1EP4A

Crystal structure of hiv-1 reverse transcriptase in complex with s-1153
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
536
structure length
522
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Binding of the second generation non-nucleoside inhibitor S-1153 to HIV-1 reverse transcriptase involves extensive main chain hydrogen bonding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 126
structure length 522
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ep4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ep4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ep4A05
3NAIA 2UVRA 2E9ZA 1LW2A 3NE6A 3KLGB 1QSSA 1QSLA 4H4OA 2HMIB 4Y1CA 4CEBA 1TK0A 3NMAA 3DRSA 3EZUA 1U45A 3WNHA 4AILC 3M8SA 1G15A 3PUFA 4CE9A 3LAKA 3RB0A 4CF1A 3L2RA 4N76A 3M9NB 5T7BA 1JLBA 3NF9A 3QIDA 3AVBA 3U3GA 2WOMA 1EX4A 2JEJA 2VA2A 2RN2A 1S10A 3OYMA 4IR1A 4DFKA 4LH4A 4B8CA 4ED7A 3NGDA 3KLFA 1T03B 4Y1DA 4DQSA 4OLBA 1K1QA 2UVUA 2G8FA 2ZE2A 1D0EA 4NLOA 1IO2A 4NLSA 4G3IA 3M8RA 4IOBA 4CFCA 1RT7A 1B92A 3IGNA 4B08A 2J6TA 3LZIA 3GIJA 4IKFA 4DG1A 4FW2A 4O3SA 3H5YA 1S1UA 5CYMA 1NK5A 4K4YA 2I5JA 1D8YA 4NCGB 3IS9A 1JLGA 1HQUB 2G8UA 4MK9A 1RT4B 1REVB 4ELUA 4K8ZA 1KCFA 5FDLB 1S48A 3PJXA 1QAIA 2W7PA 1DLOA 1RT1B 1RBSA 1S9EB 2HVHA 3QEIA 1TK5A 1CZBA 4ZTFA 5FDLA 4DTSA 2IOCA 4QWBA 1QSYA 1JIHA 4H8KA 2HHTA 3QEVA 1RTJB 3V9ZA 5CZ1A 3DOKA 3K58A 3O3FA 1S9GA 2YKNB 2A1SA 3F73A 4AH9A 1JKHA 2C28A 3ZCMA 3AA3A 1RTJA 4ZVHA 4DWIA 1CZ9A 1ZBHA 4F4XA 2FVSA 4AHSA 2IMWP 4HUEA 4B9LA 5L1IA 2X74A 1SL2A 4J9QA 2BQUA 3I0SB 1HNVB 2WCXA 4TXSA 4K4TA 4PWDB 2O4GA 3L8BA 4DQQA 2XCPA 4ZPDA 4LD0A 2YNHA 4TQRA 1LWCA 4IBNA 1DTTA 4WFZA 3I0SA 3RMCA 4TY8A 4KSEB 4U6PA 3K5MA 3HPHA 1RYRA 4RW7A 2XGPA 3NGZA 3KTQA 4RUCA 1RDDA 5KFYA 3KLEA 4M94A 4W5OA 3PW0A 3T5JA 1QAJA 4CIGA 3LWMA 1C6VA 3QO9A 2HNDA 4CEQA 3VQ8A 2GBZA 5KTQA 4TYBA 3LP2A 1SUQB 4BE0A 3JSMB 1ZETA 1LWFB 4NLYA 1JL1A 3NF7A 2KZMA 1JXBA 2QV6A 1FK9A 2R8JA 3VQ7A 2AX0A 4Y34A 2EC0A 4NLGA 1BQMA 3C6UA 5J2NA 4FJ8A 1VK0A 4CJ3A 3NGYA 2KW4A 1QHTA 4Z4GA 2KFNA 2W8KA 2AGQA 3PY8A 1S6QB 2ALZA 4AHTA 4XIUA 3MEDB 3B6PA 2GIRA 1RT2A 3VQPA 3RWUA 4C8KA 2OPSB 3AVNA 4WYLA 1N56A 3HYFA 1L5UA 3SCXA 4ZVFA 2Y1JA 1RT3B 3MR2A 3KLIB 1RCHA 4E3SA 5DGBA 1D5AA 4Q8EA 2BR0A 3FFIA 1ZTTA 5KG4A 4CK3A 1EP4A 3B6OA 3OLBA 3IAYA 4CGJA 3U3YA 1KHVA 4KHNA 3OL7A 2ATQA 3GIMA 3DLHA 4CJKA 4DSEA 3TAEA 1QQCA 1S6PA 4DTUA 3HO1A 2HNZB 1KTQA 3DI6B 3CQ8A 1OS5A 4KFBA 3CJ5A 3H4BA 1U09A 4CEZA 5FRNA 4QOZB 1GX5A 4N47A 1TKDA 4EO8A 2PY5A 2YKMB 1SL0A 4TQSA 1LWEA 4ZVEA 1IKXB 2XHBA 3FQLA 1KVCA 1JLFB 4DFPA 5DK5A 4CGGA 4DSFA 4FYDA 3CFOA 4OKJA 4DSLA 3NBPB 2HHUA 2FBXA 2WTFA 3PO4A 5L1JA 5J2PA 1KLMA 4RW4A 3HP6A 4NLTA 2W9CB 3QZ7A 1XI1A 5KG2A 4DLEA 3V6DA 1T94A 3AVMA 3RMDA 4BWJA 2XC9A 2VG5B 2FBYA 5DGAA 1J5OA 3V9WA 1T05A 4BDPA 2AX1A 3BQ0A 3DDKA 3H5SA 4KE5A 4KB7A 5CYQB 3OYFA 2ETJA 3S3NA 3QEWA 2WRMA 4E1NA 1X1PA 2QKBA 3OYEA 4JRQA 3O3HA 3VQCA 2OA8A 3H2LA 4FLUA 4W5TA 2JC1A 2G8IA 1QTMA 1BL3A 2CJQA 1C1BA 1YT3A 1W25A 3LP3A 4OJRA 3QINA 3SFGA 3MECA 4YFUA 1KFSA 4FJ5A 4CEFA 1YVUA 2KTQA 3UR0A 3AVKA 4NRTA 5DQGA 1TV6B 3K5NA 3C95A 4LQ3A 2R2UA 2RDJA 1GOBA 1RT6A 1S1WB 3DLGB 4GW6A 4QCLA 3KK3B 1VRTA 1T8EA 4FLVA 4QW9A 3G10A 3DRPA 4RW8A 4WXWA 5KG6A 3M8QB 1WNEA 4I9QA 2JEIA 3DM2A 4KAIA 4Q44A 4FS1A 4IRDA 1HNIA 3ZSVA 1TKTA 4DSJA 2QK9A 5KFVA 5J1EB 1JLCA 3E51A 3HPGA 2OPPB 1TKXB 2ITGA 4I2PA 4OL8A 3G0ZA 4F4YA 3QIPA 2PYJA 2G8HA 3ZT1A 2E4LA 2BANA 1R0AB 3K2PA 2OZSA 4FW1A 5J2QA 4CF8A 3KNAA 5F8NA 2FLLA 2IC3A 2YHBA 4B3OA 3MR6A 3ZSWA 4KRFA 4KTQA 2IAJA 3CDEA 4X2BA 2W8LA 3AO1A 4DQPA 3HVTA 4MFBB 4FLTA 4DTNA 3BQ1A 3CVKA 5EUHA 3OVNA 1J9AA 3QETA 1WAFA 2FJVA 4O4GA 1ZBUA 3HP9A 3SV4A 4URQU 2EHGA 4DQIA 4HYKA 3CJ4A 3K57A 4EP4A 3PR5B 4EBEA 2UUWA 1RA6A 3HK2A 1X9SA 2B6AA 3ZT2A 1WSHA 3V81B 3TAMB 1RTHB 1K6YA 4FVMA 3MEGA 4CJWA 3VQDA 3DMJA 1N5YA 4FK4A 4AHUA 4O0IA 3V81A 3DLEA 3BQ2A 1S1XB 4CJUA 4KPYA 3VQ4A 5DLGA 5HLFB 4JUZA 5DMRA 3HXMA 1IKYA 3DYAA 2CKWA 4G1QB 1IKWB 3V6KA 1VSLA 4M95A 4K4ZA 3WNGA 3ZSRA 2B5JA 1FKPB 3SYZA 4KBIA 3HT3A 2VG7B 1IH7A 5KI6A 4I7FB 5DQHA 4M3YA 2IM2A 3TAQA 4KHUA 2EX3A 3ITHB 5KT2A 4RNFA 3PV8A 1KLNA 4ZP6A 1JLEA 3SPYA 3NAEA 4J9KA 3QEXA 4IH6A 3M9OB 4HHTA 3AVFA 3CJ2A 3CO9A 4HUGA 3TABA 3P83D 4TN2A 4CJSA 4M3ZA 4M42A 1KHWA 1RILA 4NLUA 3ZSZA 4E19A 1BCMA 5HROB 1WAJA 3RB4A 1LAWA 1Q9YA 4FJKA 4J9OA 2IM3A 5KFXA 2JEFA 2AQ4A 1NK0A 5KFMA 4TLRA 2D0BA 3I0RA 1TL3B 2E9RX 2D3UA 4O55A 5HROA 1UAXA 3QZ8A 1S1VB 1S49A 2UVVA 4N41A 5L1KA 5KFZA 4CJLA 3CJ0A 4CEOA 3LWLA 3L2WA 3BGRB 3V4IA 4YMEA 3V9UA 5KFOA 1LW2B 1BGXT 5DG8A 3EYZA 4H4OB 4O3OA 3DRSB 5SZTA 4Z4CA 4WFYA 4ELVA 4HCCA 1A5XA 4HCBA 4FLXA 2Z1IA 4AHVA 2GUIA 2Y1IA 1RDRA 5KT4A 4RNMA 1XR7A 3SJJA 3HJFA 1RT5A 1BIZA 3O4QA 4J9PA 3GILA 1JLBB 4IFYA 3I5CA 4FZZA 1RYSA 2WOMB 4PUOA 4OVLA 2DY4A 1VSMA 5F9LA 4EZ6A 3KLFB 3L2QA 4Q0BA 4MIAA 4JS4A 1N6QA 4J9RA 1EXQA 4KI6A 2ZE2B 2J6UA 3RRGA 3AVAA 2D0AA 1JLQA 4F2SA 1MU2A 3RB6A 1JLAB 3LZJA 4DL4A 5K14A 2WONA 1D1UA 2QKKA 3OS1A 3TR8A 1RT7B 1TVRA 1JLAA 4DG1B 4MKAA 3UPFA 4F4KA 4M3RA 3H5UA 3QERA 1S1UB 5CYMB 3KD1E 5KT6A 1QUVA 1NKCA 2I5JB 4CIFA 3UQSA 3IS9B 1JLGB 3AVGA 3QNOA 1RDAA 2IDOA 2HHXA 3VQ6A 2V4RA 4FCYA 3OS0A 1DLOB 2R8IA 3KOAA 3C6TA 3EZ5A 1LW0A 1DTQA 3PHEA 4E89A 3LALA 4KB1A 3PX4A 4NLXA 4XPCA 4URSA 3AVCA 3MEEB 5KFAA 3HKWA 1JXEA 1HMVA 3DOKB 1SKRA 4IRCA 1S9GB 1NNDA 2LSNA 4C8MA 2D5RA 1C2PA 3QGHA 1WSIA 2FLPA 1JKHB 3KK2A 3OSPA 2UUTA 4F3TA 3HVWA 4F50A 3MEEA 1EETA 1C1CA 1D9FA 3NAHA 4RW6A 4E7LA 1VSDA 3KK1A 3T3FA 3UDLA 3H4DA 3M8PA 5KRSA 2HHSA 1VSHA 5JS1A 5FRMA 3D5MA 4QAGA 4FLZA 1VSJA 4BWMA 4FLWA 2KQ2A 2YNHB 4RU9A 5JXSA 3ZSXA 4CEEA 1KVBA 1LWCB 1DTTB 1L3TA 3KLHA 4TY8B 3DLBA 3UIQA 4OLAA 4ZP8A 2X78A 1HQEA 2GIQA 1HARA 2FBTA 2YNGA 4RW7B 1S1TA 3OYLA 2YNFA 4CJFA 1RTIA 4DTRA 3KLEB 3TAFA 3GYNA 1SV5A 4E7JA 3IRXA 2HNDB 3QO9B 4IDKA 2RPIA 2P1JA 1CSJA 2HHVA 3BDPA 3LP2B 5C25A 5C42A 3CFRA 4HKQA 2BQRA 3KLVA 4MQ3A 4OPKA 2ATLA 4N56A 2V0NA 1A5WA 3Q8SB 1IKVA 3THVA 3P5JA 4W5QA 3OYCA 1FK9B 4ED2A 1NK6A 1FKOA 1BQMB 3C6UB 5J2NB 4XPEA 5KFIA 2W9BA 5KGWA 3OL8A 2FVCA 1WSJA 2ZQBA 1KRPA 2AWZA 4YP3A 3TQ1A 2V9WA 4W5NA 2D7SA 2IJFA 3JYTA 2D0CA 3BREA 3CM5A 1EKEA 4B9TA 3IG1A 1RT2B 5HRPA 3EY1A 3HPOA 4YQWA 3H40A 4CFDA 4U7CA 4FJJA 3AVIA 3CG7A 3OL9A 3CDUA 2X6SA 3RB3A 3FFIB 5HRSA 1BHLA 1EP4B 3V9SA 2RF2A 4EO6A 4CGIA 3VA0A 1NKBA 4DSKA 2O4IA 3V1RA 3MTKA 1CXQA 4IG0A 1SH0A 2OPQA 5HRRA 3SQ2A 3G6VA 2J6SA 1U49A 1Q8IA 3AO2A 2P5GA 2FVQA 3NGIA 5C24A 4R8UA 1TGOA 4KB0A 1S6PB 2Z1JA 4Y2CA 1L3SA 1ZBFA 3CM6A 3SQ4A 4KFBB 3E01A 4FJGA 4RNNA 1ZBIA 3OYNA 3ULDA 1Z25A 4H4MA 4PY5A 4K4XA 1JXLA 2IS3A 3F9KA 5I42A 1RBUA 4OGEA 1LWEB 4IR9A 4EBCA 3Q8PB 1XHZA 4CEDA 4YNQA 1Z4UA 4GC7A 1MMLA 1TKZA 3S9HA 2BE2A 4CCHA 2A1RA 1XR6A 1NK8A 3OY9A 4RG8A 4C8LA 4YR2A 5J2PB 1KLMB 4RW4B 1WSGA 3KMQA 3NH0A 3I5BA 1GX6A 3SUQA 3RR7A 3OJUA 4NLDA 3V6DB 1KFDA 1NK9A 4BACA 1C0TA 2GV9A 5F8MA 4ICLA 4EP5A 4KV8A 4ECVA 4QWDA 4J2EA 1J5OB 5EWFA 1T05B 2IJNA 3MXJA 4M3UA 2E6MA 2C2EA 3MXMA 2BRLA 3DRRA 4DF4A 5CZ2A 5EWGA 4L8RB 1C1BB 3RAXA 3DOLA 3ZT3A 4FM2A 3ZT4A 3L2UA 4JV0A 4ED6A 4FK2A 4E7HA 3MECB 2IBKA 1UWBA 4CF2A 5EU7A 5KFGA 1U4BA 4K4UA 4ZHRB 4YR0A 3OYIA 1CLQA 2R2RA 1ZBLA 1YTAA 3L2VA 3S3MA 1I3AA 2ZKUA 5F8JA 4R5PA 4DL2A 1RT6B 4J9NA 2R7YA 4ZHRA 1VRTB 1GOAA 3LAMA 1RA7A 4WZMA 4KKOA 3DRPB 4RW8B 4ED0A 5KG7A 4ECYA 3RBEA 3MR3A 2ILYA 3ISNC 3GV5B 5E41A 3DM2B 3WNEA 4CFAA 4B9VA 1C1AA 1RBVA 3PW7A 1HNIB 4LSLA 4C8NA 4IKAA 4FK0A 1TKTB 3RMBA 4DL7A 3KMSA 1JLCB 3HVAA 1RDBA 5KT7A 1ITGA 4Y3CA 3PZPA 1KSPA 4I2PB 2RKIA 5F8IA 3QNNA 2JLEA 3Q8QB 4CECA 4PQUA 4Q5VA 3MXIA 3C94A 2XO7A 3QIPB 2BANB 1RBRA 3GV8B 1B9DA 4URGA 2BDPA 1SH2A 2XCAA 4NCBA 5J2QB 3PJWA 4EBDA 1WN7A 3DLKA 2G8VA 2IC3B 4B3OB 4CGFA 1D9DA 3DLRA 4DTJA 5HP1A 4FBTA 4ECWA 2IAJB 4DEZA 1TL1A 3LDSA 2JC0A 3NF8A 4E7IA 3HVTB 3T5KA 1HPZA 1I39A 1T3NA 4CHYA 3V9XA 3LP0A 1J54A 3AV9A 3FDSA 4NLRA 3NF6A 2XRIA 2VG6A 4ED8A 4IG3A 4Z4HA 5EWEA 4O4GB 1RNHA 5FROA 5KFCA 3SUOA 5KFFA 3BSOA 4CERA 4DU1A 4IRKA 4FJ7A 2B6AB 1HYSA 3KKSA 4JV2A 4CJ5A 2VWJA 4MK7A 2HNYA 4MIBA 3MEGB 1JL2A 3AA4A 3OYBA 3DMJB 1N5YB 3OL6A 4OKKA 3FRZA 3VQQA 4GC6A 4QPXA 4DL3A 3DLEB 2DPJA 4ID5A 4DL5A 2FVRA 4DU3A 3TI0A 3AO3A 4NLVA 1NOYA 3KJVA 3PVXA 1NK7A 4DL6A 1BI4A 3OYDA 1IKYB 4O3PA 1B9FA 4CHQA 3DYAB 1ASUA 4DTPA 3RR8A 4B9SA 2B5JB 3AA5X 4CJEA 4J9SA 4ZPAA 2OPRA 4MK8A 2FLNA 1BISA 3HHKA 3O3GA 4LSNA 5KGXA 1RTDB 5SWMA 3SNNA 1JLEB 2IM0A 4GMJB 4YR3A 1VSIA 4QWCA 4ID1A 3RRHA 5F8LA 3VQ5A 5DQIA 1SKSA 4KHRA 1RTDA 4RW9A 4CJPA 2XI2A 1F21A 3TANA 3N6MA 1C0UA 5KFHA 4CGDA 4DTOA 2OYQA 4DSIA 1S4FA 3NHGA 4ECRA 1U48A 2W42A 3I0RB 2FJWA 4IQXA 3OHAA 3NCIA 4ECTA 3U6FA 2YHAA 3HL8A 2AGPA 3I8DA 4WE1A 2ILZA 4EEYA 3CJ3A 1QE1A 4MH8A 3MFIA 4BE2A 3V4IB 3QESA 4O3QA 3MFHA 5KFBA 5HBMA 3H98A 3CYMA 5T14A 2I1RA 2C2DA 1VRUA 1LV5A 4FJNA 1U47A 4ECQA 2D41A 4ZP9A 3ZSQA 4KHQA 2WHOA 1NK4A 1RT5B 5KG3A 3BJYA 4IFYB 3LP1A 4ELTA 4CK2A 4PUOB 4AHCA 4W5RA 4E1MA 3PR4A 2DFHA 2BGGA 2HHQA 4CJTA 4KO0A 3D45A 4ZPCA 3NFAA 4DTXA 4Q0BB 5KFUA 3H08A 3QLHA 3O4NA 1N6QB 5D3GA 4BDYA 4WFXA 1TQLA 1JLQB 3AO4A 3ZSOA 1MU2B 1NOZA 3MF5A 5K14B 1BQNA 4O44A 4CK1A 2ASJA 2WONB 1NKEA 2AJQA 3KLGA 5JUMA 1TVRB 5CY4A 2HMIA 1GOCA 3SQ0A 4NYZA 3RAQA 3WNFA 1T7PA 3KD5E 5EDWA 3QEPA 2XWYA 1IM4A 5KFTA 4OGCA 4C8OA 3LPUA 4GVMA 2E6LA 3C6TB 1LW0B 1DTQB 5KT3A 3GIKA 4DS4A 5KFDA 1W9HA 4KREA 2RDIA 2R8HA 2UVWA 1T03A 1ZYQA 2P51A 4O3NA 2FVPA 5JS2A 1YTUA 4I9LA 4BE1A 4NYNA 1HMVB 5KG5A 4FS2A 1UA0A 4Q43A 3CFPA 4N5SA 3KK2B 2B43A 1S0MA 4FM0A 1EETB 1C1CB 4KHWA 3IN5A 4RW6B 2AGOA 3KK1B 4DMNA 3M8PB 3K59A 3TAGA 1RDCA 4TYAA 3RTVA 3VQAA 2E9TA 4NCGA 1HQUA 5KFKA 1RT4A 1REVA 4WYWA 1HRHA 1HYVA 4R0EA 3TAPA 1UOCA 3TARA 5C5JA 1WNSA 1RT1A 3KLHB 2YNIB 2B4JA 1RBTA 1HQEB 1S9EA 2YNGB 1S1TB 4ECUA 2YNFB 5KFJA 4ED1A 1RTIB 3GV7B 4CGHA 2YNIA 4F4ZA 1O1WA 1Q9XA 2PYLA 1SV5B 1ZTWA 1C0MA 3IRXB 4IDKB 2YKNA 3KHHA 5C25B 5C42B 1XC9A 4K8XA 5L9XA 3G6XA 3AA2A 4Q8FA 3H5XA 3V6HA 1SH3A 1Z26A 4CIEA 4Z4IA 1IKVB 3K5LA 3MR5A 2OH2A 2WK4A 1FKOB 3VQSA 4DF8A 2W9BB 4EYHB 1S5JA 5KRTA 3OYKA 1HNVA 2IM1A 1N48A 4PWDA 1UA1A 3HSTB 3JYTB 4OPJA 2ASDA 4M45A 1S0OA 2QXFA 2D3ZA 3V6JA 3IG1B 3VN5A 2GC8A 3RBDA 2F8SA 4J9LA 5KFRA 2ZD1B 4B9NA 2XY7A 1QS4A 4F8RA 3T19A 4OKEA 3LPTA 2Z1GA 2C2RA 2JEGA 1HJRA 2ZD1A 3MAQA 4NYFA 3L3UA 1WLJA 2RF2B 4K4WA 4CJ4A 4HVJA 3Q8RB 1SUQA 3TVKA 4IG0B 2Z1HA 3JSMA 2OPQB 1LWFA 4QW8A 4FBUA 4HUFA 5C24B 4R8UB 3ASMA 1TP7A 4LY7A 3PX6A 2ASLA 3G6YA 4IH5A 3SV3A 2DFFA 1SL1A 3E01B 3SPZA 3LANA 4K4SA 2DPIA 5KG1A 4ECXA 4H4MB 2QE5A 1S6QA 5I42B 3MEDA 4O0JA 4NLWA 3OYAA 4M3XA 4KTWA 3NL0A 4J2BA 2OPSA 3BSNA 3AO5A 3OYJA 1TKZB 1RT3A 4NZ0A 3KLIA 4F2RA 2BE2B 1LAVA 4ZTJA 5DLFA 4Z4EA 1NHVA 1YVFA 3VQBA 5KFWA 3OYGA 4LH5A 4K50A 1FXXA 2R8GA 3KKRA 5DG7A 2AU0A 2V4QA 3K5OA 3D0PA 4EZ9A 1C0TB 4KAZA 5KFNA 4ICLB 3VQ9A 4KV8B 3P1GA 4CFBA 4O3RA 2C22A 4RZRA 2HNZA 3DI6A 4M3TA 4DLGA 5KFQA 3BSAA 1X9MA 3QGIA 3PO5A 3DRRB 2YKMA 1U04A 3NKYA 2FBVA 1IKXA 3OSNA 1ASVA 3IGVA 4FXDA 1JLFA 2KZZA 3DOLB 4M41A 4ECZA 2YV0X 4KHSA 3OHBA 4Z0UA 4J2DA 2XY8A 1UWBB 4DFMA 2HB5A 4QWAA 4ZMMA 4FJMA 3NBPA 2F96A 1BCOA 4DTMA 3D28A 2O5DA 1XWLA 3GQCA 2BQ3A 4H54A 4CJRA 2IGIA 4R5PB 2W9CA 3AVHA 4E7KA 4E0DA 3I5AA 4IH7A 4NLQA 4KKOB 4CJVA 1NJWA 4TY9A 2VG5A 3TWHA 3S3OA 5DG9A 2HAIA 3EPGA 5CYQA 3SZ2A 2BRKA 4DQRA 4J2AA 5KT5A 1K1SA 4Q45A 4LSLB 3NH1A 3NDKA 3QYYA 2KFZA 1ASWA 4NLPA 3HVRA 3ISND 4EYIB 3SUNA 2RKIB 4O5BA 4FJ9A 1N4LA 4PQUB 4FJLA 3GIIA 3PW2A 1SKWA 3V1QA 4CF9A 3BR9A 4DFJA 4CF0A 3HM9A 3SI6A 1TV6A 3DLKB 1XR5A 2X6NA 1Y97A 5HP1B 3SQ1A 1S1WA 3DLGA 4KHMA 1TL1B 1WSFA 3KK3A 4ECSA 4JRPA 1HPZB 4K4VA 1XHXA 4RNHA 1TK8A 3LP0B 2XI3A 1VSFA 2DFEA 3M8QA 2VG6B 1WSEA 4IG3B 1RAJA 5F9NA 5J2MB 4O4RA 5KG0A 3N6LA 3VQEA 3CDWA 4MKBA 5KFSA 4Z4FA 2G8WA 3FQKA 4QWEA 5KFLA 3L3VA 4KTZA 3ZT0A 4J9MA 1L3VA 5J2MA 5J1EA 1BIUA 3ALYA 3FSIA 1HYSB 2PZSA 2OPPA 1TKXA 4FJIA 2FC0A 3OYHA 1HYZA 4CESA 2HNYB 2W9AA 2F8TA 2HWIA 2FJXA 1R0AA 4ZVGA 3OS2A 4NRUA 4ID5B 4FM1A 3KJVB 2VA3A 1BI4B 5L1LA 3H59A 4FZYA 1S0NA 1CXUA 2XY5A 4PA1A 4MFBA 4LQ9A 2DTUA 2IA6A 3V1OA 2VWKA 2Q3SA 4XO0A 2NUBA 4CHOA 3QGGA 3RMAA 4HTUA 4NCAA 4B8AB 2OPRB 4UQGA 3KIOA 4WXOA 1A5VA 4ZP7A 3QIOA 4LSNB 1NHUA 4KHYA 4AHRA 4KI4A 2R2TA 3KHGA 4B9MA 3T5LA 4BDZA 4TSXA 4F4WA 1NJYA 4DU4A 3TAMA 1RTHA 4RW9B 3SI8A 2R2SA 1C0UB 3OJSA 3AVJA 2XGQA 1L3UA 1S97A 1VSEA 2WB4A 4ZPBA 3OLAA 3ZSYA 2HHWA 4IFVB 4B9UA 1S1XA 4FZXC 3CWJA 4I2QB 2F8EX 4CJQA 1NJXA 4CEAA 4WE1B 5HLFA 3M9MB 4JLHA 3VA3A 3BSCA 4WZQA 3SFUA 1QE1B 4G1QA 1IKWA 3KHRA 4IFVA 1KVAA 2HWHA 1W0HA 4I2QA 4JV1A 2HW3A 1FKPA 5HBMB 1IG9A 1S9FA 4CHZA 4FJXA 2W7OA 2VG7A 2R8KA 4CHNA 3SUPA 4I7FA 5HRNA 1VRUB 3T5HA 3PW4A 3ITHA 4RNOA 4CHPA 2OZMA 2JGUA 3PX0A 5KFEA 4ED3A 1I6JA 1JX4A 4DS5A 3PW5A 4FJHA 1TAUA 5F8GA 1VSKA 3LP1B 5F8HA 3T1AA 2XY6A 1J53A 3KHLA 4F3OA 4M3WA 3G86A 4KO0B 4RUAA 5I3UB 3N6NA 2G8KA 2P5OA 3CIZA 3QLHB 4FLYA 1TL3A 5D3GB 3ICLA 5KFPA 4Y2AA 1S1VA 1X9WA 5I3UA 3EPIA 3AVLA 3NH2A 1TAQA 1BQNB 3BGRA 4O44B 2HVIA 3A2FA 4JS5A 1NJZA
chains in the Genus database with same CATH superfamily
1NO8A 2H4WB 3NAIA 3HI0A 1LW2A 1NZAA 3R6LB 3NMAA 1NJIO 2VOOA 1LXNA 1RUSA 3VERA 1GMWD 3TJ9A 3CCQN 2FZGB 1BUXA 2W41A 1FE0A 4K0KF 2AD9A 2PSZA 4ALZA 3M1VA 4FF2A 1HL6A 3C8YA 2JSXA 3I4HX 2P9PA 5LJWA 2WOMA 2VA2A 4OYPA 1WB9A 4IR1A 1N33K 1T03B 4Y1DA 3CD0A 3N4PA 3DGPB 3VGSA 4HHJA 3O5BA 4DR7F 1K1QA 1VQ5S 3IR5B 1ZBSA 2HFOA 2F4VK 1IO2A 3O6WA 4G3IA 2J5AA 4I4BA 5BJRA 3J7AP 3GG4A 1RT7A 1B92A 5K20B 2VQEF 4C1NI 3F56A 2DGSA 2FUG9 3UFCX 3P4UB 4FW2A 4DPXA 3NNHA 5CYMA 4ZCKA 1G3OA 3H2VE 2QTDA 3CUNA 3CD5A 4W90B 1HQUB 3A5NC 2G8UA 3TU5A 3UCZP 5HANA 4ELUA 1KCFA 5FDLB 5A8WB 3PJXA 2A3JA 2KG0A 4NXMJ 1WUUA 1WHVA 1CZBA 2V63A 4DTSA 2QJ3A 3VVTA 2IOCA 4QWBA 2QWNA 3JSBA 1JIHA 3B82A 3QPIA 1WC6A 1HKCA 4LFCK 1VBZA 1RTJB 3O3FA 3THYA 2YKNB 2W2QP 2C2OB 1JKHA 4HDGA 4AL7A 1ZBHA 2OI2A 4F4XA 2FVSA 4HUEA 3PYDA 3UE2A 1IBKK 2Z57B 4CZHA 4K41A 2QSWA 1RISA 4QR0A 3TP2A 2PEHA 1SL2A 3GOIA 1QHAA 4WF9L 3L8BA 1FD8A 1F5AA 2YNHA 1RHQB 3J7ZT 1I1GA 2FSJA 5H1SV 3CJQA 4USKA 3K5MA 3HPHA 1RYRA 1J5EK 2EG1A 4RW7A 2XGPA 2XTJP 1TUWA 4RUCA 4L6V3 2GVZB 4M94A 1BOTO 3T5JA 1QAJA 3QRQA 1C6VA 3OQ2A 4CEQA 3VQ8A 2IRUA 2Z2YB 3NOCA 4NO7A 3Q8UA 3B4DA 1YJ9S 4ZLNA 2FB0A 2DTJA 4IJNA 3LF0A 1PJ5A 2YH0A 1JL1A 3NF7A 4KGZB 2R8JA 3VQ7A 4NLGA 3R1XA 3SMZA 1MNEA 1QHTA 4Z4GA 3MDQA 2V2VA 3FJ2A 1HI8A 1S6QB 5L8RC 4XIUA 4BRPA 3MEDB 4ES3A 4K2JA 7AT1B 4MMOA 3TX0A 2G1DA 3WXIA 2OPSB 3AVNA 4WYLA 1N56A 3DXMB 2WB1D 1NWKA 1RT3B 4PQAA 3CF5L 5DGBA 2HOEA 2E7XA 2BR0A 1BY9A 5KG4A 3CCMN 1Z2ZA 4CK3A 1EP4A 3OLBA 3QQCD 1KHVA 1GLBG 3LDLA 3ONQA 3NRBA 4OV1A 5F0WA 3DLHA 1X5OA 4DSEA 3POTB 3G9CA 2XQCA 1FRJA 5E3CA 2YWKA 2HNZB 1KTQA 3ZTSA 5BYRA 3CMES 1TKDA 2PY5A 3NVMA 3C15A 1LWEA 4DR7K 4X4PA 3A3OB 1B7YB 2XHBA 5AQZA 3ZFVA 1JLFB 4DFPA 1FWPA 1QJHA 4ANCA 4CGGA 1OH8A 1U25A 3CFOA 2NRTA 2VQEK 3K8WA 2VC0A 3CW2C 5AXLA 4RW4A 3CERA 1YJWS 5KG2A 1FJCA 2MZJA 4BWJA 1RTZA 1DKGD 1X4AA 4LF7F 1VQ7S 2XC9A 2XLJA 3Q2TC 3D3CJ 2O8DB 1T05A 2WSEC 3P5BP 4BDPA 3BQ0A 1X4BA 4ATNA 3AY9A 5CYQB 1WHWA 3BKFA 5EGYA 3L0QA 4E1NA 2CQPA 3AB2B 1DJ0A 2QKBA 3P38A 4JI3J 4JRQA 2POKA 5IT4A 2GJ2A 4I64A 5BRHA 2JC1A 4HHUA 2G8IA 2CJQA 1YT3A 4OJRA 4TU7A 1P9QC 3P6YC 4USTA 4YFUA 2MDAA 1XN9A 5M1OA 1TUYA 3O1LA 2RDJA 4P71A 1T8EA 3T1HF 3BP8A 3M8QB 3WIUA 1QDUB 2PO4A 4I9QA 4J37A 3TVYA 2YHXA 3EE9A 2K7JA 4CLZA 1DGKN 1V4TA 1YRUA 5T7LA 4ILHA 3L4BC 1KAXA 1SC1B 1VJWA 3E51A 4OI2A 4KHPK 2OPPB 1TKXB 2BUNA 2Z58B 4I2PA 1N0VC 2DO4A 3ET6B 2NYHA 4F4YA 3QIPA 2AP6A 2G8HA 3HKZD 2DNRA 4LVNP 4WFNQ 3DLLL 2HRTA 2KU7A 2XMKA 3KNAA 5F8NA 2IC3A 3BY5A 3T6BA 1T9TA 3AO1A 4BC4A 5JICA 3PNIA 4DTNA 3MM5B 5D4LA 3OVNA 4B3RK 3HP9A 2Y1RI 4HYKA 4W98A 4EP4A 3K9JA 3PR5B 4EBEA 1PC5A 1I94F 3W5ZA 2UUWA 3V81B 4F9OA 3G6ES 2KJWA 5EX0A 4GV6A 1WKKA 4OZ2A 3VQDA 5AQQA 2HRYA 4OYXA 3SMPA 5AQOA 2D9PA 4DV4F 3MHYA 1S1XB 3UD3P 1G4CA 1RHJB 2ROPA 2Y0BB 2HIQA 1X5PA 3DYAA 4G1QB 1IKWB 2DGTA 3AD7C 1VJQA 1YIJN 2ZZMA 2B5JA 4K2XA 1DFDA 2ZUGA 4BHQA 3HT3A 2B9EA 1TYQB 3D4JA 2P9IA 5HMZA 3L4IA 3NAEA 1ZPWX 2Z4PA 4CWBA 3E1YA 1EQ0A 4I6YA 3AVFA 2M52A 4CJSA 3WQUA 1WOPA 3VAKA 3ZSZA 4NLUA 1XNQK 3MM9A 1QVFR 1BCMA 1NB2A 4CZLA 3GYGA 1LAWA 1T9UA 2IM3A 5KFXA 1NK0A 2D0BA 4V19S 1TL3B 4LF7K 2D3UA 4O55A 5HROA 2UYTA 1UAXA 1F60B 4AQYF 4CJLA 3CJ0A 4Z2XA 3NLCA 3W0LA 3BGRB 2CNKB 1U24A 4YMEA 3WXMB 3DDNA 2W24A 4DUYF 2UUAK 1BLUA 2OANA 2P9EA 4O3OA 5SZTA 4ELVA 3OFFA 1OWXA 1A5XA 4HCBA 2AJ2A 4MT1A 4FLXA 4OHVA 1Y10A 1FNMA 1VQ4N 4DV6J 1RDRA 4X65J 4RNMA 1XR7A 3HJFA 3IMXA 1Q8KA 2ZDPA 3GMGA 4DV7J 1JLBB 3I5CA 1RYSA 4PUOA 4OVLA 1VSMA 1AYEA 1WHYA 4PG4A 2LXFA 3KLFB 2V8GA 2YX6A 1WBBA 4Q0BA 3M32B 3I56S 3T1HK 4QR1A 3O8MA 4OYAA 2ZE2B 2UXBF 1NSAA 2ZZNA 2D0AA 1JLQA 2Q2RA 3VGTA 3HCXA 3NMRA 1MU2A 1YJNN 1X4DA 3LZJA 2NXEA 3C14A 5C2DA 1GLDG 3ENOA 2CH6A 3N28A 3TR8A 1IBMF 4OLPA 3PSIA 1HR0K 3OBWA 3OR2B 1ZC6A 4OPAA 1JLAA 4DG1B 3UPFA 3I32A 1YAGA 4P73A 3VV2B 3BO2A 3AOBA 2AZ1A 3IS9B 1JLGB 2A1BA 3AVGA 2GVDA 1RDAA 3RYLA 4GO5X 2V4RA 4FVUA 2WVDA 1SJ4P 3OS0A 4JKGB 2RMLA 5IC6B 3EZ5A 1DTQA 3PHEA 2UUCF 2CJBA 5L9NA 4KB1A 3PX4A 5JMVA 4NLXA 3RW7A 4UY8T 3LDQA 2JNJA 3HKWA 4HACB 1SKRA 1WTFA 2ABYA 4IXCA 2D5RA 2PA3A 2W01A 1CJTA 1YJTA 3KK2A 2WVCA 3OSPA 4YY3J 1EETA 2X1AA 3AARA 1D9FA 3HZ6A 1R31A 4USHA 5D77A 1VSDA 3T3FA 2NPIA 4WU2A 5JS1A 3CMQA 3MUVP 4BWMA 1LEOA 4UUWA 3ZSXA 4BLGA 1KVBA 4DV4K 3CNQP 2A41A 4B1ZA 1YG0A 2CQCA 1F3VA 1NBEB 4ZP8A 1YUWA 4GO7X 2YNGA 2ROGA 5DM6Q 4CJFA 5THWA 3TAFA 3GJQB 3HULA 2ZH5A 3QO9B 2R7RA 1HPMA 1RCXB 1CSJA 2HHVA 2FHKA 1WWHA 1Y11A 3NEKA 4CTAB 2LQ8A 1IQZA 1S4EA 2I9SA 4HKQA 3KLVA 4MQ3A 4OPKA 2FY1A 4LF4F 3THVA 4RWWA 2GTDA 1FK9B 1NK6A 1FKOA 3VMFB 1M1HA 3CCES 1BQMB 5KFIA 4AL6A 2W9BA 4DN9A 1PG5B 1OY9A 2CH5A 1WSJA 3KJNB 1DURA 2WBNA 2D7SA 5J1PA 4BG9A 2E44A 3BF3A 1HNWK 3IG1A 3C3LA 4PHTX 3HPOA 4N8NA 4HH1A 4YQWA 2I38A 5AJ3K 4AQYK 4H5WA 1D3WA 4BRLA 4OHWA 1RAEB 3M05A 3THWA 3LL3A 3D2EA 1ZM9A 3BM7A 3EZWA 2GUPA 3MX5A 2B8QA 4LBIA 2EFPA 3J7YI 2YY3A 2DR8A 1OVQA 1O51A 3HJVA 1JJHA 4EO6A 1NKBA 3KJFB 3ZXWA 2O4IA 1UJ6A 1S3XA 1VC0A 1IQTA 2P5GA 2QLXA 4X66J 2FVQA 4PKGA 2F7VA 4R8UA 2XS2A 1FESA 2Z1JA 3I4PA 2C2ZB 3CM6A 3E01A 1X3MA 1ZBIA 4DX5A 3GPAA 1NM2A 1Z25A 4LF1A 4PY5A 3F9KA 5DDPC 1RBUA 4B9QA 3G71N 2DEIA 3L6QA 3FGVA 1K73O 5U47A 4CEDA 3HD2A 2QWLA 1B0TA 2UU9K 4EWTA 1VBYA 1EZZB 2KVQE 2DHAA 3D6TB 4QZVB 4QYZK 1U0HA 3S9HA 2O66A 4CCHA 4QS7A 1XR6A 4BRIA 1IR1A 5J2PB 3M8WA 1N5SA 3I5BA 4AF1A 1VMBA 1NK9A 4RJVA 2VOPA 4BACA 4KV8A 5EWFA 1ATRA 2IJNA 4A8YA 2MY8A 2E6MA 4ZIVA 4EMDA 1WI8A 5GAEU 3ULEB 2UUCK 2XSFA 3L4QA 5EWGA 3A0IX 2M2BA 2SXLA 4OI0A 2C1EB 2G0IA 1FJGJ 3DOLA 5GAGI 4FM2A 1PSDA 4ED6A 4FK2A 3MECB 1IBLJ 1R6VA 1E6VB 2ZWHA 1FXLA 2R2RA 1URRA 2ZKUA 4R5PA 4YB6A 1RT6B 4J9NA 1VRTB 2ZDOA 4A8QA 4EUVA 3CJ9A 4C8YA 1RA7A 3EVOA 1SIWB 4DMZA 3DRPB 2QO3A 4CYUB 2JWLA 4RW8B 3O6QA 4OO1J 3RBEA 3C7NB 1R59O 4FSVA 2MHEA 5E41A 3KWGA 4JKBA 3H20A 1TKTB 3IRWP 5AXMA 3VEXA 1VLOA 5BPLA 1UP1A 1ITGA 5AQTA 4R79A 2HZVA 5F8IA 3I82A 3Q8QB 2V51B 3EE8A 2F3JA 4C7QA 3GV8B 1DRZA 1CVJA 1SH2A 4OX9K 1Q5YA 1WN7A 2F9JA 4BRCA 2KM8B 4CGFA 4DTJA 2UV8A 1TL1A 3LDSA 2JC0A 3HVTB 3T5KA 3NCQA 1UEVA 2VBWA 3LP0A 1VQON 3FDSA 3EVWA 4GKKK 4UQTA 1ZPVA 5EWEA 4PXDA 4ANEA 5E3QA 5KFFA 3BSOA 4CERA 5EX3A 3CCJS 1N34F 3TJAA 1HYSA 4JV2A 5HO4A 1APSA 5M1QA 4MIBA 3MEGB 1VISA 5A8RA 1GTEA 2ZH4A 1N5YB 2AA4A 3TX8A 3FRZA 4M5HA 2P9NB 1ESVA 2DPJA 2FVRA 2NXNA 3VETA 3I9ZA 3KJVA 3PVXA 4YOXA 1NK7A 1QVGR 1BWVA 2HFVA 2FHJD 4Y2IA 2QLFB 3AA5X 4CJEA 4J9SA 2KL8A 1BISA 3U9ZA 1FRLA 4YR3A 4JI5J 1CULA 4QWCA 3BN7A 1R89A 5DQIA 1GLJO 4CVNE 3G82B 1NGAA 4RW9A 3TANA 1C0UA 3RRKA 2N7CA 1K8AO 4NXMK 1FKAF 4CZCA 1U48A 1VHXA 2W42A 4Y0FA 2G2ZA 2I8EA 3OHAA 3NCIA 2CYYA 3I8DA 4WE1A 4QIWD 2ILZA 3PACA 1YJ9N 1R6YA 3QESA 5HBMA 3H98A 1LCUA 2CDRB 4IO9L 5T14A 4ZVTB 5GADU 2K3IA 4DX8H 2VBXA 2HZCA 1LV5A 4PG7A 4ZP9A 1F3FA 2E1MC 1PJ7A 2WHOA 1FRKA 1RT5B 4CK2A 1EKSA 3D1OA 4AHCA 5M2RA 4ILGB 2P9KA 2DFHA 2BGGA 4CJTA 4ZPCA 4KPCA 2NPFA 3NFAA 5KFUA 3QLHA 5D3GA 1OVYA 4N77A 3A8IA 3SQGB 1R8HA 4O44A 3PYEA 4OJGA 2XYPB 5L38A 3KLGA 1VAZA 2X3GA 1GOCA 4IEEA 3WC2A 2YKOA 5BREA 2LU1A 2VIHA 1IM4A 4DV3J 1RAAB 1FI4A 3CXCR 2VH7A 1GEHA 3LPUA 2QL9B 5LJ5Y 4A61A 4DZ6A 3EGVA 1NSQA 4CDIA 1NLVA 3E3XA 1LW0B 2F63A 3JAMU 1YJRA 2WSFC 2DIVA 4DV2J 4F0MA 1ZYQA 2X3DA 1YTUA 3EMTA 4BE1A 3MPWA 5F1XA 4TVAB 5K9FA 2NZCA 3KG0A 5AQKA 4PG8A 4I6AA 3W8PA 1HBOB 4G1IA 1S0MA 3W62A 2XMUA 2E1RA 4E98A 5M2UA 4OI6A 3J7ZO 4CLUA 5JJBA 1ROFA 2VFVA 2CJKA 2CVEA 2GZOA 3VQAA 2E9TA 3TQEA 2MKIA 1V3RA 3R9PA 1UOCA 5C5JA 1FEHA 2V9KA 3KLHB 2YNIB 3FZ2A 2OKQA 2B4JA 4LT6A 1S9EA 5BYSA 5RUBA 1DT9A 1S1TB 4ECUA 1VLYA 5KFJA 1UVIA 1IXKA 1RTIB 2CPHA 4ITSA 2PYLA 1ZTWA 4NB4A 3L7OA 3JQKA 4IDKB 2A42A 4G6VB 2YJFA 4P52A 3CI5A 3KDOA 1P27B 3MCNA 1SH3A 2ZHOA 2QLBB 1WF2A 2DYAA 1H7WA 4AM7A 3K5LA 3OT9A 2OH2A 1HIYA 2WK4A 4B3SJ 2FJBB 5DDOC 3VESA 1KQFB 1S5JA 3TUZC 3C19A 3JYTB 2LECA 4EI2A 5DM6L 4OPJA 2ASDA 5H9EJ 4IOAL 2QEXN 4JI3K 1S0OA 2GC8A 2P9UA 3NCPA 3QRPA 5KFRA 1IUJA 2XY7A 2FXUA 4F8RA 3T19A 5JLHA 2D0PA 4LC9B 2B56A 1HJRA 2CDQA 2H5IB 2XNRA 3NGTA 1WKLA 2EC2A 1WLJA 4L76A 3FNNA 4C23A 4DV7F 1SQGA 2AV5A 5HJYA 1UZDA 4IG0B 2R7QA 3BBFA 3JSMA 2OPQB 1CJUA 1X4EA 3VGMA 4QW8A 3JAMY 3J80O 4AE5A 4OYWA 3H2UB 2A5XA 4DU8A 1S5ZA 2V2ZA 2YBVA 3H6EA 3SPZA 2DPIA 4ECXA 1ZAWA 1J27A 2QRRA 2JDJA 3I9V9 3G6EN 1K9MT 3UDVA 4X64J 4M3XA 4BRKA 1WG1A 3NL0A 4JAXA 2LQBA 2QA4S 3R8EA 3SDEB 1HLUA 4OZNA 3TTCA 4KGKA 3KLIA 4WBFA 2BE2B 2D74B 4ZTJA 5DLFA 1K0TA 4WQ4A 1NHVA 2ZVSA 3MEKA 4WPAA 1YVFA 3VQBA 4BGBA 5M2PA 4BR7A 3KKFA 1FRXA 4IDHA 1U1NA 5DG7A 1D09B 3K5OA 4ICLB 1NGGA 4C1NK 4O3RA 1BXNA 2C22A 1FWKA 3GE9A 3K7RA 4DLGA 3HI9A 2YTCA 3BSAA 1K44A 4MYTA 2HS0A 3PIOQ 2Z30B 3ILLA 3CJ8A 3R97A 2LQJA 1VQNS 4M41A 3MN9A 4KHSA 2XNQA 3UDCA 4BRAA 2DR6A 2R9LA 2F96A 1JJ2M 3D28A 2E1CA 1KR4A 1U2VA 4ISFA 1VQ9S 4H54A 4BRDA 4L72B 5CABA 1JJCB 2IGIA 2W9CA 3AVHA 3R2CJ 5LMUJ 4IH7A 2PMWA 2E1ZA 4NLQA 1VQ6N 3W3SA 2VG5A 2VCPA 1F5BA 4A5BA 3A8JA 5DG9A 3FZMA 2HAIA 1DARA 3UKUB 3QJPA 2EKYA 3UKRB 1K1SA 1RSCA 2BJEA 2HBYB 2XMMA 4LSLB 1YQHA 2P2CB 2A10A 1Q16B 1ASWA 3HHLA 2J8SA 2DCLA 1VYAA 4ZJQA 3ISND 3SUNA 2O8BA 4JHDA 4A8OA 4K43A 1VOMA 4KC5A 4O5BA 1N4LA 1RWXB 4FJLA 3THPA 2A6AA 1ZH5A 2J0WA 2RVJA 2CQ0A 2L9WA 2QMWA 2X6NA 3I33A 1X7VA 1B7FA 1S1WA 2Y8YA 1WSFA 4ZJOA 3TPQA 3AODA 1VK8A 2C2KB 1TL7B 3MD1A 4FZVA 3KUHA 4CM2A 3KG4A 1VSFA 4B1WB 5BYQA 4IG3B 1FE4A 1RAJA 5F9NA 3G25A 3CC7S 2E8AA 1JQGA 5IT9O 4QQBA 5KFSA 2MMYA 2G8WA 5F3TA 3FQKA 1CC7A 3AAWB 2HS3A 4JI8F 1N8RT 3MM6B 3FSIA 3CB4A 4DV6K 4FJIA 4X65K 3G8TA 3OYHA 1PCAA 3OPKA 4DV7K 1M90T 4EK2A 3FCVA 4JKDA 4OYZA 2MQPA 4ZVGA 4C48A 4X4SA 4ZOSA 4JP8A 3MMVA 3KNGA 4FM1A 3MD3A 4PG6A 5CD4H 4EHUA 3N9UC 1N5TA 5EXWA 3R5AA 4BR5A 2IMOA 1DEJA 2DTUA 4UUXA 2YPZA 4IO8A 1SVDA 2DGQA 2IA6A 2Q3SA 2NUBA 2GO8A 2O8CB 1QTNB 2BVZA 2ERRA 1AUDA 4WXOA 3AA8A 5BPNA 3QIOA 2DVIA 4KGMA 3U9DA 4KI4A 5GAHI 2O8EA 3KHGA 4PCQA 3PDNA 4JI2J 4X62J 1RTHA 2P5VA 5ETLA 5ADXH 1HWKA 1Y4ZB 2KLAA 4IFVB 2D3OR 4B9UA 3W64A 3G87A 4X4OA 4I2QB 2F8EX 3L09A 2H5EA 3PJ9A 1YTYA 4DZDA 5HLFA 3HSGA 3BSCA 2FC9A 3FZKA 1W0HA 2OLWA 1WOSA 1FKPA 1IBLF 4FP9A 1S9FA 4FJXA 2W7OA 2V2KA 5CXTA 4DV1J 5HRNA 3PW4A 3ITHA 1HBMA 4BC2A 2CWXA 2B4VA 4A8FA 4MAKA 3PX0A 5K8PA 4DOZA 1ZOTA 5KFEA 5HATA 1JX4A 3PW5A 3ENHA 1CJVA 3LP1B 5F8HA 3R1HA 4M7XA 3OFHA 1J53A 1D9AA 1SZ2A 2LVWA 2EW9A 2ROEA 4KO0B 2VV5A 3LGMA 5I3UB 1XMQJ 1AZSB 3LDPA 4A8XA 2YI1A 4OJ3A 3AT1B 2J8AA 4Y2AA 1I51B 2EFVA 1VQPS 3NH2A 5KOXA 4U96A 1UFKA 1TAQA 2BOAA 2HVIA 3HD1A 2H54B 4JS5A 5A2QU 4CLSA 3GCWP 3Q7CA 2YXLA 1MROA 2EG2A 4RPFA 1WC1A 4H4OA 2D0OA 2IDEA 2OP5A 2OUGA 3EZUA 1U45A 4U9RA 2A6MA 1SQKA 3WNHA 2KRBA 3W5XA 4EAHD 3PUFA 2D69A 4NI2B 2B4OA 3RB0A 3H45C 2KT2A 3L2RA 3M9NB 2K8GA 3H1VX 1OJ4A 4NLBA 2RN2A 1S10A 3OYMA 4DFKA 1VQ8N 1XNRF 4ED7A 3NGDA 4DQSA 4FWSA 3MMAB 2UVUA 1B64A 2G8FA 1FVSA 4OYMA 3RG6A 4NLOA 5EVZA 3WXJA 1W2BR 1WJ9A 4IOBA 4CFCA 1P8GA 1B4SA 2PMZD 1WC0A 4BC5A 2J6TA 3GG1A 2IHR1 3M7VA 2X1GA 3TA0A 3WEEB 1LWXA 4O3SA 4X66K 4OHXA 1NK5A 3SIPB 2I5JA 1Q81T 4NCGB 1F9HA 3R5JB 2R3VA 4MK9A 1RT4B 4RL1A 4UOFA 1DLOA 1RT1B 4F3QA 3DLJA 4HTJA 1HBUB 5E5NA 4IUFA 3PEJA 4FOEA 2HVHA 2JOQA 4ZTFA 5FDLA 5D78A 4P75A 2LEAA 4XDCA 4H8KA 1T6DA 3K58A 2M88A 1S9GA 4C6AA 1MG7A 5CYJA 2OMLA 4AH9A 2DNPA 3ZCMA 1RTJA 4ZVHA 4CLTA 2YX4A 4ZN3A 5L1IA 1S22A 4LRCA 1RDWX 4NWBA 1Q18A 1Q95G 1FDAA 4IEIA 1U6ZA 4J9QA 3HFKA 3PCOB 4TXSA 2APOA 4PWDB 2VODA 2A40A 1J2VA 5D0RA 4TQRA 1RWWB 3NMUA 1LWCA 1DTTA 3VCDA 3RMCA 3FGUA 3M3ZA 4KSEB 3KXDA 2D1KA 2DIUA 1C4CA 2ZBRA 3JSYA 4X4UA 1FJGK 3KTQA 3LUYA 3P96A 2QG9B 3D54A 1NHKL 3PW0A 1IBLK 3K0SA 3LWMA 2HNDA 3W1YC 5KTQA 4TYBA 3LP2A 4GKJJ 3PKYA 1EJ7L 1SUQB 4WFAQ 4CZIA 3D2FB 1YX2A 2P9LB 3HMJG 3QAEA 4NEZA 1W26A 5LMNF 5B0EA 3C6UA 2VFRA 1VK0A 3NGYA 1KP6A 2CQGA 1N33J 2OCEA 2GHWA 1XERA 3ILOA 4LIWA 2GIRA 3BDEA 4ER8A 2YHYA 4FWPA 4LR8A 1F2HA 2LEPA 2I2YA 3FBFA 1L5UA 5KQ8A 2DT9A 3EVMA 1YITS 5ETNA 3MR2A 4DV3F 2H65B 1D5AA 2R42A 2M0GB 1E4FT 1ZTTA 4MDAA 3NS6A 3B6OA 4WP9A 3IAYA 1EWRA 1M1KT 2C42A 4IQMA 4QOTA 3DWLA 3OL7A 2GGPA 4ZVUB 4FWNA 5F2RA 4CJKA 3I6PA 3TNVA 1S6PA 1T9YA 3CCQS 4DTUA 4NA1A 3DI6B 1OS5A 3H4BA 4CEZA 2VASA 1GX5A 2ZITA 4N47A 4B1UB 1WG4A 1GXLA 2GELA 3SBMA 2HK3A 4TQSA 1YJVA 2AIRB 1T11A 3GIRA 4LF6J 1V5IB 4NEYA 4A8KA 1OPZA 2CZ4A 2PI4A 1KD1O 4OKJA 4AYBD 1Y5IB 3DDIA 2FBXA 2VKZG 3PO4A 1URNA 2GJFA 2DHHA 2CPXA 1GMWA 4B3MJ 4NLTA 3QZ7A 3F0NA 1SJQA 1XI1A 3V6DA 1L3KA 1VIXA 1T94A 3AVMA 4C3MA 4U8YA 4FF1A 5LSLA 4BRHA 3L7UA 3PIOL 3H90A 3V9WA 1AFJA 2AX1A 4KE5A 4DCJB 3MK6A 2ETJA 4PXCA 1OYDA 3HLUA 3S3NA 2WRMA 3NWRA 4JN4A 1RAHB 3VQCA 2OA8A 4FLUA 4JI5K 1Q1KA 4AL5A 3A5OC 3W3DA 3BN4A 1QTMA 2KKZA 1C1BA 4I6WA 1Q86T 4B3SF 4LREA 4H5VA 1MN7A 2NR0A 2E1AA 3Q22A 1YVUA 2XMWA 3CQYA 1H74A 1Z1ZA 3AVKA 4NRTA 4IOCQ 4V1Ak 1CZAN 1UFWA 3BPDA 4GW6A 5HJXA 3DLGB 4QCLA 3KK3B 1SI9A 2DXDA 4CZFA 1UVMA 1N32F 2XULA 2GS8A 3ENQA 3BYPA 3VPZA 2JEIA 3DM2A 4KAIA 4IRDA 4EU0A 1HNIA 3NCRA 2XWXA 1B99A 3BKUA 3CJKB 2QK9A 5J1EB 1JLCA 5EHHA 3C0BA 4YOUA 4WK3A 5FJ4A 2ITGA 4F26A 2QW9A 1GT8A 2Q1NA 4MO5A 3AY0A 2CQDA 2EBEA 3J80U 1R8AA 3G0ZA 3AQOA 4HH0A 1QQMA 1RFQA 1UEUA 2BANA 1R0AB 1NDCA 3HSJA 4FW1A 4K0KJ 4RBTA 5J2QA 4CF8A 5IM0B 4NE9C 2FLLA 4LRDA 1AW0A 3W2VB 3ZSWA 3MCMA 4OV6A 2IAJA 3CDEA 3M8YA 3MXHP 3JQJA 2EK6A 2W8LA 4DQPA 1BU6O 2V8PA 2BTFA 5AQJA 1LFWA 4M1KA 2BA9A 3O44A 3BQ1A 5EUHA 4XH1A 5LM7E 4DCHA 1M5OC 3QETA 2B3TB 3O9RA 4O4GA 1KVJA 1CQNA 2RQMA 4DQIA 2J7KA 1PBUA 2ZJQQ 3G4SN 3M2RB 2VWBA 1RA6A 2BKNA 4DV3K 2YX7A 3HK2A 1ZBTA 1RHRB 3SCKE 1CG2A 1FXRA 3A12A 4CJWA 4ED4A 2X7IA 1S72S 4FK4A 5BN9A 5D4OA 3CCMS 3V81A 3BQ2A 1UVJA 2HBRB 3BZQA 4OI4A 4KPYA 2XZTB 4DV2K 3VQ4A 1DQ8A 3JTNA 4FXWA 3HRGA 4JUZA 1IKYA 2VUGA 1PYTA 3QSIA 3ZZUA 3MURP 3FFKB 3C46A 1DZ5A 3ZC4A 4AUKA 2HHPA 5KI6A 2R7UA 4KHUA 3PV8A 4RNFA 1RWOB 2KYZA 3GL1A 1EQYA 3D1QA 3QEXA 3DFEA 4P2SA 2ZH6A 5LMUF 4HHTA 4TU9A 3NGSA 3CJ2A 3P83D 4TN2A 4M3ZA 2FQQB 4UZCA 4M42A 2ZM6F 2RQ4A 1FEEA 4V19J 4H03B 3RB4A 3WX4A 5GVQA 2RUGA 1Q9YA 4J9OA 4FJKA 3DRYA 5KFMA 1CLFA 3QZ8A 2NRZA 4WQ4C 3I55S 2UVVA 3QWUA 2P6TA 2MKKA 5L1KA 1FX2A 5DS7A 3T7ZA 3LWLA 1HHTP 1IG8A 4QS8A 1B70B 3F2KA 1IWAA 1TMJA 1BO5O 5KFOA 1LW2B 2HQDA 5HSPA 5CCMA 4WFYA 3QJJA 4CLLA 4HCCA 3IC1A 4XH4A 4AHVA 4B3SK 2GUIA 3U1MA 2Y1IA 1AUSL 3M1VB 5ETQA 3ZZPA 3J8AA 3TZZA 4DV0J 2P9PB 3GILA 4IFYA 5H9EK 3CCVS 4JKEA 2WOMB 2NZ4A 1OH7A 2MJNA 2C3PA 5F9LA 1MW7A 2ZOFA 1BD6A 3V5RA 2YX1A 5IT9U 4B1VA 4JS4A 2HBMA 1Y3JA 3RAMA 2H48B 2XM3A 3RRGA 3AVAA 5DETA 2DXFA 2QLWA 3JS9A 1T9XA 4WWSA 4DL4A 5K14A 4CBUA 1FERA 2QKKA 1RT7B 1TVRA 2QN6B 3AOCA 4H0TB 4B1XB 4DR5F 4D3GA 3H5UA 3ENBA 5CYMB 3CCWA 3KD1E 5KT6A 1QUVA 1NKCA 3S8SA 2CZ9A 4RLEA 1Q0NA 3QNOA 2JH3A 2IDOA 1NGIA 3VQ6A 4U8VA 5E3PA 1VQNN 1NPRA 3HHLC 3NP5A 2GNKA 4FL9A 5EY4A 5HVGA 4X64K 2FPHX 1U2FA 2E7VA 2BV3A 4URSA 4XPCA 3AVCA 3RJMB 4ZVPB 1VQ9N 3MEEB 1JXEA 4IRCA 4C8MA 2LSNA 3THYB 2HFSA 1C2PA 3H8YA 3QGHA 3VALA 1JKHB 1WSIA 1RABB 1W97L 3HVWA 2NSBA 3DXBA 2H4YB 4CO1A 3AHPA 4RW6A 1MWZA 3VEZA 2X1BA 3UDLA 3M8PA 2PI5A 1QQOA 5KRSA 4QU7A 1VHFA 4FLZA 2XSJB 3IM8A 2CQIA 2YNHB 4RU9A 2RE1A 5IOLA 4LF7J 3DLBA 4OLAA 4USWA 3CEDA 3MI7X 1HQEA 1HARA 2FBTA 4RW7B 3KHYA 2ZGZA 3OYLA 5HOOA 2PN6A 2YQ1A 4DTRA 3GJRB 1FWLA 3IWXA 2ZWPA 1NGHA 2P1JA 3W60A 5C25A 5C42A 3EUNA 1IWGA 4KT0C 3C6AA 2KJVA 4N56A 1A5WA 2VYPA 1UEKA 1IKVA 5BRDA 4M5NA 2I6WA 5LMUK 1NG9A 4FKXA 2VQFF 2N4DA 4Y6IA 3M6GA 4BRFA 3O1BA 2KFYA 2AWZA 1FTCA 2V9WA 4YDUA 1GLFO 3BREA 3EE3A 3O8WA 3CM5A 3ZTOA 3BEGB 4J5OA 3T1HJ 1EKEA 4USJC 4B9TA 2B51A 2HLUA 1TMMA 2PEBA 1KXPA 4CFDA 4ZJLA 1S79A 3BBBA 1VIOA 3AVIA 3CG7A 3VTIA 3D67A 3OL9A 2ZF5O 2PE8A 3PLAA 5BR8F 5AZJA 6AT1B 2KVIA 2RH3A 1NZ8A 5HRSA 3M6VA 1BHLA 1EP4B 3VA0A 4XK8C 1R8PA 3UR3C 3KYLA 1CXQA 4GRSA 5HRRA 2OMOA 5A8KA 1U49A 5IWAF 3W2WA 3O9UA 2F65A 4LR9A 1TGOA 4A5AA 2RILA 3S1TA 4KB0A 3SCIE 5DDRC 3JSRA 1TFYA 4FJGA 1XTZA 4RNNA 1X4FA 4HVZA 3OYNA 1QZ6A 5JLFA 4H4MA 2OSQA 2IS3A 3ID8A 5I42A 3C15B 1LWEB 3Q8PB 2BE9B 2IVOA 1XHZA 4IWVA 1NU4A 2J9DA 1Z4UA 3BH7B 2FHOB 3F9MA 3T9NA 5E3RA 2OD6A 2CJYB 1MMLA 4KH1B 1K8KA 4IYQA 4UT4A 1FD2A 4BROA 1YJNS 1I94J 3OY9A 2N4CA 4C8LA 4RW4B 1SQFA 2VF3A 3HOSA 4NLDA 3PM9A 3LGHA 3UE5A 2CZVC 2VICA 4FO0A 1G2EA 4K8RA 1C0TA 2GV9A 4DV4J 4QWDA 4J2EA 1T05B 3MM8A 3NOGA 2ZH7A 3CJCA 3VAFA 3DRRA 4DN0A 5CZ2A 2ZH8A 3ELHA 1AT1B 5CR4A 3IR7B 1YLXA 1OO0B 1NB7A 2WTUA 3VENA 4FWOA 2H3GX 3RAXA 2H5JB 3ZT4A 4JV0A 4X62K 1VQMN 4E7HA 1UWBA 4BQZA 5EU7A 4CH7A 4F67A 4N7TA 2V7YA 4ZHRB 3OYIA 1VQPN 1YTAA 4WIIA 2UXCF 3B54A 1UVLA 5B09A 1I3AA 1P90A 3ILIA 1B0VA 4X4VA 1GOAA 1N8RO 3GFHA 2DNQA 2WVEA 4KKOA 2LDYA 3ZO7A 2Q36A 4ECYA 5AQWA 1M90O 3FBBA 4ZITA 4B9VA 4GKJF 1RJJA 5JVHL 4FK0A 5T7LB 1H1VA 3RMBA 3KDNA 4PR6A 3KMSA 3OHRA 4DUYJ 4I2PB 4IOCL 1YBAA 4PQUA 4Q5VA 3MXIA 3C94A 2XO7A 2VHGA 3QIPB 3GWCA 2NUUG 4URGA 2BDPA 5KAKA 4U95A 2MGZA 2G1HA 1VR6A 2CPDA 5AZIA 2RQKA 1PILA 3DLKA 3DLLQ 5FPNA 2MKCA 2IC3B 3PRVA 3DLRA 4E7IA 5ETRA 1HPZA 1I39A 3MN6A 1J54A 3MDFA 3M2UA 5D8HB 2XRIA 1ACMB 4Z4HA 3RGIA 1RNHA 4ZDNA 2BMBA 2UXBJ 2BJDA 3SUOA 1C4AA 1N36F 3WBZA 1Z6RA 3IKMA 1H6KX 1X31C 4DU1A 2LEBA 3E9OA 1IBMJ 5BR8K 1KS2A 4OZJA 1UZHA 4CJ5A 2VWJA 3JXOA 3ZETA 2HNYA 3P31A 3AA4A 3OFEA 3OL6A 4JD2A 4B3TJ 4OKKA 3VQQA 4GC6A 4QPXA 4DL3A 2JL9A 1MWMA 2IYIA 1X9JA 3AO3A 3CSKA 1BI4A 2DHGA 3CC2S 3DYAB 3P8BB 4LMZA 5FPMA 4DTPA 4GV9A 4B9SA 2XS7A 3K2YA 2B5JB 2UUCJ 3VGKA 2ZJQL 1YBTA 2YCHA 4ZPAA 2OPRA 1NUEA 1S77D 4MK8A 2FLNA 2LMIA 3HHKA 3M8ZA 5HQ8A 2BW7A 1CPZA 5KGXA 3BPSP 1RTDB 2P9IB 2IM0A 5D4PA 1YWXA 3IMQJ 3TZYA 5C2FA 3RRHA 4ZPVR 5TKWA 2MEWA 5E3AA 3A4TA 4I56A 2GWJA 3MM9B 4M63A 2V50A 4CJPA 1F21A 1HKGA 2FZKB 5KFHA 2VJUA 2CIMA 1D4XA 5CCLA 3NHGA 4ECRA 2HFUA 1RHKB 3ULHA 3CGIA 4IQXA 1O6XA 4ECTA 3HL8A 1FDBA 2AGPA 1X3NA 1O5JA 2FHMA 4EEYA 2QT7A 1QE1A 1H2UX 2ZH9A 3MFIA 4BE2A 2BXJA 3CTRA 4PWUA 1VRUA 4DR4F 2P6SA 3C2PA 1U47A 4E8UA 3J81U 2FF3B 1A0OB 2GHVC 4LF4J 1Q79A 5GADP 4PUOB 5IQQA 3O4WA 4WK1A 4CO3A 4DTXA 4Q0BB 1UMJA 3CPWM 1FNXH 3QSYB 4HDHA 1IR2A 1OKJA 1JLQB 4MYUA 5M1PA 1Q81O 1U8SA 3ZSOA 1MU2B 1NOZA 1BQNA 4DKWA 3AXKA 3C14B 4GKJK 4H0XB 1FO1A 2HMIA 1SC4B 1T0TV 4P6QA 1S6OA 3TWZA 4NXNF 4JK7A 6FDRA 1PGZA 4NYZA 3SQ0A 3WNFA 3KD5E 3QJLA 2BE7D 3W65A 3AD9C 2CQ2A 2CGKA 2GVDB 1ZM2A 3VWSA 2V52B 3CIMA 1F5CA 3W5YA 4O5FA 3NVKA 1BG3A 1RDUA 4C8OA 3S41A 4CH0S 2E6LA 5C2GA 1DTQB 4OZ1A 5KT3A 4DS4A 3QMQA 1V3ZA 3IAS9 3BO4A 5LT5A 2J0QD 1R8BA 3RBZA 4MDBA 4FS2A 3R5GA 3ZZ0A 4OHZA 1CJTB 1UJ4A 4N5SA 3KK2B 2J9EA 4NL5A 3R5DA 1VQOS 4FM0A 3O1WA 1EETB 4KHWA 3DGVA 2D4WA 2MQLA 2AGOA 4PYDA 2VFTA 2CRLA 2W4CA 2L08A 3TAGA 4KH6A 3TW0A 2JLFA 2I7NA 1REVA 2DNHA 3N0VA 5H1SQ 3TAPA 3TARA 2NRRA 5HMWA 1RBTA 2YNGB 3SCJE 4ED1A 4LF6K 4CGHA 2YNIA 4F4ZA 1O1WA 3NGUA 2GAHC 3AGKA 3DAWA 2W2OP 1YBUA 1KQSM 3NY0A 1V6HA 1ITPA 2E5JA 4B3MK 3HHDA 3QFPA 5GMDA 3GJSB 2BUPA 1FKOB 3ZTPA 2W9BB 4QU6A 5E26A 3OYKA 1HNVA 1N48A 4KH5A 4Y28C 3FE1A 4M45A 1RE1B 2QXFA 1ATNA 2D3ZA 5DJBA 3IG1B 2WBMA 3VN5A 3RBDA 3QT8A 4J9LA 7FDRA 1GLAG 4BRQA 2ZD1B 5DO2A 4ETZA 2DNNA 4O8UA 1R7IA 3PHTA 3THWB 3Q86A 2FHJA 2JEGA 1OH5A 3D2EB 4JOUA 4DJBA 5CZXA 4JYAF 4H0PA 3UI3A 4DV0F 4CJ4A 1O8BA 3LA0A 1OIAA 3TVKA 2Z0GA 3D7EO 1RBAA 1UPMB 1LWFA 4FBUA 5FLXU 4R8UB 3ASMA 4LY7A 2HVZA 4A2AA 1HFEL 2HBQB 1FVQA 2G13A 3E01B 2LP4A 1FXDA 3EDRB 3CCZA 4DR3F 2K1RA 4UY85 2J4RA 3OYAA 1S72N 4PXEA 1ZA2B 2MZTA 1UL3A 2O67A 2JFDA 1U0HB 1MA9B 4F2RA 3BGFA 2VPWB 4JI4F 4WQ5C 1N34J 4K0KK 2DNZA 2YWGA 4LH5A 3OXFA 1FXXA 2R8GA 2ZOGA 2EPIA 3WT0A 3B78A 2AU0A 2V4QA 5EOYA 3D0PA 4YB1P 4KAZA 4KV8B 1ZA1B 4H5TA 1Q86O 4RZRA 3S7RA 2F7TA 2RD5C 3GFYA 4M5DA 2MQQA 2ZBQA 4R25A 3PO5A 4JNEA 3C6HA 4PXBA 3CCLS 3RZAA 2YKMA 1IKXA 3KJQB 4DCOB 3IGVA 2HHHF 4FXDA 3DOLB 1PBAA 2CQHA 4A57A 4J2DA 2C2MB 3D0GE 4UZBA 3CCSN 4ZMMA 3NBPA 1G6BA 2RRNA 1B3TA 3JXUA 3I55N 1PAEX 5A6PA 3UD5A 2J0XA 1QY7A 1XWLA 3GQCA 1S76D 3VAGA 4R5PB 3QT7A 4E7KA 1NAQA 4DR6F 4ANDA 4LFBF 5AQXA 1NJWA 2QXLA 3TWHA 3EPGA 2BRKA 1W2IA 8ATCB 4DQRA 4ZCIA 2UUBF 2F1FA 3J7YU 1JNRB 3NH1A 4PKIA 3QB0A 3NDKA 2KFZA 4NLPA 1KBRA 3CCVN 3MMCA 3FSXA 4FYXB 4DXLA 5AFUA 5D0EA 4DR1F 3R1LA 1U1MA 1NDPA 1KVIA 3PW2A 1PIEA 3TEHB 5FLXY 4CF9A 2WC9A 1WEYA 3K8VA 5AQSA 3U27A 2P9SA 4AD6A 4J9VA 4CF0A 3HM9A 3SI6A 1TV6A 1XR5A 1YGYA 4WIQA 1HKBA 4EFAC 1G99A 1TL1B 4QIVA 4ECSA 1KKHA 1IM6A 2LCWA 1TK8A 3LP0B 1SXLA 2DFEA 3BB5A 2HYIB 5J2MB 3W7BA 2HGLA 4O4RA 3N6LA 3VQEA 3MPUB 2QEXS 4QWEA 5KFLA 2CJXB 4C11A 4KTZA 3MX2A 4CZGA 1RLDA 2E5LF 3ALYA 3VEVA 1N5QA 4LJMA 4C0OC 4OI1A 1HYSB 4CESA 3PYFA 3G8SA 4C2MA 5A8RB 4DV0K 2YQ0A 2GEMA 2GAGC 2RHSB 1CS4A 3CC4S 2LU2A 4NRUA 4NA3A 3KJVB 5HL7Q 3LPYA 5L1LA 3H59A 3FEZA 3CIPA 2WAQD 1UTAA 4GNIA 4MFBA 4LQ9A 2HSTA 5GAGU 3LOUA 3VZIA 3A13A 2LQ9A 1KAYA 4XO0A 4CHOA 4NOHA 3VAHA 3O80A 3SSSA 1MMDA 4NCAA 4B8AB 3ZZYA 1A5VA 1VHIA 2B9YA 4ZP7A 1NHUA 3VF2A 4KHYA 4ETXA 5FD1A 1SJ1A 1CULB 3DXKA 3KFWX 4YDUC 2E7WA 3U8XA 3TAMA 4DU4A 4RW9B 3SI8A 2HQGA 1C0UB 4HTLA 1F9FA 1VSEA 1XC3A 2WB4A 3OLAA 2ADCA 1HW9A 3ZTRA 2W40A 3OVBA 3C16A 3DC2A 2UZAA 1NJXA 2P9CA 2IA0A 4WE1B 4AFFA 4YOVA 3VA3A 2V4JB 3DOMA 3SSQA 4IFVA 1KVAA 2HWHA 2IRYA 3S6EA 1RWMB 4I2QA 1EARA 5B08A 3E2EA 1JJ4A 3CD6S 2BM0A 5HBMB 2PIIA 4CHZA 2VG7A 2R8KA 4IO9Q 3W63A 4FDFA 4I7FA 2XHWA 3ZX2A 2HHHK 3ZEUA 2BOPA 2FYXA 4LVOP 2OZMA 2JGUA 1OQ3A 4Q7AA 4JV5J 1RQ0A 3SAFA 1U02A 3MAAA 2W2MP 5F3ZA 1G7CB 2DNGA 1GK8A 3W9IA 3KHLA 2P9KB 4F3OA 2R4FA 4M3WA 3FC9A 1FT8A 1S12A 4O23A 4RUAA 2G8KA 4DR6K 1KC8T 2HG4A 2XMJA 3CIZA 3QLHB 4FLYA 5D3GB 2CWKA 5KFPA 1S1VA 5I3UA 3EPIA 1VQ6S 4HTIA 4OZLA 4O44B 3DKDA 1NJZA 2O01C 4ES1A 2UVRA 3NE6A 3KLGB 4NX9A 1Y7PA 2ZH3A 3DRSA 3U1NA 1LOUA 3EDQB 5CHCB 3G8QA 5K8MA 4CE9A 3VF4A 4CLPA 3LAKA 2EBGA 2NSCA 4CF1A 1H2TZ 4Z94A 1LK5A 3TTDA 3FMWA 3TEGA 1TFWA 2W7AA 4EGLA 1HBNB 1M0SA 3NF9A 3QIDA 3G2XA 3AVBA 9ATCB 1EX4A 2JEJA 1P8ZA 1NGEA 5KOWA 4LH4A 2VL1A 4B8CA 3GR0A 2RHKA 3OTOF 4A8MP 2MZSA 3DHWC 2RNEA 2F9DA 4NLSA 2EI5A 1F1BB 5GIOA 4BREA 1ULRA 1PC4A 4DR2F 1QUPA 4B3TF 3IGNA 4B08A 3GIJA 1Z2LA 2E5LK 2KXFA 4NA2A 3MCPA 5AQLA 3IM9A 4A62A 1S1UA 2GQQA 5CZVA 4K4YA 2AKWB 1T6CA 4A59A 1FFGB 1RHUB 3NNCA 3EN9A 3CCUS 1WDTA 1RAIB 1UVNA 1RBSA 4JK9A 1S9EB 5B7WA 1QSYA 1R0BG 1UW9A 2DCUB 3D6RA 2HHTA 2EFOA 3V9ZA 4TKTA 5CZ1A 3LDOA 3DOKA 2A1SA 1I94K 1NH7A 2UV8G 2Q0RA 4FVCA 5E2QA 2DPNA 1BUPA 1CZ9A 2XZDB 3OTEA 1BHNA 1OYEA 4AHSA 3VEWA 2X74A 4X4TA 1YHQN 4LR7A 2ZHAA 2AF6A 2GHPA 2EFGA 2WZ1A 4NZ7A 3I0SB 4YOTA 2O4GA 2WVFA 3U4LA 4LD0A 2GW8A 4IOAQ 1Q7YO 2P9UB 1U6BA 4PPZA 3M2VA 4TY8A 3MWPA 3BV8A 2ASOA 3NGZA 1TTHB 2A2DA 4JI1F 3KLEA 5ETOA 1FTRA 4DPYA 2QWRA 2XG8A 4USMA 2GBZA 3FCWA 3JTOA 1UW4A 1VK3A 4BE0A 3JSMB 1ZETA 4MTPA 2IFXA 3BUZB 3QGPA 3RSEB 5HQMA 3WZ0A 2KZMA 3W8GA 1JXBA 2JRSA 2QV6A 4E1JA 4Y34A 5J2NA 2NXJA 1RGIA 2KW4A 2KFNA 4UOCA 4OX7A 2AGQA 4NMLA 3A5LC 3WHIA 4R0JA 4Y2KA 2BJ8A 5A76A 1RT2A 5F0UA 3VQPA 4M5MA 3MM7A 4FPAA 4DUYK 2MKJA 4M63C 3PRDA 4FNIA 5LXYA 4ZVFA 2ZOMA 1LNQA 3AGRA 3KLIB 1X0FA 1RCHA 4JI8J 4Q8EA 3OR1B 5C10A 3FFIA 5B0AA 3QFWA 4H0YB 3CC2N 2A0FB 2HBLA 2KT5A 1GMVA 2ADBA 5HN0A 2M8DB 2FJAB 2PBDA 3K89A 4KGXB 4WYBA 2CJ9A 3TAEA 1QQCA 1UCNA 2DRAA 3HO1A 2R7OA 3ZZOA 1ZXOA 3CJ5A 4KFBA 5FRNA 1U09A 5MAOA 4QOZB 2UXBK 4CI6A 2M7SA 4EO8A 2K2PA 2G4BA 1SL0A 2NCKL 1VQ8S 1KVCA 1IBMK 5DK5A 4DSFA 2W1BA 4DSLA 3HSDA 4DR2K 1EHWA 2ZJPQ 4B3TK 1U2VB 4AT1B 5L1JA 1KLMA 5FPDA 3KWIA 2C3MA 3HP6A 3UVJA 1OSDA 2W9CB 4DLEA 3RMDA 2CXEA 2DGVA 2VG5B 2K06A 5DGAA 4RUHA 1J5OA 3FUYA 3H5SA 1KOOA 1XQSC 2QA1A 3OYFA 2BBEA 3TOQA 1X5TA 4JI0F 2CJAA 1RI7A 1R3NA 1NMDA 3IO1A 3HHLB 4A47A 3SAGA 2O8BB 4JHDB 4BC9A 1BL3A 3E9PA 1W25A 3D3BJ 2FD2A 3MOJB 4WTOB 4CZJA 3SFGA 5ETMA 3QICA 2MTLA 4BRNA 4AXIA 4GVBA 1Y3KA 5DQGA 3C95A 1Q82T 1QVFM 3T69A 2R2UA 1S1WB 1RZMA 3MCOA 2YWHA 1HWLA 4J91A 3QT5A 4FLVA 3G10A 2M9KA 3FEXB 3MPYA 5IFMA 2RRAA 3O3LA 2N3OA 1JCEA 4C97A 1S59A 1WNEA 4Q44A 4FS1A 5DM7Q 2F4VF 1TU0B 2GMLA 3MZIA 3ZSVA 3L95X 2X1FA 2NYIA 2HRUA 5KFVA 3TR5A 1U0SA 1JMTA 1OY8A 2QFJA 1FJEB 2M70A 4OL8A 1S7IA 4LF4K 2JJ4D 2PYJA 2DNKA 2E4LA 1DAXA 3QMLA 4UW2A 4C3KA 3K2PA 4OZ5A 2BM1A 2V8DA 2YHBA 4B3OA 5B0FA 2FLOA 3HSCA 4L73A 3MR6A 3BR8A 1XNRJ 1BWEA 4FLTA 1HNXJ 1U2CA 3W2VA 2BJ9A 4LBHA 4LFCF 1ZBUA 3US5A 3SV4A 2PFDA 2EHGA 2KHOA 3CJ4A 3K57A 1RKIA 2BEFA 1HKAA 2EWSA 2E29A 4YN3B 1X9SA 2B6AA 3ZT2A 1RTHB 4WTYA 5HL7L 4FVMA 3IP0A 4BCAA 8RUCA 3DMJA 5K8NA 4AHUA 1IBKF 4O0IA 1JNZB 1HD0A 2E2QA 3DLEA 3BGUA 4NPOA 1HQ2A 4QJVA 3A3PB 4Q2LA 5HMXA 4C8ZA 5HLFB 3HXMA 5DMRA 3ZNUA 3BH6B 3V6KA 2Q97A 5CHIA 1I3OB 1VCTA 4M95A 4K4ZA 4JI6J 1FKPB 1ATSA 1UVKA 1U1OA 3R7SB 3CJ7A 4FWMA 2F8HA 2MSTA 1K0VA 4M3YA 5IC4B 2EX3A 3ITHB 1HBMB 4WFBQ 4ZP6A 1NGCA 1JLEA 2MLZA 3SPYA 4I6MA 4IH6A 3M9OB 4JKFA 2DGOA 2O8FA 1LQ9A 2JZ5A 3EL2A 1KHWA 1CJVB 1RILA 5I4MA 2QL5B 1MMNA 3IUCA 2UXDJ 4ZVSB 3O5TB 4JK8A 3MMBA 2ZZTA 1WAJA 4I69A 2OIHA 4NYOA 1Z05A 1Q78A 2AQ4A 4ED5A 4TLRA 2HMPA 2H9ZA 3I0RA 1E6YA 1ZAVA 2E9RX 3RUBL 1HWIA 2IPOB 2VFSA 4N41A 1NGBA 1YKWA 3L2WA 3V4IA 3CPEA 1MROB 3IXQA 5DG8A 3EYZA 2KKHA 4H4OB 1KOHA 1YRXA 4YDXA 4W4MA 2DJWA 1WEXA 2XMVA 5AXKA 4LF9J 4XTTA 5KT4A 2XLIA 2HWTA 5BN8A 2XS5A 1BIZA 5G4DA 3EO3A 4F0KA 3TSQA 5LMNJ 2DY4A 2AP1A 4H0VB 3L2QA 3IFRA 3AA9A 2HAFA 2Z56B 2CQ3A 1N6QA 4J9RA 4L74A 2OTJN 5GAHU 1EXQA 4ENOA 2J6UA 3JQMA 3SJHA 3M30A 4X4NA 4F2SA 4ILJA 3RB6A 3S01A 2A18A 3B6BA 2WONA 3GZ7A 3LTOA 1GH8A 1IR0A 3AH6A 1YF5L 1Y0HA 4MKAA 4F4KA 4M3RA 1GFWB 3CCLN 2DEJA 2I5JB 2KT3A 5AE2A 2HHXA 4ZCLA 1SCJB 2HQ3A 1DLOB 4OJHA 3KOAA 3C6TA 1BA1A 3F44A 5M1KA 1QQNA 1WACA 3LALA 3MN7A 5DZ6A 4K42A 3Q83A 5KFAA 1HMVA 2L9DA 3Q23A 1S9GB 1NNDA 2X51A 1N34K 2UUTA 4M5GA 4F50A 3MEEA 1C1CA 2NRVA 2ZH1A 4C0BA 1U1PA 3UD4P 4TNOA 3KK1A 3H4DA 4X4RA 4HI2A 2R7WA 2HHSA 4WKRA 1RB0A 3G4SS 3GB0A 1VSHA 3M6UA 3R5BA 5FRMA 3D5MA 2HLTA 4DDFA 2NUHA 1VSJA 4FLWA 3CCRN 2KQ2A 1X60A 1LWCB 1DTTB 3GDQA 2D3O1 3UIQA 5B0BA 2XSJA 2X78A 1YVNA 5G0RA 2E2NA 4QR2A 3T41A 2YNFA 3SQOP 1FNOA 2DKOB 3GYNA 4JV5F 5FIIA 1SV5A 4E7JA 3VQTA 4YS2A 3A1YG 1HLWA 3IRXA 2HNDB 3GONA 2RPIA 3PFEA 3LP2B 2MKHA 4C0HA 3L3CA 2LXIA 2AW0A 1N0UA 3HF5A 4KHPF 3PSFA 2ATLA 2V0NA 3Q8SB 2NZTA 1CQMA 3P5JA 4W5QA 3OYCA 2RS2A 4AM6A 2WW8A 2HGNA 3C6UB 1WF1A 4XDDA 5ITHA 4DUZF 3OL8A 1KRPA 4YP3A 5BR9A 3IFEA 4CQ1A 1ELOA 2D0CA 4HT7A 4N8OA 1HUXA 1RACB 4CZEA 1N32J 2J0SD 3PKMA 3IA0A 3R9LA 2Y3YA 1HNZJ 2DR7A 3CDBA 1H3DA 3CC4N 2W6LA 2E66A 4FJJA 2VGMA 3CDUA 5AE3A 4CD1A 4B3RF 4KR0B 3CJRA 3RB3A 2R7SA 4FKYA 2F4FA 5ETKA 2RF2A 1ZS6A 3R2DJ 4DSKA 4CRJA 4YHHJ 4OZ0A 3CULA 3V1RA 3MTKA 3BYRA 1SH0A 3SQ2A 2GGPB 3EXCX 2OSRA 2J6SA 2J7WA 1Q8IA 3AO2A 5C24A 3HDSA 3THXA 4I68A 1S6PB 4QPTA 4Y2CA 1L3SA 1M5KC 5CQGA 3ULDA 1RWPB 4UTGA 1JXLA 1YI2N 2HVDA 2L48A 3X1LB 2CPIA 3DCAA 1S0VA 4ZIWA 1TKZA 1RWKB 2QZ8A 1HI0P 2OHDA 3EJMA 2A1RA 3CE8A 5E7OB 3MN5A 3UCGA 4ILMA 3AAQA 1WSGA 3CD6N 2PA8D 1GX6A 4HLBA 1ZM4A 3RR7A 3TSUA 2QFIA 3V6DB 1KFDA 1XNQF 4LFAJ 2BZ2A 1R0CB 2M5YA 2DRBA 1CC8A 3AJ2A 3B8AX 3A8KA 1U8WA 4ECVA 2BX6A 1Q8BA 1QVGM 1MDUB 3MXJA 1S99A 2BRLA 1GLLO 2CVIA 2FY8A 2ZJPL 1C1BB 3ZT3A 1YDLA 3VZHA 5GMKa 1VC5A 1HWUA 3UW1A 2UUAF 2FJDB 4K4UA 2M8HA 2COLA 1NGDA 1M5VC 4OYBA 5ETPA 3HT0A 1CLQA 1ZBLA 3L2VA 1VQLS 3S3MA 2KRRA 5AT1B 2ZM6J 3TJ8A 5F8JA 4DL2A 4ZHRA 4H0OA 2CUYA 4WZMA 2GFFA 1P9YA 4ED0A 5KG7A 4ID8A 4I1TA 3KWMA 3ISNC 4LF5F 2QM1A 1AFIA 5AFUH 3K9KA 1U1LA 1FJ7A 3DM2B 3WNEA 4M5IA 4CFAA 1RBVA 1HNIB 4C8NA 4P72A 4M5JA 2HGMA 2CG8A 4DL7A 1JLCB 2LDIA 3HVAA 4JV5K 2MXYA 3SAHA 4OPHA 1OH6A 1IN0A 5LSOA 2RKIA 2L3MA 5DDQC 3DHXA 4BRMA 3GSIA 3TTFA 4CECA 1HR0F 1F0XA 2QYCA 1AA1B 3D6MB 2BANB 1RBRA 2RUSA 1T02A 1UWAA 3GP9A 1F6TA 4KIAA 2VDHA 5ELZA 4NCBA 5J2QB 3PJWA 2DR9A 2G8VA 3R27A 4YOEA 3DJCA 4G65A 3N79A 1RXOB 1TUVA 5HP1A 5IV4A 4FBTA 2E20A 4ECWA 4U67L 2IAJB 4DEZA 4BR4A 4L3NA 4DUZK 5DM7L 3WIVA 3MMJA 1T3NA 4RR5A 4CHYA 3V9XA 2QLJB 3AV9A 3H25A 2Y8WA 1VQYA 3FZFA 2VG6A 1H72C 1C0GA 3NGKA 2V69A 2Y9HA 4O4GB 3MR7A 3JAMO 4D3HA 1NSKL 3CCUN 5D6GA 4IRKA 1V9OA 4FJ7A 5CD4A 3EEQA 2B0GA 2DD8S 4MK7A 3OUYA 3OVAA 4DR5J 1WELA 3CXCM 2L9NA 2WUSA