1EP4A

Crystal structure of hiv-1 reverse transcriptase in complex with s-1153
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
536
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Binding of the second generation non-nucleoside inhibitor S-1153 to HIV-1 reverse transcriptase involves extensive main chain hydrogen bonding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 126
structure length 522
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ep4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ep4A05
3VA0A 4ZP6A 4TYBA 4EO8A 1RDAA 2OH2A 2OZMA 2FVCA 4H54A 3VN5A 3TI0A 3HVRA 3S3NA 1ZTTA 4Y1DA 4CF0A 3K58A 4AHRA 1L3SA 1LWFB 4NLVA 3V1QA 3ZSYA 2RN2A 2AU0A 1NOZA 3NGIA 2IJNA 3DLBA 5KFDA 4KI6A 1ZBFA 3BQ0A 4ZTFA 5KFZA 4Z4HA 1DTTA 1BCOA 2QKBA 4NLPA 3NF7A 3GIMA 1DLOB 1ZETA 4I7FA 3C6UA 4NCAA 2VG7B 3IS9A 1EX4A 1X9WA 2OPQB 2WK4A 4OLBA 3NL0A 3AA5X 3KK1B 1RYSA 4ELTA 3VQSA 1RT1A 3OSPA 4DWIA 2HHQA 4DFPA 3RBEA 4DQIA 3P1GA 3MR6A 1NJZA 4MIAA 1S6PB 4ED6A 1JKHB 4LH5A 5CYMA 4RW8A 3DLGA 5KG6A 3WNGA 1WSHA 4M3UA 4CJUA 2YKMA 5KRSA 3OS1A 3DOLB 1N5YA 2JC0A 4FLZA 2XHBA 4IG0B 2D3UA 2I5JA 4CGHA 1RT6A 3LP0B 5DK5A 4Q44A 3UDLA 4URGA 4ECRA 1JX4A 4WZQA 3V81B 2AGQA 2GV9A 1W25A 3GYNA 2DFFA 2UUTA 5DQHA 3CDEA 1NKCA 5HROA 1HNVB 3LAMA 3TAGA 3OYEA 1RBTA 2RDJA 1S5JA 5KT2A 1S0NA 3MEGB 3AVKA 2UVRA 1S1UA 4MIBA 3Q8SB 3DRRB 2O4IA 4M3XA 3NGYA 4O3PA 5KT4A 5HLFA 3OJSA 1NOYA 1S10A 2OYQA 2GC8A 1TAUA 5KFHA 3RMCA 5J1EB 3OHAA 3QNNA 4PY5A 4TY8B 2Z1GA 3V1OA 3BSCA 4MK7A 4IDKA 4NCBA 4KI4A 1LAVA 2ZD1B 1MU2A 3V6HA 4RUAA 3Q8PB 3KJVB 3GIJA 4QW8A 3PX6A 4AHCA 3RMBA 3S9HA 4FJIA 3LP3A 4I9LA 1LW2A 3KLFA 1L3UA 4DSKA 4K4SA 4PUOA 4ICLA 3V9ZA 4DMNA 3L8BA 1QSSA 2AQ4A 2FJWA 1RT2A 2IM3A 4KE5A 4F3OA 5KT7A 3H40A 1CXQA 3NAEA 1S1VB 2ZQBA 2WOMB 4ELUA 4J2EA 1S49A 2GIQA 1JLAB 3SNNA 5J2NB 4PQUA 1CSJA 2WHOA 4CESA 4PA1A 1FKPA 2X78A 4EO6A 4K4YA 2FLPA 2XC9A 1RT7B 3QLHB 1C0MA 3IG1B 1F21A 3PW2A 1CZ9A 3ZSVA 4ECYA 3DOKA 4OKKA 4KSEB 1ZTWA 1HYSA 4CEAA 2E9TA 4O5BA 2YNFB 1HNIB 3QEIA 4CGJA 3AO3A 4FS2A 1JXLA 4EP5A 4FZYA 2HNDB 4B9SA 3DLEB 1SL1A 1I3AA 4TY9A 4TXSA 1LWFA 4CHOA 2HHWA 1RT5B 4DQSA 2D0AA 1EXQA 4CJSA 3SUPA 4BE2A 1WAFA 1VRUB 3O4QA 4RNMA 1TK8A 4MQ3A 3KTQA 4BDYA 3CO9A 5CY4A 1DLOA 4ZVEA 5L1KA 3ISNC 4H4OB 5C5JA 4J9PA 1BISA 4B8AB 3L2QA 5HBMA 2VG7A 5J2QB 3F9KA 3T3FA 2OPQA 3KOAA 3ZSQA 4CJFA 3KK1A 1GOCA 1WSIA 2BQUA 4ZMMA 5KFEA 4CECA 1OS5A 1S6PA 2FC0A 3VQAA 2Y1IA 1RA7A 2IS3A 2IM2A 1JKHA 3H5YA 4XPCA 1B92A 3SQ2A 3L2RA 1S0MA 4NLUA 4CCHA 3FDSA 2NUBA 1VK0A 1HRHA 4CJQA 3DOLA 1UWBB 4QWBA 3KMSA 1BI4B 1SL0A 1UAXA 4IG0A 4HCBA 1T7PA 3PJXA 2ASLA 3QESA 1REVB 3D0PA 2W7OA 3NKYA 5KGWA 4F4WA 1VSEA 1RT4B 1JL2A 5KT6A 3HL8A 4EYIB 2AGPA 4GVMA 3CJ4A 5KG1A 2YHBA 1RDCA 4FJGA 1HNVA 4FLYA 3QEVA 3BGRB 4R0EA 3MEGA 4DL7A 1YT3A 4KBIA 1C1CB 3HP9A 1ASVA 4G1QB 3M8PB 3DRRA 4M42A 2XO7A 1LWCB 3ZCMA 1J5OB 5F9NA 5J1EA 1TKZB 4QAGA 4TY8A 1S97A 2E9RX 1Q8IA 1TQLA 3M9OB 3VQBA 2A1RA 3T1AA 3KJVA 4DU4A 1IKYB 3ZT0A 4FYDA 4WYWA 2G8WA 3G86A 1L5UA 3NBPB 3PJWA 3L3UA 3SYZA 3AVJA 2QKKA 4ZVFA 3U6FA 2XGQA 4J9SA 2XI2A 4ECZA 3MF5A 2QV6A 5C24B 1S1VA 4DSFA 4RNNA 4ZPAA 2WOMA 2WTFA 1TGOA 3B6PA 2RF2B 5KFWA 3FFIB 4DQRA 3QYYA 1JLAA 4CJ4A 4URQU 1S6QB 3NGDA 4ECUA 2JEIA 5J2NA 4CEFA 4Q43A 4DL4A 1RT7A 3QLHA 3IG1A 3A2FA 2UVWA 4DTOA 4NLSA 3PV8A 3VQEA 3LZJA 4CK3A 2HVIA 3OS0A 3OYNA 2HW3A 1CLQA 3AA4A 3QNOA 2IM1A 4XIUA 3AA2A 2YNFA 1HNIA 3TAQA 2AJQA 3KLGB 4K4WA 1C0TB 4CF2A 3PHEA 4NRUA 2ILYA 5HRRA 1A5XA 2R8KA 2HNDA 4DTUA 3KLHB 4QOZB 3DLEA 4OGEA 3KLIB 4CFDA 4CJKA 3VQ9A 5J2MB 1D1UA 3OL8A 3L2WA 4AHTA 3LWMA 4CHZA 1RT5A 2C22A 3KK3B 3MXIA 1VRUA 2V9WA 5KFJA 4HKQA 2EHGA 2B6AB 3ZSWA 4CGGA 4E89A 4UQGA 4CGFA 4O55A 4H4OA 4F4XA 4CEDA 1BGXT 4FLXA 1IKXB 5J2QA 4RZRA 4CJEA 5FRNA 5KG5A 3AVHA 3NHGA 1HYZA 4DQQA 1C1AA 1Z25A 3GV5B 4CHQA 3AVNA 5F8MA 2HWHA 3AVAA 2IDOA 2J6SA 4DU1A 5SWMA 2Y1JA 4LSNB 5I42B 1KLNA 4IRCA 1T05B 2FJXA 4FLTA 4F8RA 4ID1A 2XY7A 4DTSA 1RCHA 2YNGB 1UWBA 1Z4UA 1RILA 1BI4A 1RBRA 3GILA 1S9EB 4E1MA 1REVA 4FK2A 4CHPA 3RMAA 3PY8A 3HSTB 1NK0A 4FLVA 4JRQA 1RT4A 3SPZA 3SQ1A 1Z26A 4M94A 1SKRA 2P5OA 4J9LA 2VWJA 3BGRA 4CEZA 1XHXA 3RR8A 4Q0BB 3M8SA 1C1CA 4QW9A 1WNSA 1QE1B 2XI3A 1HARA 1VSLA 4G1QA 3M8PA 5F9LA 4Z4EA 1SKSA 3HPGA 1LWCA 4BDZA 3QEWA 1J5OA 4IOBA 1TKZA 4GW6A 2P5GA 4DSEA 4ZPBA 2BANB 3G6XA 3DM2B 4J9OA 2JEJA 3TAEA 1WSFA 4ZVGA 3H2LA 4FBUA 1BIZA 2E6MA 4W5QA 1IKYA 2V0NA 3KHHA 3CG7A 2R2UA 3NH0A 2D3ZA 3ITHB 2F96A 3MFIA 3DMJA 3O4NA 4KHUA 4AHVA 3QINA 3OLAA 2LSNA 4W5OA 3NBPA 2R7YA 4KREA 3F73A 3AO1A 4RU9A 5HP1B 4KPYA 4KHWA 5C24A 4RNHA 1YTAA 3U3YA 1RBVA 4B3OB 1TK0A 2ATLA 2RF2A 3OJUA 1RT3B 3FFIA 1Q9XA 3CJ2A 1U48A 3GIIA 4QPXA 1S6QA 3OYIA 4DS5A 1A5VA 1QQCA 1RNHA 2DFHA 2G8VA 2R2SA 3CWJA 3TARA 2ZE2B 4B9UA 4CF1A 1XC9A 4FJLA 1RDRA 5KFKA 4URSA 4OGCA 1S4FA 2YKNB 4NLRA 2VWKA 1RDDA 5T14A 5KFUA 4ZPCA 4KTQA 4M3TA 5F8HA 3MAQA 4ZTJA 3TAMB 5F8JA 3BREA 3KLGA 3V6KA 1C0TA 4M3YA 4NZ0A 3OL9A 3QGHA 2OPSB 3KLHA 1SUQB 4RUCA 3IGVA 1GX6A 4Z4FA 3KLIA 1VSHA 3NH1A 2XRIA 5F8IA 1XHZA 3RBDA 1JLBB 1ZBUA 5J2MA 2FVRA 2DPIA 4OPKA 4MKAA 4U6PA 1RTIB 2W9CA 3KK3A 2PZSA 3PZPA 4XO0A 3PR4A 1VRTB 2B6AA 1K1QA 4HUFA 1ZBIA 4ZP9A 4ID5B 4MH8A 4LSLB 4C8MA 3SI6A 4RW4B 1D9DA 4Z4IA 3H98A 2AGOA 1MMLA 1IKWB 3QIDA 1IKXA 3GV7B 1VSMA 1VSFA 3LANA 1LW0B 4KB7A 1U09A 4ZPDA 1XR6A 3KKSA 4DFMA 5FRMA 2D7SA 1FKOB 3H4BA 4Z4GA 2VG6B 3ULDA 1J9AA 3QZ7A 4R5PB 3CVKA 4LSNA 5I42A 4KO0B 3VQ8A 3CJ0A 1T05A 5JS1A 4Q45A 1S1WB 3V6DB 3SPYA 1SV5B 1HYVA 3RB4A 4FZZA 1D8YA 1S9EA 2XWYA 3B6OA 4K4TA 1KFSA 4FJJA 5E41A 4E7KA 4Y2CA 2X6NA 3U3GA 2OPRB 2B43A 4GMJB 3TQ1A 2KZMA 4O4GB 3MEDA 1QAJA 3OYGA 4KRFA 1N48A 2X74A 3HVAA 1R0AB 3O3HA 5CZ1A 3VA3A 4WE1B 1VSJA 4Q0BA 1LWEB 4Y2AA 2IC3B 3NAIA 1QE1A 4E1NA 4KHQA 5CZ2A 3HVTB 3OY9A 5KT5A 2KFNA 1NHVA 4ECSA 3HPOA 1NJWA 4E0DA 1QTMA 4NLYA 2AX1A 2C2EA 3LWLA 2XY5A 1JLFB 4JV1A 2BANA 4DL5A 1JXBA 4CIGA 2ASDA 4J9KA 3DYAB 2F8EX 3VQ4A 3G0ZA 4FLWA 3PW5A 1A5WA 4M3WA 3TR8A 3ITHA 1SH0A 2WONB 1EETB 2D0BA 2WCXA 1IKVB 2HHTA 4C8KA 1BQNB 1TKTB 4R8UB 1B9DA 5HP1A 4ZP8A 2R2TA 4ED2A 4B9MA 4B3OA 1J54A 2EC0A 3S3OA 1RT3A 2QK9A 4BE1A 3Q8QB 4NLOA 4JUZA 3LP2B 1BL3A 1NNDA 4Y3CA 2IMWP 4DF4A 3I0SB 5KFPA 2PYLA 2BRKA 4O4RA 3AO5A 2ZE2A 5DG7A 3DI6B 3OYLA 4F2SA 2FBYA 2YKNA 3IRXB 3KMQA 2B4JA 2XCAA 4KTZA 4BWMA 5KI6A 2G8HA 2IAJB 4WYLA 3TAMA 3UR0A 2DTUA 2GBZA 4IRKA 1L3VA 2D41A 4TLRA 2F8TA 4NYFA 2OPSA 5KFNA 2DY4A 3RB3A 1SUQA 1N4LA 4CJWA 3RRHA 4E7HA 3PVXA 1JLBA 1W9HA 4WXOA 1ITGA 4B9TA 4DL6A 1RTIA 2ATQA 4K4UA 5C42B 4HUGA 3HJFA 3AA3A 4DFJA 2A1SA 1FK9B 1VRTA 1WAJA 1QSLA 3KD1E 5L9XA 4ID5A 3T19A 4LSLA 4DTXA 4RW4A 1JLGB 4U7CA 2Q3SA 1IKWA 1T94A 1T3NA 1S1TB 1LW0A 3LP0A 2KTQA 2HHSA 4CERA 1KVAA 1FKOA 3V81A 3HYFA 2VG6A 2FBVA 3SZ2A 1U47A 2HWIA 3MEEB 5DLGA 5KFAA 4R5PA 5KFGA 4H4MB 4JRPA 4CJRA 4KO0A 3SUOA 2X6SA 4WXWA 4BE0A 1S1WA 4TN2A 2XY6A 4CEOA 1RBSA 3V6DA 4Z4CA 3CM6A 4HTUA 1NK5A 3P83D 4BDPA 2HHXA 4RNFA 1SV5A 4EYHB 1RTJB 3AO4A 4FBTA 4CEEA 4RW9B 2FLLA 5CYQB 3D28A 1TVRB 4CJ5A 2OPRA 3WNHA 3G6VA 3H5XA 2P51A 3EZ5A 2PY5A 3KHRA 2RPIA 4FJMA 3ASMA 4O4GA 3BSNA 4W5RA 2ZD1A 4OL8A 2W9BB 4Y34A 3V6JA 3K2PA 2R8JA 3VQCA 1C0UB 1R0AA 4WE1A 1LWEA 1GOBA 4LQ9A 4K4ZA 2IC3A 3MR3A 1TKDA 4N76A 4KHRA 3HVTA 2AX0A 4W5TA 3AV9A 3OYKA 4N41A 1KCFA 3QIPB 3RAXA 1UOCA 3OVNA 2BR0A 2GUIA 4E19A 3LPUA 2B5JB 3SFUA 3OYBA 1JLFA 1BHLA 3QIOA 1ZBHA 3BSAA 1S9GB 4J9QA 3C95A 4DG1B 5KFCA 3DYAA 2BDPA 1N6QB 3ISND 3VQ5A 4IKAA 4KTWA 3SQ0A 3NDKA 2YHAA 3VQDA 2WONA 3AVMA 4DTJA 1EETA 5SZTA 1NJYA 3JSMB 1IKVA 3FQLA 3RAQA 1KVBA 1BQNA 1WSGA 4N47A 2OZSA 4O3NA 1TKTA 4R8UA 2G8FA 3DDKA 4F2RA 2D0CA 4E7LA 1TL3B 1C2PA 4EEYA 1BQMB 5DQIA 2QXFA 4IKFA 3WNEA 1IH7A 3LP2A 3RWUA 4FJKA 3I0SA 3ZT2A 4J2BA 2QE5A 2C2RA 3DI6A 3LP1B 4OJRA 1VSKA 3IRXA 4HCCA 3CFRA 1KVCA 4Y1CA 5J2PB 3FRZA 2UVVA 1G15A 4MFBB 3DRPB 3BQ2A 4GC6A 2KW4A 2IAJA 3HHKA 4ECXA 3HT3A 3IN5A 2O4GA 2CKWA 3E01B 4G3IA 3VQ6A 1BCMA 4NYNA 3CJ3A 1S0OA 1KTQA 3BDPA 3V9XA 2V4RA 5KFBA 3VQQA 4DF8A 4ED7A 4IRDA 1U4BA 4ZP7A 3SQ4A 3PO4A 3OHBA 3HVWA 1U49A 5C42A 3BQ1A 1WSJA 1TL1B 3SV3A 3L2UA 4ZVHA 5KFIA 1FK9A 1L3TA 5K14B 2W7PA 3CDWA 1EP4B 3OSNA 1JLGA 4DTMA 5KFXA 3G6YA 4J9RA 1S1TA 5FROA 1C1BB 4X2BA 3UPFA 2P1JA 1X1PA 3MEEA 1SKWA 4CF9A 4FW2A 2RDIA 4RNOA 3O3FA 4H4MA 2E4LA 3NF8A 5EUHA 1TP7A 4NCGB 1JLCB 3RTVA 3PO5A 4B8CA 3AVCA 4TQSA 1N56A 1RTJA 5JUMA 1RBUA 3SV4A 1SH3A 1RTHB 4RW9A 2W8KA 4KB1A 5CYQA 1TVRA 3OYCA 4NYZA 4DSLA 1CXUA 5KFRA 4NLTA 5KG0A 4O3RA 3PX4A 4FW1A 2W9BA 5DGAA 5F8NA 2EX3A 4ICLB 5KTQA 3ZSRA 3PX0A 2E6LA 1C0UA 5DG9A 1KSPA 4M95A 1JIHA 4K50A 4IR9A 1J53A 3OS2A 4KHYA 4FVMA 3K5OA 3ALYA 4HVJA 3M8RA 3SUNA 3CQ8A 3QIPA 3H5UA 1HQUB 3EPGA 3AVFA 4Z0UA 1QAIA 1QHTA 3QETA 2B5JA 3DRSB 4QCLA 4QWCA 3BSOA 4XPEA 1IG9A 1S9GA 4NLWA 2XGPA 4HYKA 1N6QA 3EZUA 3MXMA 5EWFA 3QGIA 3JSMA 4MK9A 2XY8A 4BACA 4J9MA 3NE6A 2JEFA 1BIUA 4OKEA 3MR2A 2FLNA 3OL7A 3MFHA 1TL3A 4DL2A 2OPPB 2HAIA 3TABA 1BQMA 3H59A 3C6TB 3K5LA 2J6TA 3KK2B 1KFDA 3NGZA 2HNZB 3KHLA 3CM5A 3AVLA 3G10A 4DTPA 1JLEB 3SFGA 3CDUA 3DLHA 4Q8EA 3BR9A 3NFAA 3GV8B 1TAQA 3THVA 1UA1A 4AILC 1WN7A 5C25B 3P5JA 4FJ5A 1W0HA 4GC7A 4ED8A 3LP1A 2OA8A 4O3OA 1NKBA 4ED1A 4M3RA 2ASJA 5J2PA 3EY1A 4C8OA 4MFBA 5HBMB 3DRPA 4CJVA 3NAHA 3ZT4A 5DMRA 5KFOA 2VA2A 3E01A 3S3MA 4OLAA 3OL6A 4KFBB 5HRNA 3VQ7A 5DG8A 3PW0A 1XR5A 1SL2A 4Q5VA 2V4QA 5KG2A 3KLEB 4O44B 2E9ZA 2IBKA 3SJJA 2FVSA 4W5NA 1TL1A 3UIQA 4RW6B 4RW7B 3MECB 5KFLA 4YR2A 4LQ3A 3QEPA 5K14A 4QWEA 4QWAA 1NK6A 3CJ5A 2IM0A 3T5KA 1QSYA 2YNGA 4IG3B 3OYDA 3CYMA 1EP4A 3M8QB 2JGUA 3ZSXA 4IFVB 3LALA 3NCIA 4E7JA 3FSIA 2DFEA 3QEXA 1C1BA 4IFYB 4DLGA 3D45A 5KFQA 1T03B 2HB5A 4B08A 4KHMA 3QO9B 1I39A 4CHNA 4CJ3A 4WFYA 4J2AA 4KKOB 1TKXB 1JLCA 4NCGA 5JXSA 5KFVA 4EBDA 3ZT3A 3N6LA 4CJPA 2GIRA 4DS4A 5JS2A 3SI8A 2YV0X 2YNHB 3AVIA 1HQEB 1RTDB 3PUFA 4HHTA 1JXEA 1S1XB 1RTHA 2W9AA 3EYZA 1D0EA 4KHSA 3H4DA 4I2PB 3SCXA 2KFZA 1U04A 3JYTB 3DM2A 3DLKB 1C6VA 2F8SA 3TVKA 3E51A 4J9NA 4DEZA 4K8XA 4JS4A 1XI1A 3TAFA 3HO1A 4L8RB 1TK5A 2C28A 4AH9A 1D9FA 3RRGA 5EWEA 5KG7A 1WLJA 4YNQA 4J2DA 1HQUA 4DSJA 3I0RB 4CFBA 3DRSA 3NH2A 4KB0A 4IH7A 4WFZA 5F8LA 5KG3A 5DQGA 4CFAA 3HP6A 1WSEA 1KHVA 1NKEA 4YR0A 2J6UA 5FDLB 1VSIA 2RKIB 4CK2A 4KAZA 3L2VA 3O3GA 1JLQB 3N6NA 3MTKA 1GX5A 4EBCA 1HPZB 2CJQA 3C94A 3HM9A 3K59A 2ZKUA 4B9LA 3QGGA 1D5AA 2OPPA 4IH6A 4FM2A 5F8GA 1NK4A 3C6TA 3KK2A 2HNZA 4MKBA 4TYAA 3RMDA 1KLMB 1KHWA 2BE2B 1GOAA 1JLEA 3IAYA 3V9SA 3V9WA 4E7IA 4I2QB 4WFXA 4O3SA 5KFFA 3LAKA 5C25A 3K57A 3RB0A 4EZ9A 4K4VA 4CK1A 1DTQB 1NK8A 4ZHRB 3MXJA 3HXMA 3CFOA 3TAPA 4LD0A 2AWZA 2ITGA 4DSIA 2FJVA 3H5SA 2XCPA 3IGNA 4EZ6A 2BQ3A 4KFBA 1EKEA 2YNIB 2ILZA 4ECTA 1XR7A 4F4KA 3HK2A 2JLEA 2VG5B 4DLEA 4OPJA 4JS5A 4PWDB 3LPTA 3KLEA 4CJLA 2VA3A 1XWLA 4O44A 4E3SA 1ZBLA 2HNYB 3FQKA 4M41A 3V1RA 4RW6A 3T5HA 1RYRA 4RW7A 2DPJA 3MECA 4TQRA 4ELVA 2HHUA 4JLHA 3I5CA 4CF8A 4YFUA 4IG3A 5L1JA 3M8QA 2BQRA 1CZBA 3KNAA 1LAWA 1I6JA 3NF9A 2I1RA 4IFVA 3EPIA 2HVHA 3AVBA 4DQPA 3T5JA 2G8KA 4CEQA 4M3ZA 4IFYA 4YMEA 4KV8B 5KFSA 3VQPA 1T03A 4DTRA 4O0IA 1HMVB 3QO9A 4AHSA 4OKJA 1RAJA 4CIFA 4FJ9A 3L3VA 3CIZA 4KKOA 2IOCA 1TKXA 2PYJA 5D3GB 3AO2A 4ECWA 1ASUA 3LZIA 2HMIB 4N5SA 4FCYA 3KD5E 5KFYA 2KZZA 5DLFA 2YNHA 3DLRA 4CEBA 1HQEA 3N6MA 3M9NB 1RTDA 2G8IA 1QS4A 3LDSA 1S1XA 4FJXA 4N56A 5I3UB 5DGBA 4I2PA 5EDWA 1T8EA 1TV6B 3GQCA 3CFPA 3JYTA 3DMJB 5KFMA 3DLKA 4NLGA 5L1LA 3WNFA 2UUWA 4JV0A 1KRPA 3HPHA 3V9UA 2IA6A 4LY7A 3KIOA 3H08A 3OYAA 3I5BA 2FVPA 3NF6A 4C8LA 3BJYA 4FLUA 3V4IB 1JL1A 3T5LA 4NLDA 4JV2A 2Z1HA 4HUEA 3NMAA 2R2RA 3I0RA 4F4YA 3K5MA 4B9VA 3ZSOA 2Z1JA 1RDBA 4NLQA 4IBNA 2JC1A 5KT3A 4F50A 1NJXA 4QWDA 3K5NA 4CGIA 5EWGA 5FDLA 1WNEA 4NRTA 4KAIA 3HKWA 2RKIA 1Y97A 1JLQA 3ZT1A 2D5RA 3Q8RB 1HPZA 1DTTB 5KFTA 4ECVA 2Z1IA 4I7FB 3C6UB 4FS1A 3KKRA 3KLVA 2W8LA 1ASWA 4I9QA 4K4XA 3IS9B 1K1SA 1O1WA 4RG8A 4DU3A 1X9MA 4NLXA 4CHYA 4IQXA 3ICLA 5HRSA 1NK7A 2FVQA 4ED0A 1KLMA 2BE2A 1RT1B 3PW7A 3PW4A 4I2QA 4B9NA 4CIEA 2W9CB 3AVGA 5CYMB 4RW8B 3DLGB 2ETJA 3OYFA 4KHNA 2YKMB 4LH4A 1DTQA 4MK8A 2W42A 1IO2A 4ZHRA 1N5YB 2BRLA 5HRPA 2I5JB 2IJFA 3SUQA 1RT6B 4FK0A 4FM0A 3OYMA 1S9FA 2IGIA 2R8HA 5L1IA 3QZ8A 3TWHA 4FJNA 4WZMA 2YNIA 2C2DA 4CFCA 3PR5B 4YR3A 4TSXA 2VG5A 4PWDA 2R8IA 4Q8FA 5HROB 4FJ7A 1FXXA 2HNYA 1YVUA 4DL3A 4OVLA 5KGXA 4CJTA 3MR5A 1Q9YA 4F4ZA 1U45A 1ZYQA 1S1UB 1RA6A 5HLFB 4F3TA 3OYHA 4CE9A 4FK4A 3M9MB 3RR7A 1B9FA 4AHUA 3I8DA 4IDKB 1LV5A 3MEDB 1MU2B 4ED3A 3UQSA 1YVFA 3OYJA 1SH2A 1S48A 4KV8A 4BWJA 2UVUA 4C8NA 1NHUA 1LW2B 3KLFB 4YQWA 1K6YA 1HMVA 2WB4A 2KQ2A 5KG4A 5EU7A 1VSDA 4PUOB 2FBTA 3D5MA 3OLBA 3RB6A 1RT2B 5D3GA 3KHGA 3TANA 1QUVA 2HHVA 2HMIA 4K8ZA 4CGDA 4FM1A 1YTUA 3QERA 4EP4A 4DTNA 5I3UA 1HJRA 4ECQA 2FBXA 3I5AA 4IR1A 1NK9A 4PQUB 4YP3A 1TV6A 4IH5A 1FKPB 1X9SA 4EBEA 4O0JA 5KRTA 4O3QA 4FJ8A 2ALZA 4DG1A 2BGGA 2WRMA 2R8GA 4FZXC 4H8KA 1IM4A 3GIKA 4M45A 4DFKA 2JEGA 3ZSZA 2G8UA 4FJHA 4FXDA 3DOKB 2O5DA 5T7BA 3V4IA 1HYSB 1UA0A
chains in the Genus database with same CATH superfamily
4FL9A 2HQCA 1RDAA 3ILLA 2FVCA 2ROEA 3BGLA 2CQDA 3IWNC 1RU2A 4LFBF 1QUPA 2UV8A 5LMUJ 2RN2A 2H3GX 4CLSA 2AU0A 4Z2XA 2A40A 4CBXA 4KI6A 3I6PA 3CC2N 4Z4HA 1DTTA 3NF7A 3C6UA 4LFAK 3KHYA 1VQKS 4DR1K 1X9WA 2U2FA 2O8FB 2CQ2A 4FXVA 5LMNF 4BRHA 1FX2A 4DV3J 3NL0A 3AA5X 1RYSA 1UEUA 1U1PA 1GQEA 3BV8A 4DWIA 2AP6A 4H4KC 3GE1A 4L3KA 2VFUA 1JKHB 4LF9J 3EVWA 3PACA 3DLGA 1TL7A 3ENHA 5KG6A 3WNGA 2WUSA 2YKMA 5KRSA 4FOEA 2DNGA 3DOLB 4LF5J 5F0WA 4IG0B 2I5JA 4CGHA 3DHXA 4URGA 4RBTA 3VGKA 1KN6A 4WZQA 4IJAA 2AGQA 3K8WA 3E9LA 1SC6A 2E1AA 3WEEA 3MR7A 2EWSA 5HK4A 4RCHA 2RDJA 1S0NA 2CH5A 3C66A 3CJTA 4CZIA 2FY1A 2J9CA 5CR4A 1WEXA 1PJ5A 4M3XA 3KUEA 4O3PA 5HLFA 3VAJA 3QB0A 1S10A 2RHKA 1VC0A 2BJ1A 3V2UC 2W24A 2B9EA 4NCBA 1NB7A 4RUAA 3Q8PB 3KJVB 1HNXF 4I9LA 5FLXO 2OEJA 2JL9A 3CQXA 2N3OA 3ENAA 4ICLA 3V9ZA 2KVIA 4ATNA 1TU0B 3L8BA 1RAIB 1QLNA 4F3OA 2HZCA 4CW7B 2WOMB 4BRQA 4GKJK 1HKCA 3W2VA 2VQEJ 2HRTA 2WHOA 2D9PA 4QU6A 2HRYA 1BQXA 3T6BA 4EO6A 4UT4A 4K4YA 2FLPA 4JKGA 2XC9A 1RT7B 3IG1B 1CZ9A 3AAPA 3ZSVA 2V2KA 3PTWA 2GNKA 3Q2SC 2XYPB 1NGBA 1YDLA 2JFKA 3M7VA 3SSRA 1HYSA 1FT8A 1IBKK 1HNZJ 2O8CB 3L7UA 3VEWA 2R7UA 2CPJA 2ZBPA 3I9V9 4ZPWR 4TY9A 4TXSA 1LWFA 1JJHA 2YWHA 1K0TA 5GAEI 2HHWA 4ED4A 1OPIA 1EXQA 4CJSA 1WC6A 2NXNA 4IOCQ 4RNMA 4ZIVA 1TK8A 3CO9A 3CXCR 4B3MK 4ZVEA 3ISNC 4H4OB 4J9PA 2OCEA 2BOPA 2E5JA 4DX8H 2ZGZA 5A2QY 1GXUA 3F9KA 2OPQA 2HAFA 4PWUA 3KOAA 3KK1A 4MLHA 1WSIA 1ZAWA 3OTDA 3VEOA 1RBOB 4OI6A 2W01A 4CECA 1OS5A 1G4CA 3HLUA 2FC0A 2FGOA 2IS3A 2IM2A 3FLCO 4XPCA 1B92A 3L2RA 1VHXA 1CQMA 2BUNA 4NLUA 4A8KA 3VPZA 2ZH1A 3FDSA 2NUBA 4CJQA 1FO1A 1PAUB 1CJVB 1KC8T 1KP6A 2YKQA 1UAXA 1T7PA 3PJXA 3D0PA 4LRAA 3J7ZT 5KGWA 3QATA 2PN6A 2XMAA 3W8PA 2QGFB 3GWCA 4F4WA 5DDOC 5ADXH 1VSEA 3MPUB 1S0VA 1JL2A 4LF7J 3M8WA 2YX4A 5M1OA 1H72C 2EG2A 2AGPA 5LMUK 1RDCA 2L48A 4FJGA 2FJAB 3BGRB 4PG4A 4BQLA 5DM7Q 3D1QA 2F4VJ 1C1CB 1J2VA 3ZETB 1MMDA 4G1QB 3CJ8A 4FPRA 3DRRA 3CDAA 3R27A 3G2XA 2VGMA 3ZCMA 2RNEA 1DHMA 4PABA 2YCHA 1TQLA 4FYYB 4YDUA 2DR7A 2A6AA 1DBDA 3D6HB 4JKBA 3ZT0A 3FC9A 1VQPN 2BJ3A 2ZJRL 4ILGB 2XS5A 2RE2A 2G8WA 1TUVA 1L5UA 2PI5A 4LF9K 3US5A 1S22A 2GMJA 3NBPB 4PQAA 5TKWA 3AVJA 2QT7A 4K0KF 1D9AA 3HHNB 1KD1O 2UU9J 4LF5K 2XGQA 4J9SA 2XI2A 2YQ1A 3MF5A 3AGRA 2V2ZA 2DITA 1TGOA 1WHWA 3UKRA 4DQRA 3SCIE 1JLAA 4CJ4A 4URQU 4FPIA 1CBKA 4MTPA 2XSJB 4CEFA 2HF4A 5BN9A 3WXKA 1SC3B 3UE5A 3QLHA 2UVWA 4DTOA 3ILIA 4FP9A 2IVOA 2Q79A 3NOGA 5DZ7A 5IC4B 1RWNB 1YJNN 3GG4A 2GAGC 2HYIB 1CLQA 2HW3A 5CZXA 5LJWA 1U1RA 1VFJA 2V8HA 1AROP 5ETLA 2YNFA 3MM8B 1HNIA 3TAQA 2LXUA 5HQ8A 4BGAA 3CCQN 3CCWA 5HAOA 3VF0B 3OW2M 2BMBA 2B9XA 3VQTA 3P49B 3KLHB 3D0GE 3KLIB 2CPHA 3J81U 4OX7A 1VQMN 3OL8A 3L2WA 4AHTA 1RT5A 2C22A 3KK3B 2MZQA 3VAGA 3EO3A 3SCKE 3ZSWA 4WU3A 3DOMB 1YITS 4E89A 4O55A 1VQLN 1M5VC 1EJ7L 1ZOTA 4MAKA 5A6PA 1BGXT 5J2QA 1VLYA 3AVHA 2VQEK 2RJZA 4DUYJ 1Y00A 2E7XA 1Z25A 2YX7A 3AVNA 5F8MA 5AJ3F 3CD6N 2IDOA 2J9DE 4DU1A 1W2IA 2Y1JA 5ETMA 3D2EA 1T05B 2IBOA 4FLTA 2P9UA 3W5YA 3BH6B 4DTSA 1UWBA 1Z4UA 4F3MA 1BI4A 1RBRA 3L6QA 2HQIA 4CHPA 5A0YB 1Q7YO 3PY8A 2YX1A 3QBCA 4J9UE 4QOTA 3SQ1A 1LKZA 4M94A 1GLEG 4J9LA 4DU8A 2VWJA 4JI8J 2HZAA 3EGWB 2F7TA 2XYHB 2DD8S 3LW5C 4KR0B 1QE1B 3H1QA 3M8PA 2HBYB 2Z2ZA 3HSZA 3MPVA 2A6OA 1V3ZA 4IOBA 2Q2RA 1V3SA 2HEKA 3B6BA 3M6WA 3H2LA 4FPBA 4K42A 1RWUA 2GW8A 4ANDA 1IKYA 2VFRA 2E2QA 5DZ6A 4A8QA 4LF6F 1RP5A 3MFIA 4FWMA 1BWVA 3QINA 1N33J 3OLAA 5LJVA 3QICA 3I55S 2R7YA 2DNQA 4KREA 1NLKL 4KPYA 4AQYF 2G2YA 1WI6A 1U2FA 3ONQA 1OQ6A 2NXUA 1RBVA 1TK0A 1U24A 1LWXA 3OJUA 1RT3B 3VAKA 1U48A 1MNEA 3IM8A 2RIJA 4DZDA 2XB2D 3NXZA 3CCVS 2R2SA 3TARA 1XC9A 3R5DA 4X62J 4URSA 2MZTA 1UFKA 3TTDA 1S4FA 1VI7A 2F4VK 2VWKA 4BRMA 1CJKA 5AXMA 1E3MA 3M1FA 2D0PA 1M1HA 4ZPCA 4KTQA 3MN5A 5CE3A 4LREA 2CQ1A 1HKAA 5F8JA 3KLGA 3V6KA 1C0TA 3OTOJ 2AV5A 1UKUA 1SVDA 1PC5A 1H74A 4CI6A 5SUHA 1VJQA 1GX6A 1Y3JA 5DS7A 1IBLF 4CZHA 5J2MA 1DZ5A 2DPIA 3UDVA 4OPKA 1NAQA 1WKKA 4GO7X 2E5LF 5C12A 3PR4A 1K1QA 3NRBA 1FJ7A 1U1NA 1O8BA 4MH8A 4RW4B 4Z4IA 2B7CB 3OUYB 4BS2A 3QIDA 1DQAA 3TO8A 5FJ4A 3MM9A 4GY2B 4ZPDA 2GV1A 5FRMA 2O67A 3KDNA 3ULDA 1J9AA 1Q8BA 4M63A 4DR3K 5I42A 4C11A 4Q7AA 3LM9A 4K25A 2QN6B 4J8FA 2DY1A 1FEEA 1YRTA 5AXKA 4Y2IA 4GKJF 1DQ8A 1HYVA 3CTRA 2GQ2A 1D8YA 4RWWA 3ILOA 2XWYA 1ATRA 2AZ3A 1BUXA 2LEBA 4WFAL 1X4GA 3VGUA 5E41A 2B43A 4K5RA 1B0PA 2KZMA 3MEDA 1QAJA 3MN9A 2OFGX 1N48A 3LF0A 2N82B 4ID8A 2XTJP 5CZ1A 2IC3B 3NAIA 4KHQA 1HBMB 2BKNA 4G6VB 1YHQS 2KFNA 1NHVA 4BC7A 1VQYA 2DYAA 5TKYA 2CPIA 3OVAA 4JV5F 2BANA 2W1BA 5IT9Y 5BYQA 5HQLA 1MWQA 3G0ZA 4DUYK 5ETRA 1R0CB 1JB0C 3ITHA 3U1MA 5IV4A 4ZN1A 4I64A 3HDSA 3DWLA 4DV6J 4PL8A 2I0XA 1BQNB 4R8UB 1BLUA 4OYXA 5HP1A 2V8PA 2R2TA 4B9MA 3DFEA 4B3OA 4WIQA 3N4QA 2HQDA 2CUYA 3S3OA 2QK9A 3POTA 5JMVA 3M8YA 4HH1A 3LP2B 3HSCA 3HI9A 4Y3CA 2I2YA 3I0SB 3R5CA 1ROFA 3AO5A 3GCXP 2G2OA 3OYLA 2CZ9A 4DPUA 4ZJQA 4JI8K 3P45B 2HG4A 3L3CA 1SQGA 2B4JA 2GHPA 4KTZA 2I9SA 1SJFA 2IAJB 2DTUA 3QJJA 3UR0A 2GBZA 1L3VA 2IFXA 4H5WA 1RWOB 5KFNA 2P9NB 3ENQA 1N4LA 4CJWA 4V19X 3RRHA 3BY5A 4JD2A 3VEVA 1RTIA 1NDCA 4HUGA 4RL1A 4JKEA 1N33K 4I56A 3AA3A 4DFJA 4JEPA 2A1SA 3GJSB 4EU0A 1HWJA 1VRTA 3QMQA 3QT6A 3ULHA 1X4AA 2X3GA 4A46A 1PYSB 1JLGB 4DV3F 2JZ5A 2V4JA 2DY9A 1AFJA 3LP0A 3GTYX 1FKOA 4LF9F 3H3OB 2ZKTA 3FNNA 3K17A 5KFAA 2FC9A 2BABA 1HI0P 4H4MB 4X62K 1XEZA 4BE0A 1A0OB 1RBSA 3V6DA 1IQZA 3CM6A 1NK5A 2HHXA 3P83D 2OTLS 2KJVA 2QLFB 1QVFR 3AO4A 2PA8D 4CEEA 2FZKB 3VTIA 4RW9B 1TFWA 5CYQB 2CXEA 3D28A 3R9LA 2OPRA 4DCJB 3H5XA 2PY5A 4FJMA 1K8AO 1WI8A 4OL8A 3UCUP 4Y34A 3NMUA 3MTJA 1C0UB 4I6WA 4P9SA 3C0BA 3QJPA 2IRXA 1GOBA 2RVJA 1JCGA 3I56N 3CC2S 4N76A 3HVTA 4YB6A 3BPDA 2YHWA 1YJ9N 4OZNA 4OI2A 2YWEA 4IOCL 3OYBA 1ZBHA 1BHLA 1H98A 4J9QA 3C95A 2CQ0A 3DYAA 2BDPA 1V5VA 5ETKA 3ISND 3THYA 2E66A 1SPBP 1UJ5A 4KTWA 2YHAA 2WONA 4M7YA 5SZTA 3K0SA 5F2RA 2NXEA 3EVMA 2BM0A 4BRIA 3ZO7A 1N0UA 4N47A 2AJFE 1SC4B 3WUHA 2QLJB 2PDAA 2ZDOA 1TL3B 4Q2MA 3THTA 4GVBA 1E6YB 5DQIA 1JWWA 1NBEB 3R3TA 3WXJA 2MQLA 4JI7J 1MWZA 4B3TJ 4RPFA 3NLCA 1TUGB 3EXYA 3J7YU 2VL1A 2QWPA 4HHJA 3D7EO 4BR7A 3WXMB 3BBBA 3IRXA 3CFRA 1YQHA 4WCEQ 1HNZF 1G15A 4MFBB 4DR2F 2GS8A 2HS4A 2M70A 4GC6A 4D3GA 4KIAA 1QZ5A 2O4GA 1FJGJ 1VCTA 4Z94A 2R7VA 1KTQA 1O13A 3H1VX 1FCAA 1RBLA 4ZDNA 5KFBA 2PD1A 4JI4J 1WJ9A 4NLBA 5A2QU 3A5NC 1U49A 3BQ1A 1LOUA 1TL1B 3SV3A 5EX0A 5E3QA 1T6DA 4DV6K 2IDLA 2W7PA 3BZCA 4A8WA 3BF3A 2MKCA 3R8YA 2WVDA 2A41A 4J9RA 3T1HF 4DN9A 1I3OB 4B3SJ 2QIFA 5HVHA 1VQON 3PLAA 4RNOA 3O3FA 5CYJA 3WBZA 2QTWA 4JK7A 2NLWA 3MM6B 1GLLO 4RKUC 4NCGB 3RTVA 1S6OA 2V9KA 5GAGP 1W7WA 5KQ8A 2W7AA 4MMOA 3NWGA 1RTJA 4NYPA 5JUMA 1OSCA 1RWWB 2W8KA 2DISA 4LF7F 2Q1NA 1PYOB 1TVRA 2NUHA 3OYCA 3ID6A 4NLTA 1O0PA 4ZIWA 3EJMA 5F8NA 2EX3A 1IN0A 3TSUA 3ZSRA 2CG8A 2I8EA 4C3LA 3PX0A 5DG9A 3W5XA 4ZCKA 2CJXB 1JIHA 5LJ3Y 1UAWA 4O5FA 5LSOA 4A48A 1XK8A 5AQGA 4HVJA 2ROGA 1OY9A 2EKNA 3QIPA 1VC5A 1B0TA 3AVFA 5JJBA 4L73A 4QWCA 3BSOA 3D6TB 4F25A 2Q97A 1IG9A 1NBWA 1Z1ZA 2J0SD 4JBCA 5GAHP 3EZUA 4OJ3A 5IT9O 3MXMA 5HMZA 3BGOP 5EWFA 3NVMA 3JSMA 4B3RJ 2UU9F 4J9MA 3J7Z5 2JEFA 3MR2A 2FLNA 2DCUB 2P5VA 1AB8A 4DPTA 3C6TB 2LEAA 2J6TA 4P10A 3NGZA 3KHLA 3CM5A 1JLEB 3ISZA 4Q8EA 1XQIA 4AILC 3AB2B 2ZHBA 2DIUA 4WU2A 2E2PA 2ASJA 5KPTA 4MT1A 4P2SA 4DUZJ 5HBMB 2CWXA 1Q18A 4CLYA 3SBMA 5KFOA 3ZX3A 2VA2A 3E01A 4EWTA 1BUPA 2Z58B 2RUGA 2J7KA 1SL2A 2HHHK 3DLLL 4O44B 1FVSA 2F3JA 4KY3A 4B1XB 3CJKB 1VQPS 3BO3A 3UIQA 5A8KB 3WX4A 4WP3A 4RW7B 3OW2R 1RWXB 4LQ3A 4UUXA 4ISGA 1FDAA 2XZWA 2JGUA 1E6VA 3PNIA 3ZSXA 4DUYF 2G13A 4XH1A 2GVDB 5K8OA 1SIZA 4IFYB 4DLGA 3D45A 3AY9A 3CERA 1ZBSA 1R6YA 4RWXA 4W4MA 3CJ7A 1MMNA 1Q95G 1IUJA 4X65J 4BRDA 5KFVA 2HQ3A 2RE1A 3ZT3A 3N6LA 4CJPA 1NGAA 1YJNS 3A0IX 3OV7A 2YV0X 3MAHA 4DN0A 2ASMA 1HQEB 2E5HA 4A61A 1FJGK 1JXEA 2WW8A 1RTHA 2G0CA 4DX7A 3H3NO 4WP9A 2LDIA 1YRUA 4KYZA 3J7ZO 4I2PB 5AQYA 4JI6J 3F0NA 4V19S 3DM2A 2P9PB 4TNOA 3A3NB 4JI4K 1C6VA 5LM7E 4EMDA 4JI5K 4DCPB 1VQMS 4CWBA 7FD1A 4HACA 4ZKAA 3VMFB 2Q66A 4EI2A 4BQZA 1X0PA 3C15A 3RRGA 2EK6A 5EWEA 4OLPA 4YNQA 1HQUA 3NCRA 2MXYA 1VQLS 3F44A 4DV7F 4MYUA 3BR8A 3UKUA 3F41A 1WSEA 3OTBA 4BGBA 1W2BM 1NKEA 4YR0A 1BG3A 4NA3A 1VSIA 1BC6A 4ES1A 3TW0A 3CD6S 3MTKA 3GFYA 3G8QA 3MMAA 1T3VA 3K59A 5JMNA 1K47A 4B9LA 3QGGA 2HFSA 4WQ5C 3NVKA 1T9TA 5DDRC 4OHXA 5AXNA 1EO1A 3KK2A 1UTAA 3MXHP 1MLAA 1J5EK 1KHWA 1GOAA 2GMLA 5GVQA 3V9WA 4WFXA 1EWRA 5M1FA 5KFFA 2KYXA 2RQCA 4EZ9A 1ZM3A 4QU7A 4BLGA 4FF2A 4CK1A 2KHCA 3MXJA 2W4DA 3OTOF 2UXDJ 2KU7A 4LD0A 3KXDA 2AWZA 1SJ1A 3NCPA 3EVOA 2HVDA 1X4HA 1XUPO 3U27A 3IGNA 1Q7LB 4P71A 1GT8A 2JLEA 2VG5B 2RH3A 3M2RA 1F9HA 4DV1J 3IBWA 1YZ7A 1S7HA 3O4WA 2DGOA 4JI2K 4CZEA 1XWLA 1ZBLA 3BN4A 2QFIA 3V1RA 1I51B 2MQ8A 3MECA 3DXKB 4TQRA 3MDQA 2KO1A 3I5CA 4CF8A 2MPUA 2VPXB 4IG3A 2DO0A 1WB9A 2DHSA 2W4CA 1LAWA 1I6JA 1UVMA 3NF9A 4IFVA 2FLOA 4L76A 1AFIA 3L9ZA 3FBEA 2PYJA 1S72N 5K8NA 3R3LA 1VQ8S 2J0QD 1Q79A 4N5SA 4FCYA 2KZZA 4I69A 5DLFA 5KQDA 5C2GA 3D9BA 3FJ2A 3N6MA 3M9NB 2NRTA 1QS4A 2Q43A 3MX5A 1RLCL 3A8KA 4N56A 5I3UB 3ZLJA 5BYSA 4OZ1A 1T8EA 5EDWA 3ZEUA 1YJWN 3GQCA 3CFPA 3JYTA 1HHSA 3CJRA 4NI2B 2MQOA 1VOMA 3TOQA 5L1LA 1GMWA 2KN4A 2F1FA 4LY7A 2HVEA 5CHIA 2BEFA 1ZA1B 2DH9A 4JOUA 3H08A 3OYAA 2AJ2A 3P38A 1P9QC 1T9WA 3V4IB 4FNIA 1T95A 4JV2A 2EFVA 4HUEA 2IRUA 1XNQJ 1HWUA 3LDLA 2R2RA 3RGIA 2H3EB 3I0RA 2AMCB 3ZSOA 4NA1A 3CIMA 1RDBA 4IBNA 1WOOA 4F50A 1PILA 3SLCA 4NOHA 2PBDA 3AARA 3DN9A 3S8SA 4DV6F 4CGIA 4NRTA 1NGCA 1Y97A 2D5RA 3CJAA 1HPZA 2X3DA 1DTTB 2Z1IA 3CCZA 3C6UB 5GAEU 4FWQA 4P72A 2ZZNA 3Q8VA 1BHNA 1F2GA 1ASWA 4U7UD 4RG8A 2D4WA 5M1KA 3O8MA 1GLDG 3H7HB 3KJQB 1IV0A 4IOAQ 4IZ9A 1KLMA 2BE2A 2DGWA 3PW7A 4JI6K 5BN8A 2Q6CA 4B9NA 4W90B 3W9IA 4JKFA 3DDIA 5D8HB 4WQ4A 3WHIA 3DLGB 1TL7B 4GRSA 4CLPA 3FEZA 3OYFA 2YKMB 3O44A 2E7WA 4MK8A 2M0GB 1CULA 2BRLA 2I5JB 2IJFA 3RSEA 4FK0A 2X1AA 3ZTQA 4FM0A 1HA1A 3OYMA 4KHPJ 4CNZA 2UUCJ 3TWHA 2C2DA 2ZWHA 3C14A 4BHQA 2B9WA 5A8RA 1RAAB 3WEEB 5ITHA 4PWDA 2R8IA 4Q8FA 6FD1A 4A57A 1FXXA 2IVFB 2HNYA 4ILRA 3M5RA 3MR5A 5ETQA 4F4ZA 1FRXA 1YZ6A 2QEXS 2OIHA 2MKJA 5HLFB 3M9MB 3RR7A 1EQYA 2DR6A 2MQPA 2UVUA 4C8NA 1Y7PA 2KQ2A 1U8SA 1VSDA 3D5MA 1YXQA 3RB6A 4QIWD 5IWAK 1JJ2M 1E4FT 2VC1A 4BVOA 2DHGA 4DR4J 2UXDK 2ZUGA 3FZLA 1N0VC 1Y64A 4CGDA 4DPYA 4EP4A 3I5AA 4N7TA 4WCEL 4IR1A 1NK9A 4EHUA 1TV6A 1K8KA 1Y3KA 3D6RA 2XQCA 4O3QA 2C3MA 3SEOA 4JKGB 4DG1A 3Q8YA 3NS6A 2WRMA 3DU5A 2L9WA 4FZXC 4H8KA 4K8RA 1UPPA 5BYRA 5IT4A 2LXIA 2G8UA 4FJHA 2FYXA 2WSEC 4V1Ak 3DRXA 2O5DA 3G25A 4LC9B 1ZM2A 1HYSB 3FVYA 3CCLN 1UA0A 3C65A 2OMOA 2AJ4A 2AEMA 4TYBA 4IEIA 4EO8A 2OZMA 2OH2A 1NMEB 4TKTA 1RGVA 3HVRA 1Q81T 3P4UB 3S3NA 4Y1DA 4NASA 4R0JA 3W65A 1LWFB 1NOZA 4AL7A 3NGIA 1WHXA 5CZVA 5KFDA 3LM2A 2BM1A 3B4MA 2QKBA 4NLPA 3M6XA 3GIMA 2AYEA 2KL8A 4NCAA 4C48A 1KAZA 4JI7F 3K7RA 4B3TF 2OPQB 1YSJA 2WK4A 4KGVB 1P6TA 1XERA 2VJVA 3KK1B 3TNVA 2HGMA 4ELTA 1RT1A 2HHQA 3RBEA 4DQIA 1B0VA 3MR6A 3RAMA 3LA0A 2ITMA 1T9YA 2ZH4A 1AT1B 4RW8A 4F26A 4LF4K 5C2DA 4CJUA 1YJ7A 3OS1A 2AIRB 4QYZJ 1KVKA 4FLZA 2EKYA 2XHBA 2XZTB 1TMJA 3UDLA 5MLCV 2IYIA 4ECRA 1YJ9S 2GV9A 3THWA 2DFFA 1NKCA 3OYEA 1EIYB 1YJTA 5M1NA 1WBBA 1ZM4A 2DNNA 4MIBA 3DRRB 2MSTA 2O4IA 4CLUA 1F0XA 3FGVA 5GMDA 4X64F 5D6GA 2GC8A 4C1NI 5KFHA 4NX9A 3OHAA 2HQFA 4B3SF 3QNNA 4PRFA 2YPZA 3V1OA 2YWWA 2E29A 3JAMY 2ZD1B 1MU2A 3THPA 3V6HA 4QW8A 4AHCA 3T7ZA 3M6VA 4C1NK 1U7LA 4DSKA 2C2KB 1HJOA 4K4SA 1KS2A 1P8ZA 2GEMA 2MZJA 5CA5A 2AQ4A 1IBMF 4GV3A 2W25A 1ZA2B 3NAEA 5ETPA 3NNAA 3TU5A 1QM9A 1RISA 3U02A 3CD7A 3UKRB 4KHPK 4J2EA 2MTLA 1S49A 1RGIA 4ZLJA 1JLAB 2K3IA 2K7KA 1CSJA 4ZA1A 4PA1A 4B1ZA 3QWPA 4RTFD 3IUCA 1GLCG 1VQ9N 4X4PA 3QLHB 1RCOB 7AT1B 1C0MA 3PFOA 1TUUA 3AAQA 3GLJA 2R7WA 3A5LC 4ECYA 3FGUA 4OKKA 2QLBB 4KSEB 1ZTWA 1F9EB 2RRNA 4YHHF 2YNFB 1HNIB 3O80A 4KH0B 3IFEA 3OVSA 3QEIA 2QO3A 2UXCJ 4FS2A 4QR2A 3W2WA 1PCAA 3CC7N 4FZYA 2MMYA 2Z57B 4B9SA 3VF6A 1VBYA 2YTCA 3K5PA 1SL1A 1I3AA 2DR9A 4NPOA 4JI1K 4B3RF 3EZWA 1RT5B 3QT5A 2PT0A 3SUPA 4BE2A 4J9VA 1N36J 2HSEB 3OFEA 2CJKA 3ZYYX 3ETOA 3KTQA 2BKPA 5CY4A 4KQZA 1DLOA 3MMBA 5C5JA 2FDNA 4DR4K 1YGYA 3IDHA 3R7NB 3VETA 5J2QB 2CQ4A 2DHHA 1NPRA 1P9YA 2UUBJ 2KVQE 2BQUA 4LR9A 3E1YA 4LVNP 5KPRA 5IQ6A 1D4XA 5ETOA 1S6PA 3VQAA 3GBTA 4AFFA 3ZX0A 1WOQA 4B02A 3P31A 3HOSA 4GKKJ 3D2EB 2EC2A 3I9ZA 4DUZF 1S0MA 2P9UB 1EZZB 3MCSA 1VK0A 2KG1A 1UWBB 3DCAA 2ATCB 3BDEA 1SL0A 1BI4B 4CQ1A 1M1GA 4DU7A 2ASLA 3QESA 1S77D 1EAYC 1M1KT 2ZH8A 1BDGA 5T7LA 3W5ZA 5KG1A 2PA3A 1Q53A 2GVZA 1HNVA 2E1PA 1WELA 2HGLA 2VBZA 3PYFA 4DL7A 3FKBA 4KBIA 1LNQA 5K8PA 1JCEA 3ET6A 5B0GA 1LFWA 3TWZA 3M8PB 1JJ4A 1RHRB 3KNGA 2XO7A 3ZZOA 2QFJA 2MZ1A 3L0QA 4TY8A 1SKUB 1S97A 1Q8IA 3CCEN 1V5IB 2F9WA 5AXLA 5CD4A 3T9ZA 3VQBA 4JB8B 2A1RA 3L4BC 5F41A 3T1AA 3EXCX 1IKYB 4X65F 3CHWA 2VOPA 4FYDA 2G2ZA 1Q5VA 3G86A 1I5OB 1ICEB 3PJWA 4XDCA 4UOGA 3L3UA 4AXJA 3D6FB 3R6LB 3UN3A 2VBWA 4QYZK 2QV6A 1S1VA 4HTJA 2ZVSA 3B6PA 5KFWA 4JI6F 4BCAA 5BPLA 4ZITA 3J80Y 2WFBA 1OJ4A 3UN2A 3OPKA 4UOCA 4ZLNA 2YJFA 3CSKA 4DCHA 5AT1B 3U4LA 2KXFA 4KT0C 2RT3A 1CJKB 2HVIA 1UW9A 4OZJA 2Q3PA 1KR4A 1SB6A 1D8ZA 1FI4A 2PAVA 4XIUA 1B99A 3EUNA 3KLGB 2GMHA 4K4WA 3ELHA 1BA0A 1C0TB 4CF2A 4NRUA 2ILYA 2PEBA 5HRRA 2RS8A 2YQ3A 5LMNJ 2R8KA 4DTUA 4QOZB 4QYRA 4H5NA 4CFDA 1GMVA 5ETNA 1ZS6A 1WKJA 3VQ9A 3AQOA 1DT9A 5J2MB 1RCXB 1G7CB 3LWMA 2DK2A 5AQFA 3HOTA 2QLXA 2P9IA 5H9EJ 5KFJA 1FDDA 2CPYA 1VQ6N 5B0EA 2Q36A 1T11A 2VF3A 1HW8A 4CGFA 4BC4A 3X3UA 4RWTA 4CEDA 4LSZB 1RTZA 2X1GA 1U2RA 1W2BR 4RZRA 1BWEA 4CJEA 5FRNA 4C2MA 3MM9B 5L38A 1HYZA 1C1AA 3MX2A 1FFWB 3GB0A 4ZCMA 3IR5B 5IFMA 3OFHA 3QBXA 5SWMA 4H4KA 5I42B 4C11B 4IRCA 3E2EA 2FJXA 1M5PC 2UXDF 1SJQA 2Z2LA 2XY7A 2QRRA 4L75A 2IVPA 2J4RA 1H7WA 3M6GA 4JKDA 4HHHA 3SAHA 4E1MA 2R7OA 4FK2A 2UXCK 3FBCA 1NK0A 4FLVA 1R27B 4DV1F 2LU2A 1R59O 1VQSA 1RT4A 3NGKA 3SPZA 1OY6A 4NYOA 1HNXJ 2XLJA 3P5TL 4CEZA 3W3SA 1WNSA 2LA6A 2XI3A 3O1LA 4H0TB 2QWOA 3CT9A 1RK8A 1XNRF 4IJNA 4BDZA 1J5OA 3UB5A 4ZLLA 2P5GA 2BANB 3G6XA 3QQCD 2UUBK 2JEJA 4G1IA 1WSFA 2NRHA 2V8DA 3NS5A 2B3TB 2E6MA 3CG7A 5JICA 3I4PA 3ITHB 3FBFA 3MM5A 3DMJA 3O4NA 4AHVA 3DNCA 4GKKK 4W5OA 1OY8A 2VODA 4IOAL 4B9QA 1IR0A 4CZJA 3AO1A 2ACYA 4NXNK 2QWRA 5HP1B 1R3NA 3MEKA 4I6YA 5C24A 4RNHA 4DPOA 4B3OB 2ATLA 2RF2A 3FFIA 4K7QA 4UW2A 2VH7A 3POTB 3MWTA 3OYIA 5HATA 1FNOA 1A5VA 1Z6RA 1X3MA 3CWJA 4B9UA 3AA8A 4FJLA 1RDRA 5KFKA 4ZVPB 1XNQF 3GJQB 5AE2A 3MAQA 4C7QA 3S7RA 2ASPA 4M3YA 1FXDA 3OL9A 3QGHA 2H5JB 1YK9A 4YDXA 2JSXA 1G6BA 3NH1A 2CWKA 4JD2B 3RBDA 1XHZA 5JLHA 1F5AA 1DJ0A 4MKAA 4U6PA 1RTIB 4RLEA 2W9CA 1FESA 2PZSA 2PMHA 5HMXA 4CT9A 1GXTA 1VRTB 4JKHA 4ZP9A 4OX6A 1Q7YT 3IC1A 1S72S 4C23A 4UUWA 3SI6A 3VCDA 1D9DA 1FWLA 4I4BA 2CQHA 2V4JB 4LBPA 4KGMA 4N8OA 1VSMA 2CQIA 1GLFO 4W92B 2GX8A 1U09A 1F5CA 2JHEA 1XR6A 4LFBK 2D7SA 1FKOB 4Z4GA 2QG9B 3SQOP 4PHTX 1YJWS 4Z37A 3ZZZA 3CJ0A 3MMJA 2DNZA 3SMSA 1TMMA 1NJIT 5JS1A 4Q45A 4H5VA 4ZVUB 1DY3A 5LXRA 1FFSB 3V6DB 2NS1B 2A3JA 3M3ZA 1JNRB 4FZZA 2UUCF 1S9EA 3B6OA 3WXIA 5AQVA 1TL5A 2ZWPA 2X6NA 5D0GA 3CCMN 1X0FA 4IO8A 1VC6A 2OPRB 5LMNK 2FSKA 2HVZA 5CXTA 3AD9C 2LQBA 1Z05A 3SDEA 4USVA 2VOOA 4ZPVR 3THXA 1VYAA 3RJMB 1GLAG 3LDPA 3SK3A 3O3HA 4Q0BA 5H9EK 3EE8A 4E1NA 4QIVA 1ILYA 2BKOA 3HVTB 3ZZ0A 4K0KJ 5KT5A 4A8SA 2K2PA 3LWLA 2ZC4A 1AA1B 3TUZC 4J9KA 3DYAB 4FLWA 3PW5A 1MN7A 3G82A 4LRCA 5F3TA 2FJBB 3THYB 2OMLA 3TR8A 3B8HA 1RKIA 2GJFA 2WONB 2KYZA 2YHYA 1PJ7A 2GELA 4C8KA 4DR4F 5ETSA 3NEKA 5DETA 4YDDB 4GVBB 3AY0A 3BGUA 4FYWB 3VAIA 1J54A 2EC0A 2YX6A 4IDHA 4G1PA 4CIOA 4BE1A 3Q8QB 4JUZA 4C0OC 1BL3A 1NNDA 2IMWP 2PYLA 3BB5A 3UDEA 2IVNA 1JJ2R 1HNXK 1AUDA 4O4RA 2ZE2A 3J80O 4FYVB 2E7VA 1DQ9A 2KRBA 3PRVA 4F2SA 1FRIA 2FBYA 4BG9A 3IRXB 3LGHA 3KMQA 3FMWA 1NSQA 4BWMA 4A62A 2LVWA 2NRWA 4WYLA 5BPNA 3TAMA 4OPHA 2V63A 2RRAA 4X66J 4IO1A 4NYFA 2OPSA 1NGIA 1NMNA 5MAOA 1AZSA 4EK2A 3PVXA 5HL7Q 3GSIA 3I55N 2DKOB 2VDIA 2DJWA 4M63C 4WXOA 5AJ3J 2CGLA 1HUXA 3FFKB 3HJFA 3QFHA 1QHAA 2VBXA 2BW7A 5DRKA 5LL6d 2D69A 5L9XA 4ID5A 5AQJA 3T19A 1RKJA 4DTXA 1IJJA 1Q82T 3O6WA 4MKVA 4U7CA 3GFZA 1S79A 2DHXA 1KBRA 2BJDA 4DMZA 1T94A 4I6MB 3SBTA 2XMMA 5HQMA 2A1BA 2EFGA 2VG6A 3SZ2A 5CCLA 1U47A 3W9JA 5GMKa 2W41A 1IJFB 3T6JA 4KO0A 3QBWA 5THWA 2XY6A 4CEOA 2OEMA 3QGPA 4HTUA 2XMUA 1NSAA 3VV2B 4EYHB 1RTJB 1RQ0A 3V5RA 4FBTA 4U7BA 4TU9A 2ZGYA 1TVRB 2C3OA 1XMQJ 3G6ES 2GIFA 4USMA 3EZ5A 2R7QA 1FHTA 4W5RA 3V6JA 5E3CA 4BROA 3JQMA 3SJHA 4LF6J 3K2PA 5BR8F 4CLFA 2R8JA 3O1BA 3VQCA 1HHQA 1FRJA 3JAMU 1CPZA 3MCPA 1LWEA 2WSCC 4LQ9A 3E9PA 4K4ZA 4ZJOA 4KHRA 3EN9A 3QIPB 1UOCA 2BR0A 1M90O 1F5BA 2I7NA 3H46O 3C46A 3LPUA 2JX2A 4ED5A 1JLFA 3QIOA 2Z4PA 3I82A 2RU3A 3LTOA 2MZRA 2KT2A 2UXBF 1LXJA 5H9FK 3I96A 2CPZA 2C3UA 4DTJA 2ZH5A 3JSMB 4YB5A 1IKVA 1XMOF 3FQLA 3IBCB 4PKDB 1Q86T 5E7OB 4F9OA 5GADI 4YY3J 3G87A 2OZSA 1SJ4P 1TKTA 3BKTA 4LFCJ 3DDKA 1JNZB 2D0CA 4E7LA 4M5LA 1C2PA 4IXCA 2JVRA 1VIOA 2POKA 4IQMA 5E3AA 1B7YB 4FKXA 4C4WA 3UWTA 2DR5A 4ERDA 4HL9A 1IBLJ 3ZT2A 4CO1A 1HNWF 1B70B 1YHQN 4AM7A 1U1LA 2GQQA 2E5LJ 1KVCA 4Y1CA 1YF5L 1U0HA 3BQ2A 4K0KK 2HK2A 2KW4A 3HHKA 3A3OB 4OMFG 4ECXA 3IN5A 3VR1A 3E01B 4G3IA 3FZBA 3R2CJ 2ZWOA 3TVYA 1BCMA 4NYNA 3VGMA 3ULEA 4DV4F 1LOTB 3CJ3A 1RAOA 2V8GA 3W60A 2ZJPQ 3T1YF 1URRA 1Q81O 2HIQA 5D78A 3FSXA 1U4BA 4IRDA 1N36F 2MYFA 2NUUG 2DT9A 3SAGA 1B3TA 4XEIA 1R6VA 3HVWA 5C42A 3MUTP 1RHMB 5ETVA 2Z30B 5KFIA 5B7WA 2Z8QA 1FK9A 2GGPA 3W64A 1EQMA 3CDWA 3R5GA 3FSYA 3OBWA 3OSNA 2UUBF 1E6VB 2FQQB 1MA9B 5KFXA 3G6YA 3UW1A 3VEYA 1S1TA 2AP1A 1WDTA 3HJVA 3CO0P 3D0HE 1SKWA 2DGUA 4DOZA 4FW2A 2RDIA 4ITSA 4AE5A 3NF8A 5AQOA 1VQ9S 5EUHA 2QYGA 3N4PA 4B8CA 2OI2A 3AVCA 4WWSA 2BACA 1N56A 2PMWA 1RBUA 3Q24A 4FYXB 3SV4A 1RTHB 4YEAA 1WUAA 5DDQC 2E5GA 1WBDA 4NYZA 4JV5J 2EI5A 4O3RA 3IAM9 3CC7S 2CGKA 3D2FA 4RBVA 1MDUB 1UW4A 2CJ9A 3K89A 1ZZNA 5AJ3K 4OYWA 1WKLA 5GMEA 4HACB 4KHYA 4FVMA 4M1KA 3C15B 1WC0A 3IMQJ 1S59A 1BWFO 3M8RA 5AQHA 1WF1A 1PYTA 3CQ8A 3H5UA 1IR2A 2QSWA 3R1XA 1HQUB 2E1MC 3FEYB 1QAIA 4X4OA 1CQNA 5DM6Q 2L3MA 2B5JA 4QCLA 2A42A 3M2VA 2XMWA 3DLJA 4DV0F 1GNKA 1HI1A 1I94J 1S9GA 1NDLA 3UKUB 2FGCA 1G1XA 1FFGB 5LSRA 2QL7B 4XH4A 2XY8A 1H6KX 2V51B 3MMAB 4EGLA 2C2NA 4BACA 3NE6A 4K41A 1BIUA 4LBIA 5AZIA 3MFHA 2PFFB 3GL1A 3TABA 1WC5A 4PG5A 2LQ8A 1BQMA 1NZ8A 3KK2B 1WF2A 1XMQK 3ZC4A 2EBEA 2HRUA 4CO0A 4TU7A 4DTPA 1BOTO 3CDUA 3DLHA 5B08A 3GV8B 1TAQA 2C3YA 3THVA 3NFAA 5LY3A 4LF1A 5HOOA 4LF6K 1R43A 3AODA 3LP1A 2AEJA 1NSKL 3HHLA 3QT8A 4M3RA 3EY1A 4C8OA 1OYEA 2EXUA 3Q0AA 1IBCB 2ZZTA 3NAHA 1KEKA 4AQYK 3ZT4A 3J81O 4NA2A 3OXFA 3S3MA 9RUBA 2UZAA 4DUTA 4OLAA 1QVFM 3TJ9A 1JXVA 5FPEA 5DG8A 1RFQA 1XR5A 3CCES 1OSDA 2X1FA 3M2RB 3HM8A 3K2YA 4PKHA 2KXHA 3P8BB 3BEXA 1NDKA 4KH4A 3MECB 3L95X 3Q86A 1X5SA 3QEPA 1OVQA 3CJ5A 2IM0A 3T5KA 1QSYA 3VZIA 4IG3B 2JJ4D 1M5KC 4HDHA 4BRKA 3J7AP 4IFVB 3MCAB 4M5DA 2G0IA 4E7JA 3W1YC 2QI2A 4BG8A 2QA4G 3QEXA 1C1BA 3SSSA 5KFQA 1IBLK 1UETA 1I39A 3OR2A 3FE1A 3PYDA 3O9UA 4J2AA 4BR0A 4AM6A 2E5LK 1JLCA 4PCQA 1KQSM 4UF4A 5JS2A 4DR5J 5D0EA 1N34J 2DIVA 2DCLA 3OFGA 2DEIA 2A3ZA 4DR6F 4HHTA 3QDKA 1M1KO 1MWYA 3VGTA 5AR0A 3ZEUB 3SCXA 1V4SA 1U04A 3JYTB 5ADXA 2HFNA 1B4SA 2Y0BB 1R0BG 4JP8A 3DGPA 3ZNUA 3E51A 5HJXA 5CCMA 4J9NA 4DEZA 4X4QA 4K8XA 4JS4A 3MDFA 4K2XA 2O1PA 2C28A 3EKSA 3EZOA 2FF6A 2ZH7A 5KG7A 1VQ6S 3KVGA 1WG5A 4BR2A 1VR6A 2GJIA 2H48B 4DSJA 3I0RB 3TP2A 3FCWA 3DRSA 4M5GA 1NO8A 4A8YA 4DPXA 2BJ7A 2Z2MA 4JAXA 2RILA 2DR8A 4CK2A 2NXJA 3N01A 3HSJA 1WG4A 3H6EA 3O3GA 3N6NA 3HMJG 3D0IE 2CZ4A 4EBCA 1HPZB 1D3WA 2CJQA 3C94A 1EARA 3MD1A 4F0MA 3PEJA 2ZKUA 3J7AN 4DR2J 2UUAF 5EGYA 2OPPA 4IH6A 3IWXA 1VRQC 1RUSA 1G99A 2W2PP 1U25A 3BP8A 3U9ZA 1PBAA 3FZFA 4JV5K 2P2CB 3HFVA 1KLMB 2BE2B 3TEGA 4E7IA 5A76A 2QA4S 1CLFA 2F7VA 2ERRA 4Y0WA 3R8EA 2DH7A 4NLCA 2NSCA 3K57A 2ZM6F 2QC3A 3QFWA 1NK8A 1CULB 1IR1A 1VQNN 3RSEB 2CRLA 1S6UA 2A5XA 4C0BA 2FJVA 3H5SA 2XCPA 1KNZA 1X4EA 4HTLA 2BQ3A 4KFBA 1EKEA 3T1HJ 3GFXA 4F4KA 3C14B 4XK8C 4X4VA 4LJMA 5A8RB 4DLEA 4OPJA 3TTFA 2A2CA 4PWDB 4JS5A 3CJ9A 1SXLA 3CD0A 3DJCA 3KLEA 2HNYB 3TA0A 4M41A 3RW7A 4RW6A 3CCSS 3T5HA 2XHWA 3IAS9 1N32J 3NMRA 2COLA 3NOCA 4JLHA 1IG8A 1SJ3P 5BJRA 2K1RA 4YFUA 5L1JA 3NG8A 4ILHA 3M8QA 4DV5J 3CJBA 4RJVA 2HVHA 3AVBA 4ISEA 5AQWA 5JVGQ 4YMEA 4XDDA 2XNQA 3VQPA 1T03A 4O0IA 1S12A 1MSWD 3QO9A 4AHSA 3TSQA 4CIFA 2HS0A 1FNXH 3H8YA 4FJ9A 2GFFA 4DZ6A 3WC0A 3L3VA 4KKOA 2YQ0A 3Q7CA 1TKXA 4YOXA 1QQOA 3A8EA 4DHVA 2CPEA 2Q6BA 4ZCLA 3CETA 3LZIA 1R7IA 4KBOA 2NXCA 3RU0A 2YNHA 5K9FA 2G8IA 4DV3K 1S1XA 2HS3A 3BYPA 4P75A 2CNKB 3O5BA 2H5IB 1T9VA 1WTFA 2QWLA 1TV6B 1K8KB 2AT1B 4YOYA 5EOYA 3D67A 4DL0C 1HWKA 3DLKA 2EFQA 4NLGA 5A6WA 1KRPA 2BH1A 3J7A1 3V9UA 2IA6A 1U2VA 2VICA 2NCKL 3BJYA 4FLUA 3HF5A 5HL7L 1HR0F 4HVZA 3RRKA 4USKA 2IY5B 4J90A 3NMAA 3IBFB 2P9SA 4F4YA 3K5MA 4B9VA 2Z1JA 1S7IA 2W2NP 2JC1A 4KH1B 1Y5IB 3OR1A 2OHDA 2ZOMA 5EWGA 5FDLA 3HKWA 1JLQA 3HD2A 3TVZA 2OD6A 4OHZA 4ECVA 1QAXA 3EL2A 3KKRA 8RUCA 2CA9A 2E8AA 2W8LA 2V52B 4K4XA 4DU3A 3OXGA 4OJGA 4NLXA 4CHYA 4PG6A 3ID8A 2B4OA 3ICLA 1KOOA 1NK7A 2PC6A 3CCMS 1RT1B 4LBHA 4ALZA 1ATNA 1M0SA 5JVHQ 4CLZA 1BMQB 3WDOA 1NGEA 2VGNA 4RW8B 4LVOP 4P6QA 1SJRA 3U9DA 1DTQA 4JI3F 1VK8A 2BOAA 5E84A 4L72B 2W42A 3MCNA 1IO2A 4ZHRA 2FPHX 1CC8A 1HHTP 3D54A 4X66F 4X4TA 3BO4A 3SUQA 4U8YA 3J7YP 1VMBA 4BRGA 3GCWP 4BC9A 2DEJA 4TSXA 2FF3B 4H5RA 1JQGA 4DQ8A 3RW6A 3J8AA 5KOXA 2OJ3A 4DL3A 4AUKA 4CJTA 1NH8A 1ZYQA 4HWIA 1HNZK 3D66A 4DR2K 4PYAA 3PCOB 2E2OA 2XMVA 4F3TA 2MKYA 1QQMA 4FPAA 1RADB 1B9FA 4ISFA 4AHUA 4KH6A 1Q78A 1MU2B 3OYJA 2WVCA 2V7YA 2V2VA 1GMUA 1NHUA 3TX8A 4OX9J 2FBTA 3W63A 5D3GA 6FDRA 1PGZA 1NJIO 1QUVA 2HHVA 5I3PA 2KM8B 2HMIA 3AH6A 1XMQF 4FM1A 1YTUA 1OO0B 2M9KA 4CH0S 4DTNA 3T1HK 4DV7J 3TA1A 1X9SA 5M1QA 3CPWM 4O0JA 1NRKA 5KRTA 1J27A 2P9GA 4FJ8A 2P6SA 4H0VB 2BGGA 2YKAA 1IM4A 3GIKA 4M45A 4ANCA 2G1HA 2ZJPL 4FXDA 3GFHA 3AT1B 3NGTA 3H90A 3Q83A 2LU1A 2XHCA 2ALYB 4Y2MA 3AHPA 1H2UX 3WQUA 4DV5K 4H54A 3W2WB 4M5HA 3ENWA 3VN5A 1RHJB 2BZ2A 2BE7D 1Y5LB 3TI0A 4LF7K 4ZLPA 4MKYA 1N5TA 1FDNA 2C2MB 4CF0A 4AHRA 1L3SA 3ADAC 4NLVA 1FRMA 2R7SA 1K73T 1QTNB 2QSFA 3ZZRA 1VQ8N 2IJNA 3DLBA 2BUPA 4YY3F 3BQ0A 1FRLA 4LFCF 1NSPA 4HI2A 5KFZA 3CPEA 4PKGA 1SS6A 2CADA 1BCOA 4L6V3 1DLOB 5JLFA 3MMBB 5D77A 3CW2C 5GADP 2V7ZA 1WDDA 1S4EA 1EX4A 4CBWA 4MDBA 3OXLA 3MN7A 4OLBA 4WTYA 3OSPA 4JK8A 1KVJA 3TEHB 4FWKA 1NJZA 4MIAA 1S6PB 1Q5YA 2UV8G 3L7PA 3HSGA 2VDHA 5CYMA 3PYGA 2VPWB 2E1ZA 2UU9K 4M3UA 3HHDA 3BO2A 1LXNA 3E66A 1N5YA 2NLXA 1RT6A 2H65B 2R7TA 4F4AA 4PXBA 1RDWX 1B7FA 3VWSA 5A2QO 1X5PA 2M88A 3V81B 3K9JA 1Q0NA 1X4BA 2HPUA 2UUTA 2JH3A 5DQHA 3HZGA 2DBBA 2GVZB 1HNVB 3LAMA 3TAGA 1RBTA 5KT2A 5DM6L 5BPMA 1RACB 2H54B 2QLWA 3ET6B 4K2JA 2UVRA 5LXYA 2J7UA 4WYBA 3O2IA 3OJSA 1NOYA 5LT5A 2OYQA 1TAUA 3RMCA 4C8YA 3M1VA 4TY8B 3VZHA 1Q82O 1MW7A 4MK7A 1LAVA 3HFKA 3GIJA 3PX6A 3JQKA 3S9HA 4FJIA 3LP3A 3KLFA 2APOA 4A47A 2D74B 2VKRA 4PUOA 3C6AA 2PE8A 1QSSA 3RYLA 4OI4A 3QFUA 4BRPA 3H40A 1WF0A 1CXQA 1S1VB 2ZQBA 3AOBA 2YI1A 2K7JA 5L39A 2KKHA 2GIQA 3LGMA 4C98A 3SNNA 4PQUA 5AQXA 4CESA 1FKPA 2A6MA 3D68A 2QEXN 4CI0B 4USWA 1MWMA 1F21A 3PW2A 1PAEX 1CZAN 2F40A 3TQEA 1RWPB 2WBRA 2HIYA 5FPDA 2ZHAA 2E9TA 4O5BA 2CJYB 1I94F 1GLBG 2F63A 1JXLA 4EP5A 2VWBA 4USHA 1C0GA 1ZPVA 1SAZA 1YBUA 5E2QA 1S76D 3H2UB 3FMBA 4ANEA 2D0AA 5K8MA 5U47A 4OX9K 3UI3A 1VDHA 2P9IB 2LFVA 3O4QA 4P2FA 4MQ3A 1NZAA 3GE9A 1Q86O 5AQSA 3PEHA 2MY7A 4NO7A 1H7XA 4B8AB 1ZH5A 3L2QA 4FVUA 5HBMA 1UL3A 3MMVA 2VG7A 5GINA 1UJ4A 4CJFA 4DV7K 4OZ0A 1QZ6A 3SCJE 3NWRA 4CBUA 2HURA 2VQFF 3CMEN 3H5YA 1AXQA 4JNEA 3LH2S 2RB7A 4CCHA 4OQJA 1HRHA 1VQ7N 3CCRN 2Y3YA 4PAAA 2YH0A 4HCBA 2VFSA 2Q0RA 3NKYA 2C42A 1IXKA 5D4PA 5B0AA 3CCUN 1PKUA 2QM1A 3SQGA 1XC3A 1RT4B 5KT6A 4EYIB 5FLXY 4GVMA 3CJ4A 2I7PA 2YHBA 3JXOA 4U9RA 4FLYA 5E33A 4R0EA 3QRQA 1NG9A 3MEGA 1HWIA 3HP9A 3U1NA 3C7NA 4FOIA 2M2BA 1ASVA 3MGJA 2PFDA 2ZH2A 2KM8C 4PPZA 4M42A 1RWVB 3OTOK 2YJEA 4J7CA 1J5OB 2GZOA 2IHR1 3LOUA 5J1EA 1ZBTA 4QQBA 1I1GA 3MPWA 4HH0A 3M9OB 3UNYA 2L9DA 3CJQA 3N28A 1WC3A 4DB3A 3WIUA 3R7SB 5AQZA 1RAHB 1VK3A 4UZBA 4DR5F 1N34F 2O8DA 3ZFVA 4XH5A 4CM0A 5F0UA 2VZ9A 5C24B 4DSFA 4WKRA 1G3OA 4ZPAA 2IIRA 5ELZA 2RF2B 3FFIB 3NGDA 4ECUA 2JEIA 5J2NA 1D09B 1ZZFA 1KQSR 1H2VZ 3VESA 1SIWB 4DL4A 2B4PA 1CJUA 1YVNA 3A2FA 3HHEA 4LT6A 5K20B 4P2XA 3VQEA 3LZJA 5AE3A 1JMTA 1MROA 3VF2A 1VHIA 3AA4A 1FW6A 3CJCA 4D3HA 1IWGA 2AJQA 1CS4A 3QFPA 1A5XA 2PSZA 1TYQA 4FWPA 2HNDA 3DLEA 4FKYA 4CJKA 1H73A 3HTVA 1D1UA 2RU9A 4CHZA 3KYLA 5EVZA 1WTBA 3MXIA 1VRUA 4ZCIA 4ILMA 2EHGA 5JVGL 4JI0F 4WF9Q 4UQGA 3A1YG 5GIOA 5DM7L 3EICA 4F4XA 2IYGA 3MPYA 3UNGC 2W6LA 1FXRA 3DXMA 5KG5A 3B4DA 1DGKN 4BR4A 1PC4A 3H0PA 4DQQA 4U95A 4A4JA 5GAEP 4HEA9 2HWHA 4IEEA 1HBOA 4F8RA 4ID1A 4PG7A 5FD1A 2YKOA 4OI0A 2O8BB 2YNGB 2VIHA 2F65A 4F0KA 3ZZYA 1J6ZA 1RI7A 1S9EB 4X64J 1IBKJ 1REVA 5AQRA 3EGZA 4DR7F 3QNWB 2PMZD 3M05A 2NYIA 3HSTB 3M32A 2M8HA 4JRQA 2PO4A 4ZVQB 3SDEB 4RUHA 5D0RA 2MLXA 1KAYA 1RXOB 1FEHA 3THXB 2J76E 1KQFB 3KUGA 3BKFA 2C2OB 1N32F 5BRDA 1XHXA 3RR8A 4Q0BB 4QW9A 4BR9A 2NZCA 1HARA 2MZSA 1VSLA 3D2WA 4DV5F 5F9LA 1IBMJ 3QMLA 4Z4EA 1SKSA 3PJ9A 1LWCA 4CTAA 3QEWA 1FX4A 3A8JA 1TKZA 4GW6A 1K0VA 4DSEA 1FTRA 2H1YA 3TAEA 2OD4A 4PWWA 5CHCB 4ZVGA 1KOHA 3R5JB 1OH7A 1BIZA 4W5QA 3G82B 3KHHA 2V0NA 2R2UA 2B56A 3R97A 4AD6A 3TX0A 2F96A 1YWXA 2XBPA 2J8AA 2KHOA 2DRAA 3CEDA 3N0VA 2VASA 5LSLA 3TTCA 2N7YA 4CO2A 5JVHL 4USTA 4YHHJ 1YTAA 8ATCB 4CJ7A 1VQNS 1Q9XA 3CJ2A 3GIIA 5GADU 1R89A 4OYZA 1S6QA 5B0DA 4DS5A 5L8RC 4OYOA 1QQCA 1RNHA 3JS6A 2A18A 1RAEB 1ZAVA 2ZE2B 3NY0A 4CF1A 4OGCA 3GSDA 3PRDA 2N4DA 1NUEA 1RDDA 2MGZA 1RAGB 3HKZD 4F7VA 1RDUA 5KFUA 4A59A 3AJ1A 4M7XA 4DX6A 3OTCA 3UFCX 3VGVA 3TAMB 5FPNA 4NXMF 2OPSB 2VUGA 2XZDB 1NGHA 4OLOA 4RUCA 2P9LA 2OTJN 4Z4FA 3CCJN 1AZSB 1VSHA 2XRIA 5F8IA 4CZKA 3LDQA 2QWNA 2FVRA 2K8GA 2DGTA 5D4NA 1F1BB 3Q8UA 4K5SA 1TUWA 2CVIA 2QL9B 3PZPA 3V4MA 3G96A 5CQGA 1YBAA 2AYBA 4WJBA 2B6AA 2FSJA 3C2PA 4ID5B 4C8MA 4QBUA 2DXFA 1Q1KA 3PRBA 1GMWD 3GR1A 1MMLA 4E8UA 4HT7A 1IKXA 3GV7B 1VSFA 3LANA 3W62A 5KAKA 3P6YC 1ZPWX 3KKSA 1YRXA 3ZZUA 2ABYA 2GQCA 2VG6B 5FIIA 5HI7A 3IXQA 4BRFA 1UVKA 1BE4A 3QZ7A 2J5AA 3CVKA 1HBUA 4LSNA 4KO0B 3RG6A 3TPQA 1Q4RA 3PIPQ 3GMGA 3R9PA 4M5KA 3MCOA 5EN1A 3SPYA 4P2MA 2H4YB 3RB4A 3VENA 2EW9A 1KFSA 4JI7K 1KTVA 4FJJA 4B3TK 4E7KA 4KJIA 1TR0A 4Y2CA 3U3GA 2H51B 4QIFA 4OI3A 3E9OA 4MYTA 3OYGA 3T9NA 2VD3A 4ZVRB 3NS7B 2ZF5O 1BD6A 3HVAA 2GUPA 3VA3A 1VSJA 3FUYA 1LWEB 4Y2AA 3CDBA 4X4NA 1WORA 5A8WA 2FJDB 2VBYA 5CZ2A 1H1VA 3OY9A 1ZC6A 4ZJLA 4ECSA 1NJWA 4E0DA 4LF8F 2O8EA 4LRDA 2MHEA 4Y00A 2AX1A 2MJNA 2C2EA 2BJEA 2VFVA 2XY5A 1JLFB 2V67A 4DL5A 1JXBA 4CIGA 3NP5A 2ASDA 1U1QA 1UZDA 4OX9F 4M3WA 2P8IA 3FEXB 2C3PA 1X4CA 1IKVB 2RHSB 3CE8A 2HHTA 2H4WB 1XMBA 4A8FA 1AUSL 1TKTB 3CI5A 4ZP8A 4HR2A 4MIWA 3BN7A 2E5IA 2G0JA 3MAAA 4CZMA 4X64K 3IFRA 4B3SK 5E3PA 5H1SQ 4JYAJ 1FTCA 1SZ2A 4QR0A 1YJUA 4NLOA 4C97A 4DF4A 5KFPA 2G1DA 4YOEA 3GDQA 5DG7A 3I8BA 3SAFA 2FHKA 1R31A 2HFUA 1U6FA 4YOVA 2YKNA 2N4CA 2RUSA 4FO0A 1U0HB 5BREA 2XCAA 5C10A 3CULA 2HQGA 3HZEA 4HI1A 1IBMK 5KI6A 3VALA 2G8HA 3CPWR 1N88A 1OVYA 3CIPA 4IRKA 5G0RA 5GIPA 2FHJA 3IM9A 4TLRA 3ULEB 1XQSC 1IM6A 2DY4A 4OZ5A 2I38A 2DGVA 1SUQA 3AA9A 4JKAA 2BJ9A 1SC1B 1UVLA 4HTIA 1JLBA 2KRRA 1OIAA 1W9HA 4AXIA 4B9TA 1ITGA 2ATQA 3O9RA 5C42B 2CQ3A 5GAGI 1VGYA 3ILJA 2AJ1A 1FK9B 3KD1E 4BC5A 3AOAA 2GGPB 3ATVA 4LSLA 2O01C 3U1LA 3AXKA 5BRHA 4YHHK 2Q3SA 1KDNA 2HBJA 1IKWA 1TFYA 1T3NA 1S1TB 1LW0A 3DC2A 4NZ6A 2KTQA 2HHSA 2V34A 3MHYA 2CNOB 2CAJA 3AB4B 3KZBA 4CYUA 5DLGA 2KLAA 4B3RK 2BJ8A 4R5PA 2M52A 2X6SA 4DV2F 4WXWA 3HI0A 1S1WA 5K5MA 2OGUA 4RNFA 1SV5A 1XNRJ 1HBNA 4RX6A 3RBXA 3A3PB 1YBTA 2CH6A 3MWBA 3CC4N 1EKRA 4CJ5A 2KHDA 4KPCA 3VVUA 5GAHI 2YVSA 3ASMA 4O4GA 3BSNA 3D2FB 2ZD1A 5AQQA 1RAFB 1KQGB 3BM7A 4PXEA 1R0AA 3ZTOA 4WE1A 3O5TB 4Y65A 3VAFA 4DUZK 3MR3A 1HKGA 4LR7A 2QMXA 3KG0A 2AX0A 1UCNA 4N41A 3OYKA 2EK1A 2B9YA 4BC3A 3OVNA 5AZJA 2GUIA 2MKIA 4E19A 2MQQA 2B5JB 3SFUA 3M2VB 2JRSA 3BBFA