1EP8A

Crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
GGSVIVIDSKAAWDAQLAKGKEEHKPIVVAFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN CH1, H-TYPE
publication title Crystal structure of the wild-type and D30A mutant thioredoxin h of Chlamydomonas reinhardtii and implications for the catalytic mechanism.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 36
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ep8A00
5CAXA 5E4WA 4GQFA 3LFLA 5AN1A 4AJ7A 1YZXA 4GQCA 2IN3A 1DUGA 1FB0A 5IO2A 2ZNMA 2ON5A 2X99A 2VLTA 1NM3A 4MJBA 1GTUA 3CTGA 4KW6A 3KTLA 5CNWA 5IQYA 2OJLA 2KOKA 2PMTA 5F06A 3D21A 3KMNA 3LJRA 4OFTA 2LNTA 2FWFA 2L6DA 1FB6A 4ISDA 1YF0A 3ZTLA 3US3A 2JU5A 1K3OA 3Q74A 1QMVA 3WT2A 1TW9A 3M9JA 3HJMA 4KUNA 3KJYA 4WF4A 3A5WA 1B4PA 3GX0A 2JZTA 8GSSA 4ILFA 3G9BA 5D9TA 4E8HA 5IMFA 1N8JA 2VLUA 2JSYA 3LSZA 3VFIA 1GSYA 2V6KA 1GRXA 3A3TA 3TOTA 1O73A 1AXDA 1F37A 1THOA 3UOMA 2AUVA 2GVPA 1G7EA 2P0GA 20GSA 4PNGA 7GSSA 1THXA 2H1GA 5CRDA 4MJEA 1XCCA 3VK9A 4NAXA 2R6KA 2WJUA 3GFKA 4V2NA 4N0ZA 1V9WA 4MDCA 1VF1A 1NHYA 1X9MB 2YPMA 5D93A 3M3MA 1AQWA 4HQZA 2WRTA 2HRFA 3QFAC 1M2AA 1MD3A 5EPFA 1H75A 6GSVA 3CRTA 2H75A 1FOVA 4POMA 1GUKA 3I69A 4MCUA 1URMA 4J57E 3ISOA 9GSSA 1O8WA 2F3MA 1GSUA 1PX7A 3LXZA 3DD3A 4YH2A 3KZQA 4ECCA 1TK0B 4FO5A 2H71A 1YEXA 2VCQA 4X43A 2C3NA 5F8BA 5EL8A 1TI3A 2GSSA 4XS4B 4K1FA 3D0ZA 1XVQA 2YNXA 2H66A 4MJAA 5A4UA 1SU9A 2AAWA 3GKNA 2B5YA 1MEKA 4I2UA 4MH3A 2KP2A 5IIZA 4FH8A 3S9FA 3LORA 2O85A 19GSA 3HHVA 3QMXA 1JLVA 5CP1A 2YZHA 2XHFA 2HZEA 4G19A 2OBIA 1HYUA 2A2SA 4YAPA 3MDKA 1TU8A 1GUHA 4I5QA 4RI7A 3A2XA 1XBSA 4JE1A 4LMVA 3F4SA 3VWWA 2VL9A 1R4WA 3TCOA 1UN2A 4TR4A 1PRXA 5KN3A 4K2DA 1DSBA 2VCZA 1JZDA 4WBRD 2IMEA 3IOSA 1FO5A 3F4TA 5C00A 2H30A 3FZ9A 5B6MA 4I6XA 3QAGA 4KDYA 2DJ0A 3QDNA 4PGTA 5CREA 1ABAA 1XXUA 1GNEA 1TRVA 3GNJA 4JZQA 1YY7A 3GL3A 2DJ3A 4KNDA 2JL4A 4MLYA 4KCEA 5IMVA 5KN2A 5CRGA 3UBLA 3P8WA 1F9MA 5J41A 5JCUA 1IYHA 5GSSA 3O76A 3DIEA 1ZYEA 4JEDA 3UVTA 4I8BA 4N11A 2H73A 4XTSA 1M2DA 3WGXA 3QOUA 2OE3A 4K7OA 1VGLA 2LTKA 1ZCPA 2VL2A 2DC5A 5G30A 2L6CA 2VOCA 17GSA 1SENA 4K9ZA 3WT1A 1WOUA 3VPTA 5A5KA 1MDIA 1F6MC 2KUCA 2B7KA 2H6XA 4E8EA 3RPNA 1PKWA 3VI5A 1GWCA 4IKHA 3AY8A 4XIHA 3CMIA 4MF6A 2IFQB 2LRNA 1W89A 5HR1A 1J9BA 4TXOA 4AJ6A 2HE3A 4ZB9A 4HEA2 3CTFA 4XS6A 4HS1A 2B3SA 4QL7A 2DBCA 4XCSA 4FIWA 3ZREA 4BA7A 1OVNA 4PUFC 3G7IA 3KCMA 2OE0A 2B6MA 4TRXA 1X5DA 2GSRA 3QAVA 5IO0A 1TTZA 3QPMA 1K3YA 1XWAA 4PXOA 4ECBA 4F03A 2C4JA 4NXIA 2PGTA 4GWRA 3ZL5A 3QCPA 4OCFA 2GDRA 4KH7A 4L8EA 1B9YC 2O7KA 3EC3A 4MH2A 3GKMA 2YWOA 3QAWA 5JWOB 1TKDB 3ZZXA 5D73A 1TRWA 2KHPA 2H1BA 1QQ2A 2WCIA 3ZYWA 2DJ1A 4YQVA 2LRTA 2LRCA 4FYBA 5D8IA 1ZYQB 1JFUA 2L59A 3PGTA 5IOWA 4JU5A 4HDEA 3BBYA 3MAKA 2FHEA 2GLRA 3UL3A 2B1LA 1E2YA 2PPTA 3TKRA 3C8EA 3HKRA 3TKSA 1NW2A 5GAND 3APQA 4KB3A 3A2VA 4GTUA 4NV2A 2GS3A 4Q5NA 2L5OA 5LNKe 3SWLA 1V40A 1WRYA 4TR1B 5A4WA 3KD0A 2LQQA 2NDOA 1G6WA 1XVWA 3H8QA 2NBSA 1O6JA 3ZMKA 2LS5A 5ID2B 2F8FA 2C0EA 3FKFA 6GSYA 4POBA 4IP1A 4O7HA 2VAFA 4EF0A 4OMVA 2NPBA 1YKCA 1DBYA 4BWQA 4OFMA 4HU9A 3IC4A 5IMAA 3HZ8A 3GYKA 2YZUA 5DAKA 5ECPB 1PL2A 1VF2A 3CXGA 1GP1A 3TJBA 4EL1A 2NTOA 3GA4A 1Z7RA 2VCXA 3WD6A 2PU9C 1OAZA 4DVCA 1G7OA 4GSSA 3ZMLA 2VM2A 4MZCA 1GL8A 3O3TA 1ERTA 3JCML 1YKAA 2IMDA 3DRNA 3Q18A 2FWEA 1EV4A 1TU7A 2ZCTA 1BYEA 4V1Ag 1MTCA 2K8VA 4GRFA 4KCAA 2H1DA 1F3BA 1M2BA 2R3XA 2PUKC 5DCGA 3MSZA 3F63A 2GZPA 2CA8A 4JR6A 2KP1A 5HR2A 1EEMA 2YN1A 1ACVA 4V2LA 1LU4A 2I81A 4RUVA 3Q6OA 4G10A 1SYXA 4V1Ap 18GSA 3W8SA 4MZWA 2IWTA 2FY6A 3IBHA 4IQAA 2O8VB 3H79A 3VURA 1H4OA 3DWVA 1B9XC 1M9AA 1A2JA 2QGVA 5FT3A 3GN3A 3GH9A 4IELA 3D22A 2WULA 2JACA 3QFBC 2WS2A 5DALB 1M99A 3TKPA 4EDZA 4OO4A 2IL3A 1XWGA 2EIRA 1F3AA 2GT6A 4MA9A 3IV4A 1OC9B 2FWGA 1PMTA 4GSNA 2REMA 4D73A 2MZCA 4Q5FA 4XS4A 1NSWA 1B4QA 4LMWA 4WKWA 1SK0A 5IPHA 2DIYA 2VD1A 3I6AA 3E3EA 3WGDA 2IMFA 3KH9A 4OO5A 4HUAA 2L5LA 1A8YA 1U3AA 2PVQA 3M0FA 3U5RE 5JWRB 2VLVA 5J5NA 5DDLA 1FVKA 1UA5A 3N5OA 1GLPA 3GKXA 1K0NA 1EGRA 2LJKA 4L5LA 4O5RA 1TJDA 1U6TA 4G2EA 4WETA 5FWGA 3IAS2 1GNWA 2L4CA 5AGYA 3TRQA 5DCHA 3CYNA 3D4TA 4IJ3A 2F8AA 4F82A 1U3IA 3RDWA 4HOJA 2JZSA 2HT9A 2WDUA 2YWIA 4KDUA 3L78A 4J56E 4JBBA 1GTBA 4LLRA 22GSA 2P5QA 4KSOA 4ACSA 1BAYA 3TDGA 2MMZA 5JWQB 4O92A 2OE1A 1A2LA 1Z5YE 1AQVA 1O8XA 2P5RA 3BD2A 2I9HA 2XPDA 4K6XA 5ENUA 3DXBA 3LWAA 2G2QA 3ERGA 1WWJA 4P3YB 3C1SA 1XW5A 2YV9A 2H6ZA 5LCZA 1V98A 4TR3A 5B7CA 4EXJA 2FUG2 2YP6A 1OYJA 2L57A 1I9DA 1WIKA 4HZ2A 4Z7XA 5F07A 2OADA 1M7TA 3EU3A 6GSUA 1BJXA 5DJLA 4JR4A 1WMJA 3L9SA 4I97A 5B8BA 3WYWA 3APSA 5IOXA 1SD8A 1R7HA 2JSZA 3UIWA 1V2AA 5GAPD 5HFKA 2ALBA 1O81A 1E6BA 1MDKA 2IPAA 4PQIA 3FR9A 3CRUA 4GLTA 4EDYA 2AYTA 1ERUA 12GSA 10GSA 5ELAA 4EKZA 3EWLA 3KP9A 5J4UA 5G2ZA 2B5EA 2E7PA 3PR8A 3KIJA 1ST9A 5DJMA 3HD5A 2C0GA 1HD2A 3IE3A 1VRSD 3ZITA 2FA4A 4RQXA 3EYTA 3RPPA 5G5FA 2CVDA 5HR3A 2O89A 2DLXA 3DEXA 4BL7A 3EE2A 2RM6A 2GT5A 5D9XA 1X9WB 4XS1A 3D4MA 2R37A 2VO4A 2GSQA 2FCHA 1R26A 6GSSA 3KGKA 1K0CA 3VI7A 4TW5A 4K0NA 1TRUA 1AIUA 1Z7PA 1K0AA 3ZRDA 1ERWA 1TOFA 3NOFA 2B7JA 2QKEA 4BWSA 1FVJA 1GLQA 4N0VA 1J0FA 1XZOA 2GQMA 4L5OA 4K0GA 3F9UA 5DQSA 2RUEA 2VM1A 3GIXA 2GSTA 1R5PA 1OKDA 4IBPA 1LJRA 2GTUA 1QUWA 1SK1A 1Z6NA 2LNSA 5DQYA 1FW1A 2TIRA 3FR6A 4N10A 3HVVA 1CQGA 3UBKA 2PBJA 1GSSA 4MF5A 1OE7A 4ZBDA 1Y6EA 4K7IA 1T7PB 1Q98A 1HNBA 3ERWA 1SJZA 2H0GA 3ZVJD 1XW6A 4WBJA 2M46A 3L9UA 3IRAA 2R2JA 3TKQA 5CYYA 3I9V2 4KX4A 1XWKA 4LL1B 1U88A 3C73A 2CZ3A 4DSSA 3TJKA 1TK5B 3TGZA 3IK9A 1W4VA 2HZEB 2TRXA 3FY7A 3BOAA 5F0GA 1A24A 3IA1A 3P7XA 4TKYA 2H6YA 4MPFA 4ZBBA 1X5CA 2N5BA 3RHCA 5DVBA 2LJRA 3L0HA 4J2FA 2I4AA 5EVOA 3W8JA 1PL1A 3GSTA 1SL1B 4IP6A 1AC1A 5D96A 3E9JB 2KLXA 1KNGA 1TDIA 3BCKA 3UJ1A 3H93A 3F3QA 4KA0A 4F9ZA 3FYGA 4EC0A 4PNFA 1SK2A 4PURA 3GUSA 4BVXA 4RI6A 1EP8A 1QFNA 3FHKA 2XBQA 5J9CA 1Z3EA 2RM5A 3LQ7A 3GTUA 3ED3A 2YWNA 3VWVA 4LL4B 4HJMA 1N2AA 1YJ6A 2BTOT 4EVMA 3KXOA 4ZL9A 5IMZA 4IGJA 2H74A 3F3RA 4HZ4A 3BJ5A 1GTIA 1PSQA 2C0FA 5IMCA 4DSRA 4TR0A 4ZL8A 1EOHA 4ZBAA 2DJKA 2CAIA 4HU7A 2JZRA 4TN8A 4PQ1A 3D5JA 3PH9A 3ZFLA 3IDVA 1K0OA 2C1YA 2V41A 4IW9A 3M9KA 1M0UA 3J7Yk 3SBCA 2D2ZA 1OE8A 2PVOC 2XPEA 2RLIA 1ZMAA 2EIQA 1MD4A 5EY6A 1AW9A 4XHMA 3EMXA 5L71A 4ZILA 2WB9A 1EWXA 4TXOB 3APOA 5D9VA 2H0HA 5G31A 4IQ1A 4OCEA 2C0DA 3C1RA 3KEBA 1QXHA 3FK8A 2IJYA 2HYXA 1X9SB 2ZUPA 1JLWA 4POLA 4GCIA 1A23A 2LQOA 3GV1A 1T4ZA 2VIMA 4F0CA 4XRAA 3DYRA 2N5AA 5ABRA 2OBKA 4IJIA 2WGRA 3MWHA 2V2GA 1ON4A 5AISA 3EURA 1GSQA 1O7UA 1A0RP 3P90A 1SJ6A 3HYPA 3FZ5A 4EE0A 3HY2A 3IAM2 2I1UA 2YOIA 3DVXA 1OC3A 2OA7A 2HXKA 5GZZB 4F0BA 1SYRA 3LG6A 5IPGA 2XBIA 1A2MA 4IS0A 3H4KA 2XC2A 4ZIJA 2YV7A 3UVHA 2LSTA 1CQHA 1YQ1A 4QL9A 1JZOA 2H19A 2X64A 2LV3A 3VWUA 1TP9A 2JADA 2NVLA 2VL3A 3NZNA 3ERFA 3FR3A 3CSJA 1S3AA 3EINA 3HXSA 4MPGA 2C80A 2MMOA 3UARA 2CX3A 1A0FA 4KDXA 5B8AA 1YDKA 3RHBA 2H8LA 1HQOA 4YQMA 1EOGA 3BCIA 5ECNB 1USBA 4AJ8A 1ML6A 4H86A 2MMNA 2HI7A 2L4QA 1RW1A 2FWHA 4ECJA 5ECLB 1HNAA 4K7NA 4NHZA 3HA9A 5DAKB 5ECOB 1FHEA 5G1KA 4X0XA 1WPIA 2V1MA 2I3YA 2R5GA 5KEJA 2CAQA 3TRPA 1A8LA 5J9BA 1OKTA 1S3DA 1BEDA 4RQRA 1XIYA 3HVXA 1WJKA 2IMKA 2VCWA 2H72A 3CSIA 2MBSA 3HDCA 4X1UA 1VF4A 2HNLA 3UMAA 4TXVA 2K18A 3W6GA 1EP7A 1FAAA 5B6NA 3LEFA 2HRNA 4LA1A 5HR0A 1X5EA 2GZZA 2X8CA 2WZ9A 4N30A 1TRSA 3IXRA 2DJJA 4CDOA 4K8MA 4YAVA 4Q5QA 3H1NA 1PQNA 1IYIA 1SD9A 3U6VA 4MZBA 1B8XA 4L0WA 1V57A 1AUCA 16GSA 2YJ7A 1WP0A 1GSDA 3FZ4A 4QQ7A 1NHOA 1XOAA 3TJFA 3EU4A 2FD3A 1XOBA 5KN1A 3GRXA 2GGTA 2CVBA 3F0IA 5ECKB 2LKUA 4NHWA 4ZB8A 1T4YA 6GSTA 13GSA 2VL2C 1YF1A 3E0UA 2X8GA 4EO3A 4AF2A 6GSXA 2AJQB 2R4VA 4KSMA 2YCDA 1B48A 2WFCA 3IR4A 4GF0A 2GZYA 1QK8A 3KH7A 1TI1A 5IMDA 3GKKA 4FYUA 5ECRB 1WE0A 2DJ2A 3Q19A 1G6YA 5JCGA 2C3QA 4D73B 2DMLA 1JZRA 2AHEA 4JRRA 1PX6A 5CRHA 2AV4A 4FYCA 5H5SA 5ECQB 5GSTA 3G7JA 2IFQA 4HQSA 3IK7A 2Z9SA 3N9JA 3GSSA 1G0TA 5D9WA 1R5AA 4ID0A 4ZXGA 3KM6A 1Z6MA 1AQXA 3PINA 4ZL7A 2DSAA 3HCZA 1ILOA 3J7Yb 2O87A 5HQPA 4O32A 5JCWA 2H1AA 1J08A 3LYKA 3KTBA 4WR5A 1Y25A 2G0FA 4MMMA 3TJJA 3TOUA 2K9FA 1EZKA 2VCVA 3I43A 5G5EA 3DKSA 2E2MA 3C7MA 4DSQA 3EVIA 2M80A 2FGXA 1UC7A 3D6IA 1KEBA 1TXXA 3FZAA 3VWXA 5IM9A 1PA3A 1SKWB 2B1KA 1RQMA 1GSFA 2PWJA 3QD9A 1GSEA 2P31A 2X8HA 1XFLA 2E0QA 4CW9A 2HZFA 2CV4A 2DIZA 1ZZYA 3V1WA 1K0BA 3F6DA 4POKA 1BQ7A 1GULA 3TB2A 3M8NA 2CQ9A 3ZIVA 3QR6A 3TKSC 2H01A 1K0MA 2GQLA 4F2IA 5INYA 2MMAA 2MYGA 5HFIA 1Q4JA 4IVFA 2E2GA 3UAPA 1BG5A 1XWBA 5A4VA 3FEUA 1EGOA 4NPBA 4PUAA 1KBNA 2PERA 3OR5A 4ML6A 5ELGA 1T8EB 4L0UA 4BPYA 4WXTA 3WGEA 2A4VA 4MJCA 2BMXA 2J23A 5LD0A 3L4NA 4TVEA 4GXZA 4TR1A 3HJPA 4GSTA 2RUFA 5J3RA 4KAEA 4PX1A 1AAZA 2H70A 4AGSA 5ID2A 4OWYA 1T3BA 4TOPA 1EV9A 2BJXA 1EEJA 3HVSA 1PGTA 3G7YA 3GX8A 2HSYA 3KMOA 5AIVA 2N5FA 2TRCP 4XRDA 5CRWA 2AB6A 2ON7A 3F6FA 2IMIA 4ZB6A 3CSHA 3GHAA 3LGCA 3DMLA 1TK8B 5H5QA 1XW9A 4BVYA 1JZWA 3F8UA 1DE2A 3FRCA 3GH6A 1BX9A 5E59A 4G9HA 5ECIB 5COHA 5ECMB 3RAZA 3VPQA 3R2QA 4EUYA 3HZ4A 2FA8A 1OC8A 3A2WA 2H76A 3ZLPA 1PN9A 2HLSA 1F2EA 3K8NA 1T1VA 3EMPA 2OKAA 1I5GA 1KTEA 1YEPA 11GSA 1XPVA 4WF5A 3VLNA 1GH2A 1GUMA 1O85A 2IIYA 1K3LA 3MNGA 1ZOFA 5CO3A 3LYPA 3ME7A 2A2RA 5F05A 14GSA 4NMUA 5G1LA 2CZ2A 2OACA 2YWMA 3DVWA 1ZL9A 5FHIA 3TRXA 1LBKA 3IHQA 2F9SA 2ES7A 3ZFBA 3RBTA 1HNCA 3O6TA 3GURA 2CVKA 3C71A 1ERVA 2LUSA 2QC7A 2K8SA 3GMFA 3LXTA 4V2MA 1C72A 2PN8A 5DALA 4MK3A 2GQKA 4WEYA 1GTAA 4YQUA 4DSSB 1T00A 2MBTA 2V32A 2YANA 4HJ2A 2J9HA 2H0IA 2LJAA 1SL0B 1U87A 1OC9A 3ME8A 2V6OA 1RK4A 2EC4A 1JHBA 3DGQA 1ZGNA 3F4RA 5AIXA 1QGVA 4PQHA 2YJHA 4NWYA 2FLSA 2VUPA 4WR4A 3TKSE 1VF3A 5HFGA 2K6VA 4ULXA 2HSHA 1K0DA 4Q5RA 1V58A 1M9BA 3HJOA 2VCTA 3CBUA 2CX4A 2HFDA 2VD0A 4OFNA 3ZVJA 1UVZA 3NIVA 5KN0A 4HI7A 1SJIA 3IPZA 1DE1A 5ECSA 2FNOA 1PKZA 4KE3A 5H5RA 6GSWA 2C3TA 1XWCA 3GTUB 5ECHB 2B5XA 1SKRB 4CHSA 1MDJA 4MP4A 4I2TA 1SL2B 3ZIJA 1X0RA 1PD21 4MF7A 4KGIA 2LEGA 1S3CA 2RIIA 3FW2A 3UEMA 5C04A 4ML1A 1SKSB 4NV5A 2M72A 2EIOA 3KP8A 2C8UA 5DBQA 4DEJA 2DMMA 3TJGA 3M1GA 4IHUA 2QSIA 4ECIA 1FG4A 3P2AA 3TUEA 1Z9HA 3L9VA 4MABA 4IN0A 3GL5A 2CT6A 2F51A 4OD7A
chains in the Genus database with same CATH superfamily
5CAXA 5E4WA 4GQFA 3LFLA 5AN1A 4AJ7A 1YZXA 4GQCA 2IN3A 1DUGA 1FB0A 5IO2A 2ZNMA 2ON5A 2X99A 2VLTA 1NM3A 4MJBA 1GTUA 3CTGA 4KW6A 3KTLA 5CNWA 5IQYA 2OJLA 2KOKA 2PMTA 5F06A 2DKHA 3D21A 3KMNA 3LJRA 4OFTA 2LNTA 2FWFA 2L6DA 1FB6A 4ISDA 1YF0A 3ZTLA 3US3A 2JU5A 1K3OA 3Q74A 1QMVA 3WT2A 1TW9A 3M9JA 3HJMA 4KUNA 1ZYNA 4G0LA 3KJYA 4WF4A 3A5WA 1B4PA 3GX0A 2JZTA 8GSSA 4ILFA 3G9BA 5D9TA 4E8HA 5IMFA 1N8JA 2VLUA 2JSYA 3LSZA 3VFIA 1GSYA 2V6KA 1GRXA 3A3TA 3TOTA 1O73A 1AXDA 1F37A 1THOA 3UOMA 2AUVA 2GVPA 1G7EA 2P0GA 20GSA 4PNGA 7GSSA 1THXA 2H1GA 2X49A 4K5RA 5CRDA 4MJEA 1XCCA 3VK9A 4NAXA 2R6KA 2WJUA 3GFKA 4V2NA 4N0ZA 1V9WA 4MDCA 1VF1A 1NHYA 1X9MB 2R0GA 2YPMA 5D93A 3M3MA 1AQWA 4HQZA 2WRTA 2HRFA 3QFAC 1M2AA 1MD3A 5EPFA 1H75A 6GSVA 3CRTA 2H75A 1FOVA 4POMA 1GUKA 3I69A 4MCUA 4Z2TA 4ICYA 1URMA 4J57E 3ISOA 9GSSA 1O8WA 2F3MA 1GSUA 1PX7A 3LXZA 3DD3A 4YH2A 3KZQA 1FOHA 4ECCA 1TK0B 4FO5A 2H71A 1YEXA 2VCQA 4X43A 2C3NA 5F8BA 5EL8A 1TI3A 2GSSA 4XS4B 4K1FA 3D0ZA 1XVQA 2YNXA 2H66A 4MJAA 5A4UA 1SU9A 2AAWA 3GKNA 2B5YA 1MEKA 4I2UA 4MH3A 2KP2A 5IIZA 4FH8A 3S9FA 3LORA 2O85A 19GSA 3HHVA 3QMXA 1JLVA 5CP1A 2YZHA 2XHFA 2HZEA 4G19A 2OBIA 1HYUA 1XG8A 2A2SA 4YAPA 3MDKA 1TU8A 1GUHA 4I5QA 4RI7A 3A2XA 1XBSA 4JE1A 4LMVA 3F4SA 3VWWA 4FQUA 2VL9A 1R4WA 3TCOA 1UN2A 4TR4A 1PRXA 5KN3A 4K2DA 1DSBA 2VCZA 1JZDA 4WBRD 2IMEA 3IOSA 1FO5A 3F4TA 5C00A 2H30A 3FZ9A 5B6MA 4I6XA 3QAGA 4KDYA 2DJ0A 3QDNA 4PGTA 5CREA 1ABAA 1XXUA 4G0IA 1GNEA 1TRVA 3GNJA 4JZQA 1YY7A 3GL3A 2DJ3A 4KNDA 2JL4A 4MLYA 4KCEA 5IMVA 5KN2A 5CRGA 3UBLA 3P8WA 1F9MA 5J41A 5JCUA 1IYHA 5GSSA 3O76A 3DIEA 1ZYEA 4JEDA 3UVTA 4I8BA 4N11A 2H73A 4XTSA 1M2DA 3WGXA 3QOUA 2OE3A 4K7OA 1VGLA 2LTKA 1ZCPA 2VL2A 2DC5A 5G30A 2L6CA 2VOCA 17GSA 1SENA 4K9ZA 3WT1A 1WOUA 3VPTA 5A5KA 1MDIA 1F6MC 2KUCA 2B7KA 2H6XA 3EPTA 4E8EA 3RPNA 1PKWA 3VI5A 1GWCA 4IKHA 3AY8A 4XIHA 3CMIA 4MF6A 2IFQB 2LRNA 1W89A 5HR1A 1J9BA 4TXOA 4AJ6A 2HE3A 4ZB9A 4HEA2 3CTFA 4XS6A 4HS1A 2B3SA 4QL7A 2DBCA 4XCSA 4FIWA 3ZREA 4BA7A 1OVNA 4PUFC 3G7IA 3KCMA 2OE0A 2B6MA 4TRXA 1X5DA 2GSRA 3QAVA 5IO0A 1TTZA 3QPMA 1K3YA 1XWAA 4PXOA 4ECBA 4F03A 2C4JA 4NXIA 2PGTA 4GWRA 3R3EA 3ZL5A 3QCPA 4OCFA 2GDRA 4KH7A 4L8EA 1B9YC 2O7KA 3EC3A 4MH2A 3GKMA 2YWOA 3QAWA 5JWOB 1TKDB 3ZZXA 5D73A 1TRWA 2KHPA 2H1BA 1QQ2A 2WCIA 3ZYWA 2DJ1A 4YQVA 2LRTA 2LRCA 4FYBA 5D8IA 1ZYQB 1JFUA 2L59A 3PGTA 5IOWA 4JU5A 4HDEA 3BBYA 3MAKA 2FHEA 2GLRA 3UL3A 2B1LA 1E2YA 2PPTA 3TKRA 3C8EA 3HKRA 3TKSA 1NW2A 5GAND 3APQA 4KB3A 5KOWA 3A2VA 1ZYPA 4GTUA 4NV2A 2GS3A 4Q5NA 2L5OA 5LNKe 3SWLA 1V40A 1WRYA 4TR1B 5A4WA 3KD0A 2R0CA 2LQQA 2NDOA 1G6WA 1XVWA 3H8QA 2NBSA 1O6JA 3ZMKA 2LS5A 5ID2B 2F8FA 2C0EA 3FKFA 6GSYA 4POBA 4IP1A 4O7HA 2VAFA 4EF0A 4OMVA 2NPBA 1YKCA 1DBYA 4BWQA 4OFMA 4O5UA 4HU9A 3IC4A 5IMAA 3HZ8A 3GYKA 2YZUA 5DAKA 5ECPB 1PL2A 1VF2A 3CXGA 1GP1A 3TJBA 4BVYB 4EL1A 2NTOA 1PFOA 3GA4A 1Z7RA 2VCXA 3WD6A 2PU9C 1OAZA 4DVCA 1G7OA 4GSSA 3ZMLA 2VM2A 4MZCA 1GL8A 3O3TA 1ERTA 3JCML 1YKAA 2IMDA 4PTSA 3DRNA 3Q18A 2FWEA 1EV4A 1TU7A 2ZCTA 1BYEA 4V1Ag 1MTCA 2K8VA 4GRFA 4KCAA 2H1DA 1F3BA 1M2BA 2R3XA 2PUKC 5DCGA 3MSZA 3F63A 2GZPA 2CA8A 4JR6A 2KP1A 5HR2A 1EEMA 2YN1A 1ACVA 4V2LA 1LU4A 2I81A 4RUVA 3Q6OA 4G10A 1SYXA 4V1Ap 18GSA 3W8SA 4MZWA 2IWTA 4USSA 2FY6A 3IBHA 4IQAA 2DKIA 2O8VB 3H79A 3VURA 1H4OA 3DWVA 1B9XC 1M9AA 1A2JA 2QGVA 2A4HA 5FT3A 3GN3A 3GH9A 4IELA 3D22A 2WULA 2JACA 3QFBC 4EIQA 2WS2A 5DALB 1M99A 3TKPA 4EDZA 4OO4A 2IL3A 1XWGA 1PN0A 2EIRA 1F3AA 2GT6A 4MA9A 4O5QA 3IV4A 1OC9B 2FWGA 1PMTA 4GSNA 2REMA 4D73A 2MZCA 4Q5FA 4XS4A 1NSWA 1B4QA 4LMWA 4WKWA 1SK0A 5IPHA 2DIYA 2VD1A 3I6AA 3E3EA 3WGDA 2IMFA 3KH9A 4OO5A 4X4JA 4HUAA 2L5LA 1A8YA 1U3AA 2PVQA 3M0FA 3U5RE 5JWRB 2VLVA 5J5NA 5DDLA 1FVKA 4K2XA 1UA5A 3N5OA 1GLPA 3GKXA 1K0NA 1EGRA 2LJKA 4L5LA 4O5RA 1TJDA 1U6TA 4G2EA 4WETA 5FWGA 3IAS2 1GNWA 2L4CA 5AGYA 3TRQA 5DCHA 3CYNA 3D4TA 4IJ3A 2F8AA 4F82A 1U3IA 3RDWA 4HOJA 2JZSA 3CQFA 2HT9A 2WDUA 2YWIA 4KDUA 3L78A 4J56E 4JBBA 1GTBA 4LLRA 22GSA 2P5QA 4KSOA 4ACSA 1BAYA 3TDGA 2MMZA 5JWQB 4O92A 2OE1A 1A2LA 1Z5YE 3PPUA 1AQVA 1O8XA 2P5RA 3BD2A 2I9HA 2XPDA 4K6XA 5ENUA 3DXBA 3LWAA 2G2QA 3ERGA 1WWJA 4P3YB 3C1SA 1XW5A 2YV9A 2H6ZA 5LCZA 1V98A 4TR3A 5B7CA 4EXJA 2FUG2 2YP6A 1OYJA 2L57A 1I9DA 1WIKA 4HZ2A 4Z7XA 4CY8A 5F07A 2OADA 1M7TA 3EU3A 6GSUA 1BJXA 5DJLA 4JR4A 1WMJA 3L9SA 4I97A 5B8BA 3WYWA 3APSA 5IOXA 1SD8A 1R7HA 2JSZA 3UIWA 1V2AA 5GAPD 5HFKA 2ALBA 1O81A 1E6BA 1MDKA 2IPAA 4PQIA 3FR9A 3CRUA 4GLTA 4EDYA 2AYTA 1ERUA 12GSA 10GSA 5ELAA 4EKZA 3EWLA 3KP9A 5J4UA 5G2ZA 2B5EA 5KOXA 2E7PA 3PR8A 3KIJA 1ST9A 5DJMA 3HD5A 3HVNA 2C0GA 1HD2A 3IE3A 1VRSD 3ZITA 2FA4A 4RQXA 3EYTA 3MYDA 3RPPA 5G5FA 2CVDA 5HR3A 2O89A 2DLXA 2QA1A 3DEXA 4BL7A 3EE2A 2RM6A 2GT5A 3FMWA 5D9XA 1X9WB 4XS1A 3D4MA 2R37A 2VO4A 2GSQA 2FCHA 1R26A 6GSSA 3KGKA 1K0CA 3VI7A 4TW5A 4K0NA 1TRUA 1AIUA 1Z7PA 1K0AA 3ZRDA 1ERWA 1TOFA 3NOFA 2B7JA 2QKEA 4BWSA 2QA2A 1FVJA 1GLQA 4N0VA 1J0FA 1XZOA 2GQMA 4L5OA 4K0GA 3F9UA 5DQSA 2RUEA 2VM1A 3GIXA 2GSTA 1R5PA 1OKDA 5BRTA 4IBPA 1LJRA 2GTUA 1QUWA 1SK1A 1Z6NA 2LNSA 5DQYA 1FW1A 2TIRA 3FR6A 4N10A 3HVVA 1CQGA 3UBKA 2PBJA 1GSSA 4MF5A 1OE7A 4ZBDA 1Y6EA 4K7IA 1T7PB 1Q98A 1HNBA 3ERWA 1SJZA 2H0GA 3ZVJD 1XW6A 4WBJA 2M46A 3L9UA 3IRAA 2R2JA 3TKQA 5CYYA 3I9V2 4KX4A 1XWKA 4LL1B 1U88A 3C73A 2CZ3A 4DSSA 3TJKA 1TK5B 3TGZA 3IK9A 2A2PA 4A5PA 1W4VA 2HZEB 2TRXA 3FY7A 3BOAA 5F0GA 4CY6A 1A24A 3IA1A 3P7XA 4TKYA 2H6YA 4MPFA 4ZBBA 1X5CA 2N5BA 3RHCA 5DVBA 2LJRA 3L0HA 4J2FA 4YKGA 2I4AA 5EVOA 3W8JA 1PL1A 3GSTA 1SL1B 4IP6A 1AC1A 5D96A 3E9JB 2KLXA 1KNGA 1TDIA 3BCKA 3UJ1A 3H93A 3F3QA 4KA0A 4F9ZA 3FYGA 4EC0A 4PNFA 1SK2A 4PURA 3GUSA 4BVXA 4RI6A 1EP8A 1QFNA 3FHKA 2XBQA 5J9CA 1Z3EA 2RM5A 3LQ7A 3GTUA 3ED3A 2YWNA 3VWVA 4LL4B 4HJMA 1N2AA 1YJ6A 2BTOT 4EVMA 3KXOA 4KF9A 4ZL9A 5IMZA 4IGJA 2H74A 3F3RA 4HZ4A 3BJ5A 1GTIA 1PSQA 2C0FA 5IMCA 4DSRA 4TR0A 4ZL8A 1EOHA 4ZBAA 2DJKA 2CAIA 4HU7A 2JZRA 3LW9A 4TN8A 4PQ1A 3D5JA 3PH9A 3ZFLA 3IDVA 1K0OA 2C1YA 2V41A 4IW9A 3M9KA 1M0UA 3J7Yk 3SBCA 2D2ZA 1OE8A 2PVOC 2XPEA 2RLIA 1ZMAA 2EIQA 1MD4A 5EY6A 1AW9A 4XHMA 3EMXA 5L71A 4MNNA 4ZILA 2WB9A 1EWXA 4TXOB 3APOA 5D9VA 2H0HA 5G31A 4IQ1A 4OCEA 2C0DA 3C1RA 3KEBA 1QXHA 3FK8A 2HSMA 2IJYA 2HYXA 1X9SB 2ZUPA 1JLWA 4POLA 4GCIA 1A23A 2LQOA 3GV1A 1T4ZA 2VIMA 4F0CA 4XRAA 3DYRA 2N5AA 5ABRA 2OBKA 4IJIA 2WGRA 3MWHA 2V2GA 3A5IA 1ON4A 5AISA 3EURA 1GSQA 1O7UA 1A0RP 3P90A 1SJ6A 3HYPA 3FZ5A 4EE0A 3HY2A 3IAM2 2I1UA 2YOIA 3DVXA 1OC3A 2OA7A 2HXKA 5GZZB 4F0BA 1SYRA 3LG6A 5IPGA 2XBIA 1A2MA 4IS0A 3H4KA 2XC2A 4ZIJA 2YV7A 3UVHA 2LSTA 1CQHA 1YQ1A 4QL9A 1JZOA 2H19A 2X64A 2LV3A 3VWUA 1TP9A 2JADA 2NVLA 2VL3A 3NZNA 3ERFA 3FR3A 3CSJA 1S3AA 3EINA 3HXSA 4MPGA 2C80A 2MMOA 3UARA 2CX3A 1A0FA 4KDXA 5B8AA 1YDKA 3RHBA 2H8LA 1HQOA 4YQMA 1EOGA 3BCIA 3MIXA 1USBA 5ECNB 4AJ8A 1ML6A 4H86A 2MMNA 2HI7A 2L4QA 1RW1A 2FWHA 4ECJA 5ECLB 1HNAA 4K7NA 4NHZA 3HA9A 5DAKB 5ECOB 1FHEA 5G1KA 4X0XA 1WPIA 2V1MA 2I3YA 2R5GA 5KEJA 2CAQA 3TRPA 1A8LA 5J9BA 1OKTA 1S3DA 1BEDA 1M3IA 1XIYA 3HVXA 4RQRA 1WJKA 2IMKA 2VCWA 2H72A 3CSIA 2MBSA 3HDCA 4HSCX 4X1UA 1VF4A 2HNLA 3UMAA 4TXVA 2K18A 3W6GA 1EP7A 1FAAA 5B6NA 3LEFA 2HRNA 4LA1A 5HR0A 1X5EA 2GZZA 2X8CA 2WZ9A 4N30A 1TRSA 3IXRA 2DJJA 4CDOA 4K8MA 4YAVA 4Q5QA 4G0KA 2HRKA 3H1NA 1PQNA 1IYIA 1SD9A 3U6VA 4MZBA 1B8XA 4L0WA 1V57A 1AUCA 16GSA 2YJ7A 1WP0A 1GSDA 3FZ4A 4QQ7A 4EIPA 1NHOA 1XOAA 3TJFA 3EU4A 2FD3A 1XOBA 5KN1A 3GRXA 2GGTA 2CVBA 3F0IA 5ECKB 2LKUA 4NHWA 4ZB8A 1T4YA 6GSTA 1M3JA 13GSA 2VL2C 1YF1A 3E0UA 2X8GA 4EO3A 4AF2A 6GSXA 2AJQB 3IC8A 2R4VA 4KSMA 2YCDA 1B48A 2WFCA 3IR4A 4GF0A 2GZYA 1QK8A 3KH7A 1TI1A 5IMDA 2R0PA 3GKKA 4FYUA 5ECRB 1WE0A 2DJ2A 3IHGA 3Q19A 1G6YA 5JCGA 2C3QA 4D73B 2DMLA 4K5SA 1JZRA 2AHEA 4JRRA 1PX6A 5CRHA 2AV4A 4FYCA 5H5SA 5ECQB 5GSTA 3G7JA 2IFQA 4HQSA 3IK7A 2Z9SA 3N9JA 3GSSA 1G0TA 5D9WA 1R5AA 2X4AA 4ID0A 4ZXGA 3KM6A 2UZ8A 1Z6MA 1AQXA 3PINA 4ZL7A 2DSAA 3HCZA 1ILOA 3J7Yb 2O87A 5HQPA 4O32A 5JCWA 2H1AA 1J08A 3LYKA 3KTBA 4WR5A 1Y25A 2G0FA 4MMMA 3TJJA 3TOUA 2K9FA 1EZKA 2VCVA 3I43A 5G5EA 3DKSA 2E2MA 3C7MA 4DSQA 3EVIA 2M80A 2FGXA 1UC7A 3D6IA 1KEBA 1TXXA 3FZAA 3VWXA 5IM9A 1PA3A 1SKWB 2B1KA 1RQMA 1GSFA 2PWJA 3QD9A 1GSEA 2P31A 2X8HA 1XFLA 2E0QA 4CW9A 2HZFA 2CV4A 2DIZA 1ZZYA 3V1WA 1K0BA 3F6DA 4POKA 1BQ7A 1GULA 3TB2A 3M8NA 4Z2UA 2CQ9A 3ZIVA 3QR6A 3TKSC 2H01A 1K0MA 2GQLA 4F2IA 5INYA 2MMAA 2MYGA 5HFIA 1Q4JA 4IVFA 2E2GA 3UAPA 1BG5A 1XWBA 5A4VA 3FEUA 1EGOA 4NPBA 4PUAA 1KBNA 2PERA 3OR5A 4ML6A 5ELGA 1T8EB 4L0UA 4BPYA 4WXTA 3WGEA 2A4VA 4MJCA 2BMXA 2J23A 5LD0A 3L4NA 4TVEA 4GXZA 4TR1A 3HJPA 4GSTA 2RUFA 5J3RA 4KAEA 4PX1A 1AAZA 2H70A 4AGSA 5ID2A 4OWYA 1T3BA 4TOPA 1EV9A 2BJXA 1EEJA 3HVSA 1PGTA 3G7YA 3GX8A 2HSYA 3KMOA 5AIVA 2N5FA 2TRCP 4XRDA 5CRWA 2AB6A 2ON7A 3F6FA 2IMIA 4ZB6A 3CSHA 4BIKA 3GHAA 3LGCA 3DMLA 5BMUA 1TK8B 5H5QA 1XW9A 4BVYA 1JZWA 3F8UA 1DE2A 3FRCA 3GH6A 1BX9A 5E59A 4G9HA 4BL7B 5ECIB 5COHA 5ECMB 3RAZA 3VPQA 3R2QA 4EUYA 3HZ4A 2FA8A 1OC8A 3A2WA 2H76A 3ZLPA 1PN9A 2HLSA 2HRAA 1F2EA 3K8NA 1T1VA 3EMPA 2OKAA 1I5GA 1KTEA 1YEPA 11GSA 1XPVA 4YKFA 4WF5A 3VLNA 1GH2A 1GUMA 1O85A 2IIYA 1K3LA 3MNGA 1ZOFA 5CO3A 3LYPA 3ME7A 2A2RA 5F05A 14GSA 4NMUA 5G1LA 2CZ2A 2OACA 1S3RA 2YWMA 3DVWA 1ZL9A 5FHIA 3TRXA 1LBKA 3IHQA 2F9SA 2ES7A 3ZFBA 3RBTA 1HNCA 3O6TA 3GURA 2CVKA 3C71A 1ERVA 2LUSA 2QC7A 2K8SA 3GMFA 3LXTA 4V2MA 1C72A 2PN8A 5DALA 4MK3A 2GQKA 4WEYA 1GTAA 4YQUA 4DSSB 1T00A 2MBTA 2V32A 2YANA 4HJ2A 2J9HA 2H0IA 2LJAA 1SL0B 1U87A 1OC9A 3ME8A 2V6OA 1RK4A 2EC4A 1JHBA 3DGQA 1ZGNA 3F4RA 5AIXA 1QGVA 4PQHA 2YJHA 4NWYA 2FLSA 2VUPA 4WR4A 3TKSE 1VF3A 5HFGA 2K6VA 4ULXA 2HSHA 1K0DA 4Q5RA 1V58A 1M9BA 3HJOA 2VCTA 3CBUA 2CX4A 2HFDA 2VD0A 4OFNA 3ZVJA 1UVZA 3NIVA 5KN0A 4HI7A 1SJIA 3IPZA 1DE1A 5ECSA 4BVXB 2FNOA 1PKZA 4KE3A 5H5RA 6GSWA 2C3TA 1XWCA 3GTUB 5ECHB 2B5XA 1SKRB 4CHSA 1MDJA 4MP4A 4I2TA 1SL2B 3ZIJA 1X0RA 1PD21 4MF7A 4KGIA 2LEGA 1S3CA 2RIIA 3FW2A 3UEMA 5C04A 4ML1A 1SKSB 4NV5A 2M72A 4Z2RA 2EIOA 3KP8A 2C8UA 5DBQA 4DEJA 2DMMA 3TJGA 3M1GA 4IHUA 2QSIA 4ECIA 1FG4A 3P2AA 3TUEA 1Z9HA 3L9VA 4MABA 4IN0A 3GL5A 2CT6A 2F51A 4OD7A
chains in the Genus database with same CATH topology
5CAXA 5E4WA 4GQFA 3LFLA 5AN1A 4AJ7A 1YZXA 4GQCA 2IN3A 1DUGA 1FB0A 5IO2A 2ZNMA 2ON5A 2X99A 2VLTA 1NM3A 4MJBA 1GTUA 3CTGA 4KW6A 3KTLA 5CNWA 5IQYA 2OJLA 2KOKA 2PMTA 5F06A 2DKHA 3D21A 3KMNA 3LJRA 4OFTA 2LNTA 2FWFA 2L6DA 1FB6A 4ISDA 1YF0A 3ZTLA 3US3A 2JU5A 1K3OA 3Q74A 1QMVA 3WT2A 1TW9A 3M9JA 3HJMA 4KUNA 1ZYNA 4G0LA 3KJYA 4WF4A 3A5WA 1B4PA 3GX0A 2JZTA 8GSSA 4ILFA 3G9BA 5D9TA 4E8HA 5IMFA 1N8JA 2VLUA 2JSYA 3LSZA 3VFIA 1GSYA 2V6KA 1GRXA 3A3TA 3TOTA 1O73A 1AXDA 1F37A 1THOA 3UOMA 2AUVA 2GVPA 1G7EA 2P0GA 20GSA 4PNGA 7GSSA 1THXA 2H1GA 2X49A 4K5RA 5CRDA 4MJEA 1XCCA 3VK9A 4NAXA 2R6KA 2WJUA 3GFKA 4V2NA 4N0ZA 1V9WA 4MDCA 1VF1A 1NHYA 1X9MB 2R0GA 2YPMA 5D93A 3M3MA 1AQWA 4HQZA 2WRTA 2HRFA 3QFAC 1M2AA 1MD3A 5EPFA 1H75A 6GSVA 3CRTA 2H75A 1FOVA 4POMA 1GUKA 3I69A 4MCUA 4Z2TA 4ICYA 1URMA 4J57E 3ISOA 9GSSA 1O8WA 2F3MA 1GSUA 1PX7A 3LXZA 3DD3A 4YH2A 3KZQA 1FOHA 4ECCA 1TK0B 4FO5A 2H71A 1YEXA 2VCQA 4X43A 2C3NA 5F8BA 5EL8A 1TI3A 2GSSA 4XS4B 4K1FA 3D0ZA 1XVQA 2YNXA 2H66A 4MJAA 5A4UA 1SU9A 2AAWA 3GKNA 2B5YA 1MEKA 4I2UA 4MH3A 2KP2A 5IIZA 4FH8A 3S9FA 3LORA 2O85A 19GSA 3HHVA 3QMXA 1JLVA 5CP1A 2YZHA 2XHFA 2HZEA 4G19A 2OBIA 1HYUA 2A2SA 4YAPA 3MDKA 1TU8A 1GUHA 4I5QA 4RI7A 3A2XA 1XBSA 4JE1A 4LMVA 3F4SA 3VWWA 4FQUA 2VL9A 1R4WA 3TCOA 1UN2A 4TR4A 1PRXA 5KN3A 4K2DA 1DSBA 2VCZA 1JZDA 4WBRD 2IMEA 3IOSA 1FO5A 3F4TA 5C00A 2H30A 3FZ9A 5B6MA 4I6XA 3QAGA 4KDYA 2DJ0A 3QDNA 4PGTA 5CREA 1ABAA 1XXUA 4G0IA 1GNEA 1TRVA 3GNJA 4JZQA 1YY7A 3GL3A 2DJ3A 4KNDA 2JL4A 4MLYA 4KCEA 5IMVA 5KN2A 5CRGA 3UBLA 3P8WA 1F9MA 5J41A 5JCUA 1IYHA 5GSSA 3O76A 3DIEA 1ZYEA 4JEDA 3UVTA 4I8BA 4N11A 2H73A 4XTSA 1M2DA 3WGXA 3QOUA 2OE3A 4K7OA 1VGLA 2LTKA 1ZCPA 2VL2A 2DC5A 5G30A 2L6CA 2VOCA 17GSA 1SENA 4K9ZA 3WT1A 1WOUA 3VPTA 5A5KA 1MDIA 1F6MC 2KUCA 2B7KA 2H6XA 3EPTA 4E8EA 3RPNA 1PKWA 3VI5A 1GWCA 4IKHA 3AY8A 4XIHA 3CMIA 4MF6A 2IFQB 2LRNA 1W89A 5HR1A 1J9BA 4TXOA 4AJ6A 2HE3A 4ZB9A 4HEA2 3CTFA 4XS6A 4HS1A 2B3SA 4QL7A 2DBCA 4XCSA 4FIWA 3ZREA 4BA7A 1OVNA 4PUFC 3G7IA 3KCMA 2OE0A 2B6MA 4TRXA 1X5DA 2GSRA 3QAVA 5IO0A 1TTZA 3QPMA 1K3YA 1XWAA 4PXOA 4ECBA 4F03A 2C4JA 4NXIA 2PGTA 4GWRA 3R3EA 3ZL5A 3QCPA 4OCFA 2GDRA 4KH7A 4L8EA 1B9YC 2O7KA 3EC3A 4MH2A 3GKMA 2YWOA 3QAWA 5JWOB 1TKDB 3ZZXA 5D73A 1TRWA 2KHPA 2H1BA 1QQ2A 2WCIA 3ZYWA 2DJ1A 4YQVA 2LRTA 2LRCA 4FYBA 5D8IA 1ZYQB 1JFUA 2L59A 3PGTA 5IOWA 4JU5A 4HDEA 3BBYA 3MAKA 2FHEA 2GLRA 3UL3A 2B1LA 1E2YA 2PPTA 3TKRA 3C8EA 3HKRA 3TKSA 1NW2A 5GAND 3APQA 4KB3A 5KOWA 3A2VA 1ZYPA 4GTUA 4NV2A 2GS3A 4Q5NA 2L5OA 5LNKe 3SWLA 1V40A 1WRYA 4TR1B 5A4WA 3KD0A 2R0CA 2LQQA 2NDOA 1G6WA 1XVWA 3H8QA 2NBSA 1O6JA 3ZMKA 2LS5A 5ID2B 2F8FA 2C0EA 3FKFA 6GSYA 4POBA 4IP1A 4O7HA 2VAFA 4EF0A 4OMVA 2NPBA 1YKCA 1DBYA 4BWQA 4OFMA 4O5UA 4HU9A 3IC4A 5IMAA 3HZ8A 3GYKA 2YZUA 5DAKA 5ECPB 1PL2A 1VF2A 3CXGA 1GP1A 3TJBA 4BVYB 4EL1A 2NTOA 3GA4A 1Z7RA 2VCXA 3WD6A 2PU9C 1OAZA 4DVCA 1G7OA 4GSSA 3ZMLA 2VM2A 4MZCA 1GL8A 3O3TA 1ERTA 3JCML 1YKAA 2IMDA 4PTSA 3DRNA 3Q18A 2FWEA 1EV4A 1TU7A 2ZCTA 1BYEA 4V1Ag 1MTCA 2K8VA 4GRFA 4KCAA 2H1DA 1F3BA 1M2BA 2R3XA 2PUKC 5DCGA 3MSZA 3F63A 2GZPA 2CA8A 4JR6A 2KP1A 5HR2A 1EEMA 2YN1A 1ACVA 4V2LA 1LU4A 2I81A 4RUVA 3Q6OA 4G10A 1SYXA 4V1Ap 18GSA 3W8SA 4MZWA 2IWTA 4USSA 2FY6A 3IBHA 4IQAA 2DKIA 2O8VB 3H79A 3VURA 1H4OA 3DWVA 1B9XC 1M9AA 1A2JA 2QGVA 2A4HA 5FT3A 3GN3A 3GH9A 4IELA 3D22A 2WULA 2JACA 3QFBC 4EIQA 2WS2A 5DALB 1M99A 3TKPA 4EDZA 4OO4A 2IL3A 1XWGA 1PN0A 2EIRA 1F3AA 2GT6A 4MA9A 4O5QA 3IV4A 1OC9B 2FWGA 1PMTA 4GSNA 2REMA 4D73A 2MZCA 4Q5FA 4XS4A 1NSWA 1B4QA 4LMWA 4WKWA 1SK0A 5IPHA 2DIYA 2VD1A 3I6AA 3E3EA 3WGDA 2IMFA 3KH9A 4OO5A 4X4JA 4HUAA 2L5LA 1A8YA 1U3AA 2PVQA 3M0FA 3U5RE 5JWRB 2VLVA 5J5NA 5DDLA 1FVKA 4K2XA 1UA5A 3N5OA 1GLPA 3GKXA 1K0NA 1EGRA 2LJKA 4L5LA 4O5RA 1TJDA 1U6TA 4G2EA 4WETA 5FWGA 3IAS2 1GNWA 2L4CA 5AGYA 3TRQA 5DCHA 3CYNA 3D4TA 4IJ3A 2F8AA 4F82A 1U3IA 3RDWA 4HOJA 2JZSA 2HT9A 2WDUA 2YWIA 4KDUA 3L78A 4J56E 4JBBA 1GTBA 4LLRA 22GSA 2P5QA 4KSOA 4ACSA 1BAYA 3TDGA 2MMZA 5JWQB 4O92A 2OE1A 1A2LA 1Z5YE 3PPUA 1AQVA 1O8XA 2P5RA 3BD2A 2I9HA 2XPDA 4K6XA 5ENUA 3DXBA 3LWAA 2G2QA 3ERGA 1WWJA 4P3YB 3C1SA 1XW5A 2YV9A 2H6ZA 5LCZA 1V98A 4TR3A 5B7CA 4EXJA 2FUG2 2YP6A 1OYJA 2L57A 1I9DA 1WIKA 4HZ2A 4Z7XA 4CY8A 5F07A 2OADA 1M7TA 3EU3A 6GSUA 1BJXA 5DJLA 4JR4A 1WMJA 3L9SA 4I97A 5B8BA 3WYWA 3APSA 5IOXA 1SD8A 1R7HA 2JSZA 3UIWA 1V2AA 5GAPD 5HFKA 2ALBA 1O81A 1E6BA 1MDKA 2IPAA 4PQIA 3FR9A 3CRUA 4GLTA 4EDYA 2AYTA 1ERUA 12GSA 10GSA 5ELAA 4EKZA 3EWLA 3KP9A 5J4UA 5G2ZA 2B5EA 5KOXA 2E7PA 3PR8A 3KIJA 1ST9A 5DJMA 3HD5A 2C0GA 1HD2A 3IE3A 1VRSD 3ZITA 2FA4A 4RQXA 3EYTA 3MYDA 3RPPA 5G5FA 2CVDA 5HR3A 2O89A 2DLXA 2QA1A 3DEXA 4BL7A 3EE2A 2RM6A 2GT5A 3FMWA 5D9XA 1X9WB 4XS1A 3D4MA 2R37A 2VO4A 2GSQA 2FCHA 1R26A 6GSSA 3KGKA 1K0CA 3VI7A 4TW5A 4K0NA 1TRUA 1AIUA 1Z7PA 1K0AA 3ZRDA 1ERWA 1TOFA 3NOFA 2B7JA 2QKEA 4BWSA 2QA2A 1FVJA 1GLQA 4N0VA 1J0FA 1XZOA 2GQMA 4L5OA 4K0GA 3F9UA 5DQSA 2RUEA 2VM1A 3GIXA 2GSTA 1R5PA 1OKDA 5BRTA 4IBPA 1LJRA 2GTUA 1QUWA 1SK1A 1Z6NA 2LNSA 5DQYA 1FW1A 2TIRA 3FR6A 4N10A 3HVVA 1CQGA 3UBKA 2PBJA 1GSSA 4MF5A 1OE7A 4ZBDA 1Y6EA 4K7IA 1T7PB 1Q98A 1HNBA 3ERWA 1SJZA 2H0GA 3ZVJD 1XW6A 4WBJA 2M46A 3L9UA 3IRAA 2R2JA 3TKQA 5CYYA 3I9V2 4KX4A 1XWKA 4LL1B 1U88A 3C73A 2CZ3A 4DSSA 3TJKA 1TK5B 3TGZA 3IK9A 2A2PA 4A5PA 1W4VA 2HZEB 2TRXA 3FY7A 3BOAA 5F0GA 4CY6A 1A24A 3IA1A 3P7XA 4TKYA 2H6YA 4MPFA 4ZBBA 1X5CA 2N5BA 3RHCA 5DVBA 2LJRA 3L0HA 4J2FA 4YKGA 2I4AA 5EVOA 3W8JA 1PL1A 3GSTA 1SL1B 4IP6A 1AC1A 5D96A 3E9JB 2KLXA 1KNGA 1TDIA 3BCKA 3UJ1A 3H93A 3F3QA 4KA0A 4F9ZA 3FYGA 4EC0A 4PNFA 1SK2A 4PURA 3GUSA 4BVXA 4RI6A 1EP8A 1QFNA 3FHKA 2XBQA 5J9CA 1Z3EA 2RM5A 3LQ7A 3GTUA 3ED3A 2YWNA 3VWVA 4LL4B 4HJMA 1N2AA 1YJ6A 2BTOT 4EVMA 3KXOA 4KF9A 4ZL9A 5IMZA 4IGJA 2H74A 3F3RA 4HZ4A 3BJ5A 1GTIA 1PSQA 2C0FA 5IMCA 4DSRA 4TR0A 4ZL8A 1EOHA 4ZBAA 2DJKA 2CAIA 4HU7A 2JZRA 3LW9A 4TN8A 4PQ1A 3D5JA 3PH9A 3ZFLA 3IDVA 1K0OA 2C1YA 2V41A 4IW9A 3M9KA 1M0UA 3J7Yk 3SBCA 2D2ZA 1OE8A 2PVOC 2XPEA 2RLIA 1ZMAA 2EIQA 1MD4A 5EY6A 1AW9A 4XHMA 3EMXA 5L71A 4MNNA 4ZILA 2WB9A 1EWXA 4TXOB 3APOA 5D9VA 2H0HA 5G31A 4IQ1A 4OCEA 2C0DA 3C1RA 3KEBA 1QXHA 3FK8A 2HSMA 2IJYA 2HYXA 1X9SB 2ZUPA 1JLWA 4POLA 4GCIA 1A23A 2LQOA 3GV1A 1T4ZA 2VIMA 4F0CA 4XRAA 3DYRA 2N5AA 5ABRA 2OBKA 4IJIA 2WGRA 3MWHA 2V2GA 3A5IA 1ON4A 5AISA 3EURA 1GSQA 1O7UA 1A0RP 3P90A 1SJ6A 3HYPA 3FZ5A 4EE0A 3HY2A 3IAM2 2I1UA 2YOIA 3DVXA 1OC3A 2OA7A 2HXKA 5GZZB 4F0BA 1SYRA 3LG6A 5IPGA 2XBIA 1A2MA 4IS0A 3H4KA 2XC2A 4ZIJA 2YV7A 3UVHA 2LSTA 1CQHA 1YQ1A 4QL9A 1JZOA 2H19A 2X64A 2LV3A 3VWUA 1TP9A 2JADA 2NVLA 2VL3A 3NZNA 3ERFA 3FR3A 3CSJA 1S3AA 3EINA 3HXSA 4MPGA 2C80A 2MMOA 3UARA 2CX3A 1A0FA 4KDXA 5B8AA 1YDKA 3RHBA 2H8LA 1HQOA 4YQMA 1EOGA 3BCIA 3MIXA 1USBA 5ECNB 4AJ8A 1ML6A 4H86A 2MMNA 2HI7A 2L4QA 1RW1A 2FWHA 4ECJA 5ECLB 1HNAA 4K7NA 4NHZA 3HA9A 5DAKB 5ECOB 1FHEA 5G1KA 4X0XA 1WPIA 2V1MA 2I3YA 2R5GA 5KEJA 2CAQA 3TRPA 1A8LA 5J9BA 1OKTA 1S3DA 1BEDA 4RQRA 1XIYA 3HVXA 1WJKA 2IMKA 2VCWA 2H72A 3CSIA 2MBSA 3HDCA 4X1UA 1VF4A 2HNLA 3UMAA 4TXVA 2K18A 3W6GA 1EP7A 1FAAA 5B6NA 3LEFA 2HRNA 4LA1A 5HR0A 1X5EA 2GZZA 2X8CA 2WZ9A 4N30A 1TRSA 3IXRA 2DJJA 4CDOA 4K8MA 4YAVA 4Q5QA 4G0KA 2HRKA 3H1NA 1PQNA 1IYIA 1SD9A 3U6VA 4MZBA 1B8XA 4L0WA 1V57A 1AUCA 16GSA 2YJ7A 1WP0A 1GSDA 3FZ4A 4QQ7A 4EIPA 1NHOA 1XOAA 3TJFA 3EU4A 2FD3A 1XOBA 5KN1A 3GRXA 2GGTA 2CVBA 3F0IA 5ECKB 2LKUA 4NHWA 4ZB8A 1T4YA 6GSTA 13GSA 2VL2C 1YF1A 3E0UA 2X8GA 4EO3A 4AF2A 6GSXA 2AJQB 3IC8A 2R4VA 4KSMA 2YCDA 1B48A 2WFCA 3IR4A 4GF0A 2GZYA 1QK8A 3KH7A 1TI1A 5IMDA 2R0PA 3GKKA 4FYUA 5ECRB 1WE0A 2DJ2A 3IHGA 3Q19A 1G6YA 5JCGA 2C3QA 4D73B 2DMLA 4K5SA 1JZRA 2AHEA 4JRRA 1PX6A 5CRHA 2AV4A 4FYCA 5H5SA 5ECQB 5GSTA 3G7JA 2IFQA 4HQSA 3IK7A 2Z9SA 3N9JA 3GSSA 1G0TA 5D9WA 1R5AA 2X4AA 4ID0A 4ZXGA 3KM6A 2UZ8A 1Z6MA 1AQXA 3PINA 4ZL7A 2DSAA 3HCZA 1ILOA 3J7Yb 2O87A 5HQPA 4O32A 5JCWA 2H1AA 1J08A 3LYKA 3KTBA 4WR5A 1Y25A 2G0FA 4MMMA 3TJJA 3TOUA 2K9FA 1EZKA 2VCVA 3I43A 5G5EA 3DKSA 2E2MA 3C7MA 4DSQA 3EVIA 2M80A 2FGXA 1UC7A 3D6IA 1KEBA 1TXXA 3FZAA 3VWXA 5IM9A 1PA3A 1SKWB 2B1KA 1RQMA 1GSFA 2PWJA 3QD9A 1GSEA 2P31A 2X8HA 1XFLA 2E0QA 4CW9A 2HZFA 2CV4A 2DIZA 1ZZYA 3V1WA 1K0BA 3F6DA 4POKA 1BQ7A 1GULA 3TB2A 3M8NA 4Z2UA 2CQ9A 3ZIVA 3QR6A 3TKSC 2H01A 1K0MA 2GQLA 4F2IA 5INYA 2MMAA 2MYGA 5HFIA 1Q4JA 4IVFA 2E2GA 3UAPA 1BG5A 1XWBA 5A4VA 3FEUA 1EGOA 4NPBA 4PUAA 1KBNA 2PERA 3OR5A 4ML6A 5ELGA 1T8EB 4L0UA 4BPYA 4WXTA 3WGEA 2A4VA 4MJCA 2BMXA 2J23A 5LD0A 3L4NA 4TVEA 4GXZA 4TR1A 3HJPA 4GSTA 2RUFA 5J3RA 4KAEA 4PX1A 1AAZA 2H70A 4AGSA 5ID2A 4OWYA 1T3BA 4TOPA 1EV9A 2BJXA 1EEJA 3HVSA 1PGTA 3G7YA 3GX8A 2HSYA 3KMOA 5AIVA 2N5FA 2TRCP 4XRDA 5CRWA 2AB6A 2ON7A 3F6FA 2IMIA 4ZB6A 3CSHA 3GHAA 3LGCA 3DMLA 5BMUA 1TK8B 5H5QA 1XW9A 4BVYA 1JZWA 3F8UA 1DE2A 3FRCA 3GH6A 1BX9A 5E59A 4G9HA 4BL7B 5ECIB 5COHA 5ECMB 3RAZA 3VPQA 3R2QA 4EUYA 3HZ4A 2FA8A 1OC8A 3A2WA 2H76A 3ZLPA 1PN9A 2HLSA 2HRAA 1F2EA 3K8NA 1T1VA 3EMPA 2OKAA 1I5GA 1KTEA 1YEPA 11GSA 1XPVA 4YKFA 4WF5A 3VLNA 1GH2A 1GUMA 1O85A 2IIYA 1K3LA 3MNGA 1ZOFA 5CO3A 3LYPA 3ME7A 2A2RA 5F05A 14GSA 4NMUA 5G1LA 2CZ2A 2OACA 2YWMA 3DVWA 1ZL9A 5FHIA 3TRXA 1LBKA 3IHQA 2F9SA 2ES7A 3ZFBA 3RBTA 1HNCA 3O6TA 3GURA 2CVKA 3C71A 1ERVA 2LUSA 2QC7A 2K8SA 3GMFA 3LXTA 4V2MA 1C72A 2PN8A 5DALA 4MK3A 2GQKA 4WEYA 1GTAA 4YQUA 4DSSB 1T00A 2MBTA 2V32A 2YANA 4HJ2A 2J9HA 2H0IA 2LJAA 1SL0B 1U87A 1OC9A 3ME8A 2V6OA 1RK4A 2EC4A 1JHBA 3DGQA 1ZGNA 3F4RA 5AIXA 1QGVA 4PQHA 2YJHA 4NWYA 2FLSA 2VUPA 4WR4A 3TKSE 1VF3A 5HFGA 2K6VA 4ULXA 2HSHA 1K0DA 4Q5RA 1V58A 1M9BA 3HJOA 2VCTA 3CBUA 2CX4A 2HFDA 2VD0A 4OFNA 3ZVJA 1UVZA 3NIVA 5KN0A 4HI7A 1SJIA 3IPZA 1DE1A 5ECSA 4BVXB 2FNOA 1PKZA 4KE3A 5H5RA 6GSWA 2C3TA 1XWCA 3GTUB 5ECHB 2B5XA 1SKRB 4CHSA 1MDJA 4MP4A 4I2TA 1SL2B 3ZIJA 1X0RA 1PD21 4MF7A 4KGIA 2LEGA 1S3CA 2RIIA 3FW2A 3UEMA 5C04A 4ML1A 1SKSB 4NV5A 2M72A 4Z2RA 2EIOA 3KP8A 2C8UA 5DBQA 4DEJA 2DMMA 3TJGA 3M1GA 4IHUA 2QSIA 4ECIA 1FG4A 3P2AA 3TUEA 1Z9HA 3L9VA 4MABA 4IN0A 3GL5A 2CT6A 2F51A 4OD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAX A;  5E4W A;  4GQF A;  3LFL A;  5AN1 A;  4AJ7 A;  1YZX A;  4GQC A;  2IN3 A;  1DUG A;  1FB0 A;  5IO2 A;  2ZNM A;  2ON5 A;  2X99 A;  2VLT A;  1NM3 A;  4MJB A;  1GTU A;  3CTG A;  4KW6 A;  3KTL A;  5CNW A;  5IQY A;  2OJL A;  2KOK A;  2PMT A;  5F06 A;  3D21 A;  3KMN A;  3LJR A;  4OFT A;  2LNT A;  2FWF A;  2L6D A;  1FB6 A;  4ISD A;  1YF0 A;  3ZTL A;  3US3 A;  2JU5 A;  1K3O A;  3Q74 A;  1QMV A;  3WT2 A;  1TW9 A;  3M9J A;  3HJM A;  4KUN A;  3KJY A;  4WF4 A;  3A5W A;  1B4P A;  3GX0 A;  2JZT A;  8GSS A;  4ILF A;  3G9B A;  5D9T A;  4E8H A;  5IMF A;  1N8J A;  2VLU A;  2JSY A;  3LSZ A;  3VFI A;  1GSY A;  2V6K A;  1GRX A;  3A3T A;  3TOT A;  1O73 A;  1AXD A;  1F37 A;  1THO A;  3UOM A;  2AUV A;  2GVP A;  1G7E A;  2P0G A;  20GS A;  4PNG A;  7GSS A;  1THX A;  2H1G A;  5CRD A;  4MJE A;  1XCC A;  3VK9 A;  4NAX A;  2R6K A;  2WJU A;  3GFK A;  4V2N A;  4N0Z A;  1V9W A;  4MDC A;  1VF1 A;  1NHY A;  1X9M B;  2YPM A;  5D93 A;  3M3M A;  1AQW A;  4HQZ A;  2WRT A;  2HRF A;  3QFA C;  1M2A A;  1MD3 A;  5EPF A;  1H75 A;  6GSV A;  3CRT A;  2H75 A;  1FOV A;  4POM A;  1GUK A;  3I69 A;  4MCU A;  1URM A;  4J57 E;  3ISO A;  9GSS A;  1O8W A;  2F3M A;  1GSU A;  1PX7 A;  3LXZ A;  3DD3 A;  4YH2 A;  3KZQ A;  4ECC A;  1TK0 B;  4FO5 A;  2H71 A;  1YEX A;  2VCQ A;  4X43 A;  2C3N A;  5F8B A;  5EL8 A;  1TI3 A;  2GSS A;  4XS4 B;  4K1F A;  3D0Z A;  1XVQ A;  2YNX A;  2H66 A;  4MJA A;  5A4U A;  1SU9 A;  2AAW A;  3GKN A;  2B5Y A;  1MEK A;  4I2U A;  4MH3 A;  2KP2 A;  5IIZ A;  4FH8 A;  3S9F A;  3LOR A;  2O85 A;  19GS A;  3HHV A;  3QMX A;  1JLV A;  5CP1 A;  2YZH A;  2XHF A;  2HZE A;  4G19 A;  2OBI A;  1HYU A;  2A2S A;  4YAP A;  3MDK A;  1TU8 A;  1GUH A;  4I5Q A;  4RI7 A;  3A2X A;  1XBS A;  4JE1 A;  4LMV A;  3F4S A;  3VWW A;  2VL9 A;  1R4W A;  3TCO A;  1UN2 A;  4TR4 A;  1PRX A;  5KN3 A;  4K2D A;  1DSB A;  2VCZ A;  1JZD A;  4WBR D;  2IME A;  3IOS A;  1FO5 A;  3F4T A;  5C00 A;  2H30 A;  3FZ9 A;  5B6M A;  4I6X A;  3QAG A;  4KDY A;  2DJ0 A;  3QDN A;  4PGT A;  5CRE A;  1ABA A;  1XXU A;  1GNE A;  1TRV A;  3GNJ A;  4JZQ A;  1YY7 A;  3GL3 A;  2DJ3 A;  4KND A;  2JL4 A;  4MLY A;  4KCE A;  5IMV A;  5KN2 A;  5CRG A;  3UBL A;  3P8W A;  1F9M A;  5J41 A;  5JCU A;  1IYH A;  5GSS A;  3O76 A;  3DIE A;  1ZYE A;  4JED A;  3UVT A;  4I8B A;  4N11 A;  2H73 A;  4XTS A;  1M2D A;  3WGX A;  3QOU A;  2OE3 A;  4K7O A;  1VGL A;  2LTK A;  1ZCP A;  2VL2 A;  2DC5 A;  5G30 A;  2L6C A;  2VOC A;  17GS A;  1SEN A;  4K9Z A;  3WT1 A;  1WOU A;  3VPT A;  5A5K A;  1MDI A;  1F6M C;  2KUC A;  2B7K A;  2H6X A;  4E8E A;  3RPN A;  1PKW A;  3VI5 A;  1GWC A;  4IKH A;  3AY8 A;  4XIH A;  3CMI A;  4MF6 A;  2IFQ B;  2LRN A;  1W89 A;  5HR1 A;  1J9B A;  4TXO A;  4AJ6 A;  2HE3 A;  4ZB9 A;  4HEA 2;  3CTF A;  4XS6 A;  4HS1 A;  2B3S A;  4QL7 A;  2DBC A;  4XCS A;  4FIW A;  3ZRE A;  4BA7 A;  1OVN A;  4PUF C;  3G7I A;  3KCM A;  2OE0 A;  2B6M A;  4TRX A;  1X5D A;  2GSR A;  3QAV A;  5IO0 A;  1TTZ A;  3QPM A;  1K3Y A;  1XWA A;  4PXO A;  4ECB A;  4F03 A;  2C4J A;  4NXI A;  2PGT A;  4GWR A;  3ZL5 A;  3QCP A;  4OCF A;  2GDR A;  4KH7 A;  4L8E A;  1B9Y C;  2O7K A;  3EC3 A;  4MH2 A;  3GKM A;  2YWO A;  3QAW A;  5JWO B;  1TKD B;  3ZZX A;  5D73 A;  1TRW A;  2KHP A;  2H1B A;  1QQ2 A;  2WCI A;  3ZYW A;  2DJ1 A;  4YQV A;  2LRT A;  2LRC A;  4FYB A;  5D8I A;  1ZYQ B;  1JFU A;  2L59 A;  3PGT A;  5IOW A;  4JU5 A;  4HDE A;  3BBY A;  3MAK A;  2FHE A;  2GLR A;  3UL3 A;  2B1L A;  1E2Y A;  2PPT A;  3TKR A;  3C8E A;  3HKR A;  3TKS A;  1NW2 A;  5GAN D;  3APQ A;  4KB3 A;  3A2V A;  4GTU A;  4NV2 A;  2GS3 A;  4Q5N A;  2L5O A;  5LNK e;  3SWL A;  1V40 A;  1WRY A;  4TR1 B;  5A4W A;  3KD0 A;  2LQQ A;  2NDO A;  1G6W A;  1XVW A;  3H8Q A;  2NBS A;  1O6J A;  3ZMK A;  2LS5 A;  5ID2 B;  2F8F A;  2C0E A;  3FKF A;  6GSY A;  4POB A;  4IP1 A;  4O7H A;  2VAF A;  4EF0 A;  4OMV A;  2NPB A;  1YKC A;  1DBY A;  4BWQ A;  4OFM A;  4HU9 A;  3IC4 A;  5IMA A;  3HZ8 A;  3GYK A;  2YZU A;  5DAK A;  5ECP B;  1PL2 A;  1VF2 A;  3CXG A;  1GP1 A;  3TJB A;  4EL1 A;  2NTO A;  3GA4 A;  1Z7R A;  2VCX A;  3WD6 A;  2PU9 C;  1OAZ A;  4DVC A;  1G7O A;  4GSS A;  3ZML A;  2VM2 A;  4MZC A;  1GL8 A;  3O3T A;  1ERT A;  3JCM L;  1YKA A;  2IMD A;  3DRN A;  3Q18 A;  2FWE A;  1EV4 A;  1TU7 A;  2ZCT A;  1BYE A;  4V1A g;  1MTC A;  2K8V A;  4GRF A;  4KCA A;  2H1D A;  1F3B A;  1M2B A;  2R3X A;  2PUK C;  5DCG A;  3MSZ A;  3F63 A;  2GZP A;  2CA8 A;  4JR6 A;  2KP1 A;  5HR2 A;  1EEM A;  2YN1 A;  1ACV A;  4V2L A;  1LU4 A;  2I81 A;  4RUV A;  3Q6O A;  4G10 A;  1SYX A;  4V1A p;  18GS A;  3W8S A;  4MZW A;  2IWT A;  2FY6 A;  3IBH A;  4IQA A;  2O8V B;  3H79 A;  3VUR A;  1H4O A;  3DWV A;  1B9X C;  1M9A A;  1A2J A;  2QGV A;  5FT3 A;  3GN3 A;  3GH9 A;  4IEL A;  3D22 A;  2WUL A;  2JAC A;  3QFB C;  2WS2 A;  5DAL B;  1M99 A;  3TKP A;  4EDZ A;  4OO4 A;  2IL3 A;  1XWG A;  2EIR A;  1F3A A;  2GT6 A;  4MA9 A;  3IV4 A;  1OC9 B;  2FWG A;  1PMT A;  4GSN A;  2REM A;  4D73 A;  2MZC A;  4Q5F A;  4XS4 A;  1NSW A;  1B4Q A;  4LMW A;  4WKW A;  1SK0 A;  5IPH A;  2DIY A;  2VD1 A;  3I6A A;  3E3E A;  3WGD A;  2IMF A;  3KH9 A;  4OO5 A;  4HUA A;  2L5L A;  1A8Y A;  1U3A A;  2PVQ A;  3M0F A;  3U5R E;  5JWR B;  2VLV A;  5J5N A;  5DDL A;  1FVK A;  1UA5 A;  3N5O A;  1GLP A;  3GKX A;  1K0N A;  1EGR A;  2LJK A;  4L5L A;  4O5R A;  1TJD A;  1U6T A;  4G2E A;  4WET A;  5FWG A;  3IAS 2;  1GNW A;  2L4C A;  5AGY A;  3TRQ A;  5DCH A;  3CYN A;  3D4T A;  4IJ3 A;  2F8A A;  4F82 A;  1U3I A;  3RDW A;  4HOJ A;  2JZS A;  2HT9 A;  2WDU A;  2YWI A;  4KDU A;  3L78 A;  4J56 E;  4JBB A;  1GTB A;  4LLR A;  22GS A;  2P5Q A;  4KSO A;  4ACS A;  1BAY A;  3TDG A;  2MMZ A;  5JWQ B;  4O92 A;  2OE1 A;  1A2L A;  1Z5Y E;  1AQV A;  1O8X A;  2P5R A;  3BD2 A;  2I9H A;  2XPD A;  4K6X A;  5ENU A;  3DXB A;  3LWA A;  2G2Q A;  3ERG A;  1WWJ A;  4P3Y B;  3C1S A;  1XW5 A;  2YV9 A;  2H6Z A;  5LCZ A;  1V98 A;  4TR3 A;  5B7C A;  4EXJ A;  2FUG 2;  2YP6 A;  1OYJ A;  2L57 A;  1I9D A;  1WIK A;  4HZ2 A;  4Z7X A;  5F07 A;  2OAD A;  1M7T A;  3EU3 A;  6GSU A;  1BJX A;  5DJL A;  4JR4 A;  1WMJ A;  3L9S A;  4I97 A;  5B8B A;  3WYW A;  3APS A;  5IOX A;  1SD8 A;  1R7H A;  2JSZ A;  3UIW A;  1V2A A;  5GAP D;  5HFK A;  2ALB A;  1O81 A;  1E6B A;  1MDK A;  2IPA A;  4PQI A;  3FR9 A;  3CRU A;  4GLT A;  4EDY A;  2AYT A;  1ERU A;  12GS A;  10GS A;  5ELA A;  4EKZ A;  3EWL A;  3KP9 A;  5J4U A;  5G2Z A;  2B5E A;  2E7P A;  3PR8 A;  3KIJ A;  1ST9 A;  5DJM A;  3HD5 A;  2C0G A;  1HD2 A;  3IE3 A;  1VRS D;  3ZIT A;  2FA4 A;  4RQX A;  3EYT A;  3RPP A;  5G5F A;  2CVD A;  5HR3 A;  2O89 A;  2DLX A;  3DEX A;  4BL7 A;  3EE2 A;  2RM6 A;  2GT5 A;  5D9X A;  1X9W B;  4XS1 A;  3D4M A;  2R37 A;  2VO4 A;  2GSQ A;  2FCH A;  1R26 A;  6GSS A;  3KGK A;  1K0C A;  3VI7 A;  4TW5 A;  4K0N A;  1TRU A;  1AIU A;  1Z7P A;  1K0A A;  3ZRD A;  1ERW A;  1TOF A;  3NOF A;  2B7J A;  2QKE A;  4BWS A;  1FVJ A;  1GLQ A;  4N0V A;  1J0F A;  1XZO A;  2GQM A;  4L5O A;  4K0G A;  3F9U A;  5DQS A;  2RUE A;  2VM1 A;  3GIX A;  2GST A;  1R5P A;  1OKD A;  4IBP A;  1LJR A;  2GTU A;  1QUW A;  1SK1 A;  1Z6N A;  2LNS A;  5DQY A;  1FW1 A;  2TIR A;  3FR6 A;  4N10 A;  3HVV A;  1CQG A;  3UBK A;  2PBJ A;  1GSS A;  4MF5 A;  1OE7 A;  4ZBD A;  1Y6E A;  4K7I A;  1T7P B;  1Q98 A;  1HNB A;  3ERW A;  1SJZ A;  2H0G A;  3ZVJ D;  1XW6 A;  4WBJ A;  2M46 A;  3L9U A;  3IRA A;  2R2J A;  3TKQ A;  5CYY A;  3I9V 2;  4KX4 A;  1XWK A;  4LL1 B;  1U88 A;  3C73 A;  2CZ3 A;  4DSS A;  3TJK A;  1TK5 B;  3TGZ A;  3IK9 A;  1W4V A;  2HZE B;  2TRX A;  3FY7 A;  3BOA A;  5F0G A;  1A24 A;  3IA1 A;  3P7X A;  4TKY A;  2H6Y A;  4MPF A;  4ZBB A;  1X5C A;  2N5B A;  3RHC A;  5DVB A;  2LJR A;  3L0H A;  4J2F A;  2I4A A;  5EVO A;  3W8J A;  1PL1 A;  3GST A;  1SL1 B;  4IP6 A;  1AC1 A;  5D96 A;  3E9J B;  2KLX A;  1KNG A;  1TDI A;  3BCK A;  3UJ1 A;  3H93 A;  3F3Q A;  4KA0 A;  4F9Z A;  3FYG A;  4EC0 A;  4PNF A;  1SK2 A;  4PUR A;  3GUS A;  4BVX A;  4RI6 A;  1EP8 A;  1QFN A;  3FHK A;  2XBQ A;  5J9C A;  1Z3E A;  2RM5 A;  3LQ7 A;  3GTU A;  3ED3 A;  2YWN A;  3VWV A;  4LL4 B;  4HJM A;  1N2A A;  1YJ6 A;  2BTO T;  4EVM A;  3KXO A;  4ZL9 A;  5IMZ A;  4IGJ A;  2H74 A;  3F3R A;  4HZ4 A;  3BJ5 A;  1GTI A;  1PSQ A;  2C0F A;  5IMC A;  4DSR A;  4TR0 A;  4ZL8 A;  1EOH A;  4ZBA A;  2DJK A;  2CAI A;  4HU7 A;  2JZR A;  4TN8 A;  4PQ1 A;  3D5J A;  3PH9 A;  3ZFL A;  3IDV A;  1K0O A;  2C1Y A;  2V41 A;  4IW9 A;  3M9K A;  1M0U A;  3J7Y k;  3SBC A;  2D2Z A;  1OE8 A;  2PVO C;  2XPE A;  2RLI A;  1ZMA A;  2EIQ A;  1MD4 A;  5EY6 A;  1AW9 A;  4XHM A;  3EMX A;  5L71 A;  4ZIL A;  2WB9 A;  1EWX A;  4TXO B;  3APO A;  5D9V A;  2H0H A;  5G31 A;  4IQ1 A;  4OCE A;  2C0D A;  3C1R A;  3KEB A;  1QXH A;  3FK8 A;  2IJY A;  2HYX A;  1X9S B;  2ZUP A;  1JLW A;  4POL A;  4GCI A;  1A23 A;  2LQO A;  3GV1 A;  1T4Z A;  2VIM A;  4F0C A;  4XRA A;  3DYR A;  2N5A A;  5ABR A;  2OBK A;  4IJI A;  2WGR A;  3MWH A;  2V2G A;  1ON4 A;  5AIS A;  3EUR A;  1GSQ A;  1O7U A;  1A0R P;  3P90 A;  1SJ6 A;  3HYP A;  3FZ5 A;  4EE0 A;  3HY2 A;  3IAM 2;  2I1U A;  2YOI A;  3DVX A;  1OC3 A;  2OA7 A;  2HXK A;  5GZZ B;  4F0B A;  1SYR A;  3LG6 A;  5IPG A;  2XBI A;  1A2M A;  4IS0 A;  3H4K A;  2XC2 A;  4ZIJ A;  2YV7 A;  3UVH A;  2LST A;  1CQH A;  1YQ1 A;  4QL9 A;  1JZO A;  2H19 A;  2X64 A;  2LV3 A;  3VWU A;  1TP9 A;  2JAD A;  2NVL A;  2VL3 A;  3NZN A;  3ERF A;  3FR3 A;  3CSJ A;  1S3A A;  3EIN A;  3HXS A;  4MPG A;  2C80 A;  2MMO A;  3UAR A;  2CX3 A;  1A0F A;  4KDX A;  5B8A A;  1YDK A;  3RHB A;  2H8L A;  1HQO A;  4YQM A;  1EOG A;  3BCI A;  5ECN B;  1USB A;  4AJ8 A;  1ML6 A;  4H86 A;  2MMN A;  2HI7 A;  2L4Q A;  1RW1 A;  2FWH A;  4ECJ A;  5ECL B;  1HNA A;  4K7N A;  4NHZ A;  3HA9 A;  5DAK B;  5ECO B;  1FHE A;  5G1K A;  4X0X A;  1WPI A;  2V1M A;  2I3Y A;  2R5G A;  5KEJ A;  2CAQ A;  3TRP A;  1A8L A;  5J9B A;  1OKT A;  1S3D A;  1BED A;  4RQR A;  1XIY A;  3HVX A;  1WJK A;  2IMK A;  2VCW A;  2H72 A;  3CSI A;  2MBS A;  3HDC A;  4X1U A;  1VF4 A;  2HNL A;  3UMA A;  4TXV A;  2K18 A;  3W6G A;  1EP7 A;  1FAA A;  5B6N A;  3LEF A;  2HRN A;  4LA1 A;  5HR0 A;  1X5E A;  2GZZ A;  2X8C A;  2WZ9 A;  4N30 A;  1TRS A;  3IXR A;  2DJJ A;  4CDO A;  4K8M A;  4YAV A;  4Q5Q A;  3H1N A;  1PQN A;  1IYI A;  1SD9 A;  3U6V A;  4MZB A;  1B8X A;  4L0W A;  1V57 A;  1AUC A;  16GS A;  2YJ7 A;  1WP0 A;  1GSD A;  3FZ4 A;  4QQ7 A;  1NHO A;  1XOA A;  3TJF A;  3EU4 A;  2FD3 A;  1XOB A;  5KN1 A;  3GRX A;  2GGT A;  2CVB A;  3F0I A;  5ECK B;  2LKU A;  4NHW A;  4ZB8 A;  1T4Y A;  6GST A;  13GS A;  2VL2 C;  1YF1 A;  3E0U A;  2X8G A;  4EO3 A;  4AF2 A;  6GSX A;  2AJQ B;  2R4V A;  4KSM A;  2YCD A;  1B48 A;  2WFC A;  3IR4 A;  4GF0 A;  2GZY A;  1QK8 A;  3KH7 A;  1TI1 A;  5IMD A;  3GKK A;  4FYU A;  5ECR B;  1WE0 A;  2DJ2 A;  3Q19 A;  1G6Y A;  5JCG A;  2C3Q A;  4D73 B;  2DML A;  1JZR A;  2AHE A;  4JRR A;  1PX6 A;  5CRH A;  2AV4 A;  4FYC A;  5H5S A;  5ECQ B;  5GST A;  3G7J A;  2IFQ A;  4HQS A;  3IK7 A;  2Z9S A;  3N9J A;  3GSS A;  1G0T A;  5D9W A;  1R5A A;  4ID0 A;  4ZXG A;  3KM6 A;  1Z6M A;  1AQX A;  3PIN A;  4ZL7 A;  2DSA A;  3HCZ A;  1ILO A;  3J7Y b;  2O87 A;  5HQP A;  4O32 A;  5JCW A;  2H1A A;  1J08 A;  3LYK A;  3KTB A;  4WR5 A;  1Y25 A;  2G0F A;  4MMM A;  3TJJ A;  3TOU A;  2K9F A;  1EZK A;  2VCV A;  3I43 A;  5G5E A;  3DKS A;  2E2M A;  3C7M A;  4DSQ A;  3EVI A;  2M80 A;  2FGX A;  1UC7 A;  3D6I A;  1KEB A;  1TXX A;  3FZA A;  3VWX A;  5IM9 A;  1PA3 A;  1SKW B;  2B1K A;  1RQM A;  1GSF A;  2PWJ A;  3QD9 A;  1GSE A;  2P31 A;  2X8H A;  1XFL A;  2E0Q A;  4CW9 A;  2HZF A;  2CV4 A;  2DIZ A;  1ZZY A;  3V1W A;  1K0B A;  3F6D A;  4POK A;  1BQ7 A;  1GUL A;  3TB2 A;  3M8N A;  2CQ9 A;  3ZIV A;  3QR6 A;  3TKS C;  2H01 A;  1K0M A;  2GQL A;  4F2I A;  5INY A;  2MMA A;  2MYG A;  5HFI A;  1Q4J A;  4IVF A;  2E2G A;  3UAP A;  1BG5 A;  1XWB A;  5A4V A;  3FEU A;  1EGO A;  4NPB A;  4PUA A;  1KBN A;  2PER A;  3OR5 A;  4ML6 A;  5ELG A;  1T8E B;  4L0U A;  4BPY A;  4WXT A;  3WGE A;  2A4V A;  4MJC A;  2BMX A;  2J23 A;  5LD0 A;  3L4N A;  4TVE A;  4GXZ A;  4TR1 A;  3HJP A;  4GST A;  2RUF A;  5J3R A;  4KAE A;  4PX1 A;  1AAZ A;  2H70 A;  4AGS A;  5ID2 A;  4OWY A;  1T3B A;  4TOP A;  1EV9 A;  2BJX A;  1EEJ A;  3HVS A;  1PGT A;  3G7Y A;  3GX8 A;  2HSY A;  3KMO A;  5AIV A;  2N5F A;  2TRC P;  4XRD A;  5CRW A;  2AB6 A;  2ON7 A;  3F6F A;  2IMI A;  4ZB6 A;  3CSH A;  3GHA A;  3LGC A;  3DML A;  1TK8 B;  5H5Q A;  1XW9 A;  4BVY A;  1JZW A;  3F8U A;  1DE2 A;  3FRC A;  3GH6 A;  1BX9 A;  5E59 A;  4G9H A;  5ECI B;  5COH A;  5ECM B;  3RAZ A;  3VPQ A;  3R2Q A;  4EUY A;  3HZ4 A;  2FA8 A;  1OC8 A;  3A2W A;  2H76 A;  3ZLP A;  1PN9 A;  2HLS A;  1F2E A;  3K8N A;  1T1V A;  3EMP A;  2OKA A;  1I5G A;  1KTE A;  1YEP A;  11GS A;  1XPV A;  4WF5 A;  3VLN A;  1GH2 A;  1GUM A;  1O85 A;  2IIY A;  1K3L A;  3MNG A;  1ZOF A;  5CO3 A;  3LYP A;  3ME7 A;  2A2R A;  5F05 A;  14GS A;  4NMU A;  5G1L A;  2CZ2 A;  2OAC A;  2YWM A;  3DVW A;  1ZL9 A;  5FHI A;  3TRX A;  1LBK A;  3IHQ A;  2F9S A;  2ES7 A;  3ZFB A;  3RBT A;  1HNC A;  3O6T A;  3GUR A;  2CVK A;  3C71 A;  1ERV A;  2LUS A;  2QC7 A;  2K8S A;  3GMF A;  3LXT A;  4V2M A;  1C72 A;  2PN8 A;  5DAL A;  4MK3 A;  2GQK A;  4WEY A;  1GTA A;  4YQU A;  4DSS B;  1T00 A;  2MBT A;  2V32 A;  2YAN A;  4HJ2 A;  2J9H A;  2H0I A;  2LJA A;  1SL0 B;  1U87 A;  1OC9 A;  3ME8 A;  2V6O A;  1RK4 A;  2EC4 A;  1JHB A;  3DGQ A;  1ZGN A;  3F4R A;  5AIX A;  1QGV A;  4PQH A;  2YJH A;  4NWY A;  2FLS A;  2VUP A;  4WR4 A;  3TKS E;  1VF3 A;  5HFG A;  2K6V A;  4ULX A;  2HSH A;  1K0D A;  4Q5R A;  1V58 A;  1M9B A;  3HJO A;  2VCT A;  3CBU A;  2CX4 A;  2HFD A;  2VD0 A;  4OFN A;  3ZVJ A;  1UVZ A;  3NIV A;  5KN0 A;  4HI7 A;  1SJI A;  3IPZ A;  1DE1 A;  5ECS A;  2FNO A;  1PKZ A;  4KE3 A;  5H5R A;  6GSW A;  2C3T A;  1XWC A;  3GTU B;  5ECH B;  2B5X A;  1SKR B;  4CHS A;  1MDJ A;  4MP4 A;  4I2T A;  1SL2 B;  3ZIJ A;  1X0R A;  1PD2 1;  4MF7 A;  4KGI A;  2LEG A;  1S3C A;  2RII A;  3FW2 A;  3UEM A;  5C04 A;  4ML1 A;  1SKS B;  4NV5 A;  2M72 A;  2EIO A;  3KP8 A;  2C8U A;  5DBQ A;  4DEJ A;  2DMM A;  3TJG A;  3M1G A;  4IHU A;  2QSI A;  4ECI A;  1FG4 A;  3P2A A;  3TUE A;  1Z9H A;  3L9V A;  4MAB A;  4IN0 A;  3GL5 A;  2CT6 A;  2F51 A;  4OD7 A; 
#chains in the Genus database with same CATH topology
 5CAX A;  5E4W A;  4GQF A;  3LFL A;  5AN1 A;  4AJ7 A;  1YZX A;  4GQC A;  2IN3 A;  1DUG A;  1FB0 A;  5IO2 A;  2ZNM A;  2ON5 A;  2X99 A;  2VLT A;  1NM3 A;  4MJB A;  1GTU A;  3CTG A;  4KW6 A;  3KTL A;  5CNW A;  5IQY A;  2OJL A;  2KOK A;  2PMT A;  5F06 A;  2DKH A;  3D21 A;  3KMN A;  3LJR A;  4OFT A;  2LNT A;  2FWF A;  2L6D A;  1FB6 A;  4ISD A;  1YF0 A;  3ZTL A;  3US3 A;  2JU5 A;  1K3O A;  3Q74 A;  1QMV A;  3WT2 A;  1TW9 A;  3M9J A;  3HJM A;  4KUN A;  1ZYN A;  4G0L A;  3KJY A;  4WF4 A;  3A5W A;  1B4P A;  3GX0 A;  2JZT A;  8GSS A;  4ILF A;  3G9B A;  5D9T A;  4E8H A;  5IMF A;  1N8J A;  2VLU A;  2JSY A;  3LSZ A;  3VFI A;  1GSY A;  2V6K A;  1GRX A;  3A3T A;  3TOT A;  1O73 A;  1AXD A;  1F37 A;  1THO A;  3UOM A;  2AUV A;  2GVP A;  1G7E A;  2P0G A;  20GS A;  4PNG A;  7GSS A;  1THX A;  2H1G A;  2X49 A;  4K5R A;  5CRD A;  4MJE A;  1XCC A;  3VK9 A;  4NAX A;  2R6K A;  2WJU A;  3GFK A;  4V2N A;  4N0Z A;  1V9W A;  4MDC A;  1VF1 A;  1NHY A;  1X9M B;  2R0G A;  2YPM A;  5D93 A;  3M3M A;  1AQW A;  4HQZ A;  2WRT A;  2HRF A;  3QFA C;  1M2A A;  1MD3 A;  5EPF A;  1H75 A;  6GSV A;  3CRT A;  2H75 A;  1FOV A;  4POM A;  1GUK A;  3I69 A;  4MCU A;  4Z2T A;  4ICY A;  1URM A;  4J57 E;  3ISO A;  9GSS A;  1O8W A;  2F3M A;  1GSU A;  1PX7 A;  3LXZ A;  3DD3 A;  4YH2 A;  3KZQ A;  1FOH A;  4ECC A;  1TK0 B;  4FO5 A;  2H71 A;  1YEX A;  2VCQ A;  4X43 A;  2C3N A;  5F8B A;  5EL8 A;  1TI3 A;  2GSS A;  4XS4 B;  4K1F A;  3D0Z A;  1XVQ A;  2YNX A;  2H66 A;  4MJA A;  5A4U A;  1SU9 A;  2AAW A;  3GKN A;  2B5Y A;  1MEK A;  4I2U A;  4MH3 A;  2KP2 A;  5IIZ A;  4FH8 A;  3S9F A;  3LOR A;  2O85 A;  19GS A;  3HHV A;  3QMX A;  1JLV A;  5CP1 A;  2YZH A;  2XHF A;  2HZE A;  4G19 A;  2OBI A;  1HYU A;  1XG8 A;  2A2S A;  4YAP A;  3MDK A;  1TU8 A;  1GUH A;  4I5Q A;  4RI7 A;  3A2X A;  1XBS A;  4JE1 A;  4LMV A;  3F4S A;  3VWW A;  4FQU A;  2VL9 A;  1R4W A;  3TCO A;  1UN2 A;  4TR4 A;  1PRX A;  5KN3 A;  4K2D A;  1DSB A;  2VCZ A;  1JZD A;  4WBR D;  2IME A;  3IOS A;  1FO5 A;  3F4T A;  5C00 A;  2H30 A;  3FZ9 A;  5B6M A;  4I6X A;  3QAG A;  4KDY A;  2DJ0 A;  3QDN A;  4PGT A;  5CRE A;  1ABA A;  1XXU A;  4G0I A;  1GNE A;  1TRV A;  3GNJ A;  4JZQ A;  1YY7 A;  3GL3 A;  2DJ3 A;  4KND A;  2JL4 A;  4MLY A;  4KCE A;  5IMV A;  5KN2 A;  5CRG A;  3UBL A;  3P8W A;  1F9M A;  5J41 A;  5JCU A;  1IYH A;  5GSS A;  3O76 A;  3DIE A;  1ZYE A;  4JED A;  3UVT A;  4I8B A;  4N11 A;  2H73 A;  4XTS A;  1M2D A;  3WGX A;  3QOU A;  2OE3 A;  4K7O A;  1VGL A;  2LTK A;  1ZCP A;  2VL2 A;  2DC5 A;  5G30 A;  2L6C A;  2VOC A;  17GS A;  1SEN A;  4K9Z A;  3WT1 A;  1WOU A;  3VPT A;  5A5K A;  1MDI A;  1F6M C;  2KUC A;  2B7K A;  2H6X A;  3EPT A;  4E8E A;  3RPN A;  1PKW A;  3VI5 A;  1GWC A;  4IKH A;  3AY8 A;  4XIH A;  3CMI A;  4MF6 A;  2IFQ B;  2LRN A;  1W89 A;  5HR1 A;  1J9B A;  4TXO A;  4AJ6 A;  2HE3 A;  4ZB9 A;  4HEA 2;  3CTF A;  4XS6 A;  4HS1 A;  2B3S A;  4QL7 A;  2DBC A;  4XCS A;  4FIW A;  3ZRE A;  4BA7 A;  1OVN A;  4PUF C;  3G7I A;  3KCM A;  2OE0 A;  2B6M A;  4TRX A;  1X5D A;  2GSR A;  3QAV A;  5IO0 A;  1TTZ A;  3QPM A;  1K3Y A;  1XWA A;  4PXO A;  4ECB A;  4F03 A;  2C4J A;  4NXI A;  2PGT A;  4GWR A;  3R3E A;  3ZL5 A;  3QCP A;  4OCF A;  2GDR A;  4KH7 A;  4L8E A;  1B9Y C;  2O7K A;  3EC3 A;  4MH2 A;  3GKM A;  2YWO A;  3QAW A;  5JWO B;  1TKD B;  3ZZX A;  5D73 A;  1TRW A;  2KHP A;  2H1B A;  1QQ2 A;  2WCI A;  3ZYW A;  2DJ1 A;  4YQV A;  2LRT A;  2LRC A;  4FYB A;  5D8I A;  1ZYQ B;  1JFU A;  2L59 A;  3PGT A;  5IOW A;  4JU5 A;  4HDE A;  3BBY A;  3MAK A;  2FHE A;  2GLR A;  3UL3 A;  2B1L A;  1E2Y A;  2PPT A;  3TKR A;  3C8E A;  3HKR A;  3TKS A;  1NW2 A;  5GAN D;  3APQ A;  4KB3 A;  5KOW A;  3A2V A;  1ZYP A;  4GTU A;  4NV2 A;  2GS3 A;  4Q5N A;  2L5O A;  5LNK e;  3SWL A;  1V40 A;  1WRY A;  4TR1 B;  5A4W A;  3KD0 A;  2R0C A;  2LQQ A;  2NDO A;  1G6W A;  1XVW A;  3H8Q A;  2NBS A;  1O6J A;  3ZMK A;  2LS5 A;  5ID2 B;  2F8F A;  2C0E A;  3FKF A;  6GSY A;  4POB A;  4IP1 A;  4O7H A;  2VAF A;  4EF0 A;  4OMV A;  2NPB A;  1YKC A;  1DBY A;  4BWQ A;  4OFM A;  4O5U A;  4HU9 A;  3IC4 A;  5IMA A;  3HZ8 A;  3GYK A;  2YZU A;  5DAK A;  5ECP B;  1PL2 A;  1VF2 A;  3CXG A;  1GP1 A;  3TJB A;  4BVY B;  4EL1 A;  2NTO A;  1PFO A;  3GA4 A;  1Z7R A;  2VCX A;  3WD6 A;  2PU9 C;  1OAZ A;  4DVC A;  1G7O A;  4GSS A;  3ZML A;  2VM2 A;  4MZC A;  1GL8 A;  3O3T A;  1ERT A;  3JCM L;  1YKA A;  2IMD A;  4PTS A;  3DRN A;  3Q18 A;  2FWE A;  1EV4 A;  1TU7 A;  2ZCT A;  1BYE A;  4V1A g;  1MTC A;  2K8V A;  4GRF A;  4KCA A;  2H1D A;  1F3B A;  1M2B A;  2R3X A;  2PUK C;  5DCG A;  3MSZ A;  3F63 A;  2GZP A;  2CA8 A;  4JR6 A;  2KP1 A;  5HR2 A;  1EEM A;  2YN1 A;  1ACV A;  4V2L A;  1LU4 A;  2I81 A;  4RUV A;  3Q6O A;  4G10 A;  1SYX A;  4V1A p;  18GS A;  3W8S A;  4MZW A;  2IWT A;  4USS A;  2FY6 A;  3IBH A;  4IQA A;  2DKI A;  2O8V B;  3H79 A;  3VUR A;  1H4O A;  3DWV A;  1B9X C;  1M9A A;  1A2J A;  2QGV A;  2A4H A;  5FT3 A;  3GN3 A;  3GH9 A;  4IEL A;  3D22 A;  2WUL A;  2JAC A;  3QFB C;  4EIQ A;  2WS2 A;  5DAL B;  1M99 A;  3TKP A;  4EDZ A;  4OO4 A;  2IL3 A;  1XWG A;  1PN0 A;  2EIR A;  1F3A A;  2GT6 A;  4MA9 A;  4O5Q A;  3IV4 A;  1OC9 B;  2FWG A;  1PMT A;  4GSN A;  2REM A;  4D73 A;  2MZC A;  4Q5F A;  4XS4 A;  1NSW A;  1B4Q A;  4LMW A;  4WKW A;  1SK0 A;  5IPH A;  2DIY A;  2VD1 A;  3I6A A;  3E3E A;  3WGD A;  2IMF A;  3KH9 A;  4OO5 A;  4X4J A;  4HUA A;  2L5L A;  1A8Y A;  1U3A A;  2PVQ A;  3M0F A;  3U5R E;  5JWR B;  2VLV A;  5J5N A;  5DDL A;  1FVK A;  4K2X A;  1UA5 A;  3N5O A;  1GLP A;  3GKX A;  1K0N A;  1EGR A;  2LJK A;  4L5L A;  4O5R A;  1TJD A;  1U6T A;  4G2E A;  4WET A;  5FWG A;  3IAS 2;  1GNW A;  2L4C A;  5AGY A;  3TRQ A;  5DCH A;  3CYN A;  3D4T A;  4IJ3 A;  2F8A A;  4F82 A;  1U3I A;  3RDW A;  4HOJ A;  2JZS A;  3CQF A;  2HT9 A;  2WDU A;  2YWI A;  4KDU A;  3L78 A;  4J56 E;  4JBB A;  1GTB A;  4LLR A;  22GS A;  2P5Q A;  4KSO A;  4ACS A;  1BAY A;  3TDG A;  2MMZ A;  5JWQ B;  4O92 A;  2OE1 A;  1A2L A;  1Z5Y E;  3PPU A;  1AQV A;  1O8X A;  2P5R A;  3BD2 A;  2I9H A;  2XPD A;  4K6X A;  5ENU A;  3DXB A;  3LWA A;  2G2Q A;  3ERG A;  1WWJ A;  4P3Y B;  3C1S A;  1XW5 A;  2YV9 A;  2H6Z A;  5LCZ A;  1V98 A;  4TR3 A;  5B7C A;  4EXJ A;  2FUG 2;  2YP6 A;  1OYJ A;  2L57 A;  1I9D A;  1WIK A;  4HZ2 A;  4Z7X A;  4CY8 A;  5F07 A;  2OAD A;  1M7T A;  3EU3 A;  6GSU A;  1BJX A;  5DJL A;  4JR4 A;  1WMJ A;  3L9S A;  4I97 A;  5B8B A;  3WYW A;  3APS A;  5IOX A;  1SD8 A;  1R7H A;  2JSZ A;  3UIW A;  1V2A A;  5GAP D;  5HFK A;  2ALB A;  1O81 A;  1E6B A;  1MDK A;  2IPA A;  4PQI A;  3FR9 A;  3CRU A;  4GLT A;  4EDY A;  2AYT A;  1ERU A;  12GS A;  10GS A;  5ELA A;  4EKZ A;  3EWL A;  3KP9 A;  5J4U A;  5G2Z A;  2B5E A;  5KOX A;  2E7P A;  3PR8 A;  3KIJ A;  1ST9 A;  5DJM A;  3HD5 A;  3HVN A;  2C0G A;  1HD2 A;  3IE3 A;  1VRS D;  3ZIT A;  2FA4 A;  4RQX A;  3EYT A;  3MYD A;  3RPP A;  5G5F A;  2CVD A;  5HR3 A;  2O89 A;  2DLX A;  2QA1 A;  3DEX A;  4BL7 A;  3EE2 A;  2RM6 A;  2GT5 A;  3FMW A;  5D9X A;  1X9W B;  4XS1 A;  3D4M A;  2R37 A;  2VO4 A;  2GSQ A;  2FCH A;  1R26 A;  6GSS A;  3KGK A;  1K0C A;  3VI7 A;  4TW5 A;  4K0N A;  1TRU A;  1AIU A;  1Z7P A;  1K0A A;  3ZRD A;  1ERW A;  1TOF A;  3NOF A;  2B7J A;  2QKE A;  4BWS A;  2QA2 A;  1FVJ A;  1GLQ A;  4N0V A;  1J0F A;  1XZO A;  2GQM A;  4L5O A;  4K0G A;  3F9U A;  5DQS A;  2RUE A;  2VM1 A;  3GIX A;  2GST A;  1R5P A;  1OKD A;  5BRT A;  4IBP A;  1LJR A;  2GTU A;  1QUW A;  1SK1 A;  1Z6N A;  2LNS A;  5DQY A;  1FW1 A;  2TIR A;  3FR6 A;  4N10 A;  3HVV A;  1CQG A;  3UBK A;  2PBJ A;  1GSS A;  4MF5 A;  1OE7 A;  4ZBD A;  1Y6E A;  4K7I A;  1T7P B;  1Q98 A;  1HNB A;  3ERW A;  1SJZ A;  2H0G A;  3ZVJ D;  1XW6 A;  4WBJ A;  2M46 A;  3L9U A;  3IRA A;  2R2J A;  3TKQ A;  5CYY A;  3I9V 2;  4KX4 A;  1XWK A;  4LL1 B;  1U88 A;  3C73 A;  2CZ3 A;  4DSS A;  3TJK A;  1TK5 B;  3TGZ A;  3IK9 A;  2A2P A;  4A5P A;  1W4V A;  2HZE B;  2TRX A;  3FY7 A;  3BOA A;  5F0G A;  4CY6 A;  1A24 A;  3IA1 A;  3P7X A;  4TKY A;  2H6Y A;  4MPF A;  4ZBB A;  1X5C A;  2N5B A;  3RHC A;  5DVB A;  2LJR A;  3L0H A;  4J2F A;  4YKG A;  2I4A A;  5EVO A;  3W8J A;  1PL1 A;  3GST A;  1SL1 B;  4IP6 A;  1AC1 A;  5D96 A;  3E9J B;  2KLX A;  1KNG A;  1TDI A;  3BCK A;  3UJ1 A;  3H93 A;  3F3Q A;  4KA0 A;  4F9Z A;  3FYG A;  4EC0 A;  4PNF A;  1SK2 A;  4PUR A;  3GUS A;  4BVX A;  4RI6 A;  1EP8 A;  1QFN A;  3FHK A;  2XBQ A;  5J9C A;  1Z3E A;  2RM5 A;  3LQ7 A;  3GTU A;  3ED3 A;  2YWN A;  3VWV A;  4LL4 B;  4HJM A;  1N2A A;  1YJ6 A;  2BTO T;  4EVM A;  3KXO A;  4KF9 A;  4ZL9 A;  5IMZ A;  4IGJ A;  2H74 A;  3F3R A;  4HZ4 A;  3BJ5 A;  1GTI A;  1PSQ A;  2C0F A;  5IMC A;  4DSR A;  4TR0 A;  4ZL8 A;  1EOH A;  4ZBA A;  2DJK A;  2CAI A;  4HU7 A;  2JZR A;  3LW9 A;  4TN8 A;  4PQ1 A;  3D5J A;  3PH9 A;  3ZFL A;  3IDV A;  1K0O A;  2C1Y A;  2V41 A;  4IW9 A;  3M9K A;  1M0U A;  3J7Y k;  3SBC A;  2D2Z A;  1OE8 A;  2PVO C;  2XPE A;  2RLI A;  1ZMA A;  2EIQ A;  1MD4 A;  5EY6 A;  1AW9 A;  4XHM A;  3EMX A;  5L71 A;  4MNN A;  4ZIL A;  2WB9 A;  1EWX A;  4TXO B;  3APO A;  5D9V A;  2H0H A;  5G31 A;  4IQ1 A;  4OCE A;  2C0D A;  3C1R A;  3KEB A;  1QXH A;  3FK8 A;  2HSM A;  2IJY A;  2HYX A;  1X9S B;  2ZUP A;  1JLW A;  4POL A;  4GCI A;  1A23 A;  2LQO A;  3GV1 A;  1T4Z A;  2VIM A;  4F0C A;  4XRA A;  3DYR A;  2N5A A;  5ABR A;  2OBK A;  4IJI A;  2WGR A;  3MWH A;  2V2G A;  3A5I A;  1ON4 A;  5AIS A;  3EUR A;  1GSQ A;  1O7U A;  1A0R P;  3P90 A;  1SJ6 A;  3HYP A;  3FZ5 A;  4EE0 A;  3HY2 A;  3IAM 2;  2I1U A;  2YOI A;  3DVX A;  1OC3 A;  2OA7 A;  2HXK A;  5GZZ B;  4F0B A;  1SYR A;  3LG6 A;  5IPG A;  2XBI A;  1A2M A;  4IS0 A;  3H4K A;  2XC2 A;  4ZIJ A;  2YV7 A;  3UVH A;  2LST A;  1CQH A;  1YQ1 A;  4QL9 A;  1JZO A;  2H19 A;  2X64 A;  2LV3 A;  3VWU A;  1TP9 A;  2JAD A;  2NVL A;  2VL3 A;  3NZN A;  3ERF A;  3FR3 A;  3CSJ A;  1S3A A;  3EIN A;  3HXS A;  4MPG A;  2C80 A;  2MMO A;  3UAR A;  2CX3 A;  1A0F A;  4KDX A;  5B8A A;  1YDK A;  3RHB A;  2H8L A;  1HQO A;  4YQM A;  1EOG A;  3BCI A;  3MIX A;  1USB A;  5ECN B;  4AJ8 A;  1ML6 A;  4H86 A;  2MMN A;  2HI7 A;  2L4Q A;  1RW1 A;  2FWH A;  4ECJ A;  5ECL B;  1HNA A;  4K7N A;  4NHZ A;  3HA9 A;  5DAK B;  5ECO B;  1FHE A;  5G1K A;  4X0X A;  1WPI A;  2V1M A;  2I3Y A;  2R5G A;  5KEJ A;  2CAQ A;  3TRP A;  1A8L A;  5J9B A;  1OKT A;  1S3D A;  1BED A;  1M3I A;  1XIY A;  3HVX A;  4RQR A;  1WJK A;  2IMK A;  2VCW A;  2H72 A;  3CSI A;  2MBS A;  3HDC A;  4HSC X;  4X1U A;  1VF4 A;  2HNL A;  3UMA A;  4TXV A;  2K18 A;  3W6G A;  1EP7 A;  1FAA A;  5B6N A;  3LEF A;  2HRN A;  4LA1 A;  5HR0 A;  1X5E A;  2GZZ A;  2X8C A;  2WZ9 A;  4N30 A;  1TRS A;  3IXR A;  2DJJ A;  4CDO A;  4K8M A;  4YAV A;  4Q5Q A;  4G0K A;  2HRK A;  3H1N A;  1PQN A;  1IYI A;  1SD9 A;  3U6V A;  4MZB A;  1B8X A;  4L0W A;  1V57 A;  1AUC A;  16GS A;  2YJ7 A;  1WP0 A;  1GSD A;  3FZ4 A;  4QQ7 A;  4EIP A;  1NHO A;  1XOA A;  3TJF A;  3EU4 A;  2FD3 A;  1XOB A;  5KN1 A;  3GRX A;  2GGT A;  2CVB A;  3F0I A;  5ECK B;  2LKU A;  4NHW A;  4ZB8 A;  1T4Y A;  6GST A;  1M3J A;  13GS A;  2VL2 C;  1YF1 A;  3E0U A;  2X8G A;  4EO3 A;  4AF2 A;  6GSX A;  2AJQ B;  3IC8 A;  2R4V A;  4KSM A;  2YCD A;  1B48 A;  2WFC A;  3IR4 A;  4GF0 A;  2GZY A;  1QK8 A;  3KH7 A;  1TI1 A;  5IMD A;  2R0P A;  3GKK A;  4FYU A;  5ECR B;  1WE0 A;  2DJ2 A;  3IHG A;  3Q19 A;  1G6Y A;  5JCG A;  2C3Q A;  4D73 B;  2DML A;  4K5S A;  1JZR A;  2AHE A;  4JRR A;  1PX6 A;  5CRH A;  2AV4 A;  4FYC A;  5H5S A;  5ECQ B;  5GST A;  3G7J A;  2IFQ A;  4HQS A;  3IK7 A;  2Z9S A;  3N9J A;  3GSS A;  1G0T A;  5D9W A;  1R5A A;  2X4A A;  4ID0 A;  4ZXG A;  3KM6 A;  2UZ8 A;  1Z6M A;  1AQX A;  3PIN A;  4ZL7 A;  2DSA A;  3HCZ A;  1ILO A;  3J7Y b;  2O87 A;  5HQP A;  4O32 A;  5JCW A;  2H1A A;  1J08 A;  3LYK A;  3KTB A;  4WR5 A;  1Y25 A;  2G0F A;  4MMM A;  3TJJ A;  3TOU A;  2K9F A;  1EZK A;  2VCV A;  3I43 A;  5G5E A;  3DKS A;  2E2M A;  3C7M A;  4DSQ A;  3EVI A;  2M80 A;  2FGX A;  1UC7 A;  3D6I A;  1KEB A;  1TXX A;  3FZA A;  3VWX A;  5IM9 A;  1PA3 A;  1SKW B;  2B1K A;  1RQM A;  1GSF A;  2PWJ A;  3QD9 A;  1GSE A;  2P31 A;  2X8H A;  1XFL A;  2E0Q A;  4CW9 A;  2HZF A;  2CV4 A;  2DIZ A;  1ZZY A;  3V1W A;  1K0B A;  3F6D A;  4POK A;  1BQ7 A;  1GUL A;  3TB2 A;  3M8N A;  4Z2U A;  2CQ9 A;  3ZIV A;  3QR6 A;  3TKS C;  2H01 A;  1K0M A;  2GQL A;  4F2I A;  5INY A;  2MMA A;  2MYG A;  5HFI A;  1Q4J A;  4IVF A;  2E2G A;  3UAP A;  1BG5 A;  1XWB A;  5A4V A;  3FEU A;  1EGO A;  4NPB A;  4PUA A;  1KBN A;  2PER A;  3OR5 A;  4ML6 A;  5ELG A;  1T8E B;  4L0U A;  4BPY A;  4WXT A;  3WGE A;  2A4V A;  4MJC A;  2BMX A;  2J23 A;  5LD0 A;  3L4N A;  4TVE A;  4GXZ A;  4TR1 A;  3HJP A;  4GST A;  2RUF A;  5J3R A;  4KAE A;  4PX1 A;  1AAZ A;  2H70 A;  4AGS A;  5ID2 A;  4OWY A;  1T3B A;  4TOP A;  1EV9 A;  2BJX A;  1EEJ A;  3HVS A;  1PGT A;  3G7Y A;  3GX8 A;  2HSY A;  3KMO A;  5AIV A;  2N5F A;  2TRC P;  4XRD A;  5CRW A;  2AB6 A;  2ON7 A;  3F6F A;  2IMI A;  4ZB6 A;  3CSH A;  4BIK A;  3GHA A;  3LGC A;  3DML A;  5BMU A;  1TK8 B;  5H5Q A;  1XW9 A;  4BVY A;  1JZW A;  3F8U A;  1DE2 A;  3FRC A;  3GH6 A;  1BX9 A;  5E59 A;  4G9H A;  4BL7 B;  5ECI B;  5COH A;  5ECM B;  3RAZ A;  3VPQ A;  3R2Q A;  4EUY A;  3HZ4 A;  2FA8 A;  1OC8 A;  3A2W A;  2H76 A;  3ZLP A;  1PN9 A;  2HLS A;  2HRA A;  1F2E A;  3K8N A;  1T1V A;  3EMP A;  2OKA A;  1I5G A;  1KTE A;  1YEP A;  11GS A;  1XPV A;  4YKF A;  4WF5 A;  3VLN A;  1GH2 A;  1GUM A;  1O85 A;  2IIY A;  1K3L A;  3MNG A;  1ZOF A;  5CO3 A;  3LYP A;  3ME7 A;  2A2R A;  5F05 A;  14GS A;  4NMU A;  5G1L A;  2CZ2 A;  2OAC A;  1S3R A;  2YWM A;  3DVW A;  1ZL9 A;  5FHI A;  3TRX A;  1LBK A;  3IHQ A;  2F9S A;  2ES7 A;  3ZFB A;  3RBT A;  1HNC A;  3O6T A;  3GUR A;  2CVK A;  3C71 A;  1ERV A;  2LUS A;  2QC7 A;  2K8S A;  3GMF A;  3LXT A;  4V2M A;  1C72 A;  2PN8 A;  5DAL A;  4MK3 A;  2GQK A;  4WEY A;  1GTA A;  4YQU A;  4DSS B;  1T00 A;  2MBT A;  2V32 A;  2YAN A;  4HJ2 A;  2J9H A;  2H0I A;  2LJA A;  1SL0 B;  1U87 A;  1OC9 A;  3ME8 A;  2V6O A;  1RK4 A;  2EC4 A;  1JHB A;  3DGQ A;  1ZGN A;  3F4R A;  5AIX A;  1QGV A;  4PQH A;  2YJH A;  4NWY A;  2FLS A;  2VUP A;  4WR4 A;  3TKS E;  1VF3 A;  5HFG A;  2K6V A;  4ULX A;  2HSH A;  1K0D A;  4Q5R A;  1V58 A;  1M9B A;  3HJO A;  2VCT A;  3CBU A;  2CX4 A;  2HFD A;  2VD0 A;  4OFN A;  3ZVJ A;  1UVZ A;  3NIV A;  5KN0 A;  4HI7 A;  1SJI A;  3IPZ A;  1DE1 A;  5ECS A;  4BVX B;  2FNO A;  1PKZ A;  4KE3 A;  5H5R A;  6GSW A;  2C3T A;  1XWC A;  3GTU B;  5ECH B;  2B5X A;  1SKR B;  4CHS A;  1MDJ A;  4MP4 A;  4I2T A;  1SL2 B;  3ZIJ A;  1X0R A;  1PD2 1;  4MF7 A;  4KGI A;  2LEG A;  1S3C A;  2RII A;  3FW2 A;  3UEM A;  5C04 A;  4ML1 A;  1SKS B;  4NV5 A;  2M72 A;  4Z2R A;  2EIO A;  3KP8 A;  2C8U A;  5DBQ A;  4DEJ A;  2DMM A;  3TJG A;  3M1G A;  4IHU A;  2QSI A;  4ECI A;  1FG4 A;  3P2A A;  3TUE A;  1Z9H A;  3L9V A;  4MAB A;  4IN0 A;  3GL5 A;  2CT6 A;  2F51 A;  4OD7 A; 
#chains in the Genus database with same CATH homology
 5CAX A;  5E4W A;  4GQF A;  3LFL A;  5AN1 A;  4AJ7 A;  1YZX A;  4GQC A;  2IN3 A;  1DUG A;  1FB0 A;  5IO2 A;  2ZNM A;  2ON5 A;  2X99 A;  2VLT A;  1NM3 A;  4MJB A;  1GTU A;  3CTG A;  4KW6 A;  3KTL A;  5CNW A;  5IQY A;  2OJL A;  2KOK A;  2PMT A;  5F06 A;  2DKH A;  3D21 A;  3KMN A;  3LJR A;  4OFT A;  2LNT A;  2FWF A;  2L6D A;  1FB6 A;  4ISD A;  1YF0 A;  3ZTL A;  3US3 A;  2JU5 A;  1K3O A;  3Q74 A;  1QMV A;  3WT2 A;  1TW9 A;  3M9J A;  3HJM A;  4KUN A;  1ZYN A;  4G0L A;  3KJY A;  4WF4 A;  3A5W A;  1B4P A;  3GX0 A;  2JZT A;  8GSS A;  4ILF A;  3G9B A;  5D9T A;  4E8H A;  5IMF A;  1N8J A;  2VLU A;  2JSY A;  3LSZ A;  3VFI A;  1GSY A;  2V6K A;  1GRX A;  3A3T A;  3TOT A;  1O73 A;  1AXD A;  1F37 A;  1THO A;  3UOM A;  2AUV A;  2GVP A;  1G7E A;  2P0G A;  20GS A;  4PNG A;  7GSS A;  1THX A;  2H1G A;  2X49 A;  4K5R A;  5CRD A;  4MJE A;  1XCC A;  3VK9 A;  4NAX A;  2R6K A;  2WJU A;  3GFK A;  4V2N A;  4N0Z A;  1V9W A;  4MDC A;  1VF1 A;  1NHY A;  1X9M B;  2R0G A;  2YPM A;  5D93 A;  3M3M A;  1AQW A;  4HQZ A;  2WRT A;  2HRF A;  3QFA C;  1M2A A;  1MD3 A;  5EPF A;  1H75 A;  6GSV A;  3CRT A;  2H75 A;  1FOV A;  4POM A;  1GUK A;  3I69 A;  4MCU A;  4Z2T A;  4ICY A;  1URM A;  4J57 E;  3ISO A;  9GSS A;  1O8W A;  2F3M A;  1GSU A;  1PX7 A;  3LXZ A;  3DD3 A;  4YH2 A;  3KZQ A;  1FOH A;  4ECC A;  1TK0 B;  4FO5 A;  2H71 A;  1YEX A;  2VCQ A;  4X43 A;  2C3N A;  5F8B A;  5EL8 A;  1TI3 A;  2GSS A;  4XS4 B;  4K1F A;  3D0Z A;  1XVQ A;  2YNX A;  2H66 A;  4MJA A;  5A4U A;  1SU9 A;  2AAW A;  3GKN A;  2B5Y A;  1MEK A;  4I2U A;  4MH3 A;  2KP2 A;  5IIZ A;  4FH8 A;  3S9F A;  3LOR A;  2O85 A;  19GS A;  3HHV A;  3QMX A;  1JLV A;  5CP1 A;  2YZH A;  2XHF A;  2HZE A;  4G19 A;  2OBI A;  1HYU A;  2A2S A;  4YAP A;  3MDK A;  1TU8 A;  1GUH A;  4I5Q A;  4RI7 A;  3A2X A;  1XBS A;  4JE1 A;  4LMV A;  3F4S A;  3VWW A;  4FQU A;  2VL9 A;  1R4W A;  3TCO A;  1UN2 A;  4TR4 A;  1PRX A;  5KN3 A;  4K2D A;  1DSB A;  2VCZ A;  1JZD A;  4WBR D;  2IME A;  3IOS A;  1FO5 A;  3F4T A;  5C00 A;  2H30 A;  3FZ9 A;  5B6M A;  4I6X A;  3QAG A;  4KDY A;  2DJ0 A;  3QDN A;  4PGT A;  5CRE A;  1ABA A;  1XXU A;  4G0I A;  1GNE A;  1TRV A;  3GNJ A;  4JZQ A;  1YY7 A;  3GL3 A;  2DJ3 A;  4KND A;  2JL4 A;  4MLY A;  4KCE A;  5IMV A;  5KN2 A;  5CRG A;  3UBL A;  3P8W A;  1F9M A;  5J41 A;  5JCU A;  1IYH A;  5GSS A;  3O76 A;  3DIE A;  1ZYE A;  4JED A;  3UVT A;  4I8B A;  4N11 A;  2H73 A;  4XTS A;  1M2D A;  3WGX A;  3QOU A;  2OE3 A;  4K7O A;  1VGL A;  2LTK A;  1ZCP A;  2VL2 A;  2DC5 A;  5G30 A;  2L6C A;  2VOC A;  17GS A;  1SEN A;  4K9Z A;  3WT1 A;  1WOU A;  3VPT A;  5A5K A;  1MDI A;  1F6M C;  2KUC A;  2B7K A;  2H6X A;  3EPT A;  4E8E A;  3RPN A;  1PKW A;  3VI5 A;  1GWC A;  4IKH A;  3AY8 A;  4XIH A;  3CMI A;  4MF6 A;  2IFQ B;  2LRN A;  1W89 A;  5HR1 A;  1J9B A;  4TXO A;  4AJ6 A;  2HE3 A;  4ZB9 A;  4HEA 2;  3CTF A;  4XS6 A;  4HS1 A;  2B3S A;  4QL7 A;  2DBC A;  4XCS A;  4FIW A;  3ZRE A;  4BA7 A;  1OVN A;  4PUF C;  3G7I A;  3KCM A;  2OE0 A;  2B6M A;  4TRX A;  1X5D A;  2GSR A;  3QAV A;  5IO0 A;  1TTZ A;  3QPM A;  1K3Y A;  1XWA A;  4PXO A;  4ECB A;  4F03 A;  2C4J A;  4NXI A;  2PGT A;  4GWR A;  3R3E A;  3ZL5 A;  3QCP A;  4OCF A;  2GDR A;  4KH7 A;  4L8E A;  1B9Y C;  2O7K A;  3EC3 A;  4MH2 A;  3GKM A;  2YWO A;  3QAW A;  5JWO B;  1TKD B;  3ZZX A;  5D73 A;  1TRW A;  2KHP A;  2H1B A;  1QQ2 A;  2WCI A;  3ZYW A;  2DJ1 A;  4YQV A;  2LRT A;  2LRC A;  4FYB A;  5D8I A;  1ZYQ B;  1JFU A;  2L59 A;  3PGT A;  5IOW A;  4JU5 A;  4HDE A;  3BBY A;  3MAK A;  2FHE A;  2GLR A;  3UL3 A;  2B1L A;  1E2Y A;  2PPT A;  3TKR A;  3C8E A;  3HKR A;  3TKS A;  1NW2 A;  5GAN D;  3APQ A;  4KB3 A;  5KOW A;  3A2V A;  1ZYP A;  4GTU A;  4NV2 A;  2GS3 A;  4Q5N A;  2L5O A;  5LNK e;  3SWL A;  1V40 A;  1WRY A;  4TR1 B;  5A4W A;  3KD0 A;  2R0C A;  2LQQ A;  2NDO A;  1G6W A;  1XVW A;  3H8Q A;  2NBS A;  1O6J A;  3ZMK A;  2LS5 A;  5ID2 B;  2F8F A;  2C0E A;  3FKF A;  6GSY A;  4POB A;  4IP1 A;  4O7H A;  2VAF A;  4EF0 A;  4OMV A;  2NPB A;  1YKC A;  1DBY A;  4BWQ A;  4OFM A;  4O5U A;  4HU9 A;  3IC4 A;  5IMA A;  3HZ8 A;  3GYK A;  2YZU A;  5DAK A;  5ECP B;  1PL2 A;  1VF2 A;  3CXG A;  1GP1 A;  3TJB A;  4BVY B;  4EL1 A;  2NTO A;  3GA4 A;  1Z7R A;  2VCX A;  3WD6 A;  2PU9 C;  1OAZ A;  4DVC A;  1G7O A;  4GSS A;  3ZML A;  2VM2 A;  4MZC A;  1GL8 A;  3O3T A;  1ERT A;  3JCM L;  1YKA A;  2IMD A;  4PTS A;  3DRN A;  3Q18 A;  2FWE A;  1EV4 A;  1TU7 A;  2ZCT A;  1BYE A;  4V1A g;  1MTC A;  2K8V A;  4GRF A;  4KCA A;  2H1D A;  1F3B A;  1M2B A;  2R3X A;  2PUK C;  5DCG A;  3MSZ A;  3F63 A;  2GZP A;  2CA8 A;  4JR6 A;  2KP1 A;  5HR2 A;  1EEM A;  2YN1 A;  1ACV A;  4V2L A;  1LU4 A;  2I81 A;  4RUV A;  3Q6O A;  4G10 A;  1SYX A;  4V1A p;  18GS A;  3W8S A;  4MZW A;  2IWT A;  4USS A;  2FY6 A;  3IBH A;  4IQA A;  2DKI A;  2O8V B;  3H79 A;  3VUR A;  1H4O A;  3DWV A;  1B9X C;  1M9A A;  1A2J A;  2QGV A;  2A4H A;  5FT3 A;  3GN3 A;  3GH9 A;  4IEL A;  3D22 A;  2WUL A;  2JAC A;  3QFB C;  4EIQ A;  2WS2 A;  5DAL B;  1M99 A;  3TKP A;  4EDZ A;  4OO4 A;  2IL3 A;  1XWG A;  1PN0 A;  2EIR A;  1F3A A;  2GT6 A;  4MA9 A;  4O5Q A;  3IV4 A;  1OC9 B;  2FWG A;  1PMT A;  4GSN A;  2REM A;  4D73 A;  2MZC A;  4Q5F A;  4XS4 A;  1NSW A;  1B4Q A;  4LMW A;  4WKW A;  1SK0 A;  5IPH A;  2DIY A;  2VD1 A;  3I6A A;  3E3E A;  3WGD A;  2IMF A;  3KH9 A;  4OO5 A;  4X4J A;  4HUA A;  2L5L A;  1A8Y A;  1U3A A;  2PVQ A;  3M0F A;  3U5R E;  5JWR B;  2VLV A;  5J5N A;  5DDL A;  1FVK A;  4K2X A;  1UA5 A;  3N5O A;  1GLP A;  3GKX A;  1K0N A;  1EGR A;  2LJK A;  4L5L A;  4O5R A;  1TJD A;  1U6T A;  4G2E A;  4WET A;  5FWG A;  3IAS 2;  1GNW A;  2L4C A;  5AGY A;  3TRQ A;  5DCH A;  3CYN A;  3D4T A;  4IJ3 A;  2F8A A;  4F82 A;  1U3I A;  3RDW A;  4HOJ A;  2JZS A;  2HT9 A;  2WDU A;  2YWI A;  4KDU A;  3L78 A;  4J56 E;  4JBB A;  1GTB A;  4LLR A;  22GS A;  2P5Q A;  4KSO A;  4ACS A;  1BAY A;  3TDG A;  2MMZ A;  5JWQ B;  4O92 A;  2OE1 A;  1A2L A;  1Z5Y E;  3PPU A;  1AQV A;  1O8X A;  2P5R A;  3BD2 A;  2I9H A;  2XPD A;  4K6X A;  5ENU A;  3DXB A;  3LWA A;  2G2Q A;  3ERG A;  1WWJ A;  4P3Y B;  3C1S A;  1XW5 A;  2YV9 A;  2H6Z A;  5LCZ A;  1V98 A;  4TR3 A;  5B7C A;  4EXJ A;  2FUG 2;  2YP6 A;  1OYJ A;  2L57 A;  1I9D A;  1WIK A;  4HZ2 A;  4Z7X A;  4CY8 A;  5F07 A;  2OAD A;  1M7T A;  3EU3 A;  6GSU A;  1BJX A;  5DJL A;  4JR4 A;  1WMJ A;  3L9S A;  4I97 A;  5B8B A;  3WYW A;  3APS A;  5IOX A;  1SD8 A;  1R7H A;  2JSZ A;  3UIW A;  1V2A A;  5GAP D;  5HFK A;  2ALB A;  1O81 A;  1E6B A;  1MDK A;  2IPA A;  4PQI A;  3FR9 A;  3CRU A;  4GLT A;  4EDY A;  2AYT A;  1ERU A;  12GS A;  10GS A;  5ELA A;  4EKZ A;  3EWL A;  3KP9 A;  5J4U A;  5G2Z A;  2B5E A;  5KOX A;  2E7P A;  3PR8 A;  3KIJ A;  1ST9 A;  5DJM A;  3HD5 A;  2C0G A;  1HD2 A;  3IE3 A;  1VRS D;  3ZIT A;  2FA4 A;  4RQX A;  3EYT A;  3MYD A;  3RPP A;  5G5F A;  2CVD A;  5HR3 A;  2O89 A;  2DLX A;  2QA1 A;  3DEX A;  4BL7 A;  3EE2 A;  2RM6 A;  2GT5 A;  3FMW A;  5D9X A;  1X9W B;  4XS1 A;  3D4M A;  2R37 A;  2VO4 A;  2GSQ A;  2FCH A;  1R26 A;  6GSS A;  3KGK A;  1K0C A;  3VI7 A;  4TW5 A;  4K0N A;  1TRU A;  1AIU A;  1Z7P A;  1K0A A;  3ZRD A;  1ERW A;  1TOF A;  3NOF A;  2B7J A;  2QKE A;  4BWS A;  2QA2 A;  1FVJ A;  1GLQ A;  4N0V A;  1J0F A;  1XZO A;  2GQM A;  4L5O A;  4K0G A;  3F9U A;  5DQS A;  2RUE A;  2VM1 A;  3GIX A;  2GST A;  1R5P A;  1OKD A;  5BRT A;  4IBP A;  1LJR A;  2GTU A;  1QUW A;  1SK1 A;  1Z6N A;  2LNS A;  5DQY A;  1FW1 A;  2TIR A;  3FR6 A;  4N10 A;  3HVV A;  1CQG A;  3UBK A;  2PBJ A;  1GSS A;  4MF5 A;  1OE7 A;  4ZBD A;  1Y6E A;  4K7I A;  1T7P B;  1Q98 A;  1HNB A;  3ERW A;  1SJZ A;  2H0G A;  3ZVJ D;  1XW6 A;  4WBJ A;  2M46 A;  3L9U A;  3IRA A;  2R2J A;  3TKQ A;  5CYY A;  3I9V 2;  4KX4 A;  1XWK A;  4LL1 B;  1U88 A;  3C73 A;  2CZ3 A;  4DSS A;  3TJK A;  1TK5 B;  3TGZ A;  3IK9 A;  2A2P A;  4A5P A;  1W4V A;  2HZE B;  2TRX A;  3FY7 A;  3BOA A;  5F0G A;  4CY6 A;  1A24 A;  3IA1 A;  3P7X A;  4TKY A;  2H6Y A;  4MPF A;  4ZBB A;  1X5C A;  2N5B A;  3RHC A;  5DVB A;  2LJR A;  3L0H A;  4J2F A;  4YKG A;  2I4A A;  5EVO A;  3W8J A;  1PL1 A;  3GST A;  1SL1 B;  4IP6 A;  1AC1 A;  5D96 A;  3E9J B;  2KLX A;  1KNG A;  1TDI A;  3BCK A;  3UJ1 A;  3H93 A;  3F3Q A;  4KA0 A;  4F9Z A;  3FYG A;  4EC0 A;  4PNF A;  1SK2 A;  4PUR A;  3GUS A;  4BVX A;  4RI6 A;  1EP8 A;  1QFN A;  3FHK A;  2XBQ A;  5J9C A;  1Z3E A;  2RM5 A;  3LQ7 A;  3GTU A;  3ED3 A;  2YWN A;  3VWV A;  4LL4 B;  4HJM A;  1N2A A;  1YJ6 A;  2BTO T;  4EVM A;  3KXO A;  4KF9 A;  4ZL9 A;  5IMZ A;  4IGJ A;  2H74 A;  3F3R A;  4HZ4 A;  3BJ5 A;  1GTI A;  1PSQ A;  2C0F A;  5IMC A;  4DSR A;  4TR0 A;  4ZL8 A;  1EOH A;  4ZBA A;  2DJK A;  2CAI A;  4HU7 A;  2JZR A;  3LW9 A;  4TN8 A;  4PQ1 A;  3D5J A;  3PH9 A;  3ZFL A;  3IDV A;  1K0O A;  2C1Y A;  2V41 A;  4IW9 A;  3M9K A;  1M0U A;  3J7Y k;  3SBC A;  2D2Z A;  1OE8 A;  2PVO C;  2XPE A;  2RLI A;  1ZMA A;  2EIQ A;  1MD4 A;  5EY6 A;  1AW9 A;  4XHM A;  3EMX A;  5L71 A;  4MNN A;  4ZIL A;  2WB9 A;  1EWX A;  4TXO B;  3APO A;  5D9V A;  2H0H A;  5G31 A;  4IQ1 A;  4OCE A;  2C0D A;  3C1R A;  3KEB A;  1QXH A;  3FK8 A;  2HSM A;  2IJY A;  2HYX A;  1X9S B;  2ZUP A;  1JLW A;  4POL A;  4GCI A;  1A23 A;  2LQO A;  3GV1 A;  1T4Z A;  2VIM A;  4F0C A;  4XRA A;  3DYR A;  2N5A A;  5ABR A;  2OBK A;  4IJI A;  2WGR A;  3MWH A;  2V2G A;  3A5I A;  1ON4 A;  5AIS A;  3EUR A;  1GSQ A;  1O7U A;  1A0R P;  3P90 A;  1SJ6 A;  3HYP A;  3FZ5 A;  4EE0 A;  3HY2 A;  3IAM 2;  2I1U A;  2YOI A;  3DVX A;  1OC3 A;  2OA7 A;  2HXK A;  5GZZ B;  4F0B A;  1SYR A;  3LG6 A;  5IPG A;  2XBI A;  1A2M A;  4IS0 A;  3H4K A;  2XC2 A;  4ZIJ A;  2YV7 A;  3UVH A;  2LST A;  1CQH A;  1YQ1 A;  4QL9 A;  1JZO A;  2H19 A;  2X64 A;  2LV3 A;  3VWU A;  1TP9 A;  2JAD A;  2NVL A;  2VL3 A;  3NZN A;  3ERF A;  3FR3 A;  3CSJ A;  1S3A A;  3EIN A;  3HXS A;  4MPG A;  2C80 A;  2MMO A;  3UAR A;  2CX3 A;  1A0F A;  4KDX A;  5B8A A;  1YDK A;  3RHB A;  2H8L A;  1HQO A;  4YQM A;  1EOG A;  3BCI A;  3MIX A;  1USB A;  5ECN B;  4AJ8 A;  1ML6 A;  4H86 A;  2MMN A;  2HI7 A;  2L4Q A;  1RW1 A;  2FWH A;  4ECJ A;  5ECL B;  1HNA A;  4K7N A;  4NHZ A;  3HA9 A;  5DAK B;  5ECO B;  1FHE A;  5G1K A;  4X0X A;  1WPI A;  2V1M A;  2I3Y A;  2R5G A;  5KEJ A;  2CAQ A;  3TRP A;  1A8L A;  5J9B A;  1OKT A;  1S3D A;  1BED A;  4RQR A;  1XIY A;  3HVX A;  1WJK A;  2IMK A;  2VCW A;  2H72 A;  3CSI A;  2MBS A;  3HDC A;  4X1U A;  1VF4 A;  2HNL A;  3UMA A;  4TXV A;  2K18 A;  3W6G A;  1EP7 A;  1FAA A;  5B6N A;  3LEF A;  2HRN A;  4LA1 A;  5HR0 A;  1X5E A;  2GZZ A;  2X8C A;  2WZ9 A;  4N30 A;  1TRS A;  3IXR A;  2DJJ A;  4CDO A;  4K8M A;  4YAV A;  4Q5Q A;  4G0K A;  2HRK A;  3H1N A;  1PQN A;  1IYI A;  1SD9 A;  3U6V A;  4MZB A;  1B8X A;  4L0W A;  1V57 A;  1AUC A;  16GS A;  2YJ7 A;  1WP0 A;  1GSD A;  3FZ4 A;  4QQ7 A;  4EIP A;  1NHO A;  1XOA A;  3TJF A;  3EU4 A;  2FD3 A;  1XOB A;  5KN1 A;  3GRX A;  2GGT A;  2CVB A;  3F0I A;  5ECK B;  2LKU A;  4NHW A;  4ZB8 A;  1T4Y A;  6GST A;  13GS A;  2VL2 C;  1YF1 A;  3E0U A;  2X8G A;  4EO3 A;  4AF2 A;  6GSX A;  2AJQ B;  3IC8 A;  2R4V A;  4KSM A;  2YCD A;  1B48 A;  2WFC A;  3IR4 A;  4GF0 A;  2GZY A;  1QK8 A;  3KH7 A;  1TI1 A;  5IMD A;  2R0P A;  3GKK A;  4FYU A;  5ECR B;  1WE0 A;  2DJ2 A;  3IHG A;  3Q19 A;  1G6Y A;  5JCG A;  2C3Q A;  4D73 B;  2DML A;  4K5S A;  1JZR A;  2AHE A;  4JRR A;  1PX6 A;  5CRH A;  2AV4 A;  4FYC A;  5H5S A;  5ECQ B;  5GST A;  3G7J A;  2IFQ A;  4HQS A;  3IK7 A;  2Z9S A;  3N9J A;  3GSS A;  1G0T A;  5D9W A;  1R5A A;  2X4A A;  4ID0 A;  4ZXG A;  3KM6 A;  2UZ8 A;  1Z6M A;  1AQX A;  3PIN A;  4ZL7 A;  2DSA A;  3HCZ A;  1ILO A;  3J7Y b;  2O87 A;  5HQP A;  4O32 A;  5JCW A;  2H1A A;  1J08 A;  3LYK A;  3KTB A;  4WR5 A;  1Y25 A;  2G0F A;  4MMM A;  3TJJ A;  3TOU A;  2K9F A;  1EZK A;  2VCV A;  3I43 A;  5G5E A;  3DKS A;  2E2M A;  3C7M A;  4DSQ A;  3EVI A;  2M80 A;  2FGX A;  1UC7 A;  3D6I A;  1KEB A;  1TXX A;  3FZA A;  3VWX A;  5IM9 A;  1PA3 A;  1SKW B;  2B1K A;  1RQM A;  1GSF A;  2PWJ A;  3QD9 A;  1GSE A;  2P31 A;  2X8H A;  1XFL A;  2E0Q A;  4CW9 A;  2HZF A;  2CV4 A;  2DIZ A;  1ZZY A;  3V1W A;  1K0B A;  3F6D A;  4POK A;  1BQ7 A;  1GUL A;  3TB2 A;  3M8N A;  4Z2U A;  2CQ9 A;  3ZIV A;  3QR6 A;  3TKS C;  2H01 A;  1K0M A;  2GQL A;  4F2I A;  5INY A;  2MMA A;  2MYG A;  5HFI A;  1Q4J A;  4IVF A;  2E2G A;  3UAP A;  1BG5 A;  1XWB A;  5A4V A;  3FEU A;  1EGO A;  4NPB A;  4PUA A;  1KBN A;  2PER A;  3OR5 A;  4ML6 A;  5ELG A;  1T8E B;  4L0U A;  4BPY A;  4WXT A;  3WGE A;  2A4V A;  4MJC A;  2BMX A;  2J23 A;  5LD0 A;  3L4N A;  4TVE A;  4GXZ A;  4TR1 A;  3HJP A;  4GST A;  2RUF A;  5J3R A;  4KAE A;  4PX1 A;  1AAZ A;  2H70 A;  4AGS A;  5ID2 A;  4OWY A;  1T3B A;  4TOP A;  1EV9 A;  2BJX A;  1EEJ A;  3HVS A;  1PGT A;  3G7Y A;  3GX8 A;  2HSY A;  3KMO A;  5AIV A;  2N5F A;  2TRC P;  4XRD A;  5CRW A;  2AB6 A;  2ON7 A;  3F6F A;  2IMI A;  4ZB6 A;  3CSH A;  3GHA A;  3LGC A;  3DML A;  5BMU A;  1TK8 B;  5H5Q A;  1XW9 A;  4BVY A;  1JZW A;  3F8U A;  1DE2 A;  3FRC A;  3GH6 A;  1BX9 A;  5E59 A;  4G9H A;  4BL7 B;  5ECI B;  5COH A;  5ECM B;  3RAZ A;  3VPQ A;  3R2Q A;  4EUY A;  3HZ4 A;  2FA8 A;  1OC8 A;  3A2W A;  2H76 A;  3ZLP A;  1PN9 A;  2HLS A;  2HRA A;  1F2E A;  3K8N A;  1T1V A;  3EMP A;  2OKA A;  1I5G A;  1KTE A;  1YEP A;  11GS A;  1XPV A;  4YKF A;  4WF5 A;  3VLN A;  1GH2 A;  1GUM A;  1O85 A;  2IIY A;  1K3L A;  3MNG A;  1ZOF A;  5CO3 A;  3LYP A;  3ME7 A;  2A2R A;  5F05 A;  14GS A;  4NMU A;  5G1L A;  2CZ2 A;  2OAC A;  2YWM A;  3DVW A;  1ZL9 A;  5FHI A;  3TRX A;  1LBK A;  3IHQ A;  2F9S A;  2ES7 A;  3ZFB A;  3RBT A;  1HNC A;  3O6T A;  3GUR A;  2CVK A;  3C71 A;  1ERV A;  2LUS A;  2QC7 A;  2K8S A;  3GMF A;  3LXT A;  4V2M A;  1C72 A;  2PN8 A;  5DAL A;  4MK3 A;  2GQK A;  4WEY A;  1GTA A;  4YQU A;  4DSS B;  1T00 A;  2MBT A;  2V32 A;  2YAN A;  4HJ2 A;  2J9H A;  2H0I A;  2LJA A;  1SL0 B;  1U87 A;  1OC9 A;  3ME8 A;  2V6O A;  1RK4 A;  2EC4 A;  1JHB A;  3DGQ A;  1ZGN A;  3F4R A;  5AIX A;  1QGV A;  4PQH A;  2YJH A;  4NWY A;  2FLS A;  2VUP A;  4WR4 A;  3TKS E;  1VF3 A;  5HFG A;  2K6V A;  4ULX A;  2HSH A;  1K0D A;  4Q5R A;  1V58 A;  1M9B A;  3HJO A;  2VCT A;  3CBU A;  2CX4 A;  2HFD A;  2VD0 A;  4OFN A;  3ZVJ A;  1UVZ A;  3NIV A;  5KN0 A;  4HI7 A;  1SJI A;  3IPZ A;  1DE1 A;  5ECS A;  4BVX B;  2FNO A;  1PKZ A;  4KE3 A;  5H5R A;  6GSW A;  2C3T A;  1XWC A;  3GTU B;  5ECH B;  2B5X A;  1SKR B;  4CHS A;  1MDJ A;  4MP4 A;  4I2T A;  1SL2 B;  3ZIJ A;  1X0R A;  1PD2 1;  4MF7 A;  4KGI A;  2LEG A;  1S3C A;  2RII A;  3FW2 A;  3UEM A;  5C04 A;  4ML1 A;  1SKS B;  4NV5 A;  2M72 A;  4Z2R A;  2EIO A;  3KP8 A;  2C8U A;  5DBQ A;  4DEJ A;  2DMM A;  3TJG A;  3M1G A;  4IHU A;  2QSI A;  4ECI A;  1FG4 A;  3P2A A;  3TUE A;  1Z9H A;  3L9V A;  4MAB A;  4IN0 A;  3GL5 A;  2CT6 A;  2F51 A;  4OD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...