1EQ2A

The crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
307
structure length
272
Chain Sequence
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQIMAGEEFGDVEAIFHEGASSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIESREYEKPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGSMASVAFHLNTQLNNKRDFVYVGDVADVNLWFLENGVSGIFNLGTGRAESFQAVADATYQAFTQADLTNLRAAGYDKPFKTVAEGVTEYMAWLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
publication title The crystal structure of ADP-L-glycero-D-mannoheptose 6-epimerase: catalysis with a twist.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 103
structure length 272
sequence length 307
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.1.3.20: ADP-glyceromanno-heptose 6-epimerase.
pdb deposition date 2000-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eq2A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1eq2A02
3H65A 3RC7A 2FR1A 1PZHA 3NT2A 2HDHA 3GPIA 3ONEA 3DC2A 1BW9A 3O9ZA 4D0RA 3A06A 4PCVA 1U7HA 2EIHA 4PLTA 4DBZA 2Y1DA 4ALMA 1R4MB 1ZMTA 3PXXA 2RHRA 4CMAA 4H15A 4BOYA 1AN9A 1EQ2A 2DLDA 1R6DA 1ZXLA 1BXGB 4YEDA 4BO9A 2GN6A 4F3YA 4NFSA 3GDGA 3SC4A 4KDFA 4NDNE 5B37A 3TZHA 4BKOA 3JQAD 4W9NC 1GTMA 2NV6A 1Y6JA 2J3IA 3HFGA 1N1GA 2I76A 3FR7A 3JQDA 3LLVA 5DP2A 1PL8A 4OGWA 3RJ9A 3L77A 4QO7A 3KHUA 2X0IA 5JCJA 2WD7A 4IMRA 3LLSA 1G6KA 4CL3A 3WSWA 3D4OA 3TN7A 4WLNA 1AXEA 3OJOA 1SPXA 2PZMA 2WYVA 5TS3A 2ZKLA 2GZ1A 3GFGA 5C7LO 2JFHA 5J23A 3ZNQA 4ZHSA 5IDXA 1PJ3A 3C1OA 4BGIA 4FGWA 3PTZA 3S2EA 5KOIA 4KOAA 4RCVA 3I9KA 3LT0A 1R4MA 4J43A 1PJCA 4NK5A 1T2DA 5DZSA 2BI8A 3KVOA 1A7AA 2ZJ1A 3RU9A 4RO0A 4ZA2A 3R1IA 1JN0A 1SAYA 2HKIA 1BXGA 3GVCA 2VHYA 4WASA 1QP8A 1UZMA 5EQDA 2QQ5A 1UP4A 1BDBA 2HMWA 3K8ZA 4ID9A 5H81A 4DQXA 3DDNA 1F14A 3WQQA 1A7KA 1DDOA 1UAYA 2Y1GA 3DHYA 5JC1A 4IM7A 1WDLA 1E7MA 2IZ1A 4JP2A 2WJPA 4YAEA 3QWAA 1N7HA 4U6SA 3RBZA 2J3HA 2Y0EA 2Y1EA 1HKUA 4J9VA 3TDKA 2Q2WA 4I08A 3QVSA 3CXRA 1X13A 1Q7GA 1YB1A 2GUGA 3L07A 5CEFA 1DRWA 3QW2A 3KSZO 5EMHA 4AJKA 4FCCA 4GVXA 2PKQO 1PGNA 3WMWA 1HLDA 5L7WA 3C1AA 4JBIA 1XQ1A 5ITWA 2P5UA 5T8KC 1HDGO 1U9JA 1VKOA 4J2HA 4PLGA 2ZYDA 5DBIA 3QHAA 1JW9B 1Z45A 3S8MA 1PL7A 4TWRA 4A2CA 5K9ZA 1J6UA 4PLWA 5EESA 3ZCXA 3I9MA 5KWEA 2B0JA 3OM9A 1MXHA 3KYBA 5EL0A 3ZU3A 1KY4A 1ZMOA 4GGOA 1YL7A 2X5KO 3AK4A 3DTTA 4KUHA 5CDGA 1F0YA 3CZMA 2CDCA 1YBAA 4LW8A 4E13A 1YKFA 4II2A 5AOVA 4D46A 3INRA 2G82A 2BRUA 4NBRA 1NR7A 2VYND 4AVYA 1AXGA 3GGOA 5TGDA 1CDOA 1E1NA 2GSDA 5T6BA 1C3VA 4AJPA 3G0OA 3FPLA 4Q39A 3HDJA 5A03A 1H2HA 2YFQA 4ZQBA 5DCYA 8LDHA 5JAIA 1X7GA 3BYZA 4BO5A 4PLPA 4F45A 2PZLA 2CVZA 4HFRA 3ZWCA 1MA0A 1B0AA 2VCYA 4AJJA 1JVBA 5B12A 3VZPA 5IXYA 4XZ3A 2O3QA 5FFFA 3S1LA 4Y98A 2VTDA 3NDJA 4NPCA 4TMFA 2NU8A 2BF7A 1DC6A 3WXBA 4HNGA 2X8LA 2F00A 3I4FA 1DXYA 1O89A 3GGGA 4XB2A 1KEPA 2IE0A 4MKRA 1W4ZA 4EUEA 3HDYA 1VKNA 3GHYA 4J4HA 5T67A 3T7EA 3U4HA 4J1TA 3E6AA 4CLDA 4EEZA 3Q0EA 2PZKA 2QG4A 3GR6A 4Z0TA 4U5QA 3I1JA 4R1UA 5DULA 2NU6A 3OIDA 1EEHA 1GDHA 3KUXA 4AJHA 5CG1A 1V6AA 5JDIC 2VOEA 1HDZA 3GNTA 3PJGA 1ZCJA 4FGSA 2Q1SA 3PWZA 3RROA 3DR3A 2E37A 3NYWA 4A26A 4NBTA 4Q3AA 3ZWPA 4RLHA 1B8PA 3CMCO 1SOVA 4U8GA 2OHXA 1HYEA 3RJ5A 4YT2A 1ULUA 3JD4A 4BB6A 3FD8A 2VT2A 3GVIA 1KVTA 3TOZA 4FPXA 2FPPA 3OSUA 1U8XX 4WCFC 3A28A 4DUPA 2C07A 1FF9A 4YAJA 1BWSA 1NAIA 1RKXA 1UXGA 1ZZEA 3M2PA 1BRMA 2FR0A 4IJKA 4E5PA 3BMQA 4G5HA 3GRPA 3LC1O 4NK4A 3U62A 5KJFA 4M49A 1U4OA 4BV8A 3DHNA 3S2FA 3H7AA 2PGJA 4FDAA 1LNQA 3WGHA 2W2KB 2EJWA 3ENKA 4AJOA 4GAEA 3ULKA 4UEJA 7MDHA 1DLIA 1U4SA 3CINA 4N7RA 3WBFA 3GNSA 4RL6A 1YOVB 1NP3A 3QV1A 4U0JA 4LSMA 3RUAA 2D8AA 4YAGA 4PG7A 4Z9XA 3IP3A 9LDBA 2VWPA 3CIFA 2D5CA 2IZ0A 3JQ9A 4JJFA 4E5NA 2AG5A 1JA9A 1C0LA 4IDEA 3KEQA 2Q46A 3W1VA 2V65A 3AW9A 4UVHA 1QYCA 3GK3A 3D64A 3VH1A 5IZCA 1LSJA 4P22A 1VC2A 2UDPA 4Y6SA 2PZJA 4IQ0A 4XRRA 5CFZA 2RCYA 2ZB7A 1PZGA 1UR5A 5ES3A 3I6IA 3SBOA 3GG2A 5LC1A 2BGKA 4DBVO 2VWQA 4O1MA 1QMGA 4RPKA 3KO8A 3K9QO 4B4UA 1NR1A 2B37A 2GERA 2W2KA 1D7OA 4L74A 1NVGA 1Z73A 4HNHA 4BNMA 3QWFA 4J16A 3QJ5A 4KUEA 2ET6A 4KZPA 2RH4A 3PYLA 1NVTA 3WMXA 1YOVA 1QYDA 4PLYA 5HWSA 1V0JA 4JGBA 4K6CA 1KVQA 4I8XA 4UEKA 4DWVA 1J4AA 1HDXA 4YWJA 5TT0A 5IDWA 2ZTVA 1VL8A 1Y5MA 2E4AA 2EGGA 3K96A 1U3TA 2AMFA 2VWHA 2D5AA 2HU2A 3A9WA 4BVAA 7ADHA 1N7GA 1WLYA 1AE1A 1I2ZA 1LC3A 4RZIA 5G0TA 4PRKA 1O5IA 3JQEA 4E5YA 3U09A 3JQ7B 4KWHA 1DIRA 1YDWA 4YAIA 1QLHA 2VWGA 2X9VA 1GEEA 1A71A 4IXWA 2JFFA 1A72A 4E2ZA 1B15A 1TT7A 3EZLA 3PK0A 4OOFA 1LTHR 1XU9A 3TZQA 4AJ1A 4HADA 1YJ8A 4XYBA 3AOEA 2PKQP 1E92A 1YB4A 1QYVA 2JFGA 1ZFNA 1WVGA 4CQMA 1C0IA 4BMVA 1GY8A 3RD5A 2CMDA 4NJMB 4L9RA 4ZD6A 3JQAB 4FFRA 4D79A 4RORA 4YT5A 2VNSA 5IAAA 1SO8A 1LUAA 3BHIA 4L0QA 4Y8VA 1U5CA 5BNTA 4BO2A 2X22A 3EGOA 2VTEA 3DQPA 1EK6A 2DFVA 1SEVA 3N7UA 4MKXA 4WECA 3SJ7A 2FOIA 2C5EA 2OZPA 1JQBA 4YAKA 5HM8A 2JHGA 3G79A 3DBHB 3FTNA 1JKJA 2B5WA 2YQ4A 3A4VA 3OHSX 4FOSA 4Q3NA 1E5LA 3JYPA 3K31A 3JQ7A 3DBRB 4R9RA 4Z3DA 2VZ0A 5F21A 3GPDG 1DIGA 2R6JA 1PL6A 4W4TA 1GQQA 3GLQA 4OM8A 4Y67A 4AJIA 5A9SB 3PI7A 3NKLA 3JYOA 2EW2A 3DAPA 1DFHA 2Q3EA 2Y93A 1W0CA 3EVTA 5JC8A 2IDZA 3IAHA 3AWDA 4NJMA 1EK5A 3JQAA 1ZSYA 2CDAA 2BGLA 2ZCUA 3QSGA 1C0KA 3V1YA 1E3JA 3CSDA 3HN2A 1P77A 3VAZA 2QZZA 4GX1A 5JNLA 2PR2A 4AG3A 2DAPA 2YQ5A 4XJTA 3IOYA 1Y81A 2XXJA 3RUCA 4G81A 3MWDB 1I10A 5COBA 4Q3BA 4GL4A 3JQ8A 3RUFA 3AJRA 5AYVA 5TLSA 1ONNA 3I5MA 5B4TA 2G76A 1U7TA 1JAYA 3D0OA 1P45A 3WGQA 3DBRA 4IJVA 5KJEA 1X1TA 3UF0A 4CUKA 3WJ7A 3Q1LA 3UN1A 1DFIA 3BMCB 4J90A 1ZJYA 4JJIA 4JK3A 2Y0CA 4IQGA 4RDIA 1I5RA 4BO7A 1IZ0A 5A9SA 2OP1A 1XDWA 4XYGA 1SC6A 4JBGA 3WYEA 5EIOA 1NFQA 4IY1A 1ONPA 4ND5A 4KMSA 4WE3A 3WJAA 4BNVA 2NWQA 2B5VA 4W7HA 2X9NA 1DAPA 4M55A 3GVXA 3NRCA 3NTQA 4B7UA 2POQX 5JAZA 1PJBA 1MFZA 2NLOA 2C82A 1UP7A 2X86A 4NR0A 2C29D 4YT4A 5A1TA 1R12A 1XCBA 3X2EA 4YACA 3L4SO 2Y1OA 2GNAA 2HLPA 2I67A 4EDFA 2PNFA 5G4KA 4NH4A 3S55A 5AVOA 4FFNA 4JN6B 4LN1A 5KKAA 1XG5A 2PLAA 4OKNA 2Q2VA 2YHUA 3MEQA 5G0SA 3S2GA 1HZZA 5COQA 3FNGA 1EBUA 3VDQA 1O6ZA 3D4NA 4GH5A 3DTYA 4D7AA 3O8QB 2P4HX 4ZICA 2Y1CA 5T57A 3T4EA 3OJ0A 1Q0HA 1WNTA 5A05A 3QVWA 3QVOA 4WLFA 5GZ3A 2JJYA 3D1LA 1P1RA 5CPBA 4FSHA 5C7IO 1NTOA 1QRRA 1QSGA 4I9HA 3UGKA 2RIRA 5KJ6A 4R5HA 4TRMA 3EVNA 2DQ4A 3KYCB 4CMHA 3H6KA 1NXQA 2JD0A 2PA3A 3I9LA 5ICMA 1DLJA 1FDVA 2Z5LA 4CM1A 3KBOA 5C3MA 4WLUA 1E6WA 2ZQYA 3GQVA 1RPNA 3ANNA 4J0EA 4E32A 4ZN6A 3VVBA 1MG5A 1N92A 3KSDO 3WDSA 5A9RA 3WS7A 5JYDA 2IEDA 3JYQA 1A5ZA 3PJFA 4EEXA 2AEMA 4HP8A 3VZSA 4DC1A 4D45A 2VYNA 2PWZA 1Q0QA 3DWFA 1E6UA 3GAFA 5CHEA 4O59O 4ONEA 2VNAA 4MJLA 5C37A 3MWEB 1HL3A 4Q9NA 5IG2A 1CIVA 4PG8A 3PDJA 5T64A 2WM3A 2X0NA 4A5OA 1I3NA 4OIMA 2O4CA 4UUOA 3LF2A 2CVOA 3ZHYA 2HMVA 1LRKA 3JD1A 1JKIA 1GCUA 1KBZA 3C8MA 3GG9A 1LU9A 1KEUA 1AHIA 2AQIA 4D3FA 1BMDA 3KYCA 1IHYA 2W98A 1XLTA 4BNYA 5ILOA 3H9GA 4IDCA 2UUOA 1ZK2A 4ZRNA 1YWGO 1Y5RA 4LGVA 4DIOA 4F6LA 4YPOA 1LLQA 2ZCVA 5BSFA 1YE3A 4OXNA 1R66A 1SEPA 2HK7A 1RYEA 1OI7A 1VJ0A 3F46A 2EP7A 2A35A 3GOHA 4B7CA 4XDZA 5CPFA 5I8ZA 1GL3A 3WGZA 4PGFA 1BGVA 3L6EA 1BDMA 1KETA 3D7LA 2QW8A 4BNIA 3DMTC 1ZNQO 2DU8A 2UV8A 3AM3A 1A4IA 4WGGA 3ZV6A 3GF4A 5JAQA 2E6UX 2FSSA 1BSVA 2OORA 3KTDA 4GWKA 2CZCA 4AFNA 4P8RA 5DBFA 3UH1A 4OAQA 3WGTA 4D43A 2W90A 3JQBA 2D3TA 4GLOA 4N54A 1MB4A 5ICSA 1NYTA 2HRBA 4OMUA 3T7CA 2EJVA 4WPGA 2OXIA 4JCOA 2I3GA 3RWBA 4A0SA 5I9NA 5JS6A 1WZEA 2EKPA 5KJ1A 1HE3A 2FY8A 4MIEA 4MP3A 4RQTA 3VDRA 1DC4A 3W8FA 3TZCA 4BNWA 5L40A 5K6AA 1KERA 2C7GA 2FZWA 3FRJA 5KVQA 3JCZA 4B79A 2J8ZA 2YHIB 4QT0A 2H1SA 2GASA 3KM0A 2WE8A 5C5IA 5FYDA 4JP3A 1P31A 3ZWXA 4WLVA 3DZIA 4OYRA 3ZV4A 6LDHA 3P2YA 5TQVA 1SMKA 1GYRA 1Z74A 4F6CA 2DFDA 3CE6A 1S7CA 4D3SA 2AA3A 2OGUA 3BZUA 1UDBA 4EUHA 4G65A 4RLSA 2QX7A 2XAAA 3VKVA 1DHTA 2IRWA 1BTOA 4ALIA 2P68A 3D3EA 4M54A 5JMWA 3AOGA 3WQSB 3EC7A 1EZ4A 4FC6A 2BI7A 4H7PA 4BO4A 4U7WA 1Z7EA 4J2OA 1KOLA 3R6DA 3WGIA 1YBVA 1M75A 2DM6A 4YJHB 3H2ZA 3ZNPA 5DOZA 1WMAA 3ZH2A 1QG6A 4IIVA 2NQTA 3OFSA 1I8TA 3FWNA 3RUEA 3ZHZA 3WR5A 1FMCA 3ITDA 4DQUA 3WIDA 1DBVO 1VL0A 1NQTA 3C85A 1YH3A 3I4CA 4CMBA 5CDSA 4GBJA 4XR9A 4CMEA 1H6BA 2X4GA 1PGOA 3OEYA 3DXFA 4BQPA 4XYMA 2YHIA 3GN1A 1UXJA 3DZJA 3H8VA 1F12A 1HDCA 4YXFA 2ZQZA 1DB3A 4J91A 3SLGA 3A14A 3SEFA 1HYGA 4X54A 4J4TA 1DPGA 1HZJA 4QFCA 4I5EA 3ZW8A 2VYVD 1Y1PA 3DAFA 2FR8A 4PVDA 2C2YA 2FRDA 4R1TA 1E77A 3OECA 4PG4A 3TZ6A 1HEUA 3P7MA 1UH5A 4BB5A 1NQOA 1A27A 4RF4A 4CQLB 2A92A 1DRVA 1R0SA 4XQCA 4PIVA 4YJHA 3L4BA 3B1JA 3GGPA 1B7GO 2D0IA 5L95A 5DCWA 4RPLA 4K6FA 2LDBA 2OBYA 1YJQA 4XD2A 2DVMA 4R68A 4LRTB 4BGEA 3VHRA 3Q9UA 1K6IA 1XU7A 3HHPA 1E0DA 2ZTMA 3VPHA 1EBFA 5JDCA 3D5TA 4J4BA 1Q7CA 4C4OA 4I5FA 1UZNA 1YVEI 2B4TO 4YRAA 3Q6IA 1OC4A 3E9NA 4QECA 3RKUA 4YJGB 1ZXBA 1XQ6A 2R00C 4IZHA 4XR4A 5F3RA 3RKRA 1FXSA 3C7DB 3QWBA 4GVLA 3UUWA 4B8ZA 1N9GB 3NTOA 3ZNOA 1V9LA 1ZIDA 1JAXA 1PTJA 4IMPA 3PGXA 3WWYA 2NVUB 4ZGWA 1TLTA 1GZ3A 1G0OA 2FPIA 1Z82A 4CQLA 2EWMA 2YV3A 5BR7A 4IS3A 1ARZA 3HB4X 3VZQA 4IIUA 4G2NA 5KVSA 5EERA 1XHLA 2PD6A 3JQCA 5TX7A 3RIHA 3ADPA 3U0BA 3WLFA 4E5KA 3QE3A 1E3WB 2G5CA 4O0LA 3SC6A 3BHJA 1ZO8A 5H82A 1HXHA 1NAHA 1L1FA 3H9EO 3WOHA 1LRJA 1QR6A 4GKVA 1X15A 4JJGA 4JBHA 4CJXA 4B7XA 1CYDA 1N8KA 3PP8A 2BGMA 1LQUA 4LSWA 1MP0A 1YQGA 3H3JA 4NQZA 4YJGA 1ISIA 1GUZA 1P0CA 2Y99A 1ID1A 2O7QA 3GY0A 1N9GA 4BKQA 3NJ4A 1KYQA 3ASVA 1B16A 3DHEA 4EJ0A 3COSA 1IE3A 1EUZA 4W82A 1MV8A 3AUTA 3NGLA 3H5AA 2PGDA 3ZI0A 4BNUA 1L7DA 4D0SA 4J1SA 5IF3A 2NVUA 4RZHA 1Q0LA 4IZIA 3TJRA 1G0NA 1PR3A 2AW5A 3X2FA 4HFNA 2EHDA 3AI2A 1PJSA 1CQJA 4FJ1A 4W9NA 3K92A 3MJ4A 4CM7A 4HFJA 2NNLD 4N5NA 2WTBA 1ENZA 2UAGA 1QYWA 1IL0A 3E9QA 4L4XA 3BTSA 4LMPA 3RBVA 5K0ZA 4WNIA 3PDUA 3PVZA 3ROPA 3W6UA 1E3WA 2O50A 5EINA 5C7OO 1XYGA 3IKTA 2YZ7A 4MPDA 5DN9A 1PU2A 1PS0A 4CV2A 1VE9A 1GUFA 2BH9A 4Q3CA 4B3JA 5JFOA 3BTOA 2GZ2A 5TIIA 2X23A 5FWNA 3BXXA 1P0FA 2DPHA 8ADHA 5L7YA 5L45A 1V3VA 4OQYA 4DIFA 5CP8A 3C7CB 4UAGA 3LYLA 1ISMA 2OO5A 1UAGA 3T4XA 1H9BA 4E2YA 1YGYA 3F3SA 4UVDA 1TB4A 2GYYA 3E03A 4ND4A 2ZYAA 4WNCA 2YYYA 1B8UA 4U0KA 3WTCA 4MVJH 4AJ2A 5I7VA 4R3WA 3RFXA 2PTGA 1H94A 1VJ1A 1F8GA 4RVGA 3G49A 2OMEA 4CV0A 1R0KA 2X5OA 3RAJA 3UKOA 2I66A 3N74A 5TF4A 2P2SA 3DBVO 4A03A 4KWIA 4XCVA 1N5DA 1X14A 4OKIA 5ER6A 5A02A 2GF2A 4RDHA 3V1UA 2BMAA 2YFHA 5JE8A 2W2LD 1WW8A 5L7TA 1D4FA 4NBWA 3PGJA 5CG2A 2AG8A 5ADHA 3TF5A 2NTNA 4TVOA 1JWBB 5IZCC 1I0ZA 3MZ0A 1YB5A 1MC4A 2P9EA 4L73A 1DRUA 2WYUA 2CF6A 1X0XA 2Y67A 3ZN2A 1E1MA 2WSBA 5JCXA 1T2EA 2X5JO 4Z0HO 1NQ5A 3E48A 4FW8A 4R69A 1DJNA 1W73A 1O8CA 3H9QA 5T8KA 1VI2A 1O95A 2D4AA 3DMYA 4PVCA 4AJ4A 3VPFA 4BL5A 3GHHA 1FDSA 3ONFA 1U3WA 3ADOA 3E8XA 2B69A 4DXHA 1ENPA 1DIAA 3O03A 1C14A 5GMOA 5TJ9A 1T25A 5ITVA 3PWKA 4HWKA 3V2UA 4YRBA 1PJLA 1F8FA 2E49A 2PFGA 5MDHA 2RHCA 2VUTA 4GLLA 4L75A 1ISHA 4ZQFA 5I9LA 5IN4A 2EGHA 3OJEA 4XIYA 4YQYA 5CDYA 2JCVA 1PGQA 3E1KA 1M76A 5G4LA 3HN7A 1LEHA 4ND2A 3AOEC 1EMDA 1JDJA 4ND3A 1CJCA 1R0LA 4A10A 4KDEA 3ZHXA 2HO5A 1SOWA 3GMSA 3ROQA 4HY3A 3PFWO 1VL6A 2JAPA 4RVDA 5U9CA 4MO2A 2Q2QA 3WG9A 1B2LA 1UDAA 3DEYX 2HMTA 5KTKA 1UXIA 2H6EA 3HSKA 1LI4A 2OFPA 3GZ4A 2EP5A 1QYXA 3RC2A 4LVUA 1SB8A 3DZFA 4WCFB 3JQFC 2F1KA 1GU7A 2WWRA 5EJ2A 4XQ9A 1TVEA 2J3KA 1LSOA 3VPSA 4WOKA 1Z7BA 2I6TA 1IOLA 4CL8A 1P44A 3B6ZA 2DKNA 4LRSB 4FFLA 4IGFA 2GN4A 4Z6KA 5JDIA 1LDNA 1Y9AA 1ZW1A 4RVSA 4WCDA 4ALNA 4IDDA 4GSLA 4PLFA 2AE1A 4HKTA 4OHUA 4NBUA 4WLOA 3VTZA 4YYZA 2C7VA 2VN8A 2D1YA 4K26A 1TA4A 3EUWA 4ZQHA 2HK9A 4GSKA 2HUNA 3AU9A 1LX6A 2JL1A 3L9WA 1P3DA 2NVWA 3OIGA 2I65A 3GEMA 3QY9A 5I7SA 3LSYA 4UVGA 1CWUA 3LDHA 4RF2A 3UCEA 3HB5X 3PHGA 3L9XA 1GYQA 1O0SA 1J0XO 1TI7A 3GN2A 3LT4A 2QIOA 4CM9D 1P1HA 1T1RA 3NDIA 4MVJI 1R4NB 3FBTA 3Q9NA 5IXSA 4BO0A 4QEDA 2A4KA 3H9UA 4IJWA 4DVJA 3BMNB 5FEUA 1TXGA 3AI1A 5KCZA 1PQPA 5THQA 1LLCA 2H9IA 1C0PA 4ZRMA 1PSDA 1T2CA 4NIMA 2Q99A 4CM3A 1EVJA 3WYCA 4W99A 4NBVA 3AUAA 2Y66A 2B4RO 2BFPA 4FR5A 4A7PA 1WAMA 2YW9A 2H63A 4FC7A 1ORRA 4ITUA 4D3DA 3KRTA 3E9MA 1PR9A 4XX0A 3ICPA 4PLCA 3WGYA 3E5RA 4QXMA 3WYBA 1E7YA 1Y8RB 1HTBA 3A1NA 4MVJA 2P4QA 2FZEA 2HMUA 3PWSA 5A3VA 3GRKA 3ZWWA 3ROKA 3NUGA 3W4JA 1LSSA 3L0DA 4LCJA 4TRRA 1KC3A 1BVRA 2XOXA 4XRGA 1GV1A 3PFFA 2VYVA 2HCTA 1E1KA 1ADGA 3OQ6A 4RJTA 1R4NA 4PZEA 4EZBA 2CY0A 3H5NA 1WXDA 3PPIA 3PEFA 3BMNA 1K3TA 3CPSA 3OA0A 1DJQA 3DONA 5L9AA 4ROSA 1EE9A 3MOGA 2PGLA 4GX5A 5BT9A 4UVEA 2BLLA 4GGPA 5DBGA 4XKJA 2ZB3A 1O9BA 4H16A 2VRBA 2Q1UA 1TEHA 3PQFA 4KTVE 1YDEA 1ZJZA 4TRNA 4MP8A 4E4YA 3WICA 3DBHA 3KETA 1ZK0A 2BFMA 2X7HA 3IMFA 4TKMA 4EGFA 1Y8RA 1JLLA 5A04A 2IZZA 2IXBA 1V3TA 1XGKA 3M6IA 1EUCA 1GYPA 2QZ9A 1FJHA 1HDRA 3ST7A 1L7EA 4MINA 4OOEA 3E18A 4FFMA 4PZCA 1OOEA 5T5QA 2C54A 3AUSA 3ZWOA 1D3AA 3WTBA 1PZFA 2HJSA 3OA2A 4DA9A 4E2XA 1J5PA 1DIBA 2WMDA 2RBEA 2QRKA 2X0JA 3JYLA 1B14A 1I2CA 3JYNA 3VPXA 2V6BA 5CDTA 4ESOA 1QXSA 3TPCA 1P1IA 1LJ8A 2I99A 3BTVA 1W6UA 2YUTA 2BD0A 4QTZA 3WWZA 4RPHA 4MDHA 1MC5A 2PD3A 4DPMA 2NADA 1WP4A 3QVXA 4KQXA 4CMJA 4P4LA 4CV1A 2P9CA 3GA0A 3JD3A 2EKLA 1DOHA 2AQHA 2GZ3A 1P33A 3GVPA 2VUSA 3ZNNA 3H2SA 4RGBA 4RVUA 4II3A 4YR9A 1ENOA 1GPDG 4DTIA 1LDMA 4L76A 3ETGA 3OJFA 2PK3A 1Z75A 3U3XA 3GEGA 3INTA 1JWAB 4TKLA 5AXDA 5DCUA 2NTVA 3BMCA 1E5QA 2G17A 2JCXA 2HSDA 2RAFA 1DHRA 4BNLA 2QYSA 2YDXA 5JMPA 4BMNA 3GUCA 3WLEA 3TOXA 3AY7A 1PJ4A 2BFOA 2Q4BA 4PG6A 3EDMA 1VJTA 4NFHA 5IDQA 4RQUA 1NFFA 2EG9A 1HETA 2DTDA 4NFYA 2DBQA 5TT1A 5G0WA 1PX0A 4TQGA 4Z9FA 3TFOA 3B1KA 3EYWA 3G3EA 3QQPA 4TRJA 2AQ8A 3FR8A 4Q3DA 1GD1O 1GADO 2OL4A 3GDOA 1CERA 3NDRA 1DIHA 1UZLA 5L53A 3MJEA 3SVTA 4IS2A 2HAEA 1HF3A 1EQUA 2EKQA 2VT3A 3TNLA 1D8AA 1O94A 1PS8A 4CLOB 1JU9A 2B4QA 1GAEO 5HS6A 5I7EA 2BHLA 5HRUA 3F5QA 1VSVA 5AXAA 1H2BA 1KEWA 1E3EA 3TL3A 3OP4A 4UULA 2AXQA 2ZTUA 1OBFO 4ZVVA 1U28A 3O8QA 4YVFA 1V8BA 2VHWA 1K0UA 2V7PA 3FNHA 4EBFA 3VTFA 5DP1A 1H6CA 1NQAO 2O3SA 5DT9A 2O23A 3OJLA 2I9PA 3D4PA 3KZVA 4IDFA 3PIIA 4WEOA 3ZWYA 1A4UA 5KIAA 3V8BA 1SZJG 4QO8A 4NU5A 3FTPA 2PKRA 4M8SA 2JKVA 4PLVA 1KIFA 3U4CA 3OMLA 1NHWA 3RFVA 4CMCA 1I3KA 2O2YA 2X6TA 2WD8A 3HFSA 1A9ZA 4W6ZA 4YB8A 2W2LA 4BNZA 1PQWA 1P1FA 4LISA 4CR7A 4IINA 3SJUA 4WJZA 1ZKMA 1ZK3A 2NU9A 4MIYA 4CLOA 3W8EA 3QLJA 3I83A 2X58A 3DO5A 2WEKA 3HQ4O 5EQFA 4DC0A 4TVBA 1DEHA 3HG7A 4XQEA 3KOUA 3RQSA 5CAEA 4ZQGA 5A3JA 4RPJA 4WK6A 3ZV3A 2Y68A 1QKIA 2DBVO 3B1FA 2YV1A 1AHHA 1ADFA 3GAZA 1U2DA 1KVUA 2IYOA 4C7JA 1K6XA 2JAHA 3HZZA 2FPGA 3ZDFA 3I9OA 1HSOA 1K5HA 4FN4A 4MOWA 4PRLA 3TL2A 3VC7A 3ZWAA 5KVVA 5GY7A 1MG0A 4TZKA 4H3VA 4HV4A 4DYDA 1W8DA 4AJEA 4HBGA 1T2AA 3O26A 4OQZA 4CMGA 3IS3A 4XA8A 4N5LA 2J6IA 3PRJA 1F17A 1FK8A 3H9JA 5TJHA 4R41A 1DC3A 4YT8A 1LLUA 2R2GA 4Z9YA 1NBOA 3CH6A 5HS4A 1U2GA 5A4DA 1CEQA 1Y8QB 2Q4EA 3F1LA 4YCAA 4UUMA 3KSUA 3VOSA 1LA2A 1Q1NA 3LF1A 3L6DA 3PLRA 2O3TA 1T26A 4O63O 4AJLA 5JAMA 3D5QA 5BSGA 4BNHA 3R3SA 4CUZA 4D44A 9LDTA 2EW8A 5IN5A 1LSUA 3JSAA 4RVHA 1TT5B 3WIEA 4GMGA 5IDYA 3MJCA 1GZ6A 3CTMA 4IDAA 2D2IA 4E5MA 2DT5A 2B35A 4MVJD 3MTGA 4BNNA 1E3SA 2QRJA 4J0FA 2EV9A 4MKZA 2VUUA 3IKVA 4RF3A 5F5LA 3L6OO 3WB9A 1FDTA 5B1YA 3FHLA 4MVJG 1C1XB 2VRCD 4YTEA 5L4SA 4XYEA 3DMTA 1P74A 2GLXA 1Y8QA 4FB5A 3GUYA 4R1SA 4OJNA 1E7QA 4GKBA 4CLRB 2W4QA 1UDCA 1P9LA 5JO9A 2PY6A 3IQDB 4WLEA 3VH3A 3U9LA 3KV3O 1ZEJA 1EUDA 1ZK4A 5CDUA 3PHHA 1HDOA 4NMHA 4FFOA 1OMOA 2OBNA 2FHSA 1TT5A 4DLAA 1AGNA 2JCYA 1VLLA 1SNYA 1BXKA 4CM9A 4MIOA 2IODA 4B3IA 1EVZA 3FI9A 5DDIP 2BELA 5AXBA 3EAGA 1WDMA 3QA9A 3ZHBA 4JXKA 2PD4A 3ON5A 1ADBA 3W6ZA 3ZW9A 3LC2O 2GGSA 1C1XA 4XIJA 5JY6A 2OOSA 3QVTA 1I32A 3W8DA 2FSVA 3STHA 1IUKA 3ROMA 4E30A 1M2WA 1HRDA 4DMMA 5A06A 3PZRA 4EYEA 2X9GA 3K2BA 1EFKA 1X1EA 4GPD1 1DO8A 4XJSA 5ER9A 2IEBA 1SCUA 4CLRA 2Y1FA 4ZJUA 5KJCA 2NACA 3WNVA 4OSPA 2O7SA 3TQHA 1B8VA 4P38A 1IPFA 4Y6PA 3PHJA 2DBZA 4CM4B 2YDYA 1H93A 4E33A 3TSCA 3DOJA 3ANMA 5KNLA 4FJ2A 2VZ9A 1GQYA 1YL6A 3FPCA 4R16A 2G1UA 3WBBA 1HLPA 3BAZA 3VH4A 3ETDA 2GN8A 4DRYA 1V35A 3G1TA 2DUUA 4MVJM 3RU7A 3UAGA 4BKPA 1HDYA 3M2TA 4GQAA 5MGBA 1GCOA 1DAOA 2GR9A 2O3RA 1ISGA 1OAAA 3EZYA 4MVJP 4FFPA 1YL5A 3IUPA 2CD9A 1I3MA 4EJ6A 3BTUA 4BO1A 2VQ3A 1Q2XA 5A9TA 4I9NA 4CR6A 3ZGYA 4WOJA 2YJZA 3VKUA 3NT5A 5JW6A 3F4LA 1ML3A 2XF8A 4OO3A 1LRLA 2E82A 3GNQA 4P4NA 1K2WA 4K28A 1H0KA 4I9UA 1IPEA 4IDBA 3F9IA 3ZZNA 5G0VA 3ANLA 2DBRA 3I9NA 1HWYA 1M6WA 2B83A 3F4BA 3Q2IA 1LDYA 4JLWA 4CM4A 1IULA 1HT0A 2PV7A 3H5RA 1XA0A 4QSMA 4ALKA 5CEJA 5JO0A 4IUYA 3PJDA 3GT0A 2FN7A 2WYWA 3KB6A 3QP9A 1WPQA 2EEZA 1HE5A 3GMDA 4J49A 1QLJA 2J5RA 3WFJA 1Q7BA 4E2WA 1X0VA 4DPLA 4D42A 2ZB4A 4IDGA 3VVCA 3UVEA 4PLHA 1MX3A 1VM6A 2HMSA 3FWZA 4S3MA 1NVMB 4FS3A 4I5DA 2EXXA 5I7FA 3AU8A 2R00A 4NI5A 3MJVA 1ISJA 3KEOA 4BKRA 3IL2A 2NU7A 1Z6ZA 2EERA 1CRWG 3ZWMA 1KVRA 2ZJ0A 3GFBA 4NU6A 1T24A 3OQ1A 4CV3A 3AFNA 2RH8A 3DB2A 4XDYA 1QV7A 5DOVA 1H6AA 2AEFA 5TRTA 3CKYA 3G17A 3AM5A 3QIVA 4WKGA 3JQ9C 2BFAA 1XR3A 3HUDA 3EW7A 4R51A 3I23A 4KP7A 5DNAA 1BG6A 1YBMA 4UREA 2GN9A 3EMKA 4NZ9A 1M67A 3N58A 3PYMA 1NNUA 1R37A 2FP4A 3JV7A 3O38A 2AE2A 1WWKA 4L8VA 1A9YA 2O48X 4ALJA 3JD2A 2TMDA 4TSKA 5COAA 2ZK7A 3UHAA 4B4OA 5L4NA 4M1QA 1ZSVA 2ZIZA 4YA6A 3BMQB 4CPDA 5JY1A 4DPKA 4A27A 1EVYA 1ONOA 1PGPA 3KYDB 1PJTA 4NG5A 2Y0DA 4ILKA 4Y9DA 2J3JA 3C7AA 2AQKA 1NPTO 3AY3A 1PEDA 3PHIA 4M87A 1LBEA 4MVJF 2V6FA 3UXYA 1R16A 1M6HA 3PQEA 1LXCA 3FNEA 3RI3A 4JNKA 2XPCA 3VH2A 3W4IA 4BO8A 5AXCA 4EITA 2NQ8A 2GPTA 1J49A 3S2IA 1OZAA 5GZ1A 4BGVA 3MJTA 3FN4A 3WGGA 1CF2O 2BKAA 3HWRA 3HE3A 3P5SA 1V3UA 4N18A 4XGIA 1HYHA 5G2OA 5JXWA 4L4RA 1NX6A 4R54A 4FIZA 1VRWA 5I8WA 1KEVA 2FMUA 1UXHA 3DZGA 1LDEA 1F06A 1I24A 1BVUA 4GMFA 3RSHA 4GX0A 3KYDA 1E1LA 3GEDA 5F1OA 4W7IA 1RJWA 5FI3A 1B3RA 5ILGA 3V2HA 4NNJA 3DZBA 1P1JA 4CLEA 4YJDA 4E21A 1PWXA 2HRZA 3ONDA 3ZWNA 2VOJA 3V5NA 2ZTLA 3LVFO 3B70A 1B26A 1EFLA 1HE2A 1I3LA 1NWCA 4B4VA 3NEPX 2X0RA 4BGUA 4YRDA 2FWMX 5BNIA 1GQ2A 3O4RA 1JKFA 3PJEA 4XGKA 1D1TA 1T2FA 4I5GA 4QQRA 4BO6A 3R3JA 1EVIA 2OUIA 3GDFA 3LC7O 5LCXA 4CUJA 1BXZA 5A5EA 3HNPA 4M89A 3K2EA 4M86A 3OBBA 1UXKA 3UICA 3PHLA 2VHZA 1E7WA 3WNQA 1ENYA 4UVIA 1PIWA 1NPDA 3NV9A 3OIFA 3W4KA 2VHVA 5LDHA 4CM5A 3ZWVA 4XQGA 3JTMA 3TZKA 4RV9A 4JX8A 5TSDA 4MP6A 3P19A 3DZKA 4CQMB 1XIVA 2J5QA 3ASUA 4OXKA 2C0CA 1NFRA 5L4LA 2NUAA 4CMKA 3SX2A 1RM5A 1T1SA 1ZSNA 4WCFA 4BS9A 2CVQA 4INAA 1NWHA 3I6QA 2CDBA 4J6FA 2Z1MA 2QYTA 2VZ8A 4QX6A 1NASA 4YJFB 4BNTA 4DLBA 4L4SA 5BNFA 4IXTA 1X7DA 3WX0A 3H4VA 1XSEA 4N5MA 1ZBQA 3AI3A 2O4UX 3C1TA 4BNJA 3VZRA 4IQ8A 2YY7A 1U3UA 2C20A 4BUCA 5JCJD 2O3JA 2HK8A 1IB6A 1YONA 4UUPA 3HDQA 4ND1A 4XEHA 1QORA 2SCUA 3JQGB 4BKUA 1PGJA 3KLPX 3IIEA 2Q49A 3MTJA 5F1KA 1ZEMA 5HA5A 2P91A 5JSFA 1UUFA 2P9GA 1ULSA 4WUVA 3P2OA 1MGOA 1DFGA 2C59A 5AQ1A 1E7RA 2HJRA 3U4IA 4J3FA 4NHEA 4AICA 1YQDA 3EY4A 1P1KA 5U4QA 4C7KA 3H3FA 2DUWA 2QHXA 3AM4A 4DMLA 3OQBA 4BNXA 4Z3KA 2JHFA 3MJSA 4OL9A 3DL2A 3C3XA 4PFJA 4AL4A 3RBXA 3MCVA 3K30A 3IUSA 1OFGA 1RM4A 5F5NA 1JTVA 3CMMA 2VRCA 1FDUA 1NHGA 3JQFA 4YJFA 1KY5A 3CUKA 3C24A 2VHXA 1D1SA 2CSUA 3M1AA 4YBZA 3JQ8B 3QWHA 4BHTA 4LCEA 1XELA 3HJAA 4PG5A 2NVBA 3MOIA 5LDGA 2UYYA 4OXYA 4BQRA 3GH3A 4A73A 3DBLB 4IGEA 4LVCA 1H6DA 2ZB8A 3DAGA 2IXAA 3NAQA 4BO3A 1MLDA 3JQGA 3NX4A 2O2SA 4YDRA 3TFQA 3JD0A 4OSOA 1UJMA 1YO6A 1LDBA 3B20A 1I01A 2PH5A 5JPIA 1B3BA 1ISFA 3GVHA 3LU1A 4XYLA 1IY8A 2GO1A 3I52A 4XWYA 4XGNA 3R0IA 4J1NA 4B8WA 1RM0A 4KUGA 1U5AA 4J7UA 1IYZA 5JYEA 1U8FO 1WZIA 1AUPA 2D59A 3DFUA 4WEQA 4CLHA 3IJPA 4D41A 4YQZA 3GZNB 5IZ4A 1H9AA 3UFXA 2CUKA 1YRLA 1GEGA 3ORFA 3E82A 2C2XA 1DSSG 3AUUA 4DL9A 3U5TA 4ALLA 5G4KB 3WGOA 1LQTA 3U49A 3ZWBA 4MVJE 4DREA 1PJ2A 3U4DA 1X7HA 2GDZA 1PZEA 2DTXA 1GV0A 1RM3A 1T4DA 2P5YA 4UEOA 3DZHA 1K89A 3DBLA 5EPOA 1YQXA 5G0UA 1PJQA 2EF1A 4HXYA 3UCXA 2H5LA 2Z1NA 2HQ1A 3CEAA 3RC1A 3HDHA 4JIGA 2CNBA 1HSZA 5L3ZA 1GZ4A 4GX2A 3IC5A 2ZYGA 1T4BA 4E31A 1JVSA 4J7CA 3ZV5A 4BIIA 4E0BA 3DOOA 1SB9A 3RASA 1H5QA 4RPGA 2CF5A 3NGXA 3GZNA 4KQWA 2Q1TA 2ZATA 4RVFA 4GI2A 3FBGA 1CETA 4K9DA 5CEEA 2Q45A 4XB1A 5KVCA 3OETA 4QFDA 1DC5A 2W8ZA 2DPGA 3TWOA 3NTRA 3FCOA 5L51A 2JD2A 4LK3A 2XXBA 2WE7A 3OF2A 1YXMA 4TZTA 5B4UA 4URFA 1IHXA 3PQDA 2I5PO 1XEAA 2UUPA 1CQIA 3DOCA 2NTJA 4TROA 4DIBA 3K5PA 3NT4A 3CZRA 3JQBC 2GRAA 3INGA 4HX5A 5BSEA 2J5KA 2TMGA 3IDSA 3K73O 2Z95A 4B3HA 3LK7A 4R4JA 1HE4A 3LT1A 4CLXA 3PZBA 4NJOA 1M66A 1MUUA 5ENVA 1N2SA 4O6VA 3UCFA 1I36A 1FDWA 1KC1A 1RWBA 1LC0A 4HUJA 5K6AC 3Q3CA 4GWGA 4K1LA 1I33A 1VSUA 3FNFA 1PQUA 1LDGA 1RYDA 3UW3A 2B36A 4EJMA 1U3VA 4Y6RA 3ZU2A 2A94A 4J1QA 3AFMA 4IPTA 1WMBA 5F1PA 4J7XA 2V6MA 4EI2A 3OH8A 4UUNA 4E3ZA 2I3AA 1Y9EA 4CM6A 1R15A 1UP6A 3PYXA 3I9JA 3BA1A 4FQ8A 4CM8B 4ZQEA 1E7SA 3ITKA 5HTOA 5A5FA 3FF4A 4DYVA 1ZK1A 2V6GA 3KLMX 4FJ0A 4IBOA 1SBYA 2AHRA 5TNXA 2WDZA 5FI5A 1K6JA 3QWIA 1NM5A 2A9FA 3V1TC 1OC2A 1I2BA 1MFPA 4CODB 4CMIB 1KVSA 2E48A 5JLAA 4QUKA 4LMRA 2Y05A 5I9MA 2Q50A 2DC1A 2C5AA 3M1LA 3D3WB 4JQCA 1N1EA 5GZ6A 2DTEA 3VPGA 4OH1A 4CMEC 4JROA 1E6EA 3NJ8A 1G1AA 4BMSA 3ABIA 3JQ6A 4BNKA 4EW6A 2X1HA 3SLKA 1EDZA 1EDOA 3TRIA 3PLNA 1BHSA 4FBGA 3F6YA 3RUIA 3RUHA 1PWZA 3GC6A 4P4GA 3RVDA 5IFLA 1YS4A 4FD3A 1ZVMA 3BMOB 4Q3EA 3OICA 1VPDA 4CM8A 1LLDA 1E3LA 5IJZA 4DQVA 3WQRA 3BHMA 3RFTA 2GCGA 3K6JA 4R1NA 3Q2KA 3ZU5A 5BSHA 4AJNA 3RCBA 3PIDA 4U6QA 5U1PA 2JD1A 1KS9A 2LDXA 1XWFA 2UVDA 3F47A 3L4BC 1ZUD1 3QRWA 5JBIA 3I3OA 3F1KA 4KTTE 1Y7TA 5DF1A 4O5OA 2Q1WA 4PLZA 1IZ9A 1EE2A 4R01A 3V2GA 3F5SA 4PZDA 3E5MA 4BNGA 4CMIA 4EUFA 1MXFA 3IJRA 2AEJA 1C1DB 2ILTA 2O3UA 3EK2A 3WSVA 4DLLA 2CFCA 3D3WA 4F46A 3ENNA 4R9SA 5JDCC 5B4VA 2G0TA 2QRLA 4FOOA 1GPJA 2IYPA 3BIOA 1QV6A 1GR0A 3ETEA 4HFMA 4RF5A 1GUYA 3FSRA 6ADHA 5BQFA 3OEWA 1BW9B 1WDKA 1ZH8A 4BV9A 1GFSA 3IP1A 5HBRA 1ADCA 1XKQA 3ZU4A 1I30A 2GD1O 1E3IA 3BMOA 3G1UA 4ZU3A 3UOGA 4IJUA 3RUDA 2NSDA 4I1IA 4S1VA 3RC9A 5FF9A 3ICCA 5TC4A 4CQMD 3LZ6A 2YV2A 4B4WA 3DFZA 1U1IA 3HADA 2PH3A 3LT2A 3AY6A 5THKA 4E12A 4BNFA 5ENDA 3SXPA 4Z0PA 2NM0A 3Q11A 1NPYA 4DGSA 2OP0A 4CR8A 5KKCA 2WD7B 4J9UE 1C1DA 5EN4A 4PN3A 4R5MA 4E6PA 5H83A 1PS9A 3LQFA 3KXDA 3WFIA 3EHEA 1S6YA 4R3NA
chains in the Genus database with same CATH superfamily
1YZKA 1HLFA 3PQCA 5CX1B 4MDFA 2JGLA 5IF9A 1JEYB 1GPNA 2NZ8A 1EGMB 3G2PA 1HNWB 1Q14A 4QUGA 4Y2GA 2J6BA 2V97A 1GKYA 3ONEA 1IG0A 3WA7A 4I8IA 1AKQA 4BX2A 1BW9A 3O9ZA 1X94A 1J8MF 4PLTA 3ZE9A 2PWAA 3R6TA 5FTKA 3BD9A 1DAEA 3KJGA 6Q21A 1EH5A 3PXXA 4EZIA 2B6HA 4KYUA 4ER3A 3VMMA 1QFJA 2DLDA 2QD4A 3T5BA 2HCBA 3CEMA 4XVCA 3ICOA 1R9NA 5EMMA 1LNSA 2PX8A 1V8ZA 1CHDA 5EUQB 3SC4A 1DRKA 3UT5B 2X0KA 4UASA 1A98A 3JQAD 3D8TA 1D5CA 2BP7A 3K2QA 3QPAA 3JQDA 1H5NA 2HDNB 4RHFA 3DOEA 3T5MA 2O2EA 3UMMA 4QO7A 4KWEA 1L5FA 4Q9JA 1KP3A 1K1EA 3KKEA 5JCJA 1WD5A 3SCZA 4AG6A 4DLZA 4X24A 2A9JA 2WABA 3DEFA 5F12A 4DQDA 2YKGA 2OECA 1RXCA 4LJ5A 3Q7TA 4MRNA 4WLNA 4MA5A 1AXEA 4E4TA 1C7EA 2PZMA 2BZGA 3PXGA 2GZ1A 3EBOA 4AU1A 1JEYA 3VOTA 1C8VB 3ACCA 4BX0A 4X9XA 3PA6A 1EVQA 1PJ3A 1BEZA 2VRNA 3V1KA 1G2QA 5A3QA 4ZXPA 1QRTA 2YNMD 4FGWA 5BOSB 3ET5A 1CB7A 2X76A 1SUBA 4KOAA 4ZP1A 3S2EA 3U17A 1WPGA 3V7UA 4D9IA 1CFJA 4EMSA 4RJIA 3KFVA 1PJCA 4RZ3A 1ZJ4A 1T2DA 4WMLA 1CU1A 5DZSA 2BI8A 3RU9A 1A7AA 2DPXA 2O8VA 3FRHA 4HQ0A 3R1IA 2FHPA 1G7TA 4BFXA 4F93B 3P0EA 4IV0A 5L3VA 3CVJA 1UZMA 3FBWA 3UT5A 3ILHA 3JASB 3Q12A 3IBFA 1NU8A 1YDGA 2C3PA 3VNUA 5ALJA 4GPAA 4NYMR 2ZAIA 3G68A 2G4LA 5F1YA 5DXJA 2PXXA 1BQ4A 3WQQA 1A7KA 1DDOA 1UAYA 2GBCA 3DHYA 1NW6A 5C8VA 2TRSB 2EDCA 3VNBA 5KQGA 5TVKA 3X1DA 3KYJB 2XVMA 3EF0A 4UAVA 4C2AA 2VCHA 3HM9A 3QPWA 1PJZA 1ZVKA 1P5JA 1JMVA 2H4HA 4I50F 2IYXA 3IO5A 3MILA 1WCIB 1D0IA 1PNVA 4IXDA 1B0UA 4KYIB 3TB4A 5C46F 1TYAE 4RTRA 3BG5A 4ZYTA 3TS1A 4AKIA 2Y1EA 3EGIA 4Y9UA 1SVIA 3PT5A 2JHCA 2PBFA 1QFMA 2IS2A 1MQ8B 3WP1B 1BA3A 2GJSA 2Q2WA 3G59A 4I08A 4LOJA 4JLAA 2NZUG 4QBIA 5EZ6B 4IOLA 3STUA 3ZCTA 2UZ4A 5JBQA 1YB1A 4G0PA 2XW6A 5TXGA 1QZUA 1ORWA 1CUBA 4H3HB 4N12A 5CEFA 1MU0A 3CX4A 3CUSA 2VPIA 3KSZO 2ORVA 4WACA 1SC3A 1PGNA 3PEVA 4QTYA 1C9NA 1HLDA 1V6SA 2JKYA 1EJ6A 1XQ1A 3C1AA 1G9XA 3O3MB 4JBIA 1U9JA 5C1IA 1O95C 4PF1A 4QD3A 2A5JA 4ZIRB 2W6MA 1GNPA 1QMPA 1JW9B 3S8MA 4AF8A 1Q95A 1N5IA 2FEMA 3IELA 2P62A 1J6UA 1JTEA 1RAHA 1SELA 3ND5A 4OI4A 4ZI7F 1XNRB 3VR6H 2XQGA 2ESRA 4TN5A 1OIVA 2Q3MA 2X2OA 1COZA 2X5KO 3UXHA 1QRAA 2V7XA 4P58A 3STXA 2KB0A 5A62A 5AVYA 4HNTA 1D6SA 4EATA 2IIVA 3CNHA 2GTIA 4P82A 3CZMA 3E61A 5FBZA 4E13A 1YKFA 1PFKA 1QUEA 2HN9A 2RHLA 1Y6QA 4GR4A 5AOVA 4EB6B 5THXA 3BT7A 4F8EA 1I5EA 3B2NA 4BFLA 4XVRA 1V5GA 3L8EA 4AVYA 4C1NA 1JJAA 1NNLA 4P3NA 1E59A 2HXGA 3ROZA 2V1UA 1RI3A 4YPVA 1E1NA 3MUOA 1YZYA 4WWHA 3G0OA 3FPLA 2G09A 1U8YA 4NV3A 5CU7A 5FA8A 2P9BA 2PANA 3AKZA 2J6HA 2C9BA 2EWVA 5DCYA 4ZQBA 2YJ6A 3DBOB 1OWNA 3IPCA 4F45A 5KYNA 4DCMA 1D03A 3HRHA 2VCYA 3T3DA 3FUTA 4ZIRA 2WOOA 4ERNA 2VQSA 1N6KA 2JB9A 4X61A 5FFFA 1VGQA 4YREA 1K3FA 3S1LA 4Q01A 4Y98A 3UAOA 2WTXA 3HVUA 4LNAA 4PS0A 5JJ5A 4TMFA 2NU8A 2WK1A 1DTSA 4ESHA 3QVLA 4NOLA 1O89A 1ZXXA 3V7FA 1Z4JA 3AHFA 3KQPA 2J85A 2CV2A 2IE0A 4P0QB 1W4ZA 2C9CA 3AP1A 3F5MA 3HDYA 4OJMX 2WUVA 4J4HA 4N3GA 3VX4A 5JNWA 2FQ1A 1GZUA 2FWIA 3E6AA 3I6BA 3E81A 2KM1A 4I55F 4AKSA 2HBYA 2VCEA 4EF4A 1YBHA 4EB6A 1G3UA 2RGNC 5DULA 1Z0DA 5AHKA 1WZNA 3DA8A 2AYZA 3KUXA 4JGIA 4AJHA 5CG1A 1FFAA 4TMZA 3TD2A 3PJGA 3UWMA 1VBMA 3IVAA 2YWFA 1Z33A 2B8NA 4MRPA 2E37A 4S35A 3E9CA 4NBTA 4PXAA 3HUTA 1UT6A 3CMCO 1KEKA 4NWIA 2OHXA 2IHYA 1V1JA 3KHTA 4FN5A 3QM1A 3BH0A 3HL4A 3LW7A 4P6VF 5FUQA 1BIFA 1ULUA 3MB5A 1Z4OA 1EVEA 1JG2A 3I92A 1Z0SA 3G2IA 3KJFA 5FNVB 3TMKA 4BB6A 2QVZX 4Y18A 4PINA 1DQSA 2ADOA 3CLSD 3TR0A 1KFJB 2C4MA 2JLZA 4DUYB 1VE5A 2FTKE 4DUPA 3DH0A 2RFLA 3M6LA 5EC8A 1FF9A 1A9PA 1ZZEA 1RKXA 5EJ4A 1BRMA 2AF3C 2AFRA 1N3BA 5KTOA 3ETHA 3O6VA 3GRPA 5EQTA 4ZAGA 1QU2A 2X2EA 1U4OA 4G1BA 3SYRA 1J22A 2ZXEA 4HB3A 2OG1A 4IZOA 4YI5A 7GPBA 5I8PA 1ZOLA 1U7DA 4FDAA 1PR6A 4G0NA 4MDYA 2W2KB 4NS1A 3WGHA 2AJ8A 1T9DA 1L7AA 4AWBA 2APJA 5ALDA 1Q1QA 3QI2A 3BSYA 3E1GA 3ULKA 7MDHA 4F4IA 2AUTA 1U4SA 4YO8A 5JS2A 3QLVA 1ZD3A 4RL6A 2HF7A 1TRKA 4MV4A 4QBGB 1NP3A 3Q3GE 3A25A 3QV1A 4G5XA 4U0JA 3RWOA 3U4AA 4ERXA 1D1PA 3RUAA 3LPLA 4PG7A 3IAS6 5AI8A 3SM3A 6NULA 1H8HD 2QPTA 2VWPA 3C3MA 1QVRA 1OXTA 3CIFA 2I4MA 3LA6A 4LXHA 2IZ0A 5AK5A 3UUEA 2VKTA 2REQB 1JXMA 2GTHA 5FNVA 1A69A 3W1VA 1VP9A 1NJ8A 4MQUA 1AKWA 4Z7JA 1C8BA 1EWVA 4B31A 3LLUA 1JPNA 4ZI7A 1XE3A 2FDXA 2R8PA 1J8QA 1LGYA 1XCJA 1VC2A 2OAGA 1OAKA 2UDPA 4KN5A 4M9ZA 4URHA 4JOCA 2YJ3A 2QPOA 4G8CA 2RCYA 2ZB7A 1ITZA 2HNKA 3FYSA 3I6IA 3JPYA 1O87A 3PUIA 4HGQA 4HGZA 5F7ZA 3SBOA 5K2OA 5F2OA 2Q1XA 1DEKA 2PXAA 4JZKA 4KB5A 3R7SA 4JL6A 2JZCA 2CK3D 2Z57A 4A4DA 4NHOA 4YH1A 3WGMA 5JNTA 2W2KA 3PEUA 2WKSA 4NAVA 5JV5A 2OHHA 4U7FA 1M8PA 4JI5B 1P5FA 4HNHA 3QWFA 3TRJA 3QJ5A 3T0IA 4OLAA 3PYLA 1NVTA 1AB6A 2ZP1A 4JD5A 5J59A 1GU1A 2FPWA 4PLYA 4UEKA 2ZM5A 2O5RA 2Q2OA 1F3OA 4I8XA 1J4AA 1H1LB 5TT0A 2WSMA 3D6JA 3GJXC 1CZKA 2OAEA 2ZTVA 5IDWA 2JGKA 2W83A 3K96A 3WDMA 3UJHA 4EMUA 1XHEA 3IP6A 2B2CA 7AT1A 2D5AA 2QMOA 3A9WA 1JKJB 2Q8QA 3GQBA 5C0OE 2REQA 1N6LA 3LZCA 3ND7A 2VP4A 5K8IA 1N7GA 1JU3A 1AE1A 2ORIA 4MGZR 1NUHA 4ZTUB 4HI0E 4MVXA 4LJ7A 3CH7A 3JQ7B 4GI1A 2VXBA 2HLDD 2V5VA 3HGQA 4H6PA 4RE6A 1Q12A 3KQLA 1A71A 2L82A 3N2YA 5C9ZA 5E7IA 3AUKA 2G40A 3M6AA 2R8EA 2YIJA 4L5AA 4IFIA 4E2ZA 3IMEA 3EZLA 5LNK6 3PK0A 2EFEB 1IFXA 3P9QA 5ALTA 3GFVA 3V1LA 3AV3A 2COUA 3G88A 1YJ8A 1U7XA 1E92A 5SY4A 1JFFB 2ACKA 2P7HA 1FZTA 5IC5A 2O5EA 3IPLA 1EB9A 3E05A 4J0QA 5FOXA 5CVTA 4U6NA 4YUYA 1JQ3A 3L6CA 1L6IA 5AI5A 4D79A 5CFQA 2Y4NA 5IKPA 1AX9A 4PNHA 2PX3A 1P4RA 2M1ZA 4L0QA 4Y8VA 4YLGA 1JUDA 2VC2B 3M5PA 1VECA 4L15A 1PAUA 3EGOA 1DDIA 3HS3A 1XTZA 3OQVA 1GTZA 3FDFA 3N7AA 4ON9A 3FGZA 3KAPA 1SEVA 5FUXA 3VISA 1LPOA 4ZV4A 2HTEA 1E8NA 2FOIA 4FMCF 4ZPXA 3M4JA 3G0GA 1II9A 2OZPA 4YAKA 5HM8A 1OYOA 1L5MA 1Y3AA 2PFSA 4L7VA 2JHGA 1K5DA 2P2LA 2RAPA 3FTNA 1JKJA 3MCTA 4LWQA 3K1AB 2B5WA 2CDRA 2ZYHA 4RFVA 3AZOA 4DNQA 1M1ZA 3EVGA 5DRYA 2GN1A 2RK4A 4Q6BA 4RGVA 1XJ0A 4V2IA 1RQ2A 3JQ7A 4GICA 4IF6A 3HJHA 1Y1TA 4R9RA 3F3MA 1V5WA 4Z3DA 1QWOA 3H4TA 3RC8A 4V24A 4EG4A 1GZHB 3IUQA 3NAGA 4ICIA 3GCXA 4WDRA 5KDOA 3WK8A 4RD2A 1E2NA 2Q5CA 4L50A 3JYOA 2RBKA 3AONB 1M1NB 5EP1A 2BEWB 2G5PA 2VDWB 5E4YA 3UW1A 3WYDA 4CVNA 1JFFA 4GOKA 2PWPA 5JC8A 4WH0A 3EARA 4H6XA 1VIVA 2PHZA 2IDZA 1AO3A 2OBFA 3BC1A 3IAHA 3L01A 1HI9A 5EKUA 3WV4A 4A9AA 5HKKD 4CDGA 3FSGA 1VJ5A 4G5FA 4UFPA 4K6KA 2FEOA 3RM3A 3BCSA 5JASA 3TJMA 1F2VA 1ILWA 1C0KA 3V1YA 1E3JA 5KWVA 3OLQA 2P0AA 1JZQA 1FYFA 4ZAXA 1RLJA 3I01M 5DX0A 4QQ8A 1C81A 2PR2A 2NO1A 3HJUA 2HA0A 2DAPA 3KTAA 2YQ5A 4WI1A 2EBHX 3IOYA 1EU1A 3HM2A 4NYIQ 4U2EA 1DNPA 1SUPA 2DKOA 1QBGA 1G5TA 1QH1A 3DT6A 3OE4A 3PICA 2DYKA 5COBA 3MSXA 3JQ8A 2P3SA 4NMXB 3AJRA 3C41J 4J2TA 1ONNA 3FOZA 1TJ4A 1L8OA 4DJEC 5EJEA 5AVXA 3KSRA 1U7TA 3D0OA 3UMCA 2GYVA 2E4WA 4Q1AA 1X1TA 3WJ7A 3NHFA 3UN1A 4YY3B 4U3JB 4HVAA 1E63A 3HBNA 1M6VB 3WRXC 4BO7A 3IXMA 1BCRB 3GT3A 3O1LA 1P7PA 1WBJB 2ID4A 4MITA 2Z08A 4C7OB 1ODIA 2ZI7A 1SC6A 2FZGA 4X85A 1M1NA 4JBGA 4XYGA 1ESEA 2BEWA 3WYEA 3RO7A 2WSLA 3PNQA 3M7IA 1TMYA 4KVFA 4ND5A 3PFKA 3WJAA 1Y4UA 2QLLA 3JXEA 2NWQA 3ND6A 4RETA 4W7HA 2HV9A 4TYWA 4POAA 1XTVA 4RAOA 2X9NA 4M55A 4GECA 3WKAA 3NBZC 3GVXA 3NRCA 3LGXA 2L2QA 1WEKA 2B7CA 2D0OB 3NTQA 4TVKA 1MFZA 5HDBB 3RE1A 1XVTA 2V58A 5A1TA 3RW9A 2E55A 3LXMA 3X2EA 5JT1A 1XWWA 4IUCS 5ALOA 3A27A 2ZE6A 2HLPA 4DCSA 3W9SA 4JGGA 5JAPA 1GN8A 1L0BA 4J7AA 3BBLA 4PHFA 4NH4A 2ZE8A 3A26A 3OX2A 3I5XA 3J81A 4DLRA 4FFNA 3L0BA 2C3YA 1XT6A 4LN1A 4GZ5A 3OTQA 4NP6A 3OZTA 2F3PA 1X2BA 4L9AA 3MEQA 2YHUA 5JARA 3RSCA 2QX9A 4U3JA 5COQA 4PE5B 1SHKA 1M6VA 5DJ5A 1BCRA 3DTYA 2JW5A 2PX6A 4C7OA 4GKKB 3KUCA 3T4EA 1WNTA 5DVZA 2GEDA 1CJVC 4KEAA 5GZ3A 1SUEA 2LCFA 3D1LA 3U31A 1W4CA 1QRRA 3H5OA 4I9HA 4V38A 1UK6A 2RIRA 3URKA 1S5PA 4TRMA 4X97A 3EVNA 3NASA 4F91B 3I28A 3I61A 3PGMA 3D1VA 3BCUA 3H8WA 1V5FA 4ZDWA 3AM1A 4D6YA 4D9HA 1CP2A 3DXZA 3KZ1E 1K06A 4JI0B 3K0BA 1WUTA 1UMCB 2ORED 4RMNA 5A5DA 3TTTA 1U7OA 1XRLA 2CWDA 4G24A 5AK6A 1NUUA 1RPNA 5KTPA 3D6FA 5IMSA 1J99A 4FDMA 2PPLA 4K88A 3ZOKA 2Z8XA 3KSDO 3GBSA 3HC7A 2F17A 2GLTA 4KGZA 3V8RA 5A9RA 4LSZA 3G02A 4TS1A 5CNIA 1CY2A 2IEDA 3QUAA 3WS7A 5JQGF 4F2HA 1W0JD 2EATA 3PQ5A 4IMIB 3OM0A 1YU6A 5J43A 1JLKA 1PUIA 3VZSA 4HP8A 4D45A 3WLNA 2HDWA 3PX2A 2VA9A 4GP6A 4BVGA 4E07A 1NYQA 1SBIA 2NUTB 4EEKA 4UU1A 1GQFA 2E5FA 3AUYA 4HDRB 1KPGA 3GJ6A 1BX0A 5B36A 1IJEA 1P91A 2DPLA 1X74A 3NHWA 4Q9NA 1J70A 4LXGA 1W36D 1CIVA 2GXAA 4B3BA 3PDJA 4A5OA 1J0EA 1I3NA 2HF8A 3FAKA 3IRUA 1QCZA 4OIMA 3IEMA 4W7SA 4LF4B 3RK4A 2E4UA 1Y4ZA 3C8MA 1KBZA 5BN4B 3KQOA 3Q40A 1KE1A 3SS7X 1LBSA 1KEUA 2AQIA 2BJVA 5B57C 1SVSA 4CU2A 1R10A 3LX4A 5EHIA 3RB8A 4RY8A 5HRCA 5ILOA 2Y2VA 3OEED 1KH1A 1X80B 2ZBFA 2G04A 1YWGO 1Y5RA 3G5UA 4TQ9A 1UMCA 1R5OA 2J45A 1KJJA 1WKBA 5C53B 4Z8YA 2JIRA 1FSGA 1HQCA 3A2NA 1YE3A 5ALPA 5BSFA 3T35A 1R66A 1UFQA 1HYBA 2HK7A 2PRSA 3DVLA 3K9CA 3C4JA 3KEMA 1VJ0A 2K2QB 5L6MB 1TIPA 4FI3C 4B7CA 3N6RA 1IEQA 2DQKA 4R2LA 5JZ9A 3U7JA 2MYNA 1YQWA 3WGZA 3PX3A 1AY0A 1VZ3A 1TJYA 1AQJA 2NUTA 3AEQB 1FSSA 1E89A 1QVZA 1ZNQO 2DU8A 3KELA 2UV8A 4HDRA 1A4IA 1E94E 2PO7A 4IWNA 2GFQA 3ZV6A 2ADMA 3UK6A 4FIDA 4KAFA 2FGJA 5IU6A 3GCGA 4PONA 2FSSA 2C2ZA 4F84A 1YS9A 4N40A 2QN1A 4LPKA 2CXNA 5ALIA 1P29A 5D5QA 4U9HS 1SU7A 2UZIR 3QU9A 3WGTA 4D43A 5BN4A 2D3TA 5ICSA 3KZXA 4YCDA 3R7DA 3PEYA 1NYTA 1YQQA 2HRBA 3QPCA 4OMUA 3T7CA 4WPGA 2OXIA 4FM9A 1T35A 2AG6A 1KRHA 1TE2A 1D1QA 1X80A 1AGYA 3BGWA 4ZDIA 5E4TA 3SE7A 2X7JA 2O2IA 5LMUB 4HDMB 4A0SA 3P2JA 4PPFA 5JD5A 3GLGB 2EU8A 2D0DA 5BN3B 1XD9A 2C42A 4BNWA 3VDRA 3SYNA 1EP9A 2JI4A 4F12A 2BBOA 5F7XA 2X3FA 5L40A 1OFTA 3CNLA 4G84A 3G0HA 4LWZA 3HNRA 1IZ7A 5D3KA 3FUCA 5KVQA 3GLFE 4B79A 1PDWA 3TAXA 2J8ZA 4HZIA 2BFEB 3EDRA 2C9MA 4H0CA 5P21A 3MIZA 4OXRA 1H2FA 3R3ZA 2BUCA 5C5IA 5I3CA 5KOHB 3K70C 4O4IB 3AEQA 3SWWA 3CX7A 3ZWXA 2JGMA 3DZIA 4LSGA 1Y1LA 4OYRA 6LDHA 3U4MA 5TQVA 4PYMA 5EIWA 1S7CA 4D3SA 2AA3A 3W6PA 2OGUA 2P1RA 1OZ0A 3CKKA 2XAAA 3G5TA 2NZJA 2IRWA 4YJKA 1BTOA 3VKVA 3D3EA 4ALIA 4D4HA 5BXYA 621PA 3BL8A 1QF9A 2CEKA 1KY2A 2Z30A 3WQSB 4C78A 3TECE 1Z25A 3SC2B 5AUOB 1C2YA 2P6OA 1NVBA 1YCHA 4U7WA 1Z7EA 4N48A 1NVVQ 3DOIA 1H2WA 2W4MA 4PSUA 3V4VB 5K8VA 1FP2A 1XZGA 4PX5A 1BAPA 4HDMA 3RUEA 3O0TA 3WR5A 1FMCA 3ZHZA 3GLGA 2ECPA 1U1EA 3UQYS 1OAOA 4B6EA 3II6X 1NQTA 2DQYA 5BN3A 3LWNA 2CVFA 1XDGA 2H7YA 3BWDD 4G0ZA 5AOCA 2GPAA 4XR9A 4BJ3A 1PGOA 3N86A 4DN6A 4AY4A 2YTZA 2BFEA 1ZBDA 3C8ZA 3GN1A 1JHDA 4RZSA 2MOKA 3QG5A 1OJ7A 1UKAA 3UA4A 5EJ7A 2LGJA 2YFYA 1DB3A 3TUJC 1FMFA 3EZXA 2QI9C 4O4IA 1ZR4A 5TPZD 1CDZA 2I91A 1K88A 4GMHA 4N6GA 3G5AA 2GCOB 5K05A 1N2EA 4CNBA 1S9HA 4I5EA 1QOPB 4QFCA 4QGHA 2H08A 4ENQA 5IP5A 2XA2A 2VP6A 1J0AA 1TZ2A 5LYYA 4UE3S 4U2FA 3W5DA 1WHTB 2DECA 1N2ZA 4PG4A 4DQ0A 4LPSA 3PHCA 4OXXA 3K9WA 1BKSB 3DEKA 1H0RA 3W2IA 1WOYA 5BWBA 1A27A 1TCBA 2R7KA 3D6NB 4TWBA 1LNZA 2BFBB 3SC2A 2ZS7A 3UMBA 3UK7A 1DRVA 2BDTA 1YRWA 2VJQA 1P2GA 3MWFA 2ZWPA 4Y2YA 3VR5H 5CLJA 3OO0A 5M3BA 1MT0A 2B5OA 5IAJA 5JRJA 2OLJA 4K6FA 2LDBA 5PNTA 3EB9A 1IZZA 3HWSA 4ZZIA 3TQFA 2BMVA 1DZIA 1EXWA 4H77A 4ZALA 5ILQA 4A6XA 5A0TA 4C7BA 3HCPA 1XU7A 3NNDA 4UBIA 1QH8B 3K72B 9ATCA 3IVXA 1Z9BA 2ZTMA 3CXUA 2UU9B 1BDHA 1EBFA 1JKXA 1OZFA 3KDSE 1TTQB 3ZZ1A 5IVHA 3O74A 6YASA 4LHVA 5A0VA 4DFDA 4YRAA 5KHLB 4J1GA 2IF0A 3AFGA 3VQTA 5KMGA 4ES6A 2OAQ1 3RKUA 2RJ3A 4QZVA 1DEOA 1ZXBA 1BFUA 1XQ6A 2R00C 2GCOA 1MIHA 4HDKB 4XR4A 5JSHA 1IMOA 4OV6B 2XYPA 2FX5A 3UUWA 1CB0A 3ELBA 3OD1A 3U3ZA 3H6HA 3KTOA 2H8KA 4Q93A 4C2BA 3D43A 1WHTA 1PTJA 1PUJA 2XHZA 4IMPA 4QRHA 4QBKA 5HRAA 3EIEA 3JRNA 3WWYA 1TLTA 1GZ3A 2IQ5A 5D6NA 5EIHA 2QXTA 3ZGZA 2B1QA 3ZJUA 1Z82A 1TAQA 2BFBA 2YXPX 5BR7A 3MTEA 4F2DA 1E98A 2G06A 1K27A 4UDYX 2D3WA 2GVZC 4PYRA 2X9LA 5SY9A 5KVSA 2CL6X 4N9WA 1R0RE 3RANA 1XHLA 3I8OA 1ODFA 5JZVA 4NZPA 5L8VA 1Y3CE 3U0BA 3KWMA 4Z4QA 1OB2A 3S2YA 2PT5A 4FLFA 5DTEA 3ZDBA 2JJ1D 2E5WA 1QH8A 3A6FA 4HAYA 3VOBA 3B2EA 1YZGA 4JJGA 1BE0A 1XRPA 4HDNB 3F7TA 3WNZA 4CJXA 4OGGA 1G21B 4B7XA 4CKBA 3EWAA 1N8KA 2BM0A 3PP8A 3H2JA 2BGMA 1LQUA 2VZEA 4WXRA 1LWNA 2PZFA 2VSXA 1MP0A 1J56A 3M0EA 4ZOBA 3GLIB 3H3JA 5DMHA 2EX1A 1GUZA 1W0KD 2Y99A 5JMTA 1UJCA 3GJ3A 3WRWA 3D3NA 1XKXA 1H0HA 4ZMBA 4HEJA 1QB7A 3MK31 3TRHA 5CK4A 2HMYB 3ZE7A 4EYGA 4MZXA 3CX8A 3HXKA 3M6FA 1L7DA 3G9TA 5IF3A 1MT3A 4RZHA 2Z8YA 1VCNA 5IT9A 3HK2A 1Q15A 3DDZX 2XTNA 4WFKA 5J4YA 1G2IA 1Q83A 4M1ZA 4TLBA 3V7WA 2P69A 3X2FA 3ZCSA 2PUHA 4F9GA 3CVXA 2X2PA 3BX1A 3K92A 3MJ4A 4X8MA 5BNZA 2E4VA 3CRZA 4B75A 3SHVA 2WTBA 3E9QA 1ZZGA 4LMPA 1IL0A 2LP4Y 1E9SA 2W2PA 3M34A 3AF3A 2VJYA 4HGRA 4L4XA 4UC0A 5ED0A 3ROPA 2O50A 4F71A 5BN5B 1XYGA 5E1MA 4MPDA 2EAUA 3I2HA 3OCZA 3U1VA 4LBWA 4RIEA 1GUFA 1Z12A 2C5LA 4BTVA 1TZMA 2WUFA 4G2TA 2GZ2A 2V3VA 4N3NA 4B3JA 1G55A 2P5SA 1ZKDA 2JF0A 2AT1A 3NANA 4YK7A 4I6JA 2D00A 1O97C 3N8HA 1G21A 4QOJA 2R96A 8ADHA 3FFTA 5L45A 5CXSA 2J3MA 4IQ4A 4L07A 3W3ZB 3GLIA 1N3LA 2JLUA 1GQSA 1U7PA 3RADC 3OFVA 2WF6A 4BB9A 2QYHA 1UAGA 1T8UA 1H9BA 1Q1ZA 1SULA 4FU0A 2QY6A 4FHGA 1GTJ1 4NQRA 4JXXA 4UVDA 1Z8DA 1NUQA 1MX9A 3HKDB 4PZ9A 2GYYA 3E03A 5IX8A 5I9IA 1XRMA 2WD9A 1CP3A 4A0QA 4KQ1A 4AJ2A 1B8UA 5E9WA 4Q4CA 2FSFA 4MVJH 4COOA 1P4HA 1UIMA 2ZG6A 3H99A 2VJOA 1UJNA 3RFXA 3RAPR 4FB4A 1F8GA 2F1OA 4RVGA 4CV0A 3VU3A 1R0KA 3RAJA 2PYZA 1MAWA 5IULC 3E9ZA 6AT1A 2G63A 2W9XA 3NBXX 4J94A 4XQ0A 4Y7DA 1EZ1A 2VLBA 4O4LB 5AKEA 5TF4A 4DG5A 4F6RB 3ZGXA 5IVKA 2OAP1 1V7QA 1F4LA 4CIBA 3BGOS 4PW0A 1N5DA 2GEFA 3CO5A 1X14A 1JA1A 4P84A 2BBTA 1G63A 2QENA 3BA6A 4FYIA 5ELLA 4M21A 4OQMA 5JE8A 4D8YA 1Z37A 1CZUA 2KJQA 5BN5A 4M1SA 2P8JA 5KYYB 4ZANA 4WZBB 2RAUA 1QHXA 2QOEA 3W9UA 2BPOA 3EXEA 5G02A 1JVNA 4TYYA 2O19A 1ZVJA 2K2WA 3QBEA 4P3PA 3IEIA 1BX1A 4EHFA 4L73A 2CF6A 1X0XA 2Y67A 4KNYA 4GG1A 4Q66C 3T06B 3TBKA 3VUFA 3MS4A 1E1MA 1QX3A 3NNNA 4NCNA 4PU0A 5FPTA 4CKXA 5JCXA 4B3RB 3MLAA 4G1UC 2CLFB 2OYCA 5LUAA 1B41A 4E3WA 1I1NA 3HKDA 4LKRA 3RYCA 4HQ6A 4OP3A 4YMWA 5CCXA 2FE4A 2ECQA 2XQIA 3H9QA 4DWWA 4N3AA 2Y1LA 5BV8A 1UFOA 2V7WA 1FS4A 3EIUA 3MSCA 1FDSA 4ML3A 5KTMA 2IY9A 1ZI9A 3RS2A 1HC7A 4EPTA 2OCAA 4O4LA 5HIKA 2PZ8A 2B20A 2FWNA 4GP9A 4F6RA 1VPWA 2B69A 3JTEA 4EA6A 3E2IA 4MYDA 3OE7A 4N5DA 1ENPA 2QWXA 1AUXA 3HEAA 4DXHA 3O03A 3SZ3A 2FCRA 4HWKA 2I0FA 2MIIA 2FGKA 4KQFA 3SJZA 4EUNA 4YMGA 5KYYA 5MDHA 4WZBA 3CZPA 2RHCA 2VUTA 3EXFB 3WQBA 1TD1A 2FRVA 1JZTA 2PT9A 4L75A 2QL7A 3OFND 3N5KA 4ZEWA 1GGNA 4IVQA 3K1TA 3N0VA 1BOOA 2BGUA 4Q3KA 1VRVA 4Y9TA 1YTUA 4ZGGA 4YCCA 3E1KA 3QPDA 4KACA 3WRYC 4BLVA 3T5AA 4HYTA 1SD1A 1YHNA 4JXJA 5LMZA 3AGPA 4E46A 3AOEC 3R9XB 4ND3A 4A10A 3L7LA 4KDEA 1PR5A 3L1VA 4QYSA 1KI9A 3ROQA 1R9JA 5EJ6A 4OL0A 1ZIPA 4PTYA 1PT6A 3JRXA 4LMBA 3ADCA 2INGX 4EAQA 1T29A 1SVMA 3UHFA 2ARKA 1GGVA 1S02A 4FDVA 2V7GA 2Q7XA 3HLKA 4MO2A 4X6XA 5J1SB 3ROXA 5KTKA 3S8EA 4UD6A 1YR6A 3RC2A 1U9IC 3NW9A 2CLKB 3DYVA 4H18A 4KSCA 3MCAA 4EENA 3HUUA 1PVVA 4AF7A 3A4YA 1XVIA 2ZRCA 1CEYA 2H59A 3JVVA 4DDUA 3A36A 3CGGA 1O1YA 1KYVA 4B3CA 1Z7BA 1IOLA 3SHOA 3EXFA 2VH1A 5FKJA 2VTBB 1EFTA 1USVA 4IL5A 1W35A 3EJWA 1NLYA 4PNZA 3WIOA 1BRTA 3BF8A 4IGFA 2GN4A 4NV0A 2Q2NA 3ZQ6A 4DARA 4UHFA 1PWHA 2QV0A 3CWCA 1E2IA 2E4XA 1RXIA 4RVSA 2OZKA 4ALNA 2Z83A 4IDDA 2GHQA 3C3DA 4OCZA 1O6CA 3F90A 3R9XA 1JDNA 1RMYA 4FSXA 4OHUA 2X8AA 1FXWF 4JLBA 1WPXA 4NDAA 4MV5A 1WETA 2GILA 5KSYA 2DR2A 4GHWA 4FHDA 5DCLA 4GZ3A 4XX0B 2HC9A 4YO7A 3IKMB 2D1YA 4WY2A 2W93A 1SCQA 4LQ4A 4K26A 5H4GA 2HCFA 2C4HA 3ZZTA 2ZXUA 3MCZA 1SKYB 1MAHA 1T5IA 2QP3A 3Q2OA 1PLLA 5MN4A 4LC9A 5AHWA 1P3DA 4M1TA 3VYRB 1GFZA 2VDKB 4S24A 1RBZA 3GEMA 5LYJB 3LSYA 4IOMA 3BIXA 1CWUA 4UVGA 4BRZA 4B4DA 3ZVNA 4DSOA 1O0SA 1TI7A 3SMQA 1M8FA 2O2GA 3E9RA 5DASA 5TB5A 3V2IA 4REQB 4MVJI 1VDMA 3IFSA 3P5BA 2BJHA 1N2JA 2A4KA 4BLOA 2VTBA 3Q8KA 3ABSB 1XDUA 1M9NA 1ZGAA 2HPVA 3I04M 2FX3A 4UNIA 2YNMC 4ZRMA 4BKMA 3IJEB 1DKRA 2Y1WA 3DSRA 3R5TA 2IBTA 4TYQA 5GVSA 2DFPA 4P35A 5TARA 4FOLA 4MUNA 1W75A 4W99A 4AZVA 1NONA 3KVRA 1Z0KA 2B4RO 1SC9A 4A7PA 5DNWA 3MERA 4FC7A 1GILA 1ORRA 4ITUA 1FSZA 3QFHA 4EL0A 1SHZA 2ZI9A 4XX0A 1TTHA 1T0PA 3W2EA 1JLMA 3WYBA 1Y8RB 3VZCA 4XWKA 2HNAA 3JR7A 1L4YA 2I03A 2J1LA 1PEYA 3A1NA 2HGSA 2ZUDA 3EUAA 3NV7A 2FH5B 4PQYA 5IAGA 3D7MA 5LYJA 5DLQC 3R8CA 3PWSA 3GRKA 3ROKA 1SXJD 3NUGA 4LCJA 3T7RA 1IUOA 4JI8B 4Z9BA 1N8SA 4NARA 2J5XA 2QT9A 2R1TB 3HXMA 5K0FA 1ADGA 2X8JB 2FMIA 4ME6A 5GV8A 2H2IA 4REQA 3SM9A 4TVSA 3DVAB 4RJTA 4PZEA 4EZBA 3I58A 3AH8A 1WXDA 2C4WA 3PPIA 3CB2A 3PEFA 2YVLA 4NNPA 4AC9A 1K3TA 3CPSA 5BT8A 1XK7A 2OPBA 1K5GA 3DONA 4MUKA 3PFGA 1EE9A 2HXYA 1WUHS 2PGLA 2Z9DA 3D8RA 3MOGA 1CV2A 4UVEA 1T6XA 4CTKA 3MAGA 4XKJA 2ZB3A 3BXPA 2PLNA 4H16A 4F5ZA 5FTNA 4MROA 3DCJA 3HYSA 5GP1A 2I6UA 2YX1A 1B6SA 2O1XA 1SUIA 2QP9X 1T9GR 3P1JA 4MPPA 5DH9A 5H0IA 5BSRA 4TKUB 3UYLA 1OA1A 1ZK0A 3QEAZ 4LYHA 1NUPA 4EGFA 1NVEA 2JLWA 1Y8RA 3OD5A 5LKRA 2IXBA 1XGKA 4JSYA 5E0KB 2HFKA 4ZRDA 1GYPA 2FN8A 2AJCA 1ZN7A 2QZ9A 2WFAA 4ACAA 4HDOB 4CT4B 1A8UA 3QBVA 2DWOA 1OR8A 3B1YA 4MUFA 3KVYA 5EZYB 1L5HA 4C0JA 2PSDA 4F3TA 5J3JA 2JGEA 3IUNA 3ND8A 2C5SA 1YIAA 3UKDA 3UUFA 5HJEA 4IHJF 6GPBA 4S1TA 5EEGA 4BDSA 2R1TA 1N2XA 1C50A 1TUGA 1ZNWA 3IOEA 4E2XA 2X8JA 5ABPA 3HXQA 4YIKA 5BWOA 1RZRA 2Z4TA 3HI4A 3JYLA 2X0JA 4U9UA 1TKRA 4EQ6B 2X40A 3CPHA 1QXSA 4BP3A 2EGUA 1A1SA 1NC3A 1CS0B 1LJ8A 3A1SA 1RWNA 3AF2A 3BD8A 2YUTA 3T7DA 1CZRA 5FPQA 1DUVG 4NE9A 2PX0A 4F5YA 4K0RA 5FPKA 3VSDA 5JEEA 4DKJA 1RC8A 4FGLA 4AMUA 2R5FA 1AUVA 4L72A 3V6LA 1ECBA 1WXFA 1XTSA 3DB1A 3HY6A 5CX4A 3SIPA 3QVXA 4CMJA 3VHQA 4HLQB 4P4LA 4PQFA 4FQ7A 3UOAB 4CV1A 4TKUA 3I2YX 2GZ3A 4E5UA 5GTDA 2VUSA 13PKA 3HPQA 1ZDMA 3ID6C 1GPDG 1W29A 3LCRA 3RK0A 1URPA 4DTIA 3ETGA 3ES9A 4DANA 4R84A 1EYZA 2PK3A 4IGKA 1Z75A 3OTHA 3LNTA 5HKLA 2VDJA 4XW2A 2HJHA 4DCJA 5CVDA 1U02A 4CFYA 1NE2A 1TCUA 4MQ4A 3BJMA 1Y1KE 3PR1A 2G17A 2JCXA 2HSDA 1Q11A 1DHRA 2AN3A 1AA9A 2Q21A 2YDXA 1DL5A 4GOND 4P83A 4Q7KA 4R05A 2L0XA 5JMPA 4BMNA 4DTCA 4Z7QB 1ECFA 1SGWA 4F4CA 5JRDS 3GUCA 4O3FA 5BRAA 1T8SA 2G9ZA 1UKZA 1KO5A 4F9FA 2V9ZA 1L7RA 4LQLA 5I7OA 2ZETA 2QRMA 4B2LA 4YRZA 4EQ6A 1HETA 2H2AA 1VLZA 1B8NA 5TT1A 2QAGC 2XCOA 1CS0A 3FW1A 4UPVA 1RLTA 4X00A 5DW0A 5GJCA 3ZS8A 1EM8B 1XPUA 4NPHA 1A7JA 5B55A 3TFOA 1WXWA 3B1KA 3M1YA 3LVRE 3RHSA 4B76A 4Q3DA 1GD1O 2OL4A 2WJHA 1CERA 5DK6A 4MV0A 1I3OA 3AKYA 3OF5A 2JGRA 4IS2A 3EZFA 3REFA 3SX4A 3ZIDA 1D5WA 3A9RA 4D8WA 1N2CB 1JU9A 3JYHA 4MI6A 3CLSC 5HS6A 4M1WA 5I7EA 4R2MA 1SXGA 1YI0A 3GB9A 4IGIA 1DBRA 1JHAA 2QAJA 2F43B 1VSVA 5J5AA 1WDWB 4UBMA 2GXQA 1X1RA 1NLFA 3CC8A 4I8DA 3Q8WA 1KEWA 1E3EA 3TEJA 1Y3FE 3JX9A 1OBFO 4ZVVA 4FEGA 3O8QA 1SUSA 3COVA 5KOYA 3DPSA 3RDPA 3OURA 1K0UA 3VTFA 1YKGA 3R20A 4HDAA 5DP1A 1Y8CA 1GIAA 2HNBA 1E1RA 2CXPA 2WJVA 4X60A 1Q6YA 5I5GA 5IW8A 4U7HA 3V8BA 3ESZA 2QM7A 1SZJG 2GAIA 4QO8A 4NCXA 2XWBF 4NU5A 3HJFA 3QLUA 4B83A 2Y27A 1YASA 3FTPA 1EM8A 4DDKA 4EA8A 3B3FA 3WBKA 3AVOA 4M99A 5I9BA 2BKLA 3RFVA 1DP4A 2OQIA 3FKSA 2IPMA 3QY0A 4HEHA 1KAHA 4JLNA 1QIJA 1M83A 2TMKA 2W2LA 3R5SA 4UAUA 2OENG 4PYOA 4YB8A 3S2SA 4CR7A 2PL1A 4WJZA 4RTPA 4CEJA 1N2CA 4MIYA 1XQVA 1UQUA 5BXQC 2VF4X 3FSJX 2BAGA 4KI7A 4HMQA 2X58A 4OBWA 2OCYC 3DO5A 3C6YA 2C78A 2F43A 4C07A 1OHHA 4MYTA 4XQEA 4MSUA 4F4HA 4MW7A 1UOEA 2VDUE 2ZREA 4GLBA 2YXNA 1Y5IA 2ZUUA 3HR8A 3B2QA 5KNDH 3D7NA 3PWTA 1RP1A 2GK4A 4KWTA 3B1FA 3NFRA 1ICIA 3LHKA 1NMSA 3USCS 3CS3A 4Q1FA 4LFAB 1AHHA 1K97A 1ZW6A 3HYRA 4OK5A 4B71A 1H5UA 3FMOB 5NLLA 2M6RA 4PHCA 1Z63A 1TU0A 4Y2UA 4EHLA 1NW3A 1C3JA 2JAHA 1P61B 1T5DX 2FPGA 3HZZA 3FOBA 3JWPA 4HWPA 4R9UC 5ALLA 5JADA 1W2GA 2WPNA 1EFHA 1TGYA 2YOHA 4WXEA 3VC7A 4MOWA 4EVRA 1BROA 1JDBC 2NG1A 2ZVJA 3FZNA