1EP4A

Crystal structure of hiv-1 reverse transcriptase in complex with s-1153
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
536
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Binding of the second generation non-nucleoside inhibitor S-1153 to HIV-1 reverse transcriptase involves extensive main chain hydrogen bonding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 126
structure length 522
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ep4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ep4A05
3B6PA 1HJRA 1S6QA 3KKRA 3NF8A 1XI1A 4QOZB 1T8EA 3DLKB 4QWEA 2B6AB 4FJHA 2G8WA 5KT5A 4DQSA 5F8HA 5KFPA 5KI6A 3QETA 1REVA 5C24B 3QO9A 3U3YA 1S97A 3BDPA 4IG3A 1QSYA 1D9DA 3RTVA 2F96A 5DQHA 3M9OB 4H4MA 1ZYQA 3DLKA 4PUOB 3MECB 3P83D 4TQSA 1ZTWA 2B6AA 1NK8A 3FSIA 3SPYA 5KFYA 4NLVA 2OPQB 4EO8A 2ASJA 1BCMA 1A5VA 2G8UA 3JYTB 3LALA 4PUOA 3VA3A 2HHQA 2WONB 4ECSA 2OH2A 3CDWA 4Q8EA 2R8JA 1XR7A 4I2QB 5KG3A 2RDIA 3RB4A 4DSKA 3O4NA 2Z1JA 1RT1B 3CJ0A 4B3OB 3TWHA 5I42A 3OL8A 3DMJB 2P51A 4YQWA 1CZ9A 2WONA 3ULDA 4NYZA 1WLJA 4F4XA 3EPGA 3QEWA 3RMBA 4M94A 3VQ5A 1BIZA 2BRLA 1RDAA 1GX6A 3DMJA 1QAJA 2P1JA 1BGXT 1JLCB 3HPHA 5CYQB 5DMRA 3OJUA 3H5XA 2FBXA 1S9GB 3I5BA 4ZP8A 1QTMA 3P5JA 1RT2A 3MF5A 3H4DA 3LZJA 3MXJA 4O4GA 4FJLA 1IKWB 3GV5B 1WAJA 4CFAA 1I3AA 3NE6A 4RG8A 4KTQA 1BI4A 1BQNA 3NAEA 4K4WA 4ECYA 5CYQA 2IM0A 1S9GA 4FBTA 3BSOA 2A1RA 4CJUA 3K5OA 2XI2A 5HROA 4CEAA 1RBVA 4HVJA 4G3IA 3DLGB 4B9MA 3DRPB 3I0SB 4OKJA 5K14A 1BQMB 3L2WA 4CJSA 1J9AA 4ECZA 4CEZA 1SL2A 3LPUA 1ASWA 1RTDB 3NH0A 2XC9A 1QE1A 5KT7A 3IAYA 3MXIA 4KPYA 3VQBA 3U6FA 4DL4A 3I0RB 4LD0A 4N56A 4JUZA 5F8LA 3DLGA 4RW9B 4GC7A 3OYIA 4FS2A 4CJVA 4KAZA 2FJXA 2YKNB 3TAMA 4ZVHA 3LZIA 3H40A 2VG6A 1RTDA 4GVMA 4PWDA 3NGDA 3LANA 4RW9A 1XWLA 4ZP7A 3HO1A 5T7BA 3DI6B 3F73A 1VSJA 4LY7A 5J1EA 3V9UA 4FLXA 2X78A 2X6NA 5KFWA 4M95A 1SV5B 3ITHA 4BWMA 4B08A 3RR8A 3KLHA 3PY8A 5EUHA 1HMVA 3QESA 1EKEA 3AVGA 1JXEA 4M41A 4M3WA 3OS2A 3OYDA 4CHZA 3HVAA 4HCCA 4J2DA 4MK8A 1JX4A 3BQ0A 2W9BA 5KFRA 3Q8SB 3LP1A 1D9FA 4YP3A 4O3RA 4IFYB 1SL0A 3V81A 4DFPA 3M8PB 1N48A 3TAPA 3QGGA 3D0PA 3VQ6A 4FJJA 5L1KA 2D3ZA 4KV8B 4CJQA 1S1XB 4RW7A 2JC1A 4NCAA 4J9LA 3KKSA 3KLGA 4IFYA 3GV7B 4EEYA 3G0ZA 1UA1A 3PW7A 3RMDA 3T3FA 4M3XA 2Z1GA 4CJRA 4MIBA 3M9MB 1YTUA 1A5XA 1O1WA 1ZTTA 1Q9XA 5J2QA 3ZSRA 1TQLA 4ZP9A 3ZSOA 2CKWA 1QSSA 2R2UA 2FVRA 2IOCA 4LSLB 1NNDA 1KTQA 4Q5VA 2HVHA 3FQLA 1U45A 4AHVA 2VG7A 1YVUA 1LWFA 4QAGA 3V9SA 4G1QB 3VQ8A 3OYJA 3LAKA 4HCBA 2ILYA 5J2PB 5L1JA 2ITGA 4DFKA 2DFHA 2ATLA 1HYSB 4B9NA 4URSA 4CEFA 3D45A 4KTWA 2HHTA 4RUCA 4CJLA 4GW6A 1JLQA 1KCFA 1QHTA 1GOCA 3VN5A 5HLFA 1LWEB 4E7KA 3RWUA 3M9NB 4Y1DA 5CYMB 4PQUB 4TY9A 3NCIA 2ZD1B 5L9XA 1BCOA 3RAQA 2IBKA 4KB0A 4EP5A 4CESA 2XY5A 4O55A 2P5OA 4FK2A 4KFBB 3HYFA 1ZBIA 1VK0A 2ZQBA 2AJQA 4DTXA 1KLMA 4PA1A 4CFDA 2G8HA 1TKXB 5FRNA 2AGPA 4ED0A 1TL3A 3SFGA 1GOBA 3V1RA 2ZD1A 2W9AA 4ZPBA 5HRRA 4K8XA 4FXDA 1MU2B 1R0AB 4QPXA 4ICLA 4EBEA 3LP0A 3VQSA 4F4KA 2R2SA 4ELTA 1JLEA 1VRTB 2AX0A 3L3VA 3DLRA 3KJVA 1Y97A 3T5JA 3MAQA 3H08A 1D5AA 3TABA 1RDRA 3QERA 4NLXA 1YTAA 2WK4A 1R0AA 3RAXA 3PX0A 1RDBA 2IJFA 4HKQA 2UUWA 2D7SA 4CK1A 4CK3A 4U6PA 1S4FA 3ZT0A 2OPPB 4QWAA 4K4XA 4Y2CA 5KT6A 4J9PA 3GYNA 2VA2A 1ITGA 4E7LA 3IRXB 4OVLA 1LAVA 4KTZA 4OPJA 3RRHA 2CJQA 4F50A 5EWGA 4O0JA 3VQQA 1UWBA 4E7IA 5D3GB 3AVMA 4E19A 4W5OA 3T5LA 4ELVA 3SQ4A 4NCGB 2QKKA 4IOBA 4FVMA 4TQRA 1S9FA 1KHVA 4F3TA 1A5WA 4W5NA 1DTTA 5KFTA 4ECXA 4CF8A 2HNZB 1YT3A 2FLPA 4HUEA 2OPSB 4F2SA 2FVSA 1CXUA 5D3GA 3HT3A 3UR0A 2D41A 1B9FA 5FROA 3OSNA 1U04A 2HNZA 1JLAA 1K1SA 4DTNA 2OPSA 1WSJA 1JKHB 1RCHA 1TAUA 4O3OA 4DSIA 3TAQA 3G6XA 2B5JB 4IH5A 3ICLA 5KGXA 5DQGA 4DLEA 3LP2B 3PW0A 4ECVA 3G6VA 2D0CA 4BE2A 2YNGA 1XR6A 4HTUA 3L3UA 1TVRB 1TKDA 1RT5A 3AVKA 1IO2A 1ZBUA 3DRSA 4F2RA 1DLOB 2B5JA 3HP6A 5FRMA 2FLNA 2W9CA 5DG7A 2HNYB 4C8MA 2WB4A 2G8KA 1NHVA 3HM9A 4NLTA 2XWYA 1TVRA 1LAWA 2DY4A 1DLOA 4UQGA 4I7FB 1C0TA 4DTUA 2IC3B 4RUAA 4OLBA 1TV6B 4DL6A 4O5BA 4EO6A 2KQ2A 4CEEA 1KHWA 3SUNA 4FJ8A 3QEVA 1TKTA 3CIZA 2PZSA 4KHSA 4O44A 4I7FA 4FLTA 5KFFA 4RW4B 3CM5A 4WYLA 4CGFA 1S6PB 2P5GA 3RMAA 2BE2B 2RKIA 3BSNA 3OYBA 4PY5A 3ZT4A 4L8RB 2FJVA 4J9OA 3LP3A 3ZSWA 4KB7A 2IMWP 4CGIA 3CJ3A 2B43A 5JUMA 4DF4A 2RN2A 5KFZA 1BIUA 3WNGA 1LW0B 2D5RA 4RW4A 2R2RA 4U7CA 3IS9A 3S3OA 3PO4A 1S6PA 3GIIA 4LH5A 4IDKA 5KFLA 1LV5A 2ASDA 4IKFA 3O4QA 3N6NA 4E3SA 1IKVA 2J6SA 3CYMA 1S6QB 4WZQA 3ZSZA 5KFNA 2YHBA 1W9HA 3MR3A 3IG1A 1HNIB 4IRCA 2AWZA 4X2BA 2B4JA 3SUOA 1REVB 2XY6A 4CJWA 1RTIA 4E7JA 4IG3B 3ZT2A 4WFZA 2WCXA 4H4MB 4XO0A 1HNIA 2RPIA 4IRKA 4KAIA 3OHBA 5KRSA 2HVIA 3AO5A 4LQ9A 2UVRA 3OL6A 2OZMA 3ISND 2OZSA 1QAIA 4EZ6A 4O3SA 4J9NA 3AVCA 2AGQA 4IG0A 4CEDA 1X9MA 4IFVB 3VQ7A 4YFUA 4TYBA 3PX4A 3TAFA 3O3HA 3SV3A 1TK8A 4DU1A 3I5AA 2E9TA 3KHRA 4E0DA 4Z0UA 3RMCA 3EPIA 4IFVA 2GBZA 5I42B 3AVAA 4BDYA 3OYEA 4FS1A 3DLEA 2V9WA 2C28A 4NLDA 4DL3A 3V6HA 4TY8A 1EP4B 3K58A 1RT7B 3QZ7A 4NZ0A 3O3FA 4WZMA 5F8GA 3C6TB 3Q8QB 1B92A 2X6SA 2OYQA 1ASVA 3SQ2A 1NOYA 4WXWA 3HPGA 2Y1JA 3IN5A 1ZBHA 1RT2B 4YMEA 2V4RA 4ID1A 2HWHA 1EP4A 4XPCA 4O3QA 2WHOA 1RT7A 4O4GB 4FJMA 2HHXA 4ED2A 3L8BA 3NGIA 3UIQA 3D28A 1BI4B 1BQNB 3C6TA 4H4OA 2ILZA 3UPFA 4RW6B 2W8KA 3UDLA 3AVFA 2GIQA 4J9KA 1C2PA 3QIOA 1FK9B 1UOCA 3EZ5A 1Q9YA 3LDSA 5HROB 4ZVFA 3CO9A 4J9QA 1TKZA 3PW5A 1SKWA 1CSJA 3ZT1A 2C2DA 4OGCA 5K14B 3DDKA 4RW6A 4DSEA 4DQQA 2ZE2B 4OLAA 1FK9A 3KD1E 3K5MA 5F8MA 3FFIB 4M3RA 1QE1B 4RW8B 4ID5A 1TL1B 5SZTA 4BDZA 1VSKA 3PW4A 3AVIA 4KHQA 2QXFA 3PX6A 5J2MA 4ZPDA 1SH2A 3AV9A 1L5UA 5DG8A 4AHTA 1RT4B 4KHNA 4RNFA 3NF9A 3CDUA 3TAMB 2ZE2A 3TQ1A 5KFBA 2VG6B 3K59A 1RTJA 3FFIA 4RW8A 3OYGA 1VSDA 3ZSQA 1TL1A 4PWDB 4DL7A 4ZHRA 4I9LA 4H54A 4CCHA 5KT3A 1C6VA 3AO4A 3H2LA 1T03B 1S9EA 4RU9A 3SI8A 4FLUA 4URQU 1SH3A 1RT4A 2J6UA 1RA6A 1QUVA 4KI6A 3AO2A 2NUBA 3DOLA 5J1EB 5EDWA 3SYZA 3G6YA 5SWMA 1HQUA 3ITHB 2EX3A 2XHBA 1JLFB 1NK6A 4DSJA 1T03A 3KLHB 3V6JA 1HMVB 2VA3A 3N6MA 3BR9A 3HK2A 3K5LA 4OGEA 4EBDA 4W5TA 4MKAA 5E41A 5JS2A 2HMIB 1HPZA 3OYNA 1JLFA 4K50A 3NBPB 2O5DA 2XRIA 2W9BB 2R8HA 1RT6A 2KW4A 3LP1B 2RF2B 3FRZA 4WE1B 4WYWA 5KFMA 4E1NA 1J5OA 3CQ8A 3V81B 3OYKA 2HMIA 3NGZA 3NBPA 2HHVA 3BREA 1SL1A 4KKOA 4CECA 2YNFA 2V4QA 2IGIA 2RF2A 3IGVA 3KHHA 2HB5A 4RW7B 4AHRA 1RTHA 3DOKB 3NHGA 4WE1A 3KLGB 1KVCA 1TAQA 3QLHA 2Y1IA 4WFYA 3M8SA 3K5NA 2O4GA 3QYYA 3CG7A 5J2QB 2JLEA 2EC0A 3AVBA 4CJPA 4CGDA 4M45A 2BQUA 4DFJA 4K4SA 3G10A 3C95A 4CJKA 2HHUA 1WSEA 4KHRA 3DOKA 4CHQA 2XCAA 4NYFA 4K8ZA 1C1AA 4IR9A 1X9SA 2VG7B 1LWFB 3BGRB 3RB0A 1G15A 1JXBA 3HVTA 4FM1A 3SJJA 3V6DA 1Q8IA 2HW3A 1C1BA 3NMAA 3HVRA 4F3OA 3AA4A 5F8IA 5HP1A 3AO3A 1T7PA 2D0AA 4N76A 3OHAA 3S9HA 3BGRA 2GC8A 3E01A 4JS4A 3B6OA 2KZZA 1JLQB 3T19A 5KGWA 4ECTA 1N56A 4QW8A 5T14A 5HLFB 3DRRA 4W5RA 3PJXA 4CEOA 4DQRA 4FJ7A 4DWIA 4O3PA 4DSLA 2QV6A 4TSXA 1KVAA 3V9ZA 3QGHA 2E9ZA 3THVA 5I3UA 3I8DA 3EZUA 3MEEA 3SQ1A 4JRQA 4HHTA 3UQSA 2LSNA 1S0NA 2F8EX 3KHGA 1KLMB 1JL1A 4Z4GA 1WSHA 3QINA 4M3YA 1TL3B 3KK2A 4NLUA 3AVNA 4FJ9A 4FM0A 1VSHA 3C6UB 4FYDA 2HAIA 5DK5A 3C94A 1N6QB 2D3UA 4FCYA 2F8TA 4ICLB 3GV8B 4R0EA 3LP0B 3KLEA 1JLEB 5KFIA 3OSPA 2IDOA 1X1PA 5J2NB 3KJVB 5HRSA 3TR8A 4ECUA 3C6UA 1N6QA 3E51A 4BWJA 5F9LA 5C42B 2EHGA 4FW1A 1ZBFA 4FZYA 1HQEB 3S3NA 4AH9A 3CJ4A 5J2NA 1WSFA 4CK2A 4DU3A 3QEIA 4M3UA 1UWBB 2W8LA 4Y1CA 1ZETA 1K1QA 5KFKA 5C42A 2PY5A 1LWCB 1T3NA 1RDDA 1U4BA 4B8CA 4ED1A 1HQEA 3M8QA 5KFUA 2ATQA 2ZKUA 4KI4A 1DTTB 3DLBA 3H4BA 4F4WA 4O0IA 3PZPA 4E7HA 3T5HA 1LWCA 5F9NA 1NKCA 4XPEA 4O3NA 1WN7A 5KG5A 1D0EA 3QNOA 1OS5A 5FDLA 4H8KA 4B9SA 3BSCA 1JLAB 1WSGA 2XCPA 1GX5A 4DSFA 1BHLA 4C8NA 4YR3A 1EX4A 2R2TA 4CERA 3KHLA 3TARA 5KTQA 4CIEA 4CF1A 4ED8A 3KD5E 5HBMA 4CJ4A 3KK3A 2JEGA 3L2UA 3IGNA 4NLWA 5KG1A 5F8JA 2YNGB 4KHWA 4LSNA 2BRKA 1RT5B 2C22A 4C8OA 1IKYA 3KLFB 3VQDA 3O3GA 3DRSB 2FBVA 3OYFA 1JLBA 4JV1A 3AA3A 2W9CB 5KFGA 4Y3CA 4CJTA 2C2RA 1NKEA 3V4IA 1VSLA 4Q43A 2YV0X 4FM2A 1JL2A 1HARA 3KLFA 3BQ2A 2UUTA 2R8GA 3WNEA 2OPRA 1C0TB 2I5JB 4CJEA 2BR0A 4QW9A 1L3VA 2AQ4A 4NYNA 4FK4A 4KE5A 4KHYA 1JLGB 3NF6A 1KLNA 2R8KA 2FVCA 2DFEA 1TKTB 4FJXA 4LQ3A 1W25A 1RILA 3CJ5A 4DTOA 4O44B 3MTKA 3FQKA 1FKPA 4EBCA 2I5JA 3NDKA 4TLRA 4ZTFA 2XY7A 3DM2A 4DTRA 3VQ9A 2RKIB 3MFHA 1NJZA 1JLGA 3JSMB 4FK0A 3K57A 1N4LA 4RNOA 3ALYA 1SUQA 4Q45A 3TANA 3QIPB 1HNVA 3IS9B 2YKMA 4DL5A 4CF9A 1W0HA 1CLQA 4ED7A 4IDKB 3JSMA 4MK9A 3LWLA 2IAJA 2DPJA 1NK0A 3OL7A 1RBUA 4ZVEA 2A1SA 4Z4FA 1IKVB 1S1WA 3LPTA 3QIPA 4DEZA 4EP4A 3IG1B 3PW2A 1T05A 4OKKA 3HPOA 2HHWA 3OS0A 1UAXA 1VRUA 1S1VA 5KG0A 2DFFA 2VWJA 4AILC 3F9KA 2VG5A 1NK5A 5C5JA 1RTIB 4EYIB 4FW2A 4I2PB 3NKYA 1SKSA 4Q44A 1VSFA 1DTQB 1MMLA 3T5KA 4YR0A 3AVLA 1RBSA 3HJFA 3CDEA 1IH7A 4I2PA 5DGBA 4C8KA 1KVBA 1U49A 4KHMA 2YNHA 4Z4CA 3KMQA 3VQ4A 2IA6A 1DTQA 4IG0B 4CF0A 4DQIA 2V0NA 5JXSA 1D1UA 4GMJB 2PYLA 4KHUA 4R5PA 2XGPA 1NOZA 2IS3A 3PVXA 2R8IA 4ED3A 4F8RA 1S1TA 4QCLA 1CXQA 1RNHA 3GILA 4K4ZA 2X74A 2GUIA 4YNQA 4B9VA 3MR6A 1S5JA 4CHOA 4CE9A 4JLHA 4NLGA 3KLIA 1EETA 3DYAA 4YR2A 3DLEB 1QSLA 4NCBA 5C25B 4TY8B 5KT4A 4DTJA 4J2BA 3RB3A 4R8UB 1BL3A 4DU4A 2G8IA 2HNDB 4NRTA 3ZCMA 2BANB 3NL0A 4NLRA 3PHEA 4IBNA 4NLOA 4URGA 5L1LA 5DLFA 5C24A 5C25A 3CVKA 2Q3SA 3OY9A 2XY8A 1B9DA 4AHSA 3ZSYA 3SZ2A 3VQAA 4R8UA 4F4YA 2HNDA 4H4OB 3MECA 2BANA 5KFAA 4B9UA 3AA2A 1IM4A 3QZ8A 1IKXB 1IG9A 1YVFA 3HL8A 2OPQA 4DS5A 5KFVA 1L3UA 4Y2AA 3JYTA 3LWMA 3HVWA 4HYKA 1TKZB 4IKAA 1J54A 2O4IA 3FDSA 1UA0A 2G8VA 2GIRA 2KFZA 4E89A 4KB1A 1IKXA 3LAMA 1HYZA 4CIGA 4W5QA 1TP7A 4TXSA 4I2QA 4ELUA 4ID5B 1XC9A 2HWIA 2IJNA 3MXMA 4FLYA 3KK1B 1NK4A 1RT1A 4Z4EA 5J2MB 4B3OA 3NF7A 3MEDB 4CEQA 3HXMA 4ECQA 2BQ3A 1RTJB 5F8NA 3V9WA 3VQEA 3ZSXA 4JV2A 3P1GA 1L3TA 4ZHRB 2FLLA 1S49A 1S0MA 3KK1A 1S9EB 3EY1A 3Q8RB 4FZZA 3MEDA 1JLCA 4MK7A 5KG4A 2AU0A 1K6YA 3PV8A 4M42A 4KREA 5CY4A 4DFMA 3DOLB 4OKEA 1HQUB 1IKWA 4JV0A 3CFOA 2JEFA 1RDCA 1C1CB 2VWKA 4NRUA 4QWDA 4BE0A 5KG6A 2WTFA 4FJGA 4IH6A 3PR5B 2E6MA 1HPZB 3GIMA 4Q0BB 1NHUA 4ZP6A 3SQ0A 5DGAA 4N47A 3DRPA 3G86A 4N5SA 1RT6B 2FVPA 1RBTA 1C1CA 3I0SA 3D5MA 1BQMA 4DTPA 4WXOA 4FBUA 5KG7A 1J5OB 3SFUA 1EXQA 4CHNA 3VA0A 4Q0BA 3I0RA 1BISA 4BACA 2WOMB 2HHSA 4KO0B 5KFXA 4KKOB 3RBDA 4FJIA 3ZSVA 4HUGA 3VQCA 1VSIA 2YNFB 3EYZA 2YKNA 3OLAA 2JEIA 4CFBA 1RTHB 4DTSA 4QWBA 5EWEA 1RYRA 2XO7A 3QLHB 4MIAA 3RB6A 3WNFA 3U3GA 5KFJA 4BDPA 2R7YA 1HRHA 4I9QA 5KFQA 2C2EA 3BQ1A 2WOMA 4KO0A 4K4YA 5KRTA 3HP9A 2IM2A 2FJWA 3OYHA 4IRDA 3DI6A 4EZ9A 4CGGA 4MQ3A 3CFRA 5HRPA 4C8LA 1SV5A 5KG2A 3CM6A 3K2PA 4LH4A 3HVTB 3PO5A 3OS1A 4BE1A 2QE5A 3V6DB 1JIHA 2D0BA 1C1BB 5HP1B 2JEJA 3KIOA 5DG9A 1WSIA 4CIFA 1FKOB 5DLGA 3I5CA 2DPIA 3QNNA 3E01B 4CHPA 1Z4UA 3BSAA 5JS1A 4J9RA 2ASLA 3SNNA 3TVKA 1RBRA 4NLQA 3H5UA 4B9LA 4DL2A 3DRRB 2BGGA 4CF2A 3M8PA 1FXXA 1GOAA 4DLGA 2OA8A 4OL8A 1FKOA 4J9SA 1I39A 3L2RA 3SPZA 4GC6A 1F21A 4E1MA 1KRPA 1NK7A 2E4LA 4KV8A 3VQPA 4M3ZA 5I3UB 5EWFA 1S1XA 3MEEB 4IQXA 1QQCA 4XIUA 4ZTJA 3AVHA 3KK2B 4MFBB 4DG1B 1SKRA 4DQPA 4AHUA 3AVJA 4Z4IA 4LSLA 4IR1A 3KLEB 3OJSA 3RR7A 2W7PA 3HKWA 4MFBA 5HRNA 1KFDA 4DG1A 4FJ5A 4MKBA 1T94A 3CWJA 3TI0A 4ECWA 3QEXA 4NLYA 1HYVA 4G1QA 2XI3A 2E6LA 4B8AB 3MEGB 3ZT3A 3TAEA 5J2PA 1L3SA 1SH0A 1CZBA 1HYSA 4FLVA 1NJYA 2QK9A 3MEGA 3M8QB 3MR2A 5CZ2A 5KFDA 1LWEA 3GQCA 4J2AA 5CZ1A 5CYMA 4PQUA 2RDJA 3V6KA 3PJWA 1X9WA 2Z1HA 4CEBA 4RZRA 3KLVA 3KMSA 3OYLA 1RA7A 1XHZA 3OLBA 4KFBA 3MFIA 4CJ3A 1XHXA 2UVWA 1TKXA 3H98A 5KFCA 1RYSA 5FDLB 2BDPA 2JC0A 4KRFA 2YNIB 1NK9A 2AX1A 3CFPA 3A2FA 3SI6A 5KFOA 1MU2A 4ECRA 3V1QA 3KTQA 4JRPA 3WNHA 2GV9A 1VRTA 1N5YB 1U09A 5HBMB 3KK3B 4RNHA 4CJFA 4CHYA 1WAFA 1C0MA 2YNIA 3SUQA 4LSNB 2E9RX 3PR4A 2FC0A 4ED6A 1TK5A 3RBEA 1IKYB 1S0OA 1KSPA 1TK0A 1I6JA 5DQIA 4DTMA 1S1UB 4OPKA 1JLBB 4OJRA 3OL9A 3HSTB 1N5YA 3NGYA 2OPPA 3SV4A 3H5SA 1Z25A 3V9XA 2QKBA 4JS5A 3RRGA 3IRXA 3V4IB 2I1RA 5KT2A 2KFNA 3NH1A 1U48A 1D8YA 4NLSA 1S1UA 2OPRB 2W7OA 4NCGA 4RNMA 3QIDA 1ZBLA 4N41A 2XGQA 4FLZA 1NJWA 3Q8PB 1Z26A 4NLPA 1ASUA 1RAJA 3ISNC 2J6TA 4QWCA 5KFSA 4MH8A 1LW2B 2JGUA 3QEPA 3H5YA 4AHCA 1FKPB 2ALZA 3OYCA 2KTQA 3DLHA 5KFEA 3DM2B 4KSEB 1RT3B 2IM1A 2BQRA 2YHAA 5KFHA 4HUFA 3L2VA 4CGJA 3PUFA 4M3TA 2G8FA 3BJYA 3NAHA 1JKHA 2UVVA 3KOAA 1LW2A 4TN2A 1SUQB 4WFXA 4J2EA 3M8RA 1HNVB 4EYHB 2YKMB 1RT3A 3LP2A 3CJ2A 3OYMA 4Y34A 2IAJB 3KNAA 4ZMMA 1S48A 1KFSA 1VSEA 4FZXC 5EU7A 1S1WB 3NFAA 3L2QA 1WNEA 4Z4HA 2HNYA 3OVNA 4ZVGA 1XR5A 1T05B 5L1IA 4CJ5A 4B9TA 3NAIA 1VRUB 1S1VB 1S10A 4Q8FA 3N6LA 1JXLA 2VG5B 3AA5X 4CGHA 2KZMA 3GIJA 4ZPCA 2IC3A 2AGOA 1TV6A 1NJXA 3HHKA 4DMNA 1WNSA 4DF8A 1C0UB 4O4RA 4K4TA 1J53A 4TYAA 3MR5A 4RNNA 2PYJA 3NH2A 4ZPAA 2ETJA 2FVQA 4FJKA 2YNHB 3SCXA 4CFCA 4FLWA 2UVUA 2BE2A 3QGIA 3GIKA 1C0UA 2DTUA 4R5PB 2Z1IA 1S1TB 3ASMA 3V1OA 2FBYA 4K4VA 4J9MA 3S3MA 2WRMA 2F8SA 4DS4A 1LW0A 3T1AA 3SUPA 1VSMA 2W42A 3H59A 1TGOA 3OYAA 3KLIB 1EETB 3DYAB 4IH7A 4FJNA 4K4UA 2FBTA 1NKBA 2IM3A 3AO1A 4F4ZA 4KBIA 3TAGA 1U47A 3QO9B 1QS4A
chains in the Genus database with same CATH superfamily
1GFWB 1LCUA 4W4MA 1WTFA 2XLKA 3KKRA 2CUYA 4QOZB 3Q23A 3PLAA 2W2MP 2G8WA 5KT5A 1FHTA 3QETA 4A46A 1S97A 3BDPA 2WAQD 1N52B 1QSYA 4HT7A 2Y1LB 5DM6L 1VHXA 3DLKA 4ZDNA 5B0CA 3P83D 4TQSA 3EEQA 1HPMA 1ZTWA 2B6AA 2X1FA 2DGUA 2JRSA 2PIIA 4YB1P 3L7PA 3SSQA 3D1OA 2IVFB 2HMPA 2W41A 4EO8A 4HH1A 4OX8A 2ASJA 2F4VJ 3D2EB 2GO8A 4GO5X 3QNWB 2HHQA 4UF4A 3WEEB 5AZJA 4ECSA 4NL5A 5IWAF 5LJ5Y 2R8JA 4I2QB 2QA1A 1CS4B 2OKQA 2YPYA 2DHGA 1YQHA 3Q7BA 3HZGA 1BHNA 2J0QD 3W2WB 3BZQA 1U2CA 4UY8T 2DNPA 4YQWA 4OFZA 5C10A 3ID8A 4LF6J 4DV0F 3AOBA 4JI8J 2B56A 3VQ5A 2J7UA 4JAXA 3N5FA 3UKRA 1K8AO 1VQKS 4DR6F 2LVWA 2P9NB 2BKOA 3T1YK 4FSVA 5AQOA 4C0OC 3H5XA 3JSYA 1Q78A 3I5BA 4ZP8A 3SBTA 5BREA 3MF5A 4O4GA 3G6EN 3LDPA 3C19A 2LP4A 1OH5A 4ECYA 3AGKA 4ED4A 3CCMN 2IVPA 1M1GA 4B3TK 4FBTA 4AM6A 2D4WA 2A1RA 2DJWA 3K5OA 1Z05A 1CULB 4WFNL 3OR1A 4A5BA 1EZZB 4GKJK 4OKJA 2IRYA 3L2WA 4ECZA 4CEZA 1HWJA 2QLWA 2V8PA 4JI3K 3NH0A 1J5EK 1VQPN 5KT7A 3KG4A 2AYMA 1QDUB 4LBPA 1EIYB 4RW9B 4FS2A 4CJVA 2A42A 1R8AA 1X3NA 3TAMA 1SI9A 2VG6A 3H40A 1X4BA 2ZM6K 1JNRB 2MZQA 4PWDA 4X4SA 1RBAA 4Y6IA 4OI6A 3SCLE 5T7BA 2F9TA 2RIJA 1U2FA 3D7EO 4WKYA 5J1EA 3V9UA 3HD1A 1M0SA 3QBWA 3W3DA 5L9NA 1NPRA 4OMFG 1N88A 3ZXWA 3OYDA 5LL6d 4CHZA 4WU2A 4DZDA 1YZ7A 2O8EB 5BR9A 3L4IA 3R2CJ 3GIRA 3BQ0A 2W9BA 4LF8F 1HKGA 4L3NA 5KFRA 1JJ2M 3OA9A 1HBMA 3LP1A 4M5HA 3G8TA 3SQOP 3LDNA 2MMYA 3PYGA 4DFPA 2GTDA 4LRAA 2JVOA 1C0FA 1HD0A 2BH1A 1S1XB 2B4VA 3AGRA 2JC1A 4NCAA 1DEJA 3PW7A 2JVRA 2E1ZA 4M3XA 3THXA 1YTUA 1O51A 1A5XA 1G1XA 1O1WA 1Q9XA 1XEZA 1TQLA 4ZP9A 2CKWA 4LSLB 2LEBA 1NNDA 4W90B 1XMBA 1HNZJ 2CVIA 3ZETB 4AHVA 3I4PA 4CI6A 1YVUA 2M70A 1YGYA 4DV1F 3MPDA 4A47A 1QY7A 1UZDA 1YDLA 1DURA 4LVNP 3FJ2A 2E5LF 4HCBA 2OEMA 3ILJA 3IR5B 2UUCF 5J2PB 4NZ6A 4DFKA 3TA1A 4URSA 3PFEA 4M5GA 3VF2A 1NU4A 4RUCA 3BF3A 1QVFM 2OANA 2ROEA 3D54A 4E7KA 1CPZA 3LF0A 3M9NB 4CD3A 2VDIA 1HI0P 1E6VB 2VZ9A 5D15A 5KOXA 4FK2A 1T6CA 3CSKA 1BUXA 3U4LA 1VK0A 2ZQBA 1HHQA 4LRCA 2AGPA 3GZ7A 3SFGA 4EAHD 2VFTA 1QAXA 3EKSA 4WCEQ 3CCES 4FXDA 1XUPO 2JH3A 2YCHA 2R2SA 2J9DE 2QTDA 4OI2A 3S8SA 2HS0A 1VRTB 1Q82O 1ZS6A 1TL7A 4U7UK 2D9PA 5K5MA 1TFWA 5ETOA 3TABA 1RDRA 4K5RA 4NLXA 3PX0A 4BRKA 2IJFA 2VCPA 2UUWA 2D7SA 1YJTA 4CK3A 1OQ3A 2P9PB 2OPPB 3GYNA 1ITGA 2E7XA 4OPJA 4PXDA 2CJQA 4O0JA 5D3GB 3AVMA 4OV1A 3GB0A 3T5LA 4ELVA 1FRKA 4FF3A 2ZVIA 4TQRA 4YOTA 1KHVA 1PYOB 3GCXP 4BG8A 4L3QA 3G2XA 4KGZB 1GQEA 3LGHA 3JTNA 3UR0A 3D6TB 7FDRA 2KU7A 1IUJA 3FGVA 5FROA 4X4PA 2RT3A 4I6AA 1HNXJ 1WJ9A 3QT5A 4WYBA 3BO4A 2GS8A 1N32J 2LEPA 4WP9A 1CQMA 2JWNA 5D0RA 2E2PA 1TAUA 2B5JB 4FYYB 2AA4A 1S22A 1Y3KA 3ICLA 5KPZA 3LP2B 1LOUA 1HFEL 1FT8A 2DNRA 4DV6J 3ADAC 1V5VA 1P9YA 4HTUA 2DH8A 2Q3PA 3AVKA 1IO2A 3DRSA 4MAKA 1XN9A 4IWVA 2NUHA 2N4DA 1YITS 2UXBK 4X4OA 2FLNA 2BJ3A 2HNYB 2PFFB 3MUTP 3D2FA 5AT1B 1KD1O 2XZWA 3OW2R 4CZCA 2AT1B 1MNEA 2HPUA 2X1GA 4KH6A 1BA1A 1C0TA 3AHPA 2IC3B 1KVIA 4OLBA 3O08A 1TV6B 5AQJA 4O5BA 4I64A 1JJCB 4H03B 4CEEA 3SUNA 3KWMA 5U47A 1Q5VA 4FLTA 4WYLA 4L75A 2DY1A 4XTTA 1JXVA 5IT9U 3BSNA 4JYAF 1NM1A 2YHYA 2B43A 3G9CA 5JUMA 3ULHA 3WNGA 1LW0B 2D5RA 1KDNA 4PKDB 2YI1A 1S6PA 3GIIA 4LH5A 2ZHBA 4JI6F 4F67A 3DGPA 3H46O 2ASDA 3GSIA 1AUDA 3O4QA 3A5MC 3FUYA 2QL9B 1IKVA 1E6YB 3CYMA 1S6QB 2XMKA 3ZSZA 3M8YA 1AZSA 2YKQA 1N33K 1HR0K 4IRCA 2CGLA 5AE3A 2B4JA 3AJ1A 2XY6A 4DV3F 2LU1A 3NOCA 2FGOA 1CEZA 4WFZA 4H4MB 1HNIA 1CG2A 3CUNA 4KAIA 3UDCA 3RSEA 3TX0A 2ROPA 2UVRA 4NO7A 3FCVA 2DNHA 2JFDA 4DCJB 4IG0A 2PFDA 4IFVB 3VQ7A 4YFUA 4TYBA 5AZIA 1WOOA 1BE4A 3I9V9 5DM7L 1H7XA 2W2PP 2MLYA 1SXLA 3QFUA 4M5DB 2GAHC 4E0DA 4Z0UA 1V4SA 3RMCA 2M52A 2LMIA 2GBZA 1Q1KA 3QRQA 3DCAA 3MM5B 2JJ4D 1VAZA 3DLEA 2V9WA 4C97A 2C28A 2HFSA 4NLDA 4DL3A 2WVFA 3K58A 1HNWF 1RT7B 3AODA 3EXCX 3QZ7A 3VTHA 4NZ0A 3T1HJ 5ETLA 4MLHA 1NDLA 1B92A 2XBPA 3QBXA 1V3SA 3GTYX 2DNGA 1ASVA 3SQ2A 1NOYA 4OX9J 1RT2B 2ZJQQ 2YBVA 2WHOA 1HLUA 4NEYA 2VQEF 2CPHA 4LSZB 2OD4A 1U0HA 1M1KO 4BVOA 3UIQA 1BI4B 1I94K 4MLEA 3OQ2A 4NLBA 4M5LA 3UPFA 4RW6B 5GAHI 3UDLA 4CLUA 2W8KA 1KQFB 1C2PA 5A76A 3EZ5A 2JLFA 1NU0A 3FZFA 1CJVB 2Y0SD 3LDSA 1P1LA 3RVCA 1XMOJ 5D4OA 2EFQA 2YWHA 3HHNB 2YX7A 3TTFA 4PG4A 3M32B 3RAMA 1MA9B 1TKZA 3M7VA 1CSJA 1NDPA 4OGCA 3DDKA 3THWA 3CXCR 4HDGA 4ZCIA 1WD6A 4FL9A 1KQGB 2VQFF 1AFIA 3KD1E 1WBBA 2I8EA 4RW8B 3PW4A 4YOUA 4JYAJ 3ZX0A 4KHQA 2LXIA 3FBCA 2QXFA 2B51A 1N36K 1NDKA 3CJ7A 3NF9A 3CDUA 2ZE2A 1A9NB 1ZPWX 2QRRA 3TUZC 3J7YP 3T6JA 2UU9K 1UVLA 4WFAQ 2AHOB 4H54A 5KT3A 3AO4A 1SBRA 1Y5LB 1S9EA 4RU9A 2FLOA 4FLUA 1KWMA 1VQON 3E9LA 5AQXA 3C46A 3IBCB 4KI6A 3AO2A 3L4QA 3G6YA 3P31A 1HQUA 1KAZA 1NK6A 2O8FA 2E5IA 3MK6A 3I87A 1HMVB 3HK2A 4DR1K 3WHIA 3BF4A 3C66A 5T7LA 1IJJA 1Y0HA 3BBFA 3OYNA 4K50A 3DXKB 4JI4K 2L9DA 3NVMA 2YKPA 2XRIA 1RT6A 4B1WB 4JI0F 3UVJB 3BGOP 4NI2A 4H4KA 2QA4N 1S4EA 4WE1B 5ITHA 1X5SA 1IBMK 1U6BA 3V81B 4OPHA 2AEJA 4ILRA 3UNYA 1WDTA 1SL1A 3MAAB 1JCGA 3U9DA 3KHHA 3IGVA 1J2VA 3ULEA 4RW7B 3R2DJ 1R8BA 2R7WA 2BYCA 3LW5C 2J5AA 5LY3A 2XTJP 4IO9Q 2ALYB 4WFYA 4LJMA 3QYYA 1HBUB 1BA0A 5J2QB 2EC0A 3AVBA 4CJPA 3C95A 5BRHA 2R7SA 4KHRA 3DOKA 2AJ4A 4DUYK 4LVOP 4K8ZA 3LUYA 4UQTA 1HA1A 3HSDA 1K8KB 1S72N 1O5JA 1LWFB 1ZM4A 3MMAB 3RB0A 4DZ6A 1G15A 3A12A 3CCZA 1JXBA 5IT4A 1NMEB 5GMKa 1IBLJ 4LF9F 5E33A 2VQEJ 1HQ2A 4PHTX 3NMAA 4ZPTR 3HVRA 4K2XA 4F3OA 2ZJRL 3SMSA 2RHKA 1KR4A 2NRRA 3IWXA 3G25A 1Q8BA 1F1BB 4CNZA 2IVYA 2GC8A 1DZ5A 3MM7B 2KZZA 3B6OA 1HX1A 4JS4A 3CDAA 2MKYA 3UD4P 2VPYB 4N8OA 4WWSA 1RK8A 4W5RA 1ULRA 3QGHA 2E9ZA 2EXUA 2GCFA 4KH1B 3I8DA 3EZUA 3MEEA 3SQ1A 2KXHA 4JRQA 1ZM9A 1VQSA 3IBWA 1WSHA 3R8EA 1EO1A 1FJ7A 4XH5A 4WIIA 1PYTA 3W2VB 4FYDA 2RD5C 2W7AA 4FCYA 5DZ7A 4DR2J 3GV8B 1XQIA 3J7ZT 5KFIA 1RU1A 2Y9HA 3K17A 4AFFA 7FD1A 5J2NB 3TR8A 1SJQA 1XC3A 2J7WA 2O8DA 4LBHA 5E3RA 3VWSA 2HZAA 4BR4A 2ZOMA 3FZBA 3NXZA 4KQZA 1VMBA 1YJVA 2BJ9A 4DU3A 4M3UA 2B4UA 4Y1CA 2HFVA 3O1WA 5AQTA 2KLAA 2P2CB 3B6BA 1HQEA 5FLXU 1PKUA 5KFUA 2HHHK 2F5GA 4F4AA 5ETMA 1DTTB 4PKHA 4F0HA 5M1PA 3C2PA 1VQ4N 4O0IA 3PZPA 3VGUA 2L9NA 3M6GA 2POKA 1YHQN 1MROA 4B3MF 5AXKA 3O6WA 2EEYA 1FXLA 3MN5A 1WN7A 2QFIA 1SVDA 1VHIA 2KB2A 1OS5A 2OI2A 3DWLA 4ISEA 4B9SA 4ITSA 1FO1A 1YBAA 4BC5A 4QU6A 3I31A 4USTA 1BHLA 4YB5A 4YR3A 1EX4A 3Q22A 2CA9A 4KPCA 3FZHA 5AQKA 3KHLA 3TARA 4X4VA 5IT9Y 5KTQA 2M0GB 1XTZA 3HHLD 3KD5E 5HBMA 2JEGA 3L2UA 3ZZ0A 4NLWA 3K7RA 2YNGB 4A59A 4PG6A 1IKYA 3KLFB 2C1EB 3O3GA 3MTJA 3W7BA 3BN7A 3QJJA 2GUPA 3AA3A 5EX3A 2W9CB 5KFGA 4FWKA 2E44A 1NKEA 3V4IA 1R31A 4LF9J 4C11A 4YY3F 4PYDA 4I67A 1R6VA 2BOAA 4OJ3A 2UUTA 3WNEA 3DOMB 3AD7C 2LDYA 4DN0A 1IVZA 2I5JB 2RMLA 1Q95G 1R3NA 3DDIA 1NGCA 4X4NA 1VQ6N 4KE5A 2K1RB 2QZ8A 1Q8KA 1JLGB 1KLNA 4A8WA 3CJAA 1TKTB 2EK6A 1RZMA 4FWMA 2MZRA 4RU2A 1N8RO 1UVMA 3DRXA 4NA1A 3LO3A 3IFRA 2KT3A 3IUCA 2XYPB 3A8EA 3K57A 5GADI 4RNOA 3A8IA 3EVOA 3AD8C 1XNQK 4Q45A 3TANA 3QIPB 1HNVA 5EOYA 3PM9A 4DL5A 2HEKA 5HATA 4CF9A 3TR5A 5AQGA 2V8HA 3O1BA 3JSMA 3CC2N 4JKEA 1RBUA 2EBEA 1P8GA 2A1SA 1CZAN 4OHVA 4DR5J 1RDWX 4DEZA 2QGFB 4LF5K 3VHQA 1UPPA 1VRUA 3OT9A 2DHHA 2VWJA 5AQPA 1NK5A 1RTIB 4FW2A 1Z6RA 3NKYA 5EX0A 2JWLA 1VSFA 1JWWA 3OFHA 4M63A 1XK8A 3AVLA 3O1LA 3CDEA 3HBTA 1IH7A 5C0YA 1CC7A 3VGSA 3UNGC 3TZXA 4X62J 4WFBQ 4Z4CA 5C2DA 1D1UA 1ZBTA 2WSEC 2XGPA 2IS3A 3PVXA 1RCXB 2DCLA 1FFWB 3TSQA 1RNHA 1FEEA 1VQ8S 1BY9A 2ZH6A 3A3NB 3Q7CA 5H9FJ 1HKBA 3MR6A 3F5TA 1N54B 1GLAG 1EWQA 1HLWA 4CE9A 4NLGA 3KLIA 1EETA 3DYAA 4YR2A 2LLZA 4K0KJ 3M3ZA 4NCBA 1M5HA 5KT4A 4CM2A 1UPMB 2HNDB 2GAGC 4NRTA 3ZCMA 2HBQB 2BANB 2RE2A 2DB1A 3M6UA 4PWUA 6AT1B 2Q3SA 4AHSA 4NXMF 3J81U 2V52B 4H4OB 4Y28C 4RUHA 2ZDOA 4HHJA 1RFQA 3QZ8A 2MKHA 4J90A 4C3MA 3CETA 2Z56B 2QIFA 2DR5A 2CJBA 2VU5A 1U1QA 3D2WA 3QFPA 3FSYA 1M1HA 3LWMA 4HYKA 2YXLA 2GJIA 3IWNC 3D2EA 2G8VA 3TEGA 1HYZA 3CDBA 2VASA 2PBDA 4CLFA 1OO0B 4W5QA 1GK8A 4TXSA 4I2QA 4ELUA 2A2DA 4KGMA 1NK4A 3KK1B 4IUFA 3W2WA 3HKZD 4H5RA 1V5IB 1VQLN 2CJ9A 4CYUB 1OY8A 1RTJB 5F8NA 1HBNB 4DMZA 4GO7X 4JV2A 2XMWA 1L3TA 1S0MA 4OYWA 5CR4A 4UOCA 2P9NA 4DUTA 2GJ2A 3GG4A 4MO4A 4M42A 4FN5A 1E4GT 4DCHA 1FE4A 5K8NA 2ACMA 4OKEA 2UUBF 3A5OC 1XMQJ 3CFOA 2JEFA 4M8LA 3TVYA 1KEKA 2H9ZA 2EK1A 1DGKN 2YPZA 4BE0A 5GAHU 1B4SA 2XMUA 4ZVPB 2E6MA 2F4VK 1HPZB 1VYAA 1RU2A 4ZP6A 2BUPA 3SQ0A 4N47A 1RBTA 1C1CA 5DJBA 2HVEA 1VC5A 2PSZA 3FK4A 5KG7A 1J5OB 4IOAQ 2QYCA 2BTFA 3VA0A 4LF4J 4UZCA 2ZDPA 1BISA 4KO0B 4KKOB 4RO0A 2E7VA 4FJIA 5J1NA 1YBTA 3OLAA 2JEIA 4DTSA 1X0FA 2M7SA 4LF6K 4QIFA 2MKCA 1RYRA 4DCOB 4O8UA 3RB6A 2F7TA 1T9UA 3W62A 4JI8K 3U3GA 2AJ0A 2I38A 2NXNA 2KFYA 5GINA 2AP1A 3OYHA 1FRMA 3VVTA 2OTJS 3MPYA 5H1SV 4DR4F 2P9LB 9ATCB 4I1TA 2AZ3A 2AMCB 3FBEA 4LH4A 3DKDA 5IXUA 3CTRA 4WQ5A 3MMVA 2MYFA 1JIHA 2MGZB 2JEJA 5BR8F 2LQBA 3KIOA 3IM8A 1GAOA 2O8EA 5DLGA 1Z4UA 4J9RA 3SNNA 1G7CB 5HL7L 1IBCB 1DRZA 4B9LA 1RHMB 3NLCA 4CF2A 1PJ6A 4IEEA 2OA8A 3AAWB 4DLGA 2P9KB 2ZJPQ 4USJC 4GV9A 3CB4A 3CJRA 1F21A 4E1MA 1V9OA 3O9TA 4A62A 5FLXY 1S1XA 1M90O 4IDHA 4GKKK 3KK2B 4MFBB 3O9UA 3RU0A 4FNHA 4DQPA 4RR5A 4B3SF 3CMEN 2MJUA 2KJVA 3BO3A 2F8MA 2V94A 4LSLA 3GG0A 1MWMA 4IXCA 3ET6B 2GVZB 2A10A 4FF1A 3P3DA 3HKWA 2R7XA 1HIYA 5HRNA 3ZETA 4DG1A 5FPMA 5EHHA 3TI0A 3A8KA 5EX5A 1HYVA 3H1VX 2MB0B 1I1GA 3MEGB 1F9HA 2DNYA 2CNKB 5J2PA 1L3SA 3TUJC 2BUNA 3B8HA 1NZ8A 3CJ9A 2XM3A 3U1MA 1U1LA 4LFAF 1Z2ZA 1GXTA 2G0CA 5HO4A 4K25A 2YJEA 1O13A 3VMFB 2HQ3A 5KFDA 4UY8O 1WB9A 4J2AA 5CZ1A 1RDUA 2RDJA 2RILA 4P72A 1E6VA 4RZRA 1B70B 5AFUA 4BR7A 3SDEB 3PIOQ 3HULA 2R3VA 1C4AA 4ZITA 4KRFA 2YNIB 3D6FB 2FQQB 5H1SQ 4DV0K 4ECRA 3V1QA 2SXLA 1K9MT 2CQBA 3JXOA 1T44A 2GV9A 1VRTA 1N5YB 1U09A 2CPIA 3IXQA 5THWA 2QO3A 3HI9A 2NCKL 3THTA 4CHYA 2NXCA 2E9RX 3KYLA 1S0OA 2HFZA 1TK0A 1I6JA 5DQIA 3WXJA 1NLKL 3BN4A 4FKXA 2UV8A 4OJRA 3OL9A 2FGCA 2P9PA 3NGYA 2OPPA 3O9RA 1HI1A 2I1RA 2KFNA 1GLJO 3M2UB 4NLSA 4KIAA 2OPRB 4WBFA 1PC4A 2H1YA 1ZBLA 1B64A 1NSAA 2OHDA 4UZBA 2CJAA 3Q8PB 4NLPA 3OTCA 2NQPA 1ASUA 1NSQA 1NJIT 2VFVA 1R0BG 4MH8A 4ALZA 5A2QO 2HG4A 4AHCA 3H20A 4BQLA 2XG8A 2MQQA 1RT3B 2E20A 4H4KC 2HRYA 5KFHA 4PAAA 4CGJA 3L2VA 4M3TA 4PEOA 2U1AA 3CCVN 4TN2A 4P7TA 1SUQB 4B1ZA 3LP2A 3OTEA 4EWTA 4ZMMA 2J4RA 3OTOF 1FFGB 3LH2S 2QT7A 3IR6B 2O8BB 4FZXC 1FDDA 1X0PA 1P1TA 2NRVA 3NFAA 3CEDA 1WNEA 4Z4HA 2HNYA 4ZVGA 1XR5A 5L1IA 4FO0A 2P6SA 4B9TA 4ZKAA 2VD3A 1YSJA 3N6LA 2Z4PA 2GJFA 4USMA 4GVLA 4PRFA 3AA5X 1DQ8A 4CGHA 4CVNE 2E1MC 3B8AX 2BXJA 2IC3A 2W40A 2HGLA 2AGOA 1TV6A 4OI0A 3HDSA 4LF8K 1FJGJ 5D4PA 4ER8A 3VGVA 4WU3A 4DF8A 4K4TA 2HF4A 2XMJA 4ANEA 5L8RC 4YOYA 3G6ES 4ZIWA 3T9ZA 2L41A 2RSQA 5F1XA 2PYJA 2VB6A 3ILLA 1S5ZA 2FVQA 4FJKA 1Y5IB 2LYVA 3C14B 1FDNA 3CCMS 1AUSL 4CFCA 1REGX 3QGIA 3EE8A 2Z1IA 3EXYA 3UKUB 1N32K 4GMKA 3TEHB 5LJVA 3V1OA 2FBYA 4K4VA 4J9MA 3BR8A 1LW0A 2V8DA 3T1AA 5GADU 5FJ4A 2HURA 5FPNA 2MLXA 4IH7A 4DV6K 4K4UA 1VQPS 1NKBA 5LT5A 4F4ZA 4ID8A 4KBIA 4Y00A 1QS4A 4OPAA 2ZKTA 1NGDA 3B6PA 1S6QA 1NM2A 1ZZNA 1T8EA 3DLKB 1VR6A 2KVQE 3F41A 2B6AB 4RUBA 2QLJB 2UUCK 5LMUF 3QO9A 3U3YA 4CZEA 3FR0A 5AQQA 3D9BA 4DV7F 1W7AA 3WIUA 3M9OB 2V67A 4H4MA 1N5SA 1T6DA 2N7YA 4Y2MA 3DXMB 3SPYA 2J8AA 2YWWA 5HMWA 1J5EJ 5AQRA 3QRRA 2MLZA 3IA0A 3PJ9A 1BCMA 1A5VA 3JYTB 2WZ1A 3B4MA 4JKBA 4WPAA 3VA3A 1QZ6A 3FBFA 3HHDA 4OZ1A 1F5BA 1EHWA 2OH2A 2DGVA 2DEIA 1XR7A 2RDIA 1H0HB 4M5DA 3O4NA 5BYQA 5B09A 2Z1JA 1DBDA 1XNRF 3CJ0A 3TWHA 2RDDA 3HSGA 2WTUA 2P51A 3NCPA 4CZIA 2WONA 3EPGA 3V4MA 4ZLJA 4M94A 2BRLA 1RDAA 3QSYB 2J0XA 2ZH4A 3OTOJ 4M5IA 1QAJA 1BGXT 1JLCB 3OJUA 2MZ1A 3P5JA 1RT2A 3H4DA 3LZJA 4HH0A 2XYHB 1IKWB 4RG8A 2NSBA 1RLCL 4KTQA 1BI4A 1D9AA 2DO4A 3NAEA 4H0XB 1TUWA 4Q2MA 1BWFO 2ZGZA 3NY0A 4RWTA 3GPAA 1K73O 4WK3A 1S9GA 4MDBA 1H98A 1V3RA 1CJVA 5LL6Z 2R7RA 1X3MA 3M32A 2CQDA 1Q16B 3I0SB 2V63A 1W2IA 4CT9A 5CE3A 5AXLA 4C48A 1UEKA 2XC9A 3CCUN 4A8MP 3IAYA 2Q43A 4KPYA 3VQBA 1CJKB 3U6FA 4B17A 4LD0A 4JUZA 4GC7A 3OYIA 3MCAB 2PI4A 3ILOA 1RHJB 2RRNA 4ZVHA 1YKWA 4GVMA 3RRKA 1F60B 3C8YA 2DNMA 4K5SA 4NLCA 4ZN3A 2KYXA 1SC4B 3BPSP 3UDVA 4EHTA 1T3OA 2CGKA 1PILA 4OX9K 4Z37A 3A1YG 5HMYA 3RW7A 5CZXA 5HMZA 3M6VA 2MHEA 3FGUA 4B08A 3RR8A 2HOEA 4QS9A 5EUHA 1HMVA 4DV5F 1N5QA 1HBMB 3UD3P 4PCQA 2EWSA 3AJDA 4BRMA 3PKMA 2HBZB 4AD6A 3LTOA 2MKIA 2W6LA 1XMOK 4HCCA 4IOXA 3DXKA 5HK4A 4OZ0A 4K42A 3Q8SB 4OZ2A 3UVJA 3LGNA 2YHWA 4JEPA 1D9FA 2XNRA 2I9SA 4O3RA 3M1VA 4HTJA 4BBYA 4AUKA 3V81A 4ILLA 3M8PB 1N48A 4M63C 3QGGA 4JYAK 1Y10A 3D0PA 1FX4A 4WK1A 5EN1A 3MAAA 2GELA 4JNEA 4RW7A 1GMUA 2D3O1 4IFYA 4EEYA 3G0ZA 2DNNA 3Q8VA 4MIBA 5E3AA 2RVJA 5J2QA 5HVHA 3VQTA 1QUPA 2H4YB 1OJ4A 2FVRA 2FSNA 1WG4A 5KQDA 3NWGA 3RUBL 4Q5VA 1OIAA 1K8KA 2CG4A 3FCWA 2ZOGA 3FQLA 1KC8O 3X3UA 2ZBPA 1LWFA 4NOHA 4CLSA 3BBBA 1NLVA 3CPEA 2RAQA 3VQ8A 1JMTA 4G1IA 2Y8YA 3LAKA 3LDLA 3AT1B 2ILYA 3IKMA 4JD2B 5F2RA 1Q7LB 1TFYA 2UXDF 3MMBB 1HYSB 3W3SA 2RRBA 2IFXA 3MM7A 3ISZA 4CJLA 4GW6A 3M2VB 4D3GA 2MQLA 1FRLA 4DX5A 4FF4A 3RWUA 2JLGA 2E8AA 2XULA 5CYMB 2VFRA 4TY9A 3MHYA 3RAQA 2IBKA 2A6AA 4EP5A 4NEZA 4BC7A 4O55A 6FD1A 4KFBB 3OD2A 2CPZA 4IOCQ 3D68A 1RHRB 4DTXA 1VK8A 4CFDA 1X5PA 4ED0A 1ZOTA 1TL7B 3G71N 2W9AA 4ZPBA 3W2VA 4PXEA 4X66F 1HNWK 3A0IX 2B7BB 4ELTA 2AX0A 4F3MA 1Y97A 2YJFA 3CIPA 1RWNB 1YTAA 1T9XA 1RDBA 5RUBA 2VQEK 5E7OB 2C3OA 4CK1A 4QWAA 1SPBP 4K4XA 2BE9B 2OSRA 4CO3A 3IRXB 3FFKB 1DKGD 2RB7A 4F50A 1SJ4P 3VQQA 4ZK7M 4E19A 1X4AA 3R27A 4W5OA 4BCAA 1PBAA 2MPUA 4BR2A 3OUYB 4Y2IA 1U0SA 1S9FA 4U7BA 1DTTA 3AQPA 3NEKA 2FVSA 5FPEA 4A8OA 1CXUA 4I68A 3PEJA 4ATNA 1T9VA 2D41A 1ZXOA 2HFOA 4C8ZA 3UD5A 2PA3A 3OSNA 5HJXA 1RGIA 2HNZA 4DTNA 2QWRA 2P9GA 1FE0A 1VJQA 5AFUH 3PTWA 3CD6N 1WUAA 2AIRB 1TYQB 1DT9A 3BKFA 3PW0A 5CCLA 3D2FB 4CLWA 2YNGA 1HBOB 1U25A 1WKKA 4C0HA 5E3QA 3FNNA 1RWMB 2A3JA 3FEZA 5GMDA 2GNKA 4E8UA 5FRMA 5M1OA 3D1HA 2W9CA 1B3TA 1ZPVA 4C8MA 5M2PA 5I3PA 3UI3A 3HM9A 1B7YB 2KHCA 3A8YA 1TVRA 3MPVA 1RWPB 2DY4A 4P74A 3RZAA 3R5GA 1DLOA 4UQGA 5GIOA 1WKJA 2BM1A 4NASA 2NNWA 4F04B 1OH7A 2YQ3A 1EARA 4WQ5C 2NREA 3K8VA 2K1RA 2KQ2A 2CZVC 2KG0A 1WC0A 3QEVA 1MLAA 1TKTA 5IOLA 4KHSA 5BPLA 5LMNJ 3GFYA 1TMJA 1Q4RA 5KFFA 4ZVTB 1LWXA 5KAKA 1S6OA 2V6AA 1VDHA 2XWXA 1LOTB 1S6PB 3RMAA 2BE2B 3OYBA 4L8RB 3WIVA 3O8WA 2ZBRA 2FJVA 1TTHB 2KRRA 5D0HA 4KB7A 3CJ3A 2AYBA 3W65A 4RW4A 1AZSB 2CZ9A 4QIGA 3A5LC 3GONA 4HACB 4YHHF 3PO4A 3BM7A 2Q31A 2IRUA 1LV5A 4JKDA 4HHUA 4IKFA 1VQYA 5F3ZA 3KHYA 4H0PA 3N6NA 1N0VC 2PI5A 2R7TA 2EFGA 3QJPA 2YHBA 1W9HA 2DHXA 1HNIB 4CNYA 5D0EA 4HVZA 4TU9A 4LF9K 3I6PA 1EKSA 4AXJA 4ISGA 2G4BA 3PSIA 1REVB 2AZ1A 1NPKA 1RTIA 4QR2A 5HN0A 3J7YI 3ZT2A 1CC8A 2RQMA 1VQOS 1APSA 2C2NA 4IRKA 5IZHA 3OR2B 1CLFA 1QAYA 2O01C 4KR0B 3GWCA 4DV4F 2OZMA 2K3KA 3BH7B 4NA3A 2D0PA 5GAGP 3PIPQ 4O3SA 3AB2B 2A2CA 4J9NA 3AVCA 4GRSA 3IO1A 2CQPA 2G2ZA 2EI5A 4BC2A 2WVCA 3OVAA 3M30B 1NDCA 4EMDA 1BDGA 3J80Y 2NZ4A 1UKUA 1VQNN 2KKZA 3T6BA 3P5BP 3EPIA 2QA4S 3MN7A 5I42B 3VZHA 1JCFA 4CO4A 1JJ4A 3L3CA 1FF2A 5AQZA 5AXMA 2O67A 1Q79A 2Z8QA 5F8GA 1BQXA 3Q8QB 2X6SA 2OYQA 4F25A 5DM6Q 2GGPB 3MDFA 2Y1JA 3IN5A 1ZBHA 1EP4A 2NZCA 4XPCA 4ED2A 3L8BA 4ZA1A 2W2NP 3R5BA 1RSCA 1BQNB 1IQZA 4H4OA 1IBKJ 3THWB 3AVFA 4WFAL 2GIQA 1S72S 1UOCA 2ZUGA 3W0LA 2BZ2A 2CJYB 3WX4A 3CO9A 4P10A 4ZVUB 5F0WA 4PXBA 4J9QA 1SKWA 3PACA 2RRAA 5K14B 4OLOA 2ZE2B 1WKLA 4OV6A 1FK9A 4XEIA 3K5MA 3Q0AA 1F2GA 1R8HA 4FOIA 5H9FK 1VI7A 4DUZF 4ZPDA 1SH2A 1L5UA 3AV9A 4KHNA 3TQ1A 4K0KK 3RJMB 1M5PC 3GE9A 1RTJA 1BWVA 4JV5F 4A61A 1GT8A 1HBNA 3ZNJ1 4OX7A 4YHHJ 3ZSQA 1TL1A 4DL7A 3ZLJA 4CCHA 1BD6A 1C6VA 3H2LA 4I69A 5GVQA 3SI8A 3CCJN 3QBCA 1RT4A 5ETQA 1FNMA 1QUVA 3SCJE 3M6WA 3C6AA 5DS7A 3SYZA 2EX3A 3ITHB 3PYFA 4MIWA 5E3CA 1WTBA 3KLHB 3V6JA 3BR9A 4RL1A 4IO9L 1H2VZ 3K5LA 2G1DA 3BBCA 4WFNQ 4MKAA 4JKCA 1R43A 5JS2A 1HPZA 1JLFA 1Z2LA 3I82A 4N8NA 4DV4J 4DR3F 4WYWA 2CWXA 1J5OA 3T41A 3OYKA 4DR7F 3R9LA 2OEJA 5ETPA 4KRWA 2GIFA 4C6AA 4KKOA 3W63A 2M4MA 4CECA 3PDNA 2V4QA 4AHRA 2JWKA 3DOKB 3EVWA 4LREA 4U67L 1YK9A 3JQJA 2D1CA 2JNJA 3CJQA 1WF2A 4YDXA 4A8KA 3CG7A 1YHQS 8AT1B 2ERRA 4L74A 3MCSA 4K4SA 4NXNF 1NCLA 2HHUA 1A6LA 4K2JA 3I4HX 2CQ0A 2WBMA 1Q7YT 2B8PA 4P71A 3ZZYA 4ZLLA 4IR9A 2P9LA 1X9SA 2VG7B 1H6KX 1XMQK 3SJJA 4B3RF 1Q8IA 2MGZA 2NR0A 4WQ4C 3K5PA 4YORA 2CQHA 4USKA 2P9CA 3AA4A 5F8IA 3AO3A 2OFHX 3K89A 2D0AA 1IR0A 5LXYA 4IEIA 2O1PA 4QIWD 4C1NI 4OYXA 5C2CA 1JLQB 2Q6CA 3JXUA 2D9OA 5KGWA 4QW8A 5T14A 5HLFB 4B1VA 4LFCF 4DQRA 3H0PA 3PCOB 4FJ7A 4LF4K 2P9KA 4O3PA 5AQSA 1GLCG 2QV6A 2EVZA 3V9ZA 4ILMA 2YQ1A 1DQ9A 4DPOA 1B0PA 1VQ6S 3UQSA 2F8EX 3ZZTA 3SMZA 1KLMB 5A0YB 1YJ7A 4A8YA 4O5FA 3KK2A 1HI8A 4NLUA 2VIHA 2HGMA 2GWJA 4JV5J 4R0EA 3LP0B 3ET6A 4JK9A 2GVZA 1JLEB 4FPRA 2IDOA 1AXQA 2QXLA 3KJVB 3THYB 5AQYA 1Q53A 2V2QA 2FHOB 3C6UA 1M5VC 3CJBA 4AL5A 4RJVA 4FZYA 1O6XA 2DGTA 1HQEB 2HSTA 3CC2S 1WSFA 2AW0A 4OI4A 4CK2A 3QEIA 1WF0A 1UWBB 1U8SA 3MMJA 4A8QA 5KFKA 5C42A 1T3NA 5AR0A 1MROB 4ED1A 3PG9A 2ZKUA 3W9JA 2QMUB 2VODA 3MWTA 4BR5A 4F4WA 2GX9A 3D4JA 1QD1A 1K8AT 4U96A 2YKAA 2OP5A 4XH1A 1LWCA 3R8YA 4B3TF 4BRGA 4OLPA 4O3NA 2V9KA 1R7IA 4NMLA 1QQNA 1JLAB 2HBYB 2XCPA 2YY3A 1VRQC 4KBOA 1GXLA 4GKJF 4P73A 2P5VA 3AD9C 4DSFA 2FHMA 4C8NA 1KBRA 4JI3F 5AQNA 4CF1A 5JLHA 3IGNA 2UV8G 3ZTRA 4C11B 2BRKA 1RT5B 1WBDA 3B54A 3G87A 4ES1A 3OYFA 4JV1A 1TZ0A 2ZM6F 3AXMA 4Y3CA 2C2RA 4IO1A 4KJIA 4P52A 2JOQA 2YV0X 3M2UA 3CQXA 2OPRA 4IYQA 2QFJA 2E88A 2P9SB 3EE9A 4NYNA 4ZCKA 2KM8B 2R8KA 2K8GA 3OFGA 1NB7A 4DTOA 1ZM3A 3SJHA 1RWVB 2VGNA 3NDKA 1BC6A 3NG8A 2CNNB 4Q7AA 4HHHA 4H0YB 3VQ9A 3FLCO 2RKIB 1VBKA 1VK3A 3MFHA 3JSMB 1Q86T 2FC8A 5BJRA 1SUQA 1GTHA 1NUEA 2DISA 1IV0A 1GLLO 2JDJA 3IS9B 3IR7B 4KH5A 2G13A 4ED7A 4IDKB 1RAAB 3HFVA 4MK9A 1NSKL 5BN8A 1HWUA 4WFBL 2ZNYA 3MMCB 1RWXB 2FSKA 1RHQB 3WXMB 4J37A 4YOWA 3JAMO 1VQLS 4EP4A 3IG1B 1QVGM 4OKKA 3HPOA 2HHWA 4HEA9 4F0MA 3OS0A 2K7KA 3F9KA 4P2FA 1G2EA 2DGWA 1DHMA 1U02A 5GAEP 4CW7B 3NS7B 1JK9B 3MZIA 4YR0A 1RBSA 2DHSA 5B8HA 5ETTA 3G96A 1NMDA 1U49A 1F9EB 1SC1B 1D09B 1ZA1B 3C14A 2ZWHA 1S0VA 3HHLB 3SAGA 4RX6A 4OYBA 2BKPA 2QC3A 2QSFA 3UKUA 4LRBA 1CXQA 1IM6A 3MWPA 4A5AA 2Z2YB 4CLYA 3MPUB 2V8GA 4B9VA 3P4UB 2ZEJA 3PEHA 1LK5A 2DD8S 4H5TA 1QSLA 4U95A 4TY8B 4G1PA 4DTJA 4DKWA 3RB3A 2GQCA 1BL3A 1NSPA 4NLRA 4C4WA 4GVEA 4R25A 4KY3A 4FKYA 5L1LA 4DBQA 2CPXA 5DLFA 3CVKA 2ZGYA 2UP1A 2HKEA 1YI2S 4F0KA 3TA0A 5I9EB 4RWWA 1FJGK 4F4YA 3J7YU 2X1BA 4USVA 4JI5J 4B9UA 1UJ4A 2VPZB 3DXMA 2IIRA 3EDQB 1U1KA 2XHWA 1SJRA 3HTVA 2RE1A 1YVFA 5DM7Q 3P6YC 5KFVA 2DBBA 1L3UA 1CQNA 3JYTA 1YRUA 4M5JA 4ENOA 2ZUAA 3OBWA 4IKAA 1J54A 1N34J 1NXIA 4RLEA 2OJ3A 4USUA 1IKXA 5AJ3F 3LAMA 4CIGA 2Q79A 4ID5B 4PPDA 1XC9A 2IJNA 2EC2A 4CH1A 3ENQA 1HWLA 5H9EJ 2K7JA 4CEQA 2W4CA 3HRGA 3VQEA 2MKKA 2PDAA 1S49A 2Q36A 4CH0S 5HQ8A 3Q8RB 4FZZA 2AKWB 5KPRA 2CVEA 3GG1A 4X4RA 4GV6A 3MEDA 1JLCA 2Y8WA 1R27B 2QEXN 5KG4A 1K6YA 3W64A 2ASPA 4I56A 3DOLB 3CMES 1FWKA 2WW8A 1RAHB 1IKWA 3L7OA 4JV0A 2D74B 2N4CA 5ADXA 4TLQA 1RDCA 1C1CB 4F36A 3CD7A 1UP1A 1FVQA 4KHPF 5KG6A 2BJ1A 3SMPA 3BGLA 3GIMA 1VQ7N 2FVPA 3BYRA 3I0SA 2YWEA 3L95X 1IN0A 2F63A 3TJ8A 1QJHA 1A0OB 3P49B 4GKKJ 2MY7A 3TZWA 5KQ8A 3R3LA 4WIQA 1CJKA 2BACA 4Q0BA 4MT1A 4BACA 5KFXA 3RBDA 1FKAF 3ZSVA 4J7CA 3VQCA 1VSIA 2YNFB 1KD1T 3EYZA 1RTHB 3P96A 4QWBA 4BY9C 2QWPA 1MG7A 2NS1B 4BDPA 1OY6A 2PAVA 1HRHA 2WOMA 2BVZA 3VAFA 3AQOA 3OTOK 5AQIA 5KRTA 3MR7A 1VJWA 3OFEA 1VISA 4H0VB 4HR2A 5D6GA 3Q8UA 3C65A 1RE1B 2VBZA 2KO1A 4MQ3A 1QM9A 4C8LA 3CM6A 8ATCB 1HKAA 1A7GE 1EQ0A 1GH8A 3VGMA 2W01A 1M5KC 3OS1A 1FW6A 2W4DA 4BE1A 3C15A 3V6DB 3E3XA 1F6TA 2M9KA 4IZ9A 3Q89A 5HP1B 4V19J 5AQLA 4BR0A 2FJEB 4CIFA 5IWAJ 3VOVA 3QNNA 1HR0F 4CHPA 5JS1A 3IMQJ 2ASLA 3FZ2A 1KAYA 3TVKA 3KUGA 4CBXA 2XMMA 3N28A 3DRRB 1NZAA 2K3IA 5F0UA 3M8PA 2A40A 4OL8A 1FKOA 3G8SA 4J9SA 1LFPA 5JVHQ 5AJ3J 3SPZA 2F7VA 1KRPA 4JI1F 1NGFA 4DV0J 2E4LA 3VQPA 4M3ZA 1KAXA 4NE9C 5I3UB 5EWFA 4J9UE 4IQXA 1QQCA 5HOOA 3VGTA 1FXDA 2LCWA 4ZTJA 2CQIA 4DR6J 3AVHA 3CCSN 3JSBA 2DCUB 4DG1B 4BVPA 1SKRA 4W98A 2MY8A 4AHUA 1WSRA 1ZAWA 3KLEB 1UFKA 1C0GA 1X4DA 3QDKA 4FOEA 2ZJRQ 4MO5A 4FJ5A 4MKBA 3CCVS 3D0IE 1R6YA 2V5HG 2R7OA 3PIOL 1DARA 2XI3A 3B78A 2MTLA 5T41A 2CZ4A 2B8QA 3ZT3A 4JD2A 3AOAA 3I96A 2L08A 2LXFA 1IJEB 1SH0A 2KVIA 3MMBA 1HYSA 2QL7B 2V2ZA 3FKBA 4KHPJ 4FLVA 2AJ2A 4CDIA 1AFJA 3E2EA 3M2VA 2K2PA 3L9ZA 1E3MA 1Q0NA 4MKVA 4AQYF 1BG3A 4OYMA 5CYMA 3V6KA 3DU5A 1I94F 4CD1A 3KLVA 1RA7A 4KFBA 2VGMA 3N4PA 4PYAA 5KFCA 5FDLB 2BDPA 1M1KT 1FJEB 4R0JA 4F02A 3CFPA 3SI6A 5KFOA 3MCNA 3I9ZA 4RWXA 4JRPA 1LK7A 1EJ7L 3P45B 3WNHA 1RBLA 2E2QA 3KK3B 4X64F 4RNHA 4ILHA 2HVZA 1VCTA 5A8KB 1RB0A 3GYGA 3SUQA 4LSNB 3TOQA 4ED6A 2GX8A 2CWKA 1N36F 2V50A 4DTMA 3MPWA 4OHXA 4OPKA 1JLBB 3SK3A 3HSTB 1P6TA 3EGWB 1EWRA 4LF8J 1YJ9N 3H5SA 5A8WA 3O3LA 1RISA 3IRXA 2QG9B 2Z0GA 2AJ1A 3NH1A 2O8CB 1FWPA 1D8YA 1H73A 2FTRA 2LEAA 4CZLA 3ZNUA 2W7OA 1ROFA 5BRDA 3ZC4A 4OZLA 4QIEA 3OUYA 4RNMA 4BRPA 3B4DA 3ENAA 3W5XA 2V51B 1GLFO 5GMEA 4K43A 3MM9B 1Z26A 4CWBA 3VEZA 1RAJA 4YDUC 2JGUA 4FZVA 4DR1F 3H5YA 5AE2A 1FKPB 2ALZA 4OZ3A 3OYCA 2DNQA 2KTQA 4JI1J 1Q18A 3DM2B 3ONQA 2YHAA 4JBCA 3UN3A 3BJYA 1RAGB 2UVVA 4UOGA 1WHYA 3KKFA 3KOAA 1LW2A 1NB2A 3QWPA 3MX2A 4WFXA 3H1QA 3M05A 4DV1J 2GEMA 3S7RA 1TYQA 1UVKA 3CJ2A 3OHRA 3OYMA 1FCAA 4FYVB 1HBOA 4ED5A 3M8WA 2E5LJ 1JNZB 1S48A 2UUCJ 1KFSA 1VSEA 4YOXA 1B99A 4BRFA 3US5A 4QBUA 3MOZA 3OVNA 2OUGA 2J76E 2HAFA 4UOFA 4QR0A 3NAIA 4BRAA 2ZH3A 3NCQA 2W25A 4BGAA 3K0SA 1SCJB 4DUYF 3IM9A 4HDHA 2NPFA 1WNSA 4O4RA 4LIRA 3QMLA 4PKGA 2EFNA 5AQUA 4AQYJ 3NH2A 4ZPAA 1FRXA 3SBGA 3CERA 2YX1A 3QT8A 4B1XB 4YDDB 2UVUA 2BE2A 2DTUA 4R5PB 3VGKA 3RGIA 1S1TB 2WUSA 1VQMN 4DS4A 3U7JA 2B9EA 2W42A 3GFXA 4HACA 2M2BA 5FD1A 3H3OB 1Y5NB 1SC3B 3H8YA 4BC9A 3CCUS 2IVOA 3OYAA 2FBTA 4ZOSA 3EKUA 3BEXA 1U47A 3TAGA 3QO9B 4A8SA 4FWOA 3NF8A 1XI1A 2EWHA 4E1JA 3OPKA 1YWXA 4FJHA 3EE3A 5F8HA 3AY9A 5LSLA 1REVA 5C24B 5LJ3Y 1T9YA 5IC6B 1OVYA 1D9DA 1AROP 2OSQA 3QAEA 3UCZP 2F96A 3WZ0A 4DU8A 3MECB 3EWGA 2HBJA 2LQ9A 3OR2A 3FSIA 5LM7E 5KFYA 1T02A 4NLVA 1NG9A 4A8XA 5HMXA 1WC1A 2OPQB 5LMNK 2H5IB 2VDHA 4PZVA 1Y9OA 2OTLN 4C1NK 5ETNA 2WBNA 3EMTA 4PUOA 3K8WA 2WONB 3M30A 3MX5A 3CDWA 4Q8EA 1UAWA 3RB4A 1KS2A 3GL1A 1KVJA 1RT1B 3TYTA 2HHHF 3ENOA 1JJHA 1H2TZ 5I42A 2C2ZB 3OL8A 3ATVA 2XZDB 1CZ9A 4NYZA 3ZTSA 1OSCA 2F1FA 3QEWA 3JSRA 3C3LA 1PJ7A 2E1YA 3DMJA 2DNKA 3W1YC 3HPHA 5DMRA 3TTCA 3LL3A 2GGPA 3BY5A 2FBXA 1S9GB 2VFUA 1PGZA 1OPIA 4FXWA 2NLXA 4ZJOA 4FJLA 3GV5B 4CFAA 1I3AA 5DDQC 3MN9A 2GHPA 2AEFA 3NE6A 1VS3A 1BQNA 2DIUA 2DEJA 4K4WA 3QB0A 5CYQA 2KDOA 2IM0A 5B0EA 1O8BA 3GJSB 3MCPA 3FE1A 4CJUA 2NUUG 5M1NA 4WP8A 3M1FA 2XI2A 2XB2D 4G3IA 1NEEA 3DJCA 3QFHA 3DRPB 5B7WA 3BPDA 5K14A 3M2RB 3CC7N 1WI6A 1SL2A 4CJSA 2EFPA 4RPFA 2BX6A 2DXFA 4DL4A 5ADZA 3DLGA 4JI6J 1VQ8N 2CYYA 4FWPA 5BN9A 3RBXA 3LZIA 3ETOA 1RTDA 3GJTB 3LA0A 1NGIA 3WC0A 1OYEA 1ESVA 1XWLA 3NS6A 2XNQA 4DV3J 2LQ5A 3A3PB 3N79A 3HO1A 3SBMA 2UUAF 3DI6B 1S7IA 3F73A 4OZ5A 1VSJA 1Q5YA 5D4NA 3G71S 1G99A 2X78A 4XH4A 3T69A 4M95A 4ZPWR 1HHSA 2WVEA 4DCPB 1SV5B 3ITHA 2KHOA 2W6KA 2GVDB 4BWMA 1WELA 3LM2A 3KLHA 3D66A 3DHXA 3PY8A 3TRGA 2HQGA 3VGLA 1IBKK 1EKEA 2NXUA 2A5XA 3AVGA 3DLJA 2NPIA 2IY5B 3R5CA 1JXEA 3M1VB 4M3WA 3SSRA 2OD6A 2HK2A 4MK8A 5ADXH 1JX4A 4LF5F 1RCOB 2OAUA 3HZEA 2NXJA 3U1NA 2HQFA 2PMZD 2MQ8A 4YP3A 4IFYB 3WX8A 1KQSM 1HKCA 1SIWB 1NAQA 4FJJA 2QW9A 1HNWJ 3KKSA 3GV7B 2EW9A 2DITA 1UA1A 3RMDA 3GE1A 3T3FA 4YHHK 4M5KA 3VEOA 3M9MB 2C3PA 3ZSRA 3ZSOA 3BGFA 2R2UA 2IOCA 2HS4A 1SIZA 2CQ3A 4ANDA 5GIPA 2MQOA 1UEVA 5C2GA 4NYOA 1EKRA 2N82B 1U45A 5D77A 2VG7A 4CZGA 2MZJA 5CD4A 2EKNA 3LOUA 4MKYA 4CZKA 3CD6S 4G1QB 3GDQA 2FB0A 2BW7A 4OYAA 3EGVA 1RI7A 1OH8A 1X4GA 5HL7Q 2E1CA 2ITGA 4ZCMA 3CMAN 2DFHA 2ATLA 4B9NA 5DETA 2DR6A 3D45A 2VQFJ 3KJFB 4DV4K 2HK3A 1JLQA 2GHWA 1KCFA 1X4CA 1FTRA 2I6WA 1QHTA 4M7YA 3VN5A 5HLFA 3CMQA 3N9UC 3D0HE 4Y1DA 4PQUB 3LGMA 3SXLA 3NCIA 3S6EA 4KB0A 3W61A 1M5SA 3W8PA 4CESA 2P5OA 1ZBIA 1KLMA 1KN6A 5A0YA 2G8HA 1TKXB 5FRNA 2ZD1A 5HRRA 3WXLA 4BRLA 2AJFE 2ZZTA 3LP0A 3VQSA 1JLEA 3J7AN 5JVGL 2FF3B 3L3VA 4FP9A 3KJVA 1D4XA 3THYA 3MAHA 3MAQA 4H5WA 1R8PA 3P8BB 1D5AA 5DRKA 2WK4A 1R0AA 3RAXA 2QL5B 4BROA 4NZ7A 2GHVC 4HKQA 1S4FA 3ZT0A 1BMQB 5KT6A 2VA2A 3K9JA 4JI0J 1ACMB 4IFEA 1LAVA 3RRHA 4GVBB 5EWGA 1UWBA 3L0QA 1RWKB 4DX6A 2DXDA 4DV2F 3M6XA 2CJXB 1WOQA 3SQ4A 4NCGB 4DX8H 2QKKA 2ABYA 4IOBA 4F3TA 2RU3A 3U1LA 4W5NA 5KFTA 4CF8A 2HNZB 2FLPA 4HUEA 4F2SA 1CJUA 2KJWA 2FZKB 4CZMA 2DYAA 1UFWA 1BWEA 4FF2A 2KYZA 2PO4A 2DPNA 1H38A 1B9FA 1RUSA 4WP3A 1U04A 2F4VF 4JI2F 1JLAA 1WC3A 2OPSA 2W24A 3Q24A 4JV5K 2GV1A 1JKHB 1RCHA 3N01A 4O3OA 4DSIA 3TAQA 3G6XA 3O44A 3D3BJ 2GO9A 3KNGA 4IH5A 5GAGI 5KGXA 4DLEA 2B0GA 1P90A 2Z2LA 1XR6A 3H2UB 1VQNS 1RKIA 1TVRB 1RT5A 5HVGA 1ZBUA 1KP6A 1DLOB 1TR0A 5M1QA 3HP6A 4LF6F 3C16B 5A2QU 2WB4A 2G8KA 4PG5A 4JI8F 2XWYA 2CNLB 3Q83A 1Y64A 1Q81O 2AYEA 4C23A 1RTZA 1D8ZA 3POTA 4UT4A 5LSOA 3DHWC 4RUAA 5KPTA 2P9SA 2ACYA 4FJ8A 3ELHA 5HI7A 4DR7K 4I7FA 1OY9A 3UE5A 1QLNA 4RW4B 3CM5A 4CGFA 3GOIA 2YVSA 3N4WA 3R1XA 2P5GA 2RKIA 4PY5A 4J9OA 3LP3A 3ZZPA 4PPZA 4CGIA 4DF4A 2RN2A 5KFZA 1YJWN 1R8CA 3IBFB 1TL5A 4U7CA 3IS9A 3H2VE 4IDKA 3KVGA 2DTJA 3MMCA 1TUUA 4E3SA 2J6SA 2BJEA 4WZQA 5KFNA 4KH4A 4CTAB 3DDNA 5IM0B 3MR3A 5HQLA 2NYHA 3IG1A 3CHWA 5IV3A 3VAGA 2AWZA 1RHUB 4Z7YA 4X2BA 2W2QP 4E7JA 3CCJS 4IG3B 2G0IA 1BU6O 4LUBA 1M90T 3QICA 2RPIA 1N0UA 2X3DA 3AARA 5KRSA 4DV2J 4B3MJ 3AH6A 3DXBA 3AO5A 4LQ9A 4LFCK 5B0DA 3ISND 2X51A 3SLCA 1NGJA 4EZ6A 1ATNA 2AGQA 1S99A 3HHLA 1X9MA 2RQCA 4CEDA 3TAFA 3CIMA 3VF6A 3G8QA 5DDPC 3SV3A 4DU1A 3ENWA 2JSXA 2DRBA 2UXCF 2N7CA 3KHRA 3GR0A 4YOEA 4JI2J 3D67A 3QATA 1WOPA 2DKOB 3N4QA 2VH7A 1X8DA 5CABA 3AVAA 4BDYA 3OYEA 4FS1A 4WKRA 3VF4A 5D8HB 1WWHA 4GY2B 4TNOA 2MDAA 4TY8A 1EP4B 3WDOA 2OLWA 3N0VA 1SQEA 5ETKA 5LJWA 2JX2A 4YY3J 3O3FA 7AT1B 3RYLA 4DX7A 3CJSA 4AXIA 2NXEA 4QIVA 4YMEA 2LQJA 3V5RA 2V4RA 2IYGA 2HHXA 3D1QA 3GU0A 4FPAA 1HW8A 3D28A 2H51B 3FZMA 5E3PA 1HNZF 3C6TA 2IRXA 2ILZA 1BUPA 2KT5A 4OHWA 1FK9B 4RBVA 1QVGR 1Q9YA 2R7QA 3ZTOA 1YBUA 5HROB 2C2OB 4KT0C 5BXIA 3PW5A 3ZT1A 2GFFA 2C2DA 4DQQA 4MYTA 5F8MA 1QE1B 4ID5A 1TL1B 5SZTA 4BDZA 1VSKA 5M2RA 1WHWA 1VBXA 1K0VA 1OMSA 4CLPA 2XS2A 1RT4B 5KFBA 3GFHA 3BF1A 3FFIA 1ZZFA 4JKHA 2EKYA 1NHKL 4I9LA 4URQU 1SH3A 2J6UA 3PRBA 3MM8A 4EUVA 2E5JA 2NUBA 1X5OA 4LF7F 3DOLA 2G9OA 2J0WA 4NMXA 2X7IA 2ZFHA 5SWMA 1I3OB 1KTVA 1JLFB 4DSJA 4CI0B 1T03A 2YWKA 1B0VA 4MTPA 2P9UB 3N6MA 4IO8A 2OMOA 3CJ8A 4JI5K 2N3OA 4OGEA 4EBDA 2OCEA 4HT5A 1WEZA 4W5TA 1RGVA 1RKJA 3NRBA 1U6ZA 2HHPA 5E41A 4WF9L 3VEYA 4A2BA 1NH8A 3UFCX 4BLGA 1NMNA 4JI7F 4EFAC 1Q86O 1N34K 1VQ5N 5HSPA 4OX6A 1RACB 3FRZA 3TJ9A 4E1NA 4UUWA 3CT9A 3CQ8A 1TUYA 2HMIA 3NGZA 5KOWA 1EQMA 1YUWA 4YN3B 3MM6B 4ERDA 3NBPA 3BREA 2WVDA 3B82A 5CXTA 5H9EK 2UXCJ 2YNFA 2RF2A 2IGIA 1HW9A 1RTHA 2V7ZA 3NCRA 4YB7A 3KLGB 1KVCA 2ZZMA 2GW8A 4CZJA 4WTYA 5AE1A 3I55N 2ROGA 3QT6A 1FEHA 4DPWA 3EZOA 3KWIA 1T0TV 3PFOA 5CZVA 2ZBQA 4BRHA 2FIUA 3C7NB 1HNXF 5HQMA 1WSEA 4EU0A 3GJRB 4NXMJ 1N32F 3PYEA 4NYFA 2MXYA 3DN9A 1N5TA 1YRXA 3TNVA 2H54B 2FJDB 3V6DA 3UN2A 4HTLA 4DV6F 3VEVA 3R97A 5HP1A 3CCQN 2ZNZA 3DFEA 3BGRA 1MDUB 2VWBA 2NRWA 3NNHA 2HGNA 1U7LA 3CCLN 1Z1ZA 3UCGA 5M1KA 4MMOA 3AOCA 3DRRA 4O8KA 3PJXA 4CEOA 2Q0RA 4DSLA 3L09A 2AD9A 4TSXA 1KVAA 2YX6A 1OKJA 5I3UA 2C3MA 4CQ1A 1S0NA 2H4WB 3KHGA 2Y3YA 3R5DA 4B1UB 1LFWA 2X1AA 1JL1A 4Z4GA 3QINA 1TL3B 1VSHA 3LPEA 3C6UB 1HD1A 5DK5A 3C94A 2D3UA 4ICLB 2HRTA 3PYDA 3JTOA 4I6MB 3KLEA 1UVIA 3TWZA 2UUBJ 3OSPA 3BZKA 4H5VA 4B9QA 4D3HA 2CJKA 3FEYB 2A6MA 4LF7J 1N6QA 5ETVA 5F9LA 5C42B 2EHGA 3NWRA 4FW1A 2N3LA 3NGKA 6FDRA 3BB5A 3KXDA 4AH9A 3CJ4A 3R6MA 3WUHA 5CD4H 5IWAK 4U8VA 5A2QY 1LWCB 1U4BA 2VV5A 4B8CA 3ZZZA 2ASOA 4JI7J 2ATQA 4YEAA 1JJ2R 1BLUA 3HHEA 2OO4A 3ZEUA 3AA9A 2R4FA 5AJ3K 3UO0A 2VKRA 3T5HA 2C3YA 3QFWA 1NGHA 3SAFA 3NGRA 1NKCA 4XPEA 2MQMA 4DR6K 3QNOA 1SB6A 5FDLA 2ZWPA 3EGNA 4H8KA 4QOTA 2LQ8A 5GAEI 2HVDA 1E4FT 4JK8A 4DR4J 2CDRB 4ILGB 4USWA 2R2TA 1K73T 3M4XA 5HJYA 4ED8A 1FWLA 3KK3A 2DGOA 4LFBF 1S7HA 5A8KA 2JL9A 3CQYA 4LSNA 5L39A 5BR8J 1RBOB 2FBVA 1JLBA 3WT0A 1VLYA 4LT6A 4F7VA 1VC0A 1AT1B 2JHEA