1EPUA

X-ray crystal structure of neuronal sec1 from squid
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
590
structure length
546
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-SEC1
publication title The X-ray crystal structure of neuronal Sec1 from squid sheds new light on the role of this protein in exocytosis.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 168
structure length 546
sequence length 590
ec nomenclature
pdb deposition date 2000-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1epuA03
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1epuA04
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1epuA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1epuA02
4BX8A 2XHEA 5BV1A 3PUJA 4BX9A 1EPUA 3PUKA 1MQSA 4CCAA 4JC8A 1FVFA 1Y9JA 1FVHA 4JEHA 4JEUA 3C98A 5BV0A 5BUZA 4KMOA
chains in the Genus database with same CATH superfamily
1SC1A 4RSMA 1Z16A 1I6WA 1O1RA 3ZJYA 4BDTA 3RH0A 3RLIA 1PVDA 1WPRA 4UZSA 5GGYA 4D57A 3U7QB 2QZAA 1S9HA 1XPUA 2G8NA 4M2LA 1UFRA 3K3PA 3BM5A 1WDKA 3GARA 5D6NA 1BWQA 2AWNA 2NYUA 1VIVA 4UUBA 5LZ4A 4AF7A 2KE5A 3MCXA 1T4BA 1FFXA 1S2IA 3IXQA 5DYIA 3CCBA 3AKDA 1GL6A 2COKA 2XD4A 3GHHA 2I62A 1CSEE 1H8ED 3AX6A 4ZVQA 2ILVA 4QUBA 4QYXA 2IOYA 3VXKA 2ZSDA 3KZMA 2IHBA 4ARIA 1DOAA 4Q3KA 4K9SA 1LK5A 4L3VA 3REQA 5EJMA 1WMAA 4LYAA 1YUBA 3S68A 3WO1A 4NE9A 2WXRA 1OTHA 1SQSA 4B76A 1E2NA 3CGWA 5FH9A 4N7MA 2OV8A 4PINA 4RVCA 2X4DA 1XIVA 2QS9A 2YIVX 1XROA 1ISFA 5F4ZA 3ASOE 4UWHA 1QAMA 5C8VA 4BLTA 4AXXA 4F85A 3C16C 3RDPA 2R7MA 3BF8A 3B70A 5HTOA 1I01A 1E9CA 4BTLA 1J1UA 3O8RA 4ER6A 1H2YA 4LK3A 2AMLA 5LBTA 4KPFC 3G6WA 4PG4A 3VOBA 3WFJA 2XUJA 3UT7A 1R3DA 4YDYA 2I8LA 1VHDA 3FYTA 2O5CA 1SW6A 2A5GA 5CEEA 5DTMA 3FNHA 2GN4A 3FWVA 1XRRA 3FVTA 2GBPA 1DELA 2HO1A 1H5UA 3FWKA 2GPYA 1I7DA 2ZIWB 3T7AA 3A70A 1IB0A 3IHTA 4U8YD 2WNIA 2BFDA 5D3ZA 3NIFB 4IXNA 5CM8B 5JY6A 1V8ZA 4ISBA 3FW1A 3A3KA 5HKKD 5C3MA 4LJLA 4GOXA 1A4UA 1Z35A 1Z6QA 3C6QA 1J23A 2Z2KA 1T2NA 1QU2A 2QVZX 1U2EA 4CR6A 1A82A 1UJ4A 2AA3A 4ER7A 4GX5A 5EN5D 3CUEF 3GA5A 1L4MA 3ABRB 3ZPXA 4P3OA 2O50A 3AH8A 1IIRA 2REQB 3KOWA 4F9GA 1KQFA 4BO6A 1L3BA 4I6GA 1Z4JA 4D4HA 3GLGB 4EW1A 1BWSA 3QW2A 4HSEA 2W4QA 1W0KA 2H2WA 4Y1RA 4MV4A 4MULA 1A50B 1JCRA 3RSZA 3WB9A 1QZUA 5C81A 5ITZF 3WAKA 2O5RA 3F8WA 3NBMA 2C4KA 3USES 1PV2A 1NQTA 5KTTA 3TZ6A 4EHHA 3IPAA 1BNCA 1TIKA 2X2PA 3CPHA 2AEJA 2AR9A 4V0QA 4I9GA 4LNUD 1RC0A 3BE8A 3NFYA 1KYZA 3NKVA 3PZDA 1WQ3A 2YBEA 3BG0B 5JZ9A 3Q7TA 4ENSA 2DLDA 4GNRA 2FZGA 2GZ2A 3GDWA 2CSUA 1I6KA 2AT1A 1Y0BA 4MUIA 3UWMA 3O7MA 2OBBA 1TO2E 4QNNA 3PNBA 2ZZNA 2JLAA 2WG1A 2ZYTX 3T3EA 1XCOA 5ECWA 4BRSA 1WDWB 1H6CA 4Y1EA 4FFLA 3C1TA 5KTOA 2HCRA 1H6KA 3EZ2A 5IFKA 3TDMA 1UBRS 4PS1A 2X38A 3ETGA 2PL2A 1SBZA 1R0WA 1KBQA 3KJEA 1Q74A 3K8OE 1V11A 1T13A 1DJPA 3OIYA 1LNZA 4F1PA 3O2JA 2IZ0A 2WBLC 1CUVA 1FBTA 1UJCA 2IBMA 3QEBZ 2O54A 4F3TA 1E92A 3A6EA 5AK3A 2VNJA 3EBPA 3AERA 1SEVA 5CJPA 4B71A 1RWVA 1UQRA 5A5FA 1XELA 5SY9A 3BTOA 4ED9A 3D6MA 1WETA 1H4QA 1QWSA 1RABA 4EF6A 3L8GA 3Q5MA 2P9BA 3ZGQA 4FCWA 3BIWA 2QJWA 4K28A 3K05A 4C4XA 4QDKA 4QC2A 4ZC1A 2HYIC 1QBQA 4OA5A 4XVUA 2NUTA 4BN0A 2JARA 1W6RA 2RE8A 3HUDA 1C7ZA 3PR2B 1S63A 1ZI6A 2UYHA 3LBFA 4JLSA 3L7DA 1VJ0A 1ZYUA 2J87A 4H7PA 4US2R 4NTZA 1QS0A 3KKKA 3ZV7A 3CJQA 1QRTA 1OD6A 1UXGA 5EC8A 3BFKA 4WBXC 4LZNA 2R8YA 4AUNA 3K0CA 5JCZA 2OFWA 2O1SA 1PT8A 2YASA 1HR0B 5JHHB 4ENUA 4NEQA 2QV7A 4QFMA 1VA5A 2VH5R 2CYBA 2DB3A 4AECA 5DNWA 3NF1A 4QELA 1W47A 4G0QA 1W52X 2MJLA 4LMBA 2QL9A 4P2GA 3GLTA 3AQIA 1XWWA 1PZEA 1X8XA 5ALHA 2QJOA 5HRYA 4HOTA 3WXXA 2VDWA 1OX4A 2JEZA 2JCXA 5DX1A 3KS9A 3H16A 4PZ0A 3GMSA 4BNVA 5BYAA 3QOXA 3PC8C 2W98A 1VPTA 4LBZA 3IXMA 1N2SA 3CF0A 2YVAA 5KWVA 3IV9A 4HRNA 2F3RA 1KJQA 1QHSA 3OJCA 1WE2A 1SMKA 4UOQA 4FYJA 4ZDJA 3Q4GA 3K8YA 2J0SA 4DLOA 4RAOA 2R1ZA 1L5YA 3CX6A 4C0SA 4TMXA 3TEMA 1PG5A 5KWIA 1N4SA 5E1BA 4EPXA 3BRQA 3DL4A 5ENNA 3W5IA 3KSLA 2WNHA 4G24A 1ZRHA 3K5HA 1VMDA 2MINB 4HYYA 3RVJA 3NKLA 2PL5A 2GNPA 1AO0A 1GGJA 1Q0SA 4AZ3A 3OZVA 1C0EA 2FR0A 4X7RA 3TQHA 2UXCB 2QAGB 1JDTA 3ZQJA 1TB4A 4MI6A 4GQIA 3FMOB 1IM8A 2WWXA 3G2TA 5JAMA 2HUPA 2CHVA 1U3UA 4PHFA 2EFYA 4OXRA 4ETIA 4YJ2B 4UCXA 3PGLA 2R8EA 1MQ8B 4JYMA 2AMJA 1SPBS 2H9YA 3NHAA 3E22A 1XTBA 3HU1A 1G6KA 2ETAA 1ICIA 1XX6A 4I5EA 5BVHA 4B8AA 4H7DA 3V32A 4QQIA 1YDWA 2J9ZB 3WBKA 4BO9A 1BJTA 3OJOA 2NYRA 2OENG 1CIVA 5IKPA 3DBRA 4BBAA 1M8GA 2IXDA 3N2KA 1COWA 3A27A 3G23A 3D6HA 4F3YA 1SOVA 1MQSA 3SYTA 4YALA 4MP6A 4L4SA 4IL5A 3MCWA 4FI3C 4H3VA 3IHVA 3X1WA 3JQ9C 3L0SA 4YT8A 4WN9B 1ESZA 5DM1A 2R5FA 5AUQA 4RHYA 4Q6BA 1NWHA 4M8NE 3C1OA 5DNVA 4C0XA 3OETA 3ROPA 5FNZA 4ZHQA 4KKXB 2NP6A 4I1OA 3PQ5A 4QXAA 1BD4A 3PNQA 4PZLA 1QO9A 2FSIA 4BHTA 2Z5VA 1P3JA 3S2SA 1MJFA 1W19A 5AKYA 4AMVA 1M2VB 4LQ4A 5DISB 4E5UA 2NO0A 2V97A 1X9IA 3LWDA 4AICA 3P1UA 2P6NA 4CEHB 4YRJA 2FRXA 3NDPA 3IIMA 1ZDMA 2PGIA 3QUSA 1IQ0A 2W6CX 1MT3A 4IZ6A 3T7RA 2C3OA 5CB8A 5LFAA 1UM9A 3BOSA 4TVSA 1KY4A 1ZVMA 1B15A 3QLTA 5DZSA 4NR0A 3FSGA 3L04A 5ICSA 3QI7A 2ZISA 4G36A 1SD1A 4J0CA 4YO8A 2NUBA 3EIQC 5K09A 2JFNA 2YUIA 4RMGA 3KB2A 3LU1A 2QRUA 5EIXA 3UT8A 3CN7A 3VSAA 1ODIA 3RF6A 1TW3A 2BGUA 3V55A 1RJGA 1LNQA 1TZKA 2JZNA 1JR3D 3JAWB 3AVTA 1NF2A 1U5AA 4C6HA 1E1DA 2O5VA 4Q9HA 2A1TS 3ANYB 1O95C 1D2AA 1YCHA 1LTKA 3WNBA 5BYJA 4GWGA 1LD7A 2QT9A 1I5EA 3SKXA 4MMYB 3PL5A 2Z2ZA 4EDFA 1NNEA 2V65A 1E98A 1NUQA 1Y82A 4H17A 1EGQA 3RS7A 1W5SA 2ZRHA 4I2ZA 3D8BA 3MWDB 2W2PA 4FFBB 1AD2A 3AF6A 5K4AA 3GFVA 4D8WA 2J8ZA 4XQ0A 4O1IA 1WP4A 1YQQA 3IKMB 4RHEA 2XH8A 4L2IB 2ZYRA 5GIPE 4EARA 2QRHA 4DM7A 4BGDA 5K0FA 4QARA 3S3TA 2UUBB 1OCZE 3CX8A 4HUJA 2PQNA 1XTQA 2PCLA 3ZD8A 3LYAA 5CA0B 4TKVB 3VVBA 4D56A 4JL5A 1WB5A 4YAWA 4I17A 4JMPA 1YA4A 2FFBA 2WTMA 3RV4A 3FN4A 4KR3A 2ZUWA 3HTXA 3QOWA 4JXXA 1KYQA 2E82A 4D9JA 5BWOA 4XFKA 3UJ7A 3O95A 3JVDA 4TTQA 1E2IA 4IKEA 4K2AA 1TKAA 3J7AC 3KE8A 3M0EA 1PTJA 4M1KA 5AOBA 4B3XA 4OG2A 2H5IA 3SFVA 2ZRGA 1AMOA 1V7ZA 1YJAA 3I6QA 3D7KA 1T5SA 2XMDA 3PPVA 3IALA 4MINA 4H7JA 3ZG6A 5PNTA 4XD7A 3I5MA 3PVCA 4UOEA 2PZJA 3VNBA 1E7QA 4O3MA 4N82A 3C3PA 3BL5A 4IGIA 4B74A 1A8HA 4Q12A 4RMJA 3QJYA 1YKFA 2ETCA 3S4YA 3R9WA 4LF7B 2CJXA 2ZYAA 3EGXB 2XX3A 1CRPA 3DMYA 2WU4A 5JSZA 1ZMOA 1SQMA 1VSBA 1RHJA 1MEEA 4N18A 3MPUA 5JDCC 3QE3A 2BKUA 1LK7A 3QVTA 3R7WA 4R16A 3SMVA 4OX9B 3O94A 2WKPA 3S2YA 4RORA 5JY1A 1R5BA 2ZXFA 1PV4A 2OLJA 5LKRA 1J33A 2B4QA 2C4TA 4ZALA 4YRKA 3V7YA 2O0HA 3IQEA 3EQ9A 3G6KA 4W6ZA 2WSBA 5BMVF 2CEKA 1ECBA 3GLVA 1M67A 4KXYA 2TRSB 1DPGA 3EVEA 4YR7A 1W5AA 2VJCA 3PUHA 5EA2A 1RHUA 4G0NA 2A5FA 1OGYA 1PR4A 4R41A 2KM1A 5TPZD 4N3GA 2ZYUX 4I55F 2FNAA 2ZW9A 4LJRA 4M9RA 4GOJA 2I71A 2UZ0A 4Q0MA 4C03A 4WNIA 1YQEA 2BP7A 5B6JA 1E6UA 4OQZA 1N94A 4ZEOA 1IJKA 2EJTA 4ZJYA 5HOQA 3JYPA 2L2QA 3FLAA 4HWSA 3ZDEA 4J2OA 1Z0JA 5JPIA 4L0QA 4ENQA 3GQBB 3CLTD 3IAEA 2DHEA 3HC7A 4RPLA 4ACLA 3BL6A 3V6LA 3KQWA 1J8QA 5K05A 3OT4A 3HKDB 3HB0A 4DOMA 4OB6A 5DRTA 4GA1A 5JCJA 2HHHB 1P77A 3KEFA 2HSDA 2LCQA 4D1YA 4NKRA 1D1TA 4EHFA 3OTHA 4F3CA 1VGQA 2QC9A 3CMCO 3G85A 3TD2A 5FAKA 4DLXA 4OQDA 1LRLA 2A30A 2A58A 4Z3DA 3EY9A 4UXHA 3L40A 1BTOA 3I0ZA 1ID8A 1BEZA 3UJHA 4HFNA 4LGYA 5AH0A 1HO3A 2HCTA 2AKEA 4IDFA 1OPRA 1NFFA 3B3GA 3Q3IA 4XIJA 2HBYA 4GTTA 1NMEA 4KJZA 1YA8A 2XYHA 3RK0A 2Q21A 2IYAA 3KZCA 1NG9A 4CF4A 5DCUA 1S8OA 1M7HA 2V1UA 1T2EA 2B5WA 5E9AA 3PZ1A 2VHTA 5JC1A 4EG8A 5KSPA 1YMQA 3ANTA 4PM4A 5KTNA 1B3RA 1UW4B 2OLEA 4QXMA 2ZRQA 4DUYB 2QLFA 2QX7A 4YJFB 5IAJA 3W5VA 1AOXA 3TNFA 2G40A 1G63A 4IDEA 3TWRA 5DTQA 2FG5A 2L82A 3K1TA 3UJBA 1ZK4A 3L6OO 2VJDA 2WB4A 4HJXA 1KNQA 3L0IB 4OVKA 4Z9AA 4DAEA 4RA6A 1Z9BA 2Q62A 2XXJA 421PA 4NFYA 2AW6A 2R6CA 1RKVA 3STVA 3U19A 4MYRA 2YZ2A 4GLOA 4YFVA 1CB7A 4EKNB 2J48A 2I9CA 4HDSB 4F1SA 4GPEA 1VLHA 4PAQA 1IB6A 3LT2A 3D3EA 3AGPA 1XD9A 2X6QA 3AR8A 2FUNB 4DSNA 4DXHA 4G6ZA 1AH2A 2WXNA 1UINA 4OL0A 2PL9A 2YYYA 3L4EA 1NC3A 1IVNA 1OBHA 5BOSB 4HQFA 4J4BA 2GZAA 3CV3A 1C3VA 5I7FA 1HTWA 4J6EA 1E2UA 3C43A 4CKBB 3B3FA 1Y7TA 1W75A 2J4FA 2Q8NA 1RI3A 1JV2B 2EHDA 4YRMA 3TM4A 1L7OA 4C0LA 3ENVA 2Q7XA 2VQDA 3K09A 4G84A 3A1CA 3EWNA 1W29A 4MKIA 4ITRC 5AT1A 1KETA 1NU6A 4AVYA 1GTL1 3FFWA 2QQ5A 1JFFB 2GRLA 4KPYA 1LF5A 3OTWA 2IEIA 4H7KA 3OFKA 2CNWA 4UUQA 5JVDB 3RNLA 3HBLA 4KR6A 4BFWA 1FW8A 1NVWQ 2B2CA 3UM9A 4W8HA 3O2SB 3BCHA 1QDEA 3M33A 2CBXA 1CBUA 1QRAA 2XODA 2QTMA 3C4JA 2CJWA 3DONA 3ONFA 2P5TB 3AEQB 3R7DA 3FX2A 1P0MA 3ZOKA 3EA0A 1CTQA 1X9GA 4PBRA 2VR1A 1IZYA 4GW3A 4PLFA 4KQEA 3ONWA 2DVWA 5B1SA 1U2GC 5J2TB 3EY4A 4Y6RA 2QY7A 1ESNA 4E5SA 1E96A 4XGQA 2GK4A 1P4GA 4KBQA 4EABA 3IQZA 3DZJA 1C4XA 4CTNA 3R0XA 1A9PA 2NQ8A 1AQJA 4JGBA 4FHKA 2ALJA 4C4AA 1J1ZA 2WD8A 1U1IA 2L42A 4URZR 3PT5A 2R6FA 1SBTA 3RK4A 1T1EA 4TL7A 1WY5A 2R8PA 4KNYA 1EWQA 1H2TC 5CA1F 3OH8A 3WJ7A 2Q5OA 2NSHA 4JA7A 1SIBE 1WY6A 3CUWA 2BFBB 3G59A 2IIPA 1NVEA 1X3LA 3I58A 1RFLA 4OEHA 2WA2A 1DTSA 2XA9A 2ZE6A 5K6AC 3O2NA 3QKUA 5TQ2B 5C8ZA 2HDWA 4WCVA 1A8PA 3GBSA 1ZD9A 2PBLA 4GI2A 4O63O 3W9SA 4X60A 1DIOB 1UWKA 2YHBA 1QGZA 4QRDA 3D2LA 3GRKA 2HQOA 3PUZA 4HMOA 1AZWA 4F5DA 4F46A 4JASB 3HR7A 1BJRE 1NPDA 5A9SA 4BTEA 1U6JA 1U8AA 2ZRDA 2ZR8A 3DEAA 2Z95A 2PJUA 1TJFA 2J09A 5K3FB 3K0FA 1JWBB 1H0AA 4KVFA 4D6PA 5D3QA 1DPFA 3G13A 3E7DA 1ZQ1A 4MWCA 3WGJA 3M81A 1KOFA 4TKUA 5LMNB 1PYOA 2RGCA 2ZTUA 4L75A 4ZQFA 5A7DB 4PYLA 3AG3E 4Y98A 4DN6A 2RGNC 3Q11A 3MK31 2ASVA 4Q9JA 3KOMA 3L0DA 1PSZA 5DBFA 4UU0A 5AVWA 1M6VB 1A77A 3DYBA 2AEMA 3O73A 4PNZA 3TLGA 4AJNA 4FD2A 2P9YA 1LC0A 3QVXA 3E5NA 1E1NA 3I76A 2ZTLA 4C4TA 3OAAD 4TRQA 1TYAE 3E7WA 5AR1A 5CR9A 1QV7A 3MHTA 5JMWA 4HNAD 1M6HA 2ANBA 1P2DA 1V0JA 5I01A 2ZI3A 1V2HE 1EWKA 3FH5A 5ES4B 3LX6A 1J2JA 2J3KA 3X2EA 1KQPA 4L4YA 1CDZA 2ZETA 1ENYA 3L6UA 3DKRA 3C3JA 4TM7A 4TV9A 1NXVA 3EDCA 2VDRB 4TQGA 4LRZA 4TSFA 1V95A 4UATA 3AI1A 4XE0A 5JBNA 1GO2A 2IVZA 1Y4AE 1SKYE 2F8SA 4M7WA 2XTNA 1NFRA 3OQ6A 2H4XA 2R9VA 3UIOC 5HJ7A 5B7QA 1Y3FE 3SLKA 3EXEA 1LKZA 3IOBA 1NGSA 4JCCA 1G0NA 2SHKA 1EFDN 4FN5A 3ASNE 2I2FA 4XQCA 1VKZA 1A69A 1P4RA 5DRYA 2WYIA 1DAOA 4EZEA 1O94C 3JY6A 4Q3EA 1MRSA 3K92A 1RC1A 1IXZA 1P8JA 1Z4QA 3UG7A 3LL7A 1OLSA 2JGNA 2SNIE 1L5LA 2JJ2D 2OQ2A 4OB7A 1G55A 2XLCA 5A06A 4FI3F 1FVOA 3HSSA 3T0FA 2Z6VA 3RKVA 2WSSD 4UVGA 1RXSA 3DD1A 3QU4A 1G5TA 2CBZA 5DCWA 3ZU7B 1TT5B 1UBTS 3KO8A 3MRSA 4CEJA 3ZDFA 4ZYXA 3U3XA 1N7IA 1Y6FA 1Z6XA 3D6TB 1ZNWA 3T4EA 1CY1A 2GD2A 1VIYA 1T34A 4JLAA 3LAWA 5B7NA 4UJ5A 2UUOA 4J8DA 2OQRA 2IPXA 2D4AA 2P9ZA 5LZ8A 1BRTA 2JLZA 3TR0A 4B47A 3QELB 1C14A 5JS1A 1JQDA 2E5WA 5I4IA 2QMQA 2ZBPA 1I1NA 1T1GA 3DHNA 1UJKA 4E5VA 2DUJA 3MS2A 4L78A 3L41A 3D9OA 2J08A 4M6WA 4TWRA 1FFSA 1DHRA 2IU1A 5AJVB 2AHRA 3H4TA 3VMFA 2KYRA 2W5UA 4RKRA 1SVXA 5KCMA 5ALEA 2EX4A 2QRKA 2GETA 2NO1A 2Y1DA 5E6RB 2DZNA 3KD3A 3W2FA 2PJRA 2PXXA 2WABA 4MVJM 3PNKA 4KPEC 5CYFA 4ZYZA 1VM6A 5CBKA 1GFSA 3UH0A 2FOIA 4XWOA 4BSZB 2C0LA 1ULUA 3BMOA 3LO8A 4GPKA 3PWSA 2E4YA 5D3MA 2IDKA 3ABSB 4MKZA 1QFZA 5KYUB 4OJMX 4LMPA 2SCUB 3D8UA 1DO0A 4FEGA 3A4IA 5IWAB 3OECA 3T5GA 3SY8A 1N92A 4GR4A 4FJ1A 2G8LA 5FF9A 3KC2A 1NUPA 1ELKA 4CQMB 4MEJA 1XEWX 3KLMX 1PC2A 3FUKA 1RLMA 5M7EA 3KKQA 1CDOA 2QVYX 3MTIA 4BLPA 3V4PB 5KHAA 5DULA 4LXTA 5D8DA 3DOCA 2O4CA 3W9GA 3GBVA 1G17A 2IXTA 2HBRA 4R0NA 2ATCA 3DGFC 3H5TA 4OQNA 4Q48A 1GZ4A 2GX6A 1GEGA 2FGJA 5KX5B 4I9HA 5FYDA 3H65A 1JRLA 3T95A 1K92A 1G4UR 4WGGA 2DQKA 3T38A 4D4LA 3WWYA 4G1TA 1NI1A 3D6NB 4Y9UA 3K71B 1VB3A 2LSUA 2R7LA 4FNGA 3N8DA 2ZS8A 3JX9A 4A8JB 5EHXA 1XPJA 2G4VA 2OCIA 2O23A 1KLXA 4KVMA 1PK8A 4J0DA 1NW5A 1W36B 4IX1A 1V4NA 4NNOA 3CRQA 3FWNA 3R3JA 1G20B 2OCPA 3SZ3A 3EJNA 1C30A 3REGA 3ZUPA 5EWLA 3K6SA 4B6PA 2AQHA 1VXOA 3K16A 3U3RA 1WCIA 5E4FA 2PKQO 4G4GA 3JATB 2R6GA 1Y5MA 3OCXA 3FCSB 4DQLA 3VPCA 3IJ5A 3ZJTA 3ZWNA 1AUPA 5ERYA 5T6MA 4UQLA 1EFUA 2WT9A 3IR6A 2HX1A 3GJ6A 2RGWA 1CR2A 5C7OO 4TV8B 2WOJA 4DY4A 3F9CA 2ID7A 1IWBB 5JNRA 3FTPA 2VNKA 3ERCA 4F2HA 2JKVA 1OROA 4HB3A 2DJIA 4BQQA 4RVNA 2UDPA 3EH2A 2AQIA 5IG2A 4E31A 1YB6A 4C2BA 3GLIB 5FI5A 2ONDA 5JRJA 2C84A 3M83A 2QROA 1V9CA 1XEXA 4I2VA 2HMWA 1ZRMA 1TJ3A 3AK4A 3ECAA 2EJBA 5FPSA 2G7ZA 5WRFA 5AM3A 3D9PA 1VTKA 1QYCA 1SK8A 1KI6B 2ZUFA 3S5UA 2NO4A 5F64A 2JLQA 2HU2A 3UMJA 1DCEA 1CY2A 5KYXB 4KQXA 1CS4C 1HEIA 1ZK1A 2KC7A 3BB3A 4JH0A 4LJ4A 3K9HA 4MW7A 1JKJA 13PKA 1HRKA 4PYRA 1UPBA 4B3JA 3DOJA 1LPNA 1K2VN 2VDMB 4LUCA 4E4TA 1AS2A 3BYZA 3QXXA 4QQRA 3DC7A 2QD2A 5IWCA 2D0PB 4X20B 2Y69E 1SOUA 4DIKA 5HYVA 3HV2A 5KOHA 1K6IA 4RMHA 2OESA 5DE3A 2J3QA 2G72A 2OUKA 3P9YA 2VKQA 3S7JA 1Z06A 4RDXA 2K2WA 2VWPA 1SRRA 1N0HA 4PHHA 1KSGA 5GOTA 4G23A 3ZDAA 2RGGA 4DV6B 2Q5IA 3DM5A 5CFPA 4ABYA 3CM0A 3RTGA 1PLLA 2DIWA 3FOCA 3VKUA 4K0RA 5EI5A 2QTVB 1L3IA 4OBEA 4R7LA 1X15A 1RLIA 2YOFA 5CG2A 2IQIA 4D8VA 1WSWA 1MDFA 4OP2A 5K0SA 2YS7A 5I6DA 1Y6GA 2OV4A 3KUDA 1E4EB 2CLDX 1U0NA 2C2KA 2X5KO 1E60A 4O2BB 5DIZA 4JLUA 1TEHA 3K0AA 2BGGA 2PMCA 3T12A 5AHRA 2XUQA 2PA3A 1RIFA 1EP3B 2BRUC 3KKMA 5LXTB 2FLVA 1ID1A 3QG5A 1H2AS 1SKQA 1RD4A 3L6CA 3ESZA 3UK1A 4AMZA 1NATA 4KCGA 1PJ2A 4H6PA 3V1UA 1E8WA 2WNSA 4PEVA 2CZCA 4JOQA 2G5PA 1EFVB 2EP8A 3F4LA 2Y05A 4KI0A 4IP0A 3LG2A 2WXLA 2AGVA 2Y6VA 2I4RA 4EL0A 1ELRA 4IDOA 5HNKA 3IE0A 3AVQA 4PLZA 2VHUA 3EG9A 2PK3A 4UU8A 4DCOA 3HBJA 1HTTA 1E1CA 2UAGA 1ZRSA 4FGUA 4AS2A 3OLCX 1UOQA 2BTDA 4QOFA 1DZ3A 4GKKB 2D5IA 1YI0A 4X45A 1VPLA 4D3ZA 3EE6A 4EB8A 5CIWA 2XRZA 2QW1A 2BFOA 4XJVA 3U44B 1MX2A 4V0SA 4CIDA 4L7VA 3UMSA 1X81A 2OCGA 1OAAA 1I2MA 4OI1A 1U02A 5DWDA 3ZD6A 2ACKA 2VJAA 3DP9A 1TZJA 3BD8A 3DFKA 5K5EA 3CGHA 4ZZ2A 1RLJA 4YNDA 4DBVO 5KUTA 1JG2A 1EF1C 5J4HA 1THTA 2R7NA 2NZWA 3V00A 4CRWA 4AJLA 4XDZA 2XRYA 1C3OB 4HTAA 4JD5A 5MGBA 3QVKA 4LISA 3RT1A 4RTQA 1HMPA 1AZSC 1EVJA 3FUFA 3T1YB 4HDOB 3HKCA 4MWBA 4JB8A 3BCSA 4F6CA 1XFDA 2HMUA 3MBIA 1KZ4A 4A0RA 2Z56A 3WK4A 4H2DA 5KMGA 4Q19A 3LK6A 1EFCA 5FAXA 3EC7A 3FZNA 3CLRC 1XDDA 2HLDD 2CLHB 2XYGA 4YRSA 1Z0FA 4I1UA 1HT1E 3PQEA 1FB5A 3A6FA 3H8WA 5I8WA 4ANUA 1M66A 4G9EA 4S0XA 3ZDRA 4EY7A 3AUFA 3TECE 4H77A 2X4GA 3TMYA 2IPNA 2FZLA 4YMVA 1M2OB 3W06A 2FI1A 1EA5A 3HR8A 4YJGA 4J0UA 1SVUA 2AOTB 4O4HF 3HA7A 2WTUA 3BERA 3TVYA 3LQ4A 4BB5A 4EI8A 4EYSA 3BN3A 2GXSA 2X1HA 3WP1B 3B8EA 4OFWA 3T7SA 3S8YA 1AT1A 4Z4EA 3AI7A 1PWHA 4C21A 4G3XA 3ZBQA 4AZTA 5EJIA 3E2MA 2FMIA 3RYIB 1NNLA 2OY0A 4Q18A 1FC0A 4GI3A 2J6HA 3HDVA 1Q7EA 3ZDBA 3MCZA 3B3QA 3KAKA 3B12A 4D3XA 2H9IA 4TTRA 4GO1A 5F7JA 4BJ6A 1PJ3A 2G4CA 4CT4B 1R6VA 4MS1A 1IXRC 1Z5VA 4I1IA 3M7IA 4G2NA 1ZI9A 3VZDA 3REFA 4U5XA 3FGPA 1U2RA 2C8LA 4LBWA 3T15A 2L0IA 4X85A 3NCTA 4TYYA 2GS9A 1W4CA 4OHZA 3M4XA 5A3RA 3CNLA 1N52A 4D3DA 2VYNA 2CXNA 1OFVA 3F9IA 4TYNA 2YN4A 3TWUA 4UUAA 1MKYA 4B31A 3C3EA 1A9QA 1U7UA 1SUFA 1Y4ZA 4UNQA 3BBPA 4B0OA 5BT1A 3GNSA 3BGWA 2G71A 3IQXA 2XTMA 3HJFA 1TTTA 3W6ZA 2DFVA 2XUHA 5CB0A 4I1RA 3TL5A 4DCCA 2J9FB 2OGSA 3E23A 2QSYA 4C7BA 4EHKA 4MGIR 1DCQA 4I50A 4RVGA 2ERCA 3FUUA 1H6BA 3W1VA 2HRBA 4NRDA 1EM8B 4JJ7A 3AVWA 2P9LG 1MU0A 3EBOA 1Y1TA 3D8SA 4QO8A 4OO3A 2PLRA 1XU9A 1VLJA 2DPHA 5G4KA 5IN5A 3E9MA 4TUUA 3EDTB 1K4YA 1SXJB 2Q4RA 4YUYA 1L4KA 4NZNA 4JLMA 3FPEA 4KQ9A 2OFFA 4UHHA 1PHRA 4ZGGA 4XWGA 2JCSA 4R68A 5TIIA 5AW7A 4C0AC 2JJQA 4FHGA 3IAM1 3AEKA 3E8MA 1FSPA 4PN7A 2XR1A 5A6CA 4QAQA 4AJPA 4WKGA 2ZT8A 2FETA 2VGXA 1E9SA 1LSJA 1QHIA 3LX8A 1E6LA 3HLTA 3FBWA 4XZ3A 3NTLA 3WA7A 1YYHA 1HSOA 1M5RA 2OC9A 1PR2A 2EKQA 2J4CA 1KEPA 3HIZA 2QI9C 1JYEA 2ZAOA 4C7MA 3KHSA 5F4BA 2EFGA 4YWHA 2F4VB 1V45E 2YWBA 4LDAA 4L9PA 2HI0A 1KFBB 5GTDA 4S12A 2GPBA 2REXB 1D2HA 4XGKA 2QN9A 4IS3A 2CBGA 1E5VA 4BX3A 2AFIA 3HYLA 3EIWA 1IN5A 2RHTA 2FWMX 4H1HA 2H9AA 1JDBB 3D6FA 3QTTA 5EWMB 1UODA 4R5HA 2PMWB 3PD7A 1KC1A 4D25A 2O1EA 4HLUC 4QPJC 1TYQG 3PHHA 1PGPA 1GUAA 4YI3A 4OUKX 1N0RA 4DT1A 3Q7EA 1V16B 4XB1A 3GFOA 3GWGA 2D1RA 3DD5A 2ZANA 3Q78A 2ZUTA 3RADC 4AYTA 1Z8FA 2JFZA 5A0VA 4WX2B 1I2BA 4CGZA 4HR7A 1RZVA 2C0QA 2WIAA 1ZIOA 5LQCA 4A3SA 1T4CB 4N5QA 2GBCA 1S8NA 1E1RD 3D5TA 2WVGA 1C7FA 4PLCA 2YXEA 4FOPA 5AXAA 1LBQA 1M33A 4O4JB 3ZWCA 4H3HB 4INOA 3C7KA 3RIHA 1HM5A 4TRJA 1GQOA 2ZM5A 4FNMA 4I19A 3HCWA 4O8CA 3FD8A 3I2KA 1GT6A 1FFBA 1XCPA 1T0PA 5CXXA 4PBTA 3HDXA 1BN6A 4URUR 3Q2IA 3QWPA 3FWZA 3T4UA 4BMDA 2WAMA 4Y2VA 5DXAA 2WINI 5BNZA 4W7SA 3WGGA 5JNVA 2IIVA 4HPXB 2KMLA 1ZJ6A 5D2CA 4QLOA 2FSPA 2PT9A 3EQ7A 4TMKA 1XZQA 3JYQA 1XDBA 3IESA 2O4UX 4B84A 4N01A 2WFLB 4JU9A 2NO9A 4G01B 1E6KA 2C7VA 4O2RA 4HAIA 3X44A 3IQGX 1SG0A 3IAS6 3KTAB 4K87A 5HVNA 1CUAA 1OWLA 3AY7A 1CD5A 3GUCA 4HDKB 1MLDA 2M32A 4L8GA 4EW2A 3U1VA 1XRPA 1V8FA 3FUWA 1M7BA 1YQTA 2Y9PB 3K6RA 2A9RA 4MI1A 1WQ4A 4DG9A 3RBAA 2OGZA 2FPOA 4KH1A 1T8PA 3I9KA 3JZIA 1EE2A 3B48A 2PCJA 2HMVA 1YCFA 4AKEA 3VAZA 4R51A 1T4GA 1C3JA 2FPMA 2IXGA 1OXBB 3FVVA 3V1LA 5LCWJ 1Z5NA 4EI7A 5CFQA 1M1NA 5HBRA 1MVNA 3JXIA 1GCAA 2H5EA 5JA4D 3CHQA 4F6LA 3WK5A 1RVDA 1GZ7A 4LBYA 3RD5A 1QHHA 1WB4A 3CR3C 3EMKA 2IV2X 4NESA 3WHKA 4KO3S 2XUPA 4AJEA 3R8FA 5FA5A 3WLAA 2M2IA 1J90A 2V3VA 2ZI6A 3NOVA 2FMKA 5AQ7A 2OHXA 1LLCA 1VHTA 4DWOA 3QEKA 3DEIA 1YJBA 1FLNA 3E8SA 4NBUA 2XE7A 4IMJB 3U31A 3M6LA 1L5VA 2JIZA 2YY7A 1SZJG 1KDRA 4MS6A 4HVBA 3JASB 3IIKA 4NYJR 1DDIA 4Z2YA 4HS4A 4Q3DA 3ORQA 2ENUA 5GV7A 4NV1A 1EFPB 2Z5LA 4UFNA 4QBTA 4OJYA 1N95A 3ASDA 4CQNA 3EXHA 1HA3A 3KB8A 1NXOA 3T7KA 3H1AA 2SICE 4YECA 3VR6D 3E6AA 3CVLA 3FNRA 1X1TA 5FBVB 1LLFA 4UZFA 3WK6A 5B2EA 2ZJZA 3K1AB 1ECGA 3LJKA 5HCUA 4D8UA 5F35A 3CUUA 1DE0A 1RWXA 3QNWA 4I4LA 3KEQA 1TYBE 3PNYA 2YMQA 3BL8A 2C54A 5FOTA 5I7RA 3QVOA 5T3UA 4N5IX 2QU8A 2D2XA 4BFVA 4CCYB 1UBCA 1L8XA 3MJ4A 5JSHA 4DIFA 4DDUA 1VP3A 1NBAA 3ZK9A 1KE1A 2WV7A 1TN7A 4QUHA 3TW0A 3EIJA 4CN8A 3TQFA 3I53A 5C4MA 1CUWA 2VTDA 4MI9A 1ZXXA 5KYWB 1PVVA 2AE1A 3MRTA 1SUPA 3OZFA 2V59A 3NMUF 5IEJA 4H7XA 3LQRA 1VG8A 1I14A 4IX9A 4FU0A 1YJQA 1JG7A 1N6HA 4RVFA 2YJ4A 2PRYA 5B7GA 3RVSA 4UTNA 3P2BA 4N47A 2PWAA 2LAIA 1PI3A 2PS1A 5CCDA 1Z25A 3GUHA 5EKSA 1I5OA 1P29A 2OWEA 5AOAA 3RAUA 3OC6A 4MNTA 1QGYA 1QRDA 2F62A 2H4FA 5JAHA 3DZBA 2OP0A 2BONA 3MQ4A 1MXFA 2OHVA 5ILGA 4IIDA 2QRNA 2MYNA 3OZCA 3DO8A 3PHLA 1QH1B 3GRRA 2D1QA 2ZM6B 2I7VA 1DFGA 4PVCA 5HF6A 3SJ7A 4AX8A 5CCXA 1MJGM 4E03A 3QTBA 9ABPA 1AY0A 3NQPA 3FBTA 2A33A 1FPQA 3A6LA 2GWHA 5THXA 3EWIA 2H6GA 1LLQA 3BMXA 2X86A 2IWRA 4HGZA 3VJKA 1JG4A 4JYAB 2H63A 4FYKA 3A4VA 1CETA 5KSOA 3AVYA 4HWPA 3HV0A 1PEYA 3EFHA 3KAQA 4CMAA 1WXDA 4B45A 1GAXA 4B43A 2BUBA 2QN8A 1VPVA 2H4JA 2MSCB 2OGUA 3TZHA 4O1MA 1KO7A 5KNBA 2A84A 3I04M 4ZTZB 3KV1A 5CITA 4RQUA 3IBFA 2B0CA 3BB4A 4JV5B 3WV4A 1I94B 2Q9BA 1Q0RA 4W1SA 1YIDA 3QY0A 4WLFA 5EMLA 1GPJA 3QOFA 3SHWA 4HFMA 4OKIA 4WA7A 1BXRA 2P9PG 1AN9A 4PX2A 3T5CA 1JIUA 1BD8A 5CNKA 4J0IA 1FE8A 4NACA 4H0CA 2L18A 2IS1A 5EZYB 1RZUA 5EJFA 3ZWMA 1RPAA 2JC3A 1OFUX 1D07A 2PM8A 4YJ2F 5BURA 3W8FA 2GPJA 5M2QA 4WLOA 4Q4HB 1EYHA 4IINA 2P91A 4PWYA 1N4PA 1U2DA 3EHNA 2VZLA 3NEYA 1G3NB 4LCBA 1PQWA 1O9HA 3QQPA 4UCFA 2P2DA 2QR5A 2FMHA 4B0PA 2CVHA 4LGMA 3UHAA 2BM8A 1P0QA 2FPPB 3UB4A 3DE7X 3BJZA 3TR5A 1B14A 4WLNA 3RWMB 2BM9A 4EYOA 5JU6A 4QAJA 4BXOB 1DAHA 1ZD3A 3G2JA 1QGAA 1E0JA 3C3RA 3EC1A 1KSFX 1EX6A 1GQRA 3RO7A 3BWMA 1MIOB 1I36A 1VE7A 2WXGA 1UG3A 5TT1A 3B95A 2JAWA 3O92A 3VR4H 3A4LA 4QBKA 2I3ZA 3C2QA 5EMKA 2BMDA 4AN4A 1ESEA 4AZVA 1QZ3A 5JADA 4V1CA 2OHGA 4ZAXA 1VPEA 4Q9KA 3UC9A 3OZTA 2BEUA 3B3JA 4DLYA 2ZDQA 2M6KA 1XHEA 2RAVA 2FXVA 3LHDA 5A9TA 2HR1A 4BNNA 3HCBA 4HZUB 1GUBA 3KRTA 4F71A 4I3GA 1E6WA 1DBWA 3SCZA 3KOOA 1D2NA 1X7YB 3PJRA 4G26A 4ZIRB 3ZDDA 1EAYA 3UJPA 4E46A 3RWBA 3SY2A 4LXGA 1G5HA 4MEAA 3H2ZA 1RQNA 5TGZA 4I0WB 1XZHA 4C4YA 4DFDA 5IVKA 3IR7A 1Q14A 5D01A 5EE5B 5K3OA 4PNEA 5C0OE 2ZJ3A 2EKLA 2IHUA 1QYWA 5EYLA 1WM5A 2YVQA 3I1YA 2A2ZA 1IN7A 1DC3A 5HIMA 4QYIA 2D1SA 3ONNA 3BMQA 2UYOA 3BIOA 3A9SA 4W5RA 4FBGA 2NMVA 5I8PA 1HE2A 4JITA 1XE3A 3UMFA 3NOXA 1GTRA 2J5QA 3BTSA 4J0QA 2JKYA 1RKUA 4NMWA 3GC6A 4HDQB 1K88A 2B82A 2YNMC 2J31A 1E5XA 3L06A 2C7PA 1KORA 1UDCA 2X8LA 1H4TA 3D31A 4C3OB 1CF4A 4EL5A 2B21A 4WZBB 1XJWA 4JC0A 4EZBA 1YZYA 2WJJA 5GZ1A 5F7OA 5IBPA 4GYYA 3R7SA 3CC8A 3LT1A 5CCBA 3KB1A 3Q9UC 4HB2A 1DBVO 1NOKA 4D96A 1FDVA 1LBIA 3HJGA 4RTPA 1XTPA 4Y2YA 2IHYA 3ZQKA 2RKKA 4DIUA 3OOHA 2ZWIA 1EFTA 1IHGA 1WP9A 1Y80A 1PP4A 3EXFA 3B6MA 1G7SA 2WVIA 1NLMA 3V7FA 3CX3A 5CA0F 3GLHB 2FLKA 3EDMA 4I8XA 3MTQA 2DUNA 5COQA 3AP1A 3ED1A 4FS8A 1O57A 1FIUA 4N0EA 1JH9A 1C9JA 1SXIA 2ZBQA 2DWQA 4JXJA 2WD7A 4PCAA 3PR3A 4DV2B 3D8RA 3UUWA 3TNJA 4OQEA 3KBBA 1KZPA 1ENZA 5EZ5A 2RI1A 2WYUA 2HWUA 4FGLA 1FNNA 1QQ5A 4BT8A 1J8MF 1MB2A 3LMKA 2UKDA 3K6JA 4UBNA 5BN5A 4CM4A 4TKLA 3AR2A 3NORA 4OOFA 5EYPB 1TADA 2DBZA 1OA0A 5HA5A 2JEOA 2GM4A 3ETEA 3B36A 3LA6A 4CIYA 4ZO8A 3BFVA 5CFNA 3AY0A 1OX4B 1RRFA 3UO8B 2NACA 3C15C 1GKUB 5HJ2A 3PHGA 3MBOA 1F8YA 1HUQA 4J1NA 4P3NA 3E4BA 3IAM6 5CVCA 3R09A 2Y76A 3HUEA 1I0LA 3G8CA 4XDYA 1AX9A 4CKCB 1FCHA 4NL4H 3SZOA 3EGOA 3RKSA 4L2YA 1O96A 1GZ3A 4I8IA 1J2YA 2YV4A 3PKZA 1ACLA 3LUFA 4MDEA 2QI9F 3TUZC 2QM8A 1KY2A 1NVTA 2F55A 4MHSA 4GZMA 1WPXA 2F3QA 3QK0A 2GM3A 4I8DA 2X8AA 4WOKA 3GJ0A 4LDRA 3HR4A 4UWGA 1G8AA 4PW0A 1EUCB 4Y2TA 1FDUA 2BMVA 2OORC 3NNDA 4GMFA 5C35A 5CD1A 3RVDA 2YMMA 2KM4A 2B25A 2J3LA 4NOKA 1PUXA 3ICPA 1GILA 4R3WA 5IDXA 3C6YA 2DQSA 2CKDA 2IZZA 5LUAA 1G1MA 3GFSA 3FHCB 3N2EA 4BGEA 3WNZA 1UQTA 2WMNA 2XJ4A 1QONA 3R23A 4RKYA 2FSUA 4GYWA 1GVNB 3ILVA 5HQ3B 2Z0MA 2BJVA 2VHEA 4XVCA 2OB1A 1YGYA 2P0YA 2IUFA 2OCDA 3N2NA 3OVMA 5ALJA 1P1BA 4ZN6A 3ISVA 3E4CA 3CKLA 3FYDA 3UCEA 4G5FA 1ZRNA 4Q34A 3ON5A 3PTAA 5EUQB 3PUXA 1J7JA 5A6SA 4B6OA 2AC4A 2IVFA 2BMWA 4J9UE 4FXPA 4YMLA 2PRZA 4UPEA 2EFJA 1ZHFA 2LO6A 3DBRB 3QFHA 4YGXB 1Y48E 2YHSA 1BXKA 4OF4A 1UQUA 4R1SA 4PYMA 1Z07A 1OVGA 5CLLA 2ZBUA 5FQ4A 2DHCA 1KVUA 3ETCA 3RYCB 2R6ZA 4UM7A 3SFXA 3HKEB 1JAHA 3AS5A 3AB8A 1U3GA 1OY3D 2XOEA 4BQRA 2V3WA 4MJLA 1Q77A 4BMNA 5GJBA 1CR6A 1HFJA 1Z3XA 2LTAA 3ZW8A 1WCXA 1V47A 1FNBA 4ZT4A 1RXWA 1NBOA 4UI9J 4MV8A 1YK0A 4BWYA 5E8RA 5JTTA 3KLNA 3ES9A 3R3VA 5JRZA 1H19A 1GNPA 2ZU6B 3SZGA 1WD5A 3FXAA 1KZGB 1GL7A 5KOIA 1V1RA 4M1SA 4MARA 4TVKA 1E1QD 4ZREA 4JI6B 2ACWA 1KS9A 1GG8A 4FE4A 1JLSA 3ELUA 3EGEA 3WBFA 3DFUA 1N5OX 1OKKA 5IW8A 1YCDA 2I4MA 4FR5A 2BEVB 1ZM2A 4E5YA 2CVOA 2FN4A 4RFSB 4JA2A 1SD2A 2ZT7A 4QYMA 1NZDA 4TVBA 2AIRA 7ABPA 1ZLYA 1P0PA 1YONA 1Y8RB 3ZW9A 5AXBA 5SY6A 2ZIGA 3B1YA 3UG6A 3GMIA 2HIMA 3C3BA 1TF5A 4BV3A 1WPQA 2B30A 1NQXA 4RHXA 5JR3A 4RK6A 2R2AA 1DRWA 2QMZA 3KSAC 4J43A 3P0RA 4KV7A 1YBFA 4DQVA 3R4CA 1AG9A 1VLVA 4U7WA 1WG8A 2TYSB 5ECDA 4HQOA 5CVEA 4ZZIA 1E64A 1QCZA 4ER0A 2QSUA 5EZQA 3R4VA 3U4QA 1RU3A 4EY4A 1AQNA 4K05A 3WGZA 1D2MA 4F96A 5EMNA 3DE1X 2BY4A 5CCEA 4TRNA 4WNEA 5JVDF 1FQKA 3C6MA 1DKRA 3KIPA 1YUNA 3G2KA 4ZCSA 4K6FA 4A9AA 1V37A 1L4EA 3TTTA 2WUDA 2BTOA 4GPBA 3UKUG 1FTQA 1R9NA 2IF4A 3HCRA 4DLPA 3JD3A 5IAAA 3FHLA 4Z3KA 4PNPA 1ZJYA 1NVVQ 2E9SA 4NCXA 4UHJA 2AFIE 1P6QA 3N28A 2FMFA 1EJBA 1H1LA 3MGAA 4LX0A 3RRJA 3CKMA 4N9QA 3OG9A 4FBLA 4K6MA 2Z4SA 5J2TF 1NXWA 4EO9A 4YRAA 1SURA 2ATEA 4YXWD 4FOSA 3PPYA 2BKXA 4JOBA 1Z45A 1WMSA 2OHIA 5KB3A 5HW0A 3DXYA 2OYRA 5EMJA 2D59A 4MAAA 3MG9A 5H59A 3ZDCA 3ZKWA 1VKOA 1NQOA 3GZNA 3JQAB 3WJ1A 2XGSA 3OOEA 3VTYA 4LJ9A 1XPOA 1ESDA 1F0PA 3G89A 3JZMA 1Q95A 2B1GA 3GMDA 1IONA 4M9UA 2P2CP 4BV8A 4DV1B 3V2HA 3VDQA 2YVLA 2B7BA 1XV5A 3RUFA 3DSSA 1E2LA 3ZCVA 2YHEA 3LLMA 5A4JA 3YASA 4BJHB 2XGMA 3CVVA 2QBYB 1N3IA 4QULA 2BR5A 3VQTA 5ESWA 1P9NA 1SM4A 2AW3A 3ZKJA 3RVNA 3O1HB 1BI8B 5C31A 1V25A 5JSZB 2RKOA 3RG8A 3LUAA 2VSFA 1JTFA 3JYLA 3PEVA 4RY2A 2XNSA 2OEVA 2HQBA 4CYMD 2XYVA 4TWAA 3KZVA 2QD5A 1JLHA 3RFCA 4D8TA 2LRHA 3AUJB 1D9SA 2XWQA 1NWCA 4ZA2A 4BECA 4QECA 4DDVA 5FI3A 5HFJA 3TXXA 3LRPA 2Z98A 2ZB7A 1Y8QB 3MCUA 3O4RA 3DZFA 4AP2A 1X7HA 5J63A 4OQQA 3KQSA 5AJDA 4M55A 3LTEA 1ZGJA 5CTJA 4HLNA 2V6JA 5AVSA 2AJAA 4N3BA 3WL6A 3I92A 4FCVA 4KWCA 3IBYA 3WMXA 2PKWA 1J9GA 1NA5A 3FSJX 1WTAA 2J45A 3T5BA 2IPLA 2PSJA 4OL9A 5IC6A 1YMPA 3K5WA 4KLRA 1QB8A 4OYSA 3A1TA 1EZZA 3EB9A 4QU9A 1RLOA 2P75A 2HHCA 4DCPA 1U9IC 1RT9A 4Y8VA 4EWLA 5KBAA 4QXRA 5DVZA 2EIKE 4BWVA 1XLWA 4WUYA 2XE4A 4EA7A 1QYIA 5DLPA 4CN9A 4MW2A 2A0WA 3BRWD 4DRXB 3ZC3A 1N3LA 4FJ2A 4E15A 3ESDA 4Z0HO 3ZHVA 5DHSA 4KXLA 4BVLA 1MB3A 1FU8A 2OA0A 3QIVA 3JQ6A 1VZ3A 1NJ6A 2MMGA 4JLPA 2B20A 3LH5A 1E2PA 1JG1A 4UUMA 3B1ZA 2CXPA 1DAEA 4U7DA 2GCOA 2O3JA 3DTVB 1V8OA 1BJKA 4FHJA 3O3CA 1NP7A 1TZBA 2OV3A 3E3NA 5KWJA 1OTXA 3HA2A 2QQ0A 5HGJA 2WXOA 3MCAA 3CHOA 3SEZA 4IICA 2OCLA 5B57C 5IDQA 3L6BA 3ZNOA 1HORA 1IK6A 1ZCJA 1C0PA 1O4WA 4CKEB 3WDKA 5MN6A 2DPXA 2G9NA 4G1FA 4PAGA 4DGQA 4HDMA 3QYAA 1G59A 4Q9IA 4EHIA 3PXAA 5TPWB 3FAZA 1OI7A 4YJ3B 3IEKA 4BPBA 3HXEA 2H57A 4WWNA 1CXZA 3P2OA 2ZSEA 2FDXA 3KZXA 1TEXA 4ZRMA 4IF4A 4YCAA 2ETBA 2FWPA 4FLFA 5D85A 4ONEA 3L0CA 4BNTA 6PFKA 5BPPA 1PFYA 1PBNA 4OHWA 1JSRA 1GUDA 5FBHA 1R0XA 4IFIA 5I45A 2QY6A 5TC4A 2W0MA 2GSDA 4Q6WA 4FEAA 2NVUB 3VYVA 1QIHA 1XP5A 2I0FA 4LBVA 3EVZA 4UQXA 2IELA 1T6NA 3SKVA 2VSOA 1J8FA 5LKAA 3PC4A 3WWZA 1YSCA 1HF3A 3R9MA 2HO4A 2WF5A 3AVPA 1DBQA 3W5CA 3ELBA 1X9HA 4WH0A 1CRQA 3A37A 3VPFA 4WNAA 3ML9A 1JIVA 5FTJA 1JZTA 4I1MA 3DMHA 2AS0A 2JLRA 4YRGA 5DLDA 1B00A 1Z0UA 4MUAA 3ZHBA 2OCKA 2ORYA 2DOKA 3L8HA 1QE5A 1T3ZA 5JATA 3IIIA 3F8SA 3P0EA 5IYZB 1GTJ1 2JIBA 5DOVA 3D9KA 1IHUA 2CFOA 3RARA 3MD0A 2H4YA 2P2LA 3KTDA 7REQB 5DASA 4EMUA 3THYB 3K1YA 1NBWB 3WDLA 1OXUA 3VH4A 1Z6AA 2XS8A 2ATVA 2YMPA 4G65A 1C9EA 3WOVA 2ZSBA 3FPLA 3ZI7A 3HVJA 3H5AA 4AMBA 4ND6A 3UOGA 1A8SA 1HDRA 3H99A 4RL4A 4U0ZA 4FZRA 2QM7A 2BMFA 2WKSA 3GA7A 3KUCA 5LQRA 1UDRA 5K8LA 1RXIA 4P7GA 3BWDD 2DLCX 3NC1C 4QVIA 2F6RA 4N2QA 4DQXA 4M1YA 2VAWA 4CDGA 3LLSA 2PZBA 4DMRA 2C82A 1Q1ZA 2WIBA 4F6RB 1CY0A 2GRQB 4J9VA 3THWB 5L9AA 1SKBA 4P22A 4GM1A 5KNDD 3EU9A 3MTAA 5HI7A 3RIYA 2BMAA 1JT9A 4WKCA 2AG1A 1IDOA 1E3EA 1VIAA 4DSOA 4G67A 3D6UA 2QM3A 3ORSA 5LQNA 3T34A 1U8YA 4FKMA 3FWYA 3CEPB 1RI4A 1MIHA 5KX5F 1G19A 1Y1SA 4V3IA 2PKRA 4YB8A 4RJJA 1LWNA 4UHFA 4A23A 5CVVA 2WG0A 3ZHXA 1PX2A 2RK4A 3QLVA 4AG3A 3HBNA 1EFLA 3L7BA 5CX1B 3QEMB 1X7WB 1C80A 1A27A 2F43B 5BYKA 2HSWA 4EECA 5A4KA 2FGKA 5FFFA 4AIIA 5TGDA 1P75A 3WSVA 4BY9E 1ISMA 4CLHA 3AFNA 2BFEB 1JQLB 4XLLA 5BSWA 2GCGA 1WXWA 2FEPA 3OFND 1XVVA 4R9VA 1DWOA 4LSGA 5LCWC 4K1XA 3UM2A 3O0TA 2ZJ8A 1SBNE 4ME2A 4YLYA 3NHKA 2FH5B 3VVMA 2BPOA 4UBMA 1ZXLA 4NDZA 4E33A 2FWNA 1LBEA 3F5DA 3NOOA 3EQ6A 3MT8A 1OT3A 1T0IA 1UPUA 4GC9A 1F6BA 4GS5A 4TV8F 4G2TA 1YH3A 3TKYA 3D0OA 2FW7A 1LI4A 2CDRA 4B7XA 1YS4A 1MAAA 2P9FA 1MOQA 4ECEA 2WM8A 5BQXA 3L8ZA 5E7MA 5EL0A 2ZUEA 3TINA 2O3TA 3WICA 3U60B 8LDHA 4ZCMA 4WZ6A 1FTYA 3OQ1A 1T5BA 3S27A 1LGYA 3QIAA 4YAKA 2QAGC 1FS4A 4S04A 1U63A 1MB9A 3LCAA 3TLBA 1SCBA 3MKQB 3N76A 4WN3A 3KHKA 1XYVA 1L9XA 3FOFC 5AVKA 2DTXA 4C04A 3HJHA 4X8MA 1M3SA 5E3JA 1I3KA 2XKBA 4KGXA 5L4LA 4UWLA 5LQSA 4NYIQ 1FDTA 1JWGA 3TMKA 4R05A 1UAGA 3EMBA 4XOUA 3NHZA 4ZT6A 5DYTA 2A9VA 3AWIA 1O77A 2UVDA 3DV0B 1JALA 3KPUA 5BQOA 5EKTA 1K4KA 4GTSA 1O03A 5FR1A 5SZIA 2ZKLA 2EXXA 3E1KA 4AIRA 4I4CA 2X58A 2NO7A 3A04A 1SU6A 3WQQA 3HG7A 1YIAA 4OQYA 3OJLA 1E3DA 4HRLA 2WHPB 4FYPA 4DV0B 3S1LA 3BSFA 4R2XA 5IN4A 1MBZA 2QG4A 5AVUA 1U99A 3Q4AB 2YJTD 2HC9A 1ZPDA 2VSNA 2XA1A 3D1JA 3VR2A 3TW4A 4RETA 3BK1A 1YVPA 3PUIA 4YX9A 5E6UA 4U1RA 4YUVA 3PIRA 2O07A 3IT1A 3DP7A 1RTKA 3GEMA 3H7AA 4HDCA 4OV6B 4E6EA 2MYTA 1RYMA 1HE8A 4R54A 5DT9A 1M6NA 2AKYA 4QQ8A 3NS7A 3LOUA 1ZA2A 2ZQYA 3OOWA 5IP5A 4ZAFA 1RDFA 4L73A 4B3MB 5DKFA 1ZCZA 5H4HA 4C2UA 4JI5B 2AZDA 2NV0A 3SBDA 1LF0A 3TWSA 1EVZA 2FKAA 3F3SA 1ADYA 1US8B 2FJ0A 3VKGA 3I64A 2JVJA 4JUDX 3BXGA 1ETHA 1C8BA 5BP7A 4E5PA 5F5LA 1BKSB 5HUHA 1CEXA 4L15A 4O2BF 4X1YA 2BAGA 1RADA 3TFQA 2SKDA 2UZ4A 4GX2A 1CUZA 1U65A 5EIBD 4G97A 2JABA 3DE3X 3NC0C 4M7PA 1GG9A 4REQA 1UMKA 5LQAA 5CB4A 3P2IA 2XCOA 1NJGA 1A9XB 4IXWA 4XRGA 3WXMA 3ZXUB 3R9KA 4NG5A 2QVGA 1YE5A 3FETA 4GDMA 1UXKA 3U5ZB 4MUBA 2YZ7A 5BSRA 2OBNA 1E5TA 4RJTA 4PFSA 3VNVA 5JSFA 3CRZA 1VSVA 1ONOA 3BJIC 1LY1A 5DK4A 1ODTC 2AXEA 1UZUA 4NAUA 1T5TA 3AETA 1VGVA 5LZ5A 2CHZA 2RBGA 3I9JA 1VJRA 5JJBA 4IIXA 1CJCA 2AF3C 4TS3A 1RXUA 4XOIA 1JR6A 2OQVA 3X2FA 3L08A 3TW6A 1AGYA 4WAUA 4L1KA 2A35A 4ZODA 2BYTA 1QVAA 5D0QD 3UW3A 2XCTB 3TTYA 4X62B 3HJCA 4ZD6A 2O2CA 1MVOA 3AL0C 8ABPA 5IUNC 1GSAA 2I55A 4ZXFA 2HXSA 3WB2A 4HNRA 1JXOA 3AEUA 3MV3B 4GI7A 4HXEB 2FR8C 4MRSA 5TVKA 4V03A 3MOGA 5IMBA 4KXNA 4KXQA 4XH9B 4F5EA 1DQNA 3OEEA 2YMLA 1ODCA 3BA1A 5L45A 2FP3A 4G8KA 2ZPAA 2XXAB 2ABWA 5K03A 4QFVA 1HLFA 4C14A 3J5QB 1YCGA 3R5HA 1F6DA 3AILA 2OCAA 1FU7A 3RIGA 3Q3JB 4Q5IA 3CY6A 2JLYA 3TLCA 3IELA 4M49A 4BO5A 4NE2A 4O2LA 5AKXA 1G3QA 3CT4A 4BDSA 1D2RA 4RTJA 3HA5A 2HLPA 4D3SA 1EP1B 5HKOA 4URKA 1TVKA 4LK2A 4Y6PA 3DEZA 4UM9D 1N6KA 3SHOA 4L7TA 1ZN7A 5C51B 2Q28A 4PNHA 4HLCA 3PITA 1EINA 4N5LA 5CRUA 3UJ3X 1MUUA 1DINA 5G1PA 1AKNA 1ZBDA 2HJRA 2RHWA 5THQA 2C9OA 3HPRA 2Q5QA 3PJFA 3KQNA 3K32A 2Y66A 3QVUA 3AJ9A 2Q3BA 3BG1B 1H1TA 3DQPA 1M2EA 3RYFB 2PIAA 3ORRA 1XK6A 4LDNA 3NT4A 3WWCA 1CZLA 4ICIA 5B58T 2ISQA 1IEXA 3C8UA 3ID6C 2NZJA 4NJOA 2O48X 5FLXA 1N1MA 4AX4A 1KDYA 4M0EA 4YRDA 3KHTA 4EY5A 1JHDA 3RRNA 5IC4A 3COJA 4WFJA 4AY6A 3HJTA 3ICVA 4BB9A 1MC8A 4RZIA 2I54A 3CTMA 4I14A 3NASA 1KEEB 1I7SB 5JEEA 1LPSA 4RZQA 8MHTA 1U5BA 1M8PA 4LSZE 2CB0A 2JD1A 3TOSA 3ER8A 2GYWA 1JHPA 3NV9A 1H9AA 4DJJA 5FWDA 2WHYA 3WRYC 3IRUA 3VTKA 4LJ5A 1E2EA 2FEZA 4LAFA 4JLWA 3DNMA 3NHPA 4GE3A 1OBCA 1E1LA 2LAHA 3A6DA 3W4JA 1MC5A 2FN3A 2CDCA 1C29B 1TVCA 5C5EA 3OLVA 3CPSA 2YXPX 2XZOA 2O2EA 3RQSA 4B4WA 2QTZA 3KUUA 3U49A 1CS0A 1P73A 5CAEB 4IIJB 4F60A 3AG6A 1GKKA 4DZTA 1ZNXA 4U8HA 2GJSA 3U1TA 3WMWA 1NSTA 2O5EA 4BB0A 3ESBA 3RU3A 3TO5A 4Q4AA 4CI0B 3IAHA 2VPZA 2RMKA 2HR2A 2RB4A 5AI4A 4JVSA 2X7XA 3SS8A 3AU5A 2H4ZA 1VHLA 2FP4B 1DIBA 1C7EA 1YKSA 3IPRA 5J4VA 3OZ7A 4G1VA 3CV0A 3PZ4A 4R8KA 1T9ZA 1KO1A 2QTCA 3G2SA 4NG4A 1ZNQO 1Y4SA 4OHCA 3OCVA 4QHSA 3KT6A 1M72A 3T7CA 3MTJA 2XD9A 1LRKA 5JAQA 3BH7A 1TC2A 2X3YA 1K7SN 4PWZA 2QTHA 4MA5A 4Q02A 3PUJA 4DA6A 3UGKA 5JXIA 2BC9A 1U98A 2W2NA 1P0IA 5A4AA 3IURA 1J99A 1MAWA 4YROA 1DTWA 2I34A 2PX8A 3DXZA 3LS8A 2H08A 3JQFA 3ZU3A 3VNUA 1IY8A 4FR2A 1PJLA 2H3HA 2CVPA 1EQAA 2WHQA 1WDTA 4TLBA 3K0AB 2FPIB 5DF1A 5GONA 2PL3A 4PLTA 1JIJA 3QM1A 4URWR 2CDAA 3SSNA 3MJHA 5EHGA 3G1TA 4RK1A 5I7SA 3QP9A 1TNZA 5GOZA 4GZCA 2W2OA 4CODB 1ZUNB 3ZE2B 3WMEA 3FPFA 3AVXA 3A9UA 1TM4E 2NWQA 5DHPA 2IC5A 5DN6D 3LP8A 4XCQA 4N7JA 3EXG2 1IOZA 4W9NA 3D9JA 4DCVA 2RHJA 2ERYA 2AYZA 3O8OB 5DI9A 4X90A 3E0XA 3NHWA 4FADA 4B85A 3Q7SA 4AD8A 3USCS 3SX2A 1HDYA 4A0HA 4MQUA 2VPIA 3V3TA 5AUPB 3HQ4O 2PG3A 1K1AA 3MFYA 3S28A 1DZIA 3ZLBA 2JEKA 3S7DA 2X6RA 3L9WA 4MS3B 1J24A 3GJ7A 2ADOA 3HB1A 3WWPA 1DDGA 2EW8A 4KIFA 3ACBA 2CEAA 4HQRA 4NU6A 3FCOA 3GJRA 4O4JF 4TUYA 3O1LA 1TNDA 4AS1A 3UWOA 4CQLB 3QLUC 4AAYA 2DBRA 5K1ZA 3T8MA 4HN4B 1JQJC 1PDVA 5FUMA 2WT4A 2YFYA 2WXKA 1XMVA 4BVHA 3ZFWA 2HWYA 3JUEA 1ZX1A 2NPIA 3A26A 1L1EA 2IYNA 3QHAA 1QV6A 4D80A 6ADHA 3O48A 5IAEA 3DMTC 3HFJA 4DWVA 1GGNA 4WK2B 4KN8A 3QDNA 4NEGA 3R24A 2WQ7A 2IUUA 4NJMA 4OLHA 2AJLI 1PN3A 1ISIA 1DBIA 2WJIA 2ZKIA 4P36A 4KE6A 4GTQA 3D9HA 5IHXA 1O9GA 2EIJE 1X1AA 3LTNC 2DETA 5LZ9A 2WC1A 1AQ6A 4XW2A 3ND5A 3UGQA 1RW4A 4EKIA 3SVLA 1KFEB 2ZRMA 3MSCA 4CLOB 4KAJA 4GF5A 3A3PA 5HRCA 2HCJB 1K89A 4NABA 3E3LA 3QFFA 4ACAA 1NYQA 3GJZA 2EARA 4HL6A 1XMXA 4JQSA 3RFUA 4FYWA 1R8SA 4UI9C 2F64A 3Q5DA 3PRZA 4L50A 5AI5A 4LXHA 2QUZA 4LYHA 1VBMA 2ATXA 2VZ9A 3SJBA 3AZPA 2C1EA 4PQFA 4M0MA 5FI1B 1XQVA 1N5MA 3SN6A 4JXKA 2M63A 4KG7A 2C3MA 3PICA 4JB2A 4IJ6A 1FSFA 3Q5GA 3LP6A 1JEYA 2XAUA 4E4YA 3LHKA 2XPZA 1PAQA 2OEPA 3H75A 2DGDA 4EB6A 3SOZA 3ZOZA 2IYQA 3HPQA 3NNNA 3QENA 3CNQS 3QV1A 3AOGA 3ZE7A 4Q01A 4MKHA 3CNEA 4MVJD 1YO6A 1FFXB 4QPZA 1Z2DA 3QWIA 5JV5A 2Q5CA 3TH5A 2C77A 4PIPA 2AK2A 1W2WB 2H29A 4FD3A 3JQ7A 3H9BA 1PL6A 2YINA 2IS4A 4W6QA 4A0SA 2GI4A 4JL8A 4KSBA 2EJVA 4BIMA 1Y9DA 4ARAA 2RHDA 4QDOA 1QKKA 3REQB 4E11A 4YDEA 4HS2A 2DJ5A 1C9KA 2QTGA 3GDGA 3G2LA 2XT0A 1O4VA 2VNSA 5EIWA 5IM4A 3ZY2A 3T9KA 3G9UA 1RYFA 2WXFA 3UT5A 1E7WA 1PJZA 3NHFA 2D7CA 1BVRA 2VSOE 1PR5A 2EATA 1LZLA 2YHIA 4KTVE 2D4HA 1J0DA 3FCUB 2XUZA 4FFPA 4E12A 2X9NA 5CTAA 1KYVA 2RHCA 4JIMA 4MGZR 4DUZB 4OIFA 4CVNA 3I3NA 2IFTA 3JQGA 3CVUA 2WM2A 4H7EA 2QZ4A 3RG2A 4RIEA 3N5CA 3I5AA 3E1SA 4X8HA 1H4VB 2R60A 3HDTA 3UFXA 2FSVC 2IKSA 4RGBA 3DSVA 2PS0A 4C4SA 4DMCA 4HTFA 4I08A 3IFSA 3NDJA 3MAGA 4CGVA 1XKLA 3I6BA 3RIBA 2MCFA 4ALIA 4ZOBA 4DCJA 2BZGA 5BXQC 4NYMR 4F11A 3SBEA 2IUTA 1RZRA 1U4NA 16PKA 2GEBA 3ZJUA 1T2DA 3AY6A 2BFDB 1XYGA 3EFBA 4FGJA 5J4LA 2DPYA 2P4EA 1ZMRA 3OPNA 4YJHA 2YJNA 2CB9A 5EAIA 2VJOA 1IOWA 5F21A 3G7SA 3GN1A 2YV1A 5IZCA 1U28A 2F1IA 3ZVVA 4JI2B 1U3FA 3HLKA 1YZHA 1ISPA 2C5SA 2XCRB 5AHOA 3PGJA 3KXIA 1INZA 3C4QA 1YBVA 5D7BA 3H9EO 5BUCA 4HAYA 2C2MA 3FTQA 1S2LA 4IQ4A 1P2FA 1V5EA 4IUDS 1WG0A 4LOKA 1J49A 2Z08A 4Y1RB 3TLEA 4ZV4A 4YPOA 4OHYA 2Q7OE 4LFAB 2XCQA 3UPDA 5DGCA 4UEKA 3VHLB 4XASA 1NLYA 2J8SD 3OD5A 3R3ZA 3TE6A 2W2XA 1IULA 4LPSA 1KJWA 2VCYA 5B3KA 2ONKA 4MUGA 4V24A 3W3AD 1BWPA 3CEAA 4IIHA 2RI0A 2V96A 3TWVA 2IOFK 5CH8A 4BBJA 4W9MC 2FN7A 1RNLA 2IUSA 2I7XA 2MMCA 4RF5A 1MEOA 1RWNA 3EVAA 3TTSA 2OZEA 2HA0A 1GFZA 2B9EA 3Q3GE 5AIAA 1M8FA 4FOLA 4UMFA 4B32A 1RYYA 2PMKA 4LRWA 1NAHA 1UPXA 2XNHA 2ETXA 4HD8A 4LECA 5FPHA 3U4HA 4RKWA 3FTNA 3P9ZA 4YHHB 1JILA 3BHNA 4PICA 2VPXA 3EZXA 4QO7A 3WTCA 2EYUA 2RBKA 2ZBEA 5EZYF 1SKYB 1TD1A 4NBLA 5DBKA 1P1RA 1YC5A 4FSDA 5IDWA 4NS4A 5LWHA 3SE0A 2GJ9A 1R3UA 3RVQA 3HCAA 2H52A 1SB8A 3PT9A 2P40A 2XUDA 2P9KG 4EHLA 5F1KA 2QE7A 2V7BA 1WUIS 4BAUA 3N05A 3WHLA 1V11B 1ZNYA 5ALWA 4K8RB 3TTVA 1R8XA 2JI7A 5BPFA 3E32A 3VHRA 3K4HA 3LC1O 1MP0A 5LOZA 1XZGA 1VFPA 2X15A 2ZWAA 2B1IA 4Q7JB 3ANXA 4DG5A 3ABLE 4OK5A 3P4YA 4RV4A 1ZI8A 3VSDA 3AERB 4IRXA 3AFHA 2WPNA 4N3CA 1KBOA 4L72A 1WUYA 3K70B 3TUJC 3H9GA 2GXUA 4Q82A 3NWBA 1X0XA 1NDQA 5I7OA 4OJTA 1PSDA 3FF4A 1QOPB 4E2FA 4UTOA 5E6SA 8ATCA 3D3QA 3SBTB 3HXBA 3LCVB 4TYMA 621PA 2VGYA 1Y4DE 2ZEJA 2R85A 3K2QA 3RJZA 5DCLA 4J16C 1I2ZA 2GPWA 1GXSA 3MRVA 4C6TA 3IYLW 2CXUA 4X8QA 1GVHA 2NUTB 3SQLA 2OMKA 4B3DA 2AOVA 4EG4A 1SBYA 5IMSA 4PCUA 4OYRA 4OH1A 3L4BA 4MDFA 5JECA 3D8NA 2W2KA 1QCYA 1NE2A 3R0IA 1KJ9A 4N7BA 1F51E 4A8JC 5B3LA 1QS0B 1Y98A 1Z6YA 3V8MA 2VHJA 2C0CA 2JLUA 2BE7A 1X3SA 4LNBA 3GT3A 4OVVA 2W22A 4NICA 3K35A 1W36C 1XNGA 4MRNA 3O4JA 1LPBB 3T3HA 2H85A 2WJWA 3NALA 3IBCA 4GA2A 5HKBA 5AVYA 1Q22A 4GR9A 2VP3A 2Q6LA 2DWPA 4W9RA 1KMHA 4OXIA 4A0FA 3I8XA 1NNSA 5JTUA 3AI3A 2VDWB 3LFHA 1GLVA 3ZHZA 1XJ5A 2V6GA 3IDSA 3WFZA 2BD0A 4I4TA 2VBIA 4HX2A 5AUOB 3ZGOA 2EC5A 1I8TA 1OAKA 1PT9A 4OQXA 3LC7O 5C1DA 4TLCA 3IODA 5K6RA 3ORHA 5AHKA 2I1JA 1ML4A 4O4IA 1YR2A 4JN6B 1P2UA 3U4TA 3U4IA 4ESVA 2VAVA 3QB2A 2C31A 3WNCA 2PFGA 2YJ3A 4AZ3B 4EY6A 1O0CA 1CZRA 2WJYA 4G07A 4QZVA 3U16A 4D43A 2IYVA 1LU9A 2C1ZA 3B78A 4AXHA 4IXMA 3ZTWA 2OSVA 1LXCA 2IJGX 4YMSA 3R40A 4UVIA 3KL2A 1IUPA 1L4LA 3M1IA 5ER9A 1X77A 1M10A 3AJ8A 2JGJA 2V7VA 3CKKA 4AULA 4UHCA 4CLXA 3E22B 1DNPA 2P9IG 5EP1A 3ONLA 4DUPA 2Q99A 5BVHB 4HDRA 3UKJA 1XMPA 4W82A 5C8XA 4FFNA 4UZEA 2X9GA 3CLHA 3IMCA 3JUIA 4TXMA 2G63A 1DJNA 3SF4A 3NHSA 5H3LA 3DLCA 3CWZA 3N2KB 3VR3D 3OE1A 1QIJA 3V1KA 5B1AE 1Y8AA 2NM0A 3S1AA 2C2ZA 1UT6A 4KWIA 4GPD1 2NSYA 4S0ZA 4R71A 4GTMA 4RH3A 2HNBA 5EYPF 2HL6A 2J49A 4BNJA 1QTQA 2FBNA 1BHQ1 2WZQA 3FLBA 2WQHA 3DLIA 1T8YA 2ECOA 4ZHQB 1CQIA 4NURA 2NUAA 4I1OB 1ZCFA 3F46A 3AG2E 1CW2B 5DH9A 4RZ3A 4PG6A 1H2UA 4QFDA 3FPAA 3LYLA 3PQ4A 1SCIA 4LA4A 3CZQA 1TFUA 5G3YA 1Y3AA 5HJ5A 1OW3B 4TLEA 2PX0A 4POAA 1GYPA 5AOVA 3ADBA 4EVQA 1BMQA 4G8JA 4LSZA 4FE3A 1HI9A 1TAQA 1GW6A 4JCOA 4XB6B 3ETNA 4LCJA 1UM9B 3DHWC 4LVOA 3FKSD 4D97A 3AIKA 5FL7A 4OQMA 4UARA 5CK5A 3EXIA 1W4LA 4F4DA 4AF6A 1GYRA 3BIFA 1S8FA 3QKRA 3EA5A 4YASA 3KXPA 5CBOA 4DDKA 4BCCA 1YAHA 1JSCA 4MR9A 3VR6H 4GXQA 4G5OA 1E2FA 1KQGA 4XVRA 2ECQA 1L5FA 4KYTA 3REOA 4GOLD 3TM5A 3P27A 3Q0TA 3RVMA 5SZKB 2ZXEA 1WEHA 2MYUA 5CFOA 3T61A 1YFLA 3VKVA 4NZMA 3VO8A 4C7JA 4IIFA 2WU1A 4IZHA 4AM9A 3ZY5A 2DY0A 4J91A 3ZBPA 1B3BA 2AW5A 2XQ0A 3TIVA 3DXMG 1CVIA 4ASUA 5EG5A 2BDEA 1GTVA 2V5FA 1XF9A 1WBJB 3UXHA 2G5CA 3RYHA 1NW6A 3CRNA 4URFA 4FLMA 3QBTA 5JSQA 4B2YA 3NB0A 3SHTA 2GERA 3GLKA 2Z2JA 1XDSA 5AK5A 2PRIA 2P65A 3SM3A 4F3VA 3QK7A 4PSCA 5BUQA 1NLZA 3L1HA 3EUVA 2RONA 5FL3A 4LWOA 2YX1A 4MYTA 1E9EA 1UBUS 4M7RA 1Z5WA 3FDHA 2ZJ0A 3P9IA 1QH0A 1T5DX 3LHFA 3AR6A 5ALSA 3PTLA 3IPXA 3R9IA 1K98A 1ZOIA 2GHRA 1DMSA 3EDRA 3F98A 4Z53A 3WKDA 1RMQA 5B36A 2WVHA 4R0MA 2OC4A 2QX9A 3W6OA 3ZE1B 1IZ8A 1RS0A 4Q1DA 1Q91A 3T3IA 3PLAE 1GARA 4EHJA 4QKQA 2JAQA 3EPJA 4P7BA 4IDNA 5AM2A 3OM9A 2V9PA 3SYNA 4NZYA 2AYYA 1KTIA 1UL1X 4AUKA 2GRJA 3COWA 1H85A 1NN1A 3D4BA 2N9UA 3DCYA 3WGNA 3E48A 4DR1B 4PS0A 5U1PA 5C4GB 4FYXA 4LPKA 3QVWA 1LBHA 1R0YA 5CFZA 4L5CA 5DEIA 1N7HA 2X8BA 2AOUA 3UHFA 1ECPA 3OX4A 4LYJA 1Z34A 5AP9A 1GKIA 4PGHA 2YL2A 3AHEA 4N8DA 1U31A 4YDHB 4FJZA 4XARA 2AX3A 4PQGA 1E2MA 1I4LD 1MX3A 5J5CA 1Q11A 4KDFA 2LD4A 2DQZA 3RWOA 3MW8A 1C0LA 3V2UA 2DYRE 3B6JA 3ITEA 4GG1A 1IBKB 2Y92A 4B6JA 1MVLA 3R7WB 5FEUA 3O84A 3CLJA 3NAZA 1DCKA 1KARA 3MZ0A 4ZVSA 5DLQC 1TQDA 3KYBA 1XAGA 3GOHA 4B6RA 4L5JA 2PKCA 5AJWA 5FFNA 3R3UA 1TYCA 1N25A 3VNRA 4YACA 3CLSC 4HBDA 1HYBA 4HGOA 4ABNA 5K51A 2EAUA 3UB3A 3S2ZA 3W4KA 1L8AA 2RGXA 2RGAA 4LV5B 5H81A 3K5IA 2XMGA 2E7ZA 3HDHA 3G02A 1WW3A 2OO5C 4AL4A 3AR7A 1WX1A 1MA3A 3OE5A 4HFGA 1GAEO 1Z6ZA 2ARKA 3L0YA 2BKLA 3K9QO 2HPVA 1IY9A 2BP7B 3APCA 1IRXA 4MKGA 4DC9A 1CY7A 2C83A 4RWEA 2PUTA 4E2WA 3UIPC 2PY6A 4O29A 2XCCA 3ZTYA 2H1LA 3W9YA 1U0HC 1A2BA 5D6OA 4BN4A 1V55E 1RYDA 4DLWA 3PNOA 2X6IA 3T41A 3NXSA 5ALPA 4K9OA 2X40A 4ZJZA 4B89A 4I9FA 3S40A 3X0DA 3IT0A 4C30A 3PSHA 2NPFA 4F93B 2J7KA 4BBPA 4Y3UA 4HAOA 3U39A 1SXJC 2IH4A 5HFAA 4ZRDA 3NJ8A 2VH2A 3OEYA 1HDEA 3CH4B 3VHXA 3C48A 2EG9A 3DEKA 1EFRA 1PS0A 2ZDGA 3C45A 4RMNA 2BE9A 1AKWA 1G8KA 1YIOA 2WPDD 4F7WA 1PJSA 1MA0A 1N0UA 9ATCA 4MAFA 5LB2A 1NN5A 4U95D 1KERA 3HXFA 4ACBA 4GMDA 2QYUA 3PR1A 3FMGA 3L1JA 3G2PA 4E6HA 2DR3A 3JRWA 3HXDA 2XUKA 3H4MA 5CLGA 4H9GA 3NIGB 3BXPA 1O5TA 1OOEA 2VYVD 3VM6A 1FVFA 3U56A 1O96B 2P2ZA 4FXOA 5JDIC 1UJ6A 3Q0IA 4A2QA 3CCCA 3ACDA 2BBWA 4EMSA 4WVLA 5DGXA 2DFLA 2ZB3A 3RR2A 4RA6B 1QFMA 3OT5A 3KEZA 1K5GA 1JDBC 3ADKA 2H2AA 3SJAA 5IVDA 4MIOA 1HG2A 2J41A 3QEOA 3EZNA 4A10A 5GJVC 3BSSA 4OSOA 2HJSA 4DMUB 2X41A 5B2ZA 1QCDA 5JCOA 1SQ5A 1P2VA 3RROA 5JLJA 1EFKA 1O95D 2NTEA 3Q87B 2XKAA 3BUSA 2OZPA 2QY9A 4QDXA 3LQKA 3ZDXB 3CQGB 3UBMA 3A6KA 2AG6A 3KQLA 5LU8A 2O8DA 1P4HA 3A1SA 4M1MA 3QSGA 1Y1RA 1ZVJA 4EB3A 3K72B 3EHMA 4GGMX 5ER6A 2J9QA 5CECB 1SUWA 1CZKA 4LQLA 4R1TA 5ARDA 1HDGO 1DXOA 1UXOA 1MORA 3EEIA 3CT6A 3P5BA 1BS2A 2H1CA 5B3AA 3HZZA 3F6EX 5K3BA 4G0PA 1P7CA 1P2GA 2ECFA 5MDHA 1T2AA 2ILRA 4FFMA 1IBSA 2ROQA 3L0ZA 4E85A 1WXFA 2E4WA 2IZ1A 4NCJA 1OB5A 3GNQA 3INYA 1E94E 1NPTO 5F78A 5D7NA 2CJWB 2YICA 1YZVA 2CE2X 3T52A 3T6KA 1IQPA 2RG8A 1NBEA 3I6ZA 4Q1FA 2X3UA 1EQ2A 3HYRA 3KOXA 1E32A 2CMKA 4IRMA 2MSWA 2Q9CA 5D87A 3A2LA 5CH5A 2JFXA 3DPDA 5CCLA 1CZOA 1E96B 1P45A 5AFSA 3DEJA 4YUWA 2VIIA 3NR2A 3WYAA 3GN2A 1P19A 5DHAA 4UBKA 1GRVA 1ZD1A 3X2SA 2JJ1D 4JT2A 2RHMA 3P2MA 5IBRA 3Q1KA 4OHUA 5D00A 1J0AA 1STOA 2IZ7A 1JWAB 4U7EB 7AT1A 4QGFA 1XLTA 1VL6A 5CU7A 3ZXYA 4YJ3F 3MSXA 1OLXA 1DUSA 1ZS9A 4Q1BA 3RGGA 3GVCA 4Q24A 4R1MA 3JWHA 5CURA 1FY2A 3NWEA 4O0MA 2QN1A 2I2AA 1M73E 3K0HA 3ISJA 3OE7D 3DEOA 1Q7CA 1RJ9A 1NAIA 5TEWA 1Q3TA 2XB6A 5BR8B 2R7KA 3FI9A 4JENA 4JUCA 1FFAA 1N1DA 3NJRA 2D1FA 2Q50A 4N5HX 1N2ZA 2OPHA 1NM5A 2GA9A 2LW7A 4XYLA 2GLTA 1AKTA 1E99A 3B1WA 1SVKA 5KQRA 1S64A 1NOIA 2X6HA 4HQ0A 3AT1A 2IU6A 4GTRA 1SVWA 3PFIA 3ZHQA 3JD1A 5BSUA 3RO3A 4MI3A 2F17A 3X1JA 2L0XA 4KUHA 2EQ5A 2ZVDA 4ROSA 1K6MA 3KU1A 3WG9A 4XQ9A 2ZR9A 4L22A 2AFRA 5A9SB 1QHNA 4OY3A 4BU1A 4PO9A 2CJPA 1PJQA 4EY3A 5KVVA 2B8TA 2F7SA 3E05A 3K0FB 3NUZA 2GRPB 2C3YA 2IWHA 1R6XA 1W76A 4RLHA 4S1WA 4EFNA 1TX4B 4TKUB 1UZAA 3DLBA 2WTBA 1UC9A 4YMGA 1BAPA 5FA8A 5IYZF 1MHTA 1XTKA 4LG6A 4AEZC 2JEYA 2DH5A 1XSEA 2J5XA 4YBRA 3EHDA 1TF7A 2WB2A 2WG2A 1M0SA 3PQ3A 1IXVA 1KEKA 2WFZA 1V48A 1UBLS 1IU9A 2EILE 4UC0A 1S6YA 3TLGB 4APFA 3M6AA 3TVTA 4FHZA 3G3EA 4C0QC 2H8KA 1PKEA 4NQZA 1GWNA 1H1LB 1ZMXA 3FMIA 3VYRB 4B3GA 2G09A 2HNKA 3ADCA 2GOYA 1SN7A 4HX9A 2ST1A 4L9RA 4Y6QA 3CHRA 3QX3A 2XSZA 1KR2A 3ZKWB 5CMLA 3UJDA 3O9MA 4TWIA 3UHJA 2XITA 1IY0A 1MO3A 2MR5A 3FTUA 2VS1A 4CZ2A 1NMXA 4A26A 7MDHA 4TV9B 3B9PA 3T3MB 1K9VF 3WTBA 4C0EA 2WTXA 2ZBDA 1RHQA 1UOHA 3G2WA 4PAWA 2Z09A 1OE0A 3BCUA 2Q0SA 3ZCSA 2NYVA 4YRBA 1MABA 1GQYA 4AF8A 3EXEB 1M6YA 1XB2A 3RLFA 1OXVA 1IXKA 2CLLB 4MSUA 2SBTA 4A1FA 1ZICA 5FQ6A 3R75A 3AKYA 1NXPA 4J2TA 3JWEA 4ZPJA 3U3OA 4ZOAA 1CJVC 3OY2A 2UUAB 2XQIA 1IL0A 5TARA 1EGMB 5FJIA 2W2VA 3HM2A 2X4LA 1OLSB 3PEVB 3L49A 3JTEA 4BO3A 5BORA 2HHLA 1W5EA 4ZVPA 3DFIA 4BJ1A 1LJ8A 3VLEA 4HV4A 2Q1SA 3TKAA 4EYGA 5JJ6A 1P60A 1OXJA 2EG5A 2G70A 2I6SA 1FSZA 1JEEA 1FP7A 5FUYA 4CEJB 5ERXA 2GO7A 3AHIA 2FSHA 1QRUA 2J7PA 1ZU5A 2ZE8A 4FUQA 4WUVA 1RJEA 4AO6A 1L7XA 2PO5A 5GMOA 3IAXA 4MOWA 1VE6A 1XO1A 3ZWVA 1W0JD 721PA 1N2EA 4UQZA 4U2DA 3CZRA 2XOXA 4AV7A 1KT1A 4RENA 5ARFA 2AG5A 1SIWA 5L3SA 1A72A 1ZN8A 5J4YA 5HGXA 5JPDA 3FOAA 1F8GA 3FFAA 4IMIB 1D4OA 2DR0A 4RLSA 3OF2A 1OUMA 5BW4A 5LXTF 3T4PA 4DXDA 2A5YB 5FOQA 1Z12A 4XJSA 4N03A 1JW9B 3IIEA 3QA3E 4DR4B 3BQ9A 4QBIA 4C3ZA 1XQ9A 4M6WB 3H6HA 4RNDB 2IK8A 4LOIA 4O4LA 2VEOA 2R6AA 4Q69A 2O0JA 3QXCA 2HUNA 4GLBA 1PDOA 3EN0A 2H2IA 4IVQA 2HJWA 4E5MA 4TTJA 3DWGA 4IDAA 3T9EA 1XHFA 3OD1A 4JB8P 1XMQB 2WTNA 1RBYA 4WXYB 3ZNQA 3WGKA 4G1UC 3OXLA 5KTPA 4EJSA 4EJ6