1EQ2A

The crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
307
structure length
272
Chain Sequence
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQIMAGEEFGDVEAIFHEGASSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGSMASVAFHLNTQLNNKRDFVYVGDVADVNLWFLENGVSGIFNLGTGRAESFQAVADATYQAFTQADLTNLRAAGYDKPFKTVAEGVTEYMAWLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
publication title The crystal structure of ADP-L-glycero-D-mannoheptose 6-epimerase: catalysis with a twist.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 103
structure length 272
sequence length 307
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.1.3.20: ADP-glyceromanno-heptose 6-epimerase.
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eq2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1eq2A02
2CF6A 2UUPA 3AU9A 1EFKA 3Q6IA 4CQLB 1YONA 3OIFA 3U9LA 3WLEA 4HNHA 2WM3A 1XYGA 1PZEA 3V1TC 4B4WA 3MWEB 3ZWNA 5JMWA 4XDYA 1N5DA 2OORA 1UZMA 2VNSA 4YACA 1A4UA 1MG0A 2P9CA 4HUJA 3L6DA 3FSRA 1EQ2A 3C24A 1F8FA 2PR2A 2ZTVA 4UUPA 4E6PA 4RO0A 4WASA 4NQZA 1BXGA 2Y0DA 4WLVA 4IXWA 2FZEA 3UN1A 4BO1A 4E5PA 2UDPA 3GAZA 4FGSA 3OF2A 5JCJD 4UEJA 3SVTA 4DC1A 3DHYA 1H9BA 3M2PA 4RVFA 1UXHA 1PU2A 4Q3NA 1RPNA 4D43A 2HUNA 4PZDA 2IYPA 4RVHA 4UVHA 6LDHA 1U3UA 5I7EA 2EKPA 4YJFB 2GPTA 3WQSB 1X7HA 4TZKA 1I2ZA 1GCOA 1UAGA 1EVJA 2VUSA 3PHGA 3LT1A 5EINA 3ZWWA 1E3IA 2Q1TA 3KYDB 3IP3A 4R9SA 3H4VA 5DN9A 4EJMA 1M2WA 4I9UA 4TKLA 2Y0EA 3DBLA 3G17A 1CDOA 2HK8A 3NJ8A 1PTJA 3GPDG 2FPPA 3GQVA 1UXIA 4RPGA 4U6SA 5TX7A 3KVOA 4AFNA 4CLRB 2PLAA 4R16A 5KKCA 2AW5A 3VZSA 4DLAA 4RZHA 1N7HA 3LLVA 4DMMA 3KM0A 3DZHA 4PN3A 4QFDA 1ML3A 5JSFA 5L53A 3AM3A 4MO2A 1VSUA 4BGUA 3NJ4A 1U5AA 3A4VA 4BGIA 1ULSA 3RBXA 1E7YA 1I10A 2O3RA 2XF8A 1GAEO 2DFVA 4GSLA 4RQTA 4BO7A 4YA6A 3ZU4A 4YQZA 1HTBA 4EJ0A 3NT2A 4MVJP 4PG7A 5A3VA 1OBFO 1L7DA 4MVJD 4KWIA 2EJVA 1FK8A 3DHNA 1E3JA 4QO8A 3ZHYA 1KEVA 3RFTA 3IP1A 1CEQA 1BRMA 1V0JA 3CZRA 4DQUA 2QRKA 3AI1A 1KVQA 2I6TA 1LSSA 3ICPA 1QP8A 3GPIA 4IIVA 1L7EA 1BHSA 1AXEA 5G0SA 3FNFA 5HS4A 1QMGA 4RF5A 1E3WB 2VHYA 5GZ1A 2GZ2A 2OHXA 1U2GA 4KMSA 1LUAA 2EKLA 3ULKA 4BMSA 3TL3A 4N5NA 5IF3A 5JDIA 2VHXA 4IZIA 4AJ2A 5KJFA 1Z75A 4M49A 2ZTLA 1IULA 5CG1A 2PFGA 1FJHA 1BDBA 3ITKA 2X5OA 3DZJA 3DOOA 3GT0A 1VJTA 3AU8A 3RASA 4J7CA 1I36A 5JMPA 1VKOA 3AUTA 1GZ6A 4D3DA 4IQGA 3JQGA 1EDZA 1DBVO 4WGGA 4ONEA 2V6FA 2YV1A 3JQFA 1XU9A 2AG5A 4IJWA 2EERA 1A7KA 1QV6A 1HL3A 4ND4A 1HETA 1MA0A 3GRKA 3HHPA 3E9QA 1FMCA 5HM8A 3FNEA 4CMEA 1SNYA 2Z1MA 1KY4A 4I9NA 4YXFA 2POQX 1IE3A 3JSAA 4Q9NA 4NH4A 5CDTA 3KETA 4PLWA 5JY1A 2YDXA 4MIOA 1BWSA 5IDXA 4WLUA 3BHJA 1S7CA 2YV2A 4J0FA 3UCXA 3RKRA 1UJMA 3RAJA 4M8SA 1X1TA 4QUKA 3ZI0A 4DGSA 1TVEA 3ENNA 1A71A 2X0RA 3DO5A 3TPCA 1D7OA 1B8PA 1OFGA 3GC6A 4PLFA 2DPGA 1EE9A 1FDTA 3W6UA 1X0VA 1LRJA 2VRCD 3E48A 5JCXA 3WDSA 3FPLA 2RCYA 4FN4A 3DZGA 1QKIA 1V3TA 1C14A 3JQ9A 5L7YA 1VJ1A 3HDYA 5TC4A 1Z7EA 4JCOA 1UDCA 1Q0QA 2ZYAA 3C1OA 1NP3A 4P4GA 3OJFA 2FOIA 3OP4A 4BNHA 3QVTA 3SLGA 2OFPA 2A4KA 3OMLA 1YB4A 3PTZA 1WZIA 4NBRA 3WGGA 4JGBA 1FDUA 1R4NA 4LCEA 1ZO8A 4RF3A 4L75A 1F06A 1ZK0A 1B16A 1ZSVA 4W7HA 3ZDFA 2ZB4A 4LRSB 4YRAA 1H0KA 4UULA 4JX8A 3U4HA 4J43A 4CLDA 1ZK1A 4KUGA 1QLHA 1K0UA 4KQXA 1D4FA 4J9VA 4MIYA 3JQAB 1I3MA 3GH3A 5DOVA 2O3QA 4E5YA 3K96A 4MVJF 4R5MA 4GSKA 1GV1A 3AOEC 1HZZA 4YCAA 1VL0A 2IRWA 4TRJA 4QFCA 3KYBA 1PZFA 5ITWA 4HFRA 5K0ZA 1TB4A 4RDHA 2Q46A 3OJ0A 5DULA 3RUIA 1YJQA 3I4CA 1NM5A 1VLLA 5G4KB 1R16A 4A27A 1D3AA 1DHRA 1NAIA 5KJEA 1GY8A 2VTDA 2Y1GA 1QYVA 3TL2A 4DBZA 2OGUA 4IPTA 1E6WA 3WNQA 1GDHA 2GZ3A 3MZ0A 1X13A 5U9CA 2QZZA 4ND2A 3KB6A 1UAYA 3NRCA 3LT2A 1H9AA 1NQOA 1UDAA 2ZCVA 3MTGA 5T67A 1PWZA 4XCVA 4E4YA 5I9NA 2W2LD 4YRDA 2DBRA 1I3LA 5CG2A 1V3UA 2RH8A 5EJ2A 1X15A 1W6UA 3LDHA 1LDMA 1P0FA 3JYQA 1PX0A 3JD1A 1DAOA 2B5WA 5HBRA 2GUGA 2I5PO 2IEBA 1JN0A 4HFJA 5IJZA 2FMUA 1O0SA 2UVDA 1JDJA 4XX0A 1HSZA 3PZRA 1C0PA 1GYQA 4FFOA 1XU7A 5A04A 5JPIA 2FHSA 2YHIB 4LSWA 5JNLA 2EW2A 2JL1A 3JCZA 4I9HA 4NK4A 3IKTA 4FW8A 1GCUA 5CPFA 4NJMA 4JN6B 4OH1A 3I9JA 4IINA 4ZQEA 1LDYA 3ZV5A 2YQ4A 3OH8A 4BMNA 3P5SA 4ND1A 3B1KA 4F6LA 3DWFA 1U3WA 3IOYA 3VH1A 1B0AA 4ALKA 4IBOA 2DTEA 1IYZA 3KRTA 1MB4A 2Y1CA 4UAGA 2PGLA 1M67A 4MDHA 2WMDA 3H3JA 1VPDA 4QEDA 1O94A 2NQ8A 3UAGA 1T24A 3WGOA 3ENKA 1LI4A 1B15A 1DFIA 1R15A 4EBFA 2LDXA 3GUCA 2VT2A 3A1NA 4RORA 5ES3A 5AOVA 3AI2A 1O8CA 4HY3A 3BMCB 2W2KA 2GD1O 1LXCA 3IC5A 4CM7A 4XQ9A 4A73A 1MXHA 1R0KA 4JJIA 4RPKA 2VWGA 4J2HA 4OIMA 1JQBA 1I01A 1KY5A 1Z6ZA 4BNNA 2Q49A 1FDWA 3B20A 1NXQA 1B8VA 5EQDA 2VRBA 3NAQA 4DQXA 5L40A 1LQTA 3WWZA 2J5QA 2VOEA 4RLSA 2NVUB 1WWKA 2FR0A 4OGWA 3VH3A 1A9ZA 2JCXA 4CM9A 4OO3A 2DBZA 4FC6A 5T8KC 2D1YA 3QVOA 3X2EA 2AEFA 4ZQFA 4D46A 3DOCA 1U28A 1P1RA 5GZ6A 3JYNA 4IS3A 1B8UA 4E5MA 3WGHA 5EMHA 1N7GA 1ZK2A 5I8WA 4E5KA 5I7VA 5U4QA 4I5GA 4ALLA 1YWGO 4NPCA 3TN7A 2GN8A 3VPXA 2FP4A 1O6ZA 2V6GA 4MPDA 5JDCA 1E3LA 3D64A 3GRPA 3GHYA 2VWQA 2R2GA 4KUEA 1DIAA 2DM6A 3HFGA 4GGPA 2DQ4A 5IDQA 1NFQA 2VHZA 3G0OA 3EDMA 4YDRA 3GZNB 2AA3A 3WNVA 4FOOA 3E9NA 2HK7A 3WGQA 4E5NA 2ZQZA 4PG4A 2J3HA 3TFOA 3JQAD 4ALJA 2HAEA 1VL8A 3RIHA 3MOIA 5KVQA 5H83A 3E8XA 2QW8A 4YJGA 3BTSA 1IY8A 1V35A 2JAPA 4IQ8A 5TT0A 1G6KA 1NVMB 3PI7A 1T25A 2A35A 3WYBA 1EBUA 2C2YA 1V6AA 3CKYA 3WBBA 5T6BA 3GEGA 5TGDA 3KBOA 5FEUA 4Y6PA 1X14A 1K6JA 1A9YA 3TZCA 3RUHA 4E3ZA 4YT4A 2CZCA 3LVFO 2O4UX 2ZTMA 1O9BA 3RJ5A 3I9OA 3V1YA 1ORRA 3ZWOA 3C3XA 3MJCA 4DPKA 4I08A 4TSKA 5G4LA 3CE6A 1V9LA 3FTPA 3F1KA 3F4BA 2EF1A 2ET6A 3H3FA 4E21A 4N5MA 3HNPA 1NBOA 2HDHA 4HADA 1YRLA 4XA8A 3BIOA 4CMCA 2PGJA 5G0TA 3DZBA 4XEHA 5CFZA 1O5IA 3W8EA 1QG6A 4ALIA 1GQ2A 4URFA 4U0KA 2NUAA 1R12A 3UUWA 2AEMA 2IZ0A 3LF2A 5L7WA 1XQ6A 1GEEA 3W4JA 4CM8B 4Y8VA 5I9MA 4ALNA 4CMGA 3OQ6A 4BNMA 2X58A 4UVDA 2FSVA 4YEDA 3JQDA 3DZIA 3K2EA 3AFNA 2OOSA 2Q50A 2DT5A 1IZ0A 2RHRA 4R9RA 5DCYA 4NG5A 2PD6A 1M6HA 2WDZA 4KOAA 3TZ6A 1PZHA 4A7PA 4S3MA 1WW8A 5JCJA 3U4DA 3Q2KA 4GMGA 3F9IA 5HWSA 1DLIA 3WQRA 2YZ7A 3PFFA 2PH3A 4XIYA 4R3WA 3FR7A 1DSSG 2DBVO 4BNVA 4NFYA 3O4RA 4H16A 1NHGA 4MVJG 2XPCA 4W4TA 1K5HA 3ICCA 1NHWA 2HLPA 3ZV4A 5LCXA 1CQIA 2AQHA 2Q2QA 5GMOA 1CRWG 4PFJA 5G0UA 1XEAA 1PS9A 1LU9A 3K31A 4O59O 1HDRA 4P4LA 2TMGA 4INAA 4IZHA 2IZZA 5KWEA 2AEJA 1PJQA 4CUJA 2XOXA 1IHXA 4HFMA 4RV9A 3TOZA 3KYCB 5G0VA 4S1VA 1MC4A 1ZSYA 4RPHA 4Z3KA 1JKFA 3CUKA 4E31A 1LLUA 5KJ1A 3JQ7B 2Y1DA 4HNGA 4BNIA 5B12A 1RKXA 1F14A 2G0TA 1NX6A 3ROQA 3P2YA 4YAJA 1ISJA 2H1SA 4PGFA 2OP1A 3PJEA 3DAFA 4J90A 4BNYA 1Y81A 4I5EA 1PJSA 4AJNA 3ABIA 1E6EA 3CXRA 3FCOA 5KIAA 4EZBA 1C1DA 2JD0A 2XXBA 3EHEA 5ENVA 4MVJA 3GMSA 1ZZEA 4GBJA 4OMUA 3D3EA 4IJKA 5JAQA 4M86A 3JV7A 1U3VA 3BMQA 1NYTA 3GF4A 1GUZA 2BFAA 4TWRA 5DBGA 5ENDA 1NPDA 4J1NA 4BB6A 3S2EA 5F1PA 4RVGA 5B4TA 3D3WA 1I32A 2PZLA 3T4XA 4YB8A 3C7DB 1SPXA 5TQVA 3ZWXA 1AXGA 2PH5A 3ZW8A 4TZTA 5JW6A 1HYHA 2CD9A 3KEOA 4FQ8A 1LRLA 4FJ0A 3JQCA 4IQ0A 4GH5A 3C7CB 2E6UX 1I33A 2HRZA 4FCCA 3QRWA 4ITUA 4BUCA 4DA9A 2ZQYA 3EW7A 4PLZA 3BA1A 1ENZA 4D3SA 2B35A 2Y1OA 3G3EA 4BKQA 2B5VA 1GZ4A 1EUDA 3ONFA 5L45A 4LMRA 3DC2A 1GEGA 1GZ3A 5EIOA 2ZATA 1VM6A 2VHWA 3ETGA 3NV9A 2AE1A 3NGXA 3PQFA 4A5OA 3ANMA 2B36A 4WLNA 2FZWA 3JD2A 5TLSA 4YJDA 1JU9A 3B1FA 3MCVA 2X0NA 5ER9A 2BI8A 5KVVA 2FY8A 4KTVE 4CL8A 4RPJA 5ICSA 4CQLA 3B1JA 3FN4A 1MUUA 1I2BA 4FFLA 3MJ4A 1PJ2A 4IDBA 3U0BA 3AFMA 3I9KA 4L0QA 2P4HX 3M6IA 6ADHA 3HE3A 3DBRB 1LLDA 3PK0A 5BNTA 3NKLA 5CDYA 3DZFA 3FD8A 3QA9A 2IE0A 1BSVA 2GN4A 1BVRA 2NTVA 2Y93A 5CHEA 1LDEA 2VRCA 4JP2A 4L74A 3W6ZA 5A1TA 1PJTA 1ENPA 4D45A 3N7UA 2D8AA 2OXIA 3ETDA 2R00C 5H81A 5A4DA 1HKUA 2PZMA 1PEDA 4Z3DA 1XHLA 1EVIA 3A14A 2D2IA 1W0CA 1XQ1A 3ANNA 1J6UA 5AXCA 1DPGA 5C7LO 3RC9A 1M75A 4CR7A 1N8KA 5A02A 1YJ8A 1I0ZA 4JXKA 2PKRA 4CLOB 1B3BA 4AJ1A 4Q3AA 3V2GA 5MDHA 4XZ3A 4GX5A 1H2BA 1RJWA 4M87A 2C54A 4Q3DA 3SJUA 4D42A 1DOHA 2FR1A 4TKMA 2IEDA 3ZNPA 1DC5A 1HE4A 3KYDA 3E5RA 4OHUA 4XB1A 4YVFA 2CVOA 3FWNA 1VSVA 1CWUA 4W9NA 5FI5A 2BI7A 2B69A 2CDAA 3HB4X 3WTBA 4IDGA 1KC1A 5IN5A 5I7SA 3BMNB 4ZRNA 2J6IA 4OYRA 4CLRA 4YTEA 3QVXA 1NWCA 4J7UA 4R3NA 4F6CA 4BV8A 3PIIA 4J49A 1LQUA 2EV9A 4FS3A 4IMRA 5BSEA 1P1HA 4JP3A 4XRRA 4CM4B 1NAHA 3PQDA 2QX7A 3GVHA 2DAPA 1SO8A 5F5NA 3PHHA 3PGJA 1UP6A 3F1LA 2NNLD 3KSDO 3SBOA 1C1XB 1H93A 3OFSA 4D0RA 4K26A 5COBA 3MOGA 3UCEA 4IGEA 2W2LA 4I8XA 4NHEA 3GLQA 3MEQA 4A03A 3DQPA 4BKOA 1WMBA 9LDTA 1SC6A 4MOWA 2C7VA 4U5QA 4PLTA 2Q2VA 1I30A 4HP8A 4CV0A 2V6BA 1YH3A 4JK3A 4E32A 3ZZNA 4ZHSA 2YV3A 3LQFA 5U1PA 3MJSA 3C1TA 3ST7A 4FPXA 4LGVA 3OBBA 1IZ9A 3H9UA 4BIIA 1E3WA 1KEUA 1GUFA 3VPHA 3HFSA 1TLTA 1IUKA 3SX2A 5CEFA 1DFGA 7ADHA 3EY4A 4DWVA 4Y67A 1K6IA 1YQDA 3HZZA 3TRIA 3WSVA 2DFDA 4RVDA 4TRRA 5IZCA 1MG5A 2FSSA 2GNAA 2O3UA 4Z9YA 4J4TA 3JYOA 2ZB8A 4I5FA 4U6QA 4CMAA 1M76A 2P91A 1MXFA 3QQPA 1NFRA 1GPJA 4BNUA 3GG2A 4LCJA 2Q99A 4B79A 5DZSA 1H2HA 1P77A 4PZEA 2X8LA 4J7XA 1V3VA 2QRJA 1R4MB 3JQFC 4MIEA 3G49A 5K6AA 1UZLA 1RYEA 3LU1A 4OSPA 1TEHA 3RUAA 4QSMA 3GVXA 2HQ1A 1DIHA 4Y98A 3PQEA 2PV7A 4B4OA 1GADO 4LRTB 3PGXA 5IDWA 4Z9FA 5KVSA 4UEKA 1LSJA 5CDUA 1ULUA 2GRAA 1RWBA 1HYEA 4YR9A 3ON5A 2EXXA 2HO5A 3JQBA 3PYLA 4LVCA 3ADPA 4GWGA 3VH4A 4EUFA 4FFRA 2FRDA 4MP6A 3WG9A 4ESOA 2YHUA 3ANLA 2I76A 1NQTA 4IDFA 1QR6A 1TI7A 3P2OA 2YW9A 4NU6A 4YQYA 3ZHZA 5DT9A 4L9RA 5CP8A 3HQ4O 3AY6A 5EL0A 3R6DA 1MLDA 1PJLA 1OOEA 3QJ5A 3JD4A 4PRKA 4ZGWA 4QQRA 2WE8A 1KERA 5DCWA 2X4GA 2Q1UA 4FOSA 4E2YA 1YGYA 4GMFA 4WK6A 1DFHA 3GVPA 2VZ8A 5L4SA 3CIFA 2ZB3A 1TA4A 2BKAA 1PQWA 4K28A 3QWHA 3F4LA 1T2DA 4AJ4A 4Z0PA 4BGEA 4EEZA 3CPSA 4B8WA 2GDZA 1SMKA 1ADGA 3PJGA 4GPD1 5B4VA 5LDGA 4EUHA 3BTVA 1VC2A 1YQGA 1PJ3A 3UH1A 1YDEA 4R4JA 4XYBA 1DO8A 4P38A 3A06A 4OL9A 4BKPA 1JWBB 4J1QA 1HDYA 1YO6A 1KVRA 2P2SA 3ZNQA 2JJYA 5FWNA 4FIZA 4K9DA 2HMWA 1E7MA 4F45A 2BHLA 4HV4A 4WEOA 3JQAA 3VC7A 4BQRA 3AUSA 1HLDA 4U0JA 1UR5A 2VHVA 2WD8A 4GX0A 3I9MA 3LT4A 5IZ4A 1RM4A 2Q1SA 4XGKA 1QLJA 3IIEA 4WOKA 2O50A 4GKBA 4OM8A 3JQ8B 4C7KA 5G4KA 3STHA 3B70A 4DTIA 1T2AA 1MX3A 2X9GA 5I9LA 3K9QO 4E2XA 1IPEA 2NU7A 1T1SA 1P45A 2Q4EA 4IDAA 2VWHA 3H9GA 1EBFA 4G65A 1T1RA 3IMFA 2ZK7A 4Z0HO 1XG5A 4Q3CA 1R37A 1DLJA 4WE3A 2O3JA 3EMKA 3BHIA 3GEMA 3JQ6A 1JAYA 4J2OA 4C4OA 2F1KA 4R1TA 5ILOA 1LSUA 4ND5A 3VVBA 3DBHB 2J5RA 3ZWPA 2HJRA 5DP1A 3H8VA 5EQFA 3PP8A 1A7AA 4BO5A 3NYWA 1YB1A 4KQWA 1U3TA 2PNFA 1ZKMA 3KLMX 1RM5A 1ONPA 2WD7B 2BFMA 3F6YA 3NDIA 1YL6A 2YHIA 5THQA 1HDXA 1SEPA 2AQ8A 1I3KA 3IJRA 4GQAA 1GQQA 3UHAA 4AVYA 2HRBA 4LSMA 3IQDB 3HB5X 3PJFA 3ZHBA 3D4NA 2EW8A 3CMCO 3NTQA 1Z82A 4XIJA 4FGWA 4AJLA 4K6CA 2J5KA 3PFWO 4MVJM 3D1LA 2VN8A 1PGOA 4PIVA 3GFBA 4B3HA 3EUWA 4J1TA 4TROA 1PL7A 5A5FA 2D4AA 2QHXA 3K2BA 4E2WA 1VE9A 1EVZA 4BV9A 3ROKA 1X0XA 2E37A 2JKVA 3MTJA 4JIGA 4KUHA 4BKUA 4J6FA 3H65A 2FN7A 5L3ZA 1E1LA 1ZMTA 2C20A 5COAA 4B8ZA 2X5KO 3ZH2A 5DOZA 4D3FA 4C7JA 2YDYA 2CMDA 2ZYDA 3RJ9A 1EEHA 1UH5A 1PGJA 1IB6A 3IDSA 3OQBA 4LW8A 3WR5A 4DLBA 3F3SA 1WNTA 5DCUA 1YBAA 2Q3EA 1T2EA 3WGZA 5DNAA 3HDQA 2NVUA 3D5QA 1ZVMA 4GAEA 3RVDA 3NDJA 3WIEA 3GA0A 1P33A 3QWBA 3SC4A 3R3SA 3M2TA 1B7GO 4XYLA 4UUMA 3AOEA 3AUAA 2YQ5A 3ZNOA 1C0IA 3O8QB 1E1MA 3DL2A 1BVUA 2OBNA 2RIRA 2QG4A 5DF1A 8ADHA 3GG9A 4RJTA 4RF4A 4RGBA 1VL6A 3BMOB 2Q2WA 3FHLA 3DB2A 2I99A 4OOEA 1KVSA 3DEYX 4TVOA 3WX0A 3FPCA 4DREA 1GTMA 1E1NA 1A4IA 1ZCJA 3OIGA 4PCVA 5BSFA 3X2FA 5JDCC 1Y8RB 3H2ZA 1DDOA 3H5NA 3ZWMA 4DPMA 1KETA 1U4SA 3L9XA 5AQ1A 2P9GA 1PL8A 5C3MA 1ZMOA 3U4CA 3E03A 3K92A 1HE2A 1Q7CA 3GZNA 1B3RA 3K8ZA 3D0OA 3W8FA 2IZ1A 4WCFC 3G1UA 3UVEA 1GYPA 1Z7BA 3Q9NA 3RROA 2CDCA 4MINA 4FR5A 2I9PA 3GVCA 4YAEA 1YE3A 5DDIP 2D5AA 4RVUA 1R0SA 1XR3A 3VZQA 1GD1O 3FBGA 4XQEA 1IHYA 2D59A 2WYVA 3CZMA 1BW9B 3KHUA 5H82A 4IUYA 3L9WA 3VKVA 3WLFA 4CM6A 4KP7A 2QIOA 3HN7A 3PWZA 4D79A 3CEAA 3IAHA 2BGKA 3PLNA 3QIVA 3E82A 1ISHA 4BO3A 3QSGA 3E18A 4XJTA 4XR4A 5LC1A 1QSGA 3DAGA 4EDFA 4M89A 2X86A 1E92A 4WNCA 5JO9A 5F1KA 2VZ0A 3W4KA 4GVXA 2GF2A 2VUUA 1B2LA 5A06A 3M1AA 3D5TA 1PGNA 3H5AA 3R1IA 2PA3A 1JA9A 3AUUA 3QVWA 4J3FA 1ADFA 1J4AA 3L07A 4O0LA 5T64A 3VPGA 5A9SB 3NUGA 1PR3A 3IUPA 2R6JA 4M54A 4J16A 4CM8A 5IFLA 4BO0A 2DUUA 1SOVA 1XWFA 1F0YA 1N9GB 1BMDA 3I1JA 4DIFA 1TT5B 3GGGA 1U9JA 2ZIZA 4AL4A 3H7AA 4LVUA 4PG6A 3TNLA 2IODA 1I2CA 4WNIA 1Y9EA 1HLPA 4AJKA 2GO1A 1GUYA 4NU5A 4WLOA 1QV7A 1XLTA 2C29D 4CQMB 1XCBA 4ZQHA 1BTOA 4DC0A 1P0CA 2OMEA 1P1IA 3C8MA 2JD1A 5A9RA 1HT0A 2V6MA 4TVBA 1NPYA 4D0SA 3RFXA 3WQQA 4IGFA 4UVGA 4Y6SA 1KBZA 4WKGA 1DC3A 3L0DA 1LDNA 1OC4A 4FJ1A 3CSDA 3KSUA 4XDZA 3U3XA 1YQXA 4YYZA 3KLPX 4BNTA 3INRA 3FRJA 1TXGA 4EEXA 1YKFA 2JD2A 1HXHA 1NNUA 1PJ4A 4NI5A 5T8KA 4PRLA 1NR7A 4NK5A 2PZJA 3L6OO 4KDFA 3GVIA 1GPDG 4WEQA 2CVZA 1PJBA 4LISA 4F46A 5KKAA 3UOGA 4FJ2A 2Y67A 4FFNA 3VAZA 3EGOA 5IN4A 4MJLA 3OEYA 3ZWVA 5CPBA 1LLQA 3E5MA 2VQ3A 3IS3A 3F5QA 1Y5MA 2P4QA 2Y1FA 2EKQA 4IDDA 5COQA 1E5QA 4RZIA 4CMIB 5CEEA 2GN9A 1VJ0A 1WVGA 3KYCA 3BXXA 3O9ZA 1U7TA 1EK5A 1I24A 3DXFA 3CH6A 3ORFA 3PDJA 3RU7A 1QXSA 3H9QA 1Z74A 3ONDA 2IXAA 2J8ZA 3JQ7A 4NBUA 5TT1A 4DQVA 1Q7GA 2P68A 3UF0A 3OICA 1Z73A 3WFJA 4P22A 4L4XA 4WCFB 5LDHA 5TIIA 3L6EA 3WTCA 4BNWA 1Q2XA 2OP0A 2B0JA 5AXDA 5A9TA 5L4NA 4DL9A 3MJEA 3RSHA 4PG5A 2NLOA 2RAFA 2WWRA 4GKVA 3W1VA 2JFFA 4U8GA 3WGIA 1MC5A 1HDZA 1GU7A 4BL5A 2QYSA 4E30A 3IJPA 3RKUA 5I8ZA 4EYEA 2FPGA 3DMTA 2CSUA 1NQ5A 2HCTA 4WCDA 3UICA 4E13A 4R1SA 3PYXA 5ER6A 1HDOA 2P9EA 1J0XO 1ENYA 3QP9A 2NV6A 4G5HA 3MWDB 1AHIA 2BELA 3RUDA 5JS6A 4E2ZA 2PGDA 4CLXA 5TNXA 1Y8QB 4R69A 4RCVA 2FPIA 4BB5A 4II2A 3PHJA 2CUKA 2RH4A 4HXYA 3SEFA 4ND3A 5TF4A 2W98A 2YUTA 4WJZA 1N1GA 2VYND 1DAPA 3N74A 3WMWA 4J4BA 3UXYA 4BNXA 5ADHA 3AOGA 1YDWA 3ZV6A 3BZUA 1M66A 1U4OA 5ITVA 3C85A 4CMBA 5JFOA 5HTOA 4ZU3A 5EPOA 1JWAB 1MV8A 1EDOA 4Y6RA 4BNLA 3L4BC 4Z0TA 1N92A 4OKIA 3QE3A 1OMOA 1YBVA 5JLAA 5HRUA 2D5CA 2UAGA 2GASA 2Y68A 2RHCA 1YOVB 4B3JA 5A03A 3I9NA 2V65A 3DBRA 1VKNA 4XYMA 3WMXA 4IIUA 4CV1A 2VOJA 1W73A 4NNJA 2ZJ0A 4BVAA 4DXHA 4N18A 3DBVO 4A10A 5KCZA 3GN1A 3VZPA 3KOUA 2OZPA 4ZQBA 3PHLA 4NFHA 1P9LA 5AXAA 1P1JA 4BNJA 1O95A 5JY6A 3Q2IA 4TQGA 4M1QA 3WJAA 1R66A 1T2CA 1PSDA 3RD5A 3ASUA 3Q1LA 1HWYA 4CQMD 4PLYA 1H94A 3DR3A 4NDNE 2G82A 3QWIA 1ZJYA 2NADA 1XA0A 5JC8A 4E0BA 4JJGA 3ZV3A 3H9EO 3WJ7A 4XJSA 3D7LA 1DIBA 3KO8A 4CLOA 1C1DB 3I4FA 3QV1A 4Z6KA 1Q1NA 1A5ZA 3UKOA 2BGMA 2UYYA 4WECA 1K89A 1JVSA 3QHAA 2X22A 1EMDA 2B83A 2I65A 3EC7A 4D7AA 2GYYA 5BR7A 3GHHA 4E33A 4R54A 2O4CA 4IDEA 4JLWA 4UVEA 1HF3A 3BMNA 1AHHA 5C5IA 1DC4A 2O2SA 1DJNA 1JLLA 2GSDA 3RC7A 2FWMX 5DP2A 3RFVA 4FBGA 1IPFA 3NGLA 2JHFA 5KJ6A 1H6CA 1E7RA 4CM4A 5JC1A 4OQZA 3Q0EA 2ZTUA 1KYQA 2V7PA 4IDCA 4N7RA 4PLHA 3OA0A 1YS4A 3MJVA 1EZ4A 4RVSA 3E6AA 2WYUA 4LN1A 4R5HA 5IXSA 2WTBA 4P4NA 4D44A 1CJCA 5KOIA 2AG8A 3QWAA 4XD2A 3OETA 1C1XA 3D4PA 4KZPA 5CAEA 3ZN2A 2O7SA 3GDGA 3M1LA 4MP8A 2BMAA 4YJFA 3DMYA 3A9WA 4EJ6A 4R01A 4J9UE 4GI2A 2F00A 1OC2A 1U7HA 1IOLA 2ZKLA 4XGNA 5IDYA 5BNFA 3V5NA 1PR9A 2DTDA 5IAAA 1AN9A 1ZBQA 2NTJA 4R51A 2BLLA 3GDOA 4FFPA 3U4IA 2E49A 1V8BA 1E7QA 3WYCA 1X7GA 1DJQA 2GERA 2YFQA 4HBGA 4ROSA 4DRYA 3LK7A 4CUKA 1EQUA 2H5LA 2VWPA 4OAQA 2ZYGA 2DC1A 3JD0A 2X0IA 4MVJH 1JKIA 2HSDA 8LDHA 4MKRA 4LK3A 5IZCC 4NBWA 4AJEA 1Q0LA 3JTMA 3OHSX 4DVJA 4YT5A 4JJFA 4YJHB 3QVSA 1DRVA 2DKNA 2AHRA 3WICA 3C7AA 4MVJI 4CL3A 1ZK4A 3AM4A 3S2GA 4YAKA 5BSHA 3KZVA 2IYOA 4BNZA 1U8FO 1Q7BA 1R4MA 2D0IA 1N1EA 1PL6A 2B4RO 2Z95A 4PLPA 1Y5RA 3VPFA 5K6AC 2R00A 1E7SA 2SCUA 3ZWCA 3EK2A 4L8VA 4QT0A 4QXMA 4BO9A 1ISFA 2DU8A 2BGLA 3QW2A 1Z45A 4RQUA 3K5PA 2I3AA 1ZH8A 2WJPA 2YYYA 2HMTA 5JAZA 4XQGA 1QYWA 2B4QA 1ENOA 1KC3A 4WPGA 3WB9A 2GLXA 2UUOA 1YBMA 1E7WA 3JQBC 4CLHA 1FDSA 1KEWA 1NVGA 3GNTA 4GVLA 5L9AA 1ISIA 1R6DA 1ISMA 4AJPA 3KUXA 1P1FA 4YPOA 2G5CA 5JDIC 4CM5A 4B7CA 2TMDA 1WZEA 3DHEA 1H6BA 1DB3A 5JYEA 4YAGA 1D1TA 3A28A 4OQYA 3KSZO 3P7MA 1MP0A 3DFZA 3ZCXA 1SBYA 3LZ6A 2PK3A 4FB5A 4BO8A 5BNIA 4XYGA 1N2SA 3COSA 1UUFA 4GLLA 1XDWA 3PEFA 3AM5A 2C2XA 4UREA 3IKVA 3W4IA 1MGOA 1KIFA 4IM7A 4GLOA 4O1MA 4YT2A 1BXGB 1NFFA 1RYDA 2X7HA 3F47A 1JVBA 3JQEA 4CMEC 4ZD6A 3N58A 3LC2O 3TFQA 3F46A 3VOSA 3OJLA 2HU2A 3ITDA 1E0DA 2VUTA 1S6YA 1E3EA 1PIWA 1ZIDA 1ZXLA 3EVTA 3AY7A 1P1KA 1P44A 3NT5A 1Y9AA 4XWYA 5JAMA 2NM0A 4XRGA 4NBVA 1KEPA 5FFFA 5CDGA 1YXMA 2O48X 3K30A 3EZYA 3GNSA 2O7QA 2NWQA 1J49A 1LEHA 2I66A 1Y6JA 2VTEA 3ZWBA 2EJWA 2GZ1A 3DBLB 3I52A 5G0WA 4GWKA 4W6ZA 3LF1A 3ZGYA 2NU9A 2HJSA 3U5TA 1EFLA 1U2DA 1E3SA 5KNLA 1ADBA 2HK9A 4XGIA 3JQ9C 2NU6A 3WBFA 3PLRA 1X7DA 2PD3A 4YBZA 2RBEA 3JQ8A 3U49A 4EW6A 2DLDA 4ZJUA 3TWOA 1E6UA 4R68A 4YAIA 4M55A 2AMFA 4XB2A 3HG7A 3RQSA 3VH2A 3PDUA 3B6ZA 3OM9A 4O5OA 1QYXA 3SC6A 2CVQA 2B37A 5C7OO 4L4RA 1Y7TA 4CV2A 5B4UA 1H6AA 2DUWA 4OJNA 3ZU3A 1I5RA 3OEWA 5TS3A 3DBHA 4HKTA 1E5LA 4BQPA 1C3VA 1U8XX 5KVCA 1F12A 4GL4A 4N54A 2BFPA 2EWMA 1FF9A 2WD7A 1PJCA 4EGFA 2WSBA 2NVBA 2Y05A 2E48A 5BSGA 4I5DA 2AE2A 2VYVD 3BTUA 4II3A 3BTOA 4MVJE 2PKQO 5KJCA 2PWZA 2BF7A 4W7IA 2O3TA 3HDJA 2WYWA 4AJJA 4ALMA 3GFGA 4PLCA 3JQGB 2OO5A 1J5PA 1ID1A 4L76A 5IG2A 3QWFA 2EIHA 3S55A 4CM3A 3GNQA 2PD4A 4IMPA 3TDKA 4OXYA 1E1KA 2NQTA 1B14A 1T2FA 2AQIA 2J3KA 4O63O 1EVYA 4IXTA 2Y99A 4YRBA 1HDGO 1L1FA 5JYDA 4P8RA 1HZJA 4IJVA 3NDRA 3TSCA 1U1IA 4J91A 4B4UA 4BMVA 3IL2A 4DPLA 3NTOA 4NR0A 2X6TA 3VHRA 3HADA 4E12A 1NTOA 3E1KA 2QZ9A 1H5QA 2Z5LA 1WAMA 3NTRA 3VTZA 1NWHA 2PKQP 4OSOA 3LC7O 3OIDA 2OL4A 2Y0CA 3KXDA 5B37A 4BS9A 4EUEA 4Z9XA 4CM1A 3O8QA 2X9NA 1ZNQO 4J4HA 2VCYA 1UDBA 1NASA 1ONNA 1GFSA 1PS0A 3ETEA 3BMOA 3KV3O 3OJOA 5HA5A 4DIBA 1VRWA 1LC3A 2X1HA 4B7UA 4H15A 1BXZA 1ONOA 3RU9A 3UCFA 1UP4A 3KEQA 2YJZA 3WXBA 3AWDA 3DAPA 1ZFNA 4TMFA 3RBZA 4HFNA 5TSDA 1Y8RA 1LDGA 1AE1A 2CF5A 1LA2A 1LTHR 3BMCA 3HN2A 1DXYA 4QECA 3L77A 1G0NA 1R4NB 4LMPA 5B1YA 1LX6A 1KVTA 1C0KA 4BNKA 4RLHA 1GL3A 2IXBA 1UP7A 3NEPX 4D41A 1NVTA 5F1OA 2ILTA 1W4ZA 2FR8A 4MP3A 4CLEA 5L7TA 1HE3A 3AK4A 3H6KA 4BGVA 2VYNA 3WYEA 1HYGA 3OQ1A 3SJ7A 2Z1NA 2P5UA 1ZUD1 1BDMA 2EGHA 3FF4A 1HEUA 1JTVA 3FNHA 3Q9UA 4TRMA 3AI3A 1W8DA 4AICA 4NZ9A 5EERA 1XELA 1UXKA 1T4DA 1FDVA 4ZRMA 5ILGA 1JAXA 1BW9A 1CF2O 5F3RA 5DBIA 4A26A 3ADOA 4DYVA 1YL7A 2X5JO 5AXBA 1Y1PA 4OOFA 1ZEJA 2O23A 1SEVA 4PLGA 1SB8A 4A2CA 4XYEA 4BO4A 4BNGA 3K6JA 1XKQA 5J23A 5C37A 2NTNA 2B4TO 3GY0A 4Q3EA 3GZ4A 3WOHA 3ZU2A 1QRRA 3DTTA 1BXKA 1LDBA 2QQ5A 3GAFA 3RC2A 3BYZA 3OA2A 2PZKA 1LJ8A 3PXXA 3W8DA 4XR9A 1MFZA 2GN6A 4CPDA 1UZNA 4DYDA 3SLKA 5THKA 5A9SA 4QO7A 2HMSA 1K6XA 4DMLA 4GX2A 1LBEA 1N9GA 1TT5A 3U62A 4AJHA 5CDSA 3P19A 3V2HA 5GY7A 2JAHA 4CMJA 4FSHA 4JNKA 3ZHXA 3V8BA 1P31A 3G1TA 4R1NA 3DFUA 1WDKA 4DIOA 5A5EA 3ZU5A 3CMMA 4CQMA 1ZK3A 1DRWA 4G81A 4OXKA 3NX4A 3G79A 2QRLA 5IXYA 1LNQA 3TJRA 4NJMB 2A94A 3VTFA 1WLYA 5C7IO 3QY9A 1YVEI 5G2OA 7MDHA 3UFXA 1AUPA 2D3TA 2VT3A 4Q39A 3HJAA 1R0LA 4NFSA 4RPLA 1LSOA 1DIRA 1ARZA 1G0OA 3WWYA 3EZLA 1G1AA 2E4AA 4B4VA 1K2WA 3I9LA 5EESA 4AJOA 1SAYA 1F8GA 1ZJZA 5GZ3A 2H9IA 1HE5A 4FD3A 3K73O 4XKJA 3GMDA 2C82A 3TZKA 1ZW1A 4NJOA 2C7GA 4ZVVA 1EUCA 3GR6A 3OJEA 1P3DA 3H9JA 2A92A 2C07A 1T4BA 2JCVA 2W2KB 1Q0HA 4CMIA 2Q4BA 1RM3A 3I83A 3UGKA 1RM0A 1LC0A 1CYDA 2EEZA 5TJ9A 4I1IA 4EITA 2DVMA 1M6WA 1QYCA 2W90A 4N5LA 4EI2A 2HMVA 4WCFA 4FC7A 5K9ZA 1SZJG 1DIGA 1IL0A 3GN2A 2Q45A 5DBFA 2C5EA 2NSDA 2NVWA 1PZGA 4AG3A 3WGTA 2HMUA 4ZA2A 3T7CA 1KVUA 3GDFA 4CMHA 4KDEA 2CFCA 2J3IA 3GGOA 4KWHA 1LRKA 4TRNA 4W99A 4FFMA 4PVDA 1UXJA 3DMTC 2LDBA 3FBTA 1ADCA 3INTA 4NBTA 4PZCA 4HX5A 4JBGA 4BO2A 1TT7A 3PPIA 5JE8A 1GV0A 4ZQGA 2I3GA 1YL5A 1YB5A 2EG9A 3VDRA 3ZWYA 1JW9B 4ZICA 3WSWA 1SCUA 4WOJA 5JBIA 1Y8QA 3S8MA 1H6DA 5L4LA 1PGPA 3H5RA 2I67A 2OUIA 3I3OA 1NQAO 5TRTA 1HSOA 4BHTA 3WS7A 1HDCA 3LLSA 1AGNA 3WGYA 1DEHA 4YT8A 3LSYA 3OSUA 1SB9A 2DTXA 1T26A 3V2UA 3U09A 3MJTA 3GGPA 2PTGA 2C0CA 3I6IA 4YJGB 1OZAA 1PS8A 2O3SA 1C0LA 3Q11A 3L4SO 4L73A 4IS2A 5L95A 4O6VA 4W82A 3TOXA 1E77A 1XIVA 4J1SA 1JKJA 4FDAA 4JBIA 3AJRA 3S1LA 3O38A 2DPHA 3ONEA 4RDIA 4PG8A 1A72A 2ZJ1A 3PWSA 5L51A 4QTZA 1HRDA 1VI2A 3PRJA 3TF5A 2ZCUA 3JD3A 1WXDA 3O26A 3EAGA 4RL6A 1A27A 1LLCA 2EHDA 1U5CA 4BO6A 1D1SA 1YOVA 3D4OA 1GQYA 4BNFA 4QX6A 3QLJA 4R41A 3VVCA 4UEOA 3VDQA 3WIDA 3TZQA 2X0JA 2P5YA 1OI7A 1P74A 2YFHA 3FI9A 3PWKA 3GOHA 4JROA 5T5QA 4B7XA 3OECA 4B3IA 3UW3A 4DBVO 3RUFA 3O03A 1DHTA 3RUCA 2BH9A 3IUSA 5F21A 3ROPA 3NT4A 3CTMA 4NMHA 1GR0A 3ZWAA 5HS6A 2NU8A 3LC1O 3FWZA 3ZW9A 3FTNA 1KS9A 1BG6A 3I23A 3I6QA 3RWBA 3SXPA 3RUEA 1CERA 3PVZA 4UUNA 5A3JA 3T7EA 1O89A 2PY6A 2Y66A 9LDBA 2BD0A 4BOYA 4Q3BA 4IY1A 1I3NA 3HSKA 4PVCA 2JCYA 4XQCA 5A05A 3S2IA 4MKZA 2G17A 2QYTA 1UXGA 5AVOA 4J0EA 2HKIA 5JAIA 2X9VA 5CEJA 1PQUA 3EYWA 4U7WA 3LT0A 4MKXA 3RI3A 4OKNA 4CR6A 1XGKA 3V1UA 3FNGA 2EP7A 3ZNNA 2AXQA 3RBVA 3VZRA 3EVNA 3S2FA 2H63A 2GGSA 1CETA 3HUDA 5BT9A 2JFGA 2CNBA 3INGA 4CR8A 3E9MA 2WEKA 4X54A 1QYDA 3DZKA 1D8AA 4R1UA 4K6FA 1XSEA 2VZ9A 2W4QA 3GUYA 2OBYA 4GX1A 5FI3A 4G2NA 2EP5A 5AYVA 5FYDA 4H3VA 3BAZA 2UV8A 5TJHA 4ID9A 3ROMA 1WPQA 4CM9D 2NACA 4KTTE 4RF2A 1CIVA 3GEDA 1NR1A 3AY3A 2BFOA 3PIDA 4AJIA 5I7FA 3GK3A 1PWXA 3ASVA 1MFPA 1DC6A 4OXNA 4PLVA 4CMKA 3LYLA 4UVIA 4CV3A 1BGVA 3F5SA 3TQHA 1OAAA 3CINA 4Y9DA 3VKUA 2H6EA 1ISGA 2A9FA 1PQPA 2Y1EA 2VNAA 3BMQB 1I8TA 4W9NC 5F5LA 4F3YA 5BQFA 3BHMA 2IDZA 3I5MA 2JFHA 1K3TA 2XXJA 3H2SA 3JYLA 3L4BA 3PZBA 3D3WB 2O2YA 4CODB 3WFIA 3DTYA 4K1LA 2CDBA 5ICMA 3R0IA 4WUVA 2WE7A 3Q3CA 2CY0A 2XAAA 1DRUA 1GYRA 2EGGA 2AQKA 4WLFA 4HWKA 2YY7A 5JO0A 4WLEA 2VYVA 1B26A 2GCGA 3HDHA 3PYMA 1WP4A 1X1EA 2C5AA 4L4SA 1KOLA 4ZN6A 5KTKA 3R3JA 2JHGA 2BRUA 1WMAA 4YJHA 3PHIA 4CUZA 4GGOA 3DOJA 5EN4A 1NPTO 3TZHA 2X23A 4BKRA 1PGQA 5FF9A 3DDNA 2Q1WA 4CJXA 3JYPA 4DUPA 1EK6A 1WDMA 4DLLA 1ZSNA 1F17A 1EE2A 2DBQA 3AW9A 4YWJA 1WDLA 4H7PA 4JQCA 2G1UA 1QORA 5JXWA 1ZXBA 2E82A 3FR8A 1FXSA 1ZEMA 3C1AA 5T57A 3RCBA 3RC1A 2GR9A 4IJUA 1SOWA 5MGBA 4UUOA 2C59A 3KTDA 1CQJA 2G76A 1EUZA 3HWRA 4ILKA 2ZB7A 4NIMA 2J3JA 2W8ZA 3DONA 3T4EA 3VPSA 4A0SA 4JBHA 3PJDA
chains in the Genus database with same CATH superfamily
4DKXA 1RWQA 1WA5A 3AU9A 3BZWA 3EVBA 3NG1A 5CVTA 1YONA 2A9KA 1NYLA 5AI0A 4S1OA 2OM6A 3WLEA 1T6YA 1KI1A 2B2XA 4IIFA 1IRXA 5EVCA 1BEEA 5F73A 5KYTA 2YVLA 3O8OB 5TPWA 2MU1A 3FYCA 5JMWA 3VOTA 5K8LA 5L3SB 3FZEA 2WZQA 2ZSAA 1UZMA 5ALJA 2FVYA 4N8EA 1I0IA 4ZHQB 3S81A 3X1MA 2O9JA 1JDNA 2QVCA 2OBBA 3TSCA 3ZIDA 2H16A 3MHTA 2P6RA 2X4DA 4EPVA 1Z4QA 2CNOA 4Y1RA 5ERXA 4AAYA 3V7FA 3C24A 1OD6A 2PR2A 2XJ9A 3T7TA 1XK7A 4KI7A 4M1OA 3MINB 3AKZA 4EY8A 1C1HA 3SICE 3QPBA 1MTZA 5I7UA 2NP7A 1BXGA 1GZSA 1EFVB 1M2OB 1R1DA 4IXWA 3PNYA 1UJ2A 4FOTA 3OQJA 1QHIA 1ZHHA 2UDPA 3L82B 2E89A 1NC1A 4RU1A 5ECGC 4YUVA 1VLQA 3OCUA 2Z3WA 1MAVA 4FGSA 2LTAA 3OF2A 1EVLA 4UBKA 3T7IA 3VNSA 3L8FA 3RM3A 4DC1A 2WWWA 4J3JA 2ORED 1KJQA 5IC4A 1DEKA 2WJJA 4NX2A 2JLVA 2ATCA 2GM3A 3R5SA 1ZD4A 3X44A 1AKRA 1C3JA 4UTRA 1P7CA 2PL5A 4JNCA 3IPLA 1Y48E 3MERA 4C3OB 4CKWA 2EKPA 5JNWA 1U0LA 3GRCA 3EXFB 3Q5GA 3NM6B 2QXUA 4LPSA 3CZ4A 4F6RB 2JGMA 2CB9A 2VUSA 1EVJA 1Z2PX 4R7ZA 3TW8B 1TC1A 4DWJA 3CVYA 3IDOA 1JQ3A 5CX1B 4R9SA 4EJMA 2JGKA 2B98A 1M2WA 4TKLA 5AVWA 2VTBA 1AQYA 1GNQA 1NNLA 3P20A 3G17A 4P7GA 4DT1A 1DWQA 3GPDG 2FPPA 3CKKA 3C3DA 5FBVB 3GQVA 3LBHA 4RPGA 5AVZA 4WDQA 5GGYA 5J5CA 4ZO7A 4AFNA 5KKCA 5FL7D 3D3KA 3IBCA 3AUJB 5EHGA 1FMJA 2H1WA 4HDAA 4V24A 4KXLA 1SBTA 3GFRA 4YAWA 3LLVA 4DMMA 2YWJA 4S24A 4H59A 4UUAA 2H08A 1WXIA 2RHTA 4FCWA 3L46A 4ZMBA 5F2NA 1VKRA 4KL8S 4N0DA 4O1HA 3FPSA 4G26A 4RZXA 4A16A 1KI6A 1N2ZA 2O3RA 1Z2DA 2PA0A 2RK3A 3UQYS 1SC4A 5CLJA 2JLSA 5DFAA 3ZU4A 2D1FA 5KQPA 5BR4A 3DDHA 5JZ9A 1K7FB 4I6JA 4IO1A 2TECE 5A3VA 4AZVA 1SCQA 2XNCA 4KWIA 1UKYA 2FW7A 3HB9A 1JHVA 1FK8A 1KK0A 1AHNA 1T9ZA 1TKCA 2AOTA 2WT4A 2GCPA 3DHNA 1XXHB 1X1DA 3LAWA 4LA4A 5A3SA 4B40A 4C6TB 1W49A 1XA3A 3NPAA 2C8JA 3PFNA 4PBRA 4RA6B 1PJ8A 3RFTA 3PFIA 1BRMA 1V0JA 2HDNB 1UMKA 1WKVA 2I6SA 2YICA 4DQUA 4UOZA 3AI1A 1LSSA 1UMCA 2XMGA 3GPIA 4XVQA 3JZMA 1BHSA 4V38A 5UKDA 1AXEA 4BFTA 5LP6B 1M9NA 2ZAGA 4HZUA 4IHJF 4YHHB 4BY9E 3M6XA 4M2LA 4PR0A 4UFNA 3W7AA 1CZUA 4DCTA 4URXR 2OHXA 1V6SA 3TDNA 1NKSA 1T1EA 1LUAA 2EKLA 4KMSA 2HK6A 3EW9A 2V4ZA 2Q3DA 1TO2E 2QJOA 2O5RA 2R60A 4N5NA 3TL3A 2VHXA 1YFLA 4ZEMA 1WDWB 3CRW1 3I32A 4LGCA 2J07A 3UPDA 3B1YA 5HK8A 5I4BA 5CG1A 2AS0A 2W48A 5JMTA 1KNQA 3D6NB 5IM5A 1JHYA 5HKLA 3DOOA 1YCGA 1O4VA 2YBEA 2YN2A 5AH0A 3CPJB 3NBMA 4I50A 4NBKA 2AXEA 2F55A 1TECE 1WV1A 2P2YA 4FGKA 4Q66C 3ETHA 1QS0A 5IM4F 1XPOA 2JHCA 2GXSA 3LDGA 3WRYC 1NBWB 3I92A 3DE6X 3JQFA 4RV5A 2AG5A 1QIIA 1A1SA 3IESA 3OFNA 2R86A 4QUDA 4YJ3F 2JW5A 4MW7A 4DQ0A 5CA1F 4OGLA 1J09A 2BUAA 2RI0A 1MA0A 4FGZA 3GRKA 5K3BA 3E9QA 1FMCA 3FNEA 5J63A 1KY4A 1IUNA 1HG1A 3WO0A 1P4SA 3BWCA 1CUXA 1DWOA 1PLJA 1Q1BA 2CUNA 2QKYA 4Q9NA 4RL4A 1U99A 2I03A 1U6KA 3DLTA 1HT1E 2PKCA 4D6XA 3A6ZA 4PYMA 2YDXA 3UMYA 4DNPA 4MIOA 5G02A 5CCBA 2H7CA 4XUEA 3LLMA 3R0JA 4MYUA 3WVNA 3BHJA 2XNHA 1S7CA 2YV2A 4J0FA 4M7WA 3CW9A 3HA2A 1T15A 3NHPA 4UW9A 4QUKA 5TGTA 3HCWA 1J24A 4UM7A 2HCRA 4F5YA 1GJRA 2JH3A 3HCCA 4YP5A 5KAMA 2GD0A 2RH9B 3ENNA 3TPCA 2IWRA 4M53A 2VPTA 3K9CA 1B8PA 1YJAA 4BX2A 2XBLA 3EPHA 2G04A 1DT3A 4K46A 3FCEA 1T3SA 1N33B 1PI3A 2DPGA 4K8OA 1EE9A 4EELA 1Z0FA 2OPBA 2VRCD 2ODTX 2OK8A 1RZRD 2PZEA 3WDSA 4FN4A 4QJBA 5CMLA 1J39A 1ECLA 1V3TA 2FZGA 5EMNA 2PKYX 3P9IA 4WMLA 3AETA 4O02B 1CC1S 1MZVA 3L0SA 3T1YB 3VVLA 3NHWA 4C7MA 2ZYAA 3C1OA 4BQQA 2PH1A 6NULA 3OP4A 4BNHA 4N0EA 4DJTA 1J9ZA 3AONB 1FFSA 3OMLA 4FX5A 1BVHA 2I1WA 1WZIA 1Y6ZA 3R5XA 4NBRA 5EPEA 2QN7A 1FDUA 1R4NA 3A7DA 3DKIA 4JGBA 3BVPA 3QE4A 5I9SA 5K3SA 3VHQA 4L75A 2AKYA 1P9WA 1ZK0A 1ZSVA 3IMCA 4LRSB 2BYTA 4X8LA 2AC4A 2PH7A 4JX8A 4J43A 2J5XA 4YH1A 1QLHA 1K0UA 3W04A 5HQ3A 2FU5C 3TG2A 3W2HA 3MVEA 1D4FA 4X93A 4JD5A 3MG9A 5DOVA 1RWNA 3ODPA 1N75A 2V54A 3DL4A 1CUGA 4R5MA 4KFRA 4MAAA 3QKWA 4C01A 4DSZA 4CCYA 1MW8X 2F64A 3DE3X 3ADDA 1CVIA 1JNXX 3PXGA 1E8NA 3E9RA 2HCBA 5K0ZA 4RDHA 4K2HA 3B6KA 1JAZA 4ZIRA 4URYR 4KR7A 1Z6GA 1FA9A 5FOSA 2QIPA 4BQNA 1K0FA 1MO6A 5G4KB 2H51A 3QFCA 1D3AA 3ND8A 1DHRA 5KJEA 4ENRA 1GY8A 3CLKA 2VTDA 2Y1GA 2RJ3A 1SY7A 5ALVA 4DBZA 4G8DA 4ESVA 2QGFA 4C4AA 5JALA 4ZODA 4QDJA 1PFYA 1L7XA 2WYHA 1XKXA 1YS2X 3V8VA 4X7RA 5A7FA 5CFOA 3KR1A 3NRCA 4A0GA 4BASA 2C5SA 2XQKA 2QTFA 4CW7A 3CXUA 3UK6A 3EDCA 2W2LD 2KYRA 1WQ1R 1C29B 1C1YA 5EJ2A 4BPBA 1W6UA 1NDUA 4W8OA 3K0SA 2EJBA 3COPA 4PWZA 1G8HA 2YFKA 4IFBA 2WB4A 4ZRDA 5FD8A 5THXA 1A9XA 2XWQA 2V9CA 3QMMA 4U1RA 2VQEB 4Y0NA 1VPWA 5KTYA 4TT3D 4V3BA 2GUGA 1NBMD 4Y2SA 2WV7A 2IEBA 1BWQA 2O06A 3BQ9A 2O2CA 4JQSA 2XMZA 4PZYA 2VP3A 2YRFA 1SG0A 5CT5A 3WV5A 1M7BA 2PN1A 5ADUS 3PZRA 3E70C 1Z62A 2LZ0A 2YV5A 3OLCX 1RHQA 1ZM3A 5LD2C 2YHIB 2IHKA 4YJ2B 4JLNA 2OKCA 4CWAA 3KTAA 1E9SA 1WXGA 3M9LA 5CPFA 4MUKA 2XJ4A 1GU1A 2VJKA 1XAGA 1T43A 4OH1A 3X1ZA 1X8XA 2I22A 3K35A 4NE2A 4MPJA 3BC1A 2CT8A 3P5BA 1SC9A 1EJ6A 4X1YB 3BDIA 5DGCA 4ZCMA 1JHUA 2CC2A 3IOYA 4FMCF 3ZWQA 3T9BA 4AZTA 5EUQB 3D2CA 5KOJA 1OAKA 2UUAB 4IBOA 1Y8ZA 1IYZA 4JYMA 4TTJA 2H1IA 2XVYA 2PGLA 2QMQA 3T9AA 2WMDA 4P3XA 4UHEA 4KAAA 4KO3S 1NULA 2G67A 3RK4A 5KTNA 2HC9A 1B15A 1R15A 4C87A 4WXEA 1H4VB 1QAQA 1T34A 2IIBA 1JZQA 4PHFA 5FOUA 3W5JA 3N0WA 1SXHA 3ELYA 3SIPA 3A1NA 5HRAA 5CBPA 3HKDA 2PUDA 3AI2A 1W59A 1AS0A 4MQFA 1IBMB 5LXTF 2PQMA 4JJAA 5AM2A 2W2KA 2AG1A 2VA8A 4MDEA 1E1RD 1MXHA 2G70A 1H65A 3ORHA 5E9JA 4CIXA 3K9LA 2IIPA 4YRSA 1RLIA 3QNMA 1PV4A 2VWGA 1T0JB 3K0FA 4J2HA 1JQBA 1I01A 2ABWA 3GJ0A 1PJAA 3MTAA 4RH1A 3D6UA 1B8VA 3L49A 4F5ZA 2RIPA 3RSCA 1HFWA 3RYFA 2VOEA 4A1OA 3WK5A 1NTRA 4RLSA 1EB9A 2NVUB 2H1OA 2EZTA 4PS1A 1XXHE 2H29A 2F8SA 3LQ4A 4XGQA 4OGWA 4XWGA 3VH3A 2QPOA 3WOVA 4CM9A 1A69A 5JBIA 4KR2A 3AKCA 1RJFA 3LUCA 1ZLXA 1NBME 1CY7A 2VYFA 3ELDA 4C7XA 4BQIA 2AEFA 2CXUA 1YSCA 4D46A 1UOPA 1MHPA 2GAFA 3DOCA 3KZCA 5DBHX 4RULA 2RAVA 3JYNA 4IS3A 2AFHA 4OYYA 1P4RA 3ZWKA 4E5MA 1YJ5A 3WGHA 1NW5A 3FDJA 2FN4A 1N7GA 3OEEA 1G9SA 3IVRA 3SDBA 5I8WA 3FMIA 5EFZA 5E8RA 4E5KA 3GPLA 2HMYB 2RK6A 4I5GA 1WSDA 3VNUA 4NPCA 1U90A 2GN8A 2GPYA 2FDCA 1T9BA 4Y3UA 3WYNA 4ZALA 1GA1A 3QXXA 1U3DA 4BFXA 1P80A 1T3GA 3KE8A 4TV8F 2V6GA 1P0PA 3K0AB 5H59A 3M89A 1Q3KA 2X4IA 3GRPA 2OFWA 1RHRA 2WB2A 2DM6A 4TUYF 5JSQA 3OX3A 4IIGA 3HXTA 1QB8A 4K5QA 4ERNA 2QRVA 1NIPA 2JIMA 3DL0A 3LHFA 3ZHCA 3WP1B 3BJRA 2AA3A 4FOOA 4BRZA 1GSIA 1HRKA 1YK0A 1ZH4A 1XTTA 2R66A 4J0QA 4PNPA 4E5NA 1FYXA 1TQ6A 4PG4A 4BLWA 3CN7A 2Y71A 1DXHA 4S0XA 4G8CA 3NTVA 3TTYA 4YY3B 2KSQA 4DLRA 1OX5A 1ZGBA 2I4MA 4U6NA 3ANYB 1FE8A 2EFCB 4C0HA 2KPOA 4CFZA 4YJGA 3IAEA 3BTSA 1SVKA 4IQ8A 2JAPA 2QT9A 1G6KA 1EFRA 2A35A 2FWBA 3WYBA 3CM0A 4EM6A 5K05A 3Q3GE 1V6AA 5FOWA 3KQVA 1JTFA 3RTEA 2J0EA 3GEGA 1W0KD 5TGDA 4PFKA 5LD2B 5FEUA 2C1ZA 1THTA 1T29A 2I1LA 4Y6PA 2GT1A 5GADl 4H0NA 1QK4A 1V5EA 1W29A 1A9YA 3HL4A 5KOHB 3CSUA 1R0XA 3WHKA 1E98A 2IF0A 4YT4A 4I14A 2ZTMA 1O9BA 4LYHA 4FNMA 4I08A 3PF8A 4QYWA 1QP0A 5G4LA 1XCLA 5H5JA 4PU0A 2C42A 3F4BA 4B2YA 9ATCA 1XZPA 1IY9A 3H3FA 3NHRA 1JJAA 2A84A 3CGGA 4AKHA 1NUSA 2PGJA 2JAOA 2E21A 5G0TA 4KQMA 4Q4LA 1O5IA 2W43A 3W8EA 2NUPA 4DR4B 2P4UA 3BUSA 1V96A 2QDKA 3V4FA 4OB7A 2IZ0A 4UTVA 3RAPR 5EZYF 5L6LB 2AFRA 1U8ZA 1XQ6A 3CPHA 3W4JA 4B3SB 2IYFA 3BFVA 5BP7A 2N46A 1BCRA 3AJAA 4LTDA 3O4IA 3HDTA 1Q19A 2R44A 4FI3F 2FSVA 3UATA 3GFQA 5C1OA 3S40A 1M2FA 3DZIA 2JDID 1OILA 4HAXA 1F7VA 1L4HA 2UZ0A 2DT5A 1Z4IA 3LUBA 4LXYA 4PQRA 5IS2A 1CUAA 4ID3A 3IUQA 1IZ0A 2IXGA 2RHRA 3GJ5A 4KQFA 3COYA 1FJXA 4CF6A 1W5AA 1M6HA 2JCSA 3LBYA 2WDZA 3M4YA 4KMMA 5IAKA 4AY4A 2UVQA 4A7PA 4EY7A 5F3WB 1A8IA 3SMQA 3U4DA 1RR6A 3Q2KA 3WGMA 1NJ1A 3REGA 1S1MA 3NNNA 3PFFA 3T7SA 1G9TA 3FJYA 3A6FA 2AI1A 3FR7A 3CLVA 3WMGA 2G4VA 1P0QA 2HCJB 3VR3A 4B3RB 3CVJA 4E4RA 1YCHA 5AVXA 1OWOA 2BFBB 2JVKA 3K3PA 4US0R 1AG9A 4JUBA 3RYHA 4IIDA 3O6VA 2HBRA 3ICCA 3FPFA 2HLPA 4RWZA 4OLBA 1CQIA 1N2BA 1HTWA 2JGJA 1K7CA 3NOOA 4GHWA 1RYNA 4H1WA 3CFYA 5KNDD 2CJXA 3EFOA 5G0UA 1PQ4A 1U65A 1W35A 1PS9A 1XEAA 1LU9A 2KBEA 3IV7A 3QX7A 3LO8A 5ISMA 1JEQB 1WUYA 3EGCA 4O59O 4XVRA 3VO1A 4FZJA 3DV0A 1SIUA 4P7KA 3ZJTA 4BAUA 1PJQA 4MRMA 1E2PA 3RIEA 1X92A 2M98A 4HFMA 4PIPA 3R9IA 3VR5H 1ZSYA 4RPHA 3ZWMA 4GI5A 3UXMA 3TNFA 4DLKA 4E31A 5KNBD 2IZ6A 2XMDA 4EVIA 5KJ1A 1QX3A 3L40A 1K7EB 4PW0A 1RJDA 4CEIA 5KWSA 5D3ZA 1F14A 2WFZA 1NX6A 3ROQA 4CKZA 3RADC 1JG3A 1VXRA 3H1GA 4MNTA 1LTKA 2H1SA 1P7ZA 4EATA 4JDUA 4PGFA 5JD3A 3MUFA 1Y81A 4D74A 1PJSA 4AJNA 1E6EA 2PZAA 4MKFA 3CB2A 3BIJA 4UHKA 4UMFA 3BSFA 4EZBA 2FE1A 1QGYA 1SELA 2JD0A 2P6OA 3IP6A 3T54A 2NXCA 1WHTA 2FQYA 1G4HA 5E6SB 4OMUA 3DTVA 3D3EA 1X80A 2VXOA 1Y7LA 3P4YA 3JR7A 3BMQA 3I53A 1JKJB 1NYTA 1GUZA 1NURA 1SUWA 1TF5A 4TWRA 1QO0A 4NYMQ 4K9OA 1OJ7A 1NF8A 3GCXA 2ZREA 4BB6A 1RI2A 2J0UB 5KBYA 4Y9UA 2OILA 2YIDA 2ZTHA 2QL5A 3R0XA 4YB8A 5IP5A 2MYTA 4RZUA 1AXGA 2W83A 5BWLA 3E5NA 3EZ6A 1HYHA 2WW8A 1FFBA 4EPXA 5TEVA 3VQTA 1HDEA 4FQ8A 1QIMA 2ZRQA 3I1YA 5JS8A 3JQCA 5JJLA 4IQ0A 5C32A 4GH5A 3JASA 4V0OA 2WSIA 1I33A 1BU5A 2G08A 4XLLA 4JKYA 2IDMA 4ITUA 3EWAA 4MUFA 1KSJA 2EFDB 3CUVA 5KOJB 4BVJA 4D3SA 1U1FA 2R87A 1QGOA 3W3ZB 3I0ZA 2OCAA 4CFSA 3UOWA 3LX5A 4O4IF 4ENUA 1XQ9A 4RFLA 3TRJA 4UE2A 1RQ7A 5EIOA 3ETGA 3J80A 3HUFA 3B1VA 1E32A 4KBGA 2AE1A 3RJMA 2FB9A 3C70A 4DUGD 2H52A 4A5OA 5IVPA 1XTKA 3A1TA 5CDFE 1K8ZB 4G63A 1QCYA 5EIAA 2X0NA 2B5OA 2BI8A 1KH1A 1ODSA 5KVVA 4FMBB 2C9DA 1I13A 2RJNA 2XNDA 4FXPA 4EZIA 3NWJA 3N2EA 4QTYA 2NP6A 1EDEA 2O8BA 3M6IA 1H5NA 4EJ0A 1Z6TA 4JQOA 3MWEA 1YZKA 2BVNA 3FCAA 4HGYA 5BUSA 3NBYC 2OORC 3P4XA 2QOEA 5BNTA 2QX8A 3C3AA 2PU5A 4AW9A 4FYHA 5KX5B 3HFJA 4P0QB 1QVWA 3P9QA 3C6KA 4KYTA 3G6WA 2HA6A 1RWMA 2JJQA 4FYXA 3HJNA 2OHGA 3FYTA 1BSVA 2NTVA 3NB0A 4R83A 5TPZD 2QRQA 3NEAA 4QFBA 4DNFA 5KNCH 1Z8FA 4C22A 3A04A 2OSVA 3BB4A 3FX2A 1NBIA 1OLXB 1TD1A 1BKDR 1C2TA 3N7UA 3QBDA 2D74A 4H17A 5BRNA 4D45A 3QE9Y 3OT1B 2R00C 5H81A 1KR5A 4OTZA 3VNQA 5A4DA 5JT1A 2PZMA 2DGDA 3IRUA 2J0VA 1ZJ6A 3KOZA 1OWNA 3PUYA 1Z6XA 4OMFG 4PSUA 4BQEA 1FP4B 3C87A 4KFTA 1AUXA 1P0MA 3LZDA 2JLWA 2OXRA 2ZE7A 3RS8A 4RHYA 1BYUA 4XLTA 5A02A 4TWAA 1JYEA 2IX9A 4AROA 3HYNA 4MR8B 3ZXXA 3HKEA 2HA4A 1I0ZA 3AHDA 3AHJA 5FBWB 1VE6A 2E4UA 4LE2A 1B3BA 4YQFA 5CLHA 1J1IA 4HDNB 1EP9A 3PV0A 1HKHA 2B94A 4XZ3A 2CLKB 2R68A 5AKYA 5MDHA 4ZDJA 1SD5A 4M87A 1OLSA 2C54A 4QXPA 3TRHA 4D42A 4YASA 2JIOA 1P17A 5LN1A 1YA6A 5L3VA 1DC5A 2QR2A 3KYDA 2P9FA 4YVFA 1E79D 3FWNA 1VSVA 3QLEA 4WK2B 5FI5A 4U63A 2I62A 3UM9A 4ZRNA 3ZR4B 3O47A 2J6IA 2GBLC 1AGPA 3KJGA 2CL0X 3CRRA 4R3NA 3E9EA 3EQ2A 5KDLA 5LNK1 3JAWB 2B78A 1A2OA 1VLVA 4LWZA 4B87A 4HWPA 1U9IC 5EIFA 1QH1A 1P1HA 3NW9A 1G7RA 4EH1A 4O29A 1DE0A 1GN9A 5J3JA 2BN4A 1ZJ5A 3H99A 2ZI4A 3SXJA 5IAOA 4LYEA 2FGKA 1SO8A 4IVRA 3T94A 5F5NA 4AT1A 3DAOA 4OMCA 3PGJA 2D7DA 2G80A 1U7ZA 1UP6A 2RGXA 1ZGHA 5IX8A 4LZNA 4EGJA 1EXWA 3U61B 3EQ9A 3ZHQA 3DVAB 4IVNA 4LI0A 4NENB 3VM6A 4A1FA 5CAEB 1JHPA 5LDDC 2Y9PB 3R40A 1BA2A 4IGEA 3EGDA 4FHDA 2G0AA 3MEQA 2X7JA 1QTNA 1XRLA 4A03A 1WMBA 3TLBA 2I54A 4W8GA 3F5DA 4QGAA 1TJNA 1GKYA 4NXMB 2C7VA 1IN1A 4U5QA 3LKZA 4MR9A 2Q2OA 3H8SA 3V9AA 4IOLA 1CUCA 5A62A 1YH3A 5TQJA 5EE0A 4E32A 2VR1A 3BL6A 3LUGA 1FL9A 4B35A 4FPXA 4LGVA 4TLMB 2P9HA 2Y27A 2VXCA 1NLUA 3K94A 4ZAYA 4EF5A 4HUTA 1CB7A 4G0XA 3WQBA 1E3WA 4HC4A 1V5IA 1NG9A 2PO7A 3NWBA 8OHMA 2BGUA 2J6BA 1FNBA 4M7PA 5C81A 5CEFA 4CKEB 1LPNA 1QIFA 3VR4A 3AEQA 1DADA 3EY4A 4IHKA 3EBOA 1YQDA 2VAPA 4S04A 4Z7OB 4M0EA 3PC8A 2DFDA 4MUEA 1ZNWA 4RVDA 2C61A 2GNAA 2DPMA 4OREX 5PNTA 4UQOA 3NHBA 1L5GB 5BQOA 1M76A 2P91A 4P4UA 3FPAA 3SQXA 3GJ7A 3KVRA 4I6EA 1M1YA 3IAXA 2R97A 4LCJA 1HE8B 3QPUA 2Q99A 3DZDA 3SZMA 3PHCA 3TQQA 1TM7E 1P77A 2FSHA 2FKAA 4PZEA 2WZCA 3R5TA 4J7XA 4YRFA 3ZV7A 3Q7EA 2FN3A 5IVHA 1QQBA 2J59A 2HYIC 4KCGA 3HJUA 2QM0A 3G49A 3H2HA 2JFBA 2CJPA 2H9AA 1CZHA 2RGUA 1G8PA 1RHUA 4Q7MB 3HI4A 2H0AA 1E62A 2BMEA 2R6HA 2W2MA 4AECA 3M83A 4JUAA 5I7WA 2FW8A 3PQEA 3E22A 3KT0A 3VU0A 1VPEA 2YVQA 2EU8A 4ROTA 5IDWA 1JG1A 1KI7A 1S96A 1Z2OX 3QIAA 1Y0BA 1VJCA 4EMSA 3F73A 2GRAA 3GLIB 1HYEA 4HWSA 4ZOQI 5C31A 3PYLA 4LVCA 1Q21A 2WWTA 3ADPA 2I6GA 4G3XA 4RPIA 3VNRA 4RZ3A 1QTQA 4JZYA 2I80A 3DOUA 4QGSA 4EG1A 4UU1A 1H3FA 1L5MA 1MBZA 2O2EA 2YHUA 3LP8A 2QTLA 1OTXA 1YCDA 2W2XA 3OTWA 4HGZA 2WM2A 2YXEA 1NN5A 3QA3E 1QR6A 4N3AA 2R8YA 2ZUVA 1TI7A 4IDNA 3RNLA 2PUCA 1EDDA 5H70A 3ANTA 1FB5A 1B73A 3CZ9A 1Y82A 1U02A 4N01A 1A88A 4J94A 5FNZA 1DKRA 3R6DA 1NGSA 3ER6A 1MLDA 1OOEA 2QLFA 4AZ3B 1J0DA 3BG5A 2W0SA 2ZSEA 2X4GA 1JB9A 4FOSA 1YGYA 4WK6A 4XM1A 4QZVA 3VX4A 5AW1A 1H05A 3E7XA 4M46A 3Q2OA 2CWDA 2ECOA 2JGDB 2X1MA 1PQWA 3VYRB 2QMYA 5JAUA 1Z9BA 1X7YB 4KLCA 4Z0PA 1Z56C 3ZDYB 3DLIA 4L9AA 1CR1A 2QROA 1IY1A 1GTVA 2FG5A 2ZJ8A 4EUHA 4R8VA 5HGXA 1VC2A 1PJ3A 3F8TA 1ZNYA 3KOWA 1GFIA 3M82A 4B75A 3PQ6A 3S5UA 2JLCA 4PGHA 1DO8A 3FSGD 1Y1SA 2P9BA 1M2HA 3LFUA 4UXHA 3MWLA 4BKPA 1HDYA 2CJWB 1KVRA 3OC6A 3FW1A 3G2PA 3THWA 4KQGA 3KOMA 5LBIA 1DG3A 4FIZA 4Y9TA 5HKKD 1USKA 1E7MA 2HMWA 1WZNA 3B53X 4YAFA 4ZOEA 4HS9A 2CVFA 1S2OA 3SSNA 1AK9A 4OK5A 4XH9B 3RVLA 1RVV1 3COZA 3VUEA 4C14A 3LMKA 1DNPA 1DQNA 1OE0A 2ZETA 1PCXA 2PSSA 2PDAA 4KXNA 4KWCA 1UR5A 1BE1A 5GM2A 2PZFA 3ABQB 4FLFA 4KYVA 3NHMA 5AK6A 2Q1SA 1MNQA 3KOXA 2QB5A 1QLJA 3IIEA 2BCJQ 2NU6B 3QBVA 3D31A 1OX4A 4GKBA 4Q93A 4RTQA 4C7KA 3HR8A 3V34A 3ZQUA 2WQ6A 1OV4A 4MGEA 1VDMA 4QEKA 2REQB 1G41A 5A5VA 1J0EA 1DTSA 1KYWA 2X9GA 3A32A 1ODJA 3FMPB 5CTAA 3TR6A 1ODLA 1IPEA 2HN9A 5AHWA 1P45A 2Q4EA 1OTHA 3OUTA 1AF4A 1TMGE 1EBFA 1M2KA 4G65A 2QN3A 1KSFX 5B3AA 5MFPA 3U16A 1R37A 1DLJA 2O6HA 3ROFA 4JA2A 4N39A 4ZARA 4C4OA 3G2OA 5LLTA 4YRZA 5H3HA 1I6KA 1P75A 4QULA 2V45A 2YYAA 3C98A 1OH8A 1LSUA 3TSYA 2IPNA 4DA7A 2R8RA 2O5CA 3R24A 1X38A 1Z5GA 3Q40A 3QYPA 4LWOA 4O4IA 4PO3X 2DHDA 1E59A 2MCFA 4Q01A 4C05A 4UQLA 4EKDA 1JU3A 2CFRA 4IUBS 1Z07A 1FX1A 5HXAA 1E2HA 1TIPA 4KWTA 1VB3A 1ZKMA 3M1IA 2CUZA 4ZCLA 4CIYA 1RM5A 1ONPA 5I9BA 1SG6A 4MAMA 3OM8A 4QPNA 2BFMA 4BC1A 3OZRA 4NEQA 5HJ5A 3N53A 3GIWA 1ABEA 3A6DA 2HXYA 1KOJA 2C7RA 1E9DA 3AI7A 1CD5A 1U1DA 2CLIB 3OCZA 2QAGB 1GQQA 1RKVA 3T5MA 4AVYA 1RRKA 3P4UA 3NCHA 3G2MA 5GJWC 4BVLA 3D4NA 2EW8A 2ZUTA 2E4WA 2N42A 3C5WP 4EAQA 1Z82A 2BGTA 1C9MA 2V97A 5DI3B 3BK2A 4JT2A 4MX8A 4F4IA 2VPQA 2J5KA 4NL4H 4TWZA 1IOVA 5KMGA 1THZA 4X20A 1IIBA 1ORDA 2O05A 3UPTA 3EUWA 1CY2A 1I7SB 3BGOS 3KKLA 3PC2A 1FJ2A 4HWRA 1W88B 3K2BA 1N2HA 1VE9A 4BV9A 1RTTA 1EFPB 1CCWA 2E37A 1QHNA 3LWBA 2I7XA 2ZJAA 4IIXA 3MB5A 3L8YA 3RYIA 4QJ3A 1Z5WA 2FN7A 1E1DA 4B8ZA 4MS3A 3QVVA 3MJRA 1AKUA 1AK1A 1KKLA 3ZH2A 2LNDA 5DOZA 4AWBA 4AC9A 5C1PA 1S8NA 2CMDA 3I9V1 1F48A 4N8DA 4U9HS 1R18A 1W581 1UH5A 3GLHA 3HYTA 2MDTA 2O0LA 3IDSA 2ZIWB 3F96A 2AFIE 4LW8A 2F3RA 2ORIA 4Z4GA 3Q87B 1F6BA 4IIYA 2FUKA 5TQ2A 3F3SA 4D1YA 3WL6A 3QVGA 1L4EA 3GBVA 3IX7A 5DCUA 3WGZA 4MV9A 3QSYA 3UY4A 2A4MA 2CXNA 5DNAA 4YC7A 3STWA 3D5QA 3TG8A 1KYIA 2GTHA 5AKGA 3MMZA 1LTQA 2VAMA 1B7GO 4U7TB 4AWXA 2X5XA 4XWTA 4M6WA 3SBDA 2YQ5A 1SUIA 4MI1A 5B1SA 3QPWA 4X62B 4O0MA 2R6AA 1BVUA 2OBNA 3SBEA 2QG4A 3T5TA 4DJDC 1AOXA 2EEPA 2PO5A 1VMEA 3GCZA 1Z6AA 3GG9A 2XNKA 3GJRA 2HHAA 3KJEA 3P9YA 1VL6A 2P9YA 2Z2XA 1O96A 1D07A 4RF4A 4ZT3A 5LB4A 5H9WA 2I99A 2A88A 3M81A 3DEYX 3KOOA 4OHFA 1MRSA 4DREA 4BJ1A 3O8DA 1IC6A 1E1NA 1S2DA 3RSLA 2CLSA 3AQ4A 5E38A 1ZUIA 3KU4A 4MQ6A 4YMWA 1K6MA 1G7CA 3H7IA 1U4SA 4RSRA 1SC1A 2P11A 2WV9A 2ID4A 4NNOA 5BW8A 5BVHB 1Z15A 2H54A 4TZ0A 5AQ1A 1QONA 1H8HA 3HN6A 4XVHA 1Y5LA 1DS6A 4ENWA 3KS9A 2Q9BA 1HE2A 3GZNA 1PZXA 3NTUA 2Z4SA 8AT1A 3EXG2 1KL7A 1JPUA 2PKXA 2B8WA 1T13A 4D4IA 1CJBA 1MZPA 3N70A 1X9GA 2XRFA 3Q9NA 2CDCA 2VK8A 3AHIA 4B6PA 2D5AA 2ZANA 1CXZA 2BFNA 3O8LA 4MLCA 4MGKR 5BOSB 1IFXA 3JWGA 1GD1O 1IU9A 4XQEA 4W5NA 1F6DA 1OV6A 3CZMA 4KRGA 4RM2A 3L79A 3BF7A 3DMPA 3LPLA 1HYQA 3ZXYA 3VKVA 5JCPA 3NKFA 2XDAA 1ESDA 2ES4A 2VPIA 3HN7A 3T3PB 5P8WA 1WM1A 4D79A 2YHBA 1TQDA 3H84A 3QIVA 4KKXB 1QB7A 1Z0AA 2JI6A 1EB8A 2P2GA 4RHCA 4Z1OA 3FNRA 1V1RB 4BO3A 3M9WA 2YJTD 3E18A 3R41A 4NCHA 4HXGA 4XJTA 1ANKA 5JJBA 2I6QA 1PYGA 4EG4A 2PWBA 1R5OA 1E92A 1PK7A 4GOMD 5FPTA 2G9RA 3KHSA 1E9EA 1I51A 1XMXA 1GG5A 2TMYA 2VZ0A 3ORSA 3OURA 4TV9F 4WA8A 4BTLA 4L27A 1Y33E 5IASA 5B1IA 2NSLA 1ZZGA 2JAQA 4O2AF 3HBJA 3O21A 4GVXA 2WICA 1H3EA 1GZVA 2H5JA 2RGNA 4MWEA 4TOIA 5GV8A 3FTEA 4F1JA 3K6SB 1PGNA 2DMRA 3E3MA 3H5AA 3R1IA 1PTKA 1EP2B 1PT8A 1R5JA 5A9SB 1ADFA 1J4AA 2CHEA 3O2JA 2ECKA 3R5JA 5CURA 3NUGA 2C9MA 3IUPA 3O94A 4XSHA 4J16A 2QMHA 4KO2S 4CM8A 4BO0A 5HGJA 1SOVA 1N9GB 1E2BA 1BMDA 2NTYC 2XI4A 3HY3A 5DK4A 3GA7A 5BNZA 13PKA 3PQ4A 4RVCA 3U7RA 5CNJA 3IP8A 3V1MA 4HDRA 1JT9A 5EVJA 5B3LA 1NBEA 4WKOA 2DWQA 2QI9F 4U2EA 3QBTA 2F17A 1XLTA 2QMOA 3U7EB 4L9SA 2VUIB 5ALGA 1P1IA 1GT6A 3V4ZA 3C16C 1TQ2A 1W94A 2Q62A 2QQGA 1RZUA 2Z30A 4D0SA 3PFBA 5JATA 4IGFA 1YU6A 4UVGA 1KBZA 4WKGA 2B82A 1OKKA 3FXAA 4JKOA 1OC4A 3CSDA 1YDMA 2O2HA 4XDZA 4H6VA 4Q03A 3Q8MA 3FRJA 1TXGA 4EEXA 5IC6A 1PJ4A 5T8KA 3HNRA 2GK6A 5CA0F 4OSEA 1Z47A 2LR0A 2ZVPX 3GVIA 3HBAA 3KVNA 4KDFA 4WEQA 4HYTA 1GPBA 4U02A 4QUAA 5KKAA 4JOCA 3ZLTA 4FJ2A 4D3YA 3SOZA 3HKBA 4FFNA 4HGPA 2CMGA 1RWPA 1DV2A 3UEOA 3BCHA 3K53A 5IN4A 4BLUA 2HA2A 2HNKA 2YY6A 2G77B 1FMLA 3JU3A 3KQQA 2BGRA 1A9TA 1QUFA 1U7DA 1QUEA 2E1RA 2Y1FA 2EKQA 4TKZA 5COQA 2L17A 2XBMA 2BT4A 4KXXA 1LPPA 3O91A 4PR3A 2GN9A 5G41A 1ECGA 1WVGA 2C77A 3KYCA 3O9ZA 1KZHA 2AN5A 3FLBA 4D02A 4F86A 1U7TA 3D6TB 1YC5A 1EUYA 1M33A 3IAM6 3WRWA 1TEZA 4JHLA 3GELA 3WIUA 1OPXA 1NOIA 2WUWE 5ARDA 4JT4A 3U3MA 5CLGA 3KZMA 3DMNA 4UHJA 2NQ2C 3QMVA 3KUCA 5LDHA 1J97A 4M8KA 4L9WA 4UCWA 3WK6A 3A27A 2XV1A 3WTCA 1XVIA 5ELXA 2R9VA 1ISPA 2V9PA 1EG7A 1V41E 1XRSB 4HEJA 4ED9A 5A9TA 1E0JA 4ZYTA 3IHWA 4LOHA 1XUOA 3KTFA 3E15A 4KLNA 3NAGA 1HQKA 3O7MA 1Z25A 5JVDF 4HF7A 2QN9A 5GTDA 1USWA 2JFFA 3IVXA 2IQIA 4U8GA 4I9GA 1W96A 4PGAA 3TLGA 4YRJA 5JUWA 2QP9X 4GNRA 4GG1A 2F4VB 1NMYA 4BL5A 2GZRA 2P6NA 2CNKA 2YZMA 3LCUA 4QICA 4E30A 2WJHA 4QC2A 4UNSA 5I8ZA 1QK3A 2BTQA 2HCTA 3SX0A 4ES6A 1CHDA 1XF9A 2DCUA 1H1LA 2PFSA 4PNHA 1H4SA 1PDOA 1UADA 1AS3A 1UZUA 3C4JA 3UT6A 1BS9A 3N39C 3ABZA 5LR6A 4I1PA 3QP9A 4JB0A 5C1BA 1VKZA 2FCAA 2AZ4A 4G5HA 5KTPA 3MWDB 4QXQA 4U7HA 3DEAA 1AHIA 3ONVA 1BKSB 4K87A 4AUKA 4CLXA 2QD5A 1N0HA 3VDNB 3I04A 2GA8A 1G2QA 1Y8QB 3ORQA 4RCVA 4KN8A 4U39A 3ZE2B 4D4JA 4BB5A 2IYVA 1HT3A 4II2A 1NIJA 3KWJA 3PHJA 2RH4A 2C2WA 2YY5A 1GAXA 4GOJA 1YTLA 4K05A 2YUTA 4PC2A 4EJFA 3CVUA 5FTNA 3ILSA 3KXIA 4LZOA 2AG6A 4J4BA 1C30B 1X6VA 3VI3B 4BNXA 4DMUB 5KQGA 2VQ6A 3EGXA 1MB0A 3VR2A 3Q85A 3MMPA 2QL6A 3O5AA 3R9WA 3ZV6A 4K0KB 3HSYA 3W9YA 1SXGA 2Q4TA 4YMUA 4ZZIA 4W1RA 1EVKA 1STOA 2Q9CA 3UGJA 4ZU3A 1QPZA 2R1UA 2ZRKA 5EQJB 4DRZA 5KSZA 5C5DA 4BNLA 3IA2A 3FOZA 1N34B 3L4BC 2GFIA 1N92A 3H6HA 4OKIA 3QE3A 1MAAA 2OB1A 2QN1A 3H83A 5DWVA 5AQEA 4IZOA 1Z4PX 2Y68A 4GI7A 1ST3A 5EMKA 2RHCA 3U60B 2RHHA 4PZPA 5A03A 1JH8A 3I9NA 3NUQA 4Q4AB 3LT5A 5FBLB 1QU2A 3DBRA 4KQIA 1LFDB 2ZJ0A 3CX3A 4BVAA 3D6HA 3DBVO 4GZ3A 4A10A 3SHTA 3VZPA 3AB3A 2QV0A 3IUNA 1HNZB 1FIUA 5LMCA 1MVOA 3HXKA 5JASA 3R09A 4EP1A 4ZREA 3CR3C 3FRIA 3Q2IA 2WP0A 1SZDA 3T1VA 4O4HF 4YRCA 2JKZA 2NU8B 4HAYA 5SYAA 2JI8A 3IHTA 4KE8A 3LXXA 2QMZA 4KMRA 2XUHA 4MUYA 4BVKA 5HSGA 2E5LB 2A86A 3KHKA 4EG7A 5JC8A 3C43A 5FBZA 3TGLA 3GGDA 2CLHB 4JJGA 4RD0A 3FKSA 4OF4A 3TEMA 1TCCA 2IITA 3WJ7A 3ZV3A 2NOAA 3MCUA 121PA 4MGYR 5BSMA 1BJKA 2PPLA 4OQXA 3L4JA 3I5XA 3FJ1A 3I4FA 2FFAA 2G6TA 2IKSA 4WBNA 4I1UA 2PUJA 4XAQA 4ENSA 1G20A 1RWOA 1ESMA 2BGMA 2X3YA 1DKPA 3R8CA 3Q9SA 5ALEA 5DX1A 5AUNB 3IQIX 3QU5A 1WUJS 2VNKA 5JNTA 3BRWA 3EPRA 2VNHA 4JI6B 3L0IB 1U5BB 2GYYA 5BRAA 5AVVA 5EWJB 4OU4A 2C2ZA 2DEUA