 1ZNPA 4CE8A 4XE9A 3DYPA 4OI2A 4JVAA 5DQ0A 2ILMA 3PMSA 3PVOA 4NRQA 2Y6HA 5IK7A 3E6DA 5L73A 1RMU1 3I2IA 4JX0A 5C6CA 3H9AA 2QQJA 4RYDA 2BYVE 5EV7A 3ZSMA 5FYYA 1CIWA 2A75A 3I59A 2PA7A 2A73B 2DYCA 4NHMA 4PI2A 1W9WA 2QNKA 4QB1A 3DPRC 2HBUA 1DZTA 2R073 2XLFA 1MZEA 3BU7A 5T5PA 4KU7A 2ZGSA 4G4FA 4P9WA 1MZ6A 4FXGB 1OQEA 2CWSA 3GYDA 3M3IA 3ZFGC 1NLQA 2VZTA 1MVQA 3PU3A 5FXVA 2R30A 3HT2A 1EUTA 5IATA 5B2GB 1V9U1 5GM0A 5L19A 1SDDB 4IEPA 5FYHA 1JOBA 4KGGA 3T08A 3GJBA 1RUG1 2A1XA 1MS4A 3MPBA 3PLQA 3Q8BA 3KQ4B 3WCRA 4QHBA 2YYOA 1H2KA 1DLCA 4XC9A 5I0DA 2WLPA 5D8AB 3I8TA 1HB2A 3IDEA 1WMFA 4GH4B 1BYHA 3ZYRA 4XFBA 4K8FA 5A7WB 2RE9A 4CUAA 1RXFA 4RGKA 4NE9A 2OYZA 3T4VA 1VBE1 3HIFA 4DFSA 2WZR1 3RWNA 3SEEA 4GMP1 1JODA 1APNA 5HCBA 3AC0A 1U5XA 3E6BA 1Z7S1 2G9FA 2WWJA 1PK6C 2JX9A 4PBOA 3OB8A 3KHCA 4JQTA 4I30A 4MYEA 3U10A 3BPZA 1S4CA 3CQOA 3E5XA 4DINB 1RUF3 3KVAA 4LNVA 4I09A 1W2OA 3I3BA 2ZMLA 3C2UA 4KI5M 3VDAA 4EWDA 5ABJC 2BUKA 5LEKA 2CDPA 4OI0A 1QMJA 3SH4A 3IT8A 3LEGA 1FMD2 3VB9A 5F9TA 1G7YA 1WLTA 2PHWA 3JD71 2XWBB 4JAAA 2JE7A 3ZVXA 1DGRA 1W6NB 2VZSA 5M0TA 2WR9A 2AYHA 3GJAA 4DXRA 1MPXA 1ZBE1 3BTAA 2YPDA 1OXCA 2TEPA 4UBGA 1F5JA 1U5IA 5DZEA 2C1FA 1ZRFA 1KDMA 4HG6B 4R9DA 3SCHA 3ACLA 3CJIC 3PUQA 1GOFA 2XJVA 2ZEZA 4Y1XA 2MEV3 1UOBA 3QLQA 1CZVA 3VL9A 4IEZA 5BNQA 1ONAA 1R092 1DQ5A 1W3XA 4BK5A 1LOCA 4WM7C 1UZ0A 3ELNA 3WLUA 3AKRA 5K9YA 4Y5SA 4YZ1A 1OLMA 2YV8A 3LSEA 4YW3A 5HV4A 3H1YA 4LLFA 3OGVA 3H42B 4A41A 4YZ4A 4E2SA 3F2ZA 4R9AA 4BPZA 5C7GA 3THDA 3OGSA 3N9NA 2ZJCA 4IXLA 4K20A 4Z82A 5FZ0A 1AX2A 1RMU2 3TWIA 3BALA 3BGAA 3MLKA 1A78A 1JH5A 1RUD3 1GV9A 2VBDA 5FY9A 1NA1C 3KLSA 3ZSKA 4CDQA 4EZHA 4PLNA 4ASLA 2VZVA 4N53C 2NZ9A 4NWVA 4HK8A 3FLPA 1YI7A 1JU4A 3OCPA 4QXCA 2P4EA 1OA2A 2B5HA 4LUMA 2C26A 4YZ5A 2CSGA 1GBGA 1QNYA 3EYPA 3J4UH 2K9ZA 1XOYA 1V6KA 2FMDA 1R1ZA 5DAXA 1LGCA 1V9U2 4LHNA 2XBO1 1C8NA 4HXCA 2VCCA 5D1IA 1RUG2 3OBRA 1TZOA 1ZZ6A 3KF5A 3VDDC 4FPJA 4DNYA 1I5ZA 4AF9A 5CAZA 3NO8A 2RV9A 4Z07A 4HPKB 4K40A 4P9GA 1NCQA 2JD9A 1ZYBA 2XB6C 2AR6A 3WDTA 1PMJX 3R4DB 4DXSA 3A21A 2V5YA 2EXKA 4N43A 2EF6A 5CIRA 5T54A 3S57A 4FO9A 1I5PA 4BLIA 4RR3B 2G4IA 1UW8A 1KD7A 3HBZA 4P9XA 5DZGA 3ACGA 2WYFA 3RZZA 2Q8EA 4EJRA 1VBE2 3LZZA 5FYIA 1WA4A 4BXFA 1OBNA 1SEFA 2RG4A 1AR93 2WZR2 5A1AA 2NP0A 1VLNA 1IQDC 1W6QA 2VMHA 5BNOB 4UFMA 3CO2A 2DU0A 3UV9A 1JU3A 4JGYB 4YVSC 1JYIA 4B7KA 2F4PA 4P9YA 1Z7S2 4PQQA 1OQDA 1HW5A 2H0VA 2Q1MA 4LBQD 3KMHA 2GZWA 2ZX3A 1F2NA 2WNUC 4RGGA 4GMP0 2W1WA 5BNNB 3ZR5A 5FP7A 1JYWA 3F95A 4DY5A 1LOBA 3H8OA 5CB7A 1DDLA 4HSLA 4RQPA 3O1TA 3WQ1A 4H7LA 1SBEA 2ETEA 3ITQA 5CBLA 1IPKA 3ZFEA 2YZ4A 1UY0A 2QDNA 2V5DA 3IZOA 4IE6A 4AOCA 3GBWA 4EWEA 4URAA 4NIHA 2B39A 2PHRA 3HD8B 3LWCA 5CG8A 3JD72 4MX3A 3E5UA 4YVWA 1J59A 2QQLA 4CUBA 4B4PA 1JZ3A 1YXWA 2PAMA 1ZBE2 2CTVA 4MUVA 5FCCA 2ERFA 3C7HA 1DZQA 3OY8B 4XJUA 5EYXA 3KGZA 4XQ4A 1R083 2BOIA 3GHNA 1C8M3 3WXPA 4B4RA 1B09A 2BU9A 2RR13 3MEPA 1FV2A 4RFRB 3WG4A 3K51A 4OYUA 2EIBA 3ZFFC 2R061 3ES1A 3FUQA 4ZHNA 1JHJA 3HWJA 2OIIA 4KWUA 1C4RA 1HDKA 1OUSA 1I1EA 4NMIA 1QOSA 1UXZA 1EPWA 3OGJA 4SBVA 3SNMA 1OI6A 5KC5A 1K5MA 1AR83 1G8WA 1WLCA 5CKNA 1ZA7A 1HRI1 4YW4A 3VHNA 3HVDA 3X29B 1W90A 1NLRA 3FL7A 4XDQA 1PHMA 4CEYB 2BFUL 5JIAA 1MZFA 1R1A1 4QAWA 2VOKA 5K0UA 4ZZ5A 2DTYA 2BGCA 1VMFA 4UT5A 3NV2A 2YG0A 1D2QA 2ARAA 1EPZA 1LESA 1MS3A 3DEMA 5EWSA 1UIKA 3HNYM 1CGPA 2ZZQA 4URTA 1P8JA 2PHFA 3VBRB 2ZGPA 1ULEA 1OD5A 4H55A 5CFDB 3SH3A 4ISRA 2HWB3 4NHLA 2XBO2 2ENRA 3A0NA 3LPFA 4IV1A 3GBGA 3VBOB 3WUDA 1W9FA 2N7GA 1V70A 1UY2A 4NN0A 4BH9A 4C90A 3WQ7A 1AXZA 2JB8A 2AREA 3K75B 4FPKA 4XBLA 3E1F1 5GZGA 5IK5A 1WMEA 2HEVF 5LK7B 1XNBA 1Y4WA 4GWIA 1XNCA 3NJYA 1JS9A 4QPYA 2AGSA 5I0TA 4C8DA 3KCXA 3Q8FA 5CEHA 1MEC1 5L7OA 5FWEA 3LDRA 3IN9A 2EAKA 3QCWA 4JTNA 2JDHA 2FZ1A 1SLLA 4YLZA 1C1LA 1LCLA 1NG0A 2P1BA 3VZJA 4C1XA 1RUJ1 3POWA 1UIJA 3VBSA 2DCTA 4OMDA 5GALA 1V6NA 5A7OA 3ZN6A 3WW2A 5DG2A 5JSRA 3H3ZA 1QH7A 4Q5OA 2ZAHA 4LBMA 4AVTA 1ST8A 2B45X 1XYPA 2YGMA 1NXD1 4QXBA 1GZTA 2QVSB 4FXKB 4M01A 5LCWL 4UWDA 1NZCA 4CCJA 1KJLA 1BEV3 2RJLA 3AYAA 2LUWA 4OHWA 5LW9A 4MGSA 3P3NA 5FO9B 3RFRA 3KCCA 2NMOA 2ZGKA 3FWEA 4LITA 5FY4A 2JG9A 3HBKA 3RZLA 4B29A 1G9DA 1E5HA 4QPWA 4BE3A 4CDWC 3C7FA 5HBAA 5CFCA 4D7SA 2QKDA 3AMNA 3U4XA 3S7IA 4Q0UA 2J1UA 5C4WC 5FY0A 4YFZA 3R05A 2A6VA 2W9XA 4ATFA 1XE0A 3I59B 2G9GA 2QBXA 2VJXA 2FHRA 2Y38A 3VL8A 5F6KA 5J36A 4CCEA 4XFIA 2XKPA 5T50A 5FLIA 3O1SA 1AYN3 2R062 3PVBB 2BNMA 5JOXA 4L0PA 1BBT3 4JDMA 3ROUA 3W58A 1W04A 3AKQA 2WT0A 1EY2A 1W8TA 2WFF3 3OSDA 2Q1FA 4DO0A 3K4ZA 1DYPA 1XU1A 2JKXA 3D3AA 4PIXA 4XZPA 5ACA3 2NPIA 1CIYA 2RS31 2YUEA 4MADA 1QJX3 1HRI2 2VAUA 4RA0A 3V0BA 3VDBA 3CL1A 5FZDA 4BMEA 3NAPA 2KD7A 1R1A2 3KGLA 5FZBA 2JD4A 4HKLA 5EXOA 4E2GA 1EV13 3M70A 3OUJA 5DAQA 3ZMNA 2VVFA 3N7MA 5FYUA 3VKLA 1W28A 4LO8A 1AHSA 2TUNA 3BCWA 5LEJA 4QB2A 1XNTA 3ON7A 2CGPA 4CRQA 3VKFC 2XJRA 4TYSA 4DEVA 2XHNA 3MFAA 2X5IA 4HZFA 1TE1B 1RJ8A 1XYOA 4H14A 1LB2A 1ODMA 1NX9A 5HCFA 3RMYA 3VLBB 1RUE3 3I2KA 4LOTA 2AEZA 2LRPA 4Q8LA 3FLRA 4F3JA 5F6LB 4Q4W3 5HPOA 4Z1VA 1RUOA 1U0AA 4XDPA 5A7WA 1IPSA 5A1FA 3APBA 3DF0A 4MOAA 5JXJA 4D6RA 1QU0A 3DKQA 4ORFA 2XH6A 1AXYA 1DGWA 1SLAA 3D0JA 2R16A 4V2WA 1RUI1 1NLSA 1UKGA 1MEC2 3HQXA 5FOBB 2G9ZA 1SHWB 3ZPYA 3BTZA 4AHWA 4ATEA 5LA9A 1AJKA 4OULA 3WF3A 4HKWA 4PF1A 3U75A 2HWD1 1RUJ2 5FUNA 1N3QA 4FT8A 4QX2A 4MXVA 4LIVA 1V0AA 1VBB1 2EALA 2QE3A 4W4ZA 2WYSA 3ZM8A 4YM2A 5FZAA 4OVEA 5IFTA 1Q43A 3JUUA 2Y60A 3SQOA 3VBUA 1ASJ1 3C7EA 4E9KA 1CJPA 1CZTA 4M4PA 4B1LA 4MGZE 2VL4A 2D3SA 2VMIA 4QDRA 4XBNA 3H7JA 3SH5A 1O91A 4IDZA 2D6MA 4K8RB 1AX1A 3AYCA 3PNAA 1OOPC 3VDCA 2AZ5A 1O4ZA 5C3SA 1TNFA 4XFCA 1NAEA 2X29A 3LPGA 2UYAA 1XU2A 4IETA 2P6HA 1RUNA 1DQ0A 1DQ6A 1YCIA 4CDQB 4EN9B 3ZXLA 4LBLA 2QQVA 3B94A 1HQWA 2D5HA 2EAAA 1RUH1 4NR1A 3ALQA 5HCAA 5I93A 3WSOA 4XMAA 1BKZA 5GZDA 3PL0A 3WW1A 2WO7A 1OH4A 1QWRA 2RS51 2ZGNA 1DHKB 5FPLA 2ZPXA 5APAA 3LD8A 5FZEA 4D0QA 1RB8G 1Q8VA 1JYXA 4CCNA 1MQTA 3U0ZA 2K2SA 5FYBA 2X05A 3VKOA 4OZXA 4WVVA 1GZWA 3TYJA 4LR4A 3E5QA 3LKJA 3PVEA 3JBG3 3N4MA 5FMOL 4D3WA 2OVUA 5JXGA 2RS32 1VAMA 4CEWA 1H30A 1S2BA 4HBNA 2X10A 3UJOA 1NCQB 1W2NA 3I97A 4DRVA 2C9KA 1JHNA 3AKSA 3BYWA 4N43B 3KV5A 4TZDA 3N7KA 2Y8KA 1K42A 3LB9A 2E7TA 1FPN1 2QUOA 4GQ7A 3UGFA 1QQP1 4MSVA 1LHUA 3T1LA 5KXCA 5DDJ1 3ZSEA 1W6QB 3NKTA 3P3PA 1F31A 3MIHA 1ZM1A 2VZ1A 2WKKA 4XURA 2DVGA 1AXKA 3FFZA 1AX0A 4P08A 2GNDA 4XAAA 4DMIA 4XF9A 1SLCA 4CUCA 1O3TA 4AXOA 1H8TA 2E6VA 1TEIA 4HFSA 2JDNA 2ZGTA 4CU6A 4FAGA 4IGPA 4CXWA 1UPSA 2VU9A 2RDQA 4AFCA 1JZ5A 1XNKA 1CQ9A 4IQPA 3GCWA 2UY9A 4M3CA 1FMD3 5D8AC 4RQPB 1W06A 5FP8A 2W52A 4GH4C 1N3PA 2GP5A 5JPMB 5FXXA 1JZ7A 2IVJA 3ZFEB 5F3EA 1UMIA 1W6MA 1RUI2 2LW8A 4HMZA 4PBPA 1YFUA 3UYJA 3KV4A 5C70A 4YVWB 3MIEA 5GLUA 5JPNB 3B9IA 4XJAA 4XJ9A 2JDKA 2P3JA 3ACFA 3AFKA 3LGRA 3KZ4C 4IEWA 1VBA1 5FBJA 5FZ4A 2OQ6A 1NQDA 2Q30A 3VD9A 1VBB2 4OHXA 1VIWB 3FBYA 1YIFA 1PO11 4K7JA 4Y22A 2V4VA 5FO7B 3WHTA 1POV1 2GH2A 2D6PA 1KEXA 2EICA 2IXIA 2DVDA 3J8F1 5FZ1A 3UKVA 1ASJ2 3O0WA 3MGUA 1SLIA 3LA7A 5E89A 3RJRA 1RMU3 2D3PA 2HH9A 3B7MA 1C3HA 5J7MA 1X33A 2VY0A 2P6CA 4XIOA 5LWBA 2ZTNA 2ZZJA 2B4KA 2BDRA 4JKKA 1PNGA 3AMMA 1CAXA 3B93A 4JTOA 1HB1A 4P5YA 1XC6A 4Y3OA 3N7LA 3U78A 3W9AA 1K5MB 4OLLA 4K21A 3OBTA 4QKFA 1LEMA 4XJ8A 5C8WA 1Y3TA 3ZLIA 1UX6A 5FPBA 1OT5A 1RUH2 3VD7A 4BK4A 4KQ7A 3BODA 5FZFA 1CPNA 4RHV2 5K0UB 3MO4A 1H9WA 4YG3A 2B9UA 2IFWA 4M4RA 1QEXA 1VRH1 2RS52 4NHXA 2GC1A 2HEYF 4ZZ8A 2R1BA 2ZACA 3WQ0A 1UF2C 5BV6A 2CGNA 3CJXA 1DGLA 1GLHA 1RUG3 4MO3M 2WQ4A 1G9FA 4M0NA 3ZN5A 3W5NA 2WSVA 1WW5A 4EQVA 2NM1A 4LMFA 2D44A 2J1TA 4JGZC 4AFDA 2W1UA 1W8ZA 2CYFA 3O1MA 3GF6A 4LBJA 4Y1VA 5GKAC 4XIKA 1GWKA 3DGTA 4A6SA 2VGDA 5FZ8A 4IV1B 2BGOA 4FAHA 4FI9A 4XQWA 3OF1A 5FKBA 3GCXA 3ZFGA 4DXZA 1VBE3 3AMHA 4FFIA 3WNPA 3ORJA 3I2GA 2WZR3 1SDWA 4Y4YA 2WNVA 4QQHA 5GZEA 1ZRIA 4GMP3 1CAUA 3ZX7A 3LA3A 4AFBA 2YXSA 1FPN2 3ZXKA 4AEDA 4QQLA 2HWC1 4EE2A 3MICA 1QQP2 4LO5B 4OUSA 2PYTA 4LTAA 1Z7S3 3HNMA 4QB6A 5DDJ2 5FLHA 5FKCA 3T1MA 2WQZC 3SEPA 1XSRA 4N8MA 5BNPA 1W8WA 5L7OB 2RDSA 3I2JA 3PJQA 4OQ9A 5IVFA 1IGOA 1WBLA 2O8OA 5L9RA 4C0HA 5FXZA 2VD7A 2VO5A 1YLLA 4QXKA 1F5FA 1QDOA 3FFQA 3O1RA 3VBSB 1O8PA 4I0AA 3ZN6B 2PQSA 2FDKA 3DXUA 2ZMKA 1OA4A 1QJEA 2VBPA 4WM8A 1NY71 4ITCA 4Y20A 3S30A 4AL9A 5FZ3A 2JE9A 4AFAA 4AWDA 4RR3C 4OQ8A 3H3UA 2XJUA 4FQZA 4CP9B 3LEMA 4M3CE 1BMV1 4XILA 1ZBE3 1VBD1 3POFA 2ZHLA 1U5YA 2WLQA 3MIBA 3INAA 2LROA 2XLAA 1FNYA 3N7JA 2BNNA 4W50A 1XYNA 2E7QA 3NJZA 1GP4A 3POGA 4JGYC 5FAXA 1WWYA 1IS3A 5FXWA 4LE4A 2X8KA 2VMFA 2D93A 4XXPA 1SCRA 1VBA2 5CFCB 5CG9A 5GLTA 2R041 1YFWA 3H50A 4HOOA 5C3OA 4UFKA 1YC61 4PDWA 1PO12 4ARXA 1GNHA 4BU2A 1D4VB 5BNNC 2XVGA 1ENQA 3OPTA 3J8F2 4LHKA 4FSJA 1WCQA 1JZ6A 4QT6A 3PUIA 5IW0A 3CJIA 5CZKA 2X09A 1POV0 2VC9A 1HQLA 2ZAAA 3DL3A 1WLDA 2YC2A 3I2DA 4WM7A 2W46A 5T52A 2D6LX 2WL1A 1UOJA 1N47A 4Y26A 4L92A 3O0XA 1RIRA 5TSWA 3V0BB 2F17A 1M06G 3SHRA 3NAPB 2EA7A 1JBCA 5LB6A 4JKMA 3ZFEC 4AI3A 5KR7A 3HNBM 1OF4A 1YQ6A 3QD6A 2VZ3A 2J22A 1VBC1 4AI8A 4MV2A 2RMU1 2XBO3 1VMHA 4HKOA 4GD4A 2VNVA 5F3CA 5FREA 2Q4SA 1RHI3 3HR9A 2FDJA 1ZZBA 1LOFC 2ZGUA 1PZ7A 2GSYA 1ACCA 2FCTA 4RS5A 1VR3A 3HOBA 3ABZA 3NL1A 4LO4B 4N7UA 2PAEA 2YBPA 4LEJA 4PIZA 5DMYA 1L7LA 3WHUA 1KGYA 4BQ2A 5HXMA 1TMF1 2QZ3A 2X5IB 3C7GA 4QGLA 4QPIC 3OOXA 5DN2A 3AP9A 2XL9A 3VZOA 4KG8A 5JVVA 3SCFA 2GMEA 4XF4A 1BJQA 5F32A 1STMA 1KITA 2ORZA 4PI0A 3W21A 4BXSV 4IEXA 3AP5A 3WF1A 2WIIB 4GWMA 1LRHA 1GQGA 4CEYC 3R0RA 4TLGA 2HWC2 5C8CA 1ND3A 5FRAA 2ARXA 2R7EB 4NPLA 3ZSLA 1RC6A 4OMCA 4D94A 5IHRA 2HWF3 1NQJA 4S2DA 3NMBA 5IFPA 3WV6A 5KXDA 2YC0A 2WA3A 5JWPA 4I2OA 3ST7A 1NXMA 5FMCA 4A3ZA 3VBRC 5LASA 3ZXDA 3RRDA 1HLCA 2XJSA 1D0HA 1EUUA 3CHXA 4Y5TA 2NMNA 4KL1A 2ZGLA 1W6PA 3V56A 4ONUA 1KXGA 3NNLA 2WAOA 2BFUS 5FMDA 3W59A 5A32A 4IGOA 4C1WA 1NY72 1JYNA 5DXDA 2O14A 3UGGA 5C3RA 3VBUB 2ZEXA 3MV11 1SPPA 3BTXA 2CAUA 4DUVA 4NIGA 4XFGA 1E5IA 1QJY3 1XE8A 1GOHA 4QQ2A 2VTXA 1BMV2 1DYOA 3ETPA 2BGPA 1GMMA 1VBD2 5HCHA 2IXCA 3ZXAC 5A7NA 3HQRA 4AW7A 5C8CB 1UZWA 2A6YA 4YSFA 3EO6A 2VMGA 4JDOA 3N9OA 1Q5OA 1X9PA 4I0WB 1NE6A 1YRZA 5F5AA 1TVGA 3POJA 4O7XA 1GSLA 2GC3A 2R042 4M0HA 3ZPOA 2VOWA 3AK0A 3LOBA 2RJKA 3PIGA 2R063 2WZEA 4I02A 1VB2A 3I4IA 4M3CF 4CPBD 2XVLA 2B46X 2IZWA 4GB33 1CWPA 3JQWA 4OHVA 3H8UA 1K12A 1UZZA 4RFT0 4DQAA 4CZSA 3IBMA 4FPCA 4QPGA 4BHPA 2UURA 3HJRA 2P5BA 2I2SA 1MQTB 2WWUA 3OBZA 3USSA 1BZWA 1PNFA 3HMYA 2GU9A 1GZWB 1MZ5A 2W68A 4Z2WA 1R1A3 1D0GA 2XJPA 4ZY9A 5GZCA 4CEWB 5IUQA 2D43A 5BPXA 1H6XA 1OKOA 1DGWX 3ZIWA 1UL9A 2ZHNA 1LOGA 4YZ3A 1W8FA 1JZ4A 1MVEA 3G6JB 3V64A 4CDUA 3I54A 1D4M1 2CV6A 4FTBA 1VBC2 1RVF1 1UZVA 3LEKA 5AFEA 2RMU2 2QQOA 1H1AA 1SFYA 1WMXA 1GQHA 1Y9MA 2OPWA 1WW7A 2WN2A 3U11A 3L2YA 1X36A 2C9AA 1X50A 2HKXA 2JE8A 5FYZA 2IXHA 3FHIB 4A7KA 1VP6A 1ZREA 4AQTA 1TMF2 3NJXA 5FZGA 1H8TB 4CU8A 4XFAA 2ZS6B 3A7QA 4CUGA 1LR5A 3TEZA 4TWTA 2AENA 2D6KA 3KT7A 5JI9A 4QHOA 1YQ8A 4AEJA 4Q1RA 2CHHA 2VZRA 3B5LB 2QQNA 3MBWA 3S5AA 5JCTA 4LBQA 4P9JA 2GNTA 4M3CB 4YW7A 1MEC3 2VW2A 3FUOA 1UU6A 2DVFA 1YFYA 3M4FA 5JUVA 1V6LA 1W6MB 5F1RA 4MGTA 1XJAA 1CONA 2KA3A 1RUJ3 1W0NA 3KSCA 3NRUA 5A3UA 3ZXJA 3T30A 1TNRA 3ZXEA 2Y33A 4Y1ZA 5J48A 1QKQA 2DUPA 2IC1A 2VOTA 3WW4A 4IEUA 1HV1A 3HAGA 3R4SA 4A45A 3I2FA 3ILRA 1I6XA 4XEZA 1V00A 1MS5A 2QQKA 2JJ6A 4FTSA 1CX1A 3NNFA 4Y22B 4OFGA 2QZ2A 2BPA2 4EN6B 4AQ2A 1H0BA 2XG3A 4WVMA 4HT1T 5CKQA 3WR0A 2VMDA 1W6OA 2GDFA 3K4DA 1WCKA 3MIFA 1UYXA 3FN9A 4L8QA 3I3MA 4YG0A 5SV5A 4ISQA 3WG2A 2WBKA 4CU7A 1YI9A 1CAXB 1H1IA 1DF0A 3ZYIB 4A44A 4XFHA 5KXBA 4NROA 3WP4A 3H1MA 1EP0A 1Q8OA 5JI7A 3NWKA 1OSGA 2W95A 4YW1A 2ZOEB 2R0HA 1XXNA 4BMBA 4YWAA 4C91A 3MIDA 5GLWA 1IOAA 5F2WA 4FPGA 3LIHA 3MPPG 3D5OA 3LAGA 2YPJA 2ZBJA 1YJKA 4NIIA 3ZYHA 5KHKA 1OPOA 5LRSA 4HK9A 3LDBA 1JMUB 2ADEA 4Q0SA 2GP3A 1OLME 4LE3A 3ZKUA 4QGMA 3VBHA 1YFXA 1N1YA 4LKDA 2FBEA 5ERLA 2PLV3 3LFMA 1H2LA 4NHYA 4ZU7A 2VE1A 3CBNA 4JRLA 1RXGA 4Q4X1 1W9SA 2OXBA 3ZO0B 4GWJA 3M3CA 3ZFGB 1WCDJ 2P3IA 3WVJA 4CDQC 1ZRCA 4I3PA 2WNVB 4IEOA 3ZDSA 4YGEA 1CAUB 5K8SA 3E6CC 1W8HA 2AUYA 5FY7A 4OUMA 4CCKA 1D4M2 2W3JA 3VHOA 1C28A 4AEDB 1RVF2 1C5IA 4IW3A 1DYKA 2PQQA 4AI9A 3ES4A 2ARCA 3KT4A 3POBA 1EAH3 3T0DA 5T5LA 1KFXL 5BNPB 4I0BA 1VE0A 2NQYA 3MF6A 2XDVA 1FI2A 5AC91 5GZFA 1PO21 2P37A 4LULA 5IK8A 1PMHX 5IAVA 1T6BX 3ZYFA 2PMWB 1W99A 5FMBA 2HYXA 5CYYA 5AFBA 1PX3A 1LHVA 4OI4A 1A8DA 1QXPA 1REEA 4RN5A 2OX0A 2GC2A 3VBFA 4QKBA 4WM8B 1RUI3 4Y20B 5EYYA 1F4AA 4N43C 3MZHA 4LUKA 5FY1A 3ZKYA 3TAYA 4LBNA 5ANQA 4KMQA 2JENA 1DBNA 1UWWA 3BTYA 4R9CA 1VBB3 4QM8A 5FPVA 5J98B 5IVCA 5FMOS 4BB3A 2WO3A 5F5CA 2WZ8A 4CU9A 4YFWA 2VNOA 3LOIA 3MYXA 4HONA 3WG1A 1BLZA 4ASKA 2E26A 4BQXA 4P9LA 5DZFA 2VQAA 2BVBA 4PDWB 1CAVA 5FZKA 4AVCA 5C9AC 5J3UA 2XLGA 4YARA 4N9HA 1KS4A 1S0IA 4YW6A 4MGYE 1E5SA 2ATFA 3SLIA 4CP9A 2YROA 5E16A 3WX5A 5F3IA 4RQPC 1DQ1A 4U36A 1REDA 1JOPA 3MFCA 4COVA 2O8QA 3IMMA 1QF3A 1H4GA 2OUJA 3CJIB 3IDAA 3KM5A 5FZ7A 5A3WA 4YPJA 3HN3A 1QIQA 1OUXA 5BUVA 1V6IA 1RUH3 5DUUA 4WM7B 3AL6A 4RHV3 4IV3A 4B3NA 2RS53 3DYMA 2D40A 2RS13 3TBDA 3K77A 5FJHA 2DUQA 1YHFA 2IXJA 2SLIA 2ZKLA 3MV01 2E32A 2ZHKA 1N1TA 1RUC3 3SC7X 3WG3A 3VHPA 2JG8A 3S0MA 1FX5A 1SACA 2G19A 1UMHA 2BERA 5T5OA 4LXLA 3TNPB 4AI1A 3J9SA 4ZS2A 5CKMA 4RS5B 4N53B 1D7PM 3WINE 1PVC3 1QDCA 1S0CA 3EXUA 4IL7A 4K6BA 2HEWF 5A6YA 1GQPA 4E4HA 2DCYA 2E53A 1FNZA 2W2IA 4Q4X2 1FT9A 3VZKA 4AE2A 4KU8A 4COZA 1OMIA 1TQ5A 3KT1A 5EQUA 1W8OA 4AG4A 1FPN3 1O8SA 3VN4A 4NOTA 1K5MC 4I01A 5ISLA 3GNEA 3H3LA 1QQP3 3MIGA 1J1LA 2ZGQA 4Q0QA 4AVBA 3DYOA 1QY4A 3AXDA 1NCRA 1D2SA 3AX4A 3DXTA 3WOGA 5DUWA 3LEIA 2XL7A 5K0UC 1J83A 1EYBA 2VZQA 3KWVA 4XCBA 1WMDA 1HRV1 1ND3B 1L7QA 2VXJA 4XMIA 2PHTA 4ZPIA 5I8YA 2VG9A 3GZTB 2JICA 3WDYA 2DCKA 1H2MA 5AC92 5FK8A 1PO22 3SKJE 2VVEA 5EJZB 4A42A 3I3DA 5DAPA 1LNSA 2IWGB 4FVVA 3R6SA 5FWJA 3MF9A 3RYKA 3RPQA 3JB4C 4GALA 1W6PB 4GAZA 4IEQA 4IV1C 4UW6A 5A32B 4LT5A 2D5FA 1QNWA 2DDUA 2YU2A 4YVSB 5LRRA 1YNAA 5HI0A 5JMCA 1PGL1 1H4HA 5A3PA 5IT6A 1SPPB 5LK5A 1AL23 5L36A 2JXAA 3CKHA 1UO9A 3C8XA 3POEA 2AC1A 1QOTA 2A6WA 4FP3A 4NPMA 2WNUB 4N7IA 1HKDA 2YFUA 2ZKNA 1VBA3 2FDFA 4GWNA 2C0ZA 5JZGA 3BPSA 1X8EA 1OPMA 2W1QA 4A3XA 2D7FA 1PO13 1BQPA 3W5MA 4WV8A 2P3KA 3AMQA 2DBIA 4IEYA 3A4UA 1K45A 1XE7A 3J8F3 1I3HA 1O3SA 2YBSA 4YGDA 3WNNA 2JWPA 3LF7A 3NJVA 3VBSC 4XDOA 2EIGA 5KHHA 1RINA 3KS7A 1AR71 1OLQA 2W0XA 1HXS1 2R32A 3NW4A 3CZUA 2WRAA 5FPXA 4QPGB 4CP2A 4W6YA 2A3YA 1OURA 2KM2A 5B4XA 3RYPA 5HXVA 3AKPA 1ND2A 1KQRA 1RL3A 2LTNA 4AK3A 5JOZA 4TLFA 1JZ8A 2W47A 4HANA 1Y7BA 2DCJA 3A23A 3EQEA 4P5HA 3WP3A 4AQSA 1GUIA 2Y6JA 2JG9C 1ENXA 1R64A 3ZFFB 1SFNA 5FQ0A 3JZVA 4UFLA 5FP3A 4MGQA 1CESA 5CFCC 5E6HA 1S0DA 2P34A 1OVPA 2R49A 4NRPA 4CDUB 3AZYA 3SXWA 5LY2A 1VAVA 4JCKA 1A8MA 5IK4A 4BLJA 4CDXA 1HN0A 1JZ2A 2E31A 4IUGA 3WF4A 1DP0A 3Q9OA 5A3MA 1GOGA 3GALA 5H9SA 2I07B 1A3KA 4XF3A 3CLPA 1QXJA 4EZ4A 2I45A 3GZEA 4UFIA 1GWLA 2B42B 3IB3A 2JEMA 2DU1A 2Z42A 1Y43B 2Q8DA 3EJKA 4LLOA 2XOMA 1YYNA 2OPKA 2OS2A 2RM21 3RGBA 2Y34A 4QU2A 2HWC3 3AP6A 1H2NA 3GHMA 1LJ7A 3FBMA 3J7MA 2JIGA 4UYBA 3W20A 5GLVA 3BIEA 3CMGA 4FPLA 4JGZA 4NWWA 3S6PA 1RTVA 2Z4FA 4LBQB 1X9TA 5A33A 5BYNA 2E63A 4Q8KA 1DU3D 4NHKA 2CAVA 3SKVA 1N3OA 3AMPA 5LBFA 3LSDA 1HRV2 1YUDA 4DIQA 3I3EA 5FO8B 1SLBA 4UOJA 4AVSA 4LKEA 1B35A 2UYBA 4C0BA 4JRAA 4BYYA 1BK1A 2A6ZA 2J1AA 2V73A 1LGBA 3CIHA 3FHAA 3BOWA 3PTYA 1O5UA 4KWJA 5ANNA 3OUIA 4FTEA 2P2KA 5ACA1 2ZX4A 3A0KA 3RYRA 1G9CA 1H8VA 3VV1A 1GICA 2X5IC 1CJDA 5FOJB 2NN8A 4CVUA 4LA3A 1PIV1 1C5HA 1W0OA 2DF7A 2VM9A 2VOVA 1UXXX 1VBD3 2RVAA 2VUCA 3BOPA 4QWNA 1ULGA 3LA2A 4WVMB 1PGL2 1PZ8A 3ZYGA 2GMMA 2EXIA 3AFGA 2VH9A 1W6OB 3HPNA 2DFCA 1NYWA 4QHZA 5HV0A 2ADDA 4RGAA 2K46A 2NLRA 2ZGMA 4Q29A 2CWMA 3NV4A 2VNGA 2MHFA 1RYYA 3RZGA 3FJSA 5JR7B 2HWD2 3PIJA 1R093 3RZJA 3AYEA 1QJU1 3HN1A 5FZIA 3RWKX 1US3A 3O12A 3OTFA 4OCTA 2Y26A 1LOEA 1DZRA 4MLOA 3OD0A 4Q4W1 4ZONA 3ZR6A 2WZPP 1CVNA 1UOFA 2ID4A 3NNMA 2Y0OA 1NKGA 2VECA 3N9QA 1AR72 2UU8A 1HXS2 2XQXA 1MS1A 3LIGA 2I74A 3WF0A 1XPWA 1ZRRA 2IUWA 1ZBA1 1GZCA 2ET1A 3VBUC 3P5BA 3TEYA 1YIPA 3AJZA 3D4KA 4BCUA 1J3PA 3VBHB 1S2KA 1V6JA 3KCYA 2WT2A 1NZIA 1O7FA 2A71A 5A3LA 4U2AA 2IFRA 4JHTA 4UF0B 1YQ5A 4LK6A 1GNZA 2VR4A 1SBFA 3L9JT 4K1YA 3V65A 2W87A 1Z0HA 3K2OA 1PGSA 2RMU3 3IM0A 3DKWA 5CNAA 5A3OA 5EHDA 4A2UA 1POQA 3T4HB 3K3OA 5FYTA 2BWAA 5C33A 1V9U3 2EVXA 1JI6A 1VALA 2QTWB 4QX1A 2H6BA 2QQPA 1TMF3 2WNOA 4LO7A 4XCAA 2RDNA 3DPRA 2WUHA 1MQTC 3P1IA 5G05L 1J58A 5AVAA 3UETA 3IWZA 1S0GA 2FD8A 4DS0A 5F2SA 1KDKA 4H3WA 4FPFA 2RM22 4LHLA 2KR2A 2ZX0A 3NV1A 3K4AA 4CXYA 4YM1A 2BTVC 4O9EA 5DUVA 3BIWE 4GA9A 4UXAA 2OQ7A 5FZLA 4CEWC 3VBFB 4CCMA 3URFA 2JDMA 3AYDA 4YRDA 1VB4A 4QKNA 5F3GA 5FPZA 2PTMA 3CEWA 2A6XA 3KV9A 1RJ7A 1UOGA 4QPIA 3CF6E 4LBKA 3EHKA 3CDZB 3ACIA 4KGQA 4BM8A 1KFUL 2O1QA 4W6WA 1ZZCA 1J1TA 3T0BA 4KBZA 4XETA 1S0BA 3VZNA 3QH7A 1HIXA 5E1RA 3U14A 3ZXFA 4A7YA 4QQOA 2XUMA 1U12A 1UU4A 1YQCA 3IIIA 1QXRA 3JBG1 3POYA 4QXHA 5IJRA 3SISA 4AVAA 5ACA2 4PJYA 4LK7A 1H8TC 1XSQA 1ZVFA 2W92A 1UYPA 3O14A 1C1FA 1IKPA 2ZEYA 1CAVB 1PIV2 5H9PA 1SG3A 1WCUA 3JD73 1PK6A 3KV6A 1CAWA 5J37A 4XJZA 3AB0A 5KHJA 2ZGRA 3UNPA 5J1XA 2GALA 4QMAA 4FOYA 1UQXA 4L97A 3NKGA 3WNMA 1LU2A 3WD5A 1YEWA 2JDUA 5BNOC 1XB9A 4S2FA 3BI3A 5ABJA 4F7ZA 3OPWA 1NUKA 2WC2A 4Q4Y1 5I0UA 2AEYA 1A34A 1QJU2 3RI8A 3V0AA 3WQBA 4DZGA 4IV3B 1ULCA 3WF2A 2MPFA 4X6RB 3TEWA 4G3YC 2LS6A 2YHJA 4Y33A 2WABA 4J1WA 2LALA 4Q4W2 2Y6KA 3AXEA 1PZ9A 3R4UA 5EJ1B 1NT0A 3OBAA 3Q8EA 4CXXA 4W65A 3AVRA 2BP6A 2BBVA 1W8NA 1ZBA2 2XUEA 4N9IA 2JG8B 4AGRA 3FLTA 1AJOA 4CP0A 1SFPA 4GXLA 3K46A 2FCUA 3ZSJA 2HWE1 1F35A 1W03A 3VD5A 5FYCA 5EZWA 1KRIA 4AHXA 3H8XA 5IVVA 3UESA 1D4M3 1WKYA 1RVF3 3AKTA 2QQMA 2EXJA 2XWJB 3POSA 1VRH2 1ULFA 1LGNA 1NCRB 5G04L 2B9VA 4O65A 1NA1A 1T2XA 4O9GA 4BQ1A 1IKQA 3I7DA 4CCCA 4UBHA 4H2AA 4OHZA 4MHUA 4N53A 4Q4V1 4NIAA 2P3YA 5KWRA 2PHXA 2ZMNA 2IXLA 3DUIA 3RVHA 3TN91 5A6XA 1WD3A 3ZYJB 3OJBA 2VUAA 4XUTA 5FZHA 4X6QB 4IE5A 3FE5A 4BIOA 1AR61 1JYCA 4FQ4A 4IE7A 3ZMOA 2DWRA 3O1OA 3KF3A 4DUXA 2Y6FA 1BVVA 5IVJA 3T09A 2D3RA 2VZOA 3M7AA 3OG2A 3DV8A 2BQPA 3TRSB 1Y9QA 5LBEA 2FZ2A 3AZXA 2PHLA 2E9QA 4O61A 3VDDA 3D6EA 3VZMA 5FDBA 1LTEA 2PELA 2J42A 2WNVC 2WS91 2L9LA 1O4YA 3AL5A 2ORXA 4XUOA 4BOWA 4AEDC 4ZU5A 1WD4A 2CL2A 4CP1A 1W2TA 2XMLA 1W9YA 2DBNA 2QFEA 5F37A 4LOSA 5CFDC 5JZGB 3JU9A 4DEQA 3WT3A 5BNPC 1CZSA 4J25A 3JBG2 3M8LA 4HVOA 4PLMA 4FP2A 2VULA 5DAWA 2J1SA 4Q2FA 3VBOC 2W91A 4YVSA 3N9PA 3Q8CA 1VRBA 2BOJA 1GP5A 2BNOA 3JCIA 4K1ZA 4YM0A 4COWA 5A7PA 4V2VA 4LORA 1IS4A 1S0EA 4L9BA 4WM8C 4XBQA 4F83A 1L3JA 2PFWA 4CPBA 5CISA 2WNUA 2CNAA 4IE0A 3AVSA 2ZHMA 5F7UA 4D7YA 2PAKA 2H6CA 2XXZA 4Y4RA 2VZPA 1ND2B 4LQRA 1GNYA 4ZS3A 4Q4Y2 1GFF2 3H8RA 1TME1 4AAPA 1S1AA 3NNGA 4AYUA 1W05A 5FR3A 1M4WA 5FQ0B 2BEOA 3VHRA 4P9IA 4XVHA 1FV3A 1PGW1 3AP7A 4JHZA 1OH3A 4BA6A 3JB8A 3N36A 3WZ1A 1DGRN 2BBAA 2VW0A 4PDWC 1XBFA 5F39A 4BIFA 1LECA 4RSUA 5LY1A 4CDXB 4XZUG 1HQNA 1H6YA 3ME2A 4QDSA 4NUBA 4Q4X3 3PURA 3WDVA 4FBFA 1HRI3 1AYM1 2XVKA 3NVCA 5C5TA 2HWE2 1ZA4A 5A3TA 3KQRA 3ZFFA 3WNLA 1SQ4A 1W8UA 4MGKE 1HX6A 5JDBA 3ILFA 4DXTA 1LHOA 4S2GA 5CA6A 4Z2AA 4NPRA 3AM2A 3M1HA 3USUA 2VQ0A 4JGZB 3KVBA 2R0FA 3J26N 4YM3A 4YNIA 4AFMA 5A33B 1COV1 2HBTA 3WP5A 3VUOA 1PM4A 1UY3A 1FOD1 5AC93 1PO23 3E97A 3RS6A 4ET7A 4ZKTB 1E5RA 3NSTA 4Q4V2 2YDEA 4K3UA 1B35B 1GZ9A 3A22A 3S5QA 5SV8A 4FPHA 3FX3A 5FYVA 3TN92 1PVXA 1VJ2A 3WCSA 3ZYBA 4RS5C 2YU1A 1AR62 4UI9L 4AI2A 1H1MA 5F8PA 4B7EA 4XABA 4IERA 3DCQA 4XXAA 1BVP1 5EFUA 2OA2A 1K3IA 3IAQA 4INDA 5I8TA 1JYVA 3I2OA 4OHYA 3MDPA 2R071 4Q26A 1Q8QA 2VCBA 5FV3A 4B8EA 2XPJA 2V4AA 3THCA 3UK9A 4YGCA 1OA3A 4R52A 2J7MA 2WS92 5LBBA 1WUVA 2PHUA 5A6QA 4E2QA 2VQUA 4GJYA 4UAPA 4BDVB 1RHI1 1OVSA 4ZXKA 1ND3C 5C8CC 3THPA 1SZBA 1WZXA 3RQ0A 3B69A 3IIAA 2GNBA 3PUHA 3ECQA 2CU5A 1QH6A 4R8HA 3D82A 3HT1A 4RD7A 1C57A 4XHBA 1O3QA 5KBFA 3PUAA 5JMOA 4ES9A 4XUQA 1OF3A 1LODA 2JB4A 2C24A 1OD3A 2WSUA 3AP4A 2JDAA 3B3QE 3KB5A 5JOYA 5EP9A 4MXWA 4QX8A 2PN5A 3N9MA 1E57A 2Y64A 4KBBA 3RNSA 3T2QA 2SBAA 1ULDA 4Y1UA 1PX4A 4HLTA 3T3YA 5C3QA 4LBOA 2HWF1 4HETA 2RHPA 5FK7A 1OLRA 1W39A 4CTEA 1WA6X 5C9AA 3PMEA 5FBZA 2G1MA 1S55A 1TME2 3VKNA 5CVRA 1DIWA 4BQ5A 4PHZA 2IVIB 3U4SA 2D98A 2HJIA 4XUNA 1RUF1 4XTMA 5L9VA 5FZOA 3KHBA 1PGW2 1CPMA 1PMIA 4BWOA 5DAVA 2D97A 2A7AA 4LIUA 4CDWA 5IVBA 3OYWB 2R6QA 4QGNA 2J1RA 4L11A 5C4WA 1QJY1 2RS33 4WVZA 3THTA 5C3PA 1OFSA 3NNJA 4PT6A 2C4XA 1AYM2 4QPGC 4JV4A 3RZHA 2EIDA 4GULA 1HJGA 3DPRB 4JZRA 4UF0A 5FZ6A 2BRTA 2DURA 3BUCA 1JOJA 4XJWA 1RGSA 3CZJA 3OEBA 4LKSA 2WFPA 4SLIA 3WW3A 1KJRA 3DN7A 3N9LA 4WBBA 1HRV3 2MEV1 2Q1ZB 3TNQA 1ULPA 1DQ4A 1AL0G 4GB31 5JSOA 1JYTA 1COV2 2JDPA 3O1VA 1FOD2 4AHYA 4QPIB 1HV0A 4CDUC 1TG7A 4Q0PA 4YW2A 4NAMA 2ZX2A 3TEXA 5T5JA 5FYSA 5I91A 4MG2A 5FZ9A 3TB0A 2E7AA 2VZUA 3WDXA 3MLJA 4BQWA 5B4NA 4XOGA 3NV3A 5FJKA 5GLZA 3P6BA 1RUD1 4P00B 1SLTA 3OGRA 4PF5A 3O1UA 5H9QA 5IWFA 3CNAA 4BZ4A 4J1XA 4LKFA 3D8CA 3AZZA 3PVNA 2WWSA 1NCQC 2UWBA 3LFIA 4FFGA 4LJHA 3IPVA 4D6SA 2DTWA 2R072 3GZAA 3MW2A 4BQYA 1PK6B 2DCZA 1CAWB 3FZ3A 1UN1A 1UPIA 2GNMA 4QX0A 1HN1A 4K9SA 1ZZ7A 4LPLA 4P14A 4XTPA 1YO8A 1CR7A 4GIQA 2HWD3 1GU3A 4ZXEA 1RHI2 4YW5A 3BN6A 3G7DA 5H9RA 3O5SA 3EB7A 2WNEA 5GJ6A 2XKOA 2ZXQA 4OI1A 3EBRA 5ABJB 3RZKA 4W6XA 2Q8CA 1WGPA 3ZIXA 3V0AB 1LAJA 1ASJ3 4QDQA 1AR73 1HXS3 1G6NA 2W08A 3Q8AA 5KHIA 1OQ1A 4AEKA 1MR5A 5A7QA 3B9CA 3QACA 1UMZA 1VMJA 2VW1A 5E8AA 1Q8SA 4CYDA 1AR91 1HB3A 2ZGOA 5J09A 1BXHA 3WNKA 4XFFA 4Y5Z0 4FOVA 5KXEA 2HWF2 1ODNA 1H9PA 2W94A 3RSJA 1WLWA 3M3EA 5L9BA 3LQCA 1AVBA 2YFZA 2WQ8A 1O59A 2DVBA 4YVWC 5FY5A 4AZZA 5T3NA 1V6OA 2VBBA 5J96B 3VKMA 3M3QA 3ACHA 4BQ4A 4MH0E 3UKNA 4COYA 1GKBA 2UWCA 5JLVA 1RUF2 2JDZA 4BQ3A 1JN2P 1OOPA 1SMVA 1MS8A 4Z8BA 3B01A 2WJSA 4LHSA 1MACA 2ZABA 4J6GA 3PUSA 4DY3A 1NA1B 5CADA 2GAUA 4BISA 5JAXA 2VMEA 4AEMA 3OEAA 1QJY2 1A6CA 3B02A 4HN0A 3ETQA 4W8JA 1BCXA 1W2UA 4YYOA 2XQRA 2RM23 1UY4A 5EIYB 2O0OA 1AZDA 3IDBB 1Q8PA 2Y0IA 5IVYA 1UX7A 3T2PA 5KC6A 2A3XA 1GWMA 3H7YA 4NJ4A 3VBHC 4D6QA 4EWAA 3LE0A 4XPVA 4D7TA 4MHRA 1UNBA 3QH6A 5DG1A 2ES3A 1R081 5I0SA 3RI9A 1O3RA 2VUJA 2C6SA 4YG6A 3FHQA 2MEV2 4MZUA 1C8M1 5DDJ3 3U07A 1ZZ8A 2RR11 4DUWA 2OZ6A 4GB32 4KWLA 3S7EA 1UZYA 3GXUA 3VDDB 5FUIA 1F4HA 2CGOA 4QKDA 4E8DA 4EN7B 3WDUA 1YQ2A 5F5IA 4A7ZA 4HVQA 1U5ZA 2GMPA 3RZMA 2B7YA 1G9BA 1LKNA 4ARYA 1BK0A 1Y9GA 2PLV1 5A3NA 1G9AA 2MNGA 1V6MA 1RUD2 2ZCWA 1AR81 1PIV3 1G86A 1ZX5A 2Y6LA 1NE4A 1REFA 2GH8A 2ZA9A 3UT0A 3CU7A 2W1SA 2J1VA 2WT1A 4PCRA 3WEZA 4A4AA 1X8MA 3M2MA 4RL7A 4KG0A 1UCXA 2GN7A 1F8VA 4NIDA 4OUEA 3VBFC 5FY8A 4PLOA 3UL2A 4KNCA 1ZRDA 4XF0A 3T2OA 4CA9A 1UKRA 1LU1A 2VMCA 5LATA 5F5QA 1QJU3 2W5FA 2GC0A 5CU1A 3UKTA 5LBCA 5FIXA 4ZU4A 2W39A 2HWB1 1EAH1 3ENRA 4BJ0A 1QJFA 5D8AA 5L7OC 1CD3G 2TBVA 4XW3A 4GH4A 1POV3 1XRUA 4EN8B 2QQUA 1CX4A 2A5ZA 1QOOA 5FZCA 2K0GA 3I3QA 2D6OX 4JKLA 1XNAA 1ENSA 3BB6A 1VPHA 4AAXA 4CCOA 4X8PA 1ZBA3 1FATA 2P17A 4XACA 1SBDA 3RMXA 5IYYA 2WDBA 2ZX1A 3C7OA 2RDRA 2BWCA 4M00A 2C5DA 4NAOA 2OW4A 5K7PA 1GP6A 1AR92 4QD2A 4QM9A 2CY6A 1DFQA 4META 1I9RA 4FOWA 3OGGA 1IG3A 3T0AA 5FTTC 4GJZA 2JIJA 2F6BA 4QX5A 2VVDA 1QHDA 4E4DX 4MGIE 4NRMA 2EXHA 4TSVA 2J1EA 1VRH3 3J7HA 3RG0A 1O5LA 2BVVA 2BV4A 4TN7A 3WY6A 3U37A 2QQIA 5LZ6A 1HJFA 1NOVA 4EYUA 4IV3C 2KXLA 4FPOB 4WZCA 5FLJA 3ATGA 3USUB 3BKZA 1US2A 1LULA 4LO6B 1J3QA 1W6NA 2R1DA 5BXXA 1FAYA 2FDHA 2VCAA 4JQRA 3M3OA 5FUPA 3MW3A 1BEV1 2NYYA 3HQUA 4XYXA 1W0PA 1IS6A 2BW8A 1K5JA 2JG8C 1AUYA 2WAAA 4UFHA 1Q56A 4WVWA 3UJQA 1YJLA 3ZN4A 3MUZ1 1GANA 5I0RA 2F4LA 4FCAA 4MVTA 5JIUA 2JDYA 2H0BA 5I8SA 4RHV1 3EMRA 2WO2A 3GZUC 4R4ZA 1N1VA 2XJTA 3VZLA 3MUY1 1R082 4Z92B 5FP4A 4CSWA 4AGVA 2RS11 1C8M2 1WW6A 2VOXA 2OUHA 2Z2SB 3NAPC 3PDQA 4Q27A 4AQ6A 2RR12 2DFBA 2ARBA 4GKYA 5FP9A 1JXNA 3J7NA 4I3GA 4CCLA 3N35A 2EIEA 5C71A 1AYN1 1RUC1 3K3NA 1NCRC 2Z79A 1BBT1 5A6ZA 3WDWA 4UW4A 4COUA 5IAXA 2VUDA 2TNFA 3J7LA 2WFF1 1PVC1 2XR4A 1J84A 2PLV2 1AR82 1IS5A 1IHMA 3PHMA 1LOAA 2E33A 4IGQA 3SCGA 3O0VA 1QJX1 4XUPA 1LEDA 2YMZA 3GDBA 4HN1A 2Q0AA 1YWKA 3AZWA 5FFOC 3U1XA 1IPJA 3WP6A 1EV11 2WN3A 1URXA 2DVAA 1PM7A 4G9SB 1XQNA 1OFNA 2QJVA 1UYYA 2DUOA 3ZDVA 1WCSA 4AHZA 4MXWB 2A3WA 2FCVA 2ET7A 4Q4Y3 3ZXGA 2B8MA 1WW4A 3KD4A 5JR2A 2R043 4HPKA 2HWB2 1EAH2 4KWKA 3VD4A 4A6OA 5C9AB 4PIYA 3QBQA 2Y6GA 4R4XA 4XAEA 4DOUA 2A70A 4RR3A 4E4ZA 5JXHA 3O1PA 2VXRA 3QOPA 2UWAA 5JZGC 1RUE1 1OC1A 4WZFA 5LA0A 4QX7A 4FFHA 2XONA 4HVRA 2Z69A 5FZOB 5BNOA 5DABA 1RITA 3MHZA 4JGYA 1UAIA 4CDWB 2QQWA 2FDIA 5E88A 2HWE3 4N90A 3POIA 4QU1A 4L2NA 4KH9A 3T2TA 2E51A 1AL21 3ZOIA 5C4WB 1UYZA 3ILNA 4FPYA 5LA2A 4R9BA 3OPZA 2CDOA 5FPAA 5BNNA 3OD4A 1W2AX 5FPUA 4P02B 1HB4A 1ND2C 1VAKA 2VPVA 5BY5A 4HL0A 4Y24A 2Q5TA 1VBC3 1KS5A 3H1WA 3HEIA 1S2EA 2XGXA 3WUCA 4AR2A 3BU0A 1AF9A 1ENRA 3L2HA 2PHDA 2BJSA 4B4QA 2JKBA 3MLLA 1XNDA 3FC0A 3OYWA 4Q4V3 4B1MA 5LA1A 5EPAA 4YGBA 4EROA 3GM8A 1QJZA 2Q8OA 3AJYA
chains in the Genus database with same CATH topology
3TN93 4LA2A 3VGIA 4NVPA 4ES8A 3RJ2X 1AR63 1JUIA 1BEV2 4AVVA 4S2HA 3OY8A 2D6NA 4AI0A 2FMYA 4CDXC 3N3HA 1GYKA 2XHKA 2IXKA 3ASIA 2UY8A 3IKWA 1UU5A 3JQXA 4DPNA 1WBFA 1LOFA 2WA4A 2WS93 5AVPA 1IQAA 2RS12 4JC1A 4XF1A 3IPVB 2YY1A 1ZZ9A 2XJQA 4E4SA 4PQ9A 2JECA 1CN1A 1AYN2 1RUC2 4L99A 2LM3A 3B00A 1BBT2 1LENA 1F9KA 4Y1YA 1JW6A 1T6GC 3MW4A 2WFF2 1PVC2 4QQPA 5DUXA 4CEYA 1B35C 3LCPA 4JDNA 4EV0A 1J3RA 2QDRA 1O4TA 1QJX2 3D0SA 3TOJA 1MS0A 1Q3EA 5JOWA 4YZ2A 1IZ3A 2GN3A 1LHNA 1JUHA 1MS9A 1OHFA 4FOQA 4ASMB 4F3JA 2AH2A 3IDCB 4HSJA 1GR3A 3VBRA 1EV12 4IEVA 5CFDA 4E27A 3AZVA 4AGGA 3K48A 1LHWA 1FYUA 1X82A 4D69A 1S0FA 3C3VA 3GBFA 1TME3 4Q1PA 3VBOA 1OKQA 1DG6A 1QGLA 3O7OA 4NO4A 2YGLA 3RDIA 4DB5A 5KHGA 2WINB 2X53S 3MI8A 2OZJA 4XHXA 3ZYPA 3IMNA 1RUE2 1X7NA 4UW5A 2QCSB 4DRRA 4V1PA 1OOPB 1DQ2A 1JTZX 3H0OA 4Q0VA 1SCSA 1FMD1 4X8NA 1AYM3 1ALYA 1Z78A 2DV9A 4UW3A 4F8AA 1DLLA 4XQDA 1AL22 5T55A 5JSPA 4FPEA 2JG9B 2Z5WA 2V09A 2FQPA 4IESA 1N1SA 5EJ3A 4GKXA 1UD1A 3PJYA 1R091 3FMGA 4H7MA 4EN0A 1S0JA 1COV3 3SMHA 3SITA 2VNRA 2HYKA 1FOD3 1FXZA 3WNXA 1ZNPA 4XE9A 4OI2A 4JVAA 2ILMA 3PMSA 3PVOA 5IK7A 3E6DA 5L73A 1RMU1 5C6CA 3H9AA 2BYVE 5EV7A 3ZSMA 1CIWA 2A75A 3I59A 2PA7A 2A73B 2DYCA 4NHMA 2QNKA 3DPRC 1DZTA 2R073 2XLFA 1MZEA 3BU7A 5T5PA 4KU7A 2ZGSA 4G4FA 4P9WA 1MZ6A 4FXGB 1OQEA 2CWSA 3GYDA 3M3IA 3ZFGC 1MVQA 2R30A 3HT2A 5B2GB 1V9U1 5GM0A 5L19A 4IEPA 4KGGA 1RUG1 1MS4A 3MPBA 3PLQA 3WCRA 4QHBA 2YYOA 1H2KA 2WLPA 5D8AB 3I8TA 3IDEA 1WMFA 4GH4B 1BYHA 3ZYRA 4XFBA 4K8FA 2RE9A 2OYZA 1VBE1 3HIFA 4DFSA 2WZR1 3RWNA 4GMP1 1APNA 5HCBA 1U5XA 3E6BA 1Z7S1 2G9FA 1PK6C 2JX9A 4PBOA 4I30A 4MYEA 3U10A 3BPZA 3E5XA 4DINB 1RUF3 4LNVA 4I09A 2ZMLA 3C2UA 4EWDA 5ABJC 2BUKA 5LEKA 4OI0A 1QMJA 3SH4A 3IT8A 1FMD2 5F9TA 1G7YA 1WLTA 2PHWA 3JD71 2XWBB 4JAAA 2JE7A 3ZVXA 1DGRA 1W6NB 2AYHA 1ZBE1 3BTAA 2TEPA 4UBGA 1F5JA 1U5IA 5DZEA 2C1FA 1ZRFA 1KDMA 4R9DA 3SCHA 3ACLA 3CJIC 2XJVA 3VL9A 4Y1XA 2MEV3 3QLQA 5BNQA 4IEZA 1ONAA 1R092 1DQ5A 1LOCA 4WM7C 3ELNA 3WLUA 3AKRA 5K9YA 4YZ1A 2YV8A 3LSEA 4YW3A 3H1YA 4LLFA 4YZ4A 4E2SA 4R9AA 4BPZA 2ZJCA 4IXLA 4K20A 4Z82A 1AX2A 1RMU2 3TWIA 3BALA 3MLKA 1A78A 1JH5A 1RUD3 1GV9A 1NA1C 3KLSA 3ZSKA 4CDQA 4PLNA 4ASLA 4N53C 2NZ9A 4NWVA 4HK8A 3FLPA 1YI7A 3OCPA 1OA2A 2B5HA 4LUMA 4YZ5A 1GBGA 1QNYA 3J4UH 2K9ZA 2FMDA 1V6KA 1R1ZA 1LGCA 1V9U2 4LHNA 2XBO1 1C8NA 5D1IA 3VDDC 1RUG2 3OBRA 1ZZ6A 4DNYA 5CAZA 4FPJA 1I5ZA 4AF9A 3NO8A 4Z07A 4HPKB 4K40A 4P9GA 1NCQA 1ZYBA 2XB6C 2AR6A 3WDTA 3R4DB 2V5YA 2EXKA 4N43A 2EF6A 5CIRA 5T54A 4FO9A 4BLIA 4RR3B 2G4IA 1UW8A 1KD7A 3HBZA 4P9XA 5DZGA 3RZZA 4EJRA 1VBE2 3LZZA 1WA4A 1SEFA 1AR93 2WZR2 2NP0A 1VLNA 1W6QA 2VMHA 5BNOB 3CO2A 2DU0A 3UV9A 4JGYB 4YVSC 1JYIA 4B7KA 2F4PA 4P9YA 1Z7S2 1OQDA 1HW5A 2H0VA 2Q1MA 4LBQD 3KMHA 2GZWA 2ZX3A 1F2NA 2WNUC 4RGGA 4GMP0 5BNNB 4DY5A 1LOBA 5CB7A 1DDLA 4HSLA 4RQPA 3WQ1A 4H7LA 1SBEA 2ETEA 5CBLA 1IPKA 3ZFEA 2YZ4A 2QDNA 3GBWA 4EWEA 2B39A 2PHRA 3HD8B 3LWCA 5CG8A 3JD72 4MX3A 3E5UA 4YVWA 1J59A 4B4PA 1YXWA 2PAMA 1ZBE2 2CTVA 4MUVA 5FCCA 2ERFA 4XJUA 1DZQA 3OY8B 5EYXA 3KGZA 4XQ4A 1R083 3GHNA 1C8M3 3WXPA 4B4RA 1B09A 2RR13 3MEPA 1FV2A 3WG4A 3K51A 3ZFFC 2R061 3ES1A 3FUQA 3HWJA 2OIIA 1C4RA 1HDKA 1I1EA 1QOSA 1EPWA 3OGJA 4SBVA 3SNMA 1OI6A 5KC5A 1K5MA 1AR83 1G8WA 1WLCA 1HRI1 4YW4A 3VHNA 3X29B 1NLRA 4XDQA 1PHMA 4CEYB 2BFUL 5JIAA 1MZFA 1R1A1 5K0UA 2VOKA 2DTYA 2BGCA 3NV2A 1D2QA 1EPZA 1LESA 1MS3A 5EWSA 1UIKA 1CGPA 2ZZQA 4URTA 2PHFA 3VBRB 2ZGPA 1ULEA 1OD5A 4H55A 5CFDB 3SH3A 4ISRA 2HWB3 4NHLA 2XBO2 2ENRA 3A0NA 4IV1A 3GBGA 3VBOB 3WUDA 2N7GA 1V70A 4NN0A 4BH9A 4C90A 3WQ7A 1AXZA 2AREA 4FPKA 4XBLA 5GZGA 5IK5A 1WMEA 2HEVF 5LK7B 1XNBA 1XNCA 4QPYA 2AGSA 5I0TA 3KCXA 1MEC1 5L7OA 3IN9A 2EAKA 3QCWA 4JTNA 2FZ1A 1SLLA 4YLZA 1C1LA 1LCLA 1NG0A 3VZJA 4C1XA 1RUJ1 3POWA 1UIJA 3VBSA 2DCTA 5GALA 1V6NA 3ZN6A 3WW2A 5DG2A 5JSRA 3H3ZA 1QH7A 2ZAHA 4LBMA 4AVTA 2B45X 1XYPA 2YGMA 1NXD1 4FXKB 2QVSB 4M01A 1NZCA 1KJLA 1BEV3 2RJLA 3AYAA 2LUWA 4OHWA 3P3NA 5FO9B 3KCCA 2NMOA 2ZGKA 3FWEA 2JG9A 4B29A 1G9DA 4CDWC 4BE3A 5HBAA 5CFCA 4D7SA 2QKDA 3AMNA 3U4XA 3S7IA 4Q0UA 5C4WC 4YFZA 3R05A 2A6VA 4ATFA 3I59B 2G9GA 2Y38A 2FHRA 3VL8A 5J36A 5F6KA 4XFIA 2XKPA 5T50A 5FLIA 1AYN3 2R062 3PVBB 2BNMA 5JOXA 1BBT3 4JDMA 3ROUA 3W58A 3AKQA 2WT0A 1EY2A 2WFF3 1DYPA 1XU1A 5ACA3 4PIXA 4XZPA 2NPIA 2RS31 2YUEA 1QJX3 1HRI2 3V0BA 4RA0A 3CL1A 4BMEA 3NAPA 1R1A2 3KGLA 2JD4A 4HKLA 5EXOA 4E2GA 1EV13 3M70A 3ZMNA 2VVFA 3N7MA 3VKLA 4LO8A 1AHSA 2TUNA 3BCWA 5LEJA 2CGPA 4CRQA 3VKFC 2XJRA 4TYSA 3MFAA 2X5IA 4HZFA 1TE1B 1RJ8A 1XYOA 4H14A 1LB2A 5HCFA 3VLBB 3RMYA 1RUE3 4Q8LA 3FLRA 5F6LB 4Q4W3 4Z1VA 1RUOA 1U0AA 3APBA 3DF0A 1QU0A 4ORFA 2XH6A 1AXYA 1DGWA 1SLAA 3D0JA 2R16A 1RUI1 1NLSA 1UKGA 1MEC2 3HQXA 5FOBB 3ZPYA 4AHWA 4ATEA 1AJKA 4OULA 4HKWA 2HWD1 1RUJ2 1N3QA 4FT8A 4MXVA 1VBB1 2EALA 2QE3A 4YM2A 4OVEA 1Q43A 3JUUA 3VBUA 1ASJ1 4E9KA 1CJPA 4MGZE 2D3SA 2VMIA 4XBNA 3H7JA 3SH5A 1O91A 2D6MA 1AX1A 3AYCA 3PNAA 1OOPC 2AZ5A 1O4ZA 1TNFA 4XFCA 2X29A 2UYAA 1XU2A 4IETA 1RUNA 1DQ0A 1DQ6A 1YCIA 4CDQB 4EN9B 3ZXLA 3B94A 1HQWA 2D5HA 2EAAA 1RUH1 4NR1A 3ALQA 5HCAA 5I93A 4XMAA 1BKZA 5GZDA 3WW1A 1QWRA 2RS51 2ZGNA 1DHKB 2ZPXA 1RB8G 1Q8VA 1MQTA 3U0ZA 2K2SA 3VKOA 4OZXA 4WVVA 1GZWA 3TYJA 4LR4A 3E5QA 3LKJA 3PVEA 3JBG3 3N4MA 5FMOL 4D3WA 2OVUA 2RS32 1VAMA 4CEWA 1H30A 1S2BA 4HBNA 3UJOA 1NCQB 4DRVA 3AKSA 1JHNA 4N43B 4TZDA 3N7KA 3LB9A 2E7TA 1FPN1 2QUOA 4GQ7A 1QQP1 4MSVA 1LHUA 3T1LA 5KXCA 5DDJ1 3ZSEA 1W6QB 3NKTA 3P3PA 1F31A 3MIHA 1ZM1A 2WKKA 2DVGA 1AXKA 3FFZA 1AX0A 4DMIA 2GNDA 1O3TA 4XF9A 1SLCA 4AXOA 1H8TA 2E6VA 1TEIA 4HFSA 2ZGTA 4FAGA 1UPSA 2VU9A 4AFCA 1XNKA 1CQ9A 4IQPA 2UY9A 4M3CA 1FMD3 5D8AC 4RQPB 2W52A 4GH4C 1N3PA 5JPMB 3ZFEB 1W6MA 1RUI2 4HMZA 4PBPA 1YFUA 4YVWB 3MIEA 5GLUA 5JPNB 3B9IA 4XJAA 4XJ9A 2P3JA 3LGRA 3AFKA 4IEWA 3KZ4C 1VBA1 1NQDA 2Q30A 1VBB2 4OHXA 1VIWB 3FBYA 1YIFA 1PO11 4K7JA 4Y22A 5FO7B 3WHTA 1POV1 2GH2A 2D6PA 2IXIA 2DVDA 3J8F1 3UKVA 1ASJ2 3O0WA 3MGUA 1SLIA 3LA7A 5E89A 3RJRA 1RMU3 2D3PA 3B7MA 1C3HA 5J7MA 1X33A 2VY0A 4XIOA 2ZTNA 2ZZJA 1PNGA 3AMMA 1CAXA 3B93A 4JTOA 3W9AA 3N7LA 1K5MB 4OLLA 4K21A 3OBTA 4XJ8A 1LEMA 5C8WA 1Y3TA 1UX6A 1RUH2 4KQ7A 3BODA 1CPNA 4RHV2 5K0UB 4YG3A 1H9WA 2B9UA 2IFWA 1VRH1 2RS52 2GC1A 2HEYF 2R1BA 2ZACA 3WQ0A 1UF2C 5BV6A 2CGNA 3CJXA 1DGLA 1GLHA 1RUG3 2WQ4A 1G9FA 4M0NA 3ZN5A 2WSVA 1WW5A 2NM1A 2D44A 4JGZC 4AFDA 2CYFA 3GF6A 4LBJA 4Y1VA 5GKAC 4XIKA 3DGTA 2VGDA 4IV1B 4FAHA 4XQWA 3OF1A 3ZFGA 4DXZA 1VBE3 3AMHA 2WZR3 1SDWA 4Y4YA 2WNVA 4QQHA 5GZEA 4GMP3 3ZX7A 1CAUA 3LA3A 4AFBA 2YXSA 1FPN2 3ZXKA 4AEDA 4QQLA 2HWC1 3MICA 1QQP2 4LO5B 4OUSA 2PYTA 4LTAA 1Z7S3 5DDJ2 5FLHA 3T1MA 2WQZC 5BNPA 5L7OB 3PJQA 1IGOA 1WBLA 2O8OA 4C0HA 1YLLA 4QXKA 1F5FA 1QDOA 3FFQA 3VBSB 4I0AA 3ZN6B 2ZMKA 1OA4A 4WM8A 1NY71 4ITCA 4Y20A 3S30A 2JE9A 4AFAA 4AWDA 4RR3C 3H3UA 2XJUA 4FQZA 4M3CE 1BMV1 4XILA 1ZBE3 1VBD1 2ZHLA 1U5YA 2WLQA 3MIBA 3INAA 3N7JA 2XLAA 1FNYA 2BNNA 1XYNA 2E7QA 3NJZA 5FAXA 4JGYC 1IS3A 4LE4A 2X8KA 2D93A 4XXPA 1SCRA 1VBA2 5CFCB 5CG9A 5GLTA 2R041 1YFWA 3H50A 4PDWA 1PO12 1GNHA 1D4VB 5BNNC 2XVGA 1ENQA 3J8F2 4LHKA 4FSJA 4QT6A 3CJIA 1POV0 1HQLA 2ZAAA 3DL3A 1WLDA 3I2DA 4WM7A 5T52A 2D6LX 2WL1A 1N47A 4Y26A 4L92A 3O0XA 1RIRA 5TSWA 3V0BB 1M06G 3SHRA 3NAPB 2EA7A 1JBCA 4AI3A 3QD6A 1VBC1 4AI8A 4MV2A 2RMU1 2XBO3 4HKOA 5FREA 2Q4SA 1RHI3 3HR9A 1ZZBA 2ZGUA 1LOFC 1PZ7A 2GSYA 4RS5A 1VR3A 4LO4B 3NL1A 4N7UA 2PAEA 4LEJA 4PIZA 3WHUA 1TMF1 2QZ3A 2X5IB 4QGLA 4QPIC 3AP9A 2XL9A 3VZOA 4KG8A 5JVVA 3SCFA 2GMEA 4XF4A 1BJQA 1KITA 4IEXA 3AP5A 2WIIB 4GWMA 1LRHA 1GQGA 4CEYC 3R0RA 2HWC2 5C8CA 1ND3A 5FRAA 2ARXA 3ZSLA 1RC6A 4D94A 2HWF3 1NQJA 4S2DA 5KXDA 3WV6A 2YC0A 2WA3A 5JWPA 4I2OA 3ST7A 1NXMA 3VBRC 3ZXDA 3RRDA 1HLCA 2XJSA 1D0HA 2NMNA 4KL1A 2ZGLA 1W6PA 3V56A 4ONUA 1KXGA 2BFUS 3W59A 5A32A 4C1WA 1NY72 5DXDA 3VBUB 2CAUA 4XFGA 1QJY3 1XE8A 4QQ2A 1BMV2 1VBD2 2IXCA 3ZXAC 4AW7A 2A6YA 4YSFA 3EO6A 2VMGA 4JDOA 1Q5OA 4I0WB 1NE6A 1YRZA 1GSLA 2GC3A 2R042 4M0HA 3LOBA 2VOWA 3AK0A 2RJKA 2R063 4I02A 4M3CF 1VB2A 3I4IA 2XVLA 2B46X 2IZWA 4GB33 3JQWA 4OHVA 3H8UA 1UZZA 4RFT0 4DQAA 4CZSA 3IBMA 4FPCA 4QPGA 4BHPA 2UURA 2I2SA 1MQTB 3USSA 1BZWA 1PNFA 3HMYA 2GU9A 2W68A 1GZWB 1MZ5A 4Z2WA 1R1A3 1D0GA 2XJPA 5GZCA 4CEWB 5IUQA 2D43A 5BPXA 1DGWX 3ZIWA 1UL9A 2ZHNA 1LOGA 4YZ3A 1MVEA 3G6JB 3V64A 4CDUA 3I54A 1D4M1 2CV6A 4FTBA 1VBC2 1RVF1 5AFEA 2RMU2 1H1AA 1SFYA 1GQHA 1WW7A 3U11A 3L2YA 1X36A 2C9AA 1X50A 2HKXA 4A7KA 1ZREA 2IXHA 3FHIB 1VP6A 4AQTA 1TMF2 1H8TB 4XFAA 2ZS6B 1LR5A 4TWTA 2AENA 2D6KA 3KT7A 5JI9A 4AEJA 4Q1RA 3B5LB 5JCTA 4LBQA 4P9JA 2GNTA 4M3CB 1MEC3 2VW2A 3FUOA 1UU6A 2DVFA 1YFYA 3M4FA 1V6LA 1W6MB 5F1RA 1CONA 2KA3A 1RUJ3 3KSCA 3ZXJA 1TNRA 3ZXEA 4Y1ZA 5J48A 1QKQA 2DUPA 2IC1A 3WW4A 4IEUA 1HV1A 3HAGA 3R4SA 3ILRA 4XEZA 1I6XA 1V00A 1MS5A 2JJ6A 4FTSA 2BPA2 4Y22B 4OFGA 2QZ2A 4EN6B 4AQ2A 1H0BA 2XG3A 4WVMA 4HT1T 3WR0A 1W6OA 2GDFA 3MIFA 1WCKA 4L8QA 4YG0A 5SV5A 4ISQA 3WG2A 1YI9A 1CAXB 1H1IA 1DF0A 3ZYIB 4XFHA 5KXBA 3WP4A 3H1MA 1EP0A 1Q8OA 5JI7A 3NWKA 1OSGA 4YW1A 2ZOEB 2R0HA 1XXNA 4BMBA 4C91A 3MIDA 5GLWA 1IOAA 4FPGA 3MPPG 3D5OA 3LAGA 2YPJA 2ZBJA 1YJKA 5KHKA 1OPOA 5LRSA 4HK9A 4Q0SA 4LE3A 4QGMA 3VBHA 1YFXA 1N1YA 2FBEA 2PLV3 1H2LA 4ZU7A 4JRLA 4Q4X1 3ZO0B 3M3CA 3ZFGB 1WCDJ 2P3IA 3WVJA 4CDQC 1ZRCA 4I3PA 2WNVB 4IEOA 3ZDSA 4YGEA 1CAUB 5K8SA 3E6CC 2AUYA 4OUMA 1D4M2 3VHOA 1C28A 4AEDB 1RVF2 1C5IA 1DYKA 2PQQA 3ES4A 3KT4A 1EAH3 5T5LA 1KFXL 5BNPB 4I0BA 2NQYA 3MF6A 1FI2A 5AC91 5GZFA 1PO21 2P37A 4LULA 5IK8A 5AFBA 1LHVA 4OI4A 1A8DA 1QXPA 1REEA 3VBFA 2GC2A 4WM8B 1RUI3 4Y20B 5EYYA 4N43C 3MZHA 4LUKA 4LBNA 2JENA 1DBNA 4R9CA 1VBB3 4QM8A 5J98B 5FMOS 4YFWA 2VNOA 3LOIA 3MYXA 3WG1A 4P9LA 5DZFA 2VQAA 2BVBA 4PDWB 1CAVA 4AVCA 5C9AC 5J3UA 2XLGA 4YARA 4N9HA 1KS4A 1S0IA 3SLIA 4MGYE 2ATFA 2YROA 5E16A 3WX5A 4RQPC 1DQ1A 4U36A 1REDA 3MFCA 4COVA 2O8QA 3ZFEC 1QF3A 1H4GA 2OUJA 3CJIB 3KM5A 5BUVA 1V6IA 1RUH3 5DUUA 4WM7B 4RHV3 4IV3A 4B3NA 2RS53 2D40A 2RS13 3TBDA 2DUQA 1YHFA 2SLIA 2IXJA 2ZKLA 2ZHKA 1N1TA 1RUC3 3WG3A 3VHPA 2JG8A 3S0MA 1FX5A 1SACA 5T5OA 4AI1A 3TNPB 3J9SA 4RS5B 4N53B 3WINE 1PVC3 1QDCA 1S0CA 3EXUA 4IL7A 4K6BA 2HEWF 2DCYA 2E53A 1FNZA 4Q4X2 1FT9A 3VZKA 4AE2A 4KU8A 4COZA 1OMIA