1EPGA

Three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological ph solutions
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
53
structure length
53
Chain Sequence
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological pH solutions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Epidermal growth factor
molecule keywords EPIDERMAL GROWTH FACTOR
total genus 2
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1992-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1epgA00
2WG3C 1SZBA 2W2OE 2WPLE 1WHFA 2FLBL 4JYVL 1HT5A 4E1GA 1PTHA 1M1XB 5JB9E 4Y6DB 2BMGA 1O5DL 1A3PA 1EPJA 1MOXC 2J4IB 1TPGA 4MMXB 5CKMA 1DX5I 3ENSA 1F7EA 3BPSE 2BO2A 1IJQA 2WYGB 3TK5B 1EPIA 2P28B 2XC4L 2P3TA 2W26B 3NTBA 3HS5A 3HO3A 5L30L 1NFWB 2WPME 1APOA 4COXA 4RRWA 3K9XA 5CKQA 4RRXA 4Y7AB 2EI7B 1MQ6L 3HO5A 4BXWA 2WPHE 2BOHA 3HS6A 5JB8E 1LPGA 1HZ8A 1DQBA 2TGFA 4BTIA 3KL6B 4BTTA 1EAIC 1B9WA 4D0EA 1NPEB 3R05A 1EBVA 5I46L 1EPHA 1G2LB 1HX2A 2BQWA 1DIYA 2P94L 4FM5A 3KQDL 4X8TL 1JV2B 1EQGA 3LC5B 3GCXE 1UZJA 4XBMA 1NFYB 4RUTA 1IGXA 1IQHL 5K0HB 1LPZA 1URKA 1W7XL 3HPTA 1IVOC 1MQ5L 2P93L 4YT6L 1NT0A 1Q4GA 3Q3KB 3RR3A 4JZDL 2MHPA 3NTGA 1RFNB 3N8VA 1ATAA 2AYLA 1HREA 3KQEL 1LPKA 3SW2A 1HJ7A 2FZZL 2MGPA 3MQEA 1IQNL 3FCSB 2FLRL 1YUFA 5IKQA 3LN0A 3SOBB 1EZQB 3M36L 3CA7A 2JKHL 3ZYGA 2WPJE 2NPRA 4XLWA 4TGFA 2J94B 3KK6A 4LORA 3ZYIB 3ELAL 1IQML 1YUGA 1HRFA 2Q1JB 1FAKL 4BDWA 2VWOL 5KN5C 2Y5GL 4X8SL 2P3UA 5EGMB 2W2ME 5CISA 4MMZB 3KRKA 2XBWL 3Q7DA 1APQA 3LN1A 3C9AC 2BOXA 2DDUA 1COUA 1G1RA 1IOXA 2KB9A 3N8XA 3OLUA 4YT7L 4X8VL 5L2YL 3F6UL 4OTYA 2CJIB 2WPIE 3GCWE 2EI6B 1EPGA 4LMFA 1P0SL 5IKVA 4Z0KB 3V64C 6COXA 2W2PE 1ADXA 1K37A 2UWOB 4X8UL 5JBBE 4ISIL 2YGOA 3HS7A 2P16L 1OB1C 3U7UG 1IP0A 2PUQL 1N1IA 1CCVA 2UWPB 2W2QE 1G1QA 4RRYA 1JBUL 3M37L 4JYUL 4JZEL 2VH0B 4RS0A 1FAXL 1L5GB 2M74A 1PFXL 2H9EL 5COXA 1IQEL 4MMYB 1ATDA 1PGEA 2F9BL 3LTGD 1UZQA 3P5BL 1DVAL 4D0FA 2WG4B 2J2UB 1FF7A 2BQ7A 5JW1A 1CVWL 5F1AA 2GD4A 3QCWA 1G1SA 1IQKL 2VJ3A 3QMOA 2VH6B 4Y79B 4M10A 1XDTR 2P3FL 2Y38A 4O02B 3TGFA 2OYUP 2I9BA 1IOEL 1L3YA 3N8ZA 1NFUB 1XFEA 5CKNA 2B7DL 1KIGL 1HAFA 2K2SB 1Z6EL 2MGRA 3SOVA 1KLOA 1FSBA 3TBDA 3BT1A 3LTFB 4ZXYL 2D1JB 3N8WB 3KQCL 4BXSA 1Z6CA 1TOZA 2K2TA 4ZH8B 1IGZA 3FFGL 5IKTA 4AQTA 3KCGL 5JBCE 3GISX 2KL7A 2J34B 2WFTA 2VWNL 1NZIA 1G2MB 2Y82B 4M11A 4ISHL 3QH0A 1FJSL 1CX2A 3PGHA 1EQHA 4CSYA 3ASIA 1KLIL 1UZPA 3BT2A 1F0SB 1AUTL 1CCFA 3MDLA 4Y7BB 2XBXL 5JVYA 4G1MB 1BF9A 1PRHA 1CEJA 1W8BL 1HCGB 5JVZA 4XL1A 4ZXXL 2WFXB 1KSNB 3V65B 2BQ6A 1NFXB 2XBVL 2WPKE 3IITB 1X7AL 2UWLB 4BDXA 4Y71B 4CUEA 3N8YA 4BTUA 4Z6AL 3LAQA 1JL9A 1J9CL 1UZKA 1F0RB 4JZFL 2VVVL 2VWMK 3ZYJB 1FE2A 3U73A 2YGPA 1IQJL 1KLJL 3SOQA 3F1SB 1XKAL 2Y7XB 1PXXA 2Y80B 4OTJA 1WHEA 1ZAQA 2OYEP 1LMJA 2BOUA 3HO4A 2ADXA 4Z0LA 1LQDA 3LC3B 2FD6A 2W3KB 1IQLL 2VVUL 4CUFA 4ZHAB 3KQBL 2P26A 3N8WA 1QFKL 1P9JA 2EI8B 2P95L 4CUDA 2KV4A 3NT1A 4O1ZA 2RNLA 2W86A 4D90A 2W3IB 1NQLB 3EGFA 4NA9L 1TLEA 3CENL 3TK6B 1EMOA 2J95B 5FDQA 3H5CB 5L2ZL 1YO8A 2VWLL 2Y5FL 3TZIA 2RA0L 1FFMA 3CS7L 2G00L 1IQGL 4C16A 1XKBA 3CFWA 1WU1B 3NJPC 5IKRA 1ATBA 1U8CB 2Y5HL 4A7IA 2P3FN 4YZUB 1HAEA 2BOKL 1HT8A 1EMNA 1K36A 1CVUA 2VVCK 5KIRA 1IQFL 3LIWB 2XC0L 1N7DA 4ZAEB 3OLTA 1ATEA 3FBYA 4NG9L 1YUKB 2BZ6L 1IQIL 4Y76B 3DEMA 2W2NE 4RRZA 3POYA 1C5MF 1GK5A 2RHPA 2Y81B 2FLGA 1EGFA 1DDXA 2WYJB 2XBYL 2XC5L 1F7MA 5E8DA 5F19A 3N8YB 4PH9A 1V3XB 2J38B 1G1TA 2PHBB 2Y7ZB 4NGAL 1U67A 2I9AA 5JBAE 2PR3B 1I0UA 1YGCL 1CQEA 3TH3L 3IJEB
chains in the Genus database with same CATH superfamily
2WG3C 3S6XA 1SZBA 2W2OE 2WPLE 1WHFA 2FLBL 4JYVL 1HT5A 4E1GA 1PTHA 1M1XB 5JB9E 4Y6DB 2BMGA 1O5DL 1A3PA 1EPJA 1MOXC 2J4IB 1TPGA 4MMXB 5CKMA 1DX5I 3ENSA 1F7EA 3BPSE 2BO2A 1IJQA 2WYGB 3TK5B 1EPIA 2P28B 2XC4L 2P3TA 2W26B 3NTBA 3HS5A 3HO3A 5L30L 1NFWB 2WPME 1APOA 4COXA 4RRWA 3K9XA 5CKQA 4RRXA 4Y7AB 2EI7B 1MQ6L 2HOXA 3HO5A 4BXWA 2WPHE 2BOHA 3HS6A 5JB8E 1LPGA 1HZ8A 1DQBA 2TGFA 4BTIA 3KL6B 4BTTA 1EAIC 1B9WA 4D0EA 1NPEB 3R05A 1EBVA 5I46L 1EPHA 1G2LB 1HX2A 2BQWA 4GU3A 1DIYA 2P94L 4FM5A 3KQDL 4X8TL 1JV2B 1EQGA 3LC5B 3GCXE 1UZJA 4XBMA 1NFYB 4RUTA 1V1IA 1IGXA 1IQHL 5K0HB 1LPZA 1URKA 1W7XL 3HPTA 1IVOC 1MQ5L 2P93L 1KKEA 4YT6L 1NT0A 1Q4GA 3Q3KB 3RR3A 4JZDL 2MHPA 1RFNB 3NTGA 3N8VA 1ATAA 2AYLA 1HREA 3KQEL 1LPKA 3SW2A 1HJ7A 2FZZL 2MGPA 3MQEA 1IQNL 3FCSB 2FLRL 1YUFA 5IKQA 3LN0A 3SOBB 1EZQB 3M36L 3CA7A 2JKHL 3ZYGA 2WPJE 2NPRA 4XLWA 4TGFA 2J94B 3KK6A 4LORA 3ZYIB 3ELAL 1IQML 1YUGA 2HORA 1HRFA 2Q1JB 1FAKL 4BDWA 2VWOL 5KN5C 2Y5GL 4X8SL 2P3UA 5EGMB 2W2ME 5CISA 4MMZB 3KRKA 2XBWL 3Q7DA 1APQA 3LN1A 3C9AC 2BOXA 2DDUA 1COUA 1G1RA 1IOXA 2KB9A 3N8XA 3OLUA 4YT7L 4X8VL 5L2YL 3F6UL 4OTYA 2CJIB 2WPIE 3GCWE 2EI6B 1EPGA 4LMFA 1P0SL 2YGQA 5IKVA 4Z0KB 3V64C 6COXA 2W2PE 2VRSA 1ADXA 1K37A 2UWOB 4X8UL 5JBBE 4ISIL 2YGOA 3HS7A 2P16L 1OB1C 3U7UG 1IP0A 2PUQL 1N1IA 1CCVA 2UWPB 2W2QE 1G1QA 4RRYA 1JBUL 3M37L 2JJLA 4JYUL 4JZEL 2VH0B 4RS0A 1FAXL 1L5GB 2M74A 4GU4A 1PFXL 2H9EL 5COXA 1IQEL 1V1HA 4MMYB 1ATDA 1PGEA 2F9BL 3LTGD 1UZQA 3P5BL 1DVAL 4D0FA 2WG4B 2J2UB 1FF7A 2BQ7A 5JW1A 1CVWL 5F1AA 2GD4A 3QCWA 1G1SA 1IQKL 2VJ3A 3QMOA 2VH6B 4Y79B 4M10A 1XDTR 2P3FL 2Y38A 1LK9A 4O02B 3TGFA 2OYUP 2I9BA 1IOEL 1L3YA 3N8ZA 1NFUB 1XFEA 5CKNA 2B7DL 1KIGL 1HAFA 2K2SB 1Z6EL 2MGRA 3SOVA 1KLOA 1FSBA 3TBDA 3BT1A 3LTFB 4ZXYL 2D1JB 3N8WB 3KQCL 4BXSA 1Z6CA 1TOZA 2K2TA 4ZH8B 1IGZA 3FFGL 5IKTA 4AQTA 3KCGL 4A94C 5JBCE 3GISX 2KL7A 2J34B 2WFTA 2WZPP 2VWNL 1NZIA 1G2MB 2Y82B 4M11A 3QH0A 1FJSL 1CX2A 4ISHL 3PGHA 1EQHA 4CSYA 3ASIA 2BSFA 1KLIL 1UZPA 3BT2A 1F0SB 1AUTL 1CCFA 3MDLA 4Y7BB 2XBXL 5JVYA 4G1MB 1BF9A 1PRHA 1CEJA 1W8BL 1HCGB 5JVZA 4XL1A 4ZXXL 2WFXB 1KSNB 3V65B 2BQ6A 1NFXB 2XBVL 2WPKE 3IITB 1X7AL 2UWLB 4BDXA 4Y71B 4CUEA 3N8YA 4BTUA 4Z6AL 3LAQA 1JL9A 1J9CL 1LMMA 1UZKA 1F0RB 4JZFL 2VVVL 2VWMK 3ZYJB 1FE2A 3U73A 2YGPA 1IQJL 1KLJL 3SOQA 3F1SB 1XKAL 2Y7XB 1PXXA 2Y80B 4OTJA 1WHEA 1ZAQA 2OYEP 1LMJA 2BOUA 3HO4A 2ADXA 4Z0LA 1LQDA 3LC3B 2FD6A 2W3KB 1IQLL 2VVUL 4CUFA 4ZHAB 3KQBL 2P26A 3N8WA 1QFKL 1P9JA 2EI8B 2P95L 4CUDA 2KV4A 3NT1A 4O1ZA 2RNLA 2W86A 4D90A 2W3IB 1NQLB 3EGFA 4NA9L 1TLEA 3CENL 3TK6B 1EMOA 2J95B 5FDQA 3H5CB 5L2ZL 1YO8A 2KNIA 2VWLL 2Y5FL 3TZIA 2RA0L 1FFMA 3CS7L 1QIUA 2G00L 1IQGL 4C16A 1XKBA 3CFWA 1WU1B 3NJPC 5IKRA 1ATBA 1U8CB 2Y5HL 4A7IA 2P3FN 4YZUB 1HAEA 2BOKL 1HT8A 1EMNA 1K36A 1CVUA 2VVCK 5KIRA 1IQFL 3LIWB 2XC0L 1N7DA 4ZAEB 3OLTA 1ATEA 3FBYA 1YUKB 2BT8A 4NG9L 2BZ6L 1IQIL 4Y76B 3DEMA 2W2NE 2BT7A 4RRZA 3POYA 1C5MF 1GK5A 2RHPA 2Y81B 2FLGA 1EGFA 1DDXA 2WYJB 2XBYL 2XC5L 1F7MA 5E8DA 5F19A 3N8YB 4PH9A 1V3XB 2J38B 1G1TA 2PHBB 2Y7ZB 4NGAL 1U67A 2I9AA 5JBAE 2PR3B 1I0UA 1YGCL 2H9EC 1CQEA 3TH3L 3IJEB
chains in the Genus database with same CATH topology
2WG3C 3S6XA 1SZBA 2W2OE 2WPLE 1WHFA 2FLBL 4JYVL 1HT5A 4E1GA 1PTHA 1M1XB 5JB9E 4Y6DB 2BMGA 1O5DL 1A3PA 1EPJA 1MOXC 2J4IB 1TPGA 4MMXB 5CKMA 1DX5I 3ENSA 1F7EA 3BPSE 2BO2A 1IJQA 2WYGB 3TK5B 1EPIA 2P28B 2XC4L 2P3TA 2W26B 3NTBA 3HS5A 3HO3A 5L30L 1NFWB 2WPME 1APOA 4COXA 4RRWA 3K9XA 5CKQA 4RRXA 4Y7AB 2EI7B 1MQ6L 3HO5A 4BXWA 2WPHE 2BOHA 3HS6A 5JB8E 1LPGA 1HZ8A 1DQBA 2TGFA 4BTIA 3KL6B 4BTTA 1EAIC 1B9WA 4D0EA 1NPEB 3R05A 1EBVA 5I46L 1EPHA 1G2LB 1HX2A 2BQWA 1DIYA 2P94L 4FM5A 3KQDL 4X8TL 1JV2B 1EQGA 3LC5B 3GCXE 1UZJA 4XBMA 1NFYB 4RUTA 1IGXA 1IQHL 5K0HB 1LPZA 1URKA 1W7XL 3HPTA 1IVOC 1MQ5L 2P93L 4YT6L 1NT0A 1Q4GA 3Q3KB 3RR3A 4JZDL 2MHPA 3NTGA 1RFNB 3N8VA 1ATAA 2AYLA 1HREA 3KQEL 1LPKA 3SW2A 1HJ7A 2FZZL 2MGPA 3MQEA 1IQNL 3FCSB 2FLRL 1YUFA 5IKQA 3LN0A 3SOBB 1EZQB 3M36L 3CA7A 2JKHL 3ZYGA 2WPJE 2NPRA 4XLWA 4TGFA 2J94B 3KK6A 4LORA 3ZYIB 3ELAL 1IQML 1YUGA 1HRFA 2Q1JB 1FAKL 4BDWA 2VWOL 5KN5C 2Y5GL 4X8SL 2P3UA 5EGMB 2W2ME 5CISA 4MMZB 3KRKA 2XBWL 3Q7DA 1APQA 3LN1A 3C9AC 2BOXA 2DDUA 1COUA 1G1RA 1IOXA 2KB9A 3N8XA 3OLUA 4YT7L 4X8VL 5L2YL 3F6UL 4OTYA 2CJIB 2WPIE 3GCWE 2EI6B 1EPGA 4LMFA 1P0SL 2YGQA 5IKVA 4Z0KB 3V64C 6COXA 2W2PE 1ADXA 1K37A 2UWOB 4X8UL 5JBBE 4ISIL 2YGOA 3HS7A 2P16L 1OB1C 3U7UG 1IP0A 2PUQL 1N1IA 1CCVA 2UWPB 2W2QE 1G1QA 4RRYA 1JBUL 3M37L 4JYUL 4JZEL 2VH0B 4RS0A 1FAXL 1L5GB 2M74A 1PFXL 2H9EL 5COXA 1IQEL 4MMYB 1ATDA 1PGEA 2F9BL 3LTGD 1UZQA 3P5BL 1DVAL 4D0FA 2WG4B 2J2UB 1FF7A 2BQ7A 5JW1A 1CVWL 5F1AA 2GD4A 3QCWA 1G1SA 1IQKL 2VJ3A 3QMOA 2VH6B 4Y79B 4M10A 1XDTR 2P3FL 2Y38A 4O02B 3TGFA 2OYUP 2I9BA 1IOEL 1L3YA 3N8ZA 1NFUB 1XFEA 5CKNA 2B7DL 1KIGL 1HAFA 2K2SB 1Z6EL 2MGRA 3SOVA 1KLOA 1FSBA 3TBDA 3BT1A 3LTFB 4ZXYL 2D1JB 3N8WB 3KQCL 4BXSA 1Z6CA 1TOZA 2K2TA 4ZH8B 1IGZA 3FFGL 5IKTA 4AQTA 3KCGL 4A94C 5JBCE 3GISX 2KL7A 2J34B 2WFTA 2WZPP 2VWNL 1NZIA 1G2MB 2Y82B 4M11A 4ISHL 3QH0A 1FJSL 1CX2A 3PGHA 1EQHA 4CSYA 3ASIA 1KLIL 1UZPA 3BT2A 1F0SB 1AUTL 1CCFA 3MDLA 4Y7BB 2XBXL 5JVYA 4G1MB 1BF9A 1PRHA 1CEJA 1W8BL 1HCGB 5JVZA 4XL1A 4ZXXL 2WFXB 1KSNB 3V65B 2BQ6A 1NFXB 2XBVL 2WPKE 3IITB 1X7AL 2UWLB 4BDXA 4Y71B 4CUEA 3N8YA 4BTUA 4Z6AL 3LAQA 1JL9A 1J9CL 1LMMA 1UZKA 1F0RB 4JZFL 2VVVL 2VWMK 3ZYJB 1FE2A 3U73A 2YGPA 1IQJL 1KLJL 3SOQA 3F1SB 1XKAL 2Y7XB 1PXXA 2Y80B 4OTJA 1WHEA 1ZAQA 2OYEP 1LMJA 2BOUA 3HO4A 2ADXA 4Z0LA 1LQDA 3LC3B 2FD6A 2W3KB 1IQLL 2VVUL 4CUFA 4ZHAB 3KQBL 2P26A 3N8WA 1QFKL 1P9JA 2EI8B 2P95L 4CUDA 2KV4A 3NT1A 4O1ZA 2RNLA 2W86A 4D90A 2W3IB 1NQLB 3EGFA 4NA9L 1TLEA 3CENL 3TK6B 1EMOA 2J95B 5FDQA 3H5CB 5L2ZL 1YO8A 2KNIA 2VWLL 2Y5FL 3TZIA 2RA0L 1FFMA 3CS7L 2G00L 1IQGL 4C16A 1XKBA 3CFWA 1WU1B 3NJPC 5IKRA 1ATBA 1U8CB 2Y5HL 4A7IA 2P3FN 4YZUB 1HAEA 2BOKL 1HT8A 1EMNA 1K36A 1CVUA 2VVCK 5KIRA 1IQFL 3LIWB 2XC0L 1N7DA 4ZAEB 3OLTA 1ATEA 3FBYA 1YUKB 4NG9L 2BZ6L 1IQIL 4Y76B 3DEMA 2W2NE 4RRZA 3POYA 1C5MF 1GK5A 2RHPA 2Y81B 2FLGA 1EGFA 1DDXA 2WYJB 2XBYL 2XC5L 1F7MA 5E8DA 5F19A 3N8YB 4PH9A 1V3XB 2J38B 1G1TA 2PHBB 2Y7ZB 4NGAL 1U67A 2I9AA 5JBAE 2PR3B 1I0UA 1YGCL 2H9EC 1CQEA 3TH3L 3IJEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WG3 C;  1SZB A;  2W2O E;  2WPL E;  1WHF A;  2FLB L;  4JYV L;  1HT5 A;  4E1G A;  1PTH A;  1M1X B;  5JB9 E;  4Y6D B;  2BMG A;  1O5D L;  1A3P A;  1EPJ A;  1MOX C;  2J4I B;  1TPG A;  4MMX B;  5CKM A;  1DX5 I;  3ENS A;  1F7E A;  3BPS E;  2BO2 A;  1IJQ A;  2WYG B;  3TK5 B;  1EPI A;  2P28 B;  2XC4 L;  2P3T A;  2W26 B;  3NTB A;  3HS5 A;  3HO3 A;  5L30 L;  1NFW B;  2WPM E;  1APO A;  4COX A;  4RRW A;  3K9X A;  5CKQ A;  4RRX A;  4Y7A B;  2EI7 B;  1MQ6 L;  3HO5 A;  4BXW A;  2WPH E;  2BOH A;  3HS6 A;  5JB8 E;  1LPG A;  1HZ8 A;  1DQB A;  2TGF A;  4BTI A;  3KL6 B;  4BTT A;  1EAI C;  1B9W A;  4D0E A;  1NPE B;  3R05 A;  1EBV A;  5I46 L;  1EPH A;  1G2L B;  1HX2 A;  2BQW A;  1DIY A;  2P94 L;  4FM5 A;  3KQD L;  4X8T L;  1JV2 B;  1EQG A;  3LC5 B;  3GCX E;  1UZJ A;  4XBM A;  1NFY B;  4RUT A;  1IGX A;  1IQH L;  5K0H B;  1LPZ A;  1URK A;  1W7X L;  3HPT A;  1IVO C;  1MQ5 L;  2P93 L;  4YT6 L;  1NT0 A;  1Q4G A;  3Q3K B;  3RR3 A;  4JZD L;  2MHP A;  3NTG A;  1RFN B;  3N8V A;  1ATA A;  2AYL A;  1HRE A;  3KQE L;  1LPK A;  3SW2 A;  1HJ7 A;  2FZZ L;  2MGP A;  3MQE A;  1IQN L;  3FCS B;  2FLR L;  1YUF A;  5IKQ A;  3LN0 A;  3SOB B;  1EZQ B;  3M36 L;  3CA7 A;  2JKH L;  3ZYG A;  2WPJ E;  2NPR A;  4XLW A;  4TGF A;  2J94 B;  3KK6 A;  4LOR A;  3ZYI B;  3ELA L;  1IQM L;  1YUG A;  1HRF A;  2Q1J B;  1FAK L;  4BDW A;  2VWO L;  5KN5 C;  2Y5G L;  4X8S L;  2P3U A;  5EGM B;  2W2M E;  5CIS A;  4MMZ B;  3KRK A;  2XBW L;  3Q7D A;  1APQ A;  3LN1 A;  3C9A C;  2BOX A;  2DDU A;  1COU A;  1G1R A;  1IOX A;  2KB9 A;  3N8X A;  3OLU A;  4YT7 L;  4X8V L;  5L2Y L;  3F6U L;  4OTY A;  2CJI B;  2WPI E;  3GCW E;  2EI6 B;  1EPG A;  4LMF A;  1P0S L;  5IKV A;  4Z0K B;  3V64 C;  6COX A;  2W2P E;  1ADX A;  1K37 A;  2UWO B;  4X8U L;  5JBB E;  4ISI L;  2YGO A;  3HS7 A;  2P16 L;  1OB1 C;  3U7U G;  1IP0 A;  2PUQ L;  1N1I A;  1CCV A;  2UWP B;  2W2Q E;  1G1Q A;  4RRY A;  1JBU L;  3M37 L;  4JYU L;  4JZE L;  2VH0 B;  4RS0 A;  1FAX L;  1L5G B;  2M74 A;  1PFX L;  2H9E L;  5COX A;  1IQE L;  4MMY B;  1ATD A;  1PGE A;  2F9B L;  3LTG D;  1UZQ A;  3P5B L;  1DVA L;  4D0F A;  2WG4 B;  2J2U B;  1FF7 A;  2BQ7 A;  5JW1 A;  1CVW L;  5F1A A;  2GD4 A;  3QCW A;  1G1S A;  1IQK L;  2VJ3 A;  3QMO A;  2VH6 B;  4Y79 B;  4M10 A;  1XDT R;  2P3F L;  2Y38 A;  4O02 B;  3TGF A;  2OYU P;  2I9B A;  1IOE L;  1L3Y A;  3N8Z A;  1NFU B;  1XFE A;  5CKN A;  2B7D L;  1KIG L;  1HAF A;  2K2S B;  1Z6E L;  2MGR A;  3SOV A;  1KLO A;  1FSB A;  3TBD A;  3BT1 A;  3LTF B;  4ZXY L;  2D1J B;  3N8W B;  3KQC L;  4BXS A;  1Z6C A;  1TOZ A;  2K2T A;  4ZH8 B;  1IGZ A;  3FFG L;  5IKT A;  4AQT A;  3KCG L;  5JBC E;  3GIS X;  2KL7 A;  2J34 B;  2WFT A;  2VWN L;  1NZI A;  1G2M B;  2Y82 B;  4M11 A;  4ISH L;  3QH0 A;  1FJS L;  1CX2 A;  3PGH A;  1EQH A;  4CSY A;  3ASI A;  1KLI L;  1UZP A;  3BT2 A;  1F0S B;  1AUT L;  1CCF A;  3MDL A;  4Y7B B;  2XBX L;  5JVY A;  4G1M B;  1BF9 A;  1PRH A;  1CEJ A;  1W8B L;  1HCG B;  5JVZ A;  4XL1 A;  4ZXX L;  2WFX B;  1KSN B;  3V65 B;  2BQ6 A;  1NFX B;  2XBV L;  2WPK E;  3IIT B;  1X7A L;  2UWL B;  4BDX A;  4Y71 B;  4CUE A;  3N8Y A;  4BTU A;  4Z6A L;  3LAQ A;  1JL9 A;  1J9C L;  1UZK A;  1F0R B;  4JZF L;  2VVV L;  2VWM K;  3ZYJ B;  1FE2 A;  3U73 A;  2YGP A;  1IQJ L;  1KLJ L;  3SOQ A;  3F1S B;  1XKA L;  2Y7X B;  1PXX A;  2Y80 B;  4OTJ A;  1WHE A;  1ZAQ A;  2OYE P;  1LMJ A;  2BOU A;  3HO4 A;  2ADX A;  4Z0L A;  1LQD A;  3LC3 B;  2FD6 A;  2W3K B;  1IQL L;  2VVU L;  4CUF A;  4ZHA B;  3KQB L;  2P26 A;  3N8W A;  1QFK L;  1P9J A;  2EI8 B;  2P95 L;  4CUD A;  2KV4 A;  3NT1 A;  4O1Z A;  2RNL A;  2W86 A;  4D90 A;  2W3I B;  1NQL B;  3EGF A;  4NA9 L;  1TLE A;  3CEN L;  3TK6 B;  1EMO A;  2J95 B;  5FDQ A;  3H5C B;  5L2Z L;  1YO8 A;  2VWL L;  2Y5F L;  3TZI A;  2RA0 L;  1FFM A;  3CS7 L;  2G00 L;  1IQG L;  4C16 A;  1XKB A;  3CFW A;  1WU1 B;  3NJP C;  5IKR A;  1ATB A;  1U8C B;  2Y5H L;  4A7I A;  2P3F N;  4YZU B;  1HAE A;  2BOK L;  1HT8 A;  1EMN A;  1K36 A;  1CVU A;  2VVC K;  5KIR A;  1IQF L;  3LIW B;  2XC0 L;  1N7D A;  4ZAE B;  3OLT A;  1ATE A;  3FBY A;  4NG9 L;  1YUK B;  2BZ6 L;  1IQI L;  4Y76 B;  3DEM A;  2W2N E;  4RRZ A;  3POY A;  1C5M F;  1GK5 A;  2RHP A;  2Y81 B;  2FLG A;  1EGF A;  1DDX A;  2WYJ B;  2XBY L;  2XC5 L;  1F7M A;  5E8D A;  5F19 A;  3N8Y B;  4PH9 A;  1V3X B;  2J38 B;  1G1T A;  2PHB B;  2Y7Z B;  4NGA L;  1U67 A;  2I9A A;  5JBA E;  2PR3 B;  1I0U A;  1YGC L;  1CQE A;  3TH3 L;  3IJE B; 
#chains in the Genus database with same CATH topology
 2WG3 C;  3S6X A;  1SZB A;  2W2O E;  2WPL E;  1WHF A;  2FLB L;  4JYV L;  1HT5 A;  4E1G A;  1PTH A;  1M1X B;  5JB9 E;  4Y6D B;  2BMG A;  1O5D L;  1A3P A;  1EPJ A;  1MOX C;  2J4I B;  1TPG A;  4MMX B;  5CKM A;  1DX5 I;  3ENS A;  1F7E A;  3BPS E;  2BO2 A;  1IJQ A;  2WYG B;  3TK5 B;  1EPI A;  2P28 B;  2XC4 L;  2P3T A;  2W26 B;  3NTB A;  3HS5 A;  3HO3 A;  5L30 L;  1NFW B;  2WPM E;  1APO A;  4COX A;  4RRW A;  3K9X A;  5CKQ A;  4RRX A;  4Y7A B;  2EI7 B;  1MQ6 L;  2HOX A;  3HO5 A;  4BXW A;  2WPH E;  2BOH A;  3HS6 A;  5JB8 E;  1LPG A;  1HZ8 A;  1DQB A;  2TGF A;  4BTI A;  3KL6 B;  4BTT A;  1EAI C;  1B9W A;  4D0E A;  1NPE B;  3R05 A;  1EBV A;  5I46 L;  1EPH A;  1G2L B;  1HX2 A;  2BQW A;  4GU3 A;  1DIY A;  2P94 L;  4FM5 A;  3KQD L;  4X8T L;  1JV2 B;  1EQG A;  3LC5 B;  3GCX E;  1UZJ A;  4XBM A;  1NFY B;  4RUT A;  1V1I A;  1IGX A;  1IQH L;  5K0H B;  1LPZ A;  1URK A;  1W7X L;  3HPT A;  1IVO C;  1MQ5 L;  2P93 L;  1KKE A;  4YT6 L;  1NT0 A;  1Q4G A;  3Q3K B;  3RR3 A;  4JZD L;  2MHP A;  1RFN B;  3NTG A;  3N8V A;  1ATA A;  2AYL A;  1HRE A;  3KQE L;  1LPK A;  3SW2 A;  1HJ7 A;  2FZZ L;  2MGP A;  3MQE A;  1IQN L;  3FCS B;  2FLR L;  1YUF A;  5IKQ A;  3LN0 A;  3SOB B;  1EZQ B;  3M36 L;  3CA7 A;  2JKH L;  3ZYG A;  2WPJ E;  2NPR A;  4XLW A;  4TGF A;  2J94 B;  3KK6 A;  4LOR A;  3ZYI B;  3ELA L;  1IQM L;  1YUG A;  2HOR A;  1HRF A;  2Q1J B;  1FAK L;  4BDW A;  2VWO L;  5KN5 C;  2Y5G L;  4X8S L;  2P3U A;  5EGM B;  2W2M E;  5CIS A;  4MMZ B;  3KRK A;  2XBW L;  3Q7D A;  1APQ A;  3LN1 A;  3C9A C;  2BOX A;  2DDU A;  1COU A;  1G1R A;  1IOX A;  2KB9 A;  3N8X A;  3OLU A;  4YT7 L;  4X8V L;  5L2Y L;  3F6U L;  4OTY A;  2CJI B;  2WPI E;  3GCW E;  2EI6 B;  1EPG A;  4LMF A;  1P0S L;  2YGQ A;  5IKV A;  4Z0K B;  3V64 C;  6COX A;  2W2P E;  2VRS A;  1ADX A;  1K37 A;  2UWO B;  4X8U L;  5JBB E;  4ISI L;  2YGO A;  3HS7 A;  2P16 L;  1OB1 C;  3U7U G;  1IP0 A;  2PUQ L;  1N1I A;  1CCV A;  2UWP B;  2W2Q E;  1G1Q A;  4RRY A;  1JBU L;  3M37 L;  2JJL A;  4JYU L;  4JZE L;  2VH0 B;  4RS0 A;  1FAX L;  1L5G B;  2M74 A;  4GU4 A;  1PFX L;  2H9E L;  5COX A;  1IQE L;  1V1H A;  4MMY B;  1ATD A;  1PGE A;  2F9B L;  3LTG D;  1UZQ A;  3P5B L;  1DVA L;  4D0F A;  2WG4 B;  2J2U B;  1FF7 A;  2BQ7 A;  5JW1 A;  1CVW L;  5F1A A;  2GD4 A;  3QCW A;  1G1S A;  1IQK L;  2VJ3 A;  3QMO A;  2VH6 B;  4Y79 B;  4M10 A;  1XDT R;  2P3F L;  2Y38 A;  1LK9 A;  4O02 B;  3TGF A;  2OYU P;  2I9B A;  1IOE L;  1L3Y A;  3N8Z A;  1NFU B;  1XFE A;  5CKN A;  2B7D L;  1KIG L;  1HAF A;  2K2S B;  1Z6E L;  2MGR A;  3SOV A;  1KLO A;  1FSB A;  3TBD A;  3BT1 A;  3LTF B;  4ZXY L;  2D1J B;  3N8W B;  3KQC L;  4BXS A;  1Z6C A;  1TOZ A;  2K2T A;  4ZH8 B;  1IGZ A;  3FFG L;  5IKT A;  4AQT A;  3KCG L;  4A94 C;  5JBC E;  3GIS X;  2KL7 A;  2J34 B;  2WFT A;  2WZP P;  2VWN L;  1NZI A;  1G2M B;  2Y82 B;  4M11 A;  3QH0 A;  1FJS L;  1CX2 A;  4ISH L;  3PGH A;  1EQH A;  4CSY A;  3ASI A;  2BSF A;  1KLI L;  1UZP A;  3BT2 A;  1F0S B;  1AUT L;  1CCF A;  3MDL A;  4Y7B B;  2XBX L;  5JVY A;  4G1M B;  1BF9 A;  1PRH A;  1CEJ A;  1W8B L;  1HCG B;  5JVZ A;  4XL1 A;  4ZXX L;  2WFX B;  1KSN B;  3V65 B;  2BQ6 A;  1NFX B;  2XBV L;  2WPK E;  3IIT B;  1X7A L;  2UWL B;  4BDX A;  4Y71 B;  4CUE A;  3N8Y A;  4BTU A;  4Z6A L;  3LAQ A;  1JL9 A;  1J9C L;  1LMM A;  1UZK A;  1F0R B;  4JZF L;  2VVV L;  2VWM K;  3ZYJ B;  1FE2 A;  3U73 A;  2YGP A;  1IQJ L;  1KLJ L;  3SOQ A;  3F1S B;  1XKA L;  2Y7X B;  1PXX A;  2Y80 B;  4OTJ A;  1WHE A;  1ZAQ A;  2OYE P;  1LMJ A;  2BOU A;  3HO4 A;  2ADX A;  4Z0L A;  1LQD A;  3LC3 B;  2FD6 A;  2W3K B;  1IQL L;  2VVU L;  4CUF A;  4ZHA B;  3KQB L;  2P26 A;  3N8W A;  1QFK L;  1P9J A;  2EI8 B;  2P95 L;  4CUD A;  2KV4 A;  3NT1 A;  4O1Z A;  2RNL A;  2W86 A;  4D90 A;  2W3I B;  1NQL B;  3EGF A;  4NA9 L;  1TLE A;  3CEN L;  3TK6 B;  1EMO A;  2J95 B;  5FDQ A;  3H5C B;  5L2Z L;  1YO8 A;  2KNI A;  2VWL L;  2Y5F L;  3TZI A;  2RA0 L;  1FFM A;  3CS7 L;  1QIU A;  2G00 L;  1IQG L;  4C16 A;  1XKB A;  3CFW A;  1WU1 B;  3NJP C;  5IKR A;  1ATB A;  1U8C B;  2Y5H L;  4A7I A;  2P3F N;  4YZU B;  1HAE A;  2BOK L;  1HT8 A;  1EMN A;  1K36 A;  1CVU A;  2VVC K;  5KIR A;  1IQF L;  3LIW B;  2XC0 L;  1N7D A;  4ZAE B;  3OLT A;  1ATE A;  3FBY A;  1YUK B;  2BT8 A;  4NG9 L;  2BZ6 L;  1IQI L;  4Y76 B;  3DEM A;  2W2N E;  2BT7 A;  4RRZ A;  3POY A;  1C5M F;  1GK5 A;  2RHP A;  2Y81 B;  2FLG A;  1EGF A;  1DDX A;  2WYJ B;  2XBY L;  2XC5 L;  1F7M A;  5E8D A;  5F19 A;  3N8Y B;  4PH9 A;  1V3X B;  2J38 B;  1G1T A;  2PHB B;  2Y7Z B;  4NGA L;  1U67 A;  2I9A A;  5JBA E;  2PR3 B;  1I0U A;  1YGC L;  2H9E C;  1CQE A;  3TH3 L;  3IJE B; 
#chains in the Genus database with same CATH homology
 2WG3 C;  3S6X A;  1SZB A;  2W2O E;  2WPL E;  1WHF A;  2FLB L;  4JYV L;  1HT5 A;  4E1G A;  1PTH A;  1M1X B;  5JB9 E;  4Y6D B;  2BMG A;  1O5D L;  1A3P A;  1EPJ A;  1MOX C;  2J4I B;  1TPG A;  4MMX B;  5CKM A;  1DX5 I;  3ENS A;  1F7E A;  3BPS E;  2BO2 A;  1IJQ A;  2WYG B;  3TK5 B;  1EPI A;  2P28 B;  2XC4 L;  2P3T A;  2W26 B;  3NTB A;  3HS5 A;  3HO3 A;  5L30 L;  1NFW B;  2WPM E;  1APO A;  4COX A;  4RRW A;  3K9X A;  5CKQ A;  4RRX A;  4Y7A B;  2EI7 B;  1MQ6 L;  3HO5 A;  4BXW A;  2WPH E;  2BOH A;  3HS6 A;  5JB8 E;  1LPG A;  1HZ8 A;  1DQB A;  2TGF A;  4BTI A;  3KL6 B;  4BTT A;  1EAI C;  1B9W A;  4D0E A;  1NPE B;  3R05 A;  1EBV A;  5I46 L;  1EPH A;  1G2L B;  1HX2 A;  2BQW A;  1DIY A;  2P94 L;  4FM5 A;  3KQD L;  4X8T L;  1JV2 B;  1EQG A;  3LC5 B;  3GCX E;  1UZJ A;  4XBM A;  1NFY B;  4RUT A;  1IGX A;  1IQH L;  5K0H B;  1LPZ A;  1URK A;  1W7X L;  3HPT A;  1IVO C;  1MQ5 L;  2P93 L;  4YT6 L;  1NT0 A;  1Q4G A;  3Q3K B;  3RR3 A;  4JZD L;  2MHP A;  3NTG A;  1RFN B;  3N8V A;  1ATA A;  2AYL A;  1HRE A;  3KQE L;  1LPK A;  3SW2 A;  1HJ7 A;  2FZZ L;  2MGP A;  3MQE A;  1IQN L;  3FCS B;  2FLR L;  1YUF A;  5IKQ A;  3LN0 A;  3SOB B;  1EZQ B;  3M36 L;  3CA7 A;  2JKH L;  3ZYG A;  2WPJ E;  2NPR A;  4XLW A;  4TGF A;  2J94 B;  3KK6 A;  4LOR A;  3ZYI B;  3ELA L;  1IQM L;  1YUG A;  1HRF A;  2Q1J B;  1FAK L;  4BDW A;  2VWO L;  5KN5 C;  2Y5G L;  4X8S L;  2P3U A;  5EGM B;  2W2M E;  5CIS A;  4MMZ B;  3KRK A;  2XBW L;  3Q7D A;  1APQ A;  3LN1 A;  3C9A C;  2BOX A;  2DDU A;  1COU A;  1G1R A;  1IOX A;  2KB9 A;  3N8X A;  3OLU A;  4YT7 L;  4X8V L;  5L2Y L;  3F6U L;  4OTY A;  2CJI B;  2WPI E;  3GCW E;  2EI6 B;  1EPG A;  4LMF A;  1P0S L;  2YGQ A;  5IKV A;  4Z0K B;  3V64 C;  6COX A;  2W2P E;  1ADX A;  1K37 A;  2UWO B;  4X8U L;  5JBB E;  4ISI L;  2YGO A;  3HS7 A;  2P16 L;  1OB1 C;  3U7U G;  1IP0 A;  2PUQ L;  1N1I A;  1CCV A;  2UWP B;  2W2Q E;  1G1Q A;  4RRY A;  1JBU L;  3M37 L;  4JYU L;  4JZE L;  2VH0 B;  4RS0 A;  1FAX L;  1L5G B;  2M74 A;  1PFX L;  2H9E L;  5COX A;  1IQE L;  4MMY B;  1ATD A;  1PGE A;  2F9B L;  3LTG D;  1UZQ A;  3P5B L;  1DVA L;  4D0F A;  2WG4 B;  2J2U B;  1FF7 A;  2BQ7 A;  5JW1 A;  1CVW L;  5F1A A;  2GD4 A;  3QCW A;  1G1S A;  1IQK L;  2VJ3 A;  3QMO A;  2VH6 B;  4Y79 B;  4M10 A;  1XDT R;  2P3F L;  2Y38 A;  4O02 B;  3TGF A;  2OYU P;  2I9B A;  1IOE L;  1L3Y A;  3N8Z A;  1NFU B;  1XFE A;  5CKN A;  2B7D L;  1KIG L;  1HAF A;  2K2S B;  1Z6E L;  2MGR A;  3SOV A;  1KLO A;  1FSB A;  3TBD A;  3BT1 A;  3LTF B;  4ZXY L;  2D1J B;  3N8W B;  3KQC L;  4BXS A;  1Z6C A;  1TOZ A;  2K2T A;  4ZH8 B;  1IGZ A;  3FFG L;  5IKT A;  4AQT A;  3KCG L;  4A94 C;  5JBC E;  3GIS X;  2KL7 A;  2J34 B;  2WFT A;  2WZP P;  2VWN L;  1NZI A;  1G2M B;  2Y82 B;  4M11 A;  4ISH L;  3QH0 A;  1FJS L;  1CX2 A;  3PGH A;  1EQH A;  4CSY A;  3ASI A;  1KLI L;  1UZP A;  3BT2 A;  1F0S B;  1AUT L;  1CCF A;  3MDL A;  4Y7B B;  2XBX L;  5JVY A;  4G1M B;  1BF9 A;  1PRH A;  1CEJ A;  1W8B L;  1HCG B;  5JVZ A;  4XL1 A;  4ZXX L;  2WFX B;  1KSN B;  3V65 B;  2BQ6 A;  1NFX B;  2XBV L;  2WPK E;  3IIT B;  1X7A L;  2UWL B;  4BDX A;  4Y71 B;  4CUE A;  3N8Y A;  4BTU A;  4Z6A L;  3LAQ A;  1JL9 A;  1J9C L;  1LMM A;  1UZK A;  1F0R B;  4JZF L;  2VVV L;  2VWM K;  3ZYJ B;  1FE2 A;  3U73 A;  2YGP A;  1IQJ L;  1KLJ L;  3SOQ A;  3F1S B;  1XKA L;  2Y7X B;  1PXX A;  2Y80 B;  4OTJ A;  1WHE A;  1ZAQ A;  2OYE P;  1LMJ A;  2BOU A;  3HO4 A;  2ADX A;  4Z0L A;  1LQD A;  3LC3 B;  2FD6 A;  2W3K B;  1IQL L;  2VVU L;  4CUF A;  4ZHA B;  3KQB L;  2P26 A;  3N8W A;  1QFK L;  1P9J A;  2EI8 B;  2P95 L;  4CUD A;  2KV4 A;  3NT1 A;  4O1Z A;  2RNL A;  2W86 A;  4D90 A;  2W3I B;  1NQL B;  3EGF A;  4NA9 L;  1TLE A;  3CEN L;  3TK6 B;  1EMO A;  2J95 B;  5FDQ A;  3H5C B;  5L2Z L;  1YO8 A;  2KNI A;  2VWL L;  2Y5F L;  3TZI A;  2RA0 L;  1FFM A;  3CS7 L;  2G00 L;  1IQG L;  4C16 A;  1XKB A;  3CFW A;  1WU1 B;  3NJP C;  5IKR A;  1ATB A;  1U8C B;  2Y5H L;  4A7I A;  2P3F N;  4YZU B;  1HAE A;  2BOK L;  1HT8 A;  1EMN A;  1K36 A;  1CVU A;  2VVC K;  5KIR A;  1IQF L;  3LIW B;  2XC0 L;  1N7D A;  4ZAE B;  3OLT A;  1ATE A;  3FBY A;  1YUK B;  4NG9 L;  2BZ6 L;  1IQI L;  4Y76 B;  3DEM A;  2W2N E;  4RRZ A;  3POY A;  1C5M F;  1GK5 A;  2RHP A;  2Y81 B;  2FLG A;  1EGF A;  1DDX A;  2WYJ B;  2XBY L;  2XC5 L;  1F7M A;  5E8D A;  5F19 A;  3N8Y B;  4PH9 A;  1V3X B;  2J38 B;  1G1T A;  2PHB B;  2Y7Z B;  4NGA L;  1U67 A;  2I9A A;  5JBA E;  2PR3 B;  1I0U A;  1YGC L;  2H9E C;  1CQE A;  3TH3 L;  3IJE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...