1EPHA

Three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological ph solutions
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
53
structure length
53
Chain Sequence
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological pH solutions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Growth factor
molecule keywords EPIDERMAL GROWTH FACTOR
total genus 1
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1992-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1ephA00
1XDTR 1MQ6L 4X8TL 2FD6A 1CVUA 1WHFA 3NTGA 2UWLB 3M36L 2Y5FL 3TGFA 3N8YB 1DVAL 1UZPA 3N8VA 5IKQA 2BZ6L 1ATDA 3HPTA 1BF9A 2KV4A 1HT8A 2PHBB 4MMXB 3CFWA 2P3TA 2RA0L 3MDLA 3N8ZA 4G1MB 4COXA 1IOXA 3NTBA 2MGPA 1EGFA 4XL1A 4YT7L 1RFNB 3P5BL 1L3YA 2WPHE 3EGFA 1X7AL 2EI6B 3LC5B 4RRXA 1COUA 1EQHA 1G2LB 1JL9A 3LN1A 4OTJA 2ADXA 2VH6B 3FFGL 1EPJA 4ZH8B 2W2NE 3KCGL 4Y71B 4BDWA 1I0UA 2W2QE 1P0SL 1U67A 1YO8A 2W2OE 3KL6B 2D1JB 3OLUA 2BO2A 2P3FN 1KIGL 1FJSL 1IQIL 1FFMA 1KLJL 2XBYL 3FBYA 3NJPC 5L2YL 4Y79B 1IQJL 5COXA 1EPGA 1EQGA 1DX5I 4ISHL 2B7DL 4ZHAB 1K36A 4RS0A 1APOA 2PUQL 2J94B 3KQDL 1F7MA 3QCWA 2J4IB 1CX2A 4BDXA 4NA9L 2FZZL 1HZ8A 2DDUA 1KLIL 2VVVL 2Y82B 1KLOA 3V65B 1FAKL 2W2PE 3N8YA 1WU1B 3TK6B 2Y5GL 2MGRA 2Y7ZB 1CQEA 4Y7AB 1IQML 4X8SL 5JB9E 3IITB 5JBCE 3MQEA 3ZYJB 3KQEL 1CVWL 1F0SB 3HS6A 4BTIA 4M10A 4M11A 4RRZA 1IVOC 1YGCL 1ADXA 5E8DA 2BQ7A 2Y81B 4BXSA 4CSYA 2P16L 4LORA 1UZKA 1NFXB 4ZXXL 5JB8E 5L30L 2BQWA 1OB1C 3ZYIB 4LMFA 3U73A 1ZAQA 4Z0LA 4X8VL 1EMOA 2BQ6A 2Q1JB 1EMNA 2AYLA 2P28B 1CEJA 1NFYB 4CUEA 1UZQA 4E1GA 2XBVL 1IQKL 3N8WB 2J34B 4MMYB 1K37A 1EPIA 2P94L 2BMGA 2MHPA 5IKVA 2Y80B 3POYA 1G1QA 3TZIA 2EI7B 5JBBE 4JZDL 3CS7L 1PTHA 2WG4B 4RRWA 2W86A 3C9AC 2XBXL 1YUFA 1IGZA 1FF7A 3H5CB 2EI8B 2WPKE 3ASIA 1HT5A 2BOHA 3FCSB 2NPRA 4BTTA 5CKMA 5I46L 1IQFL 3HS7A 3V64C 2W26B 1M1XB 1FSBA 4MMZB 3HS5A 1TOZA 3BT1A 4Y7BB 5JBAE 3BPSE 5JVYA 1SZBA 2XC4L 4JZEL 3GISX 1DQBA 3SW2A 3N8WA 3LTFB 5JVZA 4CUFA 1XFEA 3QH0A 2P3UA 2BOKL 3TBDA 4RUTA 2Y38A 4NGAL 2JKHL 1XKAL 1IQGL 2I9AA 1IOEL 2UWOB 2XC5L 3ELAL 4D0FA 1IJQA 2BOUA 3HO5A 3BT2A 4XBMA 3KRKA 2OYEP 4NG9L 5KIRA 1IP0A 1IGXA 1YUGA 2P3FL 1G1TA 1IQNL 1B9WA 3DEMA 2M74A 4BTUA 4ISIL 2FLBL 1N1IA 3F1SB 1PGEA 2XBWL 2VWOL 1IQLL 1UZJA 3N8XA 1IQHL 2VWLL 3Q3KB 1KSNB 2W3KB 5EGMB 1ATAA 1DDXA 2P26A 1EPHA 4X8UL 3ENSA 2WPLE 4XLWA 2WFTA 1LPKA 4D90A 4JYVL 4Y6DB 1LPZA 1Z6EL 2VWNL 4ZXYL 4O02B 5L2ZL 3LIWB 2YGPA 2K2TA 4A7IA 3ZYGA 1O5DL 1W7XL 3RR3A 3TH3L 1HRFA 5CKNA 1EAIC 3OLTA 2BOXA 1EZQB 1NT0A 1G1RA 3SOBB 3TK5B 1NZIA 3QMOA 1WHEA 4PH9A 1MOXC 1YUKB 2W2ME 1QFKL 5CKQA 2RNLA 2VVUL 3HO3A 3K9XA 1HCGB 4ZAEB 5CISA 5IKTA 1EBVA 4RRYA 3R05A 1HX2A 2J95B 1HJ7A 3KK6A 3NT1A 1NFWB 4TGFA 1U8CB 1A3PA 1LMJA 2VH0B 1AUTL 1JBUL 1PXXA 1Z6CA 1PRHA 1CCVA 2F9BL 3M37L 1XKBA 4JYUL 2I9BA 2P95L 3GCWE 1C5MF 2VWMK 4O1ZA 1FE2A 4D0EA 2J2UB 3LN0A 4CUDA 1F0RB 2GD4A 2P93L 1HAFA 2YGOA 1G2MB 1TPGA 1G1SA 2WPME 2Y5HL 1F7EA 1J9CL 3Q7DA 2WYGB 3GCXE 3F6UL 1Q4GA 3KQBL 2Y7XB 3LAQA 2FLRL 1ATEA 1APQA 4Z0KB 1URKA 3HO4A 1NPEB 5JW1A 3CA7A 5KN5C 4C16A 3PGHA 2PR3B 2KL7A 1V3XB 2H9EL 2W3IB 1ATBA 2WG3C 2XC0L 1LPGA 3SOVA 4BXWA 1W8BL 2K2SB 2G00L 1CCFA 2WPIE 1L5GB 4Y76B 1JV2B 5FDQA 3SOQA 1MQ5L 2UWPB 2VVCK 2VJ3A 2TGFA 6COXA 4OTYA 2WFXB 1TLEA 2WYJB 5K0HB 3IJEB 1HREA 1FAXL 2FLGA 5F1AA 1IQEL 2OYUP 1DIYA 3U7UG 1N7DA 3CENL 3KQCL 4FM5A 1NQLB 4YZUB 1NFUB 2CJIB 3LTGD 4YT6L 4Z6AL 4JZFL 1HAEA 5IKRA 1PFXL 3LC3B 4AQTA 2J38B 1LQDA 2KB9A 1P9JA 1GK5A 5F19A 2WPJE 2RHPA
chains in the Genus database with same CATH superfamily
1XDTR 2BT8A 1MQ6L 4X8TL 2FD6A 1CVUA 1WHFA 3NTGA 2UWLB 3M36L 2Y5FL 3TGFA 3N8YB 1DVAL 1V1IA 1UZPA 3N8VA 5IKQA 2BZ6L 1ATDA 3HPTA 1BF9A 2KV4A 1HT8A 2PHBB 4MMXB 3CFWA 2P3TA 2RA0L 3MDLA 3N8ZA 4G1MB 2WZPP 4COXA 1IOXA 3NTBA 1KKEA 2MGPA 1EGFA 4XL1A 4YT7L 1RFNB 3P5BL 1L3YA 2WPHE 3EGFA 1X7AL 2EI6B 4GU4A 3LC5B 4RRXA 1COUA 1EQHA 1G2LB 1JL9A 3LN1A 4OTJA 2ADXA 2VH6B 3FFGL 1EPJA 4ZH8B 2W2NE 3KCGL 4Y71B 4BDWA 1I0UA 2W2QE 1P0SL 1U67A 1YO8A 2W2OE 2HOXA 3KL6B 2D1JB 3OLUA 2BO2A 2P3FN 1KIGL 1FJSL 1IQIL 1FFMA 1KLJL 2XBYL 3FBYA 3NJPC 5L2YL 4Y79B 1IQJL 5COXA 1EPGA 1EQGA 1DX5I 4ISHL 2B7DL 4ZHAB 1K36A 4RS0A 1APOA 2PUQL 2J94B 3KQDL 1F7MA 3QCWA 2J4IB 1CX2A 4BDXA 4NA9L 2FZZL 1HZ8A 2DDUA 1KLIL 2VVVL 2Y82B 1KLOA 3V65B 1FAKL 2H9EC 2W2PE 3N8YA 1WU1B 3TK6B 2Y5GL 2MGRA 2Y7ZB 1CQEA 4Y7AB 1IQML 4X8SL 5JB9E 3IITB 5JBCE 3MQEA 3ZYJB 1LMMA 3KQEL 1CVWL 1F0SB 3HS6A 4BTIA 4M10A 4M11A 4RRZA 1IVOC 1YGCL 1ADXA 5E8DA 2BQ7A 2Y81B 4BXSA 4CSYA 2P16L 4LORA 1UZKA 1NFXB 4ZXXL 5JB8E 5L30L 2BQWA 1OB1C 3ZYIB 4LMFA 3U73A 1ZAQA 4Z0LA 4X8VL 1EMOA 2BQ6A 2Q1JB 1EMNA 2AYLA 2P28B 1CEJA 1NFYB 4CUEA 1UZQA 4E1GA 2XBVL 1IQKL 3N8WB 2J34B 4MMYB 1K37A 1EPIA 2P94L 2BMGA 2MHPA 5IKVA 2Y80B 3POYA 1G1QA 3TZIA 2EI7B 5JBBE 4JZDL 3CS7L 1PTHA 2WG4B 4RRWA 2W86A 3C9AC 2XBXL 1YUFA 1IGZA 1FF7A 3H5CB 2EI8B 2WPKE 3ASIA 1HT5A 2BOHA 3FCSB 2NPRA 4BTTA 5CKMA 5I46L 1IQFL 3HS7A 3V64C 2W26B 1M1XB 1FSBA 3HS5A 4MMZB 1TOZA 3BT1A 4Y7BB 5JBAE 2KNIA 3BPSE 5JVYA 1SZBA 2XC4L 4JZEL 3GISX 1DQBA 3SW2A 3N8WA 3LTFB 5JVZA 4CUFA 1XFEA 3QH0A 2P3UA 2BOKL 3TBDA 4RUTA 2Y38A 2JJLA 4NGAL 2JKHL 1XKAL 1IQGL 2I9AA 1IOEL 2UWOB 2XC5L 3ELAL 4D0FA 1IJQA 2BOUA 3HO5A 3BT2A 4XBMA 3KRKA 2OYEP 4NG9L 5KIRA 1IP0A 1IGXA 1YUGA 2P3FL 1G1TA 1IQNL 1B9WA 3DEMA 2M74A 4BTUA 4ISIL 2FLBL 1N1IA 3F1SB 1PGEA 2XBWL 2VWOL 1IQLL 1UZJA 3N8XA 1IQHL 2VWLL 2YGQA 3Q3KB 1KSNB 2W3KB 5EGMB 1ATAA 1DDXA 2P26A 1EPHA 4X8UL 3ENSA 2WPLE 4XLWA 2WFTA 1LPKA 4D90A 4JYVL 4Y6DB 1LPZA 1Z6EL 2VWNL 4ZXYL 4O02B 5L2ZL 3LIWB 2YGPA 2K2TA 4A7IA 3ZYGA 1O5DL 1W7XL 3RR3A 3TH3L 1HRFA 5CKNA 1EAIC 3OLTA 2BOXA 1EZQB 1NT0A 1G1RA 3SOBB 3TK5B 1NZIA 3QMOA 1WHEA 4PH9A 1MOXC 1YUKB 2W2ME 1QFKL 5CKQA 2RNLA 2VVUL 3HO3A 3S6XA 3K9XA 4A94C 2BT7A 1HCGB 4ZAEB 5CISA 5IKTA 1EBVA 4RRYA 3R05A 1HX2A 2J95B 1HJ7A 3KK6A 3NT1A 1NFWB 4TGFA 1U8CB 1A3PA 1LMJA 2VH0B 1AUTL 1JBUL 1PXXA 1Z6CA 1PRHA 1CCVA 2F9BL 3M37L 1XKBA 4JYUL 2I9BA 2P95L 3GCWE 1C5MF 2VWMK 4O1ZA 1FE2A 4D0EA 2J2UB 3LN0A 4CUDA 1F0RB 2GD4A 2P93L 1HAFA 2YGOA 1G2MB 1TPGA 1G1SA 2WPME 2Y5HL 1F7EA 1QIUA 1J9CL 3Q7DA 2WYGB 3GCXE 3F6UL 1Q4GA 3KQBL 2Y7XB 3LAQA 2FLRL 1ATEA 1APQA 4Z0KB 1URKA 3HO4A 1NPEB 1V1HA 5JW1A 3CA7A 5KN5C 4C16A 3PGHA 2PR3B 2KL7A 1V3XB 2H9EL 2HORA 2W3IB 2VRSA 1ATBA 2WG3C 2XC0L 1LPGA 3SOVA 4BXWA 1W8BL 2K2SB 2G00L 1CCFA 2WPIE 1L5GB 4Y76B 1JV2B 5FDQA 3SOQA 1MQ5L 2UWPB 2VVCK 2VJ3A 2TGFA 6COXA 2BSFA 4OTYA 2WFXB 1TLEA 2WYJB 5K0HB 3IJEB 1HREA 4GU3A 1FAXL 2FLGA 5F1AA 1IQEL 2OYUP 1DIYA 3U7UG 1N7DA 3CENL 3KQCL 4FM5A 1NQLB 4YZUB 1NFUB 2CJIB 3LTGD 4YT6L 4Z6AL 4JZFL 1HAEA 5IKRA 1PFXL 3LC3B 4AQTA 2J38B 1LQDA 2KB9A 1P9JA 1GK5A 5F19A 2WPJE 1LK9A 2RHPA
chains in the Genus database with same CATH topology
1XDTR 1MQ6L 4X8TL 2FD6A 1CVUA 1WHFA 3NTGA 2UWLB 3M36L 2Y5FL 3TGFA 3N8YB 1DVAL 1UZPA 3N8VA 5IKQA 2BZ6L 1ATDA 3HPTA 1BF9A 2KV4A 1HT8A 2PHBB 4MMXB 3CFWA 2P3TA 2RA0L 3MDLA 3N8ZA 4G1MB 2WZPP 4COXA 1IOXA 3NTBA 2MGPA 1EGFA 4XL1A 4YT7L 1RFNB 3P5BL 1L3YA 2WPHE 3EGFA 1X7AL 2EI6B 3LC5B 4RRXA 1COUA 1EQHA 1G2LB 1JL9A 3LN1A 4OTJA 2ADXA 2VH6B 3FFGL 1EPJA 4ZH8B 2W2NE 3KCGL 4Y71B 4BDWA 1I0UA 2W2QE 1P0SL 1U67A 1YO8A 2W2OE 3KL6B 2D1JB 3OLUA 2BO2A 2P3FN 1KIGL 1FJSL 1IQIL 1FFMA 1KLJL 2XBYL 3FBYA 3NJPC 5L2YL 4Y79B 1IQJL 5COXA 1EPGA 1EQGA 1DX5I 4ISHL 2B7DL 4ZHAB 1K36A 4RS0A 1APOA 2PUQL 2J94B 3KQDL 1F7MA 3QCWA 2J4IB 1CX2A 4BDXA 4NA9L 2FZZL 1HZ8A 2DDUA 1KLIL 2VVVL 2Y82B 1KLOA 3V65B 1FAKL 2H9EC 2W2PE 3N8YA 1WU1B 3TK6B 2Y5GL 2MGRA 2Y7ZB 1CQEA 4Y7AB 1IQML 4X8SL 5JB9E 3IITB 5JBCE 3MQEA 3ZYJB 1LMMA 3KQEL 1CVWL 1F0SB 3HS6A 4BTIA 4M10A 4M11A 4RRZA 1IVOC 1YGCL 1ADXA 5E8DA 2BQ7A 2Y81B 4BXSA 4CSYA 2P16L 4LORA 1UZKA 1NFXB 4ZXXL 5JB8E 5L30L 2BQWA 1OB1C 3ZYIB 4LMFA 3U73A 1ZAQA 4Z0LA 4X8VL 1EMOA 2BQ6A 2Q1JB 1EMNA 2AYLA 2P28B 1CEJA 1NFYB 4CUEA 1UZQA 4E1GA 2XBVL 1IQKL 3N8WB 2J34B 4MMYB 1K37A 1EPIA 2P94L 2BMGA 2MHPA 5IKVA 2Y80B 3POYA 1G1QA 3TZIA 2EI7B 5JBBE 4JZDL 3CS7L 1PTHA 2WG4B 4RRWA 2W86A 3C9AC 2XBXL 1YUFA 1IGZA 1FF7A 3H5CB 2EI8B 2WPKE 3ASIA 1HT5A 2BOHA 3FCSB 2NPRA 4BTTA 5CKMA 5I46L 1IQFL 3HS7A 3V64C 2W26B 1M1XB 1FSBA 4MMZB 3HS5A 1TOZA 3BT1A 4Y7BB 5JBAE 2KNIA 3BPSE 5JVYA 1SZBA 2XC4L 4JZEL 3GISX 1DQBA 3SW2A 3N8WA 3LTFB 5JVZA 4CUFA 1XFEA 3QH0A 2P3UA 2BOKL 3TBDA 4RUTA 2Y38A 4NGAL 2JKHL 1XKAL 1IQGL 2I9AA 1IOEL 2UWOB 2XC5L 3ELAL 4D0FA 1IJQA 2BOUA 3HO5A 3BT2A 4XBMA 3KRKA 2OYEP 4NG9L 5KIRA 1IP0A 1IGXA 1YUGA 2P3FL 1G1TA 1IQNL 1B9WA 3DEMA 2M74A 4BTUA 4ISIL 2FLBL 1N1IA 3F1SB 1PGEA 2XBWL 2VWOL 1IQLL 1UZJA 3N8XA 1IQHL 2VWLL 2YGQA 3Q3KB 1KSNB 2W3KB 5EGMB 1ATAA 1DDXA 2P26A 1EPHA 4X8UL 3ENSA 2WPLE 4XLWA 2WFTA 1LPKA 4D90A 4JYVL 4Y6DB 1LPZA 1Z6EL 2VWNL 4ZXYL 4O02B 5L2ZL 3LIWB 2YGPA 2K2TA 4A7IA 3ZYGA 1O5DL 1W7XL 3RR3A 3TH3L 1HRFA 5CKNA 1EAIC 3OLTA 2BOXA 1EZQB 1NT0A 1G1RA 3SOBB 3TK5B 1NZIA 3QMOA 1WHEA 4PH9A 1MOXC 1YUKB 2W2ME 1QFKL 5CKQA 2RNLA 2VVUL 3HO3A 3S6XA 3K9XA 4A94C 1HCGB 4ZAEB 5CISA 5IKTA 1EBVA 4RRYA 3R05A 1HX2A 2J95B 1HJ7A 3KK6A 3NT1A 1NFWB 4TGFA 1U8CB 1A3PA 1LMJA 2VH0B 1AUTL 1JBUL 1PXXA 1Z6CA 1PRHA 1CCVA 2F9BL 3M37L 1XKBA 4JYUL 2I9BA 2P95L 3GCWE 1C5MF 2VWMK 4O1ZA 1FE2A 4D0EA 2J2UB 3LN0A 4CUDA 1F0RB 2GD4A 2P93L 1HAFA 2YGOA 1G2MB 1TPGA 1G1SA 2WPME 2Y5HL 1F7EA 1J9CL 3Q7DA 2WYGB 3GCXE 3F6UL 1Q4GA 3KQBL 2Y7XB 3LAQA 2FLRL 1ATEA 1APQA 4Z0KB 1URKA 3HO4A 1NPEB 5JW1A 3CA7A 5KN5C 4C16A 3PGHA 2PR3B 2KL7A 1V3XB 2H9EL 2W3IB 1ATBA 2WG3C 2XC0L 1LPGA 3SOVA 4BXWA 1W8BL 2K2SB 2G00L 1CCFA 2WPIE 1L5GB 4Y76B 1JV2B 5FDQA 3SOQA 1MQ5L 2UWPB 2VVCK 2VJ3A 2TGFA 6COXA 4OTYA 2WFXB 1TLEA 2WYJB 5K0HB 3IJEB 1HREA 1FAXL 2FLGA 5F1AA 1IQEL 2OYUP 1DIYA 3U7UG 1N7DA 3CENL 3KQCL 4FM5A 1NQLB 4YZUB 1NFUB 2CJIB 3LTGD 4YT6L 4Z6AL 4JZFL 1HAEA 5IKRA 1PFXL 3LC3B 4AQTA 2J38B 1LQDA 2KB9A 1P9JA 1GK5A 5F19A 2WPJE 2RHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDT R;  1MQ6 L;  4X8T L;  2FD6 A;  1CVU A;  1WHF A;  3NTG A;  2UWL B;  3M36 L;  2Y5F L;  3TGF A;  3N8Y B;  1DVA L;  1UZP A;  3N8V A;  5IKQ A;  2BZ6 L;  1ATD A;  3HPT A;  1BF9 A;  2KV4 A;  1HT8 A;  2PHB B;  4MMX B;  3CFW A;  2P3T A;  2RA0 L;  3MDL A;  3N8Z A;  4G1M B;  4COX A;  1IOX A;  3NTB A;  2MGP A;  1EGF A;  4XL1 A;  4YT7 L;  1RFN B;  3P5B L;  1L3Y A;  2WPH E;  3EGF A;  1X7A L;  2EI6 B;  3LC5 B;  4RRX A;  1COU A;  1EQH A;  1G2L B;  1JL9 A;  3LN1 A;  4OTJ A;  2ADX A;  2VH6 B;  3FFG L;  1EPJ A;  4ZH8 B;  2W2N E;  3KCG L;  4Y71 B;  4BDW A;  1I0U A;  2W2Q E;  1P0S L;  1U67 A;  1YO8 A;  2W2O E;  3KL6 B;  2D1J B;  3OLU A;  2BO2 A;  2P3F N;  1KIG L;  1FJS L;  1IQI L;  1FFM A;  1KLJ L;  2XBY L;  3FBY A;  3NJP C;  5L2Y L;  4Y79 B;  1IQJ L;  5COX A;  1EPG A;  1EQG A;  1DX5 I;  4ISH L;  2B7D L;  4ZHA B;  1K36 A;  4RS0 A;  1APO A;  2PUQ L;  2J94 B;  3KQD L;  1F7M A;  3QCW A;  2J4I B;  1CX2 A;  4BDX A;  4NA9 L;  2FZZ L;  1HZ8 A;  2DDU A;  1KLI L;  2VVV L;  2Y82 B;  1KLO A;  3V65 B;  1FAK L;  2W2P E;  3N8Y A;  1WU1 B;  3TK6 B;  2Y5G L;  2MGR A;  2Y7Z B;  1CQE A;  4Y7A B;  1IQM L;  4X8S L;  5JB9 E;  3IIT B;  5JBC E;  3MQE A;  3ZYJ B;  3KQE L;  1CVW L;  1F0S B;  3HS6 A;  4BTI A;  4M10 A;  4M11 A;  4RRZ A;  1IVO C;  1YGC L;  1ADX A;  5E8D A;  2BQ7 A;  2Y81 B;  4BXS A;  4CSY A;  2P16 L;  4LOR A;  1UZK A;  1NFX B;  4ZXX L;  5JB8 E;  5L30 L;  2BQW A;  1OB1 C;  3ZYI B;  4LMF A;  3U73 A;  1ZAQ A;  4Z0L A;  4X8V L;  1EMO A;  2BQ6 A;  2Q1J B;  1EMN A;  2AYL A;  2P28 B;  1CEJ A;  1NFY B;  4CUE A;  1UZQ A;  4E1G A;  2XBV L;  1IQK L;  3N8W B;  2J34 B;  4MMY B;  1K37 A;  1EPI A;  2P94 L;  2BMG A;  2MHP A;  5IKV A;  2Y80 B;  3POY A;  1G1Q A;  3TZI A;  2EI7 B;  5JBB E;  4JZD L;  3CS7 L;  1PTH A;  2WG4 B;  4RRW A;  2W86 A;  3C9A C;  2XBX L;  1YUF A;  1IGZ A;  1FF7 A;  3H5C B;  2EI8 B;  2WPK E;  3ASI A;  1HT5 A;  2BOH A;  3FCS B;  2NPR A;  4BTT A;  5CKM A;  5I46 L;  1IQF L;  3HS7 A;  3V64 C;  2W26 B;  1M1X B;  1FSB A;  4MMZ B;  3HS5 A;  1TOZ A;  3BT1 A;  4Y7B B;  5JBA E;  3BPS E;  5JVY A;  1SZB A;  2XC4 L;  4JZE L;  3GIS X;  1DQB A;  3SW2 A;  3N8W A;  3LTF B;  5JVZ A;  4CUF A;  1XFE A;  3QH0 A;  2P3U A;  2BOK L;  3TBD A;  4RUT A;  2Y38 A;  4NGA L;  2JKH L;  1XKA L;  1IQG L;  2I9A A;  1IOE L;  2UWO B;  2XC5 L;  3ELA L;  4D0F A;  1IJQ A;  2BOU A;  3HO5 A;  3BT2 A;  4XBM A;  3KRK A;  2OYE P;  4NG9 L;  5KIR A;  1IP0 A;  1IGX A;  1YUG A;  2P3F L;  1G1T A;  1IQN L;  1B9W A;  3DEM A;  2M74 A;  4BTU A;  4ISI L;  2FLB L;  1N1I A;  3F1S B;  1PGE A;  2XBW L;  2VWO L;  1IQL L;  1UZJ A;  3N8X A;  1IQH L;  2VWL L;  3Q3K B;  1KSN B;  2W3K B;  5EGM B;  1ATA A;  1DDX A;  2P26 A;  1EPH A;  4X8U L;  3ENS A;  2WPL E;  4XLW A;  2WFT A;  1LPK A;  4D90 A;  4JYV L;  4Y6D B;  1LPZ A;  1Z6E L;  2VWN L;  4ZXY L;  4O02 B;  5L2Z L;  3LIW B;  2YGP A;  2K2T A;  4A7I A;  3ZYG A;  1O5D L;  1W7X L;  3RR3 A;  3TH3 L;  1HRF A;  5CKN A;  1EAI C;  3OLT A;  2BOX A;  1EZQ B;  1NT0 A;  1G1R A;  3SOB B;  3TK5 B;  1NZI A;  3QMO A;  1WHE A;  4PH9 A;  1MOX C;  1YUK B;  2W2M E;  1QFK L;  5CKQ A;  2RNL A;  2VVU L;  3HO3 A;  3K9X A;  1HCG B;  4ZAE B;  5CIS A;  5IKT A;  1EBV A;  4RRY A;  3R05 A;  1HX2 A;  2J95 B;  1HJ7 A;  3KK6 A;  3NT1 A;  1NFW B;  4TGF A;  1U8C B;  1A3P A;  1LMJ A;  2VH0 B;  1AUT L;  1JBU L;  1PXX A;  1Z6C A;  1PRH A;  1CCV A;  2F9B L;  3M37 L;  1XKB A;  4JYU L;  2I9B A;  2P95 L;  3GCW E;  1C5M F;  2VWM K;  4O1Z A;  1FE2 A;  4D0E A;  2J2U B;  3LN0 A;  4CUD A;  1F0R B;  2GD4 A;  2P93 L;  1HAF A;  2YGO A;  1G2M B;  1TPG A;  1G1S A;  2WPM E;  2Y5H L;  1F7E A;  1J9C L;  3Q7D A;  2WYG B;  3GCX E;  3F6U L;  1Q4G A;  3KQB L;  2Y7X B;  3LAQ A;  2FLR L;  1ATE A;  1APQ A;  4Z0K B;  1URK A;  3HO4 A;  1NPE B;  5JW1 A;  3CA7 A;  5KN5 C;  4C16 A;  3PGH A;  2PR3 B;  2KL7 A;  1V3X B;  2H9E L;  2W3I B;  1ATB A;  2WG3 C;  2XC0 L;  1LPG A;  3SOV A;  4BXW A;  1W8B L;  2K2S B;  2G00 L;  1CCF A;  2WPI E;  1L5G B;  4Y76 B;  1JV2 B;  5FDQ A;  3SOQ A;  1MQ5 L;  2UWP B;  2VVC K;  2VJ3 A;  2TGF A;  6COX A;  4OTY A;  2WFX B;  1TLE A;  2WYJ B;  5K0H B;  3IJE B;  1HRE A;  1FAX L;  2FLG A;  5F1A A;  1IQE L;  2OYU P;  1DIY A;  3U7U G;  1N7D A;  3CEN L;  3KQC L;  4FM5 A;  1NQL B;  4YZU B;  1NFU B;  2CJI B;  3LTG D;  4YT6 L;  4Z6A L;  4JZF L;  1HAE A;  5IKR A;  1PFX L;  3LC3 B;  4AQT A;  2J38 B;  1LQD A;  2KB9 A;  1P9J A;  1GK5 A;  5F19 A;  2WPJ E;  2RHP A; 
#chains in the Genus database with same CATH topology
 1XDT R;  2BT8 A;  1MQ6 L;  4X8T L;  2FD6 A;  1CVU A;  1WHF A;  3NTG A;  2UWL B;  3M36 L;  2Y5F L;  3TGF A;  3N8Y B;  1DVA L;  1V1I A;  1UZP A;  3N8V A;  5IKQ A;  2BZ6 L;  1ATD A;  3HPT A;  1BF9 A;  2KV4 A;  1HT8 A;  2PHB B;  4MMX B;  3CFW A;  2P3T A;  2RA0 L;  3MDL A;  3N8Z A;  4G1M B;  2WZP P;  4COX A;  1IOX A;  3NTB A;  1KKE A;  2MGP A;  1EGF A;  4XL1 A;  4YT7 L;  1RFN B;  3P5B L;  1L3Y A;  2WPH E;  3EGF A;  1X7A L;  2EI6 B;  4GU4 A;  3LC5 B;  4RRX A;  1COU A;  1EQH A;  1G2L B;  1JL9 A;  3LN1 A;  4OTJ A;  2ADX A;  2VH6 B;  3FFG L;  1EPJ A;  4ZH8 B;  2W2N E;  3KCG L;  4Y71 B;  4BDW A;  1I0U A;  2W2Q E;  1P0S L;  1U67 A;  1YO8 A;  2W2O E;  2HOX A;  3KL6 B;  2D1J B;  3OLU A;  2BO2 A;  2P3F N;  1KIG L;  1FJS L;  1IQI L;  1FFM A;  1KLJ L;  2XBY L;  3FBY A;  3NJP C;  5L2Y L;  4Y79 B;  1IQJ L;  5COX A;  1EPG A;  1EQG A;  1DX5 I;  4ISH L;  2B7D L;  4ZHA B;  1K36 A;  4RS0 A;  1APO A;  2PUQ L;  2J94 B;  3KQD L;  1F7M A;  3QCW A;  2J4I B;  1CX2 A;  4BDX A;  4NA9 L;  2FZZ L;  1HZ8 A;  2DDU A;  1KLI L;  2VVV L;  2Y82 B;  1KLO A;  3V65 B;  1FAK L;  2H9E C;  2W2P E;  3N8Y A;  1WU1 B;  3TK6 B;  2Y5G L;  2MGR A;  2Y7Z B;  1CQE A;  4Y7A B;  1IQM L;  4X8S L;  5JB9 E;  3IIT B;  5JBC E;  3MQE A;  3ZYJ B;  1LMM A;  3KQE L;  1CVW L;  1F0S B;  3HS6 A;  4BTI A;  4M10 A;  4M11 A;  4RRZ A;  1IVO C;  1YGC L;  1ADX A;  5E8D A;  2BQ7 A;  2Y81 B;  4BXS A;  4CSY A;  2P16 L;  4LOR A;  1UZK A;  1NFX B;  4ZXX L;  5JB8 E;  5L30 L;  2BQW A;  1OB1 C;  3ZYI B;  4LMF A;  3U73 A;  1ZAQ A;  4Z0L A;  4X8V L;  1EMO A;  2BQ6 A;  2Q1J B;  1EMN A;  2AYL A;  2P28 B;  1CEJ A;  1NFY B;  4CUE A;  1UZQ A;  4E1G A;  2XBV L;  1IQK L;  3N8W B;  2J34 B;  4MMY B;  1K37 A;  1EPI A;  2P94 L;  2BMG A;  2MHP A;  5IKV A;  2Y80 B;  3POY A;  1G1Q A;  3TZI A;  2EI7 B;  5JBB E;  4JZD L;  3CS7 L;  1PTH A;  2WG4 B;  4RRW A;  2W86 A;  3C9A C;  2XBX L;  1YUF A;  1IGZ A;  1FF7 A;  3H5C B;  2EI8 B;  2WPK E;  3ASI A;  1HT5 A;  2BOH A;  3FCS B;  2NPR A;  4BTT A;  5CKM A;  5I46 L;  1IQF L;  3HS7 A;  3V64 C;  2W26 B;  1M1X B;  1FSB A;  3HS5 A;  4MMZ B;  1TOZ A;  3BT1 A;  4Y7B B;  5JBA E;  2KNI A;  3BPS E;  5JVY A;  1SZB A;  2XC4 L;  4JZE L;  3GIS X;  1DQB A;  3SW2 A;  3N8W A;  3LTF B;  5JVZ A;  4CUF A;  1XFE A;  3QH0 A;  2P3U A;  2BOK L;  3TBD A;  4RUT A;  2Y38 A;  2JJL A;  4NGA L;  2JKH L;  1XKA L;  1IQG L;  2I9A A;  1IOE L;  2UWO B;  2XC5 L;  3ELA L;  4D0F A;  1IJQ A;  2BOU A;  3HO5 A;  3BT2 A;  4XBM A;  3KRK A;  2OYE P;  4NG9 L;  5KIR A;  1IP0 A;  1IGX A;  1YUG A;  2P3F L;  1G1T A;  1IQN L;  1B9W A;  3DEM A;  2M74 A;  4BTU A;  4ISI L;  2FLB L;  1N1I A;  3F1S B;  1PGE A;  2XBW L;  2VWO L;  1IQL L;  1UZJ A;  3N8X A;  1IQH L;  2VWL L;  2YGQ A;  3Q3K B;  1KSN B;  2W3K B;  5EGM B;  1ATA A;  1DDX A;  2P26 A;  1EPH A;  4X8U L;  3ENS A;  2WPL E;  4XLW A;  2WFT A;  1LPK A;  4D90 A;  4JYV L;  4Y6D B;  1LPZ A;  1Z6E L;  2VWN L;  4ZXY L;  4O02 B;  5L2Z L;  3LIW B;  2YGP A;  2K2T A;  4A7I A;  3ZYG A;  1O5D L;  1W7X L;  3RR3 A;  3TH3 L;  1HRF A;  5CKN A;  1EAI C;  3OLT A;  2BOX A;  1EZQ B;  1NT0 A;  1G1R A;  3SOB B;  3TK5 B;  1NZI A;  3QMO A;  1WHE A;  4PH9 A;  1MOX C;  1YUK B;  2W2M E;  1QFK L;  5CKQ A;  2RNL A;  2VVU L;  3HO3 A;  3S6X A;  3K9X A;  4A94 C;  2BT7 A;  1HCG B;  4ZAE B;  5CIS A;  5IKT A;  1EBV A;  4RRY A;  3R05 A;  1HX2 A;  2J95 B;  1HJ7 A;  3KK6 A;  3NT1 A;  1NFW B;  4TGF A;  1U8C B;  1A3P A;  1LMJ A;  2VH0 B;  1AUT L;  1JBU L;  1PXX A;  1Z6C A;  1PRH A;  1CCV A;  2F9B L;  3M37 L;  1XKB A;  4JYU L;  2I9B A;  2P95 L;  3GCW E;  1C5M F;  2VWM K;  4O1Z A;  1FE2 A;  4D0E A;  2J2U B;  3LN0 A;  4CUD A;  1F0R B;  2GD4 A;  2P93 L;  1HAF A;  2YGO A;  1G2M B;  1TPG A;  1G1S A;  2WPM E;  2Y5H L;  1F7E A;  1QIU A;  1J9C L;  3Q7D A;  2WYG B;  3GCX E;  3F6U L;  1Q4G A;  3KQB L;  2Y7X B;  3LAQ A;  2FLR L;  1ATE A;  1APQ A;  4Z0K B;  1URK A;  3HO4 A;  1NPE B;  1V1H A;  5JW1 A;  3CA7 A;  5KN5 C;  4C16 A;  3PGH A;  2PR3 B;  2KL7 A;  1V3X B;  2H9E L;  2HOR A;  2W3I B;  2VRS A;  1ATB A;  2WG3 C;  2XC0 L;  1LPG A;  3SOV A;  4BXW A;  1W8B L;  2K2S B;  2G00 L;  1CCF A;  2WPI E;  1L5G B;  4Y76 B;  1JV2 B;  5FDQ A;  3SOQ A;  1MQ5 L;  2UWP B;  2VVC K;  2VJ3 A;  2TGF A;  6COX A;  2BSF A;  4OTY A;  2WFX B;  1TLE A;  2WYJ B;  5K0H B;  3IJE B;  1HRE A;  4GU3 A;  1FAX L;  2FLG A;  5F1A A;  1IQE L;  2OYU P;  1DIY A;  3U7U G;  1N7D A;  3CEN L;  3KQC L;  4FM5 A;  1NQL B;  4YZU B;  1NFU B;  2CJI B;  3LTG D;  4YT6 L;  4Z6A L;  4JZF L;  1HAE A;  5IKR A;  1PFX L;  3LC3 B;  4AQT A;  2J38 B;  1LQD A;  2KB9 A;  1P9J A;  1GK5 A;  5F19 A;  2WPJ E;  1LK9 A;  2RHP A; 
#chains in the Genus database with same CATH homology
 1XDT R;  1MQ6 L;  4X8T L;  2FD6 A;  1CVU A;  1WHF A;  3NTG A;  2UWL B;  3M36 L;  2Y5F L;  3TGF A;  3N8Y B;  1DVA L;  1UZP A;  3N8V A;  5IKQ A;  2BZ6 L;  1ATD A;  3HPT A;  1BF9 A;  2KV4 A;  1HT8 A;  2PHB B;  4MMX B;  3CFW A;  2P3T A;  2RA0 L;  3MDL A;  3N8Z A;  4G1M B;  2WZP P;  4COX A;  1IOX A;  3NTB A;  2MGP A;  1EGF A;  4XL1 A;  4YT7 L;  1RFN B;  3P5B L;  1L3Y A;  2WPH E;  3EGF A;  1X7A L;  2EI6 B;  3LC5 B;  4RRX A;  1COU A;  1EQH A;  1G2L B;  1JL9 A;  3LN1 A;  4OTJ A;  2ADX A;  2VH6 B;  3FFG L;  1EPJ A;  4ZH8 B;  2W2N E;  3KCG L;  4Y71 B;  4BDW A;  1I0U A;  2W2Q E;  1P0S L;  1U67 A;  1YO8 A;  2W2O E;  3KL6 B;  2D1J B;  3OLU A;  2BO2 A;  2P3F N;  1KIG L;  1FJS L;  1IQI L;  1FFM A;  1KLJ L;  2XBY L;  3FBY A;  3NJP C;  5L2Y L;  4Y79 B;  1IQJ L;  5COX A;  1EPG A;  1EQG A;  1DX5 I;  4ISH L;  2B7D L;  4ZHA B;  1K36 A;  4RS0 A;  1APO A;  2PUQ L;  2J94 B;  3KQD L;  1F7M A;  3QCW A;  2J4I B;  1CX2 A;  4BDX A;  4NA9 L;  2FZZ L;  1HZ8 A;  2DDU A;  1KLI L;  2VVV L;  2Y82 B;  1KLO A;  3V65 B;  1FAK L;  2H9E C;  2W2P E;  3N8Y A;  1WU1 B;  3TK6 B;  2Y5G L;  2MGR A;  2Y7Z B;  1CQE A;  4Y7A B;  1IQM L;  4X8S L;  5JB9 E;  3IIT B;  5JBC E;  3MQE A;  3ZYJ B;  1LMM A;  3KQE L;  1CVW L;  1F0S B;  3HS6 A;  4BTI A;  4M10 A;  4M11 A;  4RRZ A;  1IVO C;  1YGC L;  1ADX A;  5E8D A;  2BQ7 A;  2Y81 B;  4BXS A;  4CSY A;  2P16 L;  4LOR A;  1UZK A;  1NFX B;  4ZXX L;  5JB8 E;  5L30 L;  2BQW A;  1OB1 C;  3ZYI B;  4LMF A;  3U73 A;  1ZAQ A;  4Z0L A;  4X8V L;  1EMO A;  2BQ6 A;  2Q1J B;  1EMN A;  2AYL A;  2P28 B;  1CEJ A;  1NFY B;  4CUE A;  1UZQ A;  4E1G A;  2XBV L;  1IQK L;  3N8W B;  2J34 B;  4MMY B;  1K37 A;  1EPI A;  2P94 L;  2BMG A;  2MHP A;  5IKV A;  2Y80 B;  3POY A;  1G1Q A;  3TZI A;  2EI7 B;  5JBB E;  4JZD L;  3CS7 L;  1PTH A;  2WG4 B;  4RRW A;  2W86 A;  3C9A C;  2XBX L;  1YUF A;  1IGZ A;  1FF7 A;  3H5C B;  2EI8 B;  2WPK E;  3ASI A;  1HT5 A;  2BOH A;  3FCS B;  2NPR A;  4BTT A;  5CKM A;  5I46 L;  1IQF L;  3HS7 A;  3V64 C;  2W26 B;  1M1X B;  1FSB A;  4MMZ B;  3HS5 A;  1TOZ A;  3BT1 A;  4Y7B B;  5JBA E;  2KNI A;  3BPS E;  5JVY A;  1SZB A;  2XC4 L;  4JZE L;  3GIS X;  1DQB A;  3SW2 A;  3N8W A;  3LTF B;  5JVZ A;  4CUF A;  1XFE A;  3QH0 A;  2P3U A;  2BOK L;  3TBD A;  4RUT A;  2Y38 A;  4NGA L;  2JKH L;  1XKA L;  1IQG L;  2I9A A;  1IOE L;  2UWO B;  2XC5 L;  3ELA L;  4D0F A;  1IJQ A;  2BOU A;  3HO5 A;  3BT2 A;  4XBM A;  3KRK A;  2OYE P;  4NG9 L;  5KIR A;  1IP0 A;  1IGX A;  1YUG A;  2P3F L;  1G1T A;  1IQN L;  1B9W A;  3DEM A;  2M74 A;  4BTU A;  4ISI L;  2FLB L;  1N1I A;  3F1S B;  1PGE A;  2XBW L;  2VWO L;  1IQL L;  1UZJ A;  3N8X A;  1IQH L;  2VWL L;  2YGQ A;  3Q3K B;  1KSN B;  2W3K B;  5EGM B;  1ATA A;  1DDX A;  2P26 A;  1EPH A;  4X8U L;  3ENS A;  2WPL E;  4XLW A;  2WFT A;  1LPK A;  4D90 A;  4JYV L;  4Y6D B;  1LPZ A;  1Z6E L;  2VWN L;  4ZXY L;  4O02 B;  5L2Z L;  3LIW B;  2YGP A;  2K2T A;  4A7I A;  3ZYG A;  1O5D L;  1W7X L;  3RR3 A;  3TH3 L;  1HRF A;  5CKN A;  1EAI C;  3OLT A;  2BOX A;  1EZQ B;  1NT0 A;  1G1R A;  3SOB B;  3TK5 B;  1NZI A;  3QMO A;  1WHE A;  4PH9 A;  1MOX C;  1YUK B;  2W2M E;  1QFK L;  5CKQ A;  2RNL A;  2VVU L;  3HO3 A;  3S6X A;  3K9X A;  4A94 C;  1HCG B;  4ZAE B;  5CIS A;  5IKT A;  1EBV A;  4RRY A;  3R05 A;  1HX2 A;  2J95 B;  1HJ7 A;  3KK6 A;  3NT1 A;  1NFW B;  4TGF A;  1U8C B;  1A3P A;  1LMJ A;  2VH0 B;  1AUT L;  1JBU L;  1PXX A;  1Z6C A;  1PRH A;  1CCV A;  2F9B L;  3M37 L;  1XKB A;  4JYU L;  2I9B A;  2P95 L;  3GCW E;  1C5M F;  2VWM K;  4O1Z A;  1FE2 A;  4D0E A;  2J2U B;  3LN0 A;  4CUD A;  1F0R B;  2GD4 A;  2P93 L;  1HAF A;  2YGO A;  1G2M B;  1TPG A;  1G1S A;  2WPM E;  2Y5H L;  1F7E A;  1J9C L;  3Q7D A;  2WYG B;  3GCX E;  3F6U L;  1Q4G A;  3KQB L;  2Y7X B;  3LAQ A;  2FLR L;  1ATE A;  1APQ A;  4Z0K B;  1URK A;  3HO4 A;  1NPE B;  5JW1 A;  3CA7 A;  5KN5 C;  4C16 A;  3PGH A;  2PR3 B;  2KL7 A;  1V3X B;  2H9E L;  2W3I B;  1ATB A;  2WG3 C;  2XC0 L;  1LPG A;  3SOV A;  4BXW A;  1W8B L;  2K2S B;  2G00 L;  1CCF A;  2WPI E;  1L5G B;  4Y76 B;  1JV2 B;  5FDQ A;  3SOQ A;  1MQ5 L;  2UWP B;  2VVC K;  2VJ3 A;  2TGF A;  6COX A;  4OTY A;  2WFX B;  1TLE A;  2WYJ B;  5K0H B;  3IJE B;  1HRE A;  1FAX L;  2FLG A;  5F1A A;  1IQE L;  2OYU P;  1DIY A;  3U7U G;  1N7D A;  3CEN L;  3KQC L;  4FM5 A;  1NQL B;  4YZU B;  1NFU B;  2CJI B;  3LTG D;  4YT6 L;  4Z6A L;  4JZF L;  1HAE A;  5IKR A;  1PFX L;  3LC3 B;  4AQT A;  2J38 B;  1LQD A;  2KB9 A;  1P9J A;  1GK5 A;  5F19 A;  2WPJ E;  2RHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...