1EP7A

Crystal structure of wt thioredoxin h from chlamydomonas reinhardtii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
b'GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the wild-type and D30A mutant thioredoxin h of Chlamydomonas reinhardtii and implications for the catalytic mechanism.
pubmed doi rcsb
molecule keywords THIOREDOXIN CH1, H-TYPE
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 36
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ep7A00
5JWQB 3DWVA 4E8EA 1GSQA 3LFLA 1UN2A 3D4TA 5ECMB 4OO4A 2DIYA 2YWIA 4MZBA 4O32A 5INYA 3VPTA 1WP0A 2GGTA 5D9XA 2QSIA 3F3QA 1YKAA 2YWMA 3G7IA 4KGIA 1GSYA 4DSQA 2VCXA 1B9XC 1ABAA 4N0VA 3QR6A 1I9DA 2GLRA 5LNKe 1FG4A 1AAZA 4QL7A 3EU4A 10GSA 4HJ2A 6GSVA 5DAKA 2V41A 3KH9A 1GTBA 3A2VA 5F05A 1EEJA 3Q19A 1XPVA 1E2YA 3QDNA 5CO3A 3GH6A 3QOUA 4IGJA 4GXZA 2PERA 3LJRA 5ID2B 3I9V2 2YZUA 5ECQB 5B7CA 4YQUA 4ILFA 3RHBA 1WPIA 1PGTA 2C0GA 3FEUA 5IOWA 1QXHA 1C72A 2L4CA 4MPFA 2LRTA 1ERVA 1U3IA 3V1WA 2IMEA 2HSYA 2OE0A 4MZWA 3FW2A 2VL3A 5J9BA 1T7PB 5DVBA 2CX3A 5AGYA 4ISDA 3UL3A 2AHEA 5DJMA 3ME7A 2RM6A 4GCIA 3TOTA 2V32A 2DSAA 2L6CA 2BMXA 4MJEA 1M2BA 1OC8A 5D9WA 3CSHA 5HFKA 4HZ2A 1F3AA 1PL2A 4XRDA 4LA1A 2HYXA 3UEMA 3ZITA 1GP1A 3HJOA 5D93A 3UMAA 2HXKA 4F0CA 2IMKA 1Y6EA 4IHUA 1VF4A 2CVBA 2LRCA 2Z9SA 5J5NA 3PGTA 2HFDA 5J41A 4BA7A 1ZMAA 3LGCA 4WXTA 3GSSA 3WGDA 4TXOA 3M1GA 1K0MA 3RPNA 2CVKA 2JZTA 3HDCA 4KDYA 1X5CA 3U6VA 1EP8A 4WBRD 2HRFA 3IAM2 2VCZA 3C8EA 1VF1A 1SD9A 2DJ1A 1YEPA 3Q74A 5F07A 5IMAA 1OVNA 4DSSA 2C0FA 3ZMKA 4HUAA 5IO2A 3N9JA 3TUEA 3M0FA 1R7HA 3QAGA 5KN2A 3UVHA 5DALB 4GQFA 2IL3A 2DMMA 2JSYA 3ERWA 3IK9A 2WZ9A 7GSSA 3UARA 4LMVA 3J7Yb 2IFQB 2DIZA 4ULXA 3C1SA 1FVJA 3L9SA 3F6FA 1J08A 1SK0A 3F4RA 4HEA2 4I5QA 4X43A 5HR0A 5ECLB 2I81A 1MD3A 2LUSA 3F8UA 2HZEA 4AJ6A 2XC2A 1K0AA 3O3TA 4XIHA 3DVWA 3GH9A 4TR1B 2RUFA 4HS1A 3HCZA 2GSRA 4JR6A 1O8WA 3HY2A 1A2LA 4CW9A 3EMPA 1BQ7A 3P8WA 1DBYA 3QAVA 6GSSA 4OCEA 3RDWA 4N0ZA 3ZL5A 2PVOC 2L5LA 1SKRB 1Z5YE 2P0GA 1LBKA 2PVQA 2V6OA 3KMOA 4ML1A 3GKMA 3M9JA 3TJJA 3QFAC 3KTLA 3ERGA 5ECOB 3IE3A 1YY7A 5G30A 1SU9A 1BG5A 3VWXA 1Z7RA 2K9FA 3ZTLA 4L5LA 1FB6A 5EY6A 3QMXA 1NW2A 4NMUA 2GSSA 1GTAA 5KN0A 3CSIA 2AAWA 5IM9A 2WGRA 5G2ZA 4N11A 1MDJA 1GUMA 2XBQA 2H75A 1M7TA 2M72A 2PMTA 3TGZA 2B1KA 2J9HA 3M9KA 2F8FA 2H01A 2C3QA 2CAQA 1TRUA 2VUPA 4WBJA 4HDEA 4KB3A 4G19A 3TRQA 1PL1A 2VM2A 2H73A 3IOSA 3LYPA 1KNGA 1TK0B 5D96A 1EWXA 3C73A 2L5OA 2N5FA 3VWVA 2JSZA 1XWKA 2H6ZA 5G1KA 1ZYEA 1A8YA 1A2MA 3US3A 5GSSA 2H0IA 3FZAA 1WRYA 2VCVA 3DGQA 4N30A 1SJZA 1E6BA 3WT1A 5E4WA 2B6MA 1A23A 3F4SA 1SJIA 4GQCA 2IN3A 3H4KA 1JFUA 2HSHA 2C4JA 4WF5A 2MBTA 3KIJA 3MWHA 3IHQA 2OE3A 2CQ9A 2CV4A 9GSSA 1FAAA 3F3RA 3APSA 5CRWA 5J4UA 2JACA 1W89A 1QUWA 1TU7A 4XCSA 1YZXA 3L9UA 3DKSA 5ECKB 3MSZA 1DE2A 3O76A 3F4TA 3RAZA 1B9YC 16GSA 2FA4A 5ID2A 4TRXA 4ML6A 3ZVJA 3GUSA 4HQSA 4QQ7A 4V2LA 4EDYA 2YANA 2F8AA 1TOFA 3DVXA 1O6JA 1N2AA 2YCDA 3ZZXA 1NHOA 4L5OA 3VK9A 2H72A 3HVXA 5IOXA 4MF7A 4EC0A 3GHAA 3P90A 1V2AA 4JU5A 1YDKA 3LXTA 2DJJA 4EE0A 2LS5A 3MAKA 1BEDA 2X8GA 4DVCA 3FY7A 3MDKA 1XVWA 2BTOT 1Q4JA 4EF0A 1A0RP 4QL9A 1URMA 5E59A 4FYUA 4OFNA 5KEJA 2DMLA 2H1GA 1TI1A 3DRNA 3MNGA 4DSRA 2LJRA 4GWRA 2H1DA 2I3YA 4WEYA 1G6WA 2HLSA 1O81A 2PGTA 2GZYA 5DBQA 4L0WA 4J2FA 2MYGA 3IAS2 3ZLPA 3W8SA 2X8HA 2R6KA 3BOAA 2I4AA 1S3CA 2RLIA 3EINA 1SENA 4XS6A 1JZWA 3W6GA 1XW6A 3IC4A 4ZBDA 1EV9A 3BBYA 3UVTA 3RHCA 4MH3A 4GSNA 1T00A 2MMZA 2TIRA 4MJBA 3GNJA 1OE8A 1DSBA 1XWGA 1S3DA 3KMNA 2IFQA 1GL8A 1OC9B 1YJ6A 4NPBA 20GSA 3HJPA 2KUCA 2NDOA 4J56E 1SKSB 1IYHA 3ED3A 2VLTA 13GSA 1WE0A 4PUAA 4RQXA 1AC1A 1XW5A 1B4PA 2NVLA 4XRAA 5F0GA 2GS3A 3IPZA 4ECIA 3TB2A 3EC3A 2JADA 6GSTA 1J9BA 3AY8A 3O6TA 5HQPA 2IPAA 4I8BA 4Z7XA 1GSSA 1O7UA 4OMVA 1FOVA 1FVKA 4TR1A 1OE7A 1FHEA 1JLVA 3D22A 1S3AA 3IA1A 5ABRA 1AXDA 2FUG2 2IMFA 1XCCA 5A5KA 14GSA 2ALBA 4ZB8A 3VFIA 2KHPA 2DC5A 2GQKA 4L0UA 1YQ1A 4X1UA 2PU9C 4GSTA 2NBSA 1WWJA 1SL0B 3VWUA 5CYYA 5IO0A 3N5OA 4FYCA 1XVQA 2YNXA 1ZOFA 2RM5A 4NV2A 2PWJA 1V40A 1VRSD 2O89A 1OYJA 4MF5A 1YF1A 1K0OA 1BYEA 5CNWA 5AN1A 3BCKA 2C3TA 2LEGA 3DMLA 2O87A 2YJ7A 3HVVA 2IMIA 1W4VA 2PBJA 3A3TA 1GULA 1R5AA 4TR0A 1GLPA 1HYUA 3EU3A 1V98A 2QC7A 1TK8B 1XFLA 1R26A 1EOHA 3KJYA 1GUKA 1GLQA 2OKAA 2J23A 1GSUA 1QGVA 4O92A 3H79A 2H1BA 4MCUA 3TKPA 4JRRA 1RQMA 3A2WA 4KE3A 1WOUA 1BJXA 3WGEA 1ERUA 2JZSA 4ZIJA 3IV4A 2GSTA 4XS4B 4EO3A 2ON5A 2YPMA 1QFNA 1EGOA 2A2RA 3GTUB 6GSXA 5D8IA 4ECCA 1PX6A 2V1MA 2CA8A 2K18A 2WCIA 2LTKA 3TDGA 1V57A 1V9WA 1EZKA 1HNAA 2CZ2A 4LL4B 1ZGNA 3KM6A 3ZREA 4JEDA 2EIOA 5A4UA 3QCPA 2VO4A 1F6MC 5DDLA 1YEXA 4V2NA 1I5GA 2CT6A 2C3NA 3ISOA 3WGXA 1SJ6A 4ZBBA 5IMDA 5ECSA 6GSWA 2LQQA 1QK8A 5A4VA 3CBUA 4HI7A 3M3MA 1SD8A 1AQXA 5IMZA 2YP6A 2L6DA 2DJ3A 1PKWA 4IP1A 3KP8A 1A0FA 2H6YA 2R37A 5FWGA 3VI7A 2VIMA 4EXJA 2H8LA 2FHEA 2VM1A 3HHVA 2OBKA 1GTUA 2FNOA 1BAYA 2H71A 2L59A 3H1NA 2QGVA 2WS2A 1X5DA 4KNDA 1XOBA 3ZMLA 4F2IA 1CQGA 3TKQA 1SYRA 2VLUA 5G1LA 1TXXA 4IVFA 2AUVA 2FY6A 3IDVA 2G2QA 1TRVA 1HNCA 3GKKA 2WRTA 2A4VA 1XIYA 2WB9A 17GSA 3L0HA 3GN3A 2C80A 2O8VB 3IR4A 1AQVA 2E2MA 4IW9A 2H19A 4KW6A 2LJAA 4EVMA 4IP6A 1JZOA 4OO5A 3DYRA 3I69A 19GSA 3EWLA 3LWAA 5D9VA 4KX4A 4IN0A 2F3MA 1ST9A 3LG6A 4KAEA 3FKFA 1GSFA 2JU5A 2P31A 2X64A 5CP1A 1K3YA 3DD3A 3ZIJA 3TRXA 1N8JA 3J7Yk 4K7IA 1MD4A 4FYBA 4OCFA 2HRNA 2OJLA 3F9UA 5ECNB 2XHFA 4K0GA 4MK3A 4Q5FA 1XWAA 3TJGA 1J0FA 3TKSC 2LSTA 1G7EA 3L9VA 4JBBA 2XBIA 1B4QA 1RK4A 4XHMA 3DIEA 2YJHA 5EL8A 2AV4A 3RPPA 3FR6A 3FHKA 1NHYA 4ECJA 1DUGA 5ECRB 4HU9A 4KUNA 5DCHA 4CHSA 4G10A 3HD5A 1O85A 2C0DA 3CYNA 1B8XA 3APOA 1PSQA 3IXRA 1IYIA 4IJIA 4NHZA 4NV5A 5KN3A 1ON4A 5B6MA 3W8JA 1PRXA 3Q6OA 5LD0A 2V2GA 2ZUPA 4PQHA 2WFCA 2HZFA 6GSYA 4MZCA 1ZCPA 2REMA 2IJYA 1OC9A 1T8EB 3KP9A 1GSEA 4IQAA 2O7KA 4EKZA 3HA9A 1M2AA 5C00A 2YWOA 1JZRA 1DE1A 5IMFA 1X9SB 4NWYA 4HJMA 3M8NA 1PX7A 2I9HA 2H0HA 1M0UA 4KCEA 2E2GA 1SL2B 3JCML 2HE3A 1U3AA 2FGXA 1TRWA 1VF2A 1XXUA 5DQYA 4RI6A 3CSJA 2FWFA 4KA0A 1NSWA 4K1FA 3FZ4A 1MTCA 3SBCA 1OKTA 1TK5B 1K3OA 4MDCA 4BVXA 4PNFA 4I2UA 3CTFA 4O5RA 3KXOA 4V1Ap 2YWNA 3IRAA 1QQ2A 5ECIB 2RUEA 3F6DA 1TP9A 4FIWA 2DJ0A 5IMVA 4ZILA 4BVYA 3TOUA 4DEJA 2H66A 2H30A 2L4QA 4ECBA 5GSTA 2LKUA 2CZ3A 4P3YB 6GSUA 2GVPA 1XOAA 1YKCA 2AYTA 4AJ7A 1X9WB 1KEBA 1GH2A 5ELAA 5EVOA 4XS1A 1F3BA 1GTIA 2B3SA 1K3LA 4ZXGA 1B48A 2LRNA 4PUFC 2GQLA 4BWQA 1XWCA 4WETA 1PMTA 2VCQA 3FR9A 1UA5A 3Q18A 4POMA 2YOIA 4EDZA 1M99A 1MDIA 2C0EA 1TTZA 3C1RA 3CRUA 2VL2C 1THOA 3GURA 2OACA 4RI7A 4MA9A 4XS4A 1GUHA 1MDKA 3D21A 3FR3A 1R4WA 2OBIA 4RUVA 3U5RE 1R5PA 3GTUA 4JE1A 2GT5A 1FB0A 4IJ3A 4K7NA 3APQA 12GSA 3KZQA 1VGLA 4POLA 5CREA 2TRXA 2TRCP 2VD1A 3EYTA 4V1Ag 3GRXA 2PUKC 2OADA 3CXGA 3H8QA 5J3RA 5DALA 3FK8A 5IPGA 5IMCA 1USBA 3GL3A 1TDIA 2OE1A 1XWBA 3WD6A 4HU7A 2GDRA 4POBA 4K8MA 4YAVA 2DJKA 4KDUA 4HZ4A 3K8NA 2B7KA 2R3XA 4PX1A 1EEMA 4BPYA 2LNSA 3GX8A 3VI5A 5CRDA 2FA8A 4G2EA 5HFGA 1AW9A 4YQMA 4KCAA 3GKNA 2VLVA 4PNGA 5FT3A 3PINA 3E3EA 1QMVA 1G6YA 4K2DA 3WT2A 3GFKA 3GSTA 1H4OA 4LMWA 2H70A 1GNEA 1M2DA 3HVSA 4TKYA 1SKWB 4PQIA 2N5BA 5IQYA 4MH2A 3TJBA 3OR5A 1EOGA 3KEBA 4FO5A 1PA3A 1MEKA 4TXVA 4OD7A 1TU8A 2JL4A 5B8AA 2P5QA 4RQRA 3CMIA 2FWHA 2VCWA 1RW1A 5ENUA 5JWRB 1OKDA 5G5EA 2RIIA 2M46A 3SWLA 5GAND 2VCTA 1H75A 4GTUA 5LCZA 1TRSA 4F0BA 2B5EA 4JZQA 4IQ1A 3GYKA 4I6XA 2ES7A 1UC7A 2GT6A 2LQOA 5CAXA 1NM3A 1SYXA 1WIKA 2FWEA 2EC4A 4YH2A 4OWYA 5JWOB 3F63A 4GRFA 4NAXA 1X9MB 1SK1A 4MMMA 4Q5QA 4PQ1A 1M9BA 4TN8A 1Q98A 1K0CA 2K6VA 5G31A 1A2JA 2XPEA 4MF6A 1UVZA 2NPBA 4MP4A 3GX0A 2L57A 3TKRA 3I6AA 3LXZA 4EUYA 3D6IA 4FH8A 1FO5A 3LYKA 4LL1B 2P5RA 4TVEA 2I1UA 3KTBA 4ZBAA 3ME8A 4Q5NA 4ZB6A 3NZNA 4F9ZA 4NHWA 4ZL8A 2AB6A 3PH9A 2YV7A 5KN1A 2CX4A 3C7MA 1A8LA 5DQSA 5JCGA 4ACSA 2KLXA 2HI7A 1Z6MA 1JZDA 2CAIA 5D9TA 3KD0A 4KH7A 2R2JA 4D73B 2GTUA 3DXBA 1XW9A 3H93A 4H86A 3GL5A 5A4WA 2DLXA 4PXOA 1Y25A 2GQMA 3ZFLA 2IMDA 3TJFA 3P7XA 1HD2A 3G7JA 3ZIVA 5H5RA 4K6XA 4K9ZA 4ZL7A 2KP1A 4CDOA 3RBTA 1T1VA 3TCOA 1JHBA 3UAPA 2FD3A 5JCUA 1T3BA 2DBCA 4E8HA 1ZL9A 3ZRDA 1M9AA 4F82A 1G7OA 4AF2A 4TW5A 1THXA 3IK7A 5B8BA 5ELGA 2N5AA 3FYGA 1TI3A 3HZ4A 5F8BA 5DAKB 1GNWA 3CTGA 2VL9A 4J57E 2HT9A 3D5JA 2H0GA 2YV9A 5IPHA 5IIZA 4WR5A 3BJ5A 3UBLA 3CRTA 2MZCA 1U87A 4OFTA 1TW9A 3LEFA 2WULA 4F03A 2LNTA 3ZVJD 3TKSA 2FLSA 4G9HA 2G0FA 4K0NA 5D73A 2WDUA 2FWGA 1O73A 3HYPA 1KBNA 2M80A 3LQ7A 2H76A 3ERFA 1Z9HA 5H5QA 3L4NA 3UOMA 5GZZB 4PGTA 2B1LA 3FRCA 2LV3A 2K8VA 2ZCTA 2R5GA 1HNBA 4MLYA 1EGRA 3QFBC 5JCWA 5H5SA 4KDXA 2F9SA 3D0ZA 4YAPA 2PPTA 1Z3EA 4HOJA 1AUCA 3EMXA 1PN9A 5C04A 5HFIA 2X8CA 3NIVA 1PD21 4YQVA 2V6KA 3GMFA 2PN8A 5L71A 4WR4A 4WKWA 5B6NA 3R2QA 4IBPA 5CRGA 4O7HA 1TJDA 3TKSE 4I2TA 4NXIA 3F0IA 1G0TA 1K0BA 1T4YA 18GSA 2E0QA 1GRXA 3EVIA 4BWSA 4Q5RA 5EPFA 4XTSA 2JZRA 2B7JA 3GIXA 3IBHA 3QPMA 4GF0A 3UIWA 4TR4A 4X0XA 2O85A 5AIXA 4TXOB 5DCGA 3BCIA 2EIQA 3GV1A 5HR2A 1OC3A 4IELA 2E7PA 4AJ8A 3KCMA 4L8EA 2F51A 4HQZA 2H1AA 3E9JB 2C1YA 2WJUA 4BL7A 3ZFBA 4DSSB 2GSQA 3HJMA 3BD2A 4JR4A 1K0DA 2IWTA 1F2EA 2OA7A 3S9FA 4OFMA 1JLWA 3UJ1A 1GWCA 1SK2A 3I43A 2H6XA 2QKEA 3GKXA 2NTOA 1CQHA 3QD9A 4ZB9A 3QAWA 5J9CA 4I97A 2KP2A 3NOFA 1FW1A 1TKDB 2FCHA 1PQNA 2X99A 1ZYQB 2MBSA 2R4VA 1YF0A 4WF4A 1XBSA 4TR3A 2D2ZA 4V2MA 1X0RA 1KTEA 2IIYA 1U6TA 1ERWA 5AISA 1U88A 1X5EA 3FZ5A 1VF3A 3EURA 3ZYWA 1BX9A 3VWWA 1PKZA 2HZEB 4MPGA 1EV4A 3C71A 2AJQB 3G7YA 3P2AA 1ERTA 1WMJA 1HQOA 2K8SA 2B5XA 1EP7A 2GZZA 4TOPA 4KSOA 8GSSA 2VOCA 3LORA 1A24A 4MJCA 2VAFA 5AIVA 2XPDA 3D4MA 2YN1A 3FZ9A 1LJRA 4N10A 2VL2A 3KH7A 1LU4A 1F37A 4PURA 1ZZYA 5F06A 3EE2A 2CVDA 4AGSA 1XZOA 1F9MA 5ECPB 5G5FA 4EL1A 5GAPD 4GSSA 4POKA 1AIUA 5DJLA 2EIRA 4ID0A 4KSMA 2DJ2A 2KOKA 4ZL9A 3DEXA 2H74A 2VD0A 3VPQA 4MJAA 1WJKA 22GSA 2ON7A 2MMNA 1OAZA 4GLTA 3A5WA 1GSDA 1T4ZA 3VLNA 2A2SA 3TJKA 4IS0A 2GZPA 5COHA 11GSA 2YZHA 4IKHA 1Z6NA 3VURA 2C8UA 3A2XA 2B5YA 3LSZA 3HZ8A 5HR3A 2ZNMA 5FHIA 3HXSA 5CRHA 2MMAA 1V58A 5HR1A 3E0UA 5ECHB 1Z7PA 4K7OA 1SL1B 1O8XA 2HNLA 1ML6A 3G9BA 3TRPA 1K0NA 3GA4A 3L78A 3WYWA 1ACVA 2LJKA 1AQWA 2BJXA 4LLRA 4D73A 2MMOA 1ILOA 3HKRA 3KGKA 3PR8A 4MABA 3UBKA
chains in the Genus database with same CATH superfamily
5JWQB 3DWVA 4E8EA 1GSQA 3LFLA 1UN2A 3D4TA 5ECMB 4OO4A 2DIYA 2YWIA 4MZBA 4O5QA 4O32A 3HVNA 5INYA 3VPTA 1WP0A 2GGTA 5D9XA 2QSIA 3F3QA 1YKAA 2YWMA 3G7IA 4KGIA 1GSYA 4DSQA 2VCXA 1B9XC 1ABAA 4N0VA 3QR6A 1I9DA 2GLRA 4A5PA 5LNKe 1FG4A 1AAZA 4QL7A 3EU4A 10GSA 4HJ2A 6GSVA 5DAKA 2V41A 3KH9A 1GTBA 3A2VA 5F05A 1EEJA 3Q19A 1XPVA 1E2YA 3QDNA 5CO3A 3GH6A 3QOUA 4IGJA 4GXZA 2PERA 3LJRA 5ID2B 3I9V2 2YZUA 5ECQB 5B7CA 4YQUA 4ILFA 3RHBA 1WPIA 1PGTA 2C0GA 3FEUA 5IOWA 1QXHA 1C72A 2L4CA 4MPFA 2LRTA 4BVXB 1ERVA 1U3IA 3V1WA 2IMEA 2HSYA 2OE0A 4MZWA 3FW2A 2VL3A 5J9BA 1T7PB 2X4AA 2CX3A 5DVBA 5AGYA 4ISDA 3UL3A 2AHEA 5DJMA 3ME7A 2RM6A 4GCIA 3TOTA 2V32A 2DSAA 2L6CA 2BMXA 4MJEA 1M2BA 1OC8A 5D9WA 3CSHA 5HFKA 4HZ2A 1F3AA 1PL2A 4XRDA 4LA1A 2HYXA 3UEMA 3ZITA 1GP1A 3HJOA 5D93A 3UMAA 2HXKA 4F0CA 2IMKA 1Y6EA 4IHUA 1VF4A 2CVBA 2LRCA 2Z9SA 5J5NA 3PGTA 2HFDA 5J41A 4BA7A 1ZMAA 3LGCA 4WXTA 3GSSA 3WGDA 4TXOA 3M1GA 1K0MA 3RPNA 2CVKA 2JZTA 3HDCA 4KDYA 1X5CA 3U6VA 1EP8A 2HRAA 4WBRD 2HRFA 3IAM2 2VCZA 3C8EA 1VF1A 1SD9A 2DJ1A 1YEPA 3Q74A 5F07A 5IMAA 1OVNA 4DSSA 2C0FA 2R0GA 3ZMKA 4HUAA 5IO2A 3N9JA 3TUEA 3M0FA 1R7HA 3QAGA 5KN2A 3UVHA 5DALB 4GQFA 2IL3A 2DMMA 2JSYA 3ERWA 3IK9A 2WZ9A 7GSSA 3UARA 4LMVA 3J7Yb 2IFQB 2DIZA 4ULXA 3C1SA 1FVJA 3L9SA 3F6FA 1J08A 1SK0A 3F4RA 4HEA2 4K2XA 4I5QA 4X43A 5HR0A 5ECLB 2I81A 1MD3A 2LUSA 3F8UA 2HZEA 4AJ6A 2XC2A 4G0LA 1K0AA 3O3TA 4XIHA 3DVWA 3GH9A 4TR1B 2RUFA 3FMWA 4HS1A 3HCZA 2GSRA 4JR6A 1O8WA 3HY2A 4ICYA 1A2LA 4CW9A 3EMPA 4K5SA 1BQ7A 3P8WA 1DBYA 3MIXA 3QAVA 6GSSA 4OCEA 3RDWA 4N0ZA 3ZL5A 2PVOC 2L5LA 1SKRB 1Z5YE 2P0GA 1LBKA 2PVQA 2QA2A 2V6OA 3KMOA 4ML1A 3GKMA 3M9JA 3TJJA 3QFAC 3KTLA 3ERGA 3IE3A 5ECOB 1YY7A 5G30A 1SU9A 1BG5A 3VWXA 1Z7RA 2K9FA 3ZTLA 4L5LA 1FB6A 5EY6A 3QMXA 1NW2A 3LW9A 4NMUA 1ZYPA 2GSSA 1GTAA 5KN0A 3CSIA 2AAWA 5IM9A 2WGRA 5G2ZA 4N11A 1MDJA 1GUMA 2XBQA 2H75A 1M7TA 2M72A 2PMTA 3TGZA 2B1KA 2J9HA 3M9KA 2F8FA 2H01A 2C3QA 2CAQA 1TRUA 2VUPA 4WBJA 4HDEA 4KB3A 4G19A 3TRQA 1PL1A 4KF9A 2VM2A 2H73A 3IOSA 3LYPA 1KNGA 1TK0B 5D96A 1EWXA 4Z2RA 3C73A 2L5OA 2N5FA 3VWVA 2JSZA 1XWKA 2H6ZA 5G1KA 1FOHA 1ZYEA 1A8YA 1A2MA 3US3A 5GSSA 2H0IA 3FZAA 1WRYA 2VCVA 3DGQA 4N30A 1SJZA 1E6BA 3WT1A 2B6MA 1A23A 5E4WA 3F4SA 1SJIA 4GQCA 2IN3A 3H4KA 1JFUA 2HSHA 2C4JA 4WF5A 2MBTA 3KIJA 3MWHA 3IHQA 2OE3A 2CQ9A 2CV4A 9GSSA 1FAAA 3F3RA 3APSA 5CRWA 5J4UA 2JACA 1W89A 1QUWA 1TU7A 4XCSA 1YZXA 3L9UA 3DKSA 5ECKB 3MSZA 1DE2A 3O76A 3F4TA 3RAZA 1B9YC 16GSA 2FA4A 5ID2A 4TRXA 4ML6A 3ZVJA 3GUSA 4HQSA 4QQ7A 4V2LA 4EDYA 2YANA 2F8AA 1TOFA 3DVXA 1O6JA 1N2AA 2YCDA 3ZZXA 1NHOA 4L5OA 3VK9A 2QA1A 2H72A 3HVXA 5IOXA 4MF7A 4EC0A 3GHAA 3P90A 1V2AA 2X49A 4JU5A 4YKFA 1YDKA 3LXTA 2DJJA 4EE0A 2LS5A 3MAKA 1BEDA 2X8GA 4DVCA 3FY7A 4HSCX 3MDKA 1XVWA 4EIQA 2BTOT 4O5UA 1Q4JA 4EF0A 1A0RP 4QL9A 1URMA 5E59A 4CY8A 4FYUA 4OFNA 5KEJA 2DMLA 2H1GA 1TI1A 3DRNA 3MNGA 4DSRA 2LJRA 4GWRA 4MNNA 2H1DA 2I3YA 4WEYA 1G6WA 2HLSA 1O81A 2PGTA 2GZYA 5DBQA 4L0WA 4J2FA 2MYGA 3IAS2 3ZLPA 3W8SA 2X8HA 2R6KA 3BOAA 2I4AA 1S3CA 2RLIA 3EINA 1SENA 4XS6A 1JZWA 3W6GA 1XW6A 3IC4A 4ZBDA 1EV9A 3BBYA 3UVTA 3RHCA 2A2PA 4MH3A 4GSNA 1T00A 2MMZA 2TIRA 4MJBA 3GNJA 1OE8A 1DSBA 1XWGA 1S3DA 3KMNA 2IFQA 1GL8A 1OC9B 1YJ6A 4NPBA 20GSA 3HJPA 2KUCA 2NDOA 4J56E 1SKSB 1IYHA 3ED3A 2VLTA 13GSA 1WE0A 4PUAA 4RQXA 1AC1A 1XW5A 1B4PA 2NVLA 4XRAA 5F0GA 2GS3A 3IPZA 4ECIA 3TB2A 3EC3A 2JADA 6GSTA 1J9BA 3AY8A 4EIPA 3O6TA 5HQPA 2IPAA 4I8BA 4Z7XA 1GSSA 2DKIA 1O7UA 4OMVA 1FOVA 1FVKA 4TR1A 1OE7A 1FHEA 1JLVA 3D22A 1S3AA 3IA1A 5ABRA 1AXDA 2FUG2 2IMFA 1XCCA 5A5KA 14GSA 2ALBA 4ZB8A 3VFIA 2KHPA 2DC5A 2GQKA 4L0UA 1YQ1A 4X1UA 2PU9C 4GSTA 2NBSA 1WWJA 1SL0B 3VWUA 5CYYA 5IO0A 3N5OA 4FYCA 1XVQA 2YNXA 1ZOFA 2RM5A 4NV2A 2PWJA 1V40A 1VRSD 2O89A 1OYJA 4MF5A 1YF1A 1K0OA 4BVYB 5KOWA 1BYEA 5CNWA 5AN1A 3BCKA 2C3TA 2LEGA 3DMLA 2O87A 2YJ7A 3HVVA 2IMIA 1W4VA 2PBJA 3A3TA 1GULA 1R5AA 4TR0A 1GLPA 1HYUA 3EU3A 1V98A 2QC7A 1TK8B 1XFLA 1R26A 1EOHA 3KJYA 1GUKA 1GLQA 2OKAA 2J23A 1GSUA 1QGVA 4O92A 3H79A 2H1BA 4MCUA 3TKPA 4USSA 4JRRA 1RQMA 3A2WA 4KE3A 1WOUA 1BJXA 3WGEA 1ERUA 2JZSA 4ZIJA 3IV4A 2GSTA 4XS4B 4EO3A 2ON5A 2YPMA 1QFNA 1EGOA 2A2RA 3GTUB 6GSXA 5D8IA 4ECCA 1PX6A 2V1MA 2CA8A 2K18A 2WCIA 2LTKA 3TDGA 1V57A 1V9WA 1EZKA 1HNAA 2CZ2A 4LL4B 1ZGNA 1XG8A 3KM6A 3ZREA 4JEDA 2EIOA 5A4UA 3QCPA 2VO4A 1F6MC 5DDLA 1YEXA 4V2NA 4X4JA 1I5GA 2CT6A 2C3NA 3ISOA 3WGXA 1SJ6A 4ZBBA 5IMDA 5ECSA 6GSWA 2LQQA 1QK8A 5A4VA 3CBUA 4HI7A 3M3MA 1SD8A 1AQXA 5IMZA 2YP6A 2L6DA 2DJ3A 1PKWA 4IP1A 3KP8A 1A0FA 2H6YA 2R37A 5FWGA 3VI7A 2VIMA 4EXJA 2H8LA 2FHEA 2VM1A 3HHVA 2OBKA 1GTUA 2FNOA 1BAYA 2H71A 2L59A 3H1NA 2QGVA 2WS2A 1X5DA 4KNDA 1XOBA 3ZMLA 4F2IA 1CQGA 3TKQA 1SYRA 2VLUA 5G1LA 1TXXA 4IVFA 2AUVA 2FY6A 3IDVA 2G2QA 1TRVA 1HNCA 3GKKA 2WRTA 2A4VA 1XIYA 2WB9A 17GSA 3L0HA 3GN3A 2C80A 2O8VB 3IR4A 1AQVA 2E2MA 4IW9A 2H19A 4KW6A 2LJAA 4EVMA 4IP6A 1JZOA 4OO5A 3DYRA 3I69A 19GSA 3EWLA 3LWAA 5D9VA 4KX4A 4IN0A 2F3MA 1ST9A 3LG6A 4KAEA 3FKFA 1GSFA 2JU5A 2P31A 2X64A 5CP1A 1K3YA 3DD3A 3ZIJA 3TRXA 1N8JA 3J7Yk 4K7IA 1MD4A 4FYBA 4OCFA 2HRNA 2OJLA 3F9UA 5ECNB 2XHFA 2DKHA 4K0GA 4MK3A 4Q5FA 1XWAA 3TJGA 1J0FA 3TKSC 2LSTA 1G7EA 3L9VA 4JBBA 2XBIA 1B4QA 2A4HA 1RK4A 1PN0A 4XHMA 3DIEA 2YJHA 3IC8A 5EL8A 2AV4A 3RPPA 3FR6A 3FHKA 1NHYA 4ECJA 1DUGA 5ECRB 4HU9A 4KUNA 5DCHA 4CHSA 4G10A 3HD5A 1O85A 2C0DA 3CYNA 1B8XA 3APOA 1PSQA 3IXRA 1IYIA 4IJIA 4NHZA 4NV5A 5KN3A 1ON4A 5B6MA 3W8JA 1PRXA 3Q6OA 5LD0A 2V2GA 2ZUPA 4G0IA 4PQHA 2R0CA 2WFCA 2HZFA 6GSYA 4MZCA 1ZCPA 2REMA 2IJYA 1OC9A 1T8EB 4K5RA 3KP9A 1GSEA 4IQAA 2O7KA 4EKZA 3HA9A 1M2AA 5C00A 2YWOA 1JZRA 1DE1A 5IMFA 1X9SB 4NWYA 4HJMA 3M8NA 1PX7A 2I9HA 2H0HA 1M0UA 2R0PA 4KCEA 2E2GA 1SL2B 3JCML 2HE3A 1U3AA 2FGXA 1TRWA 1VF2A 1XXUA 5DQYA 4BIKA 4RI6A 3CSJA 2FWFA 4KA0A 5BMUA 1NSWA 4K1FA 3FZ4A 1MTCA 3SBCA 1OKTA 1PFOA 1TK5B 1K3OA 4MDCA 4BVXA 4PNFA 4I2UA 3CTFA 4O5RA 3KXOA 4V1Ap 2YWNA 3IRAA 3A5IA 1QQ2A 5ECIB 2RUEA 3F6DA 1TP9A 4FIWA 2DJ0A 5IMVA 4ZILA 4BVYA 3TOUA 4DEJA 2H66A 2H30A 2L4QA 4ECBA 5GSTA 2LKUA 2CZ3A 4P3YB 6GSUA 2GVPA 1XOAA 1YKCA 2AYTA 4AJ7A 1X9WB 1KEBA 3R3EA 1GH2A 5ELAA 5EVOA 4XS1A 1F3BA 1GTIA 2B3SA 1K3LA 4ZXGA 1B48A 2LRNA 4PUFC 2GQLA 4BWQA 1XWCA 4WETA 1PMTA 2VCQA 3FR9A 1UA5A 3Q18A 4POMA 2YOIA 4EDZA 1M99A 1MDIA 2C0EA 1TTZA 3C1RA 3CRUA 2VL2C 1THOA 3GURA 2OACA 4RI7A 4MA9A 4XS4A 1GUHA 1MDKA 3D21A 3FR3A 1R4WA 2OBIA 4RUVA 3U5RE 1R5PA 3GTUA 4JE1A 2GT5A 1FB0A 4IJ3A 4K7NA 3APQA 12GSA 3KZQA 1VGLA 4POLA 5CREA 2TRXA 2TRCP 2VD1A 3EYTA 4V1Ag 3GRXA 2PUKC 2OADA 3CXGA 3H8QA 4BL7B 5J3RA 5DALA 3FK8A 5IPGA 5IMCA 1USBA 3GL3A 1TDIA 2OE1A 1XWBA 3WD6A 4HU7A 2GDRA 4POBA 4K8MA 4YAVA 2DJKA 4KDUA 4HZ4A 3K8NA 2B7KA 2R3XA 4PX1A 1EEMA 4BPYA 2LNSA 3GX8A 3VI5A 2UZ8A 5CRDA 2FA8A 4G2EA 5HFGA 1AW9A 4YQMA 4KCAA 3GKNA 2VLVA 4PNGA 5FT3A 3PINA 3E3EA 1QMVA 1G6YA 4K2DA 3WT2A 3GFKA 3GSTA 1H4OA 4LMWA 2H70A 1GNEA 1M2DA 3HVSA 4TKYA 1SKWB 4PQIA 2N5BA 5IQYA 4MH2A 3TJBA 3OR5A 1EOGA 3KEBA 4FO5A 1PA3A 1MEKA 4TXVA 4OD7A 1TU8A 2JL4A 5B8AA 2P5QA 4RQRA 3CMIA 2FWHA 2VCWA 1RW1A 5ENUA 5JWRB 1OKDA 5G5EA 2RIIA 4FQUA 2M46A 3SWLA 5GAND 2VCTA 1H75A 4GTUA 5LCZA 1TRSA 4F0BA 2B5EA 4JZQA 4IQ1A 3GYKA 4I6XA 2ES7A 1UC7A 2GT6A 2LQOA 5CAXA 1NM3A 1SYXA 1WIKA 2FWEA 2EC4A 4YH2A 4OWYA 5JWOB 3F63A 4GRFA 4NAXA 1X9MB 1SK1A 4MMMA 4Q5QA 4PQ1A 1M9BA 4TN8A 1Q98A 1K0CA 2K6VA 5G31A 5KOXA 1A2JA 2XPEA 4MF6A 1ZYNA 1UVZA 2NPBA 4MP4A 3GX0A 2L57A 3TKRA 3EPTA 3I6AA 3LXZA 4EUYA 3D6IA 4FH8A 1FO5A 3LYKA 4LL1B 2P5RA 4TVEA 2I1UA 3KTBA 4ZBAA 3ME8A 4Q5NA 4ZB6A 3NZNA 4F9ZA 4NHWA 4ZL8A 2AB6A 3PH9A 2YV7A 5KN1A 2CX4A 3C7MA 1A8LA 5DQSA 5JCGA 4ACSA 2KLXA 2HI7A 1Z6MA 1JZDA 2CAIA 5D9TA 3KD0A 4KH7A 2R2JA 4D73B 2GTUA 3DXBA 1XW9A 3H93A 4H86A 3GL5A 5A4WA 2DLXA 4PXOA 1Y25A 2GQMA 3ZFLA 2IMDA 3TJFA 3P7XA 1HD2A 3G7JA 3ZIVA 5H5RA 4K6XA 4K9ZA 4ZL7A 2KP1A 4CDOA 3RBTA 1T1VA 3TCOA 4Z2UA 1JHBA 3UAPA 2FD3A 5JCUA 1T3BA 2DBCA 4E8HA 1ZL9A 3ZRDA 1M9AA 4F82A 1G7OA 4AF2A 4Z2TA 4TW5A 1THXA 3IK7A 5B8BA 5ELGA 2N5AA 3FYGA 1TI3A 5BRTA 2HRKA 3HZ4A 5F8BA 5DAKB 1GNWA 3CTGA 2VL9A 4J57E 2HT9A 3D5JA 2HSMA 2H0GA 2YV9A 5IPHA 5IIZA 4WR5A 3BJ5A 3UBLA 3CRTA 2MZCA 1U87A 4OFTA 1TW9A 3LEFA 2WULA 4F03A 2LNTA 3ZVJD 3TKSA 2FLSA 4G9HA 2G0FA 4K0NA 5D73A 2WDUA 2FWGA 1O73A 3HYPA 1KBNA 2M80A 3LQ7A 2H76A 3ERFA 1Z9HA 5H5QA 3L4NA 3UOMA 5GZZB 4PGTA 4CY6A 2B1LA 3FRCA 2LV3A 2K8VA 2ZCTA 2R5GA 1HNBA 4MLYA 1EGRA 3QFBC 5JCWA 5H5SA 4KDXA 2F9SA 3D0ZA 4YAPA 2PPTA 1Z3EA 4HOJA 1AUCA 3EMXA 1PN9A 5C04A 5HFIA 2X8CA 3NIVA 1PD21 4YQVA 2V6KA 3GMFA 2PN8A 5L71A 4WR4A 4WKWA 5B6NA 3R2QA 4IBPA 5CRGA 4O7HA 1TJDA 3TKSE 4I2TA 4NXIA 3F0IA 1G0TA 1K0BA 1T4YA 18GSA 2E0QA 1GRXA 1M3JA 3EVIA 4BWSA 4Q5RA 5EPFA 4XTSA 2JZRA 2B7JA 3GIXA 3IBHA 3QPMA 4GF0A 3UIWA 4TR4A 4X0XA 2O85A 5AIXA 4TXOB 5DCGA 3BCIA 2EIQA 3GV1A 5HR2A 1OC3A 4IELA 2E7PA 4AJ8A 3KCMA 4L8EA 2F51A 4HQZA 2H1AA 3E9JB 2C1YA 2WJUA 4BL7A 3ZFBA 4DSSB 2GSQA 3HJMA 3BD2A 4JR4A 1K0DA 2IWTA 1F2EA 2OA7A 3S9FA 4OFMA 1JLWA 3UJ1A 1GWCA 1SK2A 3I43A 2H6XA 2QKEA 3GKXA 3PPUA 2NTOA 1CQHA 3QD9A 4ZB9A 3QAWA 5J9CA 4I97A 1M3IA 2KP2A 3NOFA 1FW1A 1TKDB 2FCHA 1PQNA 2X99A 1ZYQB 2MBSA 2R4VA 1YF0A 4G0KA 4WF4A 1XBSA 4TR3A 2D2ZA 4V2MA 1X0RA 1KTEA 2IIYA 1U6TA 1ERWA 5AISA 1U88A 1X5EA 3FZ5A 1VF3A 3EURA 3ZYWA 1BX9A 3VWWA 1PKZA 2HZEB 4MPGA 1EV4A 3C71A 2AJQB 3MYDA 3G7YA 3P2AA 1ERTA 1WMJA 1HQOA 2K8SA 2B5XA 1EP7A 2GZZA 4TOPA 4KSOA 8GSSA 2VOCA 3LORA 1A24A 4MJCA 2VAFA 5AIVA 2XPDA 3D4MA 2YN1A 3FZ9A 1LJRA 4N10A 2VL2A 3KH7A 1LU4A 1F37A 4PURA 1ZZYA 5F06A 3EE2A 2CVDA 1S3RA 3IHGA 4AGSA 1XZOA 1F9MA 5ECPB 5G5FA 4EL1A 5GAPD 4GSSA 4POKA 1AIUA 5DJLA 2EIRA 4ID0A 4KSMA 2DJ2A 2KOKA 4ZL9A 3DEXA 2H74A 2VD0A 3VPQA 4MJAA 1WJKA 22GSA 2ON7A 2MMNA 1OAZA 4GLTA 3A5WA 1GSDA 1T4ZA 4PTSA 3VLNA 2A2SA 3TJKA 4IS0A 2GZPA 5COHA 11GSA 2YZHA 4IKHA 1Z6NA 3VURA 2C8UA 3A2XA 2B5YA 3LSZA 3HZ8A 5HR3A 2ZNMA 5FHIA 3HXSA 5CRHA 2MMAA 1V58A 5HR1A 3E0UA 5ECHB 1Z7PA 4K7OA 1SL1B 4YKGA 1O8XA 2HNLA 1ML6A 3G9BA 3TRPA 1K0NA 3GA4A 3L78A 3WYWA 1ACVA 2LJKA 1AQWA 2BJXA 4LLRA 4D73A 2MMOA 3CQFA 1ILOA 3HKRA 3KGKA 3PR8A 4MABA 3UBKA
chains in the Genus database with same CATH topology
5JWQB 3DWVA 4E8EA 1GSQA 3LFLA 1UN2A 3D4TA 5ECMB 4OO4A 2DIYA 2YWIA 4MZBA 4O5QA 4O32A 5INYA 3VPTA 1WP0A 2GGTA 5D9XA 2QSIA 3F3QA 1YKAA 2YWMA 3G7IA 4KGIA 1GSYA 4DSQA 2VCXA 1B9XC 1ABAA 4N0VA 3QR6A 1I9DA 2GLRA 4A5PA 5LNKe 1FG4A 1AAZA 4QL7A 3EU4A 10GSA 4HJ2A 6GSVA 5DAKA 2V41A 3KH9A 1GTBA 3A2VA 5F05A 1EEJA 3Q19A 1XPVA 1E2YA 3QDNA 5CO3A 3GH6A 3QOUA 4IGJA 4GXZA 2PERA 3LJRA 5ID2B 3I9V2 2YZUA 5ECQB 5B7CA 4YQUA 4ILFA 3RHBA 1WPIA 1PGTA 2C0GA 3FEUA 5IOWA 1QXHA 1C72A 2L4CA 4MPFA 2LRTA 4BVXB 1ERVA 1U3IA 3V1WA 2IMEA 2HSYA 2OE0A 4MZWA 3FW2A 2VL3A 5J9BA 1T7PB 2X4AA 2CX3A 5DVBA 5AGYA 4ISDA 3UL3A 2AHEA 5DJMA 3ME7A 2RM6A 4GCIA 3TOTA 2V32A 2DSAA 2L6CA 2BMXA 4MJEA 1M2BA 1OC8A 5D9WA 3CSHA 5HFKA 4HZ2A 1F3AA 1PL2A 4XRDA 4LA1A 2HYXA 3UEMA 3ZITA 1GP1A 3HJOA 5D93A 3UMAA 2HXKA 4F0CA 2IMKA 1Y6EA 4IHUA 1VF4A 2CVBA 2LRCA 2Z9SA 5J5NA 3PGTA 2HFDA 5J41A 4BA7A 1ZMAA 3LGCA 4WXTA 3GSSA 3WGDA 4TXOA 3M1GA 1K0MA 3RPNA 2CVKA 2JZTA 3HDCA 4KDYA 1X5CA 3U6VA 1EP8A 2HRAA 4WBRD 2HRFA 3IAM2 2VCZA 3C8EA 1VF1A 1SD9A 2DJ1A 1YEPA 3Q74A 5F07A 5IMAA 1OVNA 4DSSA 2C0FA 2R0GA 3ZMKA 4HUAA 5IO2A 3N9JA 3TUEA 3M0FA 1R7HA 3QAGA 5KN2A 3UVHA 5DALB 4GQFA 2IL3A 2DMMA 2JSYA 3ERWA 3IK9A 2WZ9A 7GSSA 3UARA 4LMVA 3J7Yb 2IFQB 2DIZA 4ULXA 3C1SA 1FVJA 3L9SA 3F6FA 1J08A 1SK0A 3F4RA 4HEA2 4K2XA 4I5QA 4X43A 5HR0A 5ECLB 2I81A 1MD3A 2LUSA 3F8UA 2HZEA 4AJ6A 2XC2A 4G0LA 1K0AA 3O3TA 4XIHA 3DVWA 3GH9A 4TR1B 2RUFA 3FMWA 4HS1A 3HCZA 2GSRA 4JR6A 1O8WA 3HY2A 4ICYA 1A2LA 4CW9A 3EMPA 4K5SA 1BQ7A 3P8WA 1DBYA 3MIXA 3QAVA 6GSSA 4OCEA 3RDWA 4N0ZA 3ZL5A 2PVOC 2L5LA 1SKRB 1Z5YE 2P0GA 1LBKA 2PVQA 2QA2A 2V6OA 3KMOA 4ML1A 3GKMA 3M9JA 3TJJA 3QFAC 3KTLA 3ERGA 3IE3A 5ECOB 1YY7A 5G30A 1SU9A 1BG5A 3VWXA 1Z7RA 2K9FA 3ZTLA 4L5LA 1FB6A 5EY6A 3QMXA 1NW2A 3LW9A 4NMUA 1ZYPA 2GSSA 1GTAA 5KN0A 3CSIA 2AAWA 5IM9A 2WGRA 5G2ZA 4N11A 1MDJA 1GUMA 2XBQA 2H75A 1M7TA 2M72A 2PMTA 3TGZA 2B1KA 2J9HA 3M9KA 2F8FA 2H01A 2C3QA 2CAQA 1TRUA 2VUPA 4WBJA 4HDEA 4KB3A 4G19A 3TRQA 1PL1A 4KF9A 2VM2A 2H73A 3IOSA 3LYPA 1KNGA 1TK0B 5D96A 1EWXA 4Z2RA 3C73A 2L5OA 2N5FA 3VWVA 2JSZA 1XWKA 2H6ZA 5G1KA 1FOHA 1ZYEA 1A8YA 1A2MA 3US3A 5GSSA 2H0IA 3FZAA 1WRYA 2VCVA 3DGQA 4N30A 1SJZA 1E6BA 3WT1A 2B6MA 1A23A 5E4WA 3F4SA 1SJIA 4GQCA 2IN3A 3H4KA 1JFUA 2HSHA 2C4JA 4WF5A 2MBTA 3KIJA 3MWHA 3IHQA 2OE3A 2CQ9A 2CV4A 9GSSA 1FAAA 3F3RA 3APSA 5CRWA 5J4UA 2JACA 1W89A 1QUWA 1TU7A 4XCSA 1YZXA 3L9UA 3DKSA 5ECKB 3MSZA 1DE2A 3O76A 3F4TA 3RAZA 1B9YC 16GSA 2FA4A 5ID2A 4TRXA 4ML6A 3ZVJA 3GUSA 4HQSA 4QQ7A 4V2LA 4EDYA 2YANA 2F8AA 1TOFA 3DVXA 1O6JA 1N2AA 2YCDA 3ZZXA 1NHOA 4L5OA 3VK9A 2QA1A 2H72A 3HVXA 5IOXA 4MF7A 4EC0A 3GHAA 3P90A 1V2AA 2X49A 4JU5A 4YKFA 1YDKA 3LXTA 2DJJA 4EE0A 2LS5A 3MAKA 1BEDA 2X8GA 4DVCA 3FY7A 3MDKA 1XVWA 4EIQA 2BTOT 4O5UA 1Q4JA 4EF0A 1A0RP 4QL9A 1URMA 5E59A 4CY8A 4FYUA 4OFNA 5KEJA 2DMLA 2H1GA 1TI1A 3DRNA 3MNGA 4DSRA 2LJRA 4GWRA 4MNNA 2H1DA 2I3YA 4WEYA 1G6WA 2HLSA 1O81A 2PGTA 2GZYA 5DBQA 4L0WA 4J2FA 2MYGA 3IAS2 3ZLPA 3W8SA 2X8HA 2R6KA 3BOAA 2I4AA 1S3CA 2RLIA 3EINA 1SENA 4XS6A 1JZWA 3W6GA 1XW6A 3IC4A 4ZBDA 1EV9A 3BBYA 3UVTA 3RHCA 2A2PA 4MH3A 4GSNA 1T00A 2MMZA 2TIRA 4MJBA 3GNJA 1OE8A 1DSBA 1XWGA 1S3DA 3KMNA 2IFQA 1GL8A 1OC9B 1YJ6A 4NPBA 20GSA 3HJPA 2KUCA 2NDOA 4J56E 1SKSB 1IYHA 3ED3A 2VLTA 13GSA 1WE0A 4PUAA 4RQXA 1AC1A 1XW5A 1B4PA 2NVLA 4XRAA 5F0GA 2GS3A 3IPZA 4ECIA 3TB2A 3EC3A 2JADA 6GSTA 1J9BA 3AY8A 4EIPA 3O6TA 5HQPA 2IPAA 4I8BA 4Z7XA 1GSSA 2DKIA 1O7UA 4OMVA 1FOVA 1FVKA 4TR1A 1OE7A 1FHEA 1JLVA 3D22A 1S3AA 3IA1A 5ABRA 1AXDA 2FUG2 2IMFA 1XCCA 5A5KA 14GSA 2ALBA 4ZB8A 3VFIA 2KHPA 2DC5A 2GQKA 4L0UA 1YQ1A 4X1UA 2PU9C 4GSTA 2NBSA 1WWJA 1SL0B 3VWUA 5CYYA 5IO0A 3N5OA 4FYCA 1XVQA 2YNXA 1ZOFA 2RM5A 4NV2A 2PWJA 1V40A 1VRSD 2O89A 1OYJA 4MF5A 1YF1A 1K0OA 4BVYB 5KOWA 1BYEA 5CNWA 5AN1A 3BCKA 2C3TA 2LEGA 3DMLA 2O87A 2YJ7A 3HVVA 2IMIA 1W4VA 2PBJA 3A3TA 1GULA 1R5AA 4TR0A 1GLPA 1HYUA 3EU3A 1V98A 2QC7A 1TK8B 1XFLA 1R26A 1EOHA 3KJYA 1GUKA 1GLQA 2OKAA 2J23A 1GSUA 1QGVA 4O92A 3H79A 2H1BA 4MCUA 3TKPA 4USSA 4JRRA 1RQMA 3A2WA 4KE3A 1WOUA 1BJXA 3WGEA 1ERUA 2JZSA 4ZIJA 3IV4A 2GSTA 4XS4B 4EO3A 2ON5A 2YPMA 1QFNA 1EGOA 2A2RA 3GTUB 6GSXA 5D8IA 4ECCA 1PX6A 2V1MA 2CA8A 2K18A 2WCIA 2LTKA 3TDGA 1V57A 1V9WA 1EZKA 1HNAA 2CZ2A 4LL4B 1ZGNA 3KM6A 3ZREA 4JEDA 2EIOA 5A4UA 3QCPA 2VO4A 1F6MC 5DDLA 1YEXA 4V2NA 4X4JA 1I5GA 2CT6A 2C3NA 3ISOA 3WGXA 1SJ6A 4ZBBA 5IMDA 5ECSA 6GSWA 2LQQA 1QK8A 5A4VA 3CBUA 4HI7A 3M3MA 1SD8A 1AQXA 5IMZA 2YP6A 2L6DA 2DJ3A 1PKWA 4IP1A 3KP8A 1A0FA 2H6YA 2R37A 5FWGA 3VI7A 2VIMA 4EXJA 2H8LA 2FHEA 2VM1A 3HHVA 2OBKA 1GTUA 2FNOA 1BAYA 2H71A 2L59A 3H1NA 2QGVA 2WS2A 1X5DA 4KNDA 1XOBA 3ZMLA 4F2IA 1CQGA 3TKQA 1SYRA 2VLUA 5G1LA 1TXXA 4IVFA 2AUVA 2FY6A 3IDVA 2G2QA 1TRVA 1HNCA 3GKKA 2WRTA 2A4VA 1XIYA 2WB9A 17GSA 3L0HA 3GN3A 2C80A 2O8VB 3IR4A 1AQVA 2E2MA 4IW9A 2H19A 4KW6A 2LJAA 4EVMA 4IP6A 1JZOA 4OO5A 3DYRA 3I69A 19GSA 3EWLA 3LWAA 5D9VA 4KX4A 4IN0A 2F3MA 1ST9A 3LG6A 4KAEA 3FKFA 1GSFA 2JU5A 2P31A 2X64A 5CP1A 1K3YA 3DD3A 3ZIJA 3TRXA 1N8JA 3J7Yk 4K7IA 1MD4A 4FYBA 4OCFA 2HRNA 2OJLA 3F9UA 5ECNB 2XHFA 2DKHA 4K0GA 4MK3A 4Q5FA 1XWAA 3TJGA 1J0FA 3TKSC 2LSTA 1G7EA 3L9VA 4JBBA 2XBIA 1B4QA 2A4HA 1RK4A 1PN0A 4XHMA 3DIEA 2YJHA 3IC8A 5EL8A 2AV4A 3RPPA 3FR6A 3FHKA 1NHYA 4ECJA 1DUGA 5ECRB 4HU9A 4KUNA 5DCHA 4CHSA 4G10A 3HD5A 1O85A 2C0DA 3CYNA 1B8XA 3APOA 1PSQA 3IXRA 1IYIA 4IJIA 4NHZA 4NV5A 5KN3A 1ON4A 5B6MA 3W8JA 1PRXA 3Q6OA 5LD0A 2V2GA 2ZUPA 4G0IA 4PQHA 2R0CA 2WFCA 2HZFA 6GSYA 4MZCA 1ZCPA 2REMA 2IJYA 1OC9A 1T8EB 4K5RA 3KP9A 1GSEA 4IQAA 2O7KA 4EKZA 3HA9A 1M2AA 5C00A 2YWOA 1JZRA 1DE1A 5IMFA 1X9SB 4NWYA 4HJMA 3M8NA 1PX7A 2I9HA 2H0HA 1M0UA 2R0PA 4KCEA 2E2GA 1SL2B 3JCML 2HE3A 1U3AA 2FGXA 1TRWA 1VF2A 1XXUA 5DQYA 4RI6A 3CSJA 2FWFA 4KA0A 5BMUA 1NSWA 4K1FA 3FZ4A 1MTCA 3SBCA 1OKTA 1TK5B 1K3OA 4MDCA 4BVXA 4PNFA 4I2UA 3CTFA 4O5RA 3KXOA 4V1Ap 2YWNA 3IRAA 3A5IA 1QQ2A 5ECIB 2RUEA 3F6DA 1TP9A 4FIWA 2DJ0A 5IMVA 4ZILA 4BVYA 3TOUA 4DEJA 2H66A 2H30A 2L4QA 4ECBA 5GSTA 2LKUA 2CZ3A 4P3YB 6GSUA 2GVPA 1XOAA 1YKCA 2AYTA 4AJ7A 1X9WB 1KEBA 3R3EA 1GH2A 5ELAA 5EVOA 4XS1A 1F3BA 1GTIA 2B3SA 1K3LA 4ZXGA 1B48A 2LRNA 4PUFC 2GQLA 4BWQA 1XWCA 4WETA 1PMTA 2VCQA 3FR9A 1UA5A 3Q18A 4POMA 2YOIA 4EDZA 1M99A 1MDIA 2C0EA 1TTZA 3C1RA 3CRUA 2VL2C 1THOA 3GURA 2OACA 4RI7A 4MA9A 4XS4A 1GUHA 1MDKA 3D21A 3FR3A 1R4WA 2OBIA 4RUVA 3U5RE 1R5PA 3GTUA 4JE1A 2GT5A 1FB0A 4IJ3A 4K7NA 3APQA 12GSA 3KZQA 1VGLA 4POLA 5CREA 2TRXA 2TRCP 2VD1A 3EYTA 4V1Ag 3GRXA 2PUKC 2OADA 3CXGA 3H8QA 4BL7B 5J3RA 5DALA 3FK8A 5IPGA 5IMCA 1USBA 3GL3A 1TDIA 2OE1A 1XWBA 3WD6A 4HU7A 2GDRA 4POBA 4K8MA 4YAVA 2DJKA 4KDUA 4HZ4A 3K8NA 2B7KA 2R3XA 4PX1A 1EEMA 4BPYA 2LNSA 3GX8A 3VI5A 2UZ8A 5CRDA 2FA8A 4G2EA 5HFGA 1AW9A 4YQMA 4KCAA 3GKNA 2VLVA 4PNGA 5FT3A 3PINA 3E3EA 1QMVA 1G6YA 4K2DA 3WT2A 3GFKA 3GSTA 1H4OA 4LMWA 2H70A 1GNEA 1M2DA 3HVSA 4TKYA 1SKWB 4PQIA 2N5BA 5IQYA 4MH2A 3TJBA 3OR5A 1EOGA 3KEBA 4FO5A 1PA3A 1MEKA 4TXVA 4OD7A 1TU8A 2JL4A 5B8AA 2P5QA 4RQRA 3CMIA 2FWHA 2VCWA 1RW1A 5ENUA 5JWRB 1OKDA 5G5EA 2RIIA 4FQUA 2M46A 3SWLA 5GAND 2VCTA 1H75A 4GTUA 5LCZA 1TRSA 4F0BA 2B5EA 4JZQA 4IQ1A 3GYKA 4I6XA 2ES7A 1UC7A 2GT6A 2LQOA 5CAXA 1NM3A 1SYXA 1WIKA 2FWEA 2EC4A 4YH2A 4OWYA 5JWOB 3F63A 4GRFA 4NAXA 1X9MB 1SK1A 4MMMA 4Q5QA 4PQ1A 1M9BA 4TN8A 1Q98A 1K0CA 2K6VA 5G31A 5KOXA 1A2JA 2XPEA 4MF6A 1ZYNA 1UVZA 2NPBA 4MP4A 3GX0A 2L57A 3TKRA 3EPTA 3I6AA 3LXZA 4EUYA 3D6IA 4FH8A 1FO5A 3LYKA 4LL1B 2P5RA 4TVEA 2I1UA 3KTBA 4ZBAA 3ME8A 4Q5NA 4ZB6A 3NZNA 4F9ZA 4NHWA 4ZL8A 2AB6A 3PH9A 2YV7A 5KN1A 2CX4A 3C7MA 1A8LA 5DQSA 5JCGA 4ACSA 2KLXA 2HI7A 1Z6MA 1JZDA 2CAIA 5D9TA 3KD0A 4KH7A 2R2JA 4D73B 2GTUA 3DXBA 1XW9A 3H93A 4H86A 3GL5A 5A4WA 2DLXA 4PXOA 1Y25A 2GQMA 3ZFLA 2IMDA 3TJFA 3P7XA 1HD2A 3G7JA 3ZIVA 5H5RA 4K6XA 4K9ZA 4ZL7A 2KP1A 4CDOA 3RBTA 1T1VA 3TCOA 4Z2UA 1JHBA 3UAPA 2FD3A 5JCUA 1T3BA 2DBCA 4E8HA 1ZL9A 3ZRDA 1M9AA 4F82A 1G7OA 4AF2A 4Z2TA 4TW5A 1THXA 3IK7A 5B8BA 5ELGA 2N5AA 3FYGA 1TI3A 5BRTA 2HRKA 3HZ4A 5F8BA 5DAKB 1GNWA 3CTGA 2VL9A 4J57E 2HT9A 3D5JA 2HSMA 2H0GA 2YV9A 5IPHA 5IIZA 4WR5A 3BJ5A 3UBLA 3CRTA 2MZCA 1U87A 4OFTA 1TW9A 3LEFA 2WULA 4F03A 2LNTA 3ZVJD 3TKSA 2FLSA 4G9HA 2G0FA 4K0NA 5D73A 2WDUA 2FWGA 1O73A 3HYPA 1KBNA 2M80A 3LQ7A 2H76A 3ERFA 1Z9HA 5H5QA 3L4NA 3UOMA 5GZZB 4PGTA 4CY6A 2B1LA 3FRCA 2LV3A 2K8VA 2ZCTA 2R5GA 1HNBA 4MLYA 1EGRA 3QFBC 5JCWA 5H5SA 4KDXA 2F9SA 3D0ZA 4YAPA 2PPTA 1Z3EA 4HOJA 1AUCA 3EMXA 1PN9A 5C04A 5HFIA 2X8CA 3NIVA 1PD21 4YQVA 2V6KA 3GMFA 2PN8A 5L71A 4WR4A 4WKWA 5B6NA 3R2QA 4IBPA 5CRGA 4O7HA 1TJDA 3TKSE 4I2TA 4NXIA 3F0IA 1G0TA 1K0BA 1T4YA 18GSA 2E0QA 1GRXA 3EVIA 4BWSA 4Q5RA 5EPFA 4XTSA 2JZRA 2B7JA 3GIXA 3IBHA 3QPMA 4GF0A 3UIWA 4TR4A 4X0XA 2O85A 5AIXA 4TXOB 5DCGA 3BCIA 2EIQA 3GV1A 5HR2A 1OC3A 4IELA 2E7PA 4AJ8A 3KCMA 4L8EA 2F51A 4HQZA 2H1AA 3E9JB 2C1YA 2WJUA 4BL7A 3ZFBA 4DSSB 2GSQA 3HJMA 3BD2A 4JR4A 1K0DA 2IWTA 1F2EA 2OA7A 3S9FA 4OFMA 1JLWA 3UJ1A 1GWCA 1SK2A 3I43A 2H6XA 2QKEA 3GKXA 3PPUA 2NTOA 1CQHA 3QD9A 4ZB9A 3QAWA 5J9CA 4I97A 2KP2A 3NOFA 1FW1A 1TKDB 2FCHA 1PQNA 2X99A 1ZYQB 2MBSA 2R4VA 1YF0A 4G0KA 4WF4A 1XBSA 4TR3A 2D2ZA 4V2MA 1X0RA 1KTEA 2IIYA 1U6TA 1ERWA 5AISA 1U88A 1X5EA 3FZ5A 1VF3A 3EURA 3ZYWA 1BX9A 3VWWA 1PKZA 2HZEB 4MPGA 1EV4A 3C71A 2AJQB 3MYDA 3G7YA 3P2AA 1ERTA 1WMJA 1HQOA 2K8SA 2B5XA 1EP7A 2GZZA 4TOPA 4KSOA 8GSSA 2VOCA 3LORA 1A24A 4MJCA 2VAFA 5AIVA 2XPDA 3D4MA 2YN1A 3FZ9A 1LJRA 4N10A 2VL2A 3KH7A 1LU4A 1F37A 4PURA 1ZZYA 5F06A 3EE2A 2CVDA 3IHGA 4AGSA 1XZOA 1F9MA 5ECPB 5G5FA 4EL1A 5GAPD 4GSSA 4POKA 1AIUA 5DJLA 2EIRA 4ID0A 4KSMA 2DJ2A 2KOKA 4ZL9A 3DEXA 2H74A 2VD0A 3VPQA 4MJAA 1WJKA 22GSA 2ON7A 2MMNA 1OAZA 4GLTA 3A5WA 1GSDA 1T4ZA 4PTSA 3VLNA 2A2SA 3TJKA 4IS0A 2GZPA 5COHA 11GSA 2YZHA 4IKHA 1Z6NA 3VURA 2C8UA 3A2XA 2B5YA 3LSZA 3HZ8A 5HR3A 2ZNMA 5FHIA 3HXSA 5CRHA 2MMAA 1V58A 5HR1A 3E0UA 5ECHB 1Z7PA 4K7OA 1SL1B 4YKGA 1O8XA 2HNLA 1ML6A 3G9BA 3TRPA 1K0NA 3GA4A 3L78A 3WYWA 1ACVA 2LJKA 1AQWA 2BJXA 4LLRA 4D73A 2MMOA 1ILOA 3HKRA 3KGKA 3PR8A 4MABA 3UBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWQ B;  3DWV A;  4E8E A;  1GSQ A;  3LFL A;  1UN2 A;  3D4T A;  5ECM B;  4OO4 A;  2DIY A;  2YWI A;  4MZB A;  4O32 A;  5INY A;  3VPT A;  1WP0 A;  2GGT A;  5D9X A;  2QSI A;  3F3Q A;  1YKA A;  2YWM A;  3G7I A;  4KGI A;  1GSY A;  4DSQ A;  2VCX A;  1B9X C;  1ABA A;  4N0V A;  3QR6 A;  1I9D A;  2GLR A;  5LNK e;  1FG4 A;  1AAZ A;  4QL7 A;  3EU4 A;  10GS A;  4HJ2 A;  6GSV A;  5DAK A;  2V41 A;  3KH9 A;  1GTB A;  3A2V A;  5F05 A;  1EEJ A;  3Q19 A;  1XPV A;  1E2Y A;  3QDN A;  5CO3 A;  3GH6 A;  3QOU A;  4IGJ A;  4GXZ A;  2PER A;  3LJR A;  5ID2 B;  3I9V 2;  2YZU A;  5ECQ B;  5B7C A;  4YQU A;  4ILF A;  3RHB A;  1WPI A;  1PGT A;  2C0G A;  3FEU A;  5IOW A;  1QXH A;  1C72 A;  2L4C A;  4MPF A;  2LRT A;  1ERV A;  1U3I A;  3V1W A;  2IME A;  2HSY A;  2OE0 A;  4MZW A;  3FW2 A;  2VL3 A;  5J9B A;  1T7P B;  5DVB A;  2CX3 A;  5AGY A;  4ISD A;  3UL3 A;  2AHE A;  5DJM A;  3ME7 A;  2RM6 A;  4GCI A;  3TOT A;  2V32 A;  2DSA A;  2L6C A;  2BMX A;  4MJE A;  1M2B A;  1OC8 A;  5D9W A;  3CSH A;  5HFK A;  4HZ2 A;  1F3A A;  1PL2 A;  4XRD A;  4LA1 A;  2HYX A;  3UEM A;  3ZIT A;  1GP1 A;  3HJO A;  5D93 A;  3UMA A;  2HXK A;  4F0C A;  2IMK A;  1Y6E A;  4IHU A;  1VF4 A;  2CVB A;  2LRC A;  2Z9S A;  5J5N A;  3PGT A;  2HFD A;  5J41 A;  4BA7 A;  1ZMA A;  3LGC A;  4WXT A;  3GSS A;  3WGD A;  4TXO A;  3M1G A;  1K0M A;  3RPN A;  2CVK A;  2JZT A;  3HDC A;  4KDY A;  1X5C A;  3U6V A;  1EP8 A;  4WBR D;  2HRF A;  3IAM 2;  2VCZ A;  3C8E A;  1VF1 A;  1SD9 A;  2DJ1 A;  1YEP A;  3Q74 A;  5F07 A;  5IMA A;  1OVN A;  4DSS A;  2C0F A;  3ZMK A;  4HUA A;  5IO2 A;  3N9J A;  3TUE A;  3M0F A;  1R7H A;  3QAG A;  5KN2 A;  3UVH A;  5DAL B;  4GQF A;  2IL3 A;  2DMM A;  2JSY A;  3ERW A;  3IK9 A;  2WZ9 A;  7GSS A;  3UAR A;  4LMV A;  3J7Y b;  2IFQ B;  2DIZ A;  4ULX A;  3C1S A;  1FVJ A;  3L9S A;  3F6F A;  1J08 A;  1SK0 A;  3F4R A;  4HEA 2;  4I5Q A;  4X43 A;  5HR0 A;  5ECL B;  2I81 A;  1MD3 A;  2LUS A;  3F8U A;  2HZE A;  4AJ6 A;  2XC2 A;  1K0A A;  3O3T A;  4XIH A;  3DVW A;  3GH9 A;  4TR1 B;  2RUF A;  4HS1 A;  3HCZ A;  2GSR A;  4JR6 A;  1O8W A;  3HY2 A;  1A2L A;  4CW9 A;  3EMP A;  1BQ7 A;  3P8W A;  1DBY A;  3QAV A;  6GSS A;  4OCE A;  3RDW A;  4N0Z A;  3ZL5 A;  2PVO C;  2L5L A;  1SKR B;  1Z5Y E;  2P0G A;  1LBK A;  2PVQ A;  2V6O A;  3KMO A;  4ML1 A;  3GKM A;  3M9J A;  3TJJ A;  3QFA C;  3KTL A;  3ERG A;  5ECO B;  3IE3 A;  1YY7 A;  5G30 A;  1SU9 A;  1BG5 A;  3VWX A;  1Z7R A;  2K9F A;  3ZTL A;  4L5L A;  1FB6 A;  5EY6 A;  3QMX A;  1NW2 A;  4NMU A;  2GSS A;  1GTA A;  5KN0 A;  3CSI A;  2AAW A;  5IM9 A;  2WGR A;  5G2Z A;  4N11 A;  1MDJ A;  1GUM A;  2XBQ A;  2H75 A;  1M7T A;  2M72 A;  2PMT A;  3TGZ A;  2B1K A;  2J9H A;  3M9K A;  2F8F A;  2H01 A;  2C3Q A;  2CAQ A;  1TRU A;  2VUP A;  4WBJ A;  4HDE A;  4KB3 A;  4G19 A;  3TRQ A;  1PL1 A;  2VM2 A;  2H73 A;  3IOS A;  3LYP A;  1KNG A;  1TK0 B;  5D96 A;  1EWX A;  3C73 A;  2L5O A;  2N5F A;  3VWV A;  2JSZ A;  1XWK A;  2H6Z A;  5G1K A;  1ZYE A;  1A8Y A;  1A2M A;  3US3 A;  5GSS A;  2H0I A;  3FZA A;  1WRY A;  2VCV A;  3DGQ A;  4N30 A;  1SJZ A;  1E6B A;  3WT1 A;  5E4W A;  2B6M A;  1A23 A;  3F4S A;  1SJI A;  4GQC A;  2IN3 A;  3H4K A;  1JFU A;  2HSH A;  2C4J A;  4WF5 A;  2MBT A;  3KIJ A;  3MWH A;  3IHQ A;  2OE3 A;  2CQ9 A;  2CV4 A;  9GSS A;  1FAA A;  3F3R A;  3APS A;  5CRW A;  5J4U A;  2JAC A;  1W89 A;  1QUW A;  1TU7 A;  4XCS A;  1YZX A;  3L9U A;  3DKS A;  5ECK B;  3MSZ A;  1DE2 A;  3O76 A;  3F4T A;  3RAZ A;  1B9Y C;  16GS A;  2FA4 A;  5ID2 A;  4TRX A;  4ML6 A;  3ZVJ A;  3GUS A;  4HQS A;  4QQ7 A;  4V2L A;  4EDY A;  2YAN A;  2F8A A;  1TOF A;  3DVX A;  1O6J A;  1N2A A;  2YCD A;  3ZZX A;  1NHO A;  4L5O A;  3VK9 A;  2H72 A;  3HVX A;  5IOX A;  4MF7 A;  4EC0 A;  3GHA A;  3P90 A;  1V2A A;  4JU5 A;  1YDK A;  3LXT A;  2DJJ A;  4EE0 A;  2LS5 A;  3MAK A;  1BED A;  2X8G A;  4DVC A;  3FY7 A;  3MDK A;  1XVW A;  2BTO T;  1Q4J A;  4EF0 A;  1A0R P;  4QL9 A;  1URM A;  5E59 A;  4FYU A;  4OFN A;  5KEJ A;  2DML A;  2H1G A;  1TI1 A;  3DRN A;  3MNG A;  4DSR A;  2LJR A;  4GWR A;  2H1D A;  2I3Y A;  4WEY A;  1G6W A;  2HLS A;  1O81 A;  2PGT A;  2GZY A;  5DBQ A;  4L0W A;  4J2F A;  2MYG A;  3IAS 2;  3ZLP A;  3W8S A;  2X8H A;  2R6K A;  3BOA A;  2I4A A;  1S3C A;  2RLI A;  3EIN A;  1SEN A;  4XS6 A;  1JZW A;  3W6G A;  1XW6 A;  3IC4 A;  4ZBD A;  1EV9 A;  3BBY A;  3UVT A;  3RHC A;  4MH3 A;  4GSN A;  1T00 A;  2MMZ A;  2TIR A;  4MJB A;  3GNJ A;  1OE8 A;  1DSB A;  1XWG A;  1S3D A;  3KMN A;  2IFQ A;  1GL8 A;  1OC9 B;  1YJ6 A;  4NPB A;  20GS A;  3HJP A;  2KUC A;  2NDO A;  4J56 E;  1SKS B;  1IYH A;  3ED3 A;  2VLT A;  13GS A;  1WE0 A;  4PUA A;  4RQX A;  1AC1 A;  1XW5 A;  1B4P A;  2NVL A;  4XRA A;  5F0G A;  2GS3 A;  3IPZ A;  4ECI A;  3TB2 A;  3EC3 A;  2JAD A;  6GST A;  1J9B A;  3AY8 A;  3O6T A;  5HQP A;  2IPA A;  4I8B A;  4Z7X A;  1GSS A;  1O7U A;  4OMV A;  1FOV A;  1FVK A;  4TR1 A;  1OE7 A;  1FHE A;  1JLV A;  3D22 A;  1S3A A;  3IA1 A;  5ABR A;  1AXD A;  2FUG 2;  2IMF A;  1XCC A;  5A5K A;  14GS A;  2ALB A;  4ZB8 A;  3VFI A;  2KHP A;  2DC5 A;  2GQK A;  4L0U A;  1YQ1 A;  4X1U A;  2PU9 C;  4GST A;  2NBS A;  1WWJ A;  1SL0 B;  3VWU A;  5CYY A;  5IO0 A;  3N5O A;  4FYC A;  1XVQ A;  2YNX A;  1ZOF A;  2RM5 A;  4NV2 A;  2PWJ A;  1V40 A;  1VRS D;  2O89 A;  1OYJ A;  4MF5 A;  1YF1 A;  1K0O A;  1BYE A;  5CNW A;  5AN1 A;  3BCK A;  2C3T A;  2LEG A;  3DML A;  2O87 A;  2YJ7 A;  3HVV A;  2IMI A;  1W4V A;  2PBJ A;  3A3T A;  1GUL A;  1R5A A;  4TR0 A;  1GLP A;  1HYU A;  3EU3 A;  1V98 A;  2QC7 A;  1TK8 B;  1XFL A;  1R26 A;  1EOH A;  3KJY A;  1GUK A;  1GLQ A;  2OKA A;  2J23 A;  1GSU A;  1QGV A;  4O92 A;  3H79 A;  2H1B A;  4MCU A;  3TKP A;  4JRR A;  1RQM A;  3A2W A;  4KE3 A;  1WOU A;  1BJX A;  3WGE A;  1ERU A;  2JZS A;  4ZIJ A;  3IV4 A;  2GST A;  4XS4 B;  4EO3 A;  2ON5 A;  2YPM A;  1QFN A;  1EGO A;  2A2R A;  3GTU B;  6GSX A;  5D8I A;  4ECC A;  1PX6 A;  2V1M A;  2CA8 A;  2K18 A;  2WCI A;  2LTK A;  3TDG A;  1V57 A;  1V9W A;  1EZK A;  1HNA A;  2CZ2 A;  4LL4 B;  1ZGN A;  3KM6 A;  3ZRE A;  4JED A;  2EIO A;  5A4U A;  3QCP A;  2VO4 A;  1F6M C;  5DDL A;  1YEX A;  4V2N A;  1I5G A;  2CT6 A;  2C3N A;  3ISO A;  3WGX A;  1SJ6 A;  4ZBB A;  5IMD A;  5ECS A;  6GSW A;  2LQQ A;  1QK8 A;  5A4V A;  3CBU A;  4HI7 A;  3M3M A;  1SD8 A;  1AQX A;  5IMZ A;  2YP6 A;  2L6D A;  2DJ3 A;  1PKW A;  4IP1 A;  3KP8 A;  1A0F A;  2H6Y A;  2R37 A;  5FWG A;  3VI7 A;  2VIM A;  4EXJ A;  2H8L A;  2FHE A;  2VM1 A;  3HHV A;  2OBK A;  1GTU A;  2FNO A;  1BAY A;  2H71 A;  2L59 A;  3H1N A;  2QGV A;  2WS2 A;  1X5D A;  4KND A;  1XOB A;  3ZML A;  4F2I A;  1CQG A;  3TKQ A;  1SYR A;  2VLU A;  5G1L A;  1TXX A;  4IVF A;  2AUV A;  2FY6 A;  3IDV A;  2G2Q A;  1TRV A;  1HNC A;  3GKK A;  2WRT A;  2A4V A;  1XIY A;  2WB9 A;  17GS A;  3L0H A;  3GN3 A;  2C80 A;  2O8V B;  3IR4 A;  1AQV A;  2E2M A;  4IW9 A;  2H19 A;  4KW6 A;  2LJA A;  4EVM A;  4IP6 A;  1JZO A;  4OO5 A;  3DYR A;  3I69 A;  19GS A;  3EWL A;  3LWA A;  5D9V A;  4KX4 A;  4IN0 A;  2F3M A;  1ST9 A;  3LG6 A;  4KAE A;  3FKF A;  1GSF A;  2JU5 A;  2P31 A;  2X64 A;  5CP1 A;  1K3Y A;  3DD3 A;  3ZIJ A;  3TRX A;  1N8J A;  3J7Y k;  4K7I A;  1MD4 A;  4FYB A;  4OCF A;  2HRN A;  2OJL A;  3F9U A;  5ECN B;  2XHF A;  4K0G A;  4MK3 A;  4Q5F A;  1XWA A;  3TJG A;  1J0F A;  3TKS C;  2LST A;  1G7E A;  3L9V A;  4JBB A;  2XBI A;  1B4Q A;  1RK4 A;  4XHM A;  3DIE A;  2YJH A;  5EL8 A;  2AV4 A;  3RPP A;  3FR6 A;  3FHK A;  1NHY A;  4ECJ A;  1DUG A;  5ECR B;  4HU9 A;  4KUN A;  5DCH A;  4CHS A;  4G10 A;  3HD5 A;  1O85 A;  2C0D A;  3CYN A;  1B8X A;  3APO A;  1PSQ A;  3IXR A;  1IYI A;  4IJI A;  4NHZ A;  4NV5 A;  5KN3 A;  1ON4 A;  5B6M A;  3W8J A;  1PRX A;  3Q6O A;  5LD0 A;  2V2G A;  2ZUP A;  4PQH A;  2WFC A;  2HZF A;  6GSY A;  4MZC A;  1ZCP A;  2REM A;  2IJY A;  1OC9 A;  1T8E B;  3KP9 A;  1GSE A;  4IQA A;  2O7K A;  4EKZ A;  3HA9 A;  1M2A A;  5C00 A;  2YWO A;  1JZR A;  1DE1 A;  5IMF A;  1X9S B;  4NWY A;  4HJM A;  3M8N A;  1PX7 A;  2I9H A;  2H0H A;  1M0U A;  4KCE A;  2E2G A;  1SL2 B;  3JCM L;  2HE3 A;  1U3A A;  2FGX A;  1TRW A;  1VF2 A;  1XXU A;  5DQY A;  4RI6 A;  3CSJ A;  2FWF A;  4KA0 A;  1NSW A;  4K1F A;  3FZ4 A;  1MTC A;  3SBC A;  1OKT A;  1TK5 B;  1K3O A;  4MDC A;  4BVX A;  4PNF A;  4I2U A;  3CTF A;  4O5R A;  3KXO A;  4V1A p;  2YWN A;  3IRA A;  1QQ2 A;  5ECI B;  2RUE A;  3F6D A;  1TP9 A;  4FIW A;  2DJ0 A;  5IMV A;  4ZIL A;  4BVY A;  3TOU A;  4DEJ A;  2H66 A;  2H30 A;  2L4Q A;  4ECB A;  5GST A;  2LKU A;  2CZ3 A;  4P3Y B;  6GSU A;  2GVP A;  1XOA A;  1YKC A;  2AYT A;  4AJ7 A;  1X9W B;  1KEB A;  1GH2 A;  5ELA A;  5EVO A;  4XS1 A;  1F3B A;  1GTI A;  2B3S A;  1K3L A;  4ZXG A;  1B48 A;  2LRN A;  4PUF C;  2GQL A;  4BWQ A;  1XWC A;  4WET A;  1PMT A;  2VCQ A;  3FR9 A;  1UA5 A;  3Q18 A;  4POM A;  2YOI A;  4EDZ A;  1M99 A;  1MDI A;  2C0E A;  1TTZ A;  3C1R A;  3CRU A;  2VL2 C;  1THO A;  3GUR A;  2OAC A;  4RI7 A;  4MA9 A;  4XS4 A;  1GUH A;  1MDK A;  3D21 A;  3FR3 A;  1R4W A;  2OBI A;  4RUV A;  3U5R E;  1R5P A;  3GTU A;  4JE1 A;  2GT5 A;  1FB0 A;  4IJ3 A;  4K7N A;  3APQ A;  12GS A;  3KZQ A;  1VGL A;  4POL A;  5CRE A;  2TRX A;  2TRC P;  2VD1 A;  3EYT A;  4V1A g;  3GRX A;  2PUK C;  2OAD A;  3CXG A;  3H8Q A;  5J3R A;  5DAL A;  3FK8 A;  5IPG A;  5IMC A;  1USB A;  3GL3 A;  1TDI A;  2OE1 A;  1XWB A;  3WD6 A;  4HU7 A;  2GDR A;  4POB A;  4K8M A;  4YAV A;  2DJK A;  4KDU A;  4HZ4 A;  3K8N A;  2B7K A;  2R3X A;  4PX1 A;  1EEM A;  4BPY A;  2LNS A;  3GX8 A;  3VI5 A;  5CRD A;  2FA8 A;  4G2E A;  5HFG A;  1AW9 A;  4YQM A;  4KCA A;  3GKN A;  2VLV A;  4PNG A;  5FT3 A;  3PIN A;  3E3E A;  1QMV A;  1G6Y A;  4K2D A;  3WT2 A;  3GFK A;  3GST A;  1H4O A;  4LMW A;  2H70 A;  1GNE A;  1M2D A;  3HVS A;  4TKY A;  1SKW B;  4PQI A;  2N5B A;  5IQY A;  4MH2 A;  3TJB A;  3OR5 A;  1EOG A;  3KEB A;  4FO5 A;  1PA3 A;  1MEK A;  4TXV A;  4OD7 A;  1TU8 A;  2JL4 A;  5B8A A;  2P5Q A;  4RQR A;  3CMI A;  2FWH A;  2VCW A;  1RW1 A;  5ENU A;  5JWR B;  1OKD A;  5G5E A;  2RII A;  2M46 A;  3SWL A;  5GAN D;  2VCT A;  1H75 A;  4GTU A;  5LCZ A;  1TRS A;  4F0B A;  2B5E A;  4JZQ A;  4IQ1 A;  3GYK A;  4I6X A;  2ES7 A;  1UC7 A;  2GT6 A;  2LQO A;  5CAX A;  1NM3 A;  1SYX A;  1WIK A;  2FWE A;  2EC4 A;  4YH2 A;  4OWY A;  5JWO B;  3F63 A;  4GRF A;  4NAX A;  1X9M B;  1SK1 A;  4MMM A;  4Q5Q A;  4PQ1 A;  1M9B A;  4TN8 A;  1Q98 A;  1K0C A;  2K6V A;  5G31 A;  1A2J A;  2XPE A;  4MF6 A;  1UVZ A;  2NPB A;  4MP4 A;  3GX0 A;  2L57 A;  3TKR A;  3I6A A;  3LXZ A;  4EUY A;  3D6I A;  4FH8 A;  1FO5 A;  3LYK A;  4LL1 B;  2P5R A;  4TVE A;  2I1U A;  3KTB A;  4ZBA A;  3ME8 A;  4Q5N A;  4ZB6 A;  3NZN A;  4F9Z A;  4NHW A;  4ZL8 A;  2AB6 A;  3PH9 A;  2YV7 A;  5KN1 A;  2CX4 A;  3C7M A;  1A8L A;  5DQS A;  5JCG A;  4ACS A;  2KLX A;  2HI7 A;  1Z6M A;  1JZD A;  2CAI A;  5D9T A;  3KD0 A;  4KH7 A;  2R2J A;  4D73 B;  2GTU A;  3DXB A;  1XW9 A;  3H93 A;  4H86 A;  3GL5 A;  5A4W A;  2DLX A;  4PXO A;  1Y25 A;  2GQM A;  3ZFL A;  2IMD A;  3TJF A;  3P7X A;  1HD2 A;  3G7J A;  3ZIV A;  5H5R A;  4K6X A;  4K9Z A;  4ZL7 A;  2KP1 A;  4CDO A;  3RBT A;  1T1V A;  3TCO A;  1JHB A;  3UAP A;  2FD3 A;  5JCU A;  1T3B A;  2DBC A;  4E8H A;  1ZL9 A;  3ZRD A;  1M9A A;  4F82 A;  1G7O A;  4AF2 A;  4TW5 A;  1THX A;  3IK7 A;  5B8B A;  5ELG A;  2N5A A;  3FYG A;  1TI3 A;  3HZ4 A;  5F8B A;  5DAK B;  1GNW A;  3CTG A;  2VL9 A;  4J57 E;  2HT9 A;  3D5J A;  2H0G A;  2YV9 A;  5IPH A;  5IIZ A;  4WR5 A;  3BJ5 A;  3UBL A;  3CRT A;  2MZC A;  1U87 A;  4OFT A;  1TW9 A;  3LEF A;  2WUL A;  4F03 A;  2LNT A;  3ZVJ D;  3TKS A;  2FLS A;  4G9H A;  2G0F A;  4K0N A;  5D73 A;  2WDU A;  2FWG A;  1O73 A;  3HYP A;  1KBN A;  2M80 A;  3LQ7 A;  2H76 A;  3ERF A;  1Z9H A;  5H5Q A;  3L4N A;  3UOM A;  5GZZ B;  4PGT A;  2B1L A;  3FRC A;  2LV3 A;  2K8V A;  2ZCT A;  2R5G A;  1HNB A;  4MLY A;  1EGR A;  3QFB C;  5JCW A;  5H5S A;  4KDX A;  2F9S A;  3D0Z A;  4YAP A;  2PPT A;  1Z3E A;  4HOJ A;  1AUC A;  3EMX A;  1PN9 A;  5C04 A;  5HFI A;  2X8C A;  3NIV A;  1PD2 1;  4YQV A;  2V6K A;  3GMF A;  2PN8 A;  5L71 A;  4WR4 A;  4WKW A;  5B6N A;  3R2Q A;  4IBP A;  5CRG A;  4O7H A;  1TJD A;  3TKS E;  4I2T A;  4NXI A;  3F0I A;  1G0T A;  1K0B A;  1T4Y A;  18GS A;  2E0Q A;  1GRX A;  3EVI A;  4BWS A;  4Q5R A;  5EPF A;  4XTS A;  2JZR A;  2B7J A;  3GIX A;  3IBH A;  3QPM A;  4GF0 A;  3UIW A;  4TR4 A;  4X0X A;  2O85 A;  5AIX A;  4TXO B;  5DCG A;  3BCI A;  2EIQ A;  3GV1 A;  5HR2 A;  1OC3 A;  4IEL A;  2E7P A;  4AJ8 A;  3KCM A;  4L8E A;  2F51 A;  4HQZ A;  2H1A A;  3E9J B;  2C1Y A;  2WJU A;  4BL7 A;  3ZFB A;  4DSS B;  2GSQ A;  3HJM A;  3BD2 A;  4JR4 A;  1K0D A;  2IWT A;  1F2E A;  2OA7 A;  3S9F A;  4OFM A;  1JLW A;  3UJ1 A;  1GWC A;  1SK2 A;  3I43 A;  2H6X A;  2QKE A;  3GKX A;  2NTO A;  1CQH A;  3QD9 A;  4ZB9 A;  3QAW A;  5J9C A;  4I97 A;  2KP2 A;  3NOF A;  1FW1 A;  1TKD B;  2FCH A;  1PQN A;  2X99 A;  1ZYQ B;  2MBS A;  2R4V A;  1YF0 A;  4WF4 A;  1XBS A;  4TR3 A;  2D2Z A;  4V2M A;  1X0R A;  1KTE A;  2IIY A;  1U6T A;  1ERW A;  5AIS A;  1U88 A;  1X5E A;  3FZ5 A;  1VF3 A;  3EUR A;  3ZYW A;  1BX9 A;  3VWW A;  1PKZ A;  2HZE B;  4MPG A;  1EV4 A;  3C71 A;  2AJQ B;  3G7Y A;  3P2A A;  1ERT A;  1WMJ A;  1HQO A;  2K8S A;  2B5X A;  1EP7 A;  2GZZ A;  4TOP A;  4KSO A;  8GSS A;  2VOC A;  3LOR A;  1A24 A;  4MJC A;  2VAF A;  5AIV A;  2XPD A;  3D4M A;  2YN1 A;  3FZ9 A;  1LJR A;  4N10 A;  2VL2 A;  3KH7 A;  1LU4 A;  1F37 A;  4PUR A;  1ZZY A;  5F06 A;  3EE2 A;  2CVD A;  4AGS A;  1XZO A;  1F9M A;  5ECP B;  5G5F A;  4EL1 A;  5GAP D;  4GSS A;  4POK A;  1AIU A;  5DJL A;  2EIR A;  4ID0 A;  4KSM A;  2DJ2 A;  2KOK A;  4ZL9 A;  3DEX A;  2H74 A;  2VD0 A;  3VPQ A;  4MJA A;  1WJK A;  22GS A;  2ON7 A;  2MMN A;  1OAZ A;  4GLT A;  3A5W A;  1GSD A;  1T4Z A;  3VLN A;  2A2S A;  3TJK A;  4IS0 A;  2GZP A;  5COH A;  11GS A;  2YZH A;  4IKH A;  1Z6N A;  3VUR A;  2C8U A;  3A2X A;  2B5Y A;  3LSZ A;  3HZ8 A;  5HR3 A;  2ZNM A;  5FHI A;  3HXS A;  5CRH A;  2MMA A;  1V58 A;  5HR1 A;  3E0U A;  5ECH B;  1Z7P A;  4K7O A;  1SL1 B;  1O8X A;  2HNL A;  1ML6 A;  3G9B A;  3TRP A;  1K0N A;  3GA4 A;  3L78 A;  3WYW A;  1ACV A;  2LJK A;  1AQW A;  2BJX A;  4LLR A;  4D73 A;  2MMO A;  1ILO A;  3HKR A;  3KGK A;  3PR8 A;  4MAB A;  3UBK A; 
#chains in the Genus database with same CATH topology
 5JWQ B;  3DWV A;  4E8E A;  1GSQ A;  3LFL A;  1UN2 A;  3D4T A;  5ECM B;  4OO4 A;  2DIY A;  2YWI A;  4MZB A;  4O5Q A;  4O32 A;  3HVN A;  5INY A;  3VPT A;  1WP0 A;  2GGT A;  5D9X A;  2QSI A;  3F3Q A;  1YKA A;  2YWM A;  3G7I A;  4KGI A;  1GSY A;  4DSQ A;  2VCX A;  1B9X C;  1ABA A;  4N0V A;  3QR6 A;  1I9D A;  2GLR A;  4A5P A;  5LNK e;  1FG4 A;  1AAZ A;  4QL7 A;  3EU4 A;  10GS A;  4HJ2 A;  6GSV A;  5DAK A;  2V41 A;  3KH9 A;  1GTB A;  3A2V A;  5F05 A;  1EEJ A;  3Q19 A;  1XPV A;  1E2Y A;  3QDN A;  5CO3 A;  3GH6 A;  3QOU A;  4IGJ A;  4GXZ A;  2PER A;  3LJR A;  5ID2 B;  3I9V 2;  2YZU A;  5ECQ B;  5B7C A;  4YQU A;  4ILF A;  3RHB A;  1WPI A;  1PGT A;  2C0G A;  3FEU A;  5IOW A;  1QXH A;  1C72 A;  2L4C A;  4MPF A;  2LRT A;  4BVX B;  1ERV A;  1U3I A;  3V1W A;  2IME A;  2HSY A;  2OE0 A;  4MZW A;  3FW2 A;  2VL3 A;  5J9B A;  1T7P B;  2X4A A;  2CX3 A;  5DVB A;  5AGY A;  4ISD A;  3UL3 A;  2AHE A;  5DJM A;  3ME7 A;  2RM6 A;  4GCI A;  3TOT A;  2V32 A;  2DSA A;  2L6C A;  2BMX A;  4MJE A;  1M2B A;  1OC8 A;  5D9W A;  3CSH A;  5HFK A;  4HZ2 A;  1F3A A;  1PL2 A;  4XRD A;  4LA1 A;  2HYX A;  3UEM A;  3ZIT A;  1GP1 A;  3HJO A;  5D93 A;  3UMA A;  2HXK A;  4F0C A;  2IMK A;  1Y6E A;  4IHU A;  1VF4 A;  2CVB A;  2LRC A;  2Z9S A;  5J5N A;  3PGT A;  2HFD A;  5J41 A;  4BA7 A;  1ZMA A;  3LGC A;  4WXT A;  3GSS A;  3WGD A;  4TXO A;  3M1G A;  1K0M A;  3RPN A;  2CVK A;  2JZT A;  3HDC A;  4KDY A;  1X5C A;  3U6V A;  1EP8 A;  2HRA A;  4WBR D;  2HRF A;  3IAM 2;  2VCZ A;  3C8E A;  1VF1 A;  1SD9 A;  2DJ1 A;  1YEP A;  3Q74 A;  5F07 A;  5IMA A;  1OVN A;  4DSS A;  2C0F A;  2R0G A;  3ZMK A;  4HUA A;  5IO2 A;  3N9J A;  3TUE A;  3M0F A;  1R7H A;  3QAG A;  5KN2 A;  3UVH A;  5DAL B;  4GQF A;  2IL3 A;  2DMM A;  2JSY A;  3ERW A;  3IK9 A;  2WZ9 A;  7GSS A;  3UAR A;  4LMV A;  3J7Y b;  2IFQ B;  2DIZ A;  4ULX A;  3C1S A;  1FVJ A;  3L9S A;  3F6F A;  1J08 A;  1SK0 A;  3F4R A;  4HEA 2;  4K2X A;  4I5Q A;  4X43 A;  5HR0 A;  5ECL B;  2I81 A;  1MD3 A;  2LUS A;  3F8U A;  2HZE A;  4AJ6 A;  2XC2 A;  4G0L A;  1K0A A;  3O3T A;  4XIH A;  3DVW A;  3GH9 A;  4TR1 B;  2RUF A;  3FMW A;  4HS1 A;  3HCZ A;  2GSR A;  4JR6 A;  1O8W A;  3HY2 A;  4ICY A;  1A2L A;  4CW9 A;  3EMP A;  4K5S A;  1BQ7 A;  3P8W A;  1DBY A;  3MIX A;  3QAV A;  6GSS A;  4OCE A;  3RDW A;  4N0Z A;  3ZL5 A;  2PVO C;  2L5L A;  1SKR B;  1Z5Y E;  2P0G A;  1LBK A;  2PVQ A;  2QA2 A;  2V6O A;  3KMO A;  4ML1 A;  3GKM A;  3M9J A;  3TJJ A;  3QFA C;  3KTL A;  3ERG A;  3IE3 A;  5ECO B;  1YY7 A;  5G30 A;  1SU9 A;  1BG5 A;  3VWX A;  1Z7R A;  2K9F A;  3ZTL A;  4L5L A;  1FB6 A;  5EY6 A;  3QMX A;  1NW2 A;  3LW9 A;  4NMU A;  1ZYP A;  2GSS A;  1GTA A;  5KN0 A;  3CSI A;  2AAW A;  5IM9 A;  2WGR A;  5G2Z A;  4N11 A;  1MDJ A;  1GUM A;  2XBQ A;  2H75 A;  1M7T A;  2M72 A;  2PMT A;  3TGZ A;  2B1K A;  2J9H A;  3M9K A;  2F8F A;  2H01 A;  2C3Q A;  2CAQ A;  1TRU A;  2VUP A;  4WBJ A;  4HDE A;  4KB3 A;  4G19 A;  3TRQ A;  1PL1 A;  4KF9 A;  2VM2 A;  2H73 A;  3IOS A;  3LYP A;  1KNG A;  1TK0 B;  5D96 A;  1EWX A;  4Z2R A;  3C73 A;  2L5O A;  2N5F A;  3VWV A;  2JSZ A;  1XWK A;  2H6Z A;  5G1K A;  1FOH A;  1ZYE A;  1A8Y A;  1A2M A;  3US3 A;  5GSS A;  2H0I A;  3FZA A;  1WRY A;  2VCV A;  3DGQ A;  4N30 A;  1SJZ A;  1E6B A;  3WT1 A;  2B6M A;  1A23 A;  5E4W A;  3F4S A;  1SJI A;  4GQC A;  2IN3 A;  3H4K A;  1JFU A;  2HSH A;  2C4J A;  4WF5 A;  2MBT A;  3KIJ A;  3MWH A;  3IHQ A;  2OE3 A;  2CQ9 A;  2CV4 A;  9GSS A;  1FAA A;  3F3R A;  3APS A;  5CRW A;  5J4U A;  2JAC A;  1W89 A;  1QUW A;  1TU7 A;  4XCS A;  1YZX A;  3L9U A;  3DKS A;  5ECK B;  3MSZ A;  1DE2 A;  3O76 A;  3F4T A;  3RAZ A;  1B9Y C;  16GS A;  2FA4 A;  5ID2 A;  4TRX A;  4ML6 A;  3ZVJ A;  3GUS A;  4HQS A;  4QQ7 A;  4V2L A;  4EDY A;  2YAN A;  2F8A A;  1TOF A;  3DVX A;  1O6J A;  1N2A A;  2YCD A;  3ZZX A;  1NHO A;  4L5O A;  3VK9 A;  2QA1 A;  2H72 A;  3HVX A;  5IOX A;  4MF7 A;  4EC0 A;  3GHA A;  3P90 A;  1V2A A;  2X49 A;  4JU5 A;  4YKF A;  1YDK A;  3LXT A;  2DJJ A;  4EE0 A;  2LS5 A;  3MAK A;  1BED A;  2X8G A;  4DVC A;  3FY7 A;  4HSC X;  3MDK A;  1XVW A;  4EIQ A;  2BTO T;  4O5U A;  1Q4J A;  4EF0 A;  1A0R P;  4QL9 A;  1URM A;  5E59 A;  4CY8 A;  4FYU A;  4OFN A;  5KEJ A;  2DML A;  2H1G A;  1TI1 A;  3DRN A;  3MNG A;  4DSR A;  2LJR A;  4GWR A;  4MNN A;  2H1D A;  2I3Y A;  4WEY A;  1G6W A;  2HLS A;  1O81 A;  2PGT A;  2GZY A;  5DBQ A;  4L0W A;  4J2F A;  2MYG A;  3IAS 2;  3ZLP A;  3W8S A;  2X8H A;  2R6K A;  3BOA A;  2I4A A;  1S3C A;  2RLI A;  3EIN A;  1SEN A;  4XS6 A;  1JZW A;  3W6G A;  1XW6 A;  3IC4 A;  4ZBD A;  1EV9 A;  3BBY A;  3UVT A;  3RHC A;  2A2P A;  4MH3 A;  4GSN A;  1T00 A;  2MMZ A;  2TIR A;  4MJB A;  3GNJ A;  1OE8 A;  1DSB A;  1XWG A;  1S3D A;  3KMN A;  2IFQ A;  1GL8 A;  1OC9 B;  1YJ6 A;  4NPB A;  20GS A;  3HJP A;  2KUC A;  2NDO A;  4J56 E;  1SKS B;  1IYH A;  3ED3 A;  2VLT A;  13GS A;  1WE0 A;  4PUA A;  4RQX A;  1AC1 A;  1XW5 A;  1B4P A;  2NVL A;  4XRA A;  5F0G A;  2GS3 A;  3IPZ A;  4ECI A;  3TB2 A;  3EC3 A;  2JAD A;  6GST A;  1J9B A;  3AY8 A;  4EIP A;  3O6T A;  5HQP A;  2IPA A;  4I8B A;  4Z7X A;  1GSS A;  2DKI A;  1O7U A;  4OMV A;  1FOV A;  1FVK A;  4TR1 A;  1OE7 A;  1FHE A;  1JLV A;  3D22 A;  1S3A A;  3IA1 A;  5ABR A;  1AXD A;  2FUG 2;  2IMF A;  1XCC A;  5A5K A;  14GS A;  2ALB A;  4ZB8 A;  3VFI A;  2KHP A;  2DC5 A;  2GQK A;  4L0U A;  1YQ1 A;  4X1U A;  2PU9 C;  4GST A;  2NBS A;  1WWJ A;  1SL0 B;  3VWU A;  5CYY A;  5IO0 A;  3N5O A;  4FYC A;  1XVQ A;  2YNX A;  1ZOF A;  2RM5 A;  4NV2 A;  2PWJ A;  1V40 A;  1VRS D;  2O89 A;  1OYJ A;  4MF5 A;  1YF1 A;  1K0O A;  4BVY B;  5KOW A;  1BYE A;  5CNW A;  5AN1 A;  3BCK A;  2C3T A;  2LEG A;  3DML A;  2O87 A;  2YJ7 A;  3HVV A;  2IMI A;  1W4V A;  2PBJ A;  3A3T A;  1GUL A;  1R5A A;  4TR0 A;  1GLP A;  1HYU A;  3EU3 A;  1V98 A;  2QC7 A;  1TK8 B;  1XFL A;  1R26 A;  1EOH A;  3KJY A;  1GUK A;  1GLQ A;  2OKA A;  2J23 A;  1GSU A;  1QGV A;  4O92 A;  3H79 A;  2H1B A;  4MCU A;  3TKP A;  4USS A;  4JRR A;  1RQM A;  3A2W A;  4KE3 A;  1WOU A;  1BJX A;  3WGE A;  1ERU A;  2JZS A;  4ZIJ A;  3IV4 A;  2GST A;  4XS4 B;  4EO3 A;  2ON5 A;  2YPM A;  1QFN A;  1EGO A;  2A2R A;  3GTU B;  6GSX A;  5D8I A;  4ECC A;  1PX6 A;  2V1M A;  2CA8 A;  2K18 A;  2WCI A;  2LTK A;  3TDG A;  1V57 A;  1V9W A;  1EZK A;  1HNA A;  2CZ2 A;  4LL4 B;  1ZGN A;  1XG8 A;  3KM6 A;  3ZRE A;  4JED A;  2EIO A;  5A4U A;  3QCP A;  2VO4 A;  1F6M C;  5DDL A;  1YEX A;  4V2N A;  4X4J A;  1I5G A;  2CT6 A;  2C3N A;  3ISO A;  3WGX A;  1SJ6 A;  4ZBB A;  5IMD A;  5ECS A;  6GSW A;  2LQQ A;  1QK8 A;  5A4V A;  3CBU A;  4HI7 A;  3M3M A;  1SD8 A;  1AQX A;  5IMZ A;  2YP6 A;  2L6D A;  2DJ3 A;  1PKW A;  4IP1 A;  3KP8 A;  1A0F A;  2H6Y A;  2R37 A;  5FWG A;  3VI7 A;  2VIM A;  4EXJ A;  2H8L A;  2FHE A;  2VM1 A;  3HHV A;  2OBK A;  1GTU A;  2FNO A;  1BAY A;  2H71 A;  2L59 A;  3H1N A;  2QGV A;  2WS2 A;  1X5D A;  4KND A;  1XOB A;  3ZML A;  4F2I A;  1CQG A;  3TKQ A;  1SYR A;  2VLU A;  5G1L A;  1TXX A;  4IVF A;  2AUV A;  2FY6 A;  3IDV A;  2G2Q A;  1TRV A;  1HNC A;  3GKK A;  2WRT A;  2A4V A;  1XIY A;  2WB9 A;  17GS A;  3L0H A;  3GN3 A;  2C80 A;  2O8V B;  3IR4 A;  1AQV A;  2E2M A;  4IW9 A;  2H19 A;  4KW6 A;  2LJA A;  4EVM A;  4IP6 A;  1JZO A;  4OO5 A;  3DYR A;  3I69 A;  19GS A;  3EWL A;  3LWA A;  5D9V A;  4KX4 A;  4IN0 A;  2F3M A;  1ST9 A;  3LG6 A;  4KAE A;  3FKF A;  1GSF A;  2JU5 A;  2P31 A;  2X64 A;  5CP1 A;  1K3Y A;  3DD3 A;  3ZIJ A;  3TRX A;  1N8J A;  3J7Y k;  4K7I A;  1MD4 A;  4FYB A;  4OCF A;  2HRN A;  2OJL A;  3F9U A;  5ECN B;  2XHF A;  2DKH A;  4K0G A;  4MK3 A;  4Q5F A;  1XWA A;  3TJG A;  1J0F A;  3TKS C;  2LST A;  1G7E A;  3L9V A;  4JBB A;  2XBI A;  1B4Q A;  2A4H A;  1RK4 A;  1PN0 A;  4XHM A;  3DIE A;  2YJH A;  3IC8 A;  5EL8 A;  2AV4 A;  3RPP A;  3FR6 A;  3FHK A;  1NHY A;  4ECJ A;  1DUG A;  5ECR B;  4HU9 A;  4KUN A;  5DCH A;  4CHS A;  4G10 A;  3HD5 A;  1O85 A;  2C0D A;  3CYN A;  1B8X A;  3APO A;  1PSQ A;  3IXR A;  1IYI A;  4IJI A;  4NHZ A;  4NV5 A;  5KN3 A;  1ON4 A;  5B6M A;  3W8J A;  1PRX A;  3Q6O A;  5LD0 A;  2V2G A;  2ZUP A;  4G0I A;  4PQH A;  2R0C A;  2WFC A;  2HZF A;  6GSY A;  4MZC A;  1ZCP A;  2REM A;  2IJY A;  1OC9 A;  1T8E B;  4K5R A;  3KP9 A;  1GSE A;  4IQA A;  2O7K A;  4EKZ A;  3HA9 A;  1M2A A;  5C00 A;  2YWO A;  1JZR A;  1DE1 A;  5IMF A;  1X9S B;  4NWY A;  4HJM A;  3M8N A;  1PX7 A;  2I9H A;  2H0H A;  1M0U A;  2R0P A;  4KCE A;  2E2G A;  1SL2 B;  3JCM L;  2HE3 A;  1U3A A;  2FGX A;  1TRW A;  1VF2 A;  1XXU A;  5DQY A;  4BIK A;  4RI6 A;  3CSJ A;  2FWF A;  4KA0 A;  5BMU A;  1NSW A;  4K1F A;  3FZ4 A;  1MTC A;  3SBC A;  1OKT A;  1PFO A;  1TK5 B;  1K3O A;  4MDC A;  4BVX A;  4PNF A;  4I2U A;  3CTF A;  4O5R A;  3KXO A;  4V1A p;  2YWN A;  3IRA A;  3A5I A;  1QQ2 A;  5ECI B;  2RUE A;  3F6D A;  1TP9 A;  4FIW A;  2DJ0 A;  5IMV A;  4ZIL A;  4BVY A;  3TOU A;  4DEJ A;  2H66 A;  2H30 A;  2L4Q A;  4ECB A;  5GST A;  2LKU A;  2CZ3 A;  4P3Y B;  6GSU A;  2GVP A;  1XOA A;  1YKC A;  2AYT A;  4AJ7 A;  1X9W B;  1KEB A;  3R3E A;  1GH2 A;  5ELA A;  5EVO A;  4XS1 A;  1F3B A;  1GTI A;  2B3S A;  1K3L A;  4ZXG A;  1B48 A;  2LRN A;  4PUF C;  2GQL A;  4BWQ A;  1XWC A;  4WET A;  1PMT A;  2VCQ A;  3FR9 A;  1UA5 A;  3Q18 A;  4POM A;  2YOI A;  4EDZ A;  1M99 A;  1MDI A;  2C0E A;  1TTZ A;  3C1R A;  3CRU A;  2VL2 C;  1THO A;  3GUR A;  2OAC A;  4RI7 A;  4MA9 A;  4XS4 A;  1GUH A;  1MDK A;  3D21 A;  3FR3 A;  1R4W A;  2OBI A;  4RUV A;  3U5R E;  1R5P A;  3GTU A;  4JE1 A;  2GT5 A;  1FB0 A;  4IJ3 A;  4K7N A;  3APQ A;  12GS A;  3KZQ A;  1VGL A;  4POL A;  5CRE A;  2TRX A;  2TRC P;  2VD1 A;  3EYT A;  4V1A g;  3GRX A;  2PUK C;  2OAD A;  3CXG A;  3H8Q A;  4BL7 B;  5J3R A;  5DAL A;  3FK8 A;  5IPG A;  5IMC A;  1USB A;  3GL3 A;  1TDI A;  2OE1 A;  1XWB A;  3WD6 A;  4HU7 A;  2GDR A;  4POB A;  4K8M A;  4YAV A;  2DJK A;  4KDU A;  4HZ4 A;  3K8N A;  2B7K A;  2R3X A;  4PX1 A;  1EEM A;  4BPY A;  2LNS A;  3GX8 A;  3VI5 A;  2UZ8 A;  5CRD A;  2FA8 A;  4G2E A;  5HFG A;  1AW9 A;  4YQM A;  4KCA A;  3GKN A;  2VLV A;  4PNG A;  5FT3 A;  3PIN A;  3E3E A;  1QMV A;  1G6Y A;  4K2D A;  3WT2 A;  3GFK A;  3GST A;  1H4O A;  4LMW A;  2H70 A;  1GNE A;  1M2D A;  3HVS A;  4TKY A;  1SKW B;  4PQI A;  2N5B A;  5IQY A;  4MH2 A;  3TJB A;  3OR5 A;  1EOG A;  3KEB A;  4FO5 A;  1PA3 A;  1MEK A;  4TXV A;  4OD7 A;  1TU8 A;  2JL4 A;  5B8A A;  2P5Q A;  4RQR A;  3CMI A;  2FWH A;  2VCW A;  1RW1 A;  5ENU A;  5JWR B;  1OKD A;  5G5E A;  2RII A;  4FQU A;  2M46 A;  3SWL A;  5GAN D;  2VCT A;  1H75 A;  4GTU A;  5LCZ A;  1TRS A;  4F0B A;  2B5E A;  4JZQ A;  4IQ1 A;  3GYK A;  4I6X A;  2ES7 A;  1UC7 A;  2GT6 A;  2LQO A;  5CAX A;  1NM3 A;  1SYX A;  1WIK A;  2FWE A;  2EC4 A;  4YH2 A;  4OWY A;  5JWO B;  3F63 A;  4GRF A;  4NAX A;  1X9M B;  1SK1 A;  4MMM A;  4Q5Q A;  4PQ1 A;  1M9B A;  4TN8 A;  1Q98 A;  1K0C A;  2K6V A;  5G31 A;  5KOX A;  1A2J A;  2XPE A;  4MF6 A;  1ZYN A;  1UVZ A;  2NPB A;  4MP4 A;  3GX0 A;  2L57 A;  3TKR A;  3EPT A;  3I6A A;  3LXZ A;  4EUY A;  3D6I A;  4FH8 A;  1FO5 A;  3LYK A;  4LL1 B;  2P5R A;  4TVE A;  2I1U A;  3KTB A;  4ZBA A;  3ME8 A;  4Q5N A;  4ZB6 A;  3NZN A;  4F9Z A;  4NHW A;  4ZL8 A;  2AB6 A;  3PH9 A;  2YV7 A;  5KN1 A;  2CX4 A;  3C7M A;  1A8L A;  5DQS A;  5JCG A;  4ACS A;  2KLX A;  2HI7 A;  1Z6M A;  1JZD A;  2CAI A;  5D9T A;  3KD0 A;  4KH7 A;  2R2J A;  4D73 B;  2GTU A;  3DXB A;  1XW9 A;  3H93 A;  4H86 A;  3GL5 A;  5A4W A;  2DLX A;  4PXO A;  1Y25 A;  2GQM A;  3ZFL A;  2IMD A;  3TJF A;  3P7X A;  1HD2 A;  3G7J A;  3ZIV A;  5H5R A;  4K6X A;  4K9Z A;  4ZL7 A;  2KP1 A;  4CDO A;  3RBT A;  1T1V A;  3TCO A;  4Z2U A;  1JHB A;  3UAP A;  2FD3 A;  5JCU A;  1T3B A;  2DBC A;  4E8H A;  1ZL9 A;  3ZRD A;  1M9A A;  4F82 A;  1G7O A;  4AF2 A;  4Z2T A;  4TW5 A;  1THX A;  3IK7 A;  5B8B A;  5ELG A;  2N5A A;  3FYG A;  1TI3 A;  5BRT A;  2HRK A;  3HZ4 A;  5F8B A;  5DAK B;  1GNW A;  3CTG A;  2VL9 A;  4J57 E;  2HT9 A;  3D5J A;  2HSM A;  2H0G A;  2YV9 A;  5IPH A;  5IIZ A;  4WR5 A;  3BJ5 A;  3UBL A;  3CRT A;  2MZC A;  1U87 A;  4OFT A;  1TW9 A;  3LEF A;  2WUL A;  4F03 A;  2LNT A;  3ZVJ D;  3TKS A;  2FLS A;  4G9H A;  2G0F A;  4K0N A;  5D73 A;  2WDU A;  2FWG A;  1O73 A;  3HYP A;  1KBN A;  2M80 A;  3LQ7 A;  2H76 A;  3ERF A;  1Z9H A;  5H5Q A;  3L4N A;  3UOM A;  5GZZ B;  4PGT A;  4CY6 A;  2B1L A;  3FRC A;  2LV3 A;  2K8V A;  2ZCT A;  2R5G A;  1HNB A;  4MLY A;  1EGR A;  3QFB C;  5JCW A;  5H5S A;  4KDX A;  2F9S A;  3D0Z A;  4YAP A;  2PPT A;  1Z3E A;  4HOJ A;  1AUC A;  3EMX A;  1PN9 A;  5C04 A;  5HFI A;  2X8C A;  3NIV A;  1PD2 1;  4YQV A;  2V6K A;  3GMF A;  2PN8 A;  5L71 A;  4WR4 A;  4WKW A;  5B6N A;  3R2Q A;  4IBP A;  5CRG A;  4O7H A;  1TJD A;  3TKS E;  4I2T A;  4NXI A;  3F0I A;  1G0T A;  1K0B A;  1T4Y A;  18GS A;  2E0Q A;  1GRX A;  1M3J A;  3EVI A;  4BWS A;  4Q5R A;  5EPF A;  4XTS A;  2JZR A;  2B7J A;  3GIX A;  3IBH A;  3QPM A;  4GF0 A;  3UIW A;  4TR4 A;  4X0X A;  2O85 A;  5AIX A;  4TXO B;  5DCG A;  3BCI A;  2EIQ A;  3GV1 A;  5HR2 A;  1OC3 A;  4IEL A;  2E7P A;  4AJ8 A;  3KCM A;  4L8E A;  2F51 A;  4HQZ A;  2H1A A;  3E9J B;  2C1Y A;  2WJU A;  4BL7 A;  3ZFB A;  4DSS B;  2GSQ A;  3HJM A;  3BD2 A;  4JR4 A;  1K0D A;  2IWT A;  1F2E A;  2OA7 A;  3S9F A;  4OFM A;  1JLW A;  3UJ1 A;  1GWC A;  1SK2 A;  3I43 A;  2H6X A;  2QKE A;  3GKX A;  3PPU A;  2NTO A;  1CQH A;  3QD9 A;  4ZB9 A;  3QAW A;  5J9C A;  4I97 A;  1M3I A;  2KP2 A;  3NOF A;  1FW1 A;  1TKD B;  2FCH A;  1PQN A;  2X99 A;  1ZYQ B;  2MBS A;  2R4V A;  1YF0 A;  4G0K A;  4WF4 A;  1XBS A;  4TR3 A;  2D2Z A;  4V2M A;  1X0R A;  1KTE A;  2IIY A;  1U6T A;  1ERW A;  5AIS A;  1U88 A;  1X5E A;  3FZ5 A;  1VF3 A;  3EUR A;  3ZYW A;  1BX9 A;  3VWW A;  1PKZ A;  2HZE B;  4MPG A;  1EV4 A;  3C71 A;  2AJQ B;  3MYD A;  3G7Y A;  3P2A A;  1ERT A;  1WMJ A;  1HQO A;  2K8S A;  2B5X A;  1EP7 A;  2GZZ A;  4TOP A;  4KSO A;  8GSS A;  2VOC A;  3LOR A;  1A24 A;  4MJC A;  2VAF A;  5AIV A;  2XPD A;  3D4M A;  2YN1 A;  3FZ9 A;  1LJR A;  4N10 A;  2VL2 A;  3KH7 A;  1LU4 A;  1F37 A;  4PUR A;  1ZZY A;  5F06 A;  3EE2 A;  2CVD A;  1S3R A;  3IHG A;  4AGS A;  1XZO A;  1F9M A;  5ECP B;  5G5F A;  4EL1 A;  5GAP D;  4GSS A;  4POK A;  1AIU A;  5DJL A;  2EIR A;  4ID0 A;  4KSM A;  2DJ2 A;  2KOK A;  4ZL9 A;  3DEX A;  2H74 A;  2VD0 A;  3VPQ A;  4MJA A;  1WJK A;  22GS A;  2ON7 A;  2MMN A;  1OAZ A;  4GLT A;  3A5W A;  1GSD A;  1T4Z A;  4PTS A;  3VLN A;  2A2S A;  3TJK A;  4IS0 A;  2GZP A;  5COH A;  11GS A;  2YZH A;  4IKH A;  1Z6N A;  3VUR A;  2C8U A;  3A2X A;  2B5Y A;  3LSZ A;  3HZ8 A;  5HR3 A;  2ZNM A;  5FHI A;  3HXS A;  5CRH A;  2MMA A;  1V58 A;  5HR1 A;  3E0U A;  5ECH B;  1Z7P A;  4K7O A;  1SL1 B;  4YKG A;  1O8X A;  2HNL A;  1ML6 A;  3G9B A;  3TRP A;  1K0N A;  3GA4 A;  3L78 A;  3WYW A;  1ACV A;  2LJK A;  1AQW A;  2BJX A;  4LLR A;  4D73 A;  2MMO A;  3CQF A;  1ILO A;  3HKR A;  3KGK A;  3PR8 A;  4MAB A;  3UBK A; 
#chains in the Genus database with same CATH homology
 5JWQ B;  3DWV A;  4E8E A;  1GSQ A;  3LFL A;  1UN2 A;  3D4T A;  5ECM B;  4OO4 A;  2DIY A;  2YWI A;  4MZB A;  4O5Q A;  4O32 A;  5INY A;  3VPT A;  1WP0 A;  2GGT A;  5D9X A;  2QSI A;  3F3Q A;  1YKA A;  2YWM A;  3G7I A;  4KGI A;  1GSY A;  4DSQ A;  2VCX A;  1B9X C;  1ABA A;  4N0V A;  3QR6 A;  1I9D A;  2GLR A;  4A5P A;  5LNK e;  1FG4 A;  1AAZ A;  4QL7 A;  3EU4 A;  10GS A;  4HJ2 A;  6GSV A;  5DAK A;  2V41 A;  3KH9 A;  1GTB A;  3A2V A;  5F05 A;  1EEJ A;  3Q19 A;  1XPV A;  1E2Y A;  3QDN A;  5CO3 A;  3GH6 A;  3QOU A;  4IGJ A;  4GXZ A;  2PER A;  3LJR A;  5ID2 B;  3I9V 2;  2YZU A;  5ECQ B;  5B7C A;  4YQU A;  4ILF A;  3RHB A;  1WPI A;  1PGT A;  2C0G A;  3FEU A;  5IOW A;  1QXH A;  1C72 A;  2L4C A;  4MPF A;  2LRT A;  4BVX B;  1ERV A;  1U3I A;  3V1W A;  2IME A;  2HSY A;  2OE0 A;  4MZW A;  3FW2 A;  2VL3 A;  5J9B A;  1T7P B;  2X4A A;  2CX3 A;  5DVB A;  5AGY A;  4ISD A;  3UL3 A;  2AHE A;  5DJM A;  3ME7 A;  2RM6 A;  4GCI A;  3TOT A;  2V32 A;  2DSA A;  2L6C A;  2BMX A;  4MJE A;  1M2B A;  1OC8 A;  5D9W A;  3CSH A;  5HFK A;  4HZ2 A;  1F3A A;  1PL2 A;  4XRD A;  4LA1 A;  2HYX A;  3UEM A;  3ZIT A;  1GP1 A;  3HJO A;  5D93 A;  3UMA A;  2HXK A;  4F0C A;  2IMK A;  1Y6E A;  4IHU A;  1VF4 A;  2CVB A;  2LRC A;  2Z9S A;  5J5N A;  3PGT A;  2HFD A;  5J41 A;  4BA7 A;  1ZMA A;  3LGC A;  4WXT A;  3GSS A;  3WGD A;  4TXO A;  3M1G A;  1K0M A;  3RPN A;  2CVK A;  2JZT A;  3HDC A;  4KDY A;  1X5C A;  3U6V A;  1EP8 A;  2HRA A;  4WBR D;  2HRF A;  3IAM 2;  2VCZ A;  3C8E A;  1VF1 A;  1SD9 A;  2DJ1 A;  1YEP A;  3Q74 A;  5F07 A;  5IMA A;  1OVN A;  4DSS A;  2C0F A;  2R0G A;  3ZMK A;  4HUA A;  5IO2 A;  3N9J A;  3TUE A;  3M0F A;  1R7H A;  3QAG A;  5KN2 A;  3UVH A;  5DAL B;  4GQF A;  2IL3 A;  2DMM A;  2JSY A;  3ERW A;  3IK9 A;  2WZ9 A;  7GSS A;  3UAR A;  4LMV A;  3J7Y b;  2IFQ B;  2DIZ A;  4ULX A;  3C1S A;  1FVJ A;  3L9S A;  3F6F A;  1J08 A;  1SK0 A;  3F4R A;  4HEA 2;  4K2X A;  4I5Q A;  4X43 A;  5HR0 A;  5ECL B;  2I81 A;  1MD3 A;  2LUS A;  3F8U A;  2HZE A;  4AJ6 A;  2XC2 A;  4G0L A;  1K0A A;  3O3T A;  4XIH A;  3DVW A;  3GH9 A;  4TR1 B;  2RUF A;  3FMW A;  4HS1 A;  3HCZ A;  2GSR A;  4JR6 A;  1O8W A;  3HY2 A;  4ICY A;  1A2L A;  4CW9 A;  3EMP A;  4K5S A;  1BQ7 A;  3P8W A;  1DBY A;  3MIX A;  3QAV A;  6GSS A;  4OCE A;  3RDW A;  4N0Z A;  3ZL5 A;  2PVO C;  2L5L A;  1SKR B;  1Z5Y E;  2P0G A;  1LBK A;  2PVQ A;  2QA2 A;  2V6O A;  3KMO A;  4ML1 A;  3GKM A;  3M9J A;  3TJJ A;  3QFA C;  3KTL A;  3ERG A;  3IE3 A;  5ECO B;  1YY7 A;  5G30 A;  1SU9 A;  1BG5 A;  3VWX A;  1Z7R A;  2K9F A;  3ZTL A;  4L5L A;  1FB6 A;  5EY6 A;  3QMX A;  1NW2 A;  3LW9 A;  4NMU A;  1ZYP A;  2GSS A;  1GTA A;  5KN0 A;  3CSI A;  2AAW A;  5IM9 A;  2WGR A;  5G2Z A;  4N11 A;  1MDJ A;  1GUM A;  2XBQ A;  2H75 A;  1M7T A;  2M72 A;  2PMT A;  3TGZ A;  2B1K A;  2J9H A;  3M9K A;  2F8F A;  2H01 A;  2C3Q A;  2CAQ A;  1TRU A;  2VUP A;  4WBJ A;  4HDE A;  4KB3 A;  4G19 A;  3TRQ A;  1PL1 A;  4KF9 A;  2VM2 A;  2H73 A;  3IOS A;  3LYP A;  1KNG A;  1TK0 B;  5D96 A;  1EWX A;  4Z2R A;  3C73 A;  2L5O A;  2N5F A;  3VWV A;  2JSZ A;  1XWK A;  2H6Z A;  5G1K A;  1FOH A;  1ZYE A;  1A8Y A;  1A2M A;  3US3 A;  5GSS A;  2H0I A;  3FZA A;  1WRY A;  2VCV A;  3DGQ A;  4N30 A;  1SJZ A;  1E6B A;  3WT1 A;  2B6M A;  1A23 A;  5E4W A;  3F4S A;  1SJI A;  4GQC A;  2IN3 A;  3H4K A;  1JFU A;  2HSH A;  2C4J A;  4WF5 A;  2MBT A;  3KIJ A;  3MWH A;  3IHQ A;  2OE3 A;  2CQ9 A;  2CV4 A;  9GSS A;  1FAA A;  3F3R A;  3APS A;  5CRW A;  5J4U A;  2JAC A;  1W89 A;  1QUW A;  1TU7 A;  4XCS A;  1YZX A;  3L9U A;  3DKS A;  5ECK B;  3MSZ A;  1DE2 A;  3O76 A;  3F4T A;  3RAZ A;  1B9Y C;  16GS A;  2FA4 A;  5ID2 A;  4TRX A;  4ML6 A;  3ZVJ A;  3GUS A;  4HQS A;  4QQ7 A;  4V2L A;  4EDY A;  2YAN A;  2F8A A;  1TOF A;  3DVX A;  1O6J A;  1N2A A;  2YCD A;  3ZZX A;  1NHO A;  4L5O A;  3VK9 A;  2QA1 A;  2H72 A;  3HVX A;  5IOX A;  4MF7 A;  4EC0 A;  3GHA A;  3P90 A;  1V2A A;  2X49 A;  4JU5 A;  4YKF A;  1YDK A;  3LXT A;  2DJJ A;  4EE0 A;  2LS5 A;  3MAK A;  1BED A;  2X8G A;  4DVC A;  3FY7 A;  3MDK A;  1XVW A;  4EIQ A;  2BTO T;  4O5U A;  1Q4J A;  4EF0 A;  1A0R P;  4QL9 A;  1URM A;  5E59 A;  4CY8 A;  4FYU A;  4OFN A;  5KEJ A;  2DML A;  2H1G A;  1TI1 A;  3DRN A;  3MNG A;  4DSR A;  2LJR A;  4GWR A;  4MNN A;  2H1D A;  2I3Y A;  4WEY A;  1G6W A;  2HLS A;  1O81 A;  2PGT A;  2GZY A;  5DBQ A;  4L0W A;  4J2F A;  2MYG A;  3IAS 2;  3ZLP A;  3W8S A;  2X8H A;  2R6K A;  3BOA A;  2I4A A;  1S3C A;  2RLI A;  3EIN A;  1SEN A;  4XS6 A;  1JZW A;  3W6G A;  1XW6 A;  3IC4 A;  4ZBD A;  1EV9 A;  3BBY A;  3UVT A;  3RHC A;  2A2P A;  4MH3 A;  4GSN A;  1T00 A;  2MMZ A;  2TIR A;  4MJB A;  3GNJ A;  1OE8 A;  1DSB A;  1XWG A;  1S3D A;  3KMN A;  2IFQ A;  1GL8 A;  1OC9 B;  1YJ6 A;  4NPB A;  20GS A;  3HJP A;  2KUC A;  2NDO A;  4J56 E;  1SKS B;  1IYH A;  3ED3 A;  2VLT A;  13GS A;  1WE0 A;  4PUA A;  4RQX A;  1AC1 A;  1XW5 A;  1B4P A;  2NVL A;  4XRA A;  5F0G A;  2GS3 A;  3IPZ A;  4ECI A;  3TB2 A;  3EC3 A;  2JAD A;  6GST A;  1J9B A;  3AY8 A;  4EIP A;  3O6T A;  5HQP A;  2IPA A;  4I8B A;  4Z7X A;  1GSS A;  2DKI A;  1O7U A;  4OMV A;  1FOV A;  1FVK A;  4TR1 A;  1OE7 A;  1FHE A;  1JLV A;  3D22 A;  1S3A A;  3IA1 A;  5ABR A;  1AXD A;  2FUG 2;  2IMF A;  1XCC A;  5A5K A;  14GS A;  2ALB A;  4ZB8 A;  3VFI A;  2KHP A;  2DC5 A;  2GQK A;  4L0U A;  1YQ1 A;  4X1U A;  2PU9 C;  4GST A;  2NBS A;  1WWJ A;  1SL0 B;  3VWU A;  5CYY A;  5IO0 A;  3N5O A;  4FYC A;  1XVQ A;  2YNX A;  1ZOF A;  2RM5 A;  4NV2 A;  2PWJ A;  1V40 A;  1VRS D;  2O89 A;  1OYJ A;  4MF5 A;  1YF1 A;  1K0O A;  4BVY B;  5KOW A;  1BYE A;  5CNW A;  5AN1 A;  3BCK A;  2C3T A;  2LEG A;  3DML A;  2O87 A;  2YJ7 A;  3HVV A;  2IMI A;  1W4V A;  2PBJ A;  3A3T A;  1GUL A;  1R5A A;  4TR0 A;  1GLP A;  1HYU A;  3EU3 A;  1V98 A;  2QC7 A;  1TK8 B;  1XFL A;  1R26 A;  1EOH A;  3KJY A;  1GUK A;  1GLQ A;  2OKA A;  2J23 A;  1GSU A;  1QGV A;  4O92 A;  3H79 A;  2H1B A;  4MCU A;  3TKP A;  4USS A;  4JRR A;  1RQM A;  3A2W A;  4KE3 A;  1WOU A;  1BJX A;  3WGE A;  1ERU A;  2JZS A;  4ZIJ A;  3IV4 A;  2GST A;  4XS4 B;  4EO3 A;  2ON5 A;  2YPM A;  1QFN A;  1EGO A;  2A2R A;  3GTU B;  6GSX A;  5D8I A;  4ECC A;  1PX6 A;  2V1M A;  2CA8 A;  2K18 A;  2WCI A;  2LTK A;  3TDG A;  1V57 A;  1V9W A;  1EZK A;  1HNA A;  2CZ2 A;  4LL4 B;  1ZGN A;  3KM6 A;  3ZRE A;  4JED A;  2EIO A;  5A4U A;  3QCP A;  2VO4 A;  1F6M C;  5DDL A;  1YEX A;  4V2N A;  4X4J A;  1I5G A;  2CT6 A;  2C3N A;  3ISO A;  3WGX A;  1SJ6 A;  4ZBB A;  5IMD A;  5ECS A;  6GSW A;  2LQQ A;  1QK8 A;  5A4V A;  3CBU A;  4HI7 A;  3M3M A;  1SD8 A;  1AQX A;  5IMZ A;  2YP6 A;  2L6D A;  2DJ3 A;  1PKW A;  4IP1 A;  3KP8 A;  1A0F A;  2H6Y A;  2R37 A;  5FWG A;  3VI7 A;  2VIM A;  4EXJ A;  2H8L A;  2FHE A;  2VM1 A;  3HHV A;  2OBK A;  1GTU A;  2FNO A;  1BAY A;  2H71 A;  2L59 A;  3H1N A;  2QGV A;  2WS2 A;  1X5D A;  4KND A;  1XOB A;  3ZML A;  4F2I A;  1CQG A;  3TKQ A;  1SYR A;  2VLU A;  5G1L A;  1TXX A;  4IVF A;  2AUV A;  2FY6 A;  3IDV A;  2G2Q A;  1TRV A;  1HNC A;  3GKK A;  2WRT A;  2A4V A;  1XIY A;  2WB9 A;  17GS A;  3L0H A;  3GN3 A;  2C80 A;  2O8V B;  3IR4 A;  1AQV A;  2E2M A;  4IW9 A;  2H19 A;  4KW6 A;  2LJA A;  4EVM A;  4IP6 A;  1JZO A;  4OO5 A;  3DYR A;  3I69 A;  19GS A;  3EWL A;  3LWA A;  5D9V A;  4KX4 A;  4IN0 A;  2F3M A;  1ST9 A;  3LG6 A;  4KAE A;  3FKF A;  1GSF A;  2JU5 A;  2P31 A;  2X64 A;  5CP1 A;  1K3Y A;  3DD3 A;  3ZIJ A;  3TRX A;  1N8J A;  3J7Y k;  4K7I A;  1MD4 A;  4FYB A;  4OCF A;  2HRN A;  2OJL A;  3F9U A;  5ECN B;  2XHF A;  2DKH A;  4K0G A;  4MK3 A;  4Q5F A;  1XWA A;  3TJG A;  1J0F A;  3TKS C;  2LST A;  1G7E A;  3L9V A;  4JBB A;  2XBI A;  1B4Q A;  2A4H A;  1RK4 A;  1PN0 A;  4XHM A;  3DIE A;  2YJH A;  3IC8 A;  5EL8 A;  2AV4 A;  3RPP A;  3FR6 A;  3FHK A;  1NHY A;  4ECJ A;  1DUG A;  5ECR B;  4HU9 A;  4KUN A;  5DCH A;  4CHS A;  4G10 A;  3HD5 A;  1O85 A;  2C0D A;  3CYN A;  1B8X A;  3APO A;  1PSQ A;  3IXR A;  1IYI A;  4IJI A;  4NHZ A;  4NV5 A;  5KN3 A;  1ON4 A;  5B6M A;  3W8J A;  1PRX A;  3Q6O A;  5LD0 A;  2V2G A;  2ZUP A;  4G0I A;  4PQH A;  2R0C A;  2WFC A;  2HZF A;  6GSY A;  4MZC A;  1ZCP A;  2REM A;  2IJY A;  1OC9 A;  1T8E B;  4K5R A;  3KP9 A;  1GSE A;  4IQA A;  2O7K A;  4EKZ A;  3HA9 A;  1M2A A;  5C00 A;  2YWO A;  1JZR A;  1DE1 A;  5IMF A;  1X9S B;  4NWY A;  4HJM A;  3M8N A;  1PX7 A;  2I9H A;  2H0H A;  1M0U A;  2R0P A;  4KCE A;  2E2G A;  1SL2 B;  3JCM L;  2HE3 A;  1U3A A;  2FGX A;  1TRW A;  1VF2 A;  1XXU A;  5DQY A;  4RI6 A;  3CSJ A;  2FWF A;  4KA0 A;  5BMU A;  1NSW A;  4K1F A;  3FZ4 A;  1MTC A;  3SBC A;  1OKT A;  1TK5 B;  1K3O A;  4MDC A;  4BVX A;  4PNF A;  4I2U A;  3CTF A;  4O5R A;  3KXO A;  4V1A p;  2YWN A;  3IRA A;  3A5I A;  1QQ2 A;  5ECI B;  2RUE A;  3F6D A;  1TP9 A;  4FIW A;  2DJ0 A;  5IMV A;  4ZIL A;  4BVY A;  3TOU A;  4DEJ A;  2H66 A;  2H30 A;  2L4Q A;  4ECB A;  5GST A;  2LKU A;  2CZ3 A;  4P3Y B;  6GSU A;  2GVP A;  1XOA A;  1YKC A;  2AYT A;  4AJ7 A;  1X9W B;  1KEB A;  3R3E A;  1GH2 A;  5ELA A;  5EVO A;  4XS1 A;  1F3B A;  1GTI A;  2B3S A;  1K3L A;  4ZXG A;  1B48 A;  2LRN A;  4PUF C;  2GQL A;  4BWQ A;  1XWC A;  4WET A;  1PMT A;  2VCQ A;  3FR9 A;  1UA5 A;  3Q18 A;  4POM A;  2YOI A;  4EDZ A;  1M99 A;  1MDI A;  2C0E A;  1TTZ A;  3C1R A;  3CRU A;  2VL2 C;  1THO A;  3GUR A;  2OAC A;  4RI7 A;  4MA9 A;  4XS4 A;  1GUH A;  1MDK A;  3D21 A;  3FR3 A;  1R4W A;  2OBI A;  4RUV A;  3U5R E;  1R5P A;  3GTU A;  4JE1 A;  2GT5 A;  1FB0 A;  4IJ3 A;  4K7N A;  3APQ A;  12GS A;  3KZQ A;  1VGL A;  4POL A;  5CRE A;  2TRX A;  2TRC P;  2VD1 A;  3EYT A;  4V1A g;  3GRX A;  2PUK C;  2OAD A;  3CXG A;  3H8Q A;  4BL7 B;  5J3R A;  5DAL A;  3FK8 A;  5IPG A;  5IMC A;  1USB A;  3GL3 A;  1TDI A;  2OE1 A;  1XWB A;  3WD6 A;  4HU7 A;  2GDR A;  4POB A;  4K8M A;  4YAV A;  2DJK A;  4KDU A;  4HZ4 A;  3K8N A;  2B7K A;  2R3X A;  4PX1 A;  1EEM A;  4BPY A;  2LNS A;  3GX8 A;  3VI5 A;  2UZ8 A;  5CRD A;  2FA8 A;  4G2E A;  5HFG A;  1AW9 A;  4YQM A;  4KCA A;  3GKN A;  2VLV A;  4PNG A;  5FT3 A;  3PIN A;  3E3E A;  1QMV A;  1G6Y A;  4K2D A;  3WT2 A;  3GFK A;  3GST A;  1H4O A;  4LMW A;  2H70 A;  1GNE A;  1M2D A;  3HVS A;  4TKY A;  1SKW B;  4PQI A;  2N5B A;  5IQY A;  4MH2 A;  3TJB A;  3OR5 A;  1EOG A;  3KEB A;  4FO5 A;  1PA3 A;  1MEK A;  4TXV A;  4OD7 A;  1TU8 A;  2JL4 A;  5B8A A;  2P5Q A;  4RQR A;  3CMI A;  2FWH A;  2VCW A;  1RW1 A;  5ENU A;  5JWR B;  1OKD A;  5G5E A;  2RII A;  4FQU A;  2M46 A;  3SWL A;  5GAN D;  2VCT A;  1H75 A;  4GTU A;  5LCZ A;  1TRS A;  4F0B A;  2B5E A;  4JZQ A;  4IQ1 A;  3GYK A;  4I6X A;  2ES7 A;  1UC7 A;  2GT6 A;  2LQO A;  5CAX A;  1NM3 A;  1SYX A;  1WIK A;  2FWE A;  2EC4 A;  4YH2 A;  4OWY A;  5JWO B;  3F63 A;  4GRF A;  4NAX A;  1X9M B;  1SK1 A;  4MMM A;  4Q5Q A;  4PQ1 A;  1M9B A;  4TN8 A;  1Q98 A;  1K0C A;  2K6V A;  5G31 A;  5KOX A;  1A2J A;  2XPE A;  4MF6 A;  1ZYN A;  1UVZ A;  2NPB A;  4MP4 A;  3GX0 A;  2L57 A;  3TKR A;  3EPT A;  3I6A A;  3LXZ A;  4EUY A;  3D6I A;  4FH8 A;  1FO5 A;  3LYK A;  4LL1 B;  2P5R A;  4TVE A;  2I1U A;  3KTB A;  4ZBA A;  3ME8 A;  4Q5N A;  4ZB6 A;  3NZN A;  4F9Z A;  4NHW A;  4ZL8 A;  2AB6 A;  3PH9 A;  2YV7 A;  5KN1 A;  2CX4 A;  3C7M A;  1A8L A;  5DQS A;  5JCG A;  4ACS A;  2KLX A;  2HI7 A;  1Z6M A;  1JZD A;  2CAI A;  5D9T A;  3KD0 A;  4KH7 A;  2R2J A;  4D73 B;  2GTU A;  3DXB A;  1XW9 A;  3H93 A;  4H86 A;  3GL5 A;  5A4W A;  2DLX A;  4PXO A;  1Y25 A;  2GQM A;  3ZFL A;  2IMD A;  3TJF A;  3P7X A;  1HD2 A;  3G7J A;  3ZIV A;  5H5R A;  4K6X A;  4K9Z A;  4ZL7 A;  2KP1 A;  4CDO A;  3RBT A;  1T1V A;  3TCO A;  4Z2U A;  1JHB A;  3UAP A;  2FD3 A;  5JCU A;  1T3B A;  2DBC A;  4E8H A;  1ZL9 A;  3ZRD A;  1M9A A;  4F82 A;  1G7O A;  4AF2 A;  4Z2T A;  4TW5 A;  1THX A;  3IK7 A;  5B8B A;  5ELG A;  2N5A A;  3FYG A;  1TI3 A;  5BRT A;  2HRK A;  3HZ4 A;  5F8B A;  5DAK B;  1GNW A;  3CTG A;  2VL9 A;  4J57 E;  2HT9 A;  3D5J A;  2HSM A;  2H0G A;  2YV9 A;  5IPH A;  5IIZ A;  4WR5 A;  3BJ5 A;  3UBL A;  3CRT A;  2MZC A;  1U87 A;  4OFT A;  1TW9 A;  3LEF A;  2WUL A;  4F03 A;  2LNT A;  3ZVJ D;  3TKS A;  2FLS A;  4G9H A;  2G0F A;  4K0N A;  5D73 A;  2WDU A;  2FWG A;  1O73 A;  3HYP A;  1KBN A;  2M80 A;  3LQ7 A;  2H76 A;  3ERF A;  1Z9H A;  5H5Q A;  3L4N A;  3UOM A;  5GZZ B;  4PGT A;  4CY6 A;  2B1L A;  3FRC A;  2LV3 A;  2K8V A;  2ZCT A;  2R5G A;  1HNB A;  4MLY A;  1EGR A;  3QFB C;  5JCW A;  5H5S A;  4KDX A;  2F9S A;  3D0Z A;  4YAP A;  2PPT A;  1Z3E A;  4HOJ A;  1AUC A;  3EMX A;  1PN9 A;  5C04 A;  5HFI A;  2X8C A;  3NIV A;  1PD2 1;  4YQV A;  2V6K A;  3GMF A;  2PN8 A;  5L71 A;  4WR4 A;  4WKW A;  5B6N A;  3R2Q A;  4IBP A;  5CRG A;  4O7H A;  1TJD A;  3TKS E;  4I2T A;  4NXI A;  3F0I A;  1G0T A;  1K0B A;  1T4Y A;  18GS A;  2E0Q A;  1GRX A;  3EVI A;  4BWS A;  4Q5R A;  5EPF A;  4XTS A;  2JZR A;  2B7J A;  3GIX A;  3IBH A;  3QPM A;  4GF0 A;  3UIW A;  4TR4 A;  4X0X A;  2O85 A;  5AIX A;  4TXO B;  5DCG A;  3BCI A;  2EIQ A;  3GV1 A;  5HR2 A;  1OC3 A;  4IEL A;  2E7P A;  4AJ8 A;  3KCM A;  4L8E A;  2F51 A;  4HQZ A;  2H1A A;  3E9J B;  2C1Y A;  2WJU A;  4BL7 A;  3ZFB A;  4DSS B;  2GSQ A;  3HJM A;  3BD2 A;  4JR4 A;  1K0D A;  2IWT A;  1F2E A;  2OA7 A;  3S9F A;  4OFM A;  1JLW A;  3UJ1 A;  1GWC A;  1SK2 A;  3I43 A;  2H6X A;  2QKE A;  3GKX A;  3PPU A;  2NTO A;  1CQH A;  3QD9 A;  4ZB9 A;  3QAW A;  5J9C A;  4I97 A;  2KP2 A;  3NOF A;  1FW1 A;  1TKD B;  2FCH A;  1PQN A;  2X99 A;  1ZYQ B;  2MBS A;  2R4V A;  1YF0 A;  4G0K A;  4WF4 A;  1XBS A;  4TR3 A;  2D2Z A;  4V2M A;  1X0R A;  1KTE A;  2IIY A;  1U6T A;  1ERW A;  5AIS A;  1U88 A;  1X5E A;  3FZ5 A;  1VF3 A;  3EUR A;  3ZYW A;  1BX9 A;  3VWW A;  1PKZ A;  2HZE B;  4MPG A;  1EV4 A;  3C71 A;  2AJQ B;  3MYD A;  3G7Y A;  3P2A A;  1ERT A;  1WMJ A;  1HQO A;  2K8S A;  2B5X A;  1EP7 A;  2GZZ A;  4TOP A;  4KSO A;  8GSS A;  2VOC A;  3LOR A;  1A24 A;  4MJC A;  2VAF A;  5AIV A;  2XPD A;  3D4M A;  2YN1 A;  3FZ9 A;  1LJR A;  4N10 A;  2VL2 A;  3KH7 A;  1LU4 A;  1F37 A;  4PUR A;  1ZZY A;  5F06 A;  3EE2 A;  2CVD A;  3IHG A;  4AGS A;  1XZO A;  1F9M A;  5ECP B;  5G5F A;  4EL1 A;  5GAP D;  4GSS A;  4POK A;  1AIU A;  5DJL A;  2EIR A;  4ID0 A;  4KSM A;  2DJ2 A;  2KOK A;  4ZL9 A;  3DEX A;  2H74 A;  2VD0 A;  3VPQ A;  4MJA A;  1WJK A;  22GS A;  2ON7 A;  2MMN A;  1OAZ A;  4GLT A;  3A5W A;  1GSD A;  1T4Z A;  4PTS A;  3VLN A;  2A2S A;  3TJK A;  4IS0 A;  2GZP A;  5COH A;  11GS A;  2YZH A;  4IKH A;  1Z6N A;  3VUR A;  2C8U A;  3A2X A;  2B5Y A;  3LSZ A;  3HZ8 A;  5HR3 A;  2ZNM A;  5FHI A;  3HXS A;  5CRH A;  2MMA A;  1V58 A;  5HR1 A;  3E0U A;  5ECH B;  1Z7P A;  4K7O A;  1SL1 B;  4YKG A;  1O8X A;  2HNL A;  1ML6 A;  3G9B A;  3TRP A;  1K0N A;  3GA4 A;  3L78 A;  3WYW A;  1ACV A;  2LJK A;  1AQW A;  2BJX A;  4LLR A;  4D73 A;  2MMO A;  1ILO A;  3HKR A;  3KGK A;  3PR8 A;  4MAB A;  3UBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...