1EP4A

Crystal structure of hiv-1 reverse transcriptase in complex with s-1153
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
536
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the second generation non-nucleoside inhibitor S-1153 to HIV-1 reverse transcriptase involves extensive main chain hydrogen bonding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 126
structure length 522
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ep4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ep4A05
1S1VA 4DL7A 5J2NA 1I6JA 1L3SA 5FRMA 2JEJA 1IKXA 4H4OB 4PQUB 4F2RA 4H4MA 4B9MA 4TYBA 4G3IA 3Q8PB 4Z4FA 3QO9B 3GQCA 5J2MB 3AO3A 2QKKA 1MMLA 5EUHA 3VA0A 1KVCA 1HYSA 4IG3A 4FK0A 1QE1B 3VA3A 2HHXA 3QLHA 2PYJA 4F4KA 1BIZA 2P51A 4IG3B 4BACA 3QNOA 1QE1A 2XY5A 3MF5A 1A5VA 4JUZA 1KSPA 1S9EA 3BSNA 4J9RA 1D8YA 1KLNA 4GC6A 4IG0A 3KHLA 5HBMA 1TAUA 4FK2A 3OYBA 4CJUA 4RW9A 2Y1JA 3HSTB 4FJGA 1RT6B 2VG7A 1LAVA 1HQEB 3DOKA 4OVLA 4CF8A 1C1BA 1N6QB 3AVCA 4IRCA 3DMJA 4NYFA 4CEZA 2OPPA 2D3UA 4K4UA 3QEVA 3DMJB 1CXQA 4KHYA 5F8LA 5KFNA 2IBKA 4WZMA 2WRMA 1LAWA 5L1JA 2WOMB 4BWMA 5F8JA 3PJXA 2JC0A 2V4QA 3LAMA 4TN2A 4KBIA 4K50A 4J2BA 4Q44A 3KLGA 2ITGA 3VQ7A 3KLFA 4G1QB 3TR8A 4RW4B 3KLGB 3OYEA 5KGXA 3PO4A 3ZSYA 3LP1B 5D3GA 4MH8A 4URSA 3M9NB 2AX0A 2FLPA 1BI4B 2BE2A 3ZCMA 4BWJA 5I3UA 1S0NA 1WAFA 2BE2B 5CYMA 1RTIB 4CE9A 1FKOA 5CYMB 1I3AA 2RDJA 4FM1A 5J2NB 3SQ4A 4QWDA 4F50A 3CFRA 1D9DA 2C22A 2UVWA 3MFIA 3AVMA 4CGGA 3H08A 4HKQA 4FLTA 5C5JA 5L1IA 4ZTFA 3NH2A 1JLGA 1C1CB 5HLFA 3OS1A 4CCHA 4DTUA 2BDPA 1RT3A 2GIRA 3QZ7A 4FW1A 4RW8B 2O5DA 3O4NA 1ASVA 4KE5A 1XI1A 4MQ3A 4N56A 2PYLA 4R5PB 3FDSA 3BDPA 5KFVA 4XPEA 3VQ8A 4IRDA 4ECYA 3QEPA 5KFPA 1XR6A 2ATLA 3B6OA 3ISND 2X6NA 4FZXC 3BR9A 4B9VA 3OJUA 3V9WA 2G8FA 1REVB 4X2BA 3EYZA 2IC3A 4FLVA 1WSEA 4RW6B 4DL2A 3G0ZA 1B9DA 3MR5A 3OSNA 3SFGA 2YNIB 4CK1A 1X1PA 3AO1A 1KCFA 2FJXA 4R8UB 1BCMA 4C8MA 1JLAA 4ECWA 3OHAA 4ZP9A 4J9QA 4KHMA 1KTQA 3H4DA 3AVFA 4GC7A 3SI6A 4Z4EA 1RT5A 3MEDA 4ZHRA 3RAXA 2B4JA 3HVTB 3O3HA 2Z1IA 1S1TA 5KFAA 1C1AA 3HJFA 1BHLA 2XCAA 3MEDB 4ZHRB 3DM2A 3JSMA 4HCBA 5EWGA 1S1TB 4H4OA 2ZD1A 1TKXB 2P5OA 3EZUA 4HHTA 3JSMB 5DLGA 1ZETA 4ZPCA 3QO9A 4NCGB 5KG6A 3H5YA 1YVUA 4NLGA 2YNHB 1VK0A 1NOYA 2IAJA 3KK1B 4AHVA 2E6MA 4KHUA 5C25A 3AA4A 3M8QA 5KFKA 5F8HA 2ZE2B 4NRUA 4KHWA 4DSEA 5C25B 3M8QB 3HVAA 3K5MA 4TSXA 2HHVA 3NH1A 3VQCA 4ZMMA 1IKWB 3RR8A 4B3OB 1SL2A 2I5JB 1TK5A 3LP2A 4ZPDA 3L3VA 3VQEA 4E3SA 4FZYA 3LP2B 3BJYA 4AHRA 4Q43A 3IG1A 3IGVA 1GX5A 5KRTA 4J9OA 2OH2A 4XIUA 1RTJB 2IDOA 4BE0A 4KFBB 2IGIA 3CWJA 5KFIA 1NHVA 1S1XB 4Y2AA 4ECXA 4JRQA 1QQCA 1JLFB 3AVJA 4CF0A 4RW8A 1TKZB 4IFVA 1WSHA 5HRPA 2BQUA 4KB7A 2W9AA 4IDKB 3QIDA 4RZRA 1UAXA 1TKZA 4E1MA 3OJSA 3BSOA 4DG1B 1T03A 4IDKA 1BCOA 4EYHB 4U7CA 4FXDA 3SFUA 3H5SA 1RCHA 3DYAB 4LQ3A 4ELTA 4TY8A 4DTOA 3KLFB 4IQXA 3O3GA 3E51A 3C95A 3OYLA 4DQRA 4NLPA 4KAZA 1JLCA 2R2UA 1S4FA 3GIKA 4ELUA 4XO0A 1TP7A 3QETA 1HPZA 1RTDB 3G86A 1JLCB 3Q8QB 4CK2A 3KOAA 1NNDA 2YNFA 4CJVA 1JLEB 4GMJB 1C2PA 1L5UA 1EETA 5DGBA 1NK8A 5DQIA 4TY9A 4Q8FA 4CESA 4KO0A 3NCIA 4J2DA 4E0DA 2HNYA 1S48A 4J9MA 3VQ6A 4I2PA 5KFDA 5CY4A 3LALA 1VSLA 4DSIA 2F8TA 4O44A 3AVHA 3V1RA 2OZSA 1FXXA 5KFEA 2R8GA 4YQWA 4PQUA 4EO6A 3F73A 2IAJB 4Z4HA 3KK1A 3PX0A 3RMDA 4O3NA 3V81B 1IKYB 1RT3B 2P5GA 4DWIA 2ASLA 2WONA 1ASUA 2YKMB 3S9HA 3D5MA 2YNGB 4CF1A 1NJZA 1ZTWA 1TQLA 3AVIA 4EBDA 3SI8A 2YNGA 2OPRB 4FJKA 2KQ2A 4ZP8A 3L2QA 4TYAA 4ID1A 3V1QA 3KD1E 2UVVA 3HPHA 4F3OA 4KRFA 1L3TA 4M3ZA 1XR5A 2YV0X 1QTMA 3PW7A 5I42B 3LPUA 4JV0A 3PV8A 5FROA 3LWLA 2KFZA 3CO9A 4R0EA 4CJQA 3DLKB 4CHQA 3OS0A 5JXSA 3K58A 4KB1A 4ECZA 3TAGA 1MU2A 5KFLA 5KI6A 2ZD1B 3C6UA 1MU2B 4WYLA 5KRSA 3D28A 4K4SA 2XCPA 3I5CA 3I0RA 5KT3A 4LH4A 4M41A 1U45A 3MTKA 3VN5A 3ZSRA 2V0NA 3KLHA 3BQ1A 3S3OA 4CGFA 1HYVA 2KW4A 2ZKUA 3I0RB 3I5BA 2UUWA 4Y34A 3KMQA 3HHKA 4PWDB 3TAEA 5J2QA 4CJSA 4PWDA 2IA6A 3RMCA 2E9RX 1WNEA 4DF4A 1DTQA 5KFXA 5KG0A 5KFMA 5K14B 4DU4A 4FJJA 2RPIA 1N5YB 2CJQA 4H8KA 2FLNA 1NK4A 1QAJA 4C8KA 4RU9A 4MIBA 3HO1A 4K8XA 2X74A 1RT4B 1S9FA 3PX6A 3HKWA 2VG6A 3DRSA 1D1UA 2GV9A 4Q5VA 4LSNA 4Y1DA 4O3QA 2B43A 1DTTA 4CHYA 1RT1A 2FBVA 4OGEA 3DRRA 3RRGA 1RYSA 4CJWA 2WONB 5KFFA 4IH6A 2ALZA 4NLSA 2YKMA 3K5OA 4I7FB 2F8SA 3RB3A 3V9XA 2WHOA 3ZT4A 1VRTA 1B92A 1S5JA 3UDLA 2WB4A 4DG1A 5C42B 1T03B 2DPJA 3QIPB 4BDPA 1XHXA 4AILC 2G8KA 3DRPA 4CEEA 4ZVGA 2E6LA 4Z4CA 4Y2CA 3DLEB 3HL8A 3OSPA 2G8UA 5I42A 1HNVB 1VSKA 1K1QA 5F8GA 3KNAA 1KHVA 4FJHA 3PW2A 4E7JA 1RBTA 4CFBA 1VSIA 3SUPA 4DF8A 1EP4A 2Y1IA 1SV5A 4CECA 4E89A 1FKPB 3K5LA 3H4BA 1S49A 1SV5B 3RB6A 1RT7B 2R7YA 4NLDA 1NKBA 2JC1A 3NH0A 2BANB 3MAQA 1U4BA 3QLHB 4PA1A 1HQUA 3D45A 4Q45A 4YR3A 5HRNA 2IM1A 4MK8A 1VSEA 4NCGA 2W9BA 1L3UA 3GYNA 4J9LA 3PW4A 4Y3CA 2F8EX 3CQ8A 1CSJA 2JEIA 2RN2A 4WE1A 2AGQA 4CEFA 3CG7A 2FVQA 4MK9A 1BISA 3WNFA 3L2VA 2YKNA 4FYDA 1T05A 2R8KA 2B5JA 1NK5A 4OGCA 3SJJA 1UA1A 2I1RA 1L3VA 3VQDA 3NDKA 2B6AB 1C0MA 4K4WA 2BGGA 2FLLA 4E7HA 4QWCA 3KTQA 3SZ2A 2HW3A 3KK3A 1TAQA 4ZTJA 1U49A 1RTHB 1JL2A 1UA0A 3H2LA 1RA7A 2YHBA 4E1NA 4CHNA 1UOCA 1HNIA 2R8IA 5KFBA 2IOCA 4IFYB 4GVMA 3HP6A 3ALYA 3WNHA 4Y1CA 3Q8SB 3PJWA 1SH0A 4NLVA 2QXFA 1TVRB 3MR3A 1KFSA 4CEAA 4W5QA 2AGOA 4GW6A 3GV7B 2Z1HA 5F8NA 3RWUA 1Y97A 2JEFA 1JXEA 3TABA 1QHTA 3H40A 4W5NA 3CM5A 3IS9B 4BDZA 4CEQA 2YNFB 1D9FA 1RDDA 4ZVHA 1JKHA 2BRLA 4ECVA 2KZZA 2C2DA 1NKEA 4EZ6A 4OLBA 3MECA 4ED8A 4N5SA 4ED3A 3DDKA 3M9OB 4CGIA 4DFPA 2IM2A 3AV9A 4CJRA 4XPCA 3HPOA 3PO5A 2VG6B 4W5TA 1HYSB 3OYKA 2VG5A 1YT3A 4CIFA 1TL3A 5KG1A 3T3FA 3ZSOA 1RT1B 2IS3A 3PX4A 2E9ZA 2W9BB 2OA8A 4EBCA 3QESA 2WCXA 4ED6A 1S0MA 1TL3B 2XRIA 4C8LA 4ZP6A 4RUAA 3DRRB 5KTQA 5C24A 4YNQA 5HRRA 1HJRA 3KD5E 1NHUA 4IH5A 1IKYA 1NJWA 1RBUA 4KAIA 3OY9A 5HBMB 3CM6A 1WAJA 2XC9A 4KV8A 2D7SA 1RDAA 1YTUA 5T14A 3NF8A 2R2TA 1ZBIA 3C6TB 4F4ZA 3MR6A 3HXMA 2OPPB 5DGAA 4O4GA 2BQRA 1TK0A 3OYNA 3DRPB 1EX4A 1TL1B 3CIZA 3AO4A 3RR7A 1TV6B 4ED1A 1XR7A 3FSIA 3AVAA 1JLQB 2RKIB 2W8LA 4KREA 2O4GA 2OPQA 1LW0A 1JLQA 2RKIA 3O3FA 3DLGB 3SYZA 2HB5A 3SNNA 4AH9A 4K4XA 5SZTA 5D3GB 3KJVB 4LSLA 1TVRA 3Q8RB 1K6YA 1BI4A 3PR5B 4E7LA 3KJVA 4BE2A 2XY8A 4B3OA 1LV5A 1SL0A 3PR4A 3VQSA 3GIJA 3GV8B 3AVNA 1GOCA 4CEBA 1WNSA 3ZT2A 1S9GB 4YR0A 2PZSA 4N76A 4HUFA 3H5UA 3BREA 3C94A 2BQ3A 3LP0A 4DL3A 4NLRA 4RW9B 2FBYA 4FM2A 2YKNB 2HHTA 1BQNB 4WFZA 4M45A 1N5YA 2W42A 1N6QA 4LD0A 2IJFA 1KFDA 5KT7A 4IR1A 3MFHA 5KFJA 5KT2A 2VG5B 1J9AA 1KVAA 3PZPA 3DRSB 4H54A 3ZT3A 1NK7A 3QYYA 4RNMA 4OKKA 2XWYA 3L8BA 4FLUA 3I5AA 5C24B 2W8KA 4K4VA 3MR2A 1BQMA 1NOZA 4LH5A 1ZTTA 1S0OA 4ID5B 1WN7A 4DS4A 1HPZB 1RTDA 4URGA 3E01B 1QUVA 4AHTA 1TKTB 4RW6A 2R2SA 4KTZA 3T5HA 5HROA 2HNZB 3E01A 5KFWA 4FBTA 4O0IA 3AVKA 4M3YA 4FW2A 3SV3A 4DQSA 4NLUA 1I39A 4K4TA 3V9ZA 4F4XA 1RTIA 2LSNA 1VRUA 1Q8IA 3ASMA 1FKOB 5JS2A 2IM0A 3CFOA 1IKVA 3KHGA 1S1VB 1U09A 3AVLA 3VQPA 1IH7A 3EY1A 3DM2B 2DPIA 5KG2A 3U3YA 4UQGA 2ILZA 3EPGA 1T8EA 5J2MA 4B9TA 3DLGA 5SWMA 3RAQA 4JS5A 3ZSXA 4URQU 2EC0A 4TQSA 3LWMA 3OYDA 4LSLB 1NK9A 4QAGA 3BSAA 2RF2B 2X78A 2HWIA 1RT2A 4FLYA 3QNNA 4ECSA 2RF2A 1RILA 1S6PB 3T5LA 5J2PB 2D0BA 2UUTA 1RT2B 5DMRA 2AQ4A 4PUOA 5CZ1A 1S9GA 2X6SA 1RT6A 2J6SA 4O55A 1HQEA 3NF7A 5KG7A 4ECUA 3NFAA 1C1BB 1D5AA 4QW8A 3RMAA 1S6QA 4DSJA 1B9FA 4CGDA 5DG8A 5EWFA 3HP9A 3I0SB 1S6QB 5DLFA 4CGJA 3DLKA 4KKOB 2C28A 1GOAA 4OL8A 3N6LA 1JLAB 2B6AA 3BGRB 2XY7A 3OLAA 2E9TA 1SUQB 4JLHA 2ASJA 4IKFA 4ZVFA 1SKRA 2DTUA 1DLOB 2OPSA 4FLZA 4E7KA 4B9NA 3KMSA 5KFGA 4TY8B 3OVNA 1HMVA 4ID5A 4Z0UA 4DL6A 1HMVB 3OL6A 3G6VA 2Z1JA 3NAIA 4G1QA 4CJFA 4J9SA 2W9CB 1J54A 3QGGA 1RDCA 3SPZA 3EZ5A 3LPTA 4DSFA 4CFAA 1JLEA 2OZMA 1QSYA 1QAIA 2NUBA 2FJVA 3QEWA 4MKAA 1F21A 1YTAA 2XGPA 3ZSZA 4NZ0A 4IRKA 1HRHA 4FJXA 3M8PB 3AA2A 4M3TA 2V9WA 3O4QA 4IKAA 3UQSA 1WLJA 3IS9A 4H4MB 4O0JA 4ICLB 4Q0BB 4OKJA 3UIQA 3PW0A 4QWAA 1BQNA 2C2EA 4CHPA 2AU0A 4DU3A 3P5JA 4FM0A 3TWHA 4CHZA 3NE6A 2HAIA 1X9SA 4F8RA 4DSLA 1RDBA 4LY7A 2FVSA 3KHRA 3T5JA 3QERA 3DLRA 2DFEA 2PY5A 4IFVB 5DQGA 4Z4GA 3PVXA 1S6PA 5J2PA 4DTNA 4MIAA 2W7OA 1J5OA 1NK0A 1TGOA 2KZMA 3AA3A 3SPYA 3L2RA 4IG0B 3L2WA 2IC3B 4CJLA 1SH2A 2VG7B 1Z26A 4AHSA 2EX3A 2A1SA 3NF9A 2AWZA 4IOBA 5T7BA 1U47A 1D0EA 3SUNA 3MXMA 5EWEA 4KHRA 3BQ0A 1N56A 2QKBA 3M8RA 3TAFA 3DLHA 4RW7A 4ECTA 3FRZA 4ED0A 3TAPA 2R2RA 1ZBHA 3HYFA 3CFPA 1LW2B 2HHWA 1TKXA 4RNOA 1SL1A 1TV6A 4NLQA 4J2AA 3NMAA 3NBPB 3HVTA 4F3TA 1IKXB 3ZSWA 5KFYA 1LW2A 2XI3A 5DQHA 5KFUA 3NBPA 1VSFA 3NGDA 4RW4A 4JS4A 1LWFA 4M94A 4YFUA 3IRXB 2QV6A 2XY6A 1LWFB 3H5XA 2KTQA 5EDWA 5HRSA 2JLEA 1CLQA 3RBDA 4FJ7A 3IRXA 3FFIA 4U6PA 1LWCB 3CJ2A 1NJYA 4WE1B 5I3UB 1IKWA 4QPXA 3QGIA 3AO5A 4C8OA 1LWCA 2B5JB 4DLGA 1C6VA 4F2SA 4DTJA 4PUOB 5HP1B 3QGHA 2D41A 2OPRA 3MXIA 4K4ZA 3DI6A 3QIOA 3RBEA 4M3RA 1ASWA 3PW5A 3HVWA 2GC8A 3D0PA 3UR0A 1TK8A 1VSHA 4KPYA 2FBTA 3V6DA 4ZPBA 3DOKB 1S1XA 1RA6A 5KG5A 2ASDA 5CYQB 3QZ8A 5J1EA 2XGQA 1C1CA 3SQ2A 3V6DB 3CDUA 2DY4A 3OS2A 4B8AB 3MEEA 1CZBA 2UVUA 3CJ0A 3VQ9A 4QOZB 4FCYA 3MEEB 4DTSA 4DQIA 5KT4A 4EZ9A 4WYWA 3AA5X 4FLWA 2JGUA 4M42A 4KHSA 4NRTA 3RTVA 1O1WA 3DYAA 1LWEA 3KLIA 3TAMB 5FDLA 2VWJA 3WNGA 4CF9A 1OS5A 2W9CA 2YNIA 1GX6A 3G6XA 3SUQA 4TQRA 4M3UA 4R8UA 4CEDA 4FJ5A 4FZZA 3N6MA 4CGHA 5J2QB 4IBNA 3TARA 1CXUA 4NLYA 3KK2B 3MECB 4I2PB 4CF2A 4BDYA 2G8WA 3PY8A 1BIUA 3V4IB 3KLVA 3KIOA 2Z1GA 1X9MA 4DL5A 4JV1A 1RT7A 3NL0A 5KFHA 3IAYA 1FK9B 2HWHA 4OJRA 3OYCA 2F96A 4CIEA 2BANA 4Q0BA 1GOBA 4OKEA 5KFQA 4HCCA 4NYNA 4CIGA 2C2RA 1HQUB 3TAQA 2HHQA 4LSNB 3V81A 3HM9A 1DTTB 3RB4A 3VQQA 1SH3A 1JLGB 2FJWA 1RAJA 3T19A 3CYMA 4NLOA 3OL7A 3HK2A 3FFIB 4FJ8A 3V6KA 5DG7A 4HTUA 5KGWA 1VRTB 4O3OA 4O3PA 1J5OB 2AJQA 3S3NA 4RNFA 1Q9XA 2BRKA 5DG9A 1RBRA 4CJKA 2R8JA 1HYZA 3QEXA 2ZQBA 1N4LA 3PUFA 3RB0A 1RTJA 4I9QA 4KFBA 4OPKA 3V6HA 1VSDA 2DFHA 4FVMA 4I9LA 4MK7A 3FQKA 4NLWA 4F4YA 3I0SA 2OPQB 3OYGA 3V6JA 4ZVEA 4NCBA 4B9SA 4CJ3A 4L8RB 5F8MA 4K8ZA 1EP4B 1W0HA 1KRPA 4DQPA 3JYTA 4B9LA 3PHEA 4IR9A 2FVCA 1QS4A 2WOMA 1W9HA 3LANA 4RUCA 1DLOA 4DEZA 4AHUA 4BE1A 4DFMA 3TAMA 4FJNA 4O3SA 5L9XA 4DLEA 4DTRA 3TVKA 4CHOA 2YNHA 2G8IA 4WFYA 3P1GA 3V9SA 3KLHB 2XO7A 4DTMA 1DTQB 3LP1A 1ZBFA 3OL9A 3QEIA 5KG4A 5E41A 4KO0B 2IJNA 1CZ9A 2EHGA 1ITGA 1IG9A 2OYQA 1JLBB 3OYFA 3V4IA 3H98A 5EU7A 3KKSA 3VQBA 5HP1A 4C8NA 4I2QB 2O4IA 2V4RA 1JLBA 3CDWA 4KHQA 2D0AA 2AGPA 3MEGB 5KFZA 3TI0A 5L1KA 2HMIB 2GBZA 5CYQA 1S1WB 3MEGA 4W5RA 3RRHA 4EO8A 5J1EB 1KLMA 2A1RA 3LDSA 3P83D 3K59A 3G6YA 1VSJA 3VQ5A 3KHHA 4KI4A 4DTXA 3M9MB 1A5WA 1NK6A 4FLXA 2D3ZA 3ULDA 4J2EA 4YP3A 2J6TA 1NKCA 4OLAA 1W25A 3OHBA 4NLXA 4KV8B 5KFRA 4EP4A 3NGIA 1UWBB 3KKRA 4KHNA 3NF6A 4FJMA 4W5OA 1RBVA 3SQ1A 4K4YA 1VRUB 3SQ0A 3RMBA 3LP3A 4OPJA 4KSEB 1TL1A 4B8CA 2IMWP 4AHCA 5DK5A 4J9NA 3OYAA 3HVRA 3DLEA 2WK4A 2R8HA 1T3NA 1HNVA 4J9KA 3KK2A 4ECQA 2HVIA 2HNYB 1YVFA 4CFDA 1RBSA 2HHSA 4WXOA 3JYTB 3LZIA 4RW7B 3CJ3A 1RT5B 3OYJA 3U3GA 3ZT0A 1A5XA 4ED7A 3KLEB 3HT3A 3OYHA 4DL4A 2AX1A 5F8IA 2P1JA 4MKBA 3OYMA 4WZQA 4CJ5A 2BR0A 3ITHB 3UPFA 4MFBB 3GIMA 1IO2A 4HUGA 1K1SA 3ITHA 3DLBA 3GIIA 4CERA 1TKDA 4WFXA 2WTFA 1G15A 3ICLA 3LP0B 2KFNA 3K2PA 4CJPA 4DU1A 1RDRA 2XHBA 3DI6B 1SUQA 1J53A 5CZ2A 4Z4IA 4KB0A 2HMIA 3EPIA 3AVBA 1ZBUA 4ZPAA 4O3RA 1XHZA 1RTHA 4ELVA 3MXJA 3A2FA 3I8DA 1EKEA 3F9KA 1U48A 2XI2A 4CJEA 4NCAA 1VSMA 5KFTA 1NJXA 1R0AA 2D5RA 2W7PA 4Q8EA 1U04A 4F4WA 1BQMB 4O4RA 1JLFA 4FK4A 2Q3SA 3CJ4A 5C42A 1BL3A 2FVPA 5JUMA 1UWBA 2JEGA 1WSIA 3C6UB 3S3MA 3OYIA 2HNZA 1WSFA 4YR2A 3SV4A 3TQ1A 4TLRA 3BSCA 3THVA 4FJ9A 1C0TB 4JV2A 1IM4A 2HNDA 4QWBA 2QE5A 1T94A 1S1UA 3M8PA 5FDLB 4HVJA 1C0TA 4QWEA 2ILYA 4ECRA 2HNDB 1XC9A 4ICLA 1JX4A 1XWLA 2YHAA 4M95A 5K14A 1EETB 2G8VA 1FKPA 1RNHA 4I2QA 4DFKA 2HHUA 5HLFB 2CKWA 4HUEA 4N47A 1RT4A 2GUIA 3BQ2A 3B6PA 4FS2A 3NHGA 4O44B 5FRNA 2QK9A 1BGXT 1FK9A 4CFCA 3NGZA 1HARA 4R5PA 1WSJA 3FQLA 3IN5A 3T5KA 4MFBA 4CEOA 5F9NA 1Q9YA 1JL1A 1KVBA 4TXSA 4EP5A 3ZT1A 4O5BA 2RDIA 2G8HA 3CDEA 5KT5A 4B9UA 1REVA 4DSKA 1SKSA 2HVHA 4EEYA 3G10A 5KG3A 3ZSQA 2FBXA 4HYKA 4J9PA 4FJLA 3QIPA 1TKTA 5KFOA 4O4GB 4EYIB 2ATQA 5HROB 3M8SA 3U6FA 3L3UA 3LAKA 4LQ9A 3SUOA 4KKOA 1X9WA 3VQAA 2GIQA 1S10A 3C6TA 3BGRA 5F9LA 1EXQA 3AVGA 4DS5A 2VA2A 3K57A 4ZP7A 4N41A 1IKVB 1R0AB 4KTQA 3ISNC 3QINA 1RYRA 2FVRA 3CVKA 3L2UA 3OL8A 2J6UA 2VA3A 1JXBA 4IFYA 4IH7A 4CJTA 1S97A 1QSSA 1LW0B 2E4LA 2ZE2A 2IM3A 3OLBA 3KLEA 3WNEA 3VQ4A 1C0UB 3HPGA 5KFCA 4E19A 3V9UA 4DQQA 1C0UA 4CK3A 2I5JA 3GV5B 4JRPA 1S1UB 3NKYA 4NYZA 2FC0A 1S9EB 3IG1B 3DOLA 4E7IA 2ETJA 4RG8A 3V1OA 1QSLA 1JKHB 3H59A 3DOLB 4FBUA 3N6NA 1T05B 1N48A 3AO2A 4RNHA 1Z25A 4DTPA 4QCLA 5KFSA 2DFFA 4KI6A 3T1AA 1ZBLA 4PY5A 4RNNA 1KHWA 3KK3B 2VWKA 4M3WA 1S1WA 4ED2A 2D0CA 4DFJA 5L1LA 3NGYA 3IGNA 1KLMB 3CJ5A 2OPSB 4B08A 4FJIA 3GILA 1SKWA 5JS1A 3NAHA 1LWEB 3KLIB 4FS1A 1HNIB 1JXLA 3NAEA 4I7FA 1ZYQA 4NLTA 4M3XA 5KT6A 2UVRA 4EBEA 4WXWA 3LZJA 4YMEA 1Z4UA 3TANA 4QW9A 3K5NA 3SCXA 4DMNA 3ZSVA 1WSGA 4CJ4A 1T7PA 4KTWA 1JIHA
chains in the Genus database with same CATH superfamily
3UDVA 1S1VA 5GAGU 4RO0A 2CIMA 4DL7A 3VENA 3M1FA 3SCIE 1CG2A 1H6KX 1Z6RA 5HANA 2AT1B 2H3EB 3LDNA 2JEJA 3CXCR 4U7BA 4PQUB 1QJHA 4F2RA 1IQZA 3GPAA 1FRMA 2YI1A 3I6PA 3J7AP 2VFVA 2Q31A 5J2MB 3CUNA 5D0GA 2KJWA 1Z2ZA 4WKYA 2VH7A 1UMJA 4CDIA 4IG3A 4FK0A 2IMOA 3AQPA 2PYJA 2P51A 2HBZB 1O13A 2JRSA 4DPTA 3GZ7A 5DO2A 3I56N 1SKUB 1KLNA 2D9PA 2DNOA 4P74A 4DUZK 5IXUA 3KHLA 3X3UA 1TAUA 3J7A1 1OKJA 4CJUA 1R89A 3FZBA 4JI6J 2P5VA 3NGKA 2A6AA 3DOKA 4OVLA 3GR1A 4CF8A 4NYFA 4CEZA 4A57A 4I0WA 3QEVA 3NVKA 1ZZFA 1CXQA 1XNQK 1AW0A 3NWGA 1SC3B 1LAWA 4NI2B 1HD0A 2QLBB 4CZEA 2JC0A 5ETNA 3VGVA 1N8RO 3LAMA 1NSKL 4QQBA 2EKYA 3MM7B 2HKEA 5M1KA 3CSKA 4NXNK 5BYSA 3PO4A 1C4AA 4FVCA 3Q8UA 5D3GA 4URSA 1PJ7A 2WAQD 1G7CB 2BE2A 3ZCMA 2AMCB 5I3UA 1WAFA 1CC8A 1UJ6A 4RWXA 2CH6A 4LJMA 3FZKA 3F56A 4Y28C 2LCWA 1HA1A 5CYMB 4BREA 1CVJA 2U2FA 1WSVA 2J9DA 4F50A 3OXLA 2COLA 1FNOA 2C22A 2UVWA 3MFIA 3H0PA 3C15B 2XMAA 4LRCA 4QS9A 4M5HA 5C5JA 1P6TA 4DV2K 4ZTFA 2E5LK 2QWRA 2OMLA 1W7AA 4B3SK 4DTUA 4ISEA 2XLKA 2Z8QA 4RW8B 4XTTA 4JI8K 2Z2ZA 3UKRA 2AYGA 4MQ3A 4N56A 2MJUA 2PYLA 1YJNS 4R5PB 4XPEA 5GAGI 4WQ4C 4IEIA 1K0VA 5KFPA 3ISND 1UVJA 4B3MK 1EHWA 2Z0GA 1F9EB 4FZXC 3QRPA 4B9VA 2ZJRL 2DD8S 1NSPA 4LF6K 3M8YA 4X2BA 4FLVA 3U9ZA 2LXUA 4RW6B 1NGEA 3G0ZA 1AUSL 4NWBA 3OSNA 3SFGA 5E2QA 3QFUA 1V5IB 4TU7A 1SIWB 1U24A 1Q8LA 3ENHA 4UOHA 2BACA 3DLLQ 1WTFA 3H4DA 3O80A 3SI6A 4A46A 1RT5A 3HVTB 2I38A 1Q8BA 2Z1IA 2NRTA 3GG1A 1PIEA 5EWGA 3MM7A 4H4OA 1VCTA 4PEOA 5GIOA 2QMWA 2POKA 3EZUA 3JSMB 2OSQA 5DLGA 4DR6K 4XDDA 4JI4K 3QO9A 3W0LA 4BRNA 2JNJA 1VK0A 3KK1B 2UUBJ 4AHVA 3B82A 1GXUA 5KFKA 4OZ2A 2ZE2B 4NRUA 3WXKA 2BXJA 3GYGA 2XULA 4R79A 3K5MA 2E7VA 4ETZA 1IKWB 1XBWA 5DM6L 1CS4A 1SL2A 2I5JB 3CCJN 3G71N 4ZPDA 1NMEB 2VDHA 2V8PA 1OY8A 4Q43A 3IG1A 4NX9A 2LFVA 1JCEA 4ES2A 1VI7A 2HHHJ 2IDOA 3NGRA 2IYIA 3C16B 1XNRF 1YDLA 1JLFB 4RW8A 1K0TA 4WP8A 3QFWA 1HBOA 2VC1A 2W9AA 2K7JA 1XC3A 1HKAA 1YX2A 2XB2D 4JKBA 1TKZA 4YEAA 5AQPA 4IWVA 3M7VA 3GG0A 4IDKA 1KQFB 4EHUA 4EYHB 3B4MA 3CF5Q 4JK8A 1UETA 2I2YA 4IQXA 1HBMB 2IFXA 1EIYB 1LKZA 3VHQA 2R2UA 1S4FA 4UY8O 2E5LJ 3GIKA 4ELUA 3OFGA 2FHOB 3NS6A 1HPZA 3T9ZA 4H5RA 1FEHA 1NNDA 3FMBA 2W24A 1L5UA 1EETA 3ZTPA 2NPIA 4KO0A 3GYXB 2CZ4A 4E0DA 4G6VB 3JSRA 1FFSB 1YKWA 4I2PA 1D9AA 5CY4A 3W8GA 2G2ZA 5AQYA 4O44A 3V1RA 2DIUA 2OZSA 1FXXA 3T7ZA 5DDOC 3D2FB 4YQWA 1SJRA 4X66J 4OJGA 4F7VA 3KK1A 5L38A 3PX0A 3L95X 3RMDA 2QC3A 4A8FA 2HIQA 1FRXA 1R8PA 1RT3B 4JAXA 3IC1A 4CO4A 4HWIA 4WTYA 1ASUA 4WFBL 1NJZA 2IJRA 2HBLA 3SI8A 1NMNA 2ZJQL 5LJ3Y 2V67A 3TQEA 2HURA 3V1QA 1YITN 3KD1E 4BS2A 3KKFA 2UVVA 3HPHA 4KRFA 4AQYK 2KM8C 5BRHA 2PFUA 2A40A 2YQ3A 3MZIA 3LPUA 3ZZOA 2W01A 3LWLA 1OQ6A 4CZIA 3NEKA 4H0TB 2QLXA 4HACB 3K7RA 1ZM9A 1WD6A 4KB1A 5ETKA 2XYPB 4HVZA 1Y00A 3DJCA 5KI6A 2BJ7A 1QM9A 3C6UA 4PKHA 4DV3F 4I68A 2XYGB 1NO8A 3CCMN 2F9JA 3I0RA 5KT3A 2GV1A 5B0BA 3ZSRA 1XN9A 3QFHA 3ETOA 3KLHA 4GVBB 3THTA 2ZM6F 4CGFA 3NMRA 4Y34A 3HHKA 4PWDB 2VFTA 3N5BA 2P9SB 2RQMA 3TAEA 5LT5A 3PDNA 4DF4A 2MGZB 1WNEA 4DU4A 4X65J 1XQSC 2C2MB 4JI3F 2BJ1A 2CJQA 2ZITA 3I87A 4H8KA 3SJHA 1NK4A 2FLNA 1QAJA 4B3RJ 1Y64A 3C6AA 3HO1A 3TW0A 2VG6A 3WIUA 5HL7Q 1D1UA 3MMCB 4DR3F 4Q5VA 5MLCV 4O3QA 4WFBQ 2V68A 2FJDB 4OGEA 3EGNA 3RRGA 4KHPK 1ZPVA 3F0NA 2ALZA 2NRXA 4P7TA 3BO4A 3K5OA 3RB3A 3V9XA 1P1TA 3CCTA 2RAQA 3ENAA 4LF4F 5KPZA 4WYBA 2DK2A 3A8IA 2LXIA 2HYIB 2WB4A 1CPZA 2YTCA 3CCQN 1HWJA 4ISFA 1HNWJ 4BDPA 4XK8C 1XMQF 1OIAA 4AILC 2JFKA 3MGJA 4ZVGA 4Z4CA 3MN6A 4Y2CA 4DV1F 4DV3K 1HNVB 1K1QA 1RWWB 4FJHA 2I6WA 4E7JA 1UTAA 4K2JA 4F04B 4U7UK 2YX4A 1VSIA 2B9YA 2KHDA 1I94F 1SV5A 2RUGA 1NJIT 4C0OC 3CJ8A 4E89A 1FKPB 5DJBA 3H4BA 3RB6A 1M5KC 3M6GA 1PAEX 1NKBA 4LFCJ 4DCJB 2BANB 5DZ7A 2QIFA 3TJAA 1EKSA 3ZX3A 2Q43A 1BMQB 4ILJA 3D0GE 3K89A 4CRJA 1LXJA 5HVFA 2DH8A 2A3ZA 3SXLA 4CYUB 5LMNK 4MK9A 5CABA 4UUXA 3HD1A 1YVNA 1U02A 1UA1A 4OGCA 1CQMA 2I1RA 3A5LC 3VQDA 5EN1A 1C0MA 2DCUB 3HSZA 1JNRB 5HVHA 4JHDA 2P9LB 2HS0A 2HW3A 1TAQA 5DETA 1RTHB 4DR7J 1DT9A 4CP5A 4LF5J 1A0OB 5FJ4A 3RUBL 1K9MO 1HNIA 4ES1A 1RCOB 5F0WA 3G6EN 2WVCA 2QA4S 4I69A 3HP6A 4Y1CA 2NXEA 2OFGX 1WG1A 2KDOA 4NLVA 2QXFA 5EOYA 4DV1J 4USMA 3TJ9A 3VGLA 1FDNA 2GEMA 4CEAA 1ZBTA 5C12A 1G2EA 3UE2A 4F3MA 2PEHA 1Y97A 1SZ2A 2JEFA 3G8TA 1JXEA 1MNEA 2LA4A 4CNZA 2ZH5A 3CM5A 3EE8A 1FDAA 5GAHI 1NUEA 1APSA 2YNFB 1D9FA 2CGLA 2M52A 1NKEA 4EZ6A 4OLBA 4ZDNA 3DDKA 1EQMA 3HPOA 4H0VB 5AQZA 2MEWA 4DKWA 2HS3A 1HYSB 3D1HA 1NEEA 4CIFA 2L41A 2C2ZB 2IS3A 4BR4A 3QESA 4ED6A 1S0MA 1TL3B 1RQ0A 1E4FT 3R97A 4OHVA 5HRRA 3KD5E 2EFGA 1NHUA 2LVWA 1Q81T 2VYPA 4LF8K 1IKYA 2NNWA 3CC4S 1O6XA 3OY9A 3CM6A 4XAKA 4UOCA 5AZJA 2H65B 3MPWA 5T14A 1K8KB 3KK7A 4F4ZA 5GADP 5EVZA 4CI6A 2OPPB 5DGAA 2BQRA 3CJ9A 4DR6F 1IBLF 3L9ZA 3IA0A 3LDLA 3CXCM 2E20A 3MEKA 1S72S 2B8QA 2I8EA 3FSIA 2OCEA 3AVAA 1XMOK 3QMLA 2W8LA 1S3XA 1KQSR 2HHHF 2MHNA 4KREA 2O4GA 4ALZA 2M8DB 3R6GB 3VCDA 2RKIA 3O9UA 4BGAA 2UXBJ 1YRUA 3DLGB 2KN4A 2HB5A 4AH9A 3UDCA 3DN9A 3OUYB 5DDPC 5SZTA 5GAEU 2PO4A 4E7LA 3WX8A 3BBBA 3WEEA 3IFEA 4H4KA 4BE2A 5B0FA 2GA7A 3VQSA 3GIJA 3P45B 5RUBA 4LBHA 1S9GB 4C3KA 4YR0A 1YRTA 4BVOA 3H5UA 4HUFA 3E66A 5IC6B 3DGPA 3LP0A 1HNXF 4EHTA 4RW9B 2IBOA 4AXIA 3A12A 4M45A 4FWRA 4MO4A 3J7YU 4JI0F 2AEMA 2W42A 1N6QA 2NRHA 1KFDA 2Z2LA 3MFHA 5KFJA 4OX9J 5KT2A 1K44A 3LGHA 3T6BA 1CJUB 2YVSA 4FLUA 4O0NA 5D4LA 3O4WA 3CNQP 4K4VA 3MR2A 4P2SA 2N3OA 2MZQA 4B3TF 3GDQA 2H48B 4L76A 2P9NA 1HPZB 4BY9C 3BUZB 3OTBA 1F3FA 1I5OB 1TKTB 2R2SA 2HNZB 5KFWA 4FBTA 4P2FA 2ZFHA 4DQSA 4GNIA 3THXA 1ACMB 4KQZA 4FZVA 5DM6Q 4F4XA 2LSNA 1RLDA 1UJ4A 1YI2N 5JS2A 4LFCK 1WI6A 3FBBA 1Q0NA 1S1VB 4O8UA 2Y1LB 3CCZA 2DPIA 3DLGA 4CBXA 3VF4A 4WFNQ 2O8CB 2LQ5A 2LU1A 3ZSXA 4B17A 1VQKS 1NZ8A 2EC0A 3J8AA 2DITA 2EEYA 1NK9A 4IXCA 3NGSA 3BSAA 1UVNA 2X78A 4ETXA 2WB1D 4FLYA 2C2NA 2RF2A 2GNKA 5J2PB 1X4GA 1RT2B 1TUVA 2RIJA 2AQ4A 5H9FK 2Q3PA 5CZ1A 1S9GA 4ZJOA 1GLDG 3I56S 3NF7A 3M05A 3VQTA 4DX6A 1C1BB 4DHYA 3RMAA 1URNA 4Y65A 1RHRB 2DXDA 2NRZA 5DG8A 1IWGA 3I0SB 2UUAF 5DLFA 5KPTA 4KKOB 2C28A 3LDQA 4OL8A 5LSOA 2B6AA 4LVNP 3BGRB 2XY7A 3VEZA 1VIOA 3CCSS 2HBKA 2VQFJ 4PG5A 1DLOB 3GJQB 7AT1B 5KFGA 3M6UA 2NQPA 2NRWA 2XS2A 4Z0UA 4DL6A 4DV7K 1HMVB 4DV5K 2Z1JA 1N54B 3WBZA 1NH8A 3OV7A 3CMAS 3QGGA 4U9RA 4NASA 1RDCA 3SPZA 4DUYF 1FFGB 2OZMA 2CQIA 2NUBA 2GJ2A 3QEWA 3EEQA 4MKAA 3TNVA 3ZSZA 4NZ0A 1HRHA 4KGKA 3AQOA 3M8PB 3HI0A 4W90B 3AA2A 2DNLA 4C3MA 5HATA 3IS9A 2L9NA 2CQ2A 3PW0A 1BQNA 4FO0A 1Y11A 4CHPA 4FM0A 4F8RA 3ZZUA 3C15A 3PJ9A 4UT4A 4DSLA 3US5A 2CNNB 3T5JA 1ZAWA 1XK8A 2MZSA 5DQGA 4ZVTB 2LQBA 5J2PA 2E88A 1NK0A 3NGTA 5EX0A 3H1VX 3W2VB 5C2FA 2EW9A 3L2RA 3L2WA 2WBMA 3TU5A 1R7IA 1SH2A 2VG7B 5EGYA 4W4MA 2Q6BA 1KD1T 3NF9A 1ZZNA 5T7BA 3BO3A 3IR7B 1X8DA 4OZ1A 2CG8A 4PZVA 1KOOA 4RW7A 4ED0A 2QG9B 1EJ7L 3O9QA 2V8HA 2ASMA 3OTDA 2OHDA 1TKXA 1TV6A 2EFQA 3HVTA 1TUGB 2XI3A 3FVYA 5DQHA 5KFUA 3D6FB 1VSFA 1LWFA 4ZN1A 4X4OA 4PR6A 3ET6A 3IRXA 4V19X 1NJYA 2ZJQQ 4DR3K 1C6VA 4F2SA 4BRAA 4DTJA 4A62A 2QW9A 2OPRA 4OI6A 3UI3A 4OI3A 1VQ6N 5LM7E 1MWKA 3DXKB 2Y8YA 3PW5A 3D0PA 4IOAL 4CZHA 3BF4A 1Q78A 3V6DA 1S1XA 1RA6A 2ASDA 4P2XA 5LJVA 5CCLA 2W40A 3P3DA 1TL7A 2GJFA 4ILRA 2MY7A 3QFPA 1VQ5N 1B64A 1VDHA 2JWLA 1IJEB 4EZ9A 1NDCA 3PIPL 4LIRA 4FLWA 3VZIA 3W9HA 4KHSA 1FX4A 2WVFA 1BG3A 2SXLA 4NRTA 1LWEA 3PNIA 4CLFA 2VHGA 5FDLA 1OS5A 2RJZA 1FRLA 4PABA 1GX6A 3IRWP 3PFOA 5EX5A 2GZOA 3TZYA 5E3RA 4M3UA 4CEDA 3N6MA 5J2QB 1TR0A 4NLYA 1CXUA 4JI4J 1RAIB 2H3GX 2XMKA 5JICA 4YOUA 3V4IB 3J80U 1RBOB 4HDGA 5HSPA 2Z1GA 1RT7A 2CPDA 1WC4A 3SCJE 2F96A 4Q0BA 3Q2SC 1WC6A 4NYNA 3BV8A 4CIGA 4HCCA 4NXMJ 8AT1B 2HHQA 3HM9A 1DTTB 4GV9A 1UEUA 2UXCK 2O8EA 2C3PA 3OL7A 2AJFE 2O8FB 3KUEA 4FJ8A 4M63A 2Q36A 2HBYB 5DG7A 4PL7A 1RU1A 1H2VZ 1U1NA 1T9YA 2AJQA 4RNFA 3AGKA 2BRKA 2XG8A 2OKQA 4FN5A 5JJBA 1GTHA 1HR0K 3KNGA 1Y10A 2WSEC 3PUFA 1PJ6A 3RB0A 3ISZA 4KGVB 5E3PA 5E0OA 1L3KA 4X4UA 2DFHA 4FVMA 3CMEN 2OP5A 1VR6A 4A47A 4NLWA 3CD0A 2VZ9A 4MYUA 4OV6A 4G9ZA 4L8RB 4GKJK 2RU3A 2MY8A 2VKZG 3SBMA 3T1YJ 2OMOA 2WZ1A 2QZ8A 2H51B 3PHEA 1W9HA 4RUCA 2O8DB 2KKZA 2CQGA 3FCHA 3HULA 4O3SA 3TVKA 4WFYA 3P1GA 4NLCA 4CH0S 4ZVQB 1N0VC 4NMLA 3KLHB 4GVBA 2XO7A 3W5ZA 3SLCA 2DGWA 3D6MB 2FHKA 2MMYA 2V69A 5KG4A 3OTCA 5IC4B 1IG9A 2OYQA 3V4IA 2M0GB 4BHQA 5EU7A 5ETSA 2ZZNA 4C23A 2H9ZA 3CDWA 3WXJA 4KHQA 2AHOB 4OMFG 5H9EK 3JQKA 1QZ5A 1CJUA 4DX5A 2HMIB 2DNZA 3LTOA 3MEGA 4NEZA 3RRHA 4EO8A 4DMZA 2A1RA 3K59A 1CJTB 3G6YA 5AZIA 3BYPA 1TFYA 1FFWB 3M9MB 5DDRC 3KUHA 4J2EA 2KB2A 3CMQA 1NKCA 1IBLK 3OHBA 3G4SN 4NLXA 2YHWA 3K9KA 2E1AA 1ZS6A 1B70B 1YG0A 1BWFO 1XMOF 3CCLN 3SQ0A 3H2VE 3CCUN 2ZH3A 4LFAF 1HFEL 1TL1A 3MM9B 4J9NA 3ENOA 1WSRA 1HNVA 9ATCB 2CJKA 4J9KA 1YLXA 4J9VA 3KK2A 4JI7K 4DR4F 3BS9A 2GO9A 2BJ8A 1SPBP 1RBSA 4WXOA 3LZIA 4QOTA 3L6QA 4A5AA 2LU2A 1P8ZA 4G65A 2YBVA 3ZT0A 2O8DA 3KLEB 3HT3A 5CAAA 1X4CA 4M63C 5F8IA 2AJ2A 5C15A 4CJ5A 3VAKA 2MSSA 2MKHA 4MFBB 2QLFB 4ZCKA 1V3RA 2YWWA 3ITHA 2YKQA 1M5SA 3OVSA 3CB4A 3DLBA 2OTJN 1F3VA 1QVGR 4OZLA 3TZXA 3CCWA 2PT0A 1TKDA 4WFXA 4QIGA 4GO7X 2WUSA 3W3DA 2D1KA 2WVEA 4CYUA 1XTZA 1SJ3P 4YN3B 4DU1A 1RDRA 1J53A 5CZ2A 2ZBIA 3SQOP 2HMIA 2ZBRA 4ELVA 1KWMA 2RUSA 4M8LA 2YX1A 3D54A 4F36A 3R6MA 4K43A 3DDNA 1CJTA 3S6EA 1Y0HA 4NCAA 4CJEA 1NJXA 4HI2A 3UD5A 4Q8EA 1ICEB 4F4WA 1BQMB 4H0PA 2Q3SA 2XZDB 2A1BA 5M2PA 2ATCB 2WSCC 1NGFA 4Q7AA 3R3LA 2NR0A 4F0MA 1KAZA 2FVPA 1E6VB 2QXLA 4JI7F 2EPIA 2JEGA 3RJMB 1WSFA 2DJWA 4HHHA 4C2MA 1Q18A 4FJ9A 3NVMA 2AP1A 3EUNA 2QE5A 4QYZJ 1T94A 3M8PA 2CADA 3ZXWA 1C0TA 2GX9A 4KGMA 2HNDB 3WQTA 5CD4H 1JX4A 1X4DA 2K8GA 3LUYA 3PIOQ 3IMQJ 1HI8A 2VQEF 2MKIA 5K8MA 3HF5A 1RNHA 4C3LA 4DFKA 2FHJD 5HLFB 2CKWA 4N47A 3AOBA 3B54A 4EAHD 3DC2A 3NHGA 3HM8A 2QK9A 2JZ5A 4DUZF 1HARA 3MCOA 3FQLA 3IN5A 3QBCA 3T5KA 4MFBA 1VQMS 2QTDA 4KGXB 3CCRN 4O5BA 2RDIA 3U9DA 1S0VA 2F3JA 1T6CA 3JQMA 2FXUA 1ROFA 4Z7YA 5HQMA 3RAMA 1E4GT 3QB0A 5MAOA 2EKNA 2EWHA 4HYKA 4FJLA 4LF2A 1FEEA 4O4GB 4BRIA 4JK9A 4KC5A 5HROB 3LA0A 3TVZA 4QS8A 2RHSB 1K8KA 1C0FA 3GLJA 3X1LB 1GLEG 3H42A 4DS5A 3K57A 1S72N 3A8EA 4N41A 4LF8F 3AOAA 4KTQA 5D15A 1YAGA 1DAXA 4R25A 3NLCA 4C11A 2N4DA 1X4FA 4DV1K 1Y7PA 4WJBA 4IH7A 2MKCA 4CJTA 2E4LA 3NWRA 3MWBA 4FL9A 3SMSA 2DNPA 3VQ4A 1C0UB 3OUYA 1LK5A 1YITS 3HPGA 3R9LA 2GVDA 3HZGA 4NXMF 1NGCA 4E19A 4FXWA 1IM6A 3TTDA 2FY8A 3FZHA 4ANCA 4JRPA 3HHLC 3KYLA 3NKYA 4NYZA 4CH1A 3J81U 5D4PA 1KC8O 1HX1A 1QSLA 4DQ8A 3T1HK 2MQ8A 4MO5A 4XH5A 1ZXOA 3PG9A 2CFXA 2JVRA 1TL7B 2HLTA 4PXBA 5LMNJ 5F0UA 5T7LA 4X4NA 3T1AA 3U1NA 1ZBLA 4JV5F 1U8WA 2CXEA 1Y5LB 3MAAB 2JHEA 4USKA 5L1LA 4DFJA 4AL5A 1QUPA 1KLMB 2OPSB 1VC5A 5JS1A 4NYPA 1LWEB 5FLXO 4OQJA 3W3SA 2DPNA 3ZC4A 5KT6A 4ZPTR 4M5IA 3VF2A 3ENBA 3B8AX 1FI4A 7FDRA 3CDBA 2J76E 4QW9A 5K8NA 3UW1A 4B9QA 4DMNA 4BR7A 2UUAJ 4CJ4A 3AODA 3QNOA 3HFZB 1RWKB 2BJ9A 5B0CA 3DOMA 4JKDA 4CBWA 1FJGK 1IKXA 4ED4A 4H4OB 4H4MA 2DNNA 1KXPA 3P4IA 4B9MA 2CYYA 2EI5A 3Q8PB 3QO9B 3FNNA 3GQCA 1U1OA 3AO3A 1T6DA 5EUHA 4KH1B 2GWKA 4BR2A 1QE1B 3VA3A 1N36J 3QLHA 2FSKA 4DV6K 4BACA 5M2RA 1EQYA 2XY5A 4J91A 3O1BA 2EBGA 4QIEA 1A5VA 1T9VA 4P71A 3BSNA 1D8YA 3TTCA 7FD1A 1XJWB 1VRQC 4IG0A 5HBMA 1OJ4A 2PI5A 2CPYA 2Y1JA 4S0MA 3HSTB 1H98A 1LAVA 1IJFB 2EFVA 1C1BA 1PC4A 5C2GA 3HFKA 4IRCA 3SBGA 4WFAQ 2ADBA 1PO6A 1RWVB 2B4UA 3SSRA 3M32B 3DMJB 1ILYA 2F40A 1UKUA 3OPKA 4WZMA 3WHIA 4CZMA 1LK7A 5L1JA 5U47A 4UF4A 2G2YA 2KT5A 3EKUA 4TN2A 3W64A 2DRAA 4K50A 2XMMA 2PMZD 4Q44A 3VAHA 4IJNA 4PXCA 3VQ7A 3HOTA 1WC3A 4RW4B 3KLGB 3OR1A 2VB6A 1WEZA 1BI4B 4CZGA 4P52A 5T41A 1ZA1B 4BWJA 2WTUA 2JSXA 4CE9A 1FKOA 2AJ4A 4ZPVR 1FTCA 4FM1A 2UXDJ 4F67A 4HT7A 3GSIA 4ZLLA 3CFRA 2O8BA 2DGOA 1D9DA 5FPDA 1HL6A 3AVMA 5FLXU 2GFFA 4CLZA 4LF6F 5AZIB 3AARA 3NH2A 3T1YF 1C1CB 2AJ1A 2E8AA 3OVAA 2IVFB 1RT3A 2E66A 3QZ7A 3MN5A 1DGKN 2OEJA 1S6OA 1AZSA 4JI0K 2DRBA 3FDSA 3BDPA 2X1FA 1N0UA 4ECYA 4IRDA 4JI6K 2V8DA 2ATLA 3VERA 4UZBA 2X6NA 1MWZA 3BR9A 1B7YB 3OJUA 1IR2A 1REVB 4C97A 4OZJA 1D09B 4FF1A 4BQZA 4DL2A 3U27A 4JBCA 1B9DA 4A8KA 4OX9F 4FNHA 4CK1A 2YNIB 2GQ2A 3AO1A 2HSEB 1KCFA 4C8MA 4R8UB 2G1HA 1JLAA 4ECWA 2DRDA 3S01A 3EZOA 4J9QA 5HMYA 4DV0K 4KHMA 5A2QY 4HL9A 4X4TA 3CCES 2ZOGA 4FWOA 4Z4EA 2GELA 3NNCA 4A2AA 3RAXA 3C14B 4GY2B 2XTJP 3UDEA 3O3HA 1U6FA 1S1TA 5BRDA 1YRXA 1BHLA 2XCAA 1F0XA 3MEDB 4ZHRB 3BM7A 1OH7A 1TKXB 2L3MA 4QU6A 3D0IE 1ZETA 1MMDA 4IFEA 4NCGB 1YVUA 4FVUA 1CULA 4FPIA 4E1JA 2IAJA 1Q82T 4OYXA 4PG4A 4BRQA 4KHUA 3MDFA 5C25A 1H38A 3AA4A 3M8QA 2VJUA 5IWAF 2JLGA 3M8ZA 3KJNB 3HVAA 4TSXA 3T1YK 2HHVA 2Z4PA 2MGZA 1WC0A 1N5SA 4GRSA 3RR8A 1NNEA 1OVYA 1UEKA 1FVQA 3LP2A 5GAGP 4E3SA 4AHRA 5M1NA 3IGVA 1GX5A 1NMDA 2M7SA 3W2WB 1RTJB 1M1HA 5KQ8A 3K8VA 1WOQA 3EKSA 1DY3A 2EG1A 5KFIA 1NHVA 4H03B 4DCPB 1S1XB 4Y2AA 4PYDA 5FPMA 3AVJA 4BRHA 4CF0A 2P9KA 3ATVA 4CTAA 1WSHA 1VQKN 1CEZA 3ULEB 3IR5B 3IO1A 5ETPA 4DUTA 4PPDA 4U7CA 4FXDA 3H5SA 4LQ3A 4M5GA 4TY8A 1GNKA 5B08A 2FF3B 2RS2A 1HJOA 1F6TA 4JKHA 4DQRA 4CW7B 4NLPA 1JLCA 4CD3A 4JV5K 1W2IA 3GR0A 1VQLN 3G86A 3KOAA 5C0YA 3L4QA 1UAWA 4CJVA 3ID6A 2HFOA 4DN0A 1C2PA 5DQIA 1FE4A 3OR2A 4CESA 4RLEA 3IUCA 2HNYA 3NY0A 2ZBQA 2RQ4A 2B0GA 2NZ4A 4BRDA 3LALA 4ATNA 1Y3JA 5ETMA 4X65K 2QYCA 2DT9A 3AVHA 2ZM6K 2O01C 2XM3A 1GMUA 1EWRA 3A3OB 4PRFA 4YHHJ 3F73A 2IAJB 1VC0A 4OIXA 5LMNF 3D1QA 5GMEA 2NZCA 4KBOA 3THPA 3M2UB 2P5GA 4F3QA 3JB9k 2A2CA 3D5MA 3UNYA 3N4WA 1VQYA 2HWTA 3SDEB 1NGJA 2HLUA 2R4FA 4EBDA 2YNGA 1KP6A 1NU0A 2KQ2A 2FTRA 4ID1A 1WOPA 4F3OA 1RSCA 3CERA 4M3ZA 5G4DA 3HZ6A 2ZJRQ 4N77A 3I8BA 5I42B 4JV0A 2Z2MA 2KFZA 4LT6A 1Y9OA 3MCNA 1IBCB 1H73A 3OS0A 4X64K 1TL4A 3ZX0A 3K58A 5BPLA 1FE0A 5KFLA 3RU0A 4A61A 2BA9A 2D74B 1MU2B 4WYLA 1IQTA 5KRSA 1RBAA 3AD7C 3I5CA 4ENOA 1PILA 4M5DA 1U45A 4EMDA 4M41A 4AL7A 2QSFA 3BEGB 3S3OA 2E5HA 4H0OA 4X66K 1FVSA 3VEXA 1S6UA 1Q5VA 2IA6A 4KHPF 2E9RX 5DM7L 5KFMA 2RPIA 4YB1P 1N5YB 2DGQA 1Q86O 4C8KA 4DL0C 1BY9A 2KXNB 5T7LB 4P73A 2BYCA 3CEDA 2X74A 4FP9A 2V2QA 4I1TA 1Y4ZB 2QA4G 2H5EA 3HKWA 3TX0A 3DRSA 3IWNC 4Y2IA 1P1LA 2B51A 5K20B 2XMVA 3MAAA 2NYHA 2YKAA 2XLIA 3Q86A 2B7CB 1RYSA 4CJWA 4IH6A 4Y00A 2FZGB 4NLSA 5IWAJ 3LO3A 1Q1KA 4LRFA 1BOTO 3ZT4A 1S5JA 4DV3J 1KR4A 5EX3A 2D0OA 4AD6A 4DG1A 5C42B 2K1RB 1T9XA 3FBEA 2UXDK 4M5LA 1PC5A 3SMZA 2DGUA 3GE9A 4ZCLA 2G8KA 1R8HA 2VPXB 3P38A 1Q7YT 3AD8C 1B0PA 3DLEB 5I42A 1MROB 1GT8A 1TYQA 2HG4A 3G82B 4NA1A 4CFBA 1ZM4A 4QYZK 1YJWN 1W2BR 1EP4A 4RWWA 5AQUA 5IT9O 4CECA 3K5LA 1M5VC 3JXUA 2P9PA 4NLDA 2YX7A 3NH0A 3KJFB 3QLHB 1N32J 3L09A 4PA1A 1HQUA 4YR3A 5HRNA 2HFVA 3F44A 4MK8A 1VSEA 1RAFB 2W9BA 4LF9F 3GYNA 4J9LA 3PW4A 2H54B 4Y3CA 4OHXA 2E29A 2GMJA 3PKYA 5TKYA 2JVOA 3CQ8A 1RGIA 2JEIA 1EB0A 2RN2A 3ONQA 2FVQA 4L6V3 3L2VA 1DQ9A 2HRUA 3VF0B 3NDKA 2VBYA 2DY1A 3DAWA 3AGRA 4K4WA 3MTJA 4E7HA 2ZGYA 1J5EK 1NPPA 3KK3A 5LL6Z 4EWTA 5HQLA 2KYZA 1R8AA 1N36F 2CQPA 2GVZA 3H2LA 1RA7A 1VQNS 2YHBA 4KH0B 1M5HA 5KFBA 2IOCA 4IFYB 1WACA 4GVMA 3WNHA 4HEA9 1KKHA 3HHNB 1WDTA 3MOZA 3PJWA 4DUYJ 1CZAN 4MTPA 3J80O 2ROEA 1TVRB 3MR3A 5EY4A 2GQCA 4W5QA 3AHPA 4DR2K 2KT3A 2NXJA 5GMKa 3W9JA 1NGBA 2E5JA 2ZVSA 1VQ7N 3TABA 4BDZA 4BQLA 4CEQA 3CD6S 2BRLA 2KZZA 5IZHA 2NPFA 4I56A 4ED3A 4JI6F 2AD9A 1U2RA 4I67A 2FHMA 2P9PB 3I4PA 4F25A 2IM2A 2YJEA 4CJRA 4XPCA 3I55S 3RW6A 1F9FA 3W5XA 3EJMA 2VG5A 1YT3A 3R5BA 1OPIA 3ZSOA 1RT1B 5LJWA 2V7ZA 2W9BB 2KU7A 2WCXA 3LGNA 3DRRB 5KTQA 1N33F 2ZBPA 5C24A 4YNQA 1Q4RA 2HAFA 1HJRA 2EFNA 4GKKF 1HLUA 2BJ3A 3HTVA 1SQFA 4KV8A 2D7SA 1RDAA 3GB0A 3AAWB 2ZH1A 3NF8A 1K8AT 1ZBIA 2GW8A 3C6TB 4F4AA 1IG8A 2IHR1 3O44A 2ITMA 3MR6A 4O4GA 3HI9A 3DRPB 5HJYA 4BCAA 1AYEA 2QWQA 1HNZJ 3AO4A 2UU9K 3RR7A 5G0RB 4HDHA 4DUZJ 4BRKA 2XSJA 2KJVA 5GIPA 2OPQA 1LW0A 1JLQA 4OLPA 5DRKA 4WTOB 3WXMB 3SNNA 5BR9A 4K4XA 3VZHA 4NPOA 1KVIA 3R2DJ 1WUUA 1WC5A 3KJVB 1TVRA 3Q8RB 5CZXA 3ILOA 1RWXB 4WU2A 5AQOA 4BC3A 1LV5A 4EI2A 3D66A 3EGZA 3PR4A 1XNRK 3GV8B 1H3DA 5AQLA 1WNSA 3ZT2A 4RTFD 1GAOA 4J5OA 3M30B 3C94A 1T9WA 2BQ3A 2AF6A 4NLRA 3QJPA 5IOLA 6FD1A 2FBYA 3H1QA 4HLBA 2HHTA 1BQNB 4WFZA 4DR6J 3W5YA 4JKCA 2VV5A 2PI4A 4LD0A 2IJFA 4PG6A 1U7LA 2VG5B 1J9AA 3L4IA 5CZVA 2E44A 4H54A 1A6LA 4OKKA 2OIHA 4UOFA 3I5AA 3MURP 5C24B 1ZM3A 5LJ5Y 1XQIA 1NOZA 5LXRA 2A42A 4OO1J 3B6BA 3ATUA 4ID5B 1WN7A 2X7IA 2KLAA 4UUWA 1RHJB 2IDEA 4CLWA 3E01A 3AVKA 4M3YA 3K5PA 4C9DA 5HN0A 1VHIA 2GAHC 4LREA 1FKAF 3VGSA 3AT1B 3ASMA 3F2KA 2NZTA 4KRWA 1ULRA 1IKVA 2XS7A 2PMHA 1U09A 2UXDF 3VQPA 1JJ2M 2RDDA 2EFOA 4LR8A 2QA4N 3DOMB 3DM2B 4DR3J 2BUPA 1FDBA 2J0WA 4UQGA 4U67Q 4D3HA 3W9IA 1PKUA 5H9FJ 1WEXA 1MG7A 3M2UA 4JI5J 4TQSA 4OYOA 1SB6A 1HW9A 2DEJA 2H1YA 3J7YI 2YKOA 4BGBA 4X4RA 1ITPA 3IAM9 4AXJA 1BUPA 4OYMA 2UUTA 2R7OA 3WX4A 2OANA 1RWOB 3MMBA 3MM6B 5LMUJ 5HK4A 4O55A 1HQEA 4FKYA 3UN3A 2DHAA 1UFWA 3THWB 1NM2A 1S6QA 1B9FA 4CGDA 5M1FA 5EWFA 4I6AA 2ZVIA 2IA0A 2PBDA 3ZEUA 3OVBA 4CGJA 2VFRA 1HIYA 3N6LA 3NXZA 2JFDA 3OLAA 2E9TA 1SUQB 1URRA 4KH5A 4JI2J 3ILJA 3M32A 2HQ3A 1EQ0A 5L9NA 4RWTA 5SUHA 3O8MA 2IIHA 4OFZA 3LGMA 1WORA 3L7UA 4E7KA 1HKGA 3KMSA 1WUAA 4LF9J 1X4EA 4ID5A 3WQPA 3TSQA 2HQCA 5LMUF 1U0HB 2K06A 2IVOA 5AR0A 4CJFA 2WW4A 1J54A 1YJUA 3D7SB 4OI1A 3OR1B 1YXQA 1JLEA 2ZJPQ 1GMWD 4PWWA 4LF5K 2WSFC 5F41A 1R0CB 1QAIA 2BBEA 3TX8A 3QNWB 4AYBD 4PAAA 2XGPA 3AB2B 2RE2A 2UZAA 1H72C 2RS8A 4OJ1A 3VEVA 2V9WA 3O4QA 4J7CA 3UQSA 4YOEA 2E2QA 3MCSA 4ICLB 4Q0BB 3MX2A 4QWAA 2C2EA 3HHLB 1QQMA 3UVJB 1VQLS 2V34A 3TWHA 4CHZA 2X1AA 3WIVA 3K2YA 1X9SA 5KOWA 3QDKA 3C16A 5A6PA 1CQNA 1RDBA 4LY7A 3AA9A 4FF4A 2AA4A 2DFEA 1MW7A 5AFUA 5ADXH 4KT0C 2PY5A 4OX8A 2K1RA 4DTNA 2EK6A 3CW2C 5DZ6A 1IUJA 3MM5B 2Z56B 2A5XA 1AROP 5KPRA 5AE2A 1H1VA 1YQHA 4BRMA 4DV2F 4TU8A 3OTOK 4C1NI 4AHSA 3LW5C 2UP1A 1TYQB 5J1PA 1X3MA 2GO8A 3NG8A 1U47A 2AKWB 3H3OB 5E3AA 5EWEA 5AFUH 3DLHA 2DY9A 6FDRA 3TVYA 1G99A 2R2RA 3OFHA 1LW2B 2HHWA 4RNOA 2M8HA 3NBPB 3C14A 4F3TA 1FRKA 2X1GA 1VQMN 3G8QA 3NGDA 2HSTA 4DN9A 1NB2A 2QV6A 1BLUA 1S22A 3H5XA 2DHSA 5EDWA 2YHXA 1W26A 2GAGC 1CULB 3RBDA 1LWCB 4FPRA 4C8OA 4FWSA 1GXLA 4DLGA 2NXCA 1FXLA 4A4JA 4HHUA 4K4ZA 2D1CA 3DI6A 3K17A 4M3RA 3KG1A 4OX7A 1MWMA 1TK8A 3A13A 1YI2S 4KPYA 3LQVA 2FBTA 3DOKB 2VFSA 1AT1B 3QZ8A 5IWAK 2XGQA 2F63A 5I4MA 1RAGB 4GO5X 5C2DA 4KIAA 2BABA 5CA5A 2XEXA 2WVDA 3QAUA 3CJ0A 3VQ9A 4QOZB 4KPCA 1HLWA 1YJ9N 4FCYA 3MEEB 2FD2A 5L39A 4Z2XA 1VBZA 2QLWA 2V52B 4M42A 1HI0P 1T0TV 3M1VA 2ROPA 1FNMA 1UVMA 2CJYB 5AE3A 1O1WA 1KTVA 4M1KA 3TAMB 2QFJA 4AF1A 2VWJA 1Q82O 1XNQJ 2N4CA 2NLXA 2HQFA 4XH1A 5IM0A 4FJ5A 4FZZA 4CGHA 4IBNA 3KK2B 4CF2A 2HQIA 1WF1A 1NLVA 1BIUA 3OR2B 3KLVA 1FESA 1X3NA 2G1DA 1OMSA 1X9MA 4JV1A 2CPFA 5KFHA 3IAYA 1U1LA 2HWHA 4OJRA 3BZKA 3MMCA 2C2RA 1PYTA 3TAQA 3P4UB 3MMVA 1K73O 3BGLA 4L3KA 4ID8A 3RB4A 1SH3A 4USJC 2FJWA 4B1WB 1R6VA 3GOIA 4DB3A 3CYMA 4IOCL 1NGHA 1NSAA 2ZHBA 5E26A 3FLCO 2E1MC 3C6HA 4HTUA 5KGWA 1BA0A 5A6WA 2MTLA 4OJ3A 1J5OB 2DYAA 2NSCA 1Q9XA 4FKXA 5AQRA 5HAOA 3CPWM 4U96A 3QEXA 2CVEA 2M70A 1R31A 2PFDA 2ZHAA 1N4LA 1FO1A 1FX2A 5A8KB 4HR2A 1DQAA 4KFBA 4DV4F 4DU8A 1FRIA 3V6HA 1NCLA 5K8OA 1U8SA 3SCLE 3Q0AA 1U0SA 5IQQA 2OPQB 3OYGA 5KOXA 4ZVEA 4B9SA 4CJ3A 4OI4A 4K8ZA 1Q53A 3JYTA 4B9LA 2HOEA 2VQFF 2FVCA 5LOQA 2MB0B 3CJKA 2AW0A 4EIAA 2GMHA 1M1KT 2M2BA 3Q24A 3MCMA 1IBMF 1VQ8S 3BKFA 3QPIA 4DFMA 3TAMA 4FJNA 3MN7A 4GVLA 3NRBA 5L9XA 4DLEA 3C66A 2F8MA 2VQEK 2G8IA 1M1KO 4RBUA 3FBFA 5E5NA 4FWQA 4IUFA 1ZBFA 1YZ6A 1HBUA 5D0RA 4ZJLA 2ASPA 2ZOMA 5GAHU 2OI2A 1ITGA 1DJ0A 1CS4B 3HSGA 3OYFA 2F4VK 3KKSA 4C8NA 1JLBA 2D0AA 1UW4A 3TI0A 4CLUA 5L1KA 2CQ0A 4F0HA 3OBWA 5J1EB 1Z2LA 4FPBA 2J7UA 3D7EO 1VSJA 4PG7A 1U25A 2C1EB 2EWSA 3GJTB 4FSVA 4DTXA 3M2VA 1HBOB 3OBIA 4TKTA 1NGIA 2D3ZA 1JQGA 4OLAA 1W25A 1OH8A 1AXQA 1SIZA 3SK3A 2CAJA 3NF6A 1RBVA 3FCVA 2DXFA 1B0VA 4OPJA 2BM0A 4KSEB 1V4SA 4N7TA 1KVKA 1R8BA 3OYAA 4L75A 3DLEA 1T3NA 2VQEJ 2DNRA 4G1IA 3RGIA 4JD2B 2IVPA 4DPYA 3JTOA 2H5IB 2HHSA 3JYTB 4GV6A 3VGTA 3CJ3A 3C7NA 3OYJA 3ETMA 3U3GA 3EE9A 1FF2A 2AX1A 1VAZA 1F5BA 2VU5A 2Y1RI 4WK1A 1XNRJ 3A4TA 2GCFA 2LA6A 4WZQA 2K3IA 2APOA 3UPFA 3IAS9 3PRVA 2E2NA 3KWIA 2GTDA 3GIMA 4HUGA 3T1HJ 1K1SA 3L4BC 3A5MC 4K8RA 3GIIA 3WT0A 4LIWA 4CERA 4A48A 2R7TA 1D4XA 1IBKJ 2VOPA 3UFCX 1N5VA 4LF4K 1JCGA 2VD3A 1SJFA 2F4FA 2XHBA 1SUQA 3PEJA 2KVIA 3IMXA 5H1SQ 4Z4IA 4KB0A 3AVBA 4O3RA 4UY85 4JOUA 1U48A 4X84A 1RCXB 1VSMA 5KFTA 1R0AA 2D5RA 3MDQA 2W7PA 3JS9A 2FSJA 4ED5A 2F4VJ 3T69A 1H2TZ 4FWNA 1BL3A 1VJQA 4PL8A 2ASOA 1CLFA 1VQ9N 4OYZA 5JUMA 2R7SA 1OH6A 3L7PA 2Q0RA 2CQBA 3C6UB 3S3MA 3QT6A 5I3PA 3TQ1A 1LQ9A 1HKBA 1LOUA 3UKUA 3S1TA 1IM4A 4PXDA 4QWBA 3Q2TC 2RILA 2CDQA 3O3LA 2JWKA 3N0VA 4ICLA 2IPOB 3LM2A 3UVJA 2CQCA 1J6ZA 1HQ2A 4I2QA 4HUEA 1WHVA 1U2VB 4WF9L 3IBWA 3BQ2A 2MQMA 5FRNA 1FK9A 2DHGA 4CFCA 4DDFA 3HJVA 4R5PA 4ANEA 5F9NA 2YH0A 1KVBA 4EP5A 2CJBA 3NNHA 5LY3A 4P75A 5KT5A 1CJKA 4NB4A 2NSBA 2HZCA 3KDOA 2RRBA 3BF1A 5A76A 1TKTA 5BPNA 3E9PA 5KFOA 1HWLA 2ROGA 3N79A 1RBLA 3L3UA 2ZM6J 3RYLA 2ZJPL 4JEPA 1R3NA 1X9WA 3CE8A 2A3JA 3C6TA 5F9LA 1EXQA 4ZP7A 2W4PA 3I4HX 1R0AB 3PYDA 2DGXA 3CCVS 4B1VA 3FGUA 3P49B 4CNYA 3Q7BA 2O3DA 2V9KA 2J6UA 4ZVOB 4CH7A 2VA3A 1JXBA 1BQXA 1LOTB 5HI7A 1TUUA 4ILMA 1FJGJ 1LW0B 2W2OP 2ZE2A 2IM3A 3OLBA 1YTYA 1A9NB 5EHHA 3WNEA 3CQYA 2WBRA 3ID8A 4O23A 4DQQA 3O9TA 2GHWA 2CNOB 2JX2A 4CK3A 1LFPA 2I5JA 1KEKA 3GV5B 2BW2A 2GQQA 2FC0A 1TL5A 2VQFK 3IG1B 2E5LF 3M2RA 4IOXA 2ETJA 4RG8A 5BN8A 5LSRA 1IBMK 1JKHB 1PAUB 3H59A 1NWKA 3DOLB 4QIVA 3B78A 1YHQS 4RKUC 1LWXA 1IR0A 3AO2A 2VL1A 2G2OA 1Z25A 3MD3A 1KQKA 3FE1A 3RW7A 4KI6A 4PY5A 3BY5A 4K41A 2BOAA 4RNNA 1WI8A 4HTIA 2VWKA 5K9FA 2KXFA 5BXIA 1S1WA 2D0CA 4ED2A 2B8PA 3M1VB 4B08A 2AYMA 4MMOA 4FJIA 2HZVA 5JMNA 1SKWA 3NAHA 3VF6A 1S59A 1HNIB 2YWHA 5BYRA 4I7FA 3QWUA 1ZYQA 4NLTA 1VS3A 3D67A 4EBEA 4V1Ak 1EAYC 1H0HB 2QN6B 3LZJA 4KYZA 3TANA 4QR1A 3K5NA 3M6XA 4HT5A 2V2KA 5LXYA 2VPYB 4KTWA 3MPYA 3QQCD 5D0EA 2DNQA 2P9UB 4RX6A 5J2NA 1JWWA 2FF6A 1L3SA 5BREA 4DV7F 3F9MA 2M5YA 3CGIA 3DU6A 4OJHA 4Q2MA 2UXBF 2NXUA 2PN6A 4ZITA 1BD6A 5B0EA 4LFAK 4X4VA 3T6JA 2YCHA 2FQQB 2QKKA 3VA0A 4FOEA 2C3MA 1SJ1A 1KVCA 1HYSA 3CJBA 2MKKA 3GJRB 3TYTA 3UCUP 4TLQA 4F4KA 4IG3B 4OI0A 2LLZA 1ATSA 1UVLA 4CO2A 4J9RA 2YWEA 2MQOA 4GC6A 2DGSA 3OYBA 3W1YC 1NGGA 2VG7A 4MLEA 1HQEB 3VWSA 3CMES 3UR3C 2J8AA 4PKDB 3VTIA 2OPPA 2D3UA 1NPKA 4K4UA 4BC9A 4JI2F 3JXOA 4KHYA 2L9WA 5F8LA 1FJCA 2IBKA 2UUCJ 3SEOA 3SMPA 5M1PA 3CCEN 4ES3A 4BWMA 5MLCQ 3PJXA 1WKLA 4J2BA 1RZMA 4WCEL 2ITGA 1RAHB 1OWXA 3R9PA 4G1QB 3Q8VA 2MQPA 3TR8A 5AXNA 3IWXA 5KGXA 2UUAK 3HCXA 4CZFA 3BZCA 3ZSYA 3BF3A 4K25A 3M9NB 1N5QA 4M5MA 4YOXA 2AX0A 1T3VA 1X5PA 2UXBK 1U0HA 3M5RA 4OHWA 4K2XA 3L0QA 2BE2B 5CYMA 1OYDA 1RTIB 1KS2A 4OYBA 1I3AA 1ZBSA 5J2NB 3D3CJ 2CG4A 1FW6A 3R1LA 4QWDA 2PEBA 1WHXA 2RVJA 4DR1J 2XMTA 4OPHA 4CGGA 3H08A 1B7FA 3CQXA 3D9BA 5L1IA 1JLGA 4CCHA 1GLJO 3BPDA 2BDPA 3F41A 5I9EB 2PC6A 3RBZA 5LL6d 3CULA 3O4NA 2L08A 2F8HA 2E7XA 1S7HA 4DOZA 2V94A 1XR6A 4K5SA 5HMXA 4B3SJ 4BVPA 1PBUA 1JJCB 3TUZC 1QAYA 3EYZA 1WSEA 1NBEB 3R6LB 3IFRA 3BP8A 4U8VA 1X1PA 4JI5K 2FJXA 2AYBA 3MPUB 3EO3A 4JKGA 3OHAA 3MXHP 5IS2A 1X0FA 5ADXA 2EK1A 1VQ6S 1F5AA 4YDXA 1SXLA 2R7WA 4K0KJ 3C7NB 5KFAA 4PCQA 4ER8A 3JSMA 2MJNA 3TSPA 1NDLA 2CGKA 2WC9A 3MAHA 4USHA 5KG6A 3H5YA 3BH7B 4NLGA 2YNHB 3UD4P 3TJ8A 2P9IA 1BC6A 5F8HA 2XZWA 4BROA 3AA8A 4JYAF 1YJWS 4ZMMA 3VQCA 2M3DA 3JSYA 1HUXA 2O66A 4CBUA 1TK5A 3OW2R 3DXBA 1U1KA 1FJEB 3L3VA 1XMQJ 2HFZA 2H4YB 4D3GA 4ISGA 2R42A 3BJYA 5D4OA 2P9LA 3OD2A 1VHXA 5KRTA 1JXVA 4BE0A 3VEYA 3KFWX 2V50A 3OW2M 3CWJA 4K0KF 5A8RB 4EFHA 4JRQA 4A8SA 1JCFA 3ZTRA 1TKZB 4JI1F 4QZVB 4U7UD 4WFAL 4IFVA 5HRPA 4IDKB 3MUVP 1Y5IB 4DG1B 1MMNA 2OAUA 5IT9Y 1RCHA 2OEKA 2HIYA 3KLFB 3O3GA 1H7WA 3C95A 4OI2A 1J27A 4KAZA 4OV1A 4CZKA 1TP7A 5ETOA 3QETA 2DR5A 1RAAB 8RUCA 2B4VA 3Q8QB 4CK2A 2GHVC 3UO0A 2YNFA 3E3XA 4GMJB 1WOSA 1FT8A 2RE1A 4TY9A 4Q8FA 3R5AA 3EGWB 3AB4B 4CO0A 1S48A 4X4PA 4DV4J 4J9MA 1YJTA 3VQ6A 1YF5L 4FF2A 2GUPA 1VSLA 4DSIA 1X5OA 3SIPB 3MX5A 3MM8A 2BMBA 4LF7K 1GMWA 3B8HA 4EU0A 1XEZA 2KG0A 4PQUA 3D0HE 4EO6A 2CPHA 2ZWHA 4Z4HA 1QQOA 2P6TA 3W65A 3ZZTA 1IKYB 1GTEA 1G1XA 4DWIA 2WONA 2FC9A 3S9HA 1GLLO 4K0KK 5D0HA 3MWPA 3H46O 1ZTWA 3AVIA 4JI1K 1C0GA 4FPAA 4ZP8A 4TYAA 2QWMA 5BRFA 4O5FA 1L3TA 3PW7A 1DARA 3HX9A 2VOOA 2XLJA 1VLYA 2ASYA 5FROA 2UUBK 1YBUA 5L46A 3CC2S 3DXMA 3CO9A 1EWQA 2GVZB 4CJQA 1HWIA 4BR0A 4CHQA 2PDAA 3FEZA 4ECZA 2CJ9A 2VC0A 2X51A 3ZETB 1GXTA 1IBMJ 1TZ0A 2ZD1B 2J0QD 1KBRA 3D28A 3R7NB 5A8WB 1MSWD 2VBZA 4HH0A 1GLBG 1HYVA 4JP8A 3I0RB 2UUWA 3KMQA 1X4HA 1S99A 1NM1A 1RAOA 1RADB 4PWDA 1KN6A 2GS8A 3CD7A 5KFXA 5K14B 1IBLJ 5DS7A 2W6LA 2V5HG 2CWKA 3PXGa 1F2GA 2HPUA 3KZBA 1YJNN 2B56A 3AY9A 1RT4B 3PX6A 3AXKA 1S9FA 4DCOB 2E1RA 2GV9A 2G0CA 4LSNA 4Y1DA 4C8YA 2B43A 3CCUS 4CHYA 4J37A 3I32A 3ZX2A 2FC8A 1RT1A 1X60A 4GKKK 3CIPA 3HHEA 2NUHA 4CT8A 3PIPQ 3DRRA 1V3ZA 1HR0J 2WONB 5KFFA 4I7FB 3FJ2A 1KVJA 2A6OA 4F26A 1VRTA 1B92A 3WXLA 2IRUA 3UKRB 2KRRA 2F1FA 1T03B 2DPJA 3QIPB 1RACB 3F5TA 2DCLA 3IXQA 4BRLA 3THXB 5HMWA 2F5GA 1XHXA 2VICA 3DRPA 3NCPA 4CEEA 1T95A 3HL8A 3OSPA 2G8UA 1VSKA 3KNAA 4BBYA 3O5TB 2MZRA 3PW2A 3GFXA 1RBTA 2DBBA 1WHWA 4WQ5A 4NXNJ 3SUPA 1CJVA 4LF8J 2RRNA 2MZJA 3TA1A 1AFIA 2V2VA 1RDUA 4PG8A 1VYAA 1SV5B 1RT7B 4DR2F 2R7YA 2W2QP 4TNOA 3N4PA 1TUWA 3AJDA 3MAQA 1U4BA 1HHTP 2C3UA 4ZA1A 3D45A 3K0JA 1RWNB 2EFPA 2QM1A 2CPZA 1HNXK 4ZLNA 1SI9A 4C1NK 2YQ1A 2HK2A 3AJ2A 4W92B 1QVFR 4K7QA 4MYTA 5EXWA 1W7WA 2LDIA 2HVEA 1CSJA 2C3OA 2HMPA 4NZ6A 2LEPA 3MWTA 3TO8A 4WE1A 2CPXA 3SSQA 2AGQA 3CG7A 3WNFA 4FYDA 1T05A 2I7PA 2CNKB 2RD5C 1L3VA 4IJAA 4FOIA 2B6AB 3GIRA 2F9TA 3E8OA 2BGGA 3DHWC 2FLLA 3NS7B 2R7UA 4JYAK 4OZNA 4QWCA 4GMKA 1SBRA 1HWUA 3HHLD 3SZ2A 3H20A 4DXLA 4CM2A 5A2QO 4ZTJA 1FHTA 4QS7A 2DO0A 3A3NB 3CO0P 1JL2A 3EM1A 2XWXA 3VALA 3QBXA 1PJ5A 3C8YA 4DV4K 2DXEA 4KH6A 4B1YB 3HFVA 3P96A 3ALYA 3H8YA 3DLJA 1FA0A 2KL8A 2ZWPA 1SQGA 5GADU 1SH0A 4GVEA 3FR0A 2B4OA 1VBKA 1RE1B 2BKNA 3C65A 2AGOA 3GV7B 2Z1HA 1UZDA 5F8NA 4Z7CA 3RWUA 2XHCA 3G6ES 2DIVA 4CLKA 4BRCA 2Y3YA 6AT1B 2CQDA 1QHTA 3H40A 3IS9B 4ZIVA 3CC4N 1QZ6A 1RDDA 5B09A 3AH6A 4USIA 2MQQA 4ECVA 1ZPWX 2C2DA 2CZVC 2BOPA 4N5SA 1FRJA 4P72A 3M9OB 4DFPA 3AV9A 3PO5A 2OD6A 3GTYX 3C2PA 5AE1A 2MQLA 1TL3A 3U4LA 5KG1A 2V7YA 1KOHA 2OA8A 3QATA 1NGDA 2DH7A 1RAEB 3LM9A 4IH5A 1NJWA 4KAIA 3PACA 1HI1A 1WAJA 4AT1B 3CJQA 1EKRA 1YTUA 3VV2B 4PHTX 1I3OB 3K8WA 4EFAC 2WBNA 5AQIA 1R0BG 2C2OB 1BWVA 3OYNA 4L74A 1EX4A 1TL1B 3CIZA 5GAHP 4FYYB 1HD1A 2LQ9A 3LF0A 4B3RF 1TV6B 4ED1A 4FWPA 4DV5F 2N7YA 3EZWA 2XO6A 1VJWA 4V19J 2RKIB 1MWQA 2OD4A 2JLFA 4DR5K 2D0PA 5F3ZA 2FIUA 5AT1B 4LF5F 4YDUA 2V6AA 4DPXA 5D6GA 4CZCA 1RTZA 1FDDA 5D3GB 2W25A 4O8KA 5IT9U 4LSLA 1K6YA 2OJ3A 1I94K 3OFEA 5GAEI 1UJ5A 2XY8A 3IBCB 3WEEB 3R1XA 1GOCA 4NA3A 4B3TJ 4CEBA 5ETVA 2QYGA 3DXKA 2PZSA 2RH3A 4N76A 3BREA 1QHAA 4DL3A 3OXFA 2YKNB 3THYB 5HL7L 3SAGA 3DGPB 2V8GA 2A41A 1OYEA 4IR1A 2E1YA 3HMJG 3QBWA 1E6YB 3PZPA 2Z58B 1NK7A 1VBXA 3L8BA 4DR4J 4UW2A 2W8KA 3GE1A 2JL9A 3NMUA 1BQMA 5AQVA 2W7AA 4NLBA 4WQ5C 2ZH9A 1RB0A 1ZTTA 1GLFO 2RQKA 3CETA 4DBQA 4DS4A 3FKBA 4URGA 1QUVA 4RW6A 2P9NB 2UU9J 3SV3A 2G0JA 1SC4B 4NLUA 1I39A 4K4TA 3V9ZA 4N8OA 1Q8IA 3Q7CA 1FKOB 4KR0B 2ZNYA 1GFWB 3CFOA 3ZZ0A 1WWHA 2ZH7A 4H5TA 3AVLA 1IH7A 3EY1A 3R5CA 2P9UA 4MLHA 1WBBA 3U3YA 3A8JA 2ILZA 3EPGA 4B9TA 4X62K 2C2KB 2LQ8A 1R27B 1SQKA 4JS5A 4URQU 2UYTA 3FZLA 3R8EA 4LSLB 3OYDA 4QAGA 1NRKA 2E5GA 1UWAA 2RF2B 1FTRA 2BV3A 2HWIA 4IZ9A 4DCHA 3VAFA 1RT2A 4X64J 2GJIA 4DR5J 3T5LA 2D0BA 1AZSB 1R8CA 5DMRA 3P31A 4LBPA 3MOJB 3KHYA 2MLYA 1DFDA 1HWKA 1OH5A 1UPPA 2CJXB 2MYFA 1RT6A 2J6SA 4JI0J 3A1YG 1WF0A 3NP5A 4QW8A 1RWPB 1YJRA 1IV0A 4DSJA 2B4PA 3TR5A 5CYJA 1GOAA 1JLAB 1VQPS 1PBAA 4LFBF 3ZETA 3O9SA 3N4QA 4IKFA 2ZH4A 3TUJC 1HHSA 2D69A 3QICA 2DTUA 4LF6J 2AZ3A 4B9NA 4WU3A 1HMVA 4EUVA 2W4CA 4G1QA 2F9DA 4J9SA 1B0TA 1J5EJ 3A5NC 5E84A 5AQKA 3EZ5A 3LPTA 2Q97A 4DSFA 5IM0B 1QSYA 3HT0A 3Q89A 2L48A 2F7TA 1F21A 4CWBA 2QWPA 3QMQA 3JAMO 2VF3A 4FJXA 2ZEJA 3ZZPA 3ZYYX 4IKAA 4DU7A 4QPTA 2ZBCA 4WPAA 5E3CA 3UIQA 4BLGA 4DU3A 2AU0A 3QSYB 4QYRA 4CVNE 4B1XB