1EPUA

X-ray crystal structure of neuronal sec1 from squid
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
590
structure length
546
Chain Sequence
b'ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-SEC1
publication title The X-ray crystal structure of neuronal Sec1 from squid sheds new light on the role of this protein in exocytosis.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 168
structure length 546
sequence length 590
ec nomenclature
pdb deposition date 2000-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1epuA03
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1epuA04
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1epuA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1epuA02
5BV0A 1Y9JA 4CCAA 4BX8A 4BX9A 4JEHA 4JC8A 3C98A 5BV1A 1FVFA 1MQSA 4JEUA 1EPUA 1FVHA 3PUJA 2XHEA 5BUZA 3PUKA 4KMOA
chains in the Genus database with same CATH superfamily
2ECKA 2HGSA 1JAYA 4IWYA 4G6ZA 2UYOA 2J7PA 3DXFA 4J8YA 3OQ6A 3GLGA 1L1QA 4O1PA 2C5GA 3MAJA 1EXMA 3HB9A 2IF2A 4JHKA 2BTQA 1H4TA 1Y6JA 1OFGA 2FOLA 3NHMA 4ZT4A 1TQDA 1FBNA 4PAGA 4ZVLA 1DFGA 3F49S 4Y0AA 3NOGD 2PHZA 3EYWA 1H1TA 2A7QA 4X95A 3BTOA 3I0NA 3KUUA 3A4LA 4NRHB 1Z8NA 3V8RA 2D5BA 2N46A 1LDMA 3LXRA 5FL3A 4NS1A 3GPCA 3BXXA 5FQOA 2WMOA 1U7ZA 3FHLA 5ALXA 4MCHA 1E6EA 2JIOA 3IT2A 4LF5B 1UMCB 2BHTA 3EGXA 2JGMA 2IONA 1WP9A 1N33B 1BH2A 2KCLA 3JAMA 4LNBA 2HGZA 3OFND 2FZLA 4TZ0A 2P1ZA 1W1UA 4RC9A 4AWAA 2Q1YA 2AOUA 3QNWA 4AUMA 1N9GA 4N5DA 3JYOA 1Q0ZA 3HFGA 3IVRA 1O94D 1UKEA 1OB5A 1T91A 3FEXA 3QA9A 5EJ9A 2PGJA 1W0JD 1HE8A 3AR3A 1A8HA 1I7NA 1Z7YA 2YS7A 1GDDA 1R16A 5FEUA 3TJZA 1II9A 4Z68A 2GN1A 3I6MA 4UC0A 1XB2A 3R3VA 3UIPC 4TV9F 2RARA 1IM8A 2P2YA 4LSWA 2JKVA 3KQTA 4B2YA 4EW6A 3JR3A 1GITA 3QMVA 1A7AA 1JJIA 3JQ7B 3SNKA 3GLIB 2AI1A 4QQRA 2D1FA 5H7PA 4CT4A 5ILOA 4I1RA 1NV8A 3M82A 3VYVA 2ETBA 2PJZA 4R2LA 3P0JA 1VBFA 1VA4A 1WW3A 1NUPA 1HQKA 3FVQA 4JT4A 1FMCA 1ZX1A 3THOA 4CKEA 5FBZA 3RRBA 1I7DA 4IVNA 2ICAA 2RBGA 4R1UA 1OU4A 1ZJJA 4B2LA 4D4IA 1M2OB 3DE2X 5TS3A 3FHJA 4DSTA 4P3YA 2ZI7A 4UTXA 4ZT6A 2CYBA 5LXTA 4A0SA 2AOVA 2O2YA 3ZGNA 5L53A 1WAO1 1IY1A 3LC7O 1K1BA 1VZ2A 3E9QA 1W8DA 5DOZA 1EXVA 3MTIA 1OJ7A 3ND6A 3U1BA 1CIVA 3UMBA 4Z3DA 3HDJA 2P4QA 5HCIA 1FFDA 2AMVA 3A9TA 2LXMA 1X92A 3PVCA 2WFZA 4MKXA 3K09C 2CHUA 3KTOA 3DB1A 4CODB 5CXSA 5KYUB 1J42A 3OM0A 2GBPA 1ULAA 4CT0A 3JWPA 4U9HS 1XKTA 4RSGA 1EHYA 5AIJA 3WKCA 1YMVA 2XKAA 3B3FA 1BMTA 1PFKA 1V11A 5ALFA 3HUEA 4E2XA 3FH5A 2AG5A 1V8PA 1CUCA 1RRKA 1HDRA 4YAWA 5CU7A 2WTUA 1BS2A 4AYTA 1YC5A 3DO8A 4UAJA 3AP2A 4YRGA 3I5PA 3DCNA 5TVKA 4HLCA 1FYFA 1ULBA 1T24A 4O2AB 4EYEA 4RGYA 4YAOA 4J7XA 1O95C 1BKDR 2JCBA 4NDNE 1MAHA 3V55A 4CLRB 4U2EA 1QQ7A 4FR2A 3GFBA 1OTXA 4EVIA 1OC2A 2W93A 4MVYA 1R64A 3TZBA 4E2WA 2LSUA 1RBYA 3T1VA 3VJRA 4RD1A 2MDTA 1DC6A 2F62A 1G1AA 4BCDA 3UK1A 3ZCPA 5KCZA 1YF3A 3WMWA 1EWQA 1T0HB 3THSA 4UUPA 4B4UA 2UY1B 2LD4A 5EOVA 2RHGB 4UHBA 2SKEA 3OFSA 4ACBA 3LIPA 3RNOA 4U8YD 3LUCA 4GBJA 4FOPA 3WKEA 1E58A 1FDIA 2OKGA 3T5TA 4NFSA 1H2HA 3LVRE 2G67A 2GZ1A 1H4SA 3GJZA 3ECCA 5FJIA 4BY9E 2HF2A 2PG3A 1ZUNA 1PC2A 3WWYA 3UK7A 1A7UA 1GZVA 2VYCA 2WM3A 3GW4A 3D4OA 5JJBA 5K05A 4AS1A 4FVTA 3N6XA 4EG4A 3DZFA 3C3KA 5E6RA 5AKLA 2Q3MA 1AQJA 1BU9A 4EUHA 1J9GA 5JPCA 3AFMA 4FN5A 5E2BA 3ETNA 3HU2A 1G16A 4GMGA 2IYXA 4AN4A 4DXAA 1A8SA 2XQJA 1W49A 1XZKA 1WCIA 5LQUA 4CF3A 4IO0A 1FJHA 4N8EA 1S1CA 1N2IA 3NIGB 4LYJA 5HE8A 1BFDA 2BFDB 1YB5A 1NSYA 2YNMA 3HG7A 4MW4A 1RPAA 3OZRA 3SZLA 5AR1A 2PUVA 1QG6A 3H4IA 3OAAA 3I6QA 4F4CA 3JD2A 3OZCA 1LLQA 2HWKA 5CEEA 4OH1A 3A4NA 5EJFA 2OKCA 4CCYB 5K51A 3VNBA 2XGSA 2F3SA 5ALQA 2VTEA 2O20A 4Q4LA 3TPCA 2ZSUA 1EZ4A 2V03A 4L02A 4JXTA 3HYMB 1I0IA 5LQMA 2H1OA 1SIWA 1ZH4A 1CYEA 1FX0A 2XCCA 2MSKA 2O7NA 4LDAA 1Q1AA 2I3ZA 1QH1A 3LBFA 4G84A 4PH4B 4CQNA 2MIIA 2XT6A 4YBRA 2O1EA 3K9IA 1DUSA 3H17A 2JJ2A 3ICOA 1KORA 2FWMX 2EC5A 4HLLA 4JA9A 5H82A 1RJEA 2D59A 3TWRA 3AEYA 4Q15A 2G09A 4AP5A 4OI2A 4F3NA 3HB7A 3T1TA 2H2IA 1PGOA 3ABIA 1JVBA 3ZCXA 3NBYC 3PZRA 3KM0A 1OWNA 3K0BA 5P21A 3EEBA 3NUQA 3DA8A 1Z33A 3ROZA 4G0VA 4U2CA 5I7VA 4OOEA 4BMXA 3PEUB 3PFHA 1KJQA 3U4IA 3J7AC 2YBEA 4AVYA 3WGOA 3VKUA 3IEKA 1EMDA 4UTPA 2NO9A 3TFWA 4Y2VA 2C8JA 2IPAB 1PR4A 4NCAA 1TNDA 4I0WB 3V1LA 3VPHA 2WI8A 4K0KB 4NJMB 2XPYA 1V4NA 3RABA 3OCJA 2QE7D 1JG1A 3L4BA 2BGUA 5B1IA 1NI3A 4BZQA 1CG6A 4TKMA 5CFZA 2H4FA 3ZU2A 3S3TA 1WXWA 2I6SA 1JTEA 4L1BA 2AZ4A 3QPBA 4DA6A 4MDEA 1IHUA 1QCYA 3K0SA 2HPHA 3KSUA 3ZD8A 4U6SA 5IBRA 4LZZA 3PENA 3UWPA 2D1YA 4AT1A 1MB9A 3H4TA 3VVCA 4KYTA 1KERA 1C4OA 2Z6VA 1XDZA 4NBWA 4O60A 4LVCA 1P7ZA 4MX8A 4I81A 1E20A 5HFNA 3NJRA 3VZRA 4OF4A 3KCQA 1EFHA 1R4NA 4HGNA 4RZ3A 4YAGA 2P4UA 3L6EA 4ARIA 3RTBA 1WULS 3IAS6 2X3FA 2JFGA 3NWEA 3FSGA 2H4ZA 2XECA 1YKFA 2A92A 4LJSA 2GESA 3OT5A 1T5OA 1U0EA 3SR0A 2GUWA 3ZCVA 3ROFA 2CHFA 3UW3A 1EFUA 3ZS9A 4X7RA 4XGKA 4EA9A 5A7DB 2HPZA 2O52A 3ZJ5A 2HQRA 1CE8B 4BJ1A 1WEKA 2QG9A 3M6LA 3PJDA 5JV5A 1BDBA 1PD0A 5HR5A 2HE0A 3FTDA 1LI5A 4X44A 2C04A 4AD8A 3VDQA 1W4LA 5GIOE 4G65A 3RSEG 1E5DA 2EQAA 4UBJA 4DBZA 621PA 2Y4TA 3ZOKA 5KINB 4P5EA 1AH2A 4FCTA 4AU1A 4APFA 3D6MA 4Y7DA 3CVWA 4HPXB 1XVUA 1SULA 3P9YA 2IYWA 1YRQA 2VUSA 1T29A 3WB2A 1BWQA 1U28A 1D7AA 4JMPA 1IXZA 1ODLA 3MMPA 3NJ4A 4IXNA 5IKMA 2WJ6A 4NFYA 3H9GA 1BEEA 4TT3A 4HWRA 8GPBA 1GR1A 3OZAA 3ANXA 1PEAA 1Z56C 4XDYA 1ND6A 1DJLA 3FOBA 5K4AA 4CQMB 2V6JA 3JASB 2GSDA 1HQDA 4XUEA 3EIXA 2H08A 4PZZA 1U81A 1N7HA 5A03A 5G3ZA 4ZVQA 2Y2VA 1PL7A 4OXYA 4DC0A 1XLWA 3PXCX 1F4VA 4AZVA 5A0TA 1GSAA 3OJLA 1KS2A 2OCIA 2DY0A 1BIFA 3FPGA 2QE6A 1G66A 3CLUC 3FPKA 3UWOA 3BRWD 1ZGBA 2VHTA 1I5RA 1TJCA 2R5SA 5IAKA 1UMBB 1JEQA 2X9NA 2I2FA 1G8KA 3K6RA 1YZFA 5I9SA 2PZGA 4UI9C 3JYPA 4X1OA 4OLJA 4GMDA 4I1YA 3DR5A 2B2CA 2XKBA 1I9GA 4MRAA 3ZHQA 4C5BA 3RJ9A 3GFRA 4NG4A 5JD6A 4L4SA 4XM0A 2GRRB 3AL3A 1ADCA 4ARAA 1RZUA 5G41A 5JO0A 1L5WA 3T1OA 2MSNA 2BKXA 4XWWA 3VDMA 3DBRB 5AQ7A 1ULSA 5KVQA 4LJ7A 3HH8A 4TRRA 4R1QA 3LDFA 2C4HA 2O06A 2ZTLA 2QRNA 1BOFA 4CDNA 1O0SA 1V5FA 3QU9A 4P58A 2RHOA 3QTBA 3MN1A 1AA9A 5IKPA 4Y9DA 3OO1A 2BDTA 2BFCB 1Q17A 1FTWA 5IXSA 3ORRA 4CL0A 4QYXA 5CA0B 3AKCA 2FYTA 3RUFA 1J8YF 3ZGZA 3TRHA 1UOHA 3C14C 1LPAB 1I2ZA 2EZUA 1W88B 2OBNA 4KG7A 2IT1A 4UQLA 1U2TA 4Q21A 2VSOA 3IJ5A 4G8JA 2GD1O 4ZYVA 3UT0A 2GTIA 3B13B 3MEKA 1SOMA 3LQ2A 4MCAA 1QIEA 3SYTA 4FQ5A 4IM7A 4K5CA 2GBLA 2AYXA 3FVRA 2WMNA 1L9XA 1ISIA 2XLBA 1ZMRA 3ILVA 3S55A 4G5HA 4I3GA 1FXWA 1MB3A 2W0SA 3RVPA 2C0CA 4Z3OA 3Q47B 4RLYA 3FUDA 4F11A 2GGFA 2EP7A 4Y6GB 2EP5A 3ITDA 2XQFA 1S5PA 3SJ7A 2YQ8A 4U0ZA 4GA2A 1QZTA 1QAOA 3E9RA 1LF8A 5KX5B 3QYAA 1QZZA 2RBKA 3MYYA 1Y3FE 4PPYA 4ZOBA 4A8JB 1ONOA 4BVGA 4KU4A 3SZ3A 3STHA 3H42B 5J1TB 1L4YA 1LF5A 1XXHB 2C99A 5IY5E 1QONA 4GNRA 1V0JA 3NKFA 1DQYA 4IUYA 4EUNA 4RZXA 1JPVA 1ZD9A 4MVJP 3RBAA 1E9CA 1E99A 5FB3A 1AKYA 3QARA 4QIHA 4KHZA 5E2AA 3DM9B 3MKQB 10MHA 3L49A 2C4KA 2DAPA 4JA0A 3EF3A 2HIHA 4JKYA 2PGAA 1Z4QA 3LPLA 5FLYA 2Q1XA 2DR3A 3RIHA 1QRDA 1O77A 2YC4C 3RO3A 4LZPA 3LF2A 2I9PA 1HDEA 5I7UA 2TECE 3Q8XB 1NZFA 3GT7A 2DJ5A 3GVCA 3CF6R 4K9KA 2BIFA 3A3PA 1B3RA 4ZOQI 2F00A 1AO0A 2IWRA 3PDNA 3OD5A 2R85A 4I66A 4DR2B 2FP4B 3K35A 4LRZA 1CUHA 3Q5DA 2VDPB 1P1CA 2NO5A 1YMPA 3TLAA 3NYWA 5FI1B 3AB8A 4QHYA 2YJ3A 3M70A 1YQEA 5KNDH 1CU1A 5AQAA 3IS3A 3I5YA 4D4KA 4GMHA 4GOMD 1M1ZA 4FEGA 5CH8A 1WKBA 4OHYA 2O2SA 1PBNA 4GR4A 4Z7QB 3FU3A 3G8AA 3BEOA 3RCBA 4CMAA 3P27A 1Z8DA 5TMDA 3EW7A 3QX7A 2XGJA 4Y2JA 2WQZA 1Z3YA 1S2GA 2MCFA 3GUZA 1RE0A 1H5UA 1NC1A 1BWRA 5CW2A 5K3EA 3LWNA 3FTWA 4AXHA 5AJYA 4B74A 5AVOA 2AW6A 3SJBA 1KJ9A 4OHXA 1EBBA 1AKEA 3C8UA 2ABWA 2G9RA 4XR4A 5ISMA 3K2BA 3WL5A 3H1AA 4RG6A 2YWEA 4EG1A 3VR5D 3OJOA 1V8DA 3KHSA 3AY7A 1I33A 2G9UA 1BKSB 2IDMA 5IM5A 2YQ5A 1BN6A 3GA0A 3ZXYA 1MNQA 3KSQA 2L0TB 5KNBD 2EKPA 5JJ7A 1T0UA 1SU6A 4HNUA 3B3GA 4ZO9A 2GRPB 2QUAA 3U7JA 3LCRA 3LK7A 1U2RA 1YIOA 1HO8A 2YMPA 1IQPA 3QI7A 1N3IA 4TKVB 4TPKA 2ZAIA 1O58A 4R54A 2XTAA 1YFKA 2YBDA 3KQUA 2G88A 3AEXA 4BO8A 3KVNA 3R41A 4LSZE 3TTSA 1N9ZA 5CTAA 1NASA 5LXTF 4O0MA 3TAXA 4JL5A 2GI4A 1VP3A 2OR3A 3W0LB 4OHBA 4I8DA 1YCDA 3TRKA 4BO2A 2A33A 1P1HA 5F9HA 3FDJA 4MPDA 2FPIB 4P84A 5K03A 4ZXPA 4CYMD 1VRCA 4X6XA 1V9SA 1JDSA 4O33A 1QYRA 3SYNA 2HV8A 4NXNB 4UDNA 3E9EA 4O8CA 4OU5A 3Q4AB 1FYWA 2KM4A 1NULA 1BEUB 1XTJA 4DBVO 2V4ZA 3ZE2B 4WLOA 3UJ9A 1B41A 4RHEA 2OHIA 3JYQA 5MN5A 5IVPA 4JLBA 1H4VB 4WZBA 4CM8A 3EVFA 1ONPA 5BN4B 4YMIA 2IP4A 1WMBA 1RM0A 3LVBA 1DCMA 2RONA 1X70A 1PQWA 3CLRD 2VDNB 2VDWB 3OC6A 2VTDA 3MGKA 4G85A 4OXNA 1QRUA 5AICA 1NE2A 3DGEC 3BTUA 1IXYA 3KWJA 2PIAA 4BYMA 4ZTBA 2VPXA 3VR3D 3WHPA 3GZNB 3BWDD 3D5TA 4LGCA 5E1OA 3HFSA 4G9GA 4Q5IA 1Z74A 4UI9J 3EEOA 2JEOA 1JW9B 3F90A 2F3PA 2EFCB 1NBHA 4KE6A 3ZZUA 3Q87B 3NC4A 4XWYA 1U8UA 4PSVA 3NCHA 3PP8A 3PKJA 1EUYA 4X71A 1PEDA 1YIAA 3L0DA 1MBZA 1X5BA 4HB3A 3P52A 1XP8A 5J4YA 3WJ7A 1Y42X 1HYBA 2AJ8A 1ULUA 4J6IA 3ZE6A 4F5ZA 1YOBA 4QYMA 2E82A 3QM1A 2GAAA 3ESLA 2FQ1A 5F3RA 5DKFA 1NXQA 1CZNA 4KXLA 2C8LA 4NFHA 3OKAA 2GLUA 1SBQA 4W1PA 2Z56A 3LWDA 1DQNA 2Q46A 1F2UA 5HGXA 4P34A 3TB4A 5BW4A 2XQGA 3HUTA 1LKZA 4QFDA 3M4NA 2RGAA 1G21B 1JSCA 3FTNA 1ZB1A 4CV3A 5JU6A 1D0VA 3A1UA 3HXQA 2GXSA 1PL0A 1E2MA 3EQ2A 4X3CA 1T1SA 3I42A 1QNLA 1S8NA 1HDOA 5CCBA 1LLCA 1KMIY 5IFKA 3PL5A 2J3JA 2XUOA 4TQUS 2NZVG 2AG0A 1WXIA 4BN5A 2WYWA 3UPDA 4I7EA 3Q5GA 3UVEA 4IHQA 2QGZA 4ESOA 4D57A 3UB3A 2HLDA 4DG8A 4NH4A 3L4JA 4PW0A 3EA5A 1JQ3A 3FYDA 2B37A 3HVUA 4IULA 1T8WA 2D7CA 121PA 4HOSA 2BGTA 5TX7A 3JW8A 3TD6A 3LWZA 2V3WA 4RJIA 2D1QA 1KDPA 2CBZA 2GPNA 3AG2E 1EFAA 4D0SA 3U4MA 3U4QB 2V3VA 1KSGA 3I73A 1B7GO 4UCXA 3HYSA 2R7LA 5DLPA 1MVOA 4IRUB 3D6VA 3K0EA 1BWSA 3NHWA 1GRVA 1QAMA 1W85B 1MAVA 3WL8A 4WASA 3FUVA 1YA6A 4MA4A 4BGEA 4AF7A 3WX0A 4OP1A 3OPYI 4QXMA 4PS1A 3GGCA 4A1SA 3KEFA 5CVJA 2PEZA 4QPNA 3T7TA 2FW8A 3E3LA 1E2GA 1E5VA 4MQFB 4G37A 1Q1EA 2N42A 3ZBQA 4O2BF 4ZVOA 3ZVVA 3IB6A 1SVOA 2DPGA 3ENWA 2G4VA 2ZGGA 1DBSA 3UATA 1VPVA 3X1ZA 2C20A 5J2TB 2VH1A 2FEZA 5GWXA 2F8SA 3CEHA 2W2MA 2D2IA 3LO8A 2OCCE 2XEXA 2XB2A 3UJBA 3TAHA 5DHFA 3J80A 1QQAA 4DM3A 4XOUA 3KXKA 2VQFB 1AA6A 4C0QC 3LUPA 1CUSA 3VHRA 5A5GA 5CJPA 2IEJA 4B3IA 1JSZA 3PPVA 1XALA 2V97A 2AE2A 4ZDKA 4EMTA 4R3UC 2G76A 2P69A 1ZC3A 4JY7A 4A7PA 4YO8A 4Z8XA 2I9CA 2YZKA 4H7HA 4KR3A 2GH1A 3HO8A 1ZQ1A 4KIJA 4JOBA 2O48X 1MQ8B 2V7XA 4IDNA 4CM3A 3GRZA 1C0PA 3CH5A 3CEMA 3AL2A 5BR8B 1VLHA 1EUDA 4C6SA 2W8ZA 3G1UA 4QX6A 1T26A 4INPA 3WK6A 4H6PA 4DPLA 4UZSA 3TLJA 2ZB2A 3FCYA 4RQIA 4EGAA 4F4FA 3WWCA 1F3OA 3M4YA 5HDQA 2OG1A 4QOEA 2R4QA 3V8MA 2G1PA 3SICE 2PGDA 3EXG1 4HBZA 1MOPA 4BFZA 4HDRA 4KVMA 1CUUA 5ITWA 4QC2A 3VR0A 1J22A 2BM9A 2ORIA 4MV4A 4AJHA 1KGDA 7MDHA 3R7AA 3UUXA 1WW2A 1TYDE 2XVXA 1XTSA 4I36A 3VVMA 2E4WA 1HT3A 1N4RA 2R25B 3L16A 5H1YA 3TQOA 3OETA 4XWAA 5ENQD 5JYEA 4R1OA 5C81A 2EF1A 1VJTA 2PTHA 3X0DA 1L4NA 1F0NA 3Q0IA 3QUBA 5TQ0B 1Q44A 3SQWA 4FYHA 1K1AA 3DDWA 1HL3A 3B2EA 3EHQA 3ZDXB 1QK5A 1EP2B 4WCFA 3CWCA 3TQRA 3ND5A 1WDMA 1EU1A 3LKDA 2X76A 1N6IA 4EHFA 4EA7A 4HATA 3B7UX 3TDKA 4BDTA 5FTMA 2PNNA 1RYFA 1RM3A 1L7PA 4UBKA 1CKEA 3G82C 3PFKA 1DKNA 4Q4AA 3HJGA 4WKOA 1EWKA 3EIOA 3H5LA 5AM0A 5D3ZA 2FPWA 3MOSA 5H0IA 5H70A 2WPNA 1XE3A 2XE4A 2VQEB 1E79D 1NF8A 3GLFE 1V7ZA 4BB9A 2NV6A 3TR0A 3QVGB 3GHYA 5EKDA 4F12A 5GJBA 2BTDA 3CURA 2QSZA 4I17A 3HU3A 4WE3A 2QD4A 2V0NA 3GRVA 4KO8A 4AK9A 5AFSA 3PDIB 1PJBA 3IUEA 1CR6A 2BMWA 4XVHA 3O1IC 3R9XA 3DWFA 1PS8A 1EP9A 2VHVA 2MJLA 2GEKA 3PRYA 2FEWB 2VF4X 4PHGA 1VMIA 4WXYB 4CM5A 6AT1A 4ZI5A 3GJ7A 5J2UF 2PSEA 1DXOA 4H16A 4BX0A 3KZVA 2VDJA 4G4SO 4UAGA 3M83A 3CGGA 5CAEB 3IQHX 4OMCA 3BH0A 2UKDA 2Q4BA 1Y6RA 4WNYA 1OXKB 3RC7A 5LCWJ 2J31A 2YNMC 3Q6NA 5B1BE 2EIXA 5F9MA 1KEKA 3QWPA 4X8MA 3DCIA 4BE4A 1U98A 4IG9A 3DDHA 2GPYA 1S0UA 3WA6A 4JWTA 4UXJA 4A2QA 3OJXA 3KNZA 2L69A 1GL9B 3NHRA 1Z4JA 1H1DA 3EUWA 4A1FA 5DYNA 1XNQB 5CRUA 3SHQA 1CEQA 3WOVA 1Z29A 3UAWA 3UKUG 2A9RA 3P2KA 4CN9A 1B93A 1E62A 2HMYB 3KPYA 5JY1A 3SI5A 3K96A 4HN4B 4QDZA 2IITA 4PGGA 1FXWF 5BSTA 4LVNA 3HCAA 2RAVA 1VBMA 3DBLB 2CCGA 2ODPA 3DDSA 3HB1A 5DH9A 3SKVA 2WFAA 1TTPB 3ONWA 1NHWA 4FI3C 4BIMA 4D43A 4IRMA 3P4UA 4U96D 1AE1A 1JHZA 5IW8A 1SW6A 1DMSA 1MKYA 1X7XA 4EY5A 4I1VA 2E3JA 1PDVA 4I4IA 3WSVA 3RJMA 1T2AA 4G0PA 5C1PA 1XV5A 2ZAGA 2FG6C 3W2HA 5AI5A 4C43A 1TADA 4ND8A 2HF8A 4DW8A 2FMFA 3INGA 1SZPA 3ESAA 3OEEA 4UUAA 2Y1OA 1U6JA 3KYDA 4PEVA 4PNEA 2IE8A 4FZ5A 3LMKA 5KTYA 2DX7A 4WK0B 4MQEB 3E9NA 4MITA 2FSVC 4E6HA 3AEKB 1KH3A 4UPEA 3A3KA 3PLAE 4JEIA 3IAFA 2QTVA 4L57A 1L5RA 3FP3A 2AW5A 4P4SB 2Y05A 5EZ5A 1RKBA 1PG0A 1Z45A 3T38A 5BYKA 2JS7A 2G9ZA 4BO9A 4B32A 4P7FA 2J0QA 4PONA 4AN1A 3VPFA 2WU4A 3OZXA 4CF5A 1COWD 3U13A 4V1CI 2QY7A 4RZUA 1DBRA 4YGYA 3KYCB 2R65A 4EYKA 3R3ZA 4N5CA 4Q34A 3FFWA 4Z7OB 3T9FA 4HRNA 1SUDA 2VHQA 4PCUA 3ISJA 3W4KA 1PJQA 3AW8A 3ZQUA 4TWRA 1AKQA 3AY6A 1CZLA 1N5DA 4W7IA 1VL6A 2GETA 4JLUA 1WPXA 4FFVA 4HOYA 4R2WA 2W00A 4LHEA 2M6LA 3U44B 5E9AA 4GYJA 4RNDB 3LF1A 3TNDA 3IIMA 1Y5RA 5EWMB 3DWIA 3PUJA 1R6DA 2OESA 3ONLA 1XD2B 2P91A 3QXJA 2YDYA 3F46A 2AF4C 3ZHEA 5LOVF 3WO0A 3K9HA 5BV1A 2WD9A 3KZKA 4J2HA 3HN2A 4ZN6A 4KH1A 3P7MA 3JRXA 4KB5A 3T7IA 1GWNA 5LOZA 2ZULA 4GPAA 3WMFA 3UMCA 2IXGA 5B12A 2CNOA 4JI1B 4CPDA 1PVOA 2OEVA 2OXFA 1IKND 2QRJA 1CJVC 1ENOA 4I08A 1TUGA 3BQNB 3CBQA 1Q84A 3UT5B 2X4DA 1H5QA 2NZUG 1J2EA 2X9LA 1D1TA 1X1EA 1SK8A 3EVNA 3IV6A 4HZGA 5EKXA 1P5JA 1JYFA 2QV7A 5D1HA 1IHPA 2GNPA 4E5NA 1CJCA 1N2CE 3NT2A 4DBLC 1U28C 5JD5A 4PQFA 4ENQA 3ZIDA 3W77A 4EENA 5C52B 5C51B 3Q72A 3NNNA 1YDFA 4P4LA 1H42A 5LSAA 3IEVA 3B2QA 5JJTA 4QVGA 2DFTA 2Z5GA 3ICQB 5TRTA 1ISPA 1PWZA 3L0CA 3PNKA 1UFRA 5BNFA 3BIOA 1K6IA 4GZ3A 4KQWA 2AG1A 5DP2A 4U95D 4Z51A 3LUDA 4BZZA 5B3JA 5ELLA 3HDXA 4PHHA 2QVYX 5B2EA 5TQ2B 2Y1FA 1YZLA 4LUCA 4J3JA 3E53A 3HCCA 3V2IA 1OT8A 1FUIA 5FWXB 4Z99A 4J0IA 4EW1A 3IVMA 1BDIA 2H11A 16PKA 2P9GA 4WN9A 1A9XB 1KI6B 4BQOA 4WZZA 2A67A 3BZUA 3SZ7A 1N77A 1IHXA 4QUGA 2PVPA 5K0JA 2XUHA 3H5AA 3UXYA 2BGJA 5AM2A 1CT9A 4WAFA 3RVJA 4BFLA 1N32B 2EX1A 1BXKA 4K0RA 2AR7A 3KEZA 1ZONA 3CJQA 4PLGA 1T9GR 3BL5A 1RM5A 4JB2A 1FK8A 3U62A 2PXXA 3GEMA 3WAKA 2ZSEA 5TS2A 1I6WA 3CC8A 3Q9LA 4DAOA 3VVBA 4DG9A 3MNFA 4OHOA 2VA8A 5I4IA 4R6XA 3PZ3A 1RJFA 3AHIA 4DUPA 1GLVA 4KNYA 4H3KB 2DT5A 4U63A 1V7QA 5BOSA 4A10A 5D0OD 1JG2A 4MKGA 2WSSA 4GLFA 2JBHA 2HSEA 4XRRA 1V54E 2WXQA 3ZZTA 1EX9A 1JAXA 2ZYDA 2DSTA 3REFA 5CB4A 3FHCB 1IBMB 4HH0A 3QHPA 2IVFA 4UMFA 3D0QA 5CRIA 3TWUA 3U60B 5KDLA 1Z4NA 1WXFA 3TTVA 5C5IA 4J76A 3N2LA 5F9FA 3GIDA 1UBMS 4YUYA 4AO7A 3CK7A 4WZAE 1A9YA 4LZOA 4LGYA 5I7HA 4YR7A 5FBLB 3PFWO 1VPTA 5EE9A 4DV7B 4XIJA 2P27A 4LW8A 3FVVA 3HVEA 2A8YA 4UE6A 2YYSA 2FCRA 4I50B 3AF1A 4R2MA 1YL5A 3RVNA 1XGKA 1T1EA 4ZC1A 3E48A 1JXAA 2QRGA 1QFYA 1U0TA 3NVMB 4QUIA 4DCUA 4RQTA 4M1KA 2I8LA 3OIVA 4L4UA 2WYOA 1NVMB 3L41A 4RSMA 3QLVA 3EC1A 2Z6AA 4JITA 4GMFA 5M7EA 2NMVA 1IJFA 3TKYA 2HCBA 4F4JA 4LFAB 1YULA 1CZKA 1R6AA 2N1MA 2HO1A 4L6AA 2YHIB 4YACA 5KPJA 2UU9B 2QK4A 4N5HX 3UFXA 4A1OA 3LY5A 2LKCA 3BE5A 3JARA 4FFRA 2ZJZA 1KJNA 4AP9A 5MFPA 5HTOA 4FYPA 3W9BA 2OCLA 3DOFA 2X9VA 1DTWB 1CEEA 1A8PA 4EJ2A 3GPDG 1ORDA 3I3NA 4YS6A 1DC5A 2E2EA 4LPSA 5F12A 5KUTA 4PZCA 4F6RB 5B6JA 5G53C 1ITZA 3V42A 1UCFA 1OYOA 2NNLD 1PP4A 1T1GA 4RIIA 2OBXA 1KAEA 3W3AD 3IDAA 1SHKA 5EWJB 3QWBA 5H59A 1UXOA 3N86A 4ON9A 5KYYB 3NMUF 4DQ0A 2AQKA 1CB0A 2O2GA 1SH7A 4JI0B 4G2NA 3AVYA 2VZ0A 4HI9A 4KL8S 2FW9A 4YMTA 5DGDA 4DABA 3V8PA 4DCJA 2AJDA 4QJBA 3CA8A 3S28A 2YY6A 5DNAA 3E3MA 1RXVA 2HQOA 1PYDA 3C72A 1XCGB 4LVOA 2B20A 1DWOA 3D7NA 4M88A 2A58A 3OKCA 1MUUA 2BEVA 5AQBA 2FQWA 3L7YA 2P5TB 2CF6A 3UMYA 3AVPA 1NVEA 2WWHA 3TNLA 2NZWA 2V6FA 4U3JA 1IL0A 2V4MA 2CHGA 3ZIUA 1W0CA 1RYHA 1NL3A 2R8YA 3G1WA 3MJ4A 4ILIA 3Q75A 1ZITA 2B9VA 4MQ6A 4BTAA 1UFQA 1QHSA 1RZ3A 4JLSA 5BWOA 2JBAB 3TRJA 4QUAA 4B2IA 4JNKA 3HYTA 2BGRA 2WKQA 4W5NA 3UXMA 4X24A 3RS0A 3VV3A 1RVV1 1C9NA 3AR8A 3ACCA 1LW6E 5EIBD 3O0TA 3ZLJA 4JCCA 2FR1A 1GAQA 1NA0A 4D5GA 4MB2A 2VLBA 1R18A 4P92A 4PINA 3DEIA 3LQRA 4Y3UA 3RSLA 3B5IA 1LQTA 4B76A 1SVNA 4M7OA 3FUTA 3KV1A 5C8VA 2P78A 5DOVA 1FVXA 4YRZA 1Z28A 1R0BA 1G41A 2IYFA 1YZUA 4TL7A 5K0FA 3PNPA 1X1RA 4EG6A 4EGFA 4FD3A 2XZTA 4BMSA 3FTEA 4YQYA 4M8NE 1CUAA 4OAVB 1JJVA 3Q7PA 2C9DA 5JZSA 3IRVA 3CB2A 1Y6QA 3AAAC 3VSDA 3M89A 3TW8A 3GNQA 4GX1A 1B14A 1Z82A 4C0HA 1L4BA 2W2PA 2W6PA 1VCOA 4YMGA 4BV2A 4J8SA 1F06A 3LHIA 3RVDA 4M53A 3DNMA 1SUSA 1JKXA 3L0SA 4FYIA 3Q15A 4MUIA 5KYXB 3ZWNA 4MPJA 4FK8A 2XB4A 1UWVA 1DC7A 1QLJA 3SFZA 5JHBA 5LLSA 5MFZA 4YI3A 4I19A 4C7MA 2FX5A 5L45A 1SQ0A 4KGDA 5IYZA 4NZPA 3RRUA 1DARA 1DUVG 5A9SB 4ZYZA 3KSBC 4H18A 1RACA 3FH0A 2CY0A 5CIYA 3D5QA 3ESRA 1WY6A 2BFWA 4XQCA 5ULLA 3U3JA 5EMHA 4UVGA 3MJSA 4O59O 2B8EA 3BWYA 1SELA 3AIOA 2CHEA 3I09A 1SCUA 2HDWA 2P6OA 3DOOA 3EOBI 1YJ8A 4BLQA 1PT9A 5KHLB 2Q2OA 4E21A 4KH0A 4XEHA 4MLDA 1HXHA 4ZQGA 4DT1B 1T0BA 4GE0A 1TTTA 1IOWA 1FS4A 3OPXA 5I4BA 1CR0A 4QULA 1PJTA 4W7SA 2CHXA 1EKXA 3AJ8A 3ZCUA 4LKOA 2J4CA 4R3NA 2IHNA 3NHZA 5NULA 4LI0A 4KITB 4P93A 2IYZA 3AI3A 3DQQA 2NOAA 3JUEA 2L9BA 3BUAA 4MJLA 3VQTA 3ET4A 3O8OA 4JQZA 3J7TA 3SIWA 4C7KA 3KOZA 1M34E 4J16C 3UCXA 5AVZA 3VO9A 3OLYA 1BE8A 1WUHS 5EIBE 1GOTA 3ANSA 4NBRA 3H0EA 3HR8A 3ZNQA 2VHCA 2LRHA 3WOHA 2QI9C 1D9SA 3ONFA 4HAOA 2DE0X 3DPYA 3A10A 5CDUA 4PLVA 4PY2A 3A6PC 5DW3A 3VM6A 2YHBA 2XUQA 3U3RA 2YFHA 1S96A 3D3NA 3ODGA 2PK3A 2IDJA 3C97A 5DSTA 4O1MA 4IBOA 2Q3CA 1OXJA 5I7AA 4Y8VA 4O2BA 3IOEA 4H77A 1B2LA 1XPRA 3BX1A 3BCSA 4ZOLB 1OLSA 5DJ5A 2XF2A 421PA 3WISA 3B6MA 1SCAA 1QP7A 2AX3A 4F8JA 3IE0A 4FEEA 4YJFA 4NCXA 4YYEA 4KPEC 1L4GA 3S2SA 3ZLTA 4D8UA 5C4MA 2X0DA 4HNRA 5IPFA 3J81k 1QB7A 1E2BA 2F3RA 1D2HA 3DAYA 3DS8A 1I6LA 3PHCA 2NXWA 2Q0QA 4DRXB 2QUZA 2QYOA 1R0RE 3HPQA 2HMAA 2R66A 3VUEA 1LS1A 4R1NA 4MAAA 3IMGA 1FTNA 1FTQA 1JQBA 2MSLA 2IHKA 4E2ZA 1RLUA 5TNXA 1ZNQO 2XOEA 2GYYA 1LD3A 2RD2A 4XPZA 4R1MA 2PMEA 4MW7A 1RSZA 2X38A 2ZIEA 3W5CA 1VKZA 1KPHA 4RIHA 3IPYA 3ESXA 1SXJA 3GFFA 3U81A 2H7XA 1E6LA 1F60A 4LJKA 5CIWA 4WBNF 5CDFA 2M98A 3KZNA 2Z1MA 5KNDA 1DIOB 4YO7A 2M6KA 2FKNA 2G0AA 5FNZA 3FOEC 2CZGA 2NNWB 2YWRA 3L0OA 3MKRA 2V1UA 1P2FA 4OYYA 3WJ2A 3TGWA 3IJEB 5JMTA 4U2GA 4EKIA 2FFAA 2YJ6A 3W7AA 3IQIX 2G83A 5IT0A 2PA3A 5JNTA 4UU0A 5COBA 4KNWA 2WT8A 1GPAA 2J33A 3FSJX 2WK1A 2ZJ1A 5LBTA 3OE7D 4UXHA 5ECWA 4B3XA 3ZHCA 2J3EA 1IULA 2QC9A 3EBOA 1LPBB 1DQZA 2CLDX 1U90A 3NKLA 4W6QA 3ILYA 1MR3F 2Q50A 1ULZA 4DV4B 3DT9A 3WKBA 3SXPA 1YNOA 2XNSA 2YCBA 4KLAA 4AYWA 1SA4A 4QL3A 5G0VA 3W3ZB 2K4MA 1EFDN 3TUJC 3G2LA 1P60A 1BLXB 1OBHA 2OWEA 2YTZA 3FWZA 1N7GA 4RTQA 3S70A 1Z4MA 3D3JA 2RHMA 3WL6A 1U7UA 4PN7A 4YP0A 4LERA 3EFHA 4BNXA 3T61A 2GEVA 2I7VA 1C29B 4AJ1A 1TQ8A 2H5JA 2W43A 4TSFA 3OZ7A 4MWZA 1V1JA 4P86A 4L9AA 3DHEA 3M6UA 4JIGA 3ZJYA 4EUEA 2OD9A 4IJKA 1LX7A 2EIME 1KPSB 4J0KA 4D8XA 5HX7A 1Q0HA 2QIOA 3PEWA 4EP1A 1ELOA 4OAOA 3T1YB 4U8GA 1NI4B 3WLRA 1TO1E 5DI3B 2NPIA 4EKEA 2J30A 1N0HA 1D5WA 4U5XA 5JWHA 5DM70 4LY3A 2WV7A 4QBKA 1M1YE 4PN3A 1J8DA 2PX3A 4LXYA 3VPSA 4QO7A 2HBQA 4AL4A 4JVNA 2VBCA 1B8UA 4G8LA 3U0VA 1OYWA 3NGXA 4MKIA 4DJ5X 1OI7A 2AMLA 2UZ1A 1T6YA 2IOHA 5D7NA 1BI8B 4KUHA 5J2UA 2YOFA 4DY4A 1JLLB 2Y1CA 2EHDA 3ZHYA 3F0TA 3C3QA 3RAUA 3BK2A 3M2PA 3L4KA 3ANLA 2NO4A 5K8CA 4ENPA 1C9EA 1BQ4A 4G23A 2EJTA 1XSEA 4PM4A 4HAYA 2LE0A 1XRPA 2QVCA 2ZSAA 5KQMA 4QXPA 2VWPA 5KNGA 1EVLA 5BN5A 2CGEA 3TJPA 1IY8A 3QHQA 4OHMA 1DB3A 4YDRA 2OK8A 2JJ1A 3TOVA 2XCQA 3DMTC 3JQGB 3CLVA 4ER6A 1IN5A 1XWFA 1TF5A 4IHKA 1OFHA 3LW7A 4TYNA 2E87A 2P35A 3DBHB 1Y4AE 4FFDA 3BOSA 4CE6A 3AR6A 2EWWA 3LKVA 4PG6A 3EQZA 3OMWA 3U09A 1UN8A 3V7WA 3GA7A 4HS9A 1NPYA 2EIKE 4D99A 3HIZA 4FGUA 1U8FO 4HDMA 3ETJA 4TM7A 2WT9A 5CMLA 1TJNA 3QIVA 5E8RA 5FWYA 3V32A 2JLXA 4I5FA 3TNFA 4PPFA 1BHQ1 3VHLB 4FLEA 2QR5A 1TKCA 1MDFA 1OWPA 2XTNA 2CF5A 3ZY6A 4JR2A 3SXUB 4RXMA 1OVMA 4EGSA 3KQYA 1PFYA 4GA0A 2CL0X 3IEIA 2PUGA 4IDDA 3LJ3A 3C5HA 3AVOA 4C22A 3RU3A 2R6R1 4B6QA 2X23A 2QMQA 1FFBA 4CR8A 8ABPA 1P9LA 3N7AA 3ONKA 3CHYA 1KQOA 2HKIA 4DNPA 3LKUA 3RAPR 3FKSD 3B1FA 2E9SA 3SYMA 5I7SA 1KMNA 3JQFA 2ZFUA 2TMYA 4GE3A 4U2DA 1YCGA 5FTJA 3D9QX 3V7FA 2WTMA 1HDZA 1YE8A 3S8MA 3V9PA 4JJIA 2ONCA 2QXTA 5JSKA 4JLAA 4N6NA 3I2YX 1M0EA 1UM8A 3IOYA 2QL7A 3NBMA 3KOWA 1LLDA 2PUJA 4RD3A 3I4GA 5CB4F 1ES9A 2FETA 1NBIA 4QXAA 1Y37A 3KEAA 4K6FA 3L7OA 3EVCA 1FNMA 1B6SA 3OI7A 2OLJA 3DFKA 4UZFA 1HMPA 5D5HA 4CM1A 4NX2A 1M1XB 2WU8A 2ODWA 2OHHA 1WO8A 3HCOA 1AXGA 2C9OA 2C5FA 2XE6A 3DEPA 2IC5A 1Y4ZA 3WK4A 3I76A 4MH0R 3COYA 4NQZA 3EQ8A 3PHLA 5TPZD 4DIKA 2IO3C 4IGFA 1V26A 1BHO1 5LOVA 5DPMA 5THKA 5LYJF 4RK5A 1P2SA 1K8RA 2YUIA 5K01A 2KX7A 1KFKB 3IAHA 1VKNA 3T3EA 1W46A 2CFCA 1N5OX 1SJ9A 2LCQA 1BS9A 5KSWB 1H3EA 2OECA 4MMYB 3TS1A 2F1IA 1TW3A 2MINA 4V3CA 3KAKA 4CLHA 4Y9SA 2ETCA 4HEQA 4X8LA 2X19A 3FDHA 3EAFA 2DTXA 5IT5A 3TMKA 2OGUA 3LO5A 2B2NA 1MHQA 1NJFA 3D3EA 1WCV1 4AUNA 4G5QA 1U3VA 2PS0A 2QF7A 2VI5A 3G6WA 4AMGA 2CNWA 2GA8A 3OZBA 4YMVA 3EASA 1GDHA 3E30A 5DXAA 3OFKA 4UCFA 1EWTA 3T95A 1UADA 1Y9AA 3IDFA 5BRAA 2WVIA 1V4BA 2YV1A 2Q8PA 2JDIA 5JE8A 1LBQA 1JIKA 3V7YA 4GA1A 2VSQA 4DCNA 2ZBFA 2PZEA 3ZLBA 1KSFX 1N5RA 4BQNA 3MBKA 5C8DA 1Y8ZA 1ZOPA 4FGKA 4KFTA 4S04A 1GZ3A 3IUMA 2UXCB 1LNZA 4PLWA 3AUTA 5AD1A 3ET5A 1C9KA 1LTKA 3DTTA 3Q3IA 4UEKA 4KJZA 4OBBA 3DWEX 3GU3A 3WAGA 3I9V1 2F1OA 2OHFA 2SCUA 4R1LA 5IMSA 1K88A 3WYBA 1BOOA 5HBGA 1FDSA 2EJBA 1P2TA 2P4HX 2V98A 3CF4G 1XU4A 1DHRA 3L43A 1H2WA 1V45E 1XNFA 4CETA 1OHHD 3IUQA 4BB5A 4UEJA 2PCJA 4JC0A 3P9IA 1O6CA 1KTVA 1DKRA 3IBSA 5COQA 4QOSA 5KYTA 1JKMA 3RWMB 1FTYA 1MPTA 4EABA 1L4KA 4O29A 2JARA 4D0GA 1E7UA 3PUZA 2J6IA 3P0IA 4J1SA 1FF9A 3WK8A 2Q2NA 3G7UA 3S5UA 1HT2E 2EBUA 2JFWA 2FK8A 5B1EA 4LCTA 1VHQA 3AHGA 3ASNE 3MZ0A 4W5QA 2JEYA 3QRWA 3IRUA 1ZINA 1SQMA 3FJ1A 2IBTA 3VA7A 1EDUA 1SXQA 2BH2A 3ZDQA 3PSHA 4BLOA 3K9GA 2IIQA 1P29A 2NSYA 3R3JA 4JLPA 2PNJA 4RVNA 5K4GA 4KXMA 3L79A 1MABA 3HYCA 3K1AA 3RNLA 4WW0A 3PNTB 1UIMA 4ZP1A 4XA8A 2C78A 2H18A 4PWYA 4B6RA 4U00A 4PZPA 3NYIA 5LCWC 5LVAA 4LDPA 4HDKA 2NWQA 1DC4A 1UOPA 3IUSA 1WABA 2YV4A 3H4VA 4U9UA 4FYVA 5EUQB 2BZ1A 2NVWA 2E2WA 3UGQA 4K9MA 2Q4DA 1T4DA 2M9MA 4JT8A 4AP2A 1QQTA 2JGDA 5CXQA 4RMJA 1C3OA 5IKXA 4HGZA 1WUYA 2VHWA 2Y67A 4JBHA 3R0XA 4DR1B 1L5HA 4K9PA 5J58A 5KB3A 1IB0A 5HJ2A 4F7AA 4HNAB 3W9FA 4GXNA 2OG2A 2Y3AA 1XCBA 2PGLA 1I4WA 2D2VA 4U2KA 5LZ8A 2ZETA 4ZKEA 2IXDA 4MS1A 1FCHA 5CK4A 3O4JA 3FPSA 2A0FA 1U2VG 3MTDA 1DQPA 5IK2D 3S2YA 1MO6A 5CH3A 6YASA 2JAHA 3ZCQA 4LRWA 2W6OA 2YWJA 1DDGA 1VGVA 1MEEA 3AB7A 2W2VA 3GLTA 1ORVA 1USVA 1K6JA 3UEOA 4JJEA 1NZJA 2QAIA 3CSTA 2OQRA 1VDZA 4XVQA 5IYZF 1HC7A 4HDNB 2WVGA 3PKZA 4EGQA 2GBIA 4UM9B 2FO7A 4AKHA 1F7VA 1JR2A 3UINC 1YCFA 1IZ7A 2JZNA 2P65A 5D6OA 1GQYA 3GMTA 3CR7A 1BU8A 4Q9JA 4FE4A 1ZJWA 4BIIA 2HDOA 2H8GA 3JVVA 4JBIA 1MV8A 5AVVA 4PTYA 4L6CA 1EWVA 1MQSA 1XLTA 3WYCA 4C2BA 1LPMA 3OCXA 2QL9A 2IKSA 4H1UA 3L8ZA 1UJMA 1TVCA 2VJYA 1T8TA 2FHSA 4GKKB 3RPEA 5EI5A 3WZMA 3JQAB 2W2QA 3QMMA 1FL9A 5IAJA 4IRXA 4RVBA 3NEPX 1P2VA 1EUCB 1JA0A 3NCTA 3BTSA 5HA5A 2JBWA 3KB8A 4K2AA 2CFIA 1X9HA 4NK5A 4C0BA 3TIFA 5I45A 2PE5A 2IEBA 4DQDA 2GYVA 3GH3A 2A9JA 1G9XA 2XCUA 4REOA 2J3KA 3N7TA 1UUFA 3S7BA 4LHZA 5B30A 2QJWA 3V97A 1U65A 1SUWA 8AT1A 3R6WA 3KALA 4LYDA 1JALA 2GZHA 4G56A 2G5GX 1JBKA 1VLJA 1N57A 3PKIA 3UTCA 5THXA 1NJ8A 2OM6A 1YJAA 2RFMA 2XDWA 3DBOB 5HZMA 4L7TA 3BH7A 5TT1A 3DQZA 2NO7A 3OPVA 3UCEA 3LBHA 3VMFA 4DMLA 5LJIA 4PFJA 2W6MA 3P4XA 3L7AA 3BIJA 1NG1A 1S2MA 2PZAA 3GLGB 2HJVA 3BMNA 2ZDHA 4QJIA 4TN1A 1WP4A 5CLFA 1ZIXA 2BTQB 1IBSA 2E21A 5BURA 4KPYA 4LF4B 5CT9A 1CRWG 1FFHA 3EF0A 4BEWA 2YCLA 3G2OA 4B3TB 2W7TA 1GG5A 4LHXA 4MYUA 4BTLA 4FNAA 3CVNA 4AFNA 4MLPA 4C0EA 1IH8A 3INRA 4TTPA 5JBIA 1L5GB 5JSUA 4Q4JB 1K5PA 3SS9X 4NQRA 1FDVA 1CQJB 4R0NA 1Z6XA 2XUKA 2JRCA 1PEYA 2JVJA 1QR6A 1RLMA 1UBCA 2QL6A 5C8XA 4WFIA 5LFAA 2LXLA 4OQNA 2WJIA 4Q3DA 1N9GB 4PO1A 4LHSA 3NM5A 2HNKA 3CK9A 3OTIA 3H1GA 1E32A 4NCJA 1D2CA 4BSZB 3TSYA 5IJXA 4BP3A 1HE8B 3EZYA 3TL5A 3C5WP 3N7UA 3SKXA 4RKFA 2WJGA 3TM4A 4ZA2A 4I9EA 1OLUA 3JXIA 2BCEA 1LF0A 3H18A 5LD2C 1NU6A 2CV0A 4M49A 1FA9A 4H6VA 4KXQA 1OXBB 3WVNA 3SSOA 2J0SA 1S3GA 3T9KA 2W42A 1ISGA 4KN9S 3L54A 1ICIA 3AVWA 1PR6A 1X80A 2ZIGA 5EWLA 4FYXA 4ZYXA 2VHZA 4BKRA 2LWIA 2IEIA 1UJ6A 2HYDA 1JILA 4Z1MA 4UUBA 4PS8A 3KJNA 4QQNA 1F2VA 4GAAA 4UEQA 2XUDA 3S44A 2HDNB 2XUJA 1OV6A 4WJLA 3UV7A 3FN4A 5HF9A 2PSFA 1OFUA 3OOHA 3G2UA 5LQAA 3CBGA 3O95A 3JWEA 1Z6ZA 4OFZA 4NHOA 1SHJA 3NO4A 4KRGA 2PU5A 4YAEA 2O8FA 1QRSA 3OSUA 1CEYA 1KFCB 3MQ2A 1CUEA 2JVKA 3CYFA 3WBKA 2XSZA 4XDGA 5DIZA 1YO6A 3I01A 1CLEA 1CRLA 2DQKA 2DERA 4GCNA 4EY6A 3MS4A 1ZIYA 2W2TA 2PWAA 4WLUA 1RHUA 1TNBA 2DWUA 4LZLA 4NZ9A 1C7RA 5F7OA 1I80A 2OBMA 2DBAA 4BO4A 3WS7A 3BF8A 3KFLA 4P22A 4WNIA 4YRMA 3VTFA 1M76A 5F2NA 1NRJB 4KZPA 5CFOA 1BQ3A 4I9UA 2VT3A 1ZBQA 4Y67A 2YXBA 4YDOA 3OTWA 1UBFA 2KBEA 2W4IA 4BWFB 3ZYLA 4UUOA 4L51A 5FBHA 4BTVA 4GXQA 1ZK1A 1EJ0A 2Z1NA 1SVIA 3RUHA 4ZAYA 4K6HA 3HHMA 1V11B 3L6CA 2BI7A 5EIHA 1Y6GA 4WNFA 2C5EA 3D4NA 5FNVB 3H9JA 3A2KA 4V0NA 3NM6B 3E22A 3UJAA 3RK1A 1E77A 4GZLA 3LUBA 3Q3GE 2CEKA 3KQLA 4RM2A 2FSFA 2HXYA 2V5UA 4J91A 1Y3BE 2X86A 4P2BA 3G1TA 2KW5A 5CCMA 2GXUA 1KNQA 3QBVA 4IS3A 3NTQA 3OWXA 3N8KA 3VR6D 1G7SA 2D5CA 4EJSA 2P2CA 3SZUA 4WXRA 1ISHA 5HJ7A 4AZ0A 4YV7A 4DJFC 1QRAA 3KOOA 1ZYUA 3H2BA 3ECAA 1KY2A 3G9ZA 1JUQA 3EDYA 1QJCA 3IQWA 5E7IA 4ALLA 1QFSA 5IRCD 2DXIA 4BWVA 3LPDA 3AWIA 2VXCA 3ABZA 3OHSX 1Y7IA 3ESYA 4YEDA 4C4AA 1NV9A 2EZ9A 4RABA 3V4RA 5AXCA 1NJ1A 1MJGA 5HWSA 1GCIA 2Q6IA 1N3BA 1TN6A 1DG9A 4GPKA 3LSYA 3AP1A 1YMQA 4CV2A 3QEMA 3FOZA 5EE0A 4WBNA 1YUBA 4BRSA 4EATA 2V7BA 3IP6A 3TQIA 3JYSA 1J0DA 1DI0A 1ZUNB 3KC2A 4JB8A 4A8TA 1RCTE 1U7HA 2YRWA 2HA4A 3I72A 3RQIA 3V4SA 3AKDA 1TC2A 3C15C 5CLLA 4O02B 3JZFA 2BTOA 3DEAA 2G3YA 5FBQB 5HRCA 2W58A 5HXAA 3SWWA 3EVGA 4F1SA 3CTMA 4AKTA 3HCFA 3Q4GA 4NICA 3MA5A 5JHHB 2UXBB 2H4YA 4RORA 3WLNA 2IKQA 4JUCA 3FYHA 5A6SA 3GMDA 1NVKA 2YXLA 2O8BB 3RLIA 4RTKA 1YE5A 5FZSA 1WCIB 4AX4A 4F04A 1YVUA 3UT7A 1M2VB 2D1RA 5DNVA 2C2OA 2J9FA 4C9BA 4NMMA 3OQMA 4TUMA 3V2OA 1ACJA 3L9TA 3WGMA 2ZWIA 4Y6QA 4Q4DA 4JXXA 1FOEB 2NQTA 3D9IA 3E4BA 3PD1A 1X7YA 1XEWX 4MEBA 3HBNA 5HUHA 3DLIA 5SY9A 1CV2A 1EFRD 3L07A 3L9WA 4X7PA 5JFOA 4FUQA 4CQMD 1NJSA 4D3DA 1SOAA 4CG3A 3UKOA 1AY0A 3HBAA 4YAJA 1JQAA 3LCMA 4DDVA 4HADA 4YC7A 2C4UA 1NOJA 1Y5NA 2I4OA 4DCCA 1B6RA 3QVMA 2VYVA 3L4BC 4ZGGA 4L16A 4G1EB 3NWBA 4WGGA 2KCVA 2F1HA 1JHDA 4L2LA 4D79A 3TLGB 3H11B 1UAAA 5DDIP 5AKXA 2B69A 1VIMA 4H1TA 5AW7A 3OIFA 2PQRA 2D8MA 4KPFC 2YJ4A 4GUAA 1MJNA 1QH1B 3RRNB 3CLSC 1A97A 1GZ4A 2JGJA 1ZPDA 1BFUA 1CQZA 3EIJA 4B6GA 3IP5A 4N6OA 5CK5A 4F2HA 2XDQA 4UU8A 3TINA 3EZXA 4I4CA 3BF7A 3PWTA 1XDGA 3RK6A 4HOUA 4R9VA 2GD6A 2Q2WA 3BT7A 2B6NA 4KBGA 4WOCA 1EZ1A 4NSNA 4HVLA 1JDJA 3I62A 2H1SA 4D0LB 2RJ3A 1ZR2A 2JFBA 3P0RA 2PD3A 1MEJA 4A2CA 3RO7A 1ZKDA 2XVYA 3FPJA 1AV6A 3NWPA 1EFCA 4I4NA 3RFVA 1QG4A 4GVXA 5LB4A 2WZDA 1THGA 5EJMA 2BL4A 3LSTA 1NVWQ 4B71A 2AJAA 1ISFA 3R8CA 4UEOA 3CCCA 1T4BA 1U2SA 2CK3A 2YICA 4MUJA 4G07A 3S68A 4O6VA 3LEWA 4PX5A 1ZH6A 1LZKA 2FH5B 4E15A 3C3EA 2I80A 2BCGY 4DZZA 3EHRA 1M9NA 7ABPA 2AQIA 3PRZA 5FIOA 1JFSA 1K8ZB 3NRCA 1P4SA 1GFWA 1FFCA 4QA9A 1REQA 2H6IA 5EZ6B 3ZYCA 2YX1A 4AJ9A 3A6GA 4F3YA 5LZ7A 2GVDC 1R5NA 5BQ5A 1Z4LA 5F51A 2WD7B 3RYCB 1J0EA 5K0ZA 4JB3A 4JI4B 2GNOA 3RYTC 4N41A 3SZRA 3QMPA 4EJ6A 1KZHA 3UMVA 2IEYA 3HVKA 1DAKA 5EXXA 4B84A 4DUGD 5D3MA 4DIUA 3ADOA 2V7UA 4QUDA 2BFBA 3WLJA 1OAAA 1OBVA 5JXIA 1BYIA 2OPBA 3JQBA 2R84A 3NDJA 3GRAA 4FW8A 1I3NA 3VKHA 1UWCA 5FEMA 4Y6OA 4MEAA 1O97C 4TX1A 4B83A 4JUBA 1TYAE 4BMCA 1H1LB 3EFOA 1ZK3A 3DZBA 4KN6A 2X8AA 1EUZA 5DRTA 3CS3A 2FMTA 1EG7A 2RH9B 5E95A 3E32A 1ZCJA 1LS6A 3MAGA 2QNIA 1G5QA 1ZESA 1Q7GA 3EQ9A 1XHFA 2WIBA 3C3BA 1PL8A 1W9MA 3LPMA 1DBIA 3SQNA 1I1NA 5D6NA 3RVKA 4WESA 3G2SA 3SFYA 2V7QD 5AJXA 2HCTA 4K9RA 3U4CA 1R8QA 3DP7A 1PNVA 2WYIA 3JZMA 2AOTA 3EG9A 5EE5B 2ANBA 3DC2A 2Y76A 1BDMA 2L2QA 2DR2A 4QRDA 4HJRA 3M1AA 2GWRA 1CXZA 1P5FA 3E2IA 2MR5A 4DMRA 2QBYA 4G86A 4EEXA 3VPBA 2AXUA 4D4HA 4QQ8A 5HOQA 3W7VA 3MWLA 3SE7A 4H7FA 1JXMA 2ZP1A 1Y0BA 3KDAA 4FYMA 1H0KA 3RYHB 2WYHA 3MILA 3HCEA 3QVVA 4LC9A 1XG5A 4DLNA 3M0EA 2VDQB 3PL1A 2CHVA 2ONJA 1UK9A 1FEZA 3NM4A 4HWPA 1M1NA 2NU6A 4UUMA 1JWAB 1RYZA 4J75A 4FWIB 4OKNA 2GM4A 3ZXSA 3AF5A 3CKLA 2GBLC 3A32A 4TM8A 4MYHA 5CEAA 1ZJ4A 4ZYUA 1B16A 1E4VA 2C5LA 3CRNA 1Y7PA 2WSLA 5JR3A 2AKAB 2DUNA 2CNDA 1IDOA 5LYJA 1B2RA 1OH7A 4JI7B 1MJFA 3O4FA 2FKAA 3WL4A 4CEJB 5DV9A 4DREA 1UDRA 1OI2A 2QTRA 1PCXA 1D6NA 4G81A 3UUGA 1NR7A 3P1JA 5KOJB 3BEEA 2C95A 4BETA 2C3OA 3PUXA 4BCCA 3ND9A 4Y2GA 4DA9A 2F9LA 4X3PA 4IF4A 3PXGA 5CMWA 3IIEA 5C4IA 4JLWA 1S7CA 2IZ7A 4HH1A 5B55A 1Y7TA 1C3EA 4B3GA 2C84A 4K6OA 2QJRA 1XZMA 5AHRA 1NMZA 4C0LA 4TSKA 3OQNA 4HQKA 3BRCA 5WRFA 3GJTA 1ZK0A 4P0PB 5JBQA 3LI2A 4JEHA 5AH0A 5ECYA 3WNQA 1IBLB 4MW5A 1J2JA 2X0NA 4BGDA 2ZJFA 4DMFA 4FGSA 3FF4A 5KBAA 2HR2A 1XXHE 2I6TA 2KB0A 2ETXA 3LOQA 1KFBB 1I3LA 2BMVA 4HH4A 3G2HA 1JFLA 5JARA 2VCYA 3WA7A 4ZGWA 1DC2A 1WZCA 1RHRA 2HIGA 2MRIA 4BQIA 5E1DA 3K53A 3OJWA 1N4DA 3BPSA 4IIHA 4PZAA 2KCKA 1JG6A 4N3BA 4JWKA 1OLXA 1JX6A 1BEZA 3QEBZ 2H9YA 3M6AA 4IZIA 2QSJA 3NEYA 3ZH2A 1U99A 2HK9A 2BUCA 4BMPB 4PX3A 4BEVA 4PSUA 3M34A 5AI8A 3FRJA 3D7MA 3PXXA 5KC9A 5DCUA 3CNQS 3K1JA 2DQ4A 3DXKG 2JLSA 1XJWA 1OGJA 1ELRA 4JP8A 5DM2A 2VG8A 1ZRMA 2ISSD 2GCOA 1G6HA 5HF6A 3WV5A 2OXTA 4YMWA 3BSFA 1ZXLA 3C6BA 3ASYA 5L7YA 1RTKA 4GX2A 1BMQA 3PFGA 2BEKA 4XCQA 3L8MA 2C4WA 4RV5A 4OHCA 1UBJS 1IIRA 3FUIA 2JNWA 3BILA 2OENG 4KFUA 1KHHA 3SJCA 3N8HA 5IJAA 4F8YA 1P2BA 4M8LA 4G97A 3R5JA 4HQFA 1UBRS 2D5IA 3CNLA 1RTTA 3HS3A 4CR6A 4OFBA 1FCJA 3R0IA 4A91A 4B7CA 3N2IA 5M72A 4N3CA 4ZHQA 4OUDA 4APOA 5A7HA 1MRNA 1EQUA 3UPUA 5EZYB 1RI2A 4RJTA 4C4PA 2J7KA 4HFNA 1DU4A 4EB8A 2ENUA 4IGEA 3M1IA 3HSSA 1Q57A 5ICCA 5LZ5A 1SVUA 2BOVA 3MC1A 3HYNA 3CEQA 3ROQA 1TX4B 4ZVNA 4TTVA 1IXSB 1K7CA 3IPRA 4F7DA 1U63A 1H9CA 3BKXA 1U5AA 2G04A 3HA7A 3AM5A 4P35A 2C3UA 2RC5A 2QOEA 3ZWBA 4TROA 4ZU6X 4J7WA 1CDEA 3PRHA 3UAXA 2VGYA 1A5ZA 2B0JA 2YUTA 2LDBA 1NXXA 2JFNA 4FZRA 3IHYA 4X20B 2VUHB 3D6UA 3KJEA 2JGIA 2R87A 3WK7A 5BN3B 5T8KA 3AU5A 1ICEA 3L0YA 1F2DA 3O4HA 4RVGA 5JDCA 4CIYA 1JHPA 1ZL2A 1PQPA 3WC4A 1QCZA 3N2KA 2AX4A 3HP4A 4JLKA 2XIJA 2WSIA 5TMEA 2WF5A 2L0XA 2HDHA 4TQGA 1BI7B 1E1YA 4N65A 3L8FA 3VSCA 2O6HA 5TJ9A 1A9ZA 3G9XA 1XMVA 3G0HA 1CJSA 1JIXA 3IQXA 3MYVA 1NMQA 2IUUA 3PD0A 4HAWA 2EYUA 1EDDA 5GOZA 2A1UA 3PXDA 2RB5A 5BPHA 1QIDA 1ZU5A 4XH9B 3HMKA 2G28A 3QU4A 1TQ2A 4RKRA 3Q6MA 3GFTA 5AYVA 4WACA 3ML9A 1CHNA 3ASDA 4I4TF 4CCWA 1J5XA 4OUKX 1TKAA 3WFJA 1E3QA 3T12A 4RQUA 1ZWKA 1K86A 3HXMA 3O74A 3C0KA 5TEWA 4QTYA 1SCNE 1IBKB 1JFFB 3DBVO 1FNCA 4PF1A 2I6QA 3LT4A 3UBMA 1MIHA 1D0SA 4KE9A 1NLZA 4XWGA 5FWAA 3TVYA 3HCNA 1QZXA 3EJWA 3SYKA 4R1SA 4RZ2A 3W5DA 4TVBA 4WIAA 4ML3A 2Q6VA 2ZTUA 4R9NA 4ITVA 1X8JA 1DS6A 3AESA 3JQ1A 4MSUA 4NDZA 4KMMA 4JA2A 2QSYA 2V4LA 4C4RA 3U17A 3SSMA 2Q99A 3AHEA 3BGSA 4IJUA 4K87A 3R7QA 3LGAA 1Z7BA 1M54A 2C31A 4IDFA 5L3SB 1LBTA 3K92A 3GXBA 4GVPA 2PL1A 1CS4C 5TC4A 1VA5A 1NE7A 2NU9A 1SZAA 1KKMA 3D64A 4IKOA 3HGMA 4UD6A 1SHTX 5F77A 3Q78A 1FSGA 2VJDA 3L6UA 2W2NA 3IDOA 5K9ZA 1USGA 4KQEA 1YA0A 5E6SA 3SZMA 3LCUA 4OJMX 4CM8B 2ZQZA 4BO1A 2F8MA 2HLNA 4JL6A 4B4KA 2IYNA 3U1VA 4WFQA 4FFLA 4RS3A 5DFAA 4WD3A 1G6KA 1TA9A 1RW2A 3R9IA 5F52A 1X1TA 5D2MC 4M0KA 2CXHA 3H5IA 1QVAA 5FQ6A 2GZDA 3ZWOA 2P9ZA 2PYDA 3FJYA 2GJ8A 3C2QA 3SU8A 2VT7A 2EXXA 3EXFB 1QDEA 2DH6A 2V7GA 4MRMB 1YB4A 3ND8A 1ZIOA 2ZZMA 1RFGE 3DB2A 2QMEA 5EFZA 5CLHA 2UYHA 4Y6WA 5LDGA 1FJXA 3VOBA 3FMOB 4MP6A 2VN8A 3O6VA 5BXUA 4RPHA 4EELA 2GZRA 1G21E 2IYOA 1TRKA 2I65A 3CQCB 3W5JA 1MZCA 4G09A 2H9IA 1G8JA 2DZDA 1L0BA 1P9RA 3THYB 2Y27A 4KACA 4ALMA 2ZREA 2A7XA 4OQDA 2HBYA 3LPCA 3TTWA 2B3DA 3LV8A 2Y69E 3DONA 2YN2A 4YQFA 3EGDB 1RQ2A 3TSCA 4V0SA 1HQCA 2YXPX 1E3JA 2YV5A 1KYZA 1UKAA 4DYHA 5JSQA 4TV9B 5ERXA 3RI3A 3N76A 4D96A 1PV2A 1NU8A 4FFMA 4A03A 1AZLA 3E35A 4Z0HO 4RSRA 1A3CA 1ZMBA 1X86B 5JH7F 1WHTB 2XNDD 2C9BA 1QGAA 4IIUA 2CUNA 5B2FA 1HFAA 4YRJA 2IZOA 2BDUA 1F2UB 1Y3IA 4MV0A 3ZBTA 3EC7A 3FBWA 1D8TA 1L8QA 5F76A 4BJ6A 1C4WA 2XA1A 5JZVA 4PC1A 1W5SA 2N47A 3I2FA 3OJEA 3SY2A 4JOSA 2QRZA 1S6YA 2ZSIA 3K6KA 4GZ6A 3DHVA 1N6KA 3S7DA 3PF9A 4I9NA 3E33A 4F1JA 1VGRA 3T6KA 1X7WA 2IK8A 4KPUB 2ZT5A 3GDHA 5IZCA 2X0RA 3HBFA 4OBXA 1OMOA 2PUFA 1SCBA 3CVYA 4KZCA 3L02A 4AQYB 3ZDYB 3B1ZA 4ZT5A 2LP4Y 4KOAA 4OJNA 1MIOA 2FWNA 4OREX 4B73A 5CDSA 2H07A 4MUXA 4NI5A 3LFTA 2QPAA 1IVNA 1D0IA 4TXRA 1KBZA 5DBHX 1PV4A 3DDZX 2BFOA 1BQEA 3U3ZA 3T9AA 2G17A 1FYDA 4LYGA 3H5RA 2DHQA 3OJFA 3PR1A 5IZ4A 3GLQA 1W94A 2ATEA 4KWHA 2ZIZA 4Q02A 4KGZA 1X9GA 2QRMA 1TFUA 4PZUA 3VDNB 1GLGA 5KBYA 1SQFA 1ORHA 4IJVA 5KNCH 5KJ6A 3TD9A 4BTEA 3AFOA 1E8YA 1N4AA 1RDFA 4JN6B 4ZDIA 4MP3A 1ZIDA 2WUGA 4ANVA 1XKXA 4DYDA 3A27A 2IY0C 4KQ1A 3NDPA 3RK0A 5U4QA 3OCCA 2HBZA 4JP2A 1I9CA 1GU7A 3K5WA 3NLLA 4CR7A 3UT8A 1T6BY 3KB2A 3RYIB 3SLKA 1KQGA 4UHFA 3UAGA 5LYYA 1XZBA 3SJUA 3KTAB 3U4DA 2VAMA 2DBRA 2Y1LA 4FBLA 4UTOA 5AIBA 3ZV4A 3GGGA 3E1KA 1G18A 1JIVA 2UZ4A 2C59A 2WSMA 2ZWVA 2WJPA 1V1MB 3KUDA 4S0ZA 3KDPA 3PJGA 1F8YA 4B7XA 4JUIA 5G05C 1MX9A 1E3EA 4JGIA 1ZM2A 4RPGA 1ESDA 2NZ2A 4CKZA 5EQDA 2A9VA 1IDN1 2ID9A 4RKYA 2CNBA 3ZQJA 5C7IO 3BMCB 3ZYKA 4TRQA 1R3UA 2DFVA 2CBGA 3AR4A 3IJRA 3S2ZA 2CXOA 4K5BA 3WLEA 2Y68A 1P44A 3EZ9A 2RKOA 1JV2B 3BMOA 1Q21A 4NHEA 1S3IA 4FE7A 1DEKA 5EQJB 4RE5A 4HC4A 4BNUA 1ETHA 4Y0VA 1H9BA 4LNUA 3C3MA 4WCFC 1DTEA 4ZYTA 4CL8A 5AVJA 2QT0A 2RIRA 4XARA 4OVKA 2JGFA 1OZHA 1QCDA 3V79K 3WGIA 5AM3A 3NTRA 1B00A 4ES6A 2Z58A 1PFUA 4ATGA 4M1TA 3V34A 4BNDB 3ZZMA 3OEHD 3C8ZA 4NENB 1MFPA 3EDOA 4YJ2B 2M2IA 3V1NA 1XYVA 2CDRA 3T7AA 4KRYA 3KETA 4ZAFA 2CUZA 4NV0A 2G0TA 4N3GA 4FMBB 4XZ3A 1Q0PA 3URMA 4KKVA 2HAEA 3HXTA 4R9UC 4RJKA 2XCTB 3NHYA 1ZEMA 1YHZA 2FPPA 1E1NA 2HN9A 3VNSA 4X62B 4OJYA 3AL0C 1KEWA 4LF8B 3HJAA 3AR9A 3GLHA 1I5OA 4HDRB 4AMUA 1BRMA 2LNDA 3T34A 5ESWA 2YIDA 4CUZA 3TX6A 2YIMA 4O1HA 2YJGA 3ZWPA 1B1AA 1EE2A 4I1PA 3G9UA 4CZ2D 3PE3A 3PIIA 4L8LA 4BJHB 1QHXA 2Z3VA 4BBJA 3ZU6A 1H2XA 3B5EA 4MWOA 4LJ8A 3OHPA 1O96B 1O1SA 2BONA 3DH0A 3M1YA 2FXIA 2J9ZB 1SNYA 2ISCA 3R44A 1GYPA 3ICWA 1G7RA 1IXRC 1EX7A 1XMSA 2YNQA 2FV8A 3SHOA 1Y1SA 3QY0A 3U61B 1WX1A 4MVWA 4E5YA 1C7ZA 1QTIA 1OKKA 4LTMA 2YKGA 1AMUA 3DAGA 4GTMA 3ZLVA 3DDUA 5C31A 3PDWA 4KLZA 4LK3A 5FOSA 2CNNA 4QUJA 4LOJA 4PLTA 3O4RA 4A4DA 3KLOA 3FMFA 1D2RA 5LLTA 2IU3A 4JLMA 1OZ0A 1Q50A 3MUNA 4PCAA 5CA1F 2D0OB 1JEEA 3A4MA 4JW1A 1LRLA 3V33A 1OZAA 1UXIA 3V9AA 4XX1A 1YBAA 4ZT7A 2OFXA 2AXPA 2IOQA 1XD8A 2DPXA 3GEBA 1R66A 4RZSA 1BGVA 1RLIA 1VSBA 4Z7NB 4A63B 1C3LA 4RS4A 4LA4A 4RETA 4N0EA 3KQHA 4YLYA 1VSTA 1H94A 5BVGB 4UARA 3SC2A 3WL3A 1M7GA 1MTZA 2REBA 3J81A 4LFCB 5DHUA 2RGNA 4YXWD 2XXJA 4UQOA 5MN4A 3AEUB 4DLZA 3H8SA 1QLHA 2C2ZA 3ENVA 5AVQA 1E4YA 3NHUA 3CX4A 2KC7A 1N8KA 3A3OA 1DWUA 3CZQA 5ES4B 3TWQA 2QD3A 1KK0A 1TQHA 1K98A 1HTTA 4BV3A 3R20A 4Z9BA 3PUIA 2FP3A 3WKDA 3GD5A 3DMRA 4DQLA 1FRZA 1JFRA 1S8FA 2AKEA 1G98A 3BWCA 3GK3A 4CI9A 3DOUA 2IU4A 1FTSA 3BXHA 5KQPA 1XQWA 1PZGA 3QWWA 4QYTA 1I30A 2PYIA 3VGPA 2P2LA 2XMRA 4CIBA 3NF1A 1DV1A 4YCDA 3I9LA 4YCAA 1KRXA 3L7CA 5DX0A 1J39A 1KVQA 4MHTA 3RIEA 1ZD4A 4YY3B 3LJKA 5J4HA 4R8SA 4P54A 4OQPA 5ALHA 3PQ5A 1RBMA 5BMVA 5EN5D 2OCAA 2GCPA 1GQRA 2FEMA 5B58T 3O83A 4Q82A 5L7TA 4YBZA 1EDEA 3M9XA 3CKKA 3ASOE 3DMFA 2IZ1A 4EHJA 4YQEA 3THRA 3OIDA 4LE0A 5JNRA 5FWQA 2ZWPA 4DLLA 1KAOA 4FFNA 6REQA 2JI9A 2OV4A 2OZLA 1MQAA 1N1MA 3CUWA 5JCJD 1JEYA 2Y1EA 3BB3A 3IEUA 3H99A 1YR1A 4M9SA 5HF5A 2B34A 5BWBA 4HLDA 3NH9A 5ICGA 1UPAA 1P5ZB 5EIFA 1BA2A 5HM6A 1QVRA 3T5BA 4WX2B 1XRMA 4FZVA 3PNLA 4DK5A 1XTBA 4ZK2A 1L4LA 5F1PA 1NOIA 5DYIA 4N7RA 4DEXA 5A6CA 1Z7EA 2GRLA 3FTXA 1DADA 2ALJA 1HLPA 4E5DA 1G3IA 1H6AA 3KFVA 3NAWA 1II0A 3KYDB 2NO0A 5FWNA 3EVAA 721PA 4H08A 1XQ1A 4Y7CA 2EW8A 4ZOEA 1FFEA 1RXUA 2FPMA 1ODJA 3F6EX 1VYTA 1U3DA 3V1YA 2AFIA 1EGHA 4E1AA 2QLMA 5A5VA 1YVRA 4X0EA 2PBRA 3PR2B 4CHTA 1SVMA 1N36B 3KB1A 2ZDQA 2FPOA 5CFRA 2BFPA 1L5NA 1G2IA 4B09A 2WJ3A 4ND6A 2WNSA 4ZHQF 4MRRA 2MYPA 1IY2A 4BFVA 2G25A 1VMAA 3O90A 1NBMA 5DCYA 4I9FA 4ZVSA 1ZGGA 4MVJD 1B0ZA 3DVSX 3DKVA 5DNDA 3TUIC 4I6GA 2JIQA 1CUWA 1X8XA 2BI8A 1N6HA 2JFHA 5HS6A 1AS0A 3V4FA 5B4UA 2HPVA 4LOHA 1T3TA 5DULA 2L0IA 1XWWA 4R7GA 1RBZA 5EIWA 5F4BA 5B3JC 3LDUA 3SS7X 3TPZA 4J0UA 3DDOA 1GAWA 3E7PA 3I52A 3F6CA 3O38A 2OT3B 3VPAA 5T8IA 1GADO 3CPSA 2ZRGA 5GZ3A 2XMGA 4A73A 5DX8A 3S7JA 4IFTA 3TBKA 3AS8A 4ZFNA 4GL2A 3ZEIA 2Q21A 1XP5A 2EKQA 1Q19A 5K3AA 1JEDA 1VG8A 4H7IA 4CEIA 2ILTA 1ZIPA 1E1RA 3NC0C 1BXRA 4H35A 4U2FA 3NNDA 2XXAA 4CMHA 2KJQA 3K31A 4BNZA 4R3WA 4F96A 3OZDA 2OHGA 2FG5A 2ZS9A 4DIEA 1E2HA 1JPNA 5G05J 3QX9A 2XEHA 5TF4A 1PTKA 1K27A 3HJFA 4IHAA 2V65A 3ITKA 5HQTA 5BN1A 4F6RD 2XD9A 5JQWA 2R60A 2CYAA 1DBVO 3GBPA 3HVHA 5BR1A 3KL2A 4CDRA 4YJHB 4X91A 5H81A 5BSKA 3LBNA 5FOUA 2H92A 1QX4A 4OVUA 4CKBB 3FG9A 3AS5A 3F2IA 4C7VA 1VHTA 3HKEA 3PU6A 5K0SA 1E2FA 4FMDF 1WXXA 1O9HA 1ONSA 1DXQA 1NLMA 1WA5A 5M5BA 1J9EA 2WWFA 3AM4A 4HRAA 1XTZA 3TUZC 1I01A 2A5FA 2DZOA 5HNKA 1EESA 1SGWA 3LL7A 3BIWA 5IX8A 1L4EA 4BNTA 2WXGA 2ST1A 4PNPA 3NV7A 1E0DA 3NHAA 3Q40A 5FV7A 2GEBA 4HAUA 4WN9B 4ROSA 4P1ZA 3PQCA 4Q4CA 4KVOA 4RHXA 4DL9A 2V7VA 2UVPA 1E4EA 3VAZA 2WYVA 3C3JA 2JF0A 1GNRA 1NMYA 2RFLA 5EEHA 5KTSA 1KA9H 2WXJA 4TS9A 1WNTA 4JOCA 1DIAA 2ZJ2A 1SVSA 3HCRA 4JHXA 5C2YA 4HAVA 5FZQA 3HB4X 4QLBA 3HJBA 1HS6A 2ONZA 1YR6A 2L18A 1IN4A 2FPKA 1I3KA 4MV3A 2JASA 4AY6A 3STUA 1IAVA 2AN1A 3E82A 3QPVA 2AXEA 3V7UA 3QLVC 4YRNA 4OBWA 2PRJA 2GPBA 3R4CA 2ARKA 1FFWA 3RRYA 4FXOA 5FIUA 3CW2A 3D9LA 4C0WA 5DASA 1MO2A 3TLZA 1Y5IA 3OIGA 4L5JA 3VHXA 3R6GA 3P32A 4TTAA 3RSSA 4Y9UA 4PO8A 1Z5OA 4CLOA 1X13A 1QIMA 1Q5PA 2Y9PB 2O2XA 5LP6F 4GX0A 3BXFA 1DXHA 4YVQC 4KMRA 1GAXA 1CZHA 1BKYA 5EXDA 1ZW1A 4QOFA 3RUDA 3SKYA 2WMOB 3LKBA 2I87A 1IUPA 2QV0A 4KHPB 4B9AA 5BV7A 4D46A 3D8SA 4YUVA 3EGXB 5L3ZA 3GLIE 5IXJA 1T8PA 5IHXA 3VPGA 2W2LD 5B57C 4V2UA 3RW9A 3BZBA 4ITRC 1L6IA 4H6XA 1PX0A 4INZA 2AWNA 1V5GA 3PGKA 4RELA 2AOUB 4FHKA 3OPQA 3TMYA 4PYNA 1QRRA 4M0PA 2E5LB 4EF5A 4DPRA 2FSGA 1FDUA 3RVQA 2IE0A 1B76A 3KVRA 1YB7A 4EG5A 4X1KA 1HGXA 1O95D 3KU4A 1CNEA 3CT6A 1G8FA 5ENRD 3B2NA 3FLBA 2O0JA 2GLXA 1EEHA 3WWPA 2HJSA 3L46A 1HKHA 1LRKA 4Y2RA 1TLLA 5CJ2A 5K0GA 3ZUVB 3LXUX 2R03A 4KQFA 2EX4A 1DE0A 1MOQA 3K8ZA 4MVJI 1A0OA 1DIGA 5JCOA 4MP8A 5IKEA 1DZ3A 4CIDA 5A9RA 5EZSA 1HZZA 3NTVA 2XH8A 4DIDA 4ASUA 4G8BA 4J3NA 1QKKA 2VP0A 4P5PA 5KTTA 2P2NA 4NK4A 2IUFA 2V4HC 4LEUA 5CHEE 4IXWA 3OZSA 4CT4B 1Q2ZA 4Q4HA 2XGMA 1KJWA 5JTUA 1RWVA 2GO7A 1PQ4A 2O0HA 2AYZA 1MG0A 3T9CA 4FT2A 2PEYA 3WDSA 1RKXA 1HLFA 3JYLA 4CKEB 4I4TA 3GUUA 2OBBA 2A9QA 3QUCA 2GXAA 3AF2A 5HKBA 2JKZA 4XYEA 4UMVA 3LYAA 1V8BA 4DOMA 1F48A 2E4YA 2V6BA 1Z07A 5IDYA 1GUFA 5JLJA 2GXQA 5LXTB 2WSBA 2FEAA 4EPZA 3N87A 5HRAA 1YJCA 5ECGC 3ADBA 1BCRA 4D4MA 4Y1RA 4HCJA 1YZKA 3G0BA 4KGXA 5KTPA 1FU7A 1PGJA 2WZCA 1DKQA 3GIWA 2JJMA 2NTVA 1B0PA 3JZAA 4I1OA 1ZKMA 4FGWA 2GHQA 2VKQA 2ZROA 5LD2B 2PO7A 5IBCA 2TYSB 2Q41A 4YRKA 3HB0A 5H16A 3ETHA 5CCLA 1Z6TA 1W52X 2B61A 4G1TA 4JU9A 1HT1E 1FFSA 1KAMA 2C4TA 5JROA 2ZJ4A 1G3UA 4KQJA 2QG6A 4LOLA 2GDJA 3Q15C 3W5UA 2JLWA 1X74A 3ULEG 3C6QA 3NDRA 3I9V6 4X9XA 1TNZA 5JDCC 3KSAC 4DEYA 2CJWA 4V3IA 4REMA 2WB2A 1H22A 1TUBA 4BAUA 2XRMA 3V2UA 3UG7A 4ZPXA 5JSZA 2E4AA 4Z9FA 2RDMA 2QTMA 3IMEA 3AZQA 2DPYA 4KQHA 1VOTA 4H0FA 5C1OA 5ALMA 2RG8A 3S2EA 1XDBA 5DK4A 2JLUA 3TZQA 3BFJA 4I9HA 1AZTA 4DLXA 1EDOA 1S89A 3QSYA 1VJRA 3D4LA 5AK6A 4XUGB 4OYLA 5LM3A 5D00A 1JQLB 2I67A 4B7UA 1DIBA 4M22A 3LK6A 2TMGA 4LEIA 3KZOA 1RWWA 1N94A 2O0KA 4G5GA 5ITSA 5DWDA 4PC7A 4LXGA 4BNFA 3KELA 5EMKA 4UOZA 1FNNA 5F64A 4H3SA 3ZNNA 2JIDA 3HXBA 5BNTA 2VSNA 1BX1A 5E6RB 1E8ZA 1P3Y1 5ADVA 4L5CA 5J5AA 2SICE 1A82A 1H6OA 2ZKIA 1FFYA 3NTXA 5JH7A 1BMFD 3VLFA 8OHMA 3STXA 1L4HA 1ZGCA 4UNQA 3R76A 2O2IA 2BHSA 3TBFA 2DF8A 5DIFA 2CE2X 4BECA 2DWOA 3ONVA 3TLBA 4EA8A 1BTOA 3P96A 4RY8A 2JGNA 4MROA 4G0YA 3OJCA 4BQRA 2COKA 4BNLA 3I1YA 2FA9A 2ZRAA 4YT8A 3F3KA 2NAFA 2ZSJA 5FJYA 5J23A 3TCXB 3RJ5A 4NCKA 2C7RA 1YRAA 3U4GA 4ESVA 4BU1A 3GJ4A 3DPIA 3CHSA 3IO3A 4RK6A 1D1SA 4DCMA 3RSCA 2FB9A 3HLKA 4C76A 1YXMA 4DFDA 3QG1A 4UQYA 1US8A 4PSKA 3TX2A 1OX4A 5JSYA 3N39C 4UQXA 2E0IA 2OB2A 1FX0B 4JC8A 4MGIR 5FI0B 2QD5A 3ZWVA 5FQ4A 1OCRE 3M6VA 2FN8A 1JQKA 3IC5A 2IEZA 5EYPF 4IDGA 2PCLA 3BC1A 1DWQA 1E1QA 4HUTA 1G8GA 1ZUHA 1E1DA 1LVHA 2CJYA 3GDWA 2PZBA 2E6UX 1E5LA 5TY0A 3BG1B 3CVJA 2E4VA 1GN8A 5DTRA 1PLLA 3TXXA 2QGFA 4HNGA 2C2XA 1RI5A 4N5QA 2LVBA 1Z47A 4TWJA 1SXJC 3H87A 1R8JA 3RFFA 3GP5A 2FFRA 3EGCA 4PC3A 4ARVA 1HBJA 3UHOA 4DRXE 4KREA 4GLJA 2QW1A 4AJ4A 3WDMA 3CW8X 1LJUA 5BRJA 4ME6A 1K89A 1ZM9A 4D25A 1GNTA 1I4OA 3A7DA 5BT1A 4PLZA 2GZ3A 3MMXA 4AJOA 4O2BB 3ZDAA 1E0KA 4ZDJA 3L7JA 3H1PA 2WD8A 1JJBA 3EGOA 2IY8A 3RM3A 2YWDA 4HSGA 4YJFB 3E5HA 1RI1A 4AS3A 1CF9A 2BP7A 3II6X 2XWQA 1N3YA 3WRWA 3WV4A 4MRVA 3RVOA 4D9IA 4ZAVA 2GA9A 3BQOA 3N2EA 1DJMA 4L4ZA 3CLUD 5JZ9A 2G1AA 2GJAA 1NQWA 4X7MA 1JP7A 4JFRA 4DQUA 5JXHA 1OBOA 3I3SR 1XGWA 3RT7A 4RVDA 1JDVA 3Q5EA 3KYJB 4Z4HA 4YRQA 4ROTA 1QGED 5FUBA 1UPUA 1V96A 1TL7C 5BMVF 3MLBA 1XO1A 2W6ID 1R4NB 4QEKA 5JZOA 3R7WA 1EDZA 1FNBA 1HPLA 1A8QA 1PFWA 3FCUB 2GERA 5MHTA 3UK6A 4HWSA 2QTFA 2XRYA 5K7SA 3V8VA 4XIFA 3RKRA 3OICA 2Z8YM 2VF5X 2JJYA 3B82A 4WADA 2UV8A 3BREA 1UKCA 4J8PA 5HBRA 1QJ4A 4UHDA 1GUDA 2GAFA