1EQ7A

Core structure of the outer membrane lipoprotein from escherichia coli at 1.9 angstrom resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
56
structure length
56
Chain Sequence
SSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Core structure of the outer membrane lipoprotein from Escherichia coli at 1.9 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE LIPOPROTEIN
total genus 25
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1eq7A00
1N2DC 2GUVA 2GUSA 1EQ7A 3H6PA 1KFNA 1T8ZA 2IX7C 1JCCA 1KFMA 1JCDA
chains in the Genus database with same CATH superfamily
2M3EA 1EQ7A 2WMMA 2NPSD 4ZKPA 3SWFA 1BSHA 1GW3A 1ZLLA 3SWYA 1SS1A 4NPFX 1S5LX 2FYUE 2RN0A 2HG5D 1NU1E 3MGNA 2M3BA 1JTHB 2QVAA 3GHGB 3M9BA 4Y28J 2QM7A 1LP1A 1U7JA 2JO1A 1LTIC 1YJNP 3VTPC 3VP9A 1JY3O 2WT7B 2AEFA 1KB9H 1S4XA 3TGUE 3H32B 2E74D 3QH9A 1IJDB 4L75A 1BGYJ 1KILC 3V2PA 1VF5B 1KYOE 1SQQG 1S9KD 1GZLA 1L0LE 3CCEP 2IBZG 2KZJA 3I56P 3H25A 3GG2A 5APYA 1W2BO 1KB9E 3NTNA 1N8RQ 1Q86Q 1L0NG 1KQFB 1KC8Q 1FDOA 5KKZC 3MTUE 1Y9BA 1EDKA 3PP5A 3KQGA 1M90Q 1YQ4C 2HPCA 5B5EH 3AE1C 3AEFC 4OVNF 2H8PD 1SQQJ 1P84E 2YKQA 5AVRB 5AW4B 1A02J 3FXEA 1CI6A 5DJUB 3L75G 2ZJSE 3H1HG 1KZUB 3D6YA 1EC5A 1GL2B 1VQ4P 1VDFA 2ZYDA 1H0TB 5H2FH 5AW2B 2Q5UA 1BCCD 1HGZA 1SQVD 3P8MC 4ZMDA 2B9BA 1PGQA 1J1DB 2BCCE 3B4SA 3HTKB 1T2KD 1S1CX 2K3RA 4TLFA 1JOCA 1IK9A 3BASA 3V2NA 2FFDA 1RF1A 2KS1B 3F89A 1M1KQ 2D2CB 1K04A 3CD6P 1EDLA 3L72G 5C39A 2RKLA 4YXDC 2Y9ZA 1N73B 4EYYQ 1GL2D 3C9IA 2K9JA 2IPPA 2FYUJ 2H89C 2UWJE 2WSFH 1RQUA 2YO2A 2ZVNB 1PPJG 5B66H 1FJPA 2PRRA 1EZVD 1HGVA 2MJZA 3L73D 3MD0A 4K35A 2A45G 2FYNB 3H1JE 4M3LA 4N3YB 1RH5B 2WQYC 5E79H 3S9OA 3JC22 2JWAA 1H8AA 1VF5C 1X0TA 2A06G 4AQRD 3L72J 4H44C 1E5WA 2FYUK 1LWUB 2WPSA 3E1IA 3I5CA 3M0DA 1L0LJ 1T6AA 2D2CC 2P67A 4WVZA 1PP9J 3VMXA 1LNQA 1N7SA 2O1KA 3AE5C 2NPSA 3MIWA 2JDIH 1N7SD 2PGDA 1HH0A 1OWAA 1UIXA 1PGOA 2JEEA 3H1LJ 3L72D 1OW7A 4GIFA 3CCLP 1G1JA 2Z5HA 3L73G 2FBWC 1FZGA 1VQKP 1PPJD 1FBMA 1S5LH 2OYIC 1LP1B 1SQPE 1KV4A 1JNMA 3CLQA 3V5BA 1LT9C 1KTMA 2OTJP 3KZIH 1VQ6P 3W67A 5BVZA 2YKPA 5KLIC 5APUA 3AE3C 1PPJE 4H44B 3S4RA 2W6BA 2O1JA 3HD7A 3LW5J 2E5TA 3AE9C 4R4MA 2C9NY 2O3JA 2QG4A 1SQQE 2FYNC 2R44A 1SQVJ 1QLED 1H0TA 4Z1MH 4WY4A 1MZ9A 2GUVA 1RE3C 1KYOI 2M5AB 2XDJA 1YITP 2J5UA 3WUTA 5AVTB 3BCCJ 5KLVK 2P2UA 1PV3A 2V7QJ 3B5NC 4UB6H 3RL0D 5KAIH 3U59A 1SQPJ 2POHA 1N2DC 3CXHI 3HUSC 1QGKB 3L37A 1L4AC 1HJBA 3N4XA 2FXPA 5AVVB 4H0LB 3O6QB 2WTYA 1SQXK 2J58A 1CZQA 2QIWA 3IFMA 4L76A 3VMYA 1FOSF 3VP8A 5CMZA 5B66E 3MUDC 2OYHC 4I1LA 1YTZI 4NPEA 3A5TA 2AEJA 2C9LY 1Y47A 5E79E 1KMIZ 1LGHB 1YBKA 2B87A 2V7QH 1SQVE 2K9YA 3GF3A 2HODA 2Y0CA 2BCCD 4U7JA 3Q3DA 3L70E 2XNXA 1PGPA 1SFCA 3E7KA 3MUDA 5KLVG 2OYHA 1OXZA 3CC7P 1L0LG 1U7MA 1IFIA 3GHGA 3H1JJ 1J2JB 3O8ZA 1Q82Q 3CC4P 3N7NA 1RQVA 2WSEH 3EWKA 3MZWB 4ASVA 3CCUP 3L72E 3L74J 3GMAA 3LW5H 1BE3J 3OA7A 5CCGA 4A7PA 3RK3C 1HVVA 4Y99B 1EXJA 1AQ5A 1JUNA 1SQPK 2N1TA 3GF7A 1NTZD 1NTZG 1AQTA 2W27A 3NXSA 3I55P 2QA4P 1KYOH 3V2QA 3A0BH 2GUSA 4YXWH 3HUSA 1AJYA 3V4WA 3HD7D 3H1JG 1FS0E 3H1HE 1NGMB 4QMAA 4JPZB 5KJ7A 3RK3E 3U1AA 4N78E 1GU4A 1L0LK 2PP6A 5KJ7C 1QL2A 2Q9IA 1RF1C 3CMAP 2ZFCA 1HUCA 1NTZJ 4ZNCA 2E74B 2WVRA 2N1TC 4JQ0D 4BXLA 2XU6A 3R2PA 5APWA 2Q6QA 4XA4A 2PFXA 4PD4H 5CCGC 1KB9I 1VF5D 4OGQB 3TDKA 1NTKG 2OARA 3L70D 4W80A 2VRSA 1X9VA 2D2CD 3P32A 1KD1Q 1LTGC 5AW7B 1SQBE 2N9BA 4H0LD 5H2FE 1K05A 2R3SA 1PL5A 1AA0A 1R5SA 3BCCG 4LC1A 2JJLA 5KAIE 3V6IA 3HTKA 2WWWA 2I1JA 2FKWB 3L75D 1IZNB 4XE5B 1NH4A 1NTMG 1Q2NA 2P7JA 3CL3D 4N6JA 3A7OA 3PJSK 1JY3N 1PIXA 2N1TB 1EDIA 5M1BA 1M7LA 4CPGA 1GL2A 1ZRTE 2KIKA 2O01N 2QSIA 3H1IG 4IFMA 4GOEA 4IFFA 1VQPP 1JMBA 1BGYE 1AV1A 3D6ZA 1YJWP 1L0NE 1OW6A 1ZV8A 1FC2C 2FXOA 2YNYA 3SWKA 2Y9YA 2ZVOB 1L0LD 1URQA 4R4LA 1SFCB 1YQ3C 2Z4EA 1P84I 1IO4A 1LTBC 2W6JH 3H1IJ 2K1AA 2CPBA 1OVRA 3W68A 3H1LE 4PD4I 3HRNA 5GTIE 3Q1MA 5CCHD 1OMIA 2SPZA 4EIJA 1OFCX 1LTSC 1SQXD 1DD3A 3JSVC 5K5GB 2WSSH 1NO4A 4C7RA 3AE6C 1DD4A 1T3JA 2AXCA 2YKOA 4DT0A 4D6TE 3CWBG 3D71A 3OAKA 2QM8A 3FWNA 3E1RA 1NKZB 5AW6B 2BCCG 1E79H 1NTKD 4W7YA 3IN6A 1EDJA 2HODB 4IOIH 1CI6B 1W5CE 1YYCA 2FFDC 2Y0DA 1W2EA 3RK3D 3HE5B 1VQNP 2QJPB 1KORA 3B5ND 3TGUG 2XNDH 2E75D 1DX7A 1BE3D 3IF4A 3L71G 1ZMEC 3T97A 3Q5RA 2JKVA 2A06D 4W7ZA 1VQLP 3CC2P 2ZXEB 1KILD 5CHXA 2BASA 3L75J 3D70A 1QL1A 3HD7B 1SQQK 4D6TJ 2FYZA 3AEEC 1K73Q 5APQA 2B88A 1JY3P 2XZRA 1NTZE 2P58A 5KLIB 2Q3EA 2ZAEB 3A0HE 1N7SC 1FZCB 1FE6A 1PP9D 2K9JB 1QVGO 2YIUB 1X79B 3C8VA 3CXHE 4WBAA 4WY4B 3WU2E 1FZEA 4UB8H 2YMKA 3CCSP 1MV8A 3L73E 1YJ9P 2QJYC 2QJKC 2P1JA 3TGUD 3G71P 3EFFK 1R8EA 4HB1A 3CX5I 1Y8AA 1GD2E 3RK2B 1PGJA 3P8CD 3RBXA 1KN7A 1SP4A 1VQ5P 3A0HH 2FYUD 3TYYA 1A02F 2R3CA 2QE7H 2Y0EA 4C46A 4UB8E 1LTAC 1N7SB 4KT0J 1USDA 1N7LA 2HLOA 3G3ZA 2E5YA 1M1JC 4BRYA 3FX0A 1KQLA 2ITAA 2W6AA 3M9HA 1SLQA 3HD7C 4JYCA 4U3FD 1LTJA 2IZ1A 1K8AQ 1HTLC 1JCDA 1G1IA 3AE7C 2A45I 2CPSA 5AVQB 1X22A 2KUBA 4U3FJ 2MKVA 2N1TD 3RL0g 3USSA 3WMM0 4DCKA 3TF5A 3B8EB 2R5DA 2E75C 3MHVA 2M5AA 3H1IE 3CCMP 2QRXA 2LXBA 4EOTA 2IYOA 3CI9A 1K9MQ 4KHXA 3KZIE 3H1KG 3LIDA 1R5LA 3C1LA 4H13B 5CBNA 1SQQD 1IK7A 4BWNA 1OIPA 2NZ2A 1NAYA 4U3FG 1BDCA 2K37A 3A0BE 2A45H 2KZIA 2RH0A 5TISH 1FZAA 1SQVG 2O01H 3L74D 3L71D 2IYPA 3H1LG 3H1LD 4GKGA 3L36A 1KYOD 3MP7B 5KLVE 3H1KJ 1BCCE 2KS1A 4IL6H 1CW5A 5CCGD 3H1HJ 4IL6X 4D6TD 1HBWA 1RHZB 1G2CB 1PP9E 3SFDC 4EI2A 1ZP0C 3CXHD 1NVOA 4GODA 3L74E 1OVVA 1NU1D 2AEMA 5TISE 3CXHH 1FZFA 2E76B 1QVFO 3AECC 3B5NA 1S2EA 1JB0J 1M1JA 3CX5H 3O6QA 1ZR2A 3AE8C 2IBZE 1VPCA 3HE4B 2KK7A 3V2RA 3VMZA 1GU5A 4RESB 1NKNA 1S3JA 1SQVK 2K88A 2WZ7A 2XV5A 1LJ2A 3T97B 2W8ZA 3PRJA 1Z56A 4RO0A 5L8RJ 1KILB 1ZR4A 1KQSO 3BVHA 3PTZA 3JCUH 2Q7CA 3TNUA 2KP8A 1XTCC 3BCCD 3K5BA 2YMYA 1BSNA 1JCCA 1WRGA 1ZOYC 1J1EC 3KXDA 3Q5SA 1SQXJ 2P10A 3M9QA 5AVZB 4LGDE 5AVXB 2I8DA 1LT9A 2L5GB 1SQBJ 2IBZI 1NHLA 5CJ4A 1PZQA 1DEBA 3EQ2A 3GHGC 4YPCA 4LLHA 5AVYB 3RGUA 4I7ZC 1RF1B 2DW3A 2B87B 2OTKE 4H13C 5AW5B 3P8CE 2ZYAA 1LTTC 5BU5A 1IFDA 2E43A 4RKUJ 5AW1B 3G6EP 5KAFE 1IFMA 1NU1K 2KYVA 1Q81Q 1U57A 2KOGA 4AYCA 1JY2P 1LT9B 4WB4A 2KI7B 3A3YB 3GW6A 3M0DC 1VQ9P 1YIJP 3AEDC 4OH8B 2O01J 4TT3H 4ZKUA 1FDIA 2G3AA 1L4AA 4GT1A 1SFCD 4HJGH 4PD4E 1KB9D 3B71A 5KJ7D 3RL0C 4WY4D 1KILA 2QJYB 2ZYGA 2LXCB 4DOJA 1HJ0A 3L75E 5BU8B 1BGYG 1L4AD 1RF0C 2KSJA 3L70J 3KDPB 1VQ7P 2OQQA 1NU1G 3CCJP 1GMJA 2IX7C 1Q90D 4RJTA 1NTZK 1ZRTD 1EZVE 4I6MC 3RK3B 1VQMP 3RK2C 3Q5PA 1AVOA 2PAJA 1BCCJ 1YTZT 2C0WA 1GK6A 3VN0A 5CCHC 3AEAC 4C7NA 1L0NK 5B5EE 3WU2H 4PV1D 4JBZA 1NAFA 2LKMA 1NOHA 2FFDB 2M8RA 2NPSB 4PJ0H 1QEXA 4OGQD 5AW0B 5KLVD 4D6TG 1HWTC 2WSCH 1JTHA 3KPEA 3BCCE 3JCUE 1P84D 4JF7A 4OWFA 4YTPC 1SQXE 4EDFA 3H1KD 1FOSE 3GLMA 1T3UA 1GDTA 2WPRA 1T2KC 3R4YA 4PD4D 3L74G 1ZXGA 5GTIH 2QEXP 1USEA 2CK3H 3L35A 4H0LC 2JR8A 5CBOA 2KLUA 3CCRP 2YO3A 2QJPC 1FZCA 1J1EB 3H1JD 2FXMA 1DIPA 1MFZA 2H43A 1PFIA 1FJKA 2HR3A 2YXQB 3RBZA 4NPDA 2BCCJ 1NTMK 2OGUA 3H6PA 4K3AA 1NWQA 2IFMA 4PV1C 1VL2A 1GK4A 3WUUA 1N73A 5AW8B 1BE3E 5KTBA 1TU3F 2B89A 3PLNA 2KSEA 5TJHA 4I2LC 2OYIB 1JM0A 2IZ0A 4Y99C 3G9RA 1EZVI 1RE4C 4BRYB 3AEBC 1URQD 3FGAD 1SQBG 4O9BA 1S72P 1VQ8P 2QJKB 2IDBA 2WPVB 1SVFA 1M57D 3QWOC 1WMKA 1SQPD 3SFEC 1NTMJ 3M91A 2IFNA 1IFPA 2WPQA 3CWBD 2YIUC 3P7KA 1ZN5A 1JY2N 5AVSB 1Q7YQ 3VOPA 3FWLA 4HH2A 1LWUC 4WWIA 3VMAA 1RY3A 3RL0B 3FXDA 2Z5IA 2I1KA 1URQB 1BDDA 1OVUA 3CWBJ 1P84H 1T8ZA 2HPCB 4OGQC 1GTWA 3CX5D 1LTJC 3AE2C 2HYNA 2OYOA 2KNCB 4IL6E 1UIIA 3AEGC 2E74C 2KXPB 3PH0A 4H13D 1KILE 1WT6A 2GA1A 2HFED 2KB7P 1YI2P 1OZHA 1XTGB 1FZBA 2FY8A 1SQBK 3A2AA 3TGUJ 1KFNA 3HUSB 1CSBA 1LT1A 3PHLA 5DJTB 3G4SP 1H88A 1M1JB 1RE4A 3CMEP 2NPSC 4GDOA 4U3FE 3B5NB 1JO5A 3CX5E 1D7MA 1HF9A 2E75B 4PJ0E 1GW4A 2V4HA 4I7ZB 4H44D 3Q2YA 1AVYA 4DZOA 3HE4A 2ZT9B 1NYHA 2KNCA 3H1KE 5GTHH 3ZDMA 3HE5A 1FAVA 3OW2O 1SQBD 5AW3B 3M0AA 1EZVG 3NMDA 1BCCG 4GOFA 1KQGB 3TK1A 3TSIA 3H32A 2GM4A 1YHQP 3F5HA 2WT7A 1GL2C 3M06A 1PP9G 3L70G 3TNUB 3WUVA 3UIAA 4WY4C 1SFCC 2KLVA 2M0BA 2XKMA 3IAOA 2RMZA 3S1KA 3SSUA 1DH3A 1SQPG 2Q3IA 1JY2O 4PV1B 3BRVB 1IFJA 1X8YA 2N9YB 1FZCC 4ASWA 1NTKJ 5AW9B 1J1DC 3ABVC 5APXA 3RK2D 1MKMA 3U1CA 2WITA 3L73J 3L71E 1DEEG 3V4QA 1N86A 1LWUA 1NTME 1L0NJ 1JEKA 1L0ND 3L4FA 1SQXG 5CJ0A 2E76C 2NRGA 5APVA 1FU1A 5AVUB 2ZT9C 5AVWB 1NU1J 3H1ID 3CCVP 1L4AB 1QX8A 1VQOP 5APSA 1M8OB 2A06E 2Q1KA 1G2CA 2YXRB 3H1HD 1S5LE 1NTKK 1NTMD 1ZW0A 3LIEA 1RF0A 4DJGA 1RE3A 1S9KE 5KKZB 2BEZF 3BRTB 2OYHB 1M56D 2R5BA 2W90A 3L71J 1H89A 2ZXXA 1BE3G 4JYBA 2H7HA 1FDMA 1LTJB 4L74A 1NTKE 4IFDK 2FYUG 1AFOA 2WSCJ 3KYQA 2R32A 2H88C 2WSEJ 1URQC 1JMMA 1KFMA 1L2PA 1N73C 3KHUA 2ZT9D 3AE4C 4MN4C 1OX3A 1OW8A 4XFJA 1EXIA 3CWBE 4B86A 2E42A 4HYTB 1MFTA 3EFGA 4C7NB 1IFNA 2AXTH 3IR9A 3BATA 3CPWO 2OYIA 2OTLP 2JP3A 4KJMA 2G8YA 4UB6E 4L73A 1IC2A 3OJAB 3VYIA 3NFQA 1NJIQ 3II6A 4N78D 5GTHE 2IBZD 2JWDA 2W83C 5EFWB 2C0XA 2LR2A 1MUUA 2J59M 2WSFJ 5APTA 1BGYD 3CCQP 2BEQD 2L91A 3ITKA 5KLVJ 2AXTE 5CCHA 4HKZH 4AUWA 2E76D 5KAFH
chains in the Genus database with same CATH topology
1EQ7A 2NPSD 4ZKPA 3SWFA 1GW3A 1ZLLA 3SWYA 2HG5D 3MGNA 2M3BA 1JTHB 3GHGB 3M9BA 2QM7A 1LTIC 3VTPC 3VP9A 1JY3O 2WT7B 3H32B 1IJDB 1KILC 3V2PA 1S9KD 1GZLA 5APYA 3NTNA 3MTUE 3PP5A 2HPCA 3KQGA 5AVRB 2H8PD 2YKQA 5AW4B 1A02J 1CI6A 1KZUB 1GL2B 1VDFA 5AW2B 2Q5UA 1HGZA 3P8MC 3HTKB 1J1DB 1T2KD 1JOCA 1IK9A 3BASA 3V2NA 2FFDA 1RF1A 1N73B 1GL2D 3C9IA 2IPPA 2WSFH 2YO2A 1FJPA 1HGVA 3MD0A 2MJZA 2A45G 4M3LA 4N3YB 2C9NY 1H8AA 4AQRD 1E5WA 2FYUK 1LWUB 2WPSA 3I5CA 3E1IA 3M0DA 3VMXA 2P67A 1N7SA 2O1KA 2NPSA 3MIWA 1N7SD 1HH0A 1OWAA 2JEEA 4GIFA 1G1JA 2Z5HA 1FZGA 1FBMA 2OYIC 1JNMA 3CLQA 3V5BA 1LT9C 5BVZA 2YKPA 5APUA 2W6BA 2O1JA 3HD7A 4WY4A 1MZ9A 2GUVA 1RE3C 2XDJA 5AVTB 5KLVK 2P2UA 3RL0D 3B5NC 3U59A 2POHA 1N2DC 3HUSC 3L37A 1HJBA 1L4AC 3N4XA 5AVVB 2WTYA 1SQXK 2J58A 3IFMA 1CZQA 3VMYA 1FOSF 3VP8A 5CMZA 2OYHC 4I1LA 1YTZI 3A5TA 2C9LY 1LGHB 2HODA 2XNXA 1SFCA 3MUDA 2OYHA 1OXZA 1IFIA 3GHGA 1J2JB 3O8ZA 3N7NA 2WSEH 3LW5H 3OA7A 5CCGA 3RK3C 1HVVA 4Y99B 1AQ5A 1JUNA 1SQPK 2N1TA 2W27A 3NXSA 3V2QA 2GUSA 3HUSA 3V4WA 3HD7D 5KJ7A 3U1AA 4N78E 1GU4A 1L0LK 2PP6A 5KJ7C 1QL2A 2Q9IA 1RF1C 2ZFCA 1HUCA 2N1TC 2XU6A 3R2PA 5APWA 4XA4A 5CCGC 2OARA 4W80A 2VRSA 1X9VA 3P32A 1LTGC 5AW7B 2N9BA 4LC1A 2JJLA 3HTKA 2WWWA 2I1JA 2FKWB 4XE5B 1NH4A 2P7JA 4N6JA 3CL3D 3A7OA 1JY3N 2N1TB 1M7LA 1GL2A 4IFMA 4IFFA 2YNYA 1ZV8A 2Z4EA 1URQA 1SFCB 1IO4A 1LTBC 2CPBA 3HRNA 5CCHD 4EIJA 1LTSC 1NO4A 4C7RA 1T3JA 2YKOA 3OAKA 2QM8A 3TNUA 1NKZB 5AW6B 4W7YA 2HODB 1CI6B 1YYCA 2FFDC 1W2EA 3RK3D 3HE5B 3B5ND 1DX7A 3T97A 4W7ZA 2ZXEB 1KILD 5CHXA 2BASA 1QL1A 3HD7B 1SQQK 2FYZA 1DH3A 5APQA 1JY3P 2XZRA 1FZCB 1N7SC 1X79B 4WBAA 4WY4B 1FZEA 1MV8A 2P1JA 1GD2E 3RK2B 3P8CD 1SP4A 3TYYA 2R3CA 4C46A 1LTAC 1N7SB 1N7LA 2HLOA 3G3ZA 1M1JC 4JYCA 1KQLA 2W6AA 3M9HA 1SLQA 3HD7C 1LTJA 1HTLC 1JCDA 1G1IA 2A45I 2CPSA 5AVQB 3WMM0 2N1TD 3B8EB 2R5DA 4EOTA 3CI9A 4KHXA 3LIDA 2A45H 1FZAA 2O01H 4GKGA 3L36A 1CW5A 5CCGD 1HBWA 1G2CB 1A02F 1FZFA 3B5NA 1M1JA 1ZR2A 1VPCA 3HE4B 3V2RA 3VMZA 1GU5A 4RESB 1NKNA 1SQVK 2WZ7A 2XV5A 1Z56A 3BVHA 1ZR4A 1KILB 2Q7CA 2KP8A 1XTCC 2YMYA 1JCCA 1WRGA 1J1EC 3M9QA 5AVZB 4LGDE 5AVXB 1LT9A 2L5GB 1NHLA 5CJ4A 3EQ2A 1DEBA 3GHGC 4LLHA 5AVYB 1RF1B 5AW5B 3P8CE 1LTTC 5BU5A 1IFDA 2E43A 5AW1B 1IFMA 1NU1K 2KYVA 2KOGA 4AYCA 1JY2P 1LT9B 4WB4A 3A3YB 2E42A 3M0DC 4OH8B 4ZKUA 4GT1A 1L4AA 1SFCD 5KJ7D 3RL0C 4WY4D 1KILA 4DOJA 5BU8B 1L4AD 1RF0C 2KSJA 3KDPB 2IX7C 1NTZK 4I6MC 3RK3B 3RK2C 2PAJA 1YTZT 2C0WA 1GK6A 3VN0A 5CCHC 4C7NA 1L0NK 1NAFA 2LKMA 1NOHA 2FFDB 2M8RA 2NPSB 5AW0B 1HWTC 2WSCH 1JTHA 3KPEA 4JF7A 1GDTA 1FOSE 1T3UA 2WPRA 1T2KC 3L35A 2YO3A 1J1EB 2FXMA 1MFZA 2H43A 1PFIA 1FJKA 3H6PA 1NTMK 1NWQA 2IFMA 1N73A 1GK4A 5AW8B 5KTBA 4I2LC 2OYIB 4Y99C 1RE4C 1URQD 4O9BA 1SVFA 3M91A 2IFNA 3P7KA 2WPQA 5AVSB 1ZN5A 1JY2N 3VOPA 4HH2A 1LWUC 1RY3A 3RL0B 2Z5IA 2I1KA 1URQB 1T8ZA 2HPCB 1GTWA 1LTJC 2HYNA 2HFED 1WT6A 2KB7P 1FZCA 1XTGB 1FZBA 1SQBK 3A2AA 1KFNA 3HUSB 1CSBA 1H88A 1M1JB 1RE4A 2NPSC 3B5NB 1JO5A 1GW4A 4DZOA 3HE4A 3HE5A 1FAVA 5AW3B 3M0AA 3NMDA 3TK1A 2GM4A 3TSIA 3H32A 2WT7A 1GL2C 3M06A 3TNUB 3UIAA 4WY4C 1SFCC 2KLVA 2XKMA 2Q3IA 1JY2O 3BRVB 1IFJA 1X8YA 1FZCC 5AW9B 1J1DC 5APXA 3RK2D 3U1CA 2WITA 3V4QA 1N86A 1LWUA 3L4FA 5CJ0A 5APVA 1FU1A 5AVUB 5AVWB 1L4AB 5APSA 1G2CA 1NTKK 3LIEA 1RF0A 1RE3A 1S9KE 3BRTB 2OYHB 2R5BA 2H7HA 1H89A 1FDMA 4JYBA 1LTJB 1AFOA 4IFDK 3KYQA 2R32A 1URQC 1JMMA 1KFMA 1N73C 4B86A 4HYTB 3EFGA 4C7NB 1IFNA 3IR9A 3BATA 2OYIA 3VYIA 1IC2A 3OJAB 3NFQA 3II6A 4N78D 2C0XA 1MUUA 2J59M 5APTA 5CCHA 4AUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2D C;  2GUV A;  2GUS A;  1EQ7 A;  3H6P A;  1KFN A;  1T8Z A;  2IX7 C;  1JCC A;  1KFM A;  1JCD A; 
#chains in the Genus database with same CATH topology
 2M3E A;  1EQ7 A;  2WMM A;  2NPS D;  4ZKP A;  3SWF A;  1BSH A;  1GW3 A;  1ZLL A;  3SWY A;  1SS1 A;  4NPF X;  1S5L X;  2FYU E;  2RN0 A;  2HG5 D;  1NU1 E;  3MGN A;  2M3B A;  1JTH B;  2QVA A;  3GHG B;  3M9B A;  4Y28 J;  2QM7 A;  1LP1 A;  1U7J A;  2JO1 A;  1LTI C;  1YJN P;  3VTP C;  3VP9 A;  1JY3 O;  2WT7 B;  2AEF A;  1KB9 H;  1S4X A;  3TGU E;  3H32 B;  2E74 D;  3QH9 A;  1IJD B;  4L75 A;  1BGY J;  1KIL C;  3V2P A;  1VF5 B;  1KYO E;  1SQQ G;  1S9K D;  1GZL A;  1L0L E;  3CCE P;  2IBZ G;  2KZJ A;  3I56 P;  3H25 A;  3GG2 A;  5APY A;  1W2B O;  1KB9 E;  3NTN A;  1N8R Q;  1Q86 Q;  1L0N G;  1KQF B;  1KC8 Q;  1FDO A;  5KKZ C;  3MTU E;  1Y9B A;  1EDK A;  3PP5 A;  3KQG A;  1M90 Q;  1YQ4 C;  2HPC A;  5B5E H;  3AE1 C;  3AEF C;  4OVN F;  2H8P D;  1SQQ J;  1P84 E;  2YKQ A;  5AVR B;  5AW4 B;  1A02 J;  3FXE A;  1CI6 A;  5DJU B;  3L75 G;  2ZJS E;  3H1H G;  1KZU B;  3D6Y A;  1EC5 A;  1GL2 B;  1VQ4 P;  1VDF A;  2ZYD A;  1H0T B;  5H2F H;  5AW2 B;  2Q5U A;  1BCC D;  1HGZ A;  1SQV D;  3P8M C;  4ZMD A;  2B9B A;  1PGQ A;  1J1D B;  2BCC E;  3B4S A;  3HTK B;  1T2K D;  1S1C X;  2K3R A;  4TLF A;  1JOC A;  1IK9 A;  3BAS A;  3V2N A;  2FFD A;  1RF1 A;  2KS1 B;  3F89 A;  1M1K Q;  2D2C B;  1K04 A;  3CD6 P;  1EDL A;  3L72 G;  5C39 A;  2RKL A;  4YXD C;  2Y9Z A;  1N73 B;  4EYY Q;  1GL2 D;  3C9I A;  2K9J A;  2IPP A;  2FYU J;  2H89 C;  2UWJ E;  2WSF H;  1RQU A;  2YO2 A;  2ZVN B;  1PPJ G;  5B66 H;  1FJP A;  2PRR A;  1EZV D;  1HGV A;  2MJZ A;  3L73 D;  3MD0 A;  4K35 A;  2A45 G;  2FYN B;  3H1J E;  4M3L A;  4N3Y B;  1RH5 B;  2WQY C;  5E79 H;  3S9O A;  3JC2 2;  2JWA A;  1H8A A;  1VF5 C;  1X0T A;  2A06 G;  4AQR D;  3L72 J;  4H44 C;  1E5W A;  2FYU K;  1LWU B;  2WPS A;  3E1I A;  3I5C A;  3M0D A;  1L0L J;  1T6A A;  2D2C C;  2P67 A;  4WVZ A;  1PP9 J;  3VMX A;  1LNQ A;  1N7S A;  2O1K A;  3AE5 C;  2NPS A;  3MIW A;  2JDI H;  1N7S D;  2PGD A;  1HH0 A;  1OWA A;  1UIX A;  1PGO A;  2JEE A;  3H1L J;  3L72 D;  1OW7 A;  4GIF A;  3CCL P;  1G1J A;  2Z5H A;  3L73 G;  2FBW C;  1FZG A;  1VQK P;  1PPJ D;  1FBM A;  1S5L H;  2OYI C;  1LP1 B;  1SQP E;  1KV4 A;  1JNM A;  3CLQ A;  3V5B A;  1LT9 C;  1KTM A;  2OTJ P;  3KZI H;  1VQ6 P;  3W67 A;  5BVZ A;  2YKP A;  5KLI C;  5APU A;  3AE3 C;  1PPJ E;  4H44 B;  3S4R A;  2W6B A;  2O1J A;  3HD7 A;  3LW5 J;  2E5T A;  3AE9 C;  4R4M A;  2C9N Y;  2O3J A;  2QG4 A;  1SQQ E;  2FYN C;  2R44 A;  1SQV J;  1QLE D;  1H0T A;  4Z1M H;  4WY4 A;  1MZ9 A;  2GUV A;  1RE3 C;  1KYO I;  2M5A B;  2XDJ A;  1YIT P;  2J5U A;  3WUT A;  5AVT B;  3BCC J;  5KLV K;  2P2U A;  1PV3 A;  2V7Q J;  3B5N C;  4UB6 H;  3RL0 D;  5KAI H;  3U59 A;  1SQP J;  2POH A;  1N2D C;  3CXH I;  3HUS C;  1QGK B;  3L37 A;  1L4A C;  1HJB A;  3N4X A;  2FXP A;  5AVV B;  4H0L B;  3O6Q B;  2WTY A;  1SQX K;  2J58 A;  1CZQ A;  2QIW A;  3IFM A;  4L76 A;  3VMY A;  1FOS F;  3VP8 A;  5CMZ A;  5B66 E;  3MUD C;  2OYH C;  4I1L A;  1YTZ I;  4NPE A;  3A5T A;  2AEJ A;  2C9L Y;  1Y47 A;  5E79 E;  1KMI Z;  1LGH B;  1YBK A;  2B87 A;  2V7Q H;  1SQV E;  2K9Y A;  3GF3 A;  2HOD A;  2Y0C A;  2BCC D;  4U7J A;  3Q3D A;  3L70 E;  2XNX A;  1PGP A;  1SFC A;  3E7K A;  3MUD A;  5KLV G;  2OYH A;  1OXZ A;  3CC7 P;  1L0L G;  1U7M A;  1IFI A;  3GHG A;  3H1J J;  1J2J B;  3O8Z A;  1Q82 Q;  3CC4 P;  3N7N A;  1RQV A;  2WSE H;  3EWK A;  3MZW B;  4ASV A;  3CCU P;  3L72 E;  3L74 J;  3GMA A;  3LW5 H;  1BE3 J;  3OA7 A;  5CCG A;  4A7P A;  3RK3 C;  1HVV A;  4Y99 B;  1EXJ A;  1AQ5 A;  1JUN A;  1SQP K;  2N1T A;  3GF7 A;  1NTZ D;  1NTZ G;  1AQT A;  2W27 A;  3NXS A;  3I55 P;  2QA4 P;  1KYO H;  3V2Q A;  3A0B H;  2GUS A;  4YXW H;  3HUS A;  1AJY A;  3V4W A;  3HD7 D;  3H1J G;  1FS0 E;  3H1H E;  1NGM B;  4QMA A;  4JPZ B;  5KJ7 A;  3RK3 E;  3U1A A;  4N78 E;  1GU4 A;  1L0L K;  2PP6 A;  5KJ7 C;  1QL2 A;  2Q9I A;  1RF1 C;  3CMA P;  2ZFC A;  1HUC A;  1NTZ J;  4ZNC A;  2E74 B;  2WVR A;  2N1T C;  4JQ0 D;  4BXL A;  2XU6 A;  3R2P A;  5APW A;  2Q6Q A;  4XA4 A;  2PFX A;  4PD4 H;  5CCG C;  1KB9 I;  1VF5 D;  4OGQ B;  3TDK A;  1NTK G;  2OAR A;  3L70 D;  4W80 A;  2VRS A;  1X9V A;  2D2C D;  3P32 A;  1KD1 Q;  1LTG C;  5AW7 B;  1SQB E;  2N9B A;  4H0L D;  5H2F E;  1K05 A;  2R3S A;  1PL5 A;  1AA0 A;  1R5S A;  3BCC G;  4LC1 A;  2JJL A;  5KAI E;  3V6I A;  3HTK A;  2WWW A;  2I1J A;  2FKW B;  3L75 D;  1IZN B;  4XE5 B;  1NH4 A;  1NTM G;  1Q2N A;  2P7J A;  3CL3 D;  4N6J A;  3A7O A;  3PJS K;  1JY3 N;  1PIX A;  2N1T B;  1EDI A;  5M1B A;  1M7L A;  4CPG A;  1GL2 A;  1ZRT E;  2KIK A;  2O01 N;  2QSI A;  3H1I G;  4IFM A;  4GOE A;  4IFF A;  1VQP P;  1JMB A;  1BGY E;  1AV1 A;  3D6Z A;  1YJW P;  1L0N E;  1OW6 A;  1ZV8 A;  1FC2 C;  2FXO A;  2YNY A;  3SWK A;  2Y9Y A;  2ZVO B;  1L0L D;  1URQ A;  4R4L A;  1SFC B;  1YQ3 C;  2Z4E A;  1P84 I;  1IO4 A;  1LTB C;  2W6J H;  3H1I J;  2K1A A;  2CPB A;  1OVR A;  3W68 A;  3H1L E;  4PD4 I;  3HRN A;  5GTI E;  3Q1M A;  5CCH D;  1OMI A;  2SPZ A;  4EIJ A;  1OFC X;  1LTS C;  1SQX D;  1DD3 A;  3JSV C;  5K5G B;  2WSS H;  1NO4 A;  4C7R A;  3AE6 C;  1DD4 A;  1T3J A;  2AXC A;  2YKO A;  4DT0 A;  4D6T E;  3CWB G;  3D71 A;  3OAK A;  2QM8 A;  3FWN A;  3E1R A;  1NKZ B;  5AW6 B;  2BCC G;  1E79 H;  1NTK D;  4W7Y A;  3IN6 A;  1EDJ A;  2HOD B;  4IOI H;  1CI6 B;  1W5C E;  1YYC A;  2FFD C;  2Y0D A;  1W2E A;  3RK3 D;  3HE5 B;  1VQN P;  2QJP B;  1KOR A;  3B5N D;  3TGU G;  2XND H;  2E75 D;  1DX7 A;  1BE3 D;  3IF4 A;  3L71 G;  1ZME C;  3T97 A;  3Q5R A;  2JKV A;  2A06 D;  4W7Z A;  1VQL P;  3CC2 P;  2ZXE B;  1KIL D;  5CHX A;  2BAS A;  3L75 J;  3D70 A;  1QL1 A;  3HD7 B;  1SQQ K;  4D6T J;  2FYZ A;  3AEE C;  1K73 Q;  5APQ A;  2B88 A;  1JY3 P;  2XZR A;  1NTZ E;  2P58 A;  5KLI B;  2Q3E A;  2ZAE B;  3A0H E;  1N7S C;  1FZC B;  1FE6 A;  1PP9 D;  2K9J B;  1QVG O;  2YIU B;  1X79 B;  3C8V A;  3CXH E;  4WBA A;  4WY4 B;  3WU2 E;  1FZE A;  4UB8 H;  2YMK A;  3CCS P;  1MV8 A;  3L73 E;  1YJ9 P;  2QJY C;  2QJK C;  2P1J A;  3TGU D;  3G71 P;  3EFF K;  1R8E A;  4HB1 A;  3CX5 I;  1Y8A A;  1GD2 E;  3RK2 B;  1PGJ A;  3P8C D;  3RBX A;  1KN7 A;  1SP4 A;  1VQ5 P;  3A0H H;  2FYU D;  3TYY A;  1A02 F;  2R3C A;  2QE7 H;  2Y0E A;  4C46 A;  4UB8 E;  1LTA C;  1N7S B;  4KT0 J;  1USD A;  1N7L A;  2HLO A;  3G3Z A;  2E5Y A;  1M1J C;  4BRY A;  3FX0 A;  1KQL A;  2ITA A;  2W6A A;  3M9H A;  1SLQ A;  3HD7 C;  4JYC A;  4U3F D;  1LTJ A;  2IZ1 A;  1K8A Q;  1HTL C;  1JCD A;  1G1I A;  3AE7 C;  2A45 I;  2CPS A;  5AVQ B;  1X22 A;  2KUB A;  4U3F J;  2MKV A;  2N1T D;  3RL0 g;  3USS A;  3WMM 0;  4DCK A;  3TF5 A;  3B8E B;  2R5D A;  2E75 C;  3MHV A;  2M5A A;  3H1I E;  3CCM P;  2QRX A;  2LXB A;  4EOT A;  2IYO A;  3CI9 A;  1K9M Q;  4KHX A;  3KZI E;  3H1K G;  3LID A;  1R5L A;  3C1L A;  4H13 B;  5CBN A;  1SQQ D;  1IK7 A;  4BWN A;  1OIP A;  2NZ2 A;  1NAY A;  4U3F G;  1BDC A;  2K37 A;  3A0B E;  2A45 H;  2KZI A;  2RH0 A;  5TIS H;  1FZA A;  1SQV G;  2O01 H;  3L74 D;  3L71 D;  2IYP A;  3H1L G;  3H1L D;  4GKG A;  3L36 A;  1KYO D;  3MP7 B;  5KLV E;  3H1K J;  1BCC E;  2KS1 A;  4IL6 H;  1CW5 A;  5CCG D;  3H1H J;  4IL6 X;  4D6T D;  1HBW A;  1RHZ B;  1G2C B;  1PP9 E;  3SFD C;  4EI2 A;  1ZP0 C;  3CXH D;  1NVO A;  4GOD A;  3L74 E;  1OVV A;  1NU1 D;  2AEM A;  5TIS E;  3CXH H;  1FZF A;  2E76 B;  1QVF O;  3AEC C;  3B5N A;  1S2E A;  1JB0 J;  1M1J A;  3CX5 H;  3O6Q A;  1ZR2 A;  3AE8 C;  2IBZ E;  1VPC A;  3HE4 B;  2KK7 A;  3V2R A;  3VMZ A;  1GU5 A;  4RES B;  1NKN A;  1S3J A;  1SQV K;  2K88 A;  2WZ7 A;  2XV5 A;  1LJ2 A;  3T97 B;  2W8Z A;  3PRJ A;  1Z56 A;  4RO0 A;  5L8R J;  1KIL B;  1ZR4 A;  1KQS O;  3BVH A;  3PTZ A;  3JCU H;  2Q7C A;  3TNU A;  2KP8 A;  1XTC C;  3BCC D;  3K5B A;  2YMY A;  1BSN A;  1JCC A;  1WRG A;  1ZOY C;  1J1E C;  3KXD A;  3Q5S A;  1SQX J;  2P10 A;  3M9Q A;  5AVZ B;  4LGD E;  5AVX B;  2I8D A;  1LT9 A;  2L5G B;  1SQB J;  2IBZ I;  1NHL A;  5CJ4 A;  1PZQ A;  1DEB A;  3EQ2 A;  3GHG C;  4YPC A;  4LLH A;  5AVY B;  3RGU A;  4I7Z C;  1RF1 B;  2DW3 A;  2B87 B;  2OTK E;  4H13 C;  5AW5 B;  3P8C E;  2ZYA A;  1LTT C;  5BU5 A;  1IFD A;  2E43 A;  4RKU J;  5AW1 B;  3G6E P;  5KAF E;  1IFM A;  1NU1 K;  2KYV A;  1Q81 Q;  1U57 A;  2KOG A;  4AYC A;  1JY2 P;  1LT9 B;  4WB4 A;  2KI7 B;  3A3Y B;  3GW6 A;  3M0D C;  1VQ9 P;  1YIJ P;  3AED C;  4OH8 B;  2O01 J;  4TT3 H;  4ZKU A;  1FDI A;  2G3A A;  1L4A A;  4GT1 A;  1SFC D;  4HJG H;  4PD4 E;  1KB9 D;  3B71 A;  5KJ7 D;  3RL0 C;  4WY4 D;  1KIL A;  2QJY B;  2ZYG A;  2LXC B;  4DOJ A;  1HJ0 A;  3L75 E;  5BU8 B;  1BGY G;  1L4A D;  1RF0 C;  2KSJ A;  3L70 J;  3KDP B;  1VQ7 P;  2OQQ A;  1NU1 G;  3CCJ P;  1GMJ A;  2IX7 C;  1Q90 D;  4RJT A;  1NTZ K;  1ZRT D;  1EZV E;  4I6M C;  3RK3 B;  1VQM P;  3RK2 C;  3Q5P A;  1AVO A;  2PAJ A;  1BCC J;  1YTZ T;  2C0W A;  1GK6 A;  3VN0 A;  5CCH C;  3AEA C;  4C7N A;  1L0N K;  5B5E E;  3WU2 H;  4PV1 D;  4JBZ A;  1NAF A;  2LKM A;  1NOH A;  2FFD B;  2M8R A;  2NPS B;  4PJ0 H;  1QEX A;  4OGQ D;  5AW0 B;  5KLV D;  4D6T G;  1HWT C;  2WSC H;  1JTH A;  3KPE A;  3BCC E;  3JCU E;  1P84 D;  4JF7 A;  4OWF A;  4YTP C;  1SQX E;  4EDF A;  3H1K D;  1FOS E;  3GLM A;  1T3U A;  1GDT A;  2WPR A;  1T2K C;  3R4Y A;  4PD4 D;  3L74 G;  1ZXG A;  5GTI H;  2QEX P;  1USE A;  2CK3 H;  3L35 A;  4H0L C;  2JR8 A;  5CBO A;  2KLU A;  3CCR P;  2YO3 A;  2QJP C;  1FZC A;  1J1E B;  3H1J D;  2FXM A;  1DIP A;  1MFZ A;  2H43 A;  1PFI A;  1FJK A;  2HR3 A;  2YXQ B;  3RBZ A;  4NPD A;  2BCC J;  1NTM K;  2OGU A;  3H6P A;  4K3A A;  1NWQ A;  2IFM A;  4PV1 C;  1VL2 A;  1GK4 A;  3WUU A;  1N73 A;  5AW8 B;  1BE3 E;  5KTB A;  1TU3 F;  2B89 A;  3PLN A;  2KSE A;  5TJH A;  4I2L C;  2OYI B;  1JM0 A;  2IZ0 A;  4Y99 C;  3G9R A;  1EZV I;  1RE4 C;  4BRY B;  3AEB C;  1URQ D;  3FGA D;  1SQB G;  4O9B A;  1S72 P;  1VQ8 P;  2QJK B;  2IDB A;  2WPV B;  1SVF A;  1M57 D;  3QWO C;  1WMK A;  1SQP D;  3SFE C;  1NTM J;  3M91 A;  2IFN A;  1IFP A;  2WPQ A;  3CWB D;  2YIU C;  3P7K A;  1ZN5 A;  1JY2 N;  5AVS B;  1Q7Y Q;  3VOP A;  3FWL A;  4HH2 A;  1LWU C;  4WWI A;  3VMA A;  1RY3 A;  3RL0 B;  3FXD A;  2Z5I A;  2I1K A;  1URQ B;  1BDD A;  1OVU A;  3CWB J;  1P84 H;  1T8Z A;  2HPC B;  4OGQ C;  1GTW A;  3CX5 D;  1LTJ C;  3AE2 C;  2HYN A;  2OYO A;  2KNC B;  4IL6 E;  1UII A;  3AEG C;  2E74 C;  2KXP B;  3PH0 A;  4H13 D;  1KIL E;  1WT6 A;  2GA1 A;  2HFE D;  2KB7 P;  1YI2 P;  1OZH A;  1XTG B;  1FZB A;  2FY8 A;  1SQB K;  3A2A A;  3TGU J;  1KFN A;  3HUS B;  1CSB A;  1LT1 A;  3PHL A;  5DJT B;  3G4S P;  1H88 A;  1M1J B;  1RE4 A;  3CME P;  2NPS C;  4GDO A;  4U3F E;  3B5N B;  1JO5 A;  3CX5 E;  1D7M A;  1HF9 A;  2E75 B;  4PJ0 E;  1GW4 A;  2V4H A;  4I7Z B;  4H44 D;  3Q2Y A;  1AVY A;  4DZO A;  3HE4 A;  2ZT9 B;  1NYH A;  2KNC A;  3H1K E;  5GTH H;  3ZDM A;  3HE5 A;  1FAV A;  3OW2 O;  1SQB D;  5AW3 B;  3M0A A;  1EZV G;  3NMD A;  1BCC G;  4GOF A;  1KQG B;  3TK1 A;  3TSI A;  3H32 A;  2GM4 A;  1YHQ P;  3F5H A;  2WT7 A;  1GL2 C;  3M06 A;  1PP9 G;  3L70 G;  3TNU B;  3WUV A;  3UIA A;  4WY4 C;  1SFC C;  2KLV A;  2M0B A;  2XKM A;  3IAO A;  2RMZ A;  3S1K A;  3SSU A;  1DH3 A;  1SQP G;  2Q3I A;  1JY2 O;  4PV1 B;  3BRV B;  1IFJ A;  1X8Y A;  2N9Y B;  1FZC C;  4ASW A;  1NTK J;  5AW9 B;  1J1D C;  3ABV C;  5APX A;  3RK2 D;  1MKM A;  3U1C A;  2WIT A;  3L73 J;  3L71 E;  1DEE G;  3V4Q A;  1N86 A;  1LWU A;  1NTM E;  1L0N J;  1JEK A;  1L0N D;  3L4F A;  1SQX G;  5CJ0 A;  2E76 C;  2NRG A;  5APV A;  1FU1 A;  5AVU B;  2ZT9 C;  5AVW B;  1NU1 J;  3H1I D;  3CCV P;  1L4A B;  1QX8 A;  1VQO P;  5APS A;  1M8O B;  2A06 E;  2Q1K A;  1G2C A;  2YXR B;  3H1H D;  1S5L E;  1NTK K;  1NTM D;  1ZW0 A;  3LIE A;  1RF0 A;  4DJG A;  1RE3 A;  1S9K E;  5KKZ B;  2BEZ F;  3BRT B;  2OYH B;  1M56 D;  2R5B A;  2W90 A;  3L71 J;  1H89 A;  2ZXX A;  1BE3 G;  4JYB A;  2H7H A;  1FDM A;  1LTJ B;  4L74 A;  1NTK E;  4IFD K;  2FYU G;  1AFO A;  2WSC J;  3KYQ A;  2R32 A;  2H88 C;  2WSE J;  1URQ C;  1JMM A;  1KFM A;  1L2P A;  1N73 C;  3KHU A;  2ZT9 D;  3AE4 C;  4MN4 C;  1OX3 A;  1OW8 A;  4XFJ A;  1EXI A;  3CWB E;  4B86 A;  2E42 A;  4HYT B;  1MFT A;  3EFG A;  4C7N B;  1IFN A;  2AXT H;  3IR9 A;  3BAT A;  3CPW O;  2OYI A;  2OTL P;  2JP3 A;  4KJM A;  2G8Y A;  4UB6 E;  4L73 A;  1IC2 A;  3OJA B;  3VYI A;  3NFQ A;  1NJI Q;  3II6 A;  4N78 D;  5GTH E;  2IBZ D;  2JWD A;  2W83 C;  5EFW B;  2C0X A;  2LR2 A;  1MUU A;  2J59 M;  2WSF J;  5APT A;  1BGY D;  3CCQ P;  2BEQ D;  2L91 A;  3ITK A;  5KLV J;  2AXT E;  5CCH A;  4HKZ H;  4AUW A;  2E76 D;  5KAF H; 
#chains in the Genus database with same CATH homology
 1EQ7 A;  2NPS D;  4ZKP A;  3SWF A;  1GW3 A;  1ZLL A;  3SWY A;  2HG5 D;  3MGN A;  2M3B A;  1JTH B;  3GHG B;  3M9B A;  2QM7 A;  1LTI C;  3VTP C;  3VP9 A;  1JY3 O;  2WT7 B;  3H32 B;  1IJD B;  1KIL C;  3V2P A;  1S9K D;  1GZL A;  5APY A;  3NTN A;  3MTU E;  3PP5 A;  2HPC A;  3KQG A;  5AVR B;  2H8P D;  2YKQ A;  5AW4 B;  1A02 J;  1CI6 A;  1KZU B;  1GL2 B;  1VDF A;  5AW2 B;  2Q5U A;  1HGZ A;  3P8M C;  3HTK B;  1J1D B;  1T2K D;  1JOC A;  1IK9 A;  3BAS A;  3V2N A;  2FFD A;  1RF1 A;  1N73 B;  1GL2 D;  3C9I A;  2IPP A;  2WSF H;  2YO2 A;  1FJP A;  1HGV A;  3MD0 A;  2MJZ A;  2A45 G;  4M3L A;  4N3Y B;  2C9N Y;  1H8A A;  4AQR D;  1E5W A;  2FYU K;  1LWU B;  2WPS A;  3I5C A;  3E1I A;  3M0D A;  3VMX A;  2P67 A;  1N7S A;  2O1K A;  2NPS A;  3MIW A;  1N7S D;  1HH0 A;  1OWA A;  2JEE A;  4GIF A;  1G1J A;  2Z5H A;  1FZG A;  1FBM A;  2OYI C;  1JNM A;  3CLQ A;  3V5B A;  1LT9 C;  5BVZ A;  2YKP A;  5APU A;  2W6B A;  2O1J A;  3HD7 A;  4WY4 A;  1MZ9 A;  2GUV A;  1RE3 C;  2XDJ A;  5AVT B;  5KLV K;  2P2U A;  3RL0 D;  3B5N C;  3U59 A;  2POH A;  1N2D C;  3HUS C;  3L37 A;  1HJB A;  1L4A C;  3N4X A;  5AVV B;  2WTY A;  1SQX K;  2J58 A;  3IFM A;  1CZQ A;  3VMY A;  1FOS F;  3VP8 A;  5CMZ A;  2OYH C;  4I1L A;  1YTZ I;  3A5T A;  2C9L Y;  1LGH B;  2HOD A;  2XNX A;  1SFC A;  3MUD A;  2OYH A;  1OXZ A;  1IFI A;  3GHG A;  1J2J B;  3O8Z A;  3N7N A;  2WSE H;  3LW5 H;  3OA7 A;  5CCG A;  3RK3 C;  1HVV A;  4Y99 B;  1AQ5 A;  1JUN A;  1SQP K;  2N1T A;  2W27 A;  3NXS A;  3V2Q A;  2GUS A;  3HUS A;  3V4W A;  3HD7 D;  5KJ7 A;  3U1A A;  4N78 E;  1GU4 A;  1L0L K;  2PP6 A;  5KJ7 C;  1QL2 A;  2Q9I A;  1RF1 C;  2ZFC A;  1HUC A;  2N1T C;  2XU6 A;  3R2P A;  5APW A;  4XA4 A;  5CCG C;  2OAR A;  4W80 A;  2VRS A;  1X9V A;  3P32 A;  1LTG C;  5AW7 B;  2N9B A;  4LC1 A;  2JJL A;  3HTK A;  2WWW A;  2I1J A;  2FKW B;  4XE5 B;  1NH4 A;  2P7J A;  4N6J A;  3CL3 D;  3A7O A;  1JY3 N;  2N1T B;  1M7L A;  1GL2 A;  4IFM A;  4IFF A;  2YNY A;  1ZV8 A;  2Z4E A;  1URQ A;  1SFC B;  1IO4 A;  1LTB C;  2CPB A;  3HRN A;  5CCH D;  4EIJ A;  1LTS C;  1NO4 A;  4C7R A;  1T3J A;  2YKO A;  3OAK A;  2QM8 A;  3TNU A;  1NKZ B;  5AW6 B;  4W7Y A;  2HOD B;  1CI6 B;  1YYC A;  2FFD C;  1W2E A;  3RK3 D;  3HE5 B;  3B5N D;  1DX7 A;  3T97 A;  4W7Z A;  2ZXE B;  1KIL D;  5CHX A;  2BAS A;  1QL1 A;  3HD7 B;  1SQQ K;  2FYZ A;  1DH3 A;  5APQ A;  1JY3 P;  2XZR A;  1FZC B;  1N7S C;  1X79 B;  4WBA A;  4WY4 B;  1FZE A;  1MV8 A;  2P1J A;  1GD2 E;  3RK2 B;  3P8C D;  1SP4 A;  3TYY A;  2R3C A;  4C46 A;  1LTA C;  1N7S B;  1N7L A;  2HLO A;  3G3Z A;  1M1J C;  4JYC A;  1KQL A;  2W6A A;  3M9H A;  1SLQ A;  3HD7 C;  1LTJ A;  1HTL C;  1JCD A;  1G1I A;  2A45 I;  2CPS A;  5AVQ B;  3WMM 0;  2N1T D;  3B8E B;  2R5D A;  4EOT A;  3CI9 A;  4KHX A;  3LID A;  2A45 H;  1FZA A;  2O01 H;  4GKG A;  3L36 A;  1CW5 A;  5CCG D;  1HBW A;  1G2C B;  1A02 F;  1FZF A;  3B5N A;  1M1J A;  1ZR2 A;  1VPC A;  3HE4 B;  3V2R A;  3VMZ A;  1GU5 A;  4RES B;  1NKN A;  1SQV K;  2WZ7 A;  2XV5 A;  1Z56 A;  3BVH A;  1ZR4 A;  1KIL B;  2Q7C A;  2KP8 A;  1XTC C;  2YMY A;  1JCC A;  1WRG A;  1J1E C;  3M9Q A;  5AVZ B;  4LGD E;  5AVX B;  1LT9 A;  2L5G B;  1NHL A;  5CJ4 A;  3EQ2 A;  1DEB A;  3GHG C;  4LLH A;  5AVY B;  1RF1 B;  5AW5 B;  3P8C E;  1LTT C;  5BU5 A;  1IFD A;  2E43 A;  5AW1 B;  1IFM A;  1NU1 K;  2KYV A;  2KOG A;  4AYC A;  1JY2 P;  1LT9 B;  4WB4 A;  3A3Y B;  2E42 A;  3M0D C;  4OH8 B;  4ZKU A;  4GT1 A;  1L4A A;  1SFC D;  5KJ7 D;  3RL0 C;  4WY4 D;  1KIL A;  4DOJ A;  5BU8 B;  1L4A D;  1RF0 C;  2KSJ A;  3KDP B;  2IX7 C;  1NTZ K;  4I6M C;  3RK3 B;  3RK2 C;  2PAJ A;  1YTZ T;  2C0W A;  1GK6 A;  3VN0 A;  5CCH C;  4C7N A;  1L0N K;  1NAF A;  2LKM A;  1NOH A;  2FFD B;  2M8R A;  2NPS B;  5AW0 B;  1HWT C;  2WSC H;  1JTH A;  3KPE A;  4JF7 A;  1GDT A;  1FOS E;  1T3U A;  2WPR A;  1T2K C;  3L35 A;  2YO3 A;  1J1E B;  2FXM A;  1MFZ A;  2H43 A;  1PFI A;  1FJK A;  3H6P A;  1NTM K;  1NWQ A;  2IFM A;  1N73 A;  1GK4 A;  5AW8 B;  5KTB A;  4I2L C;  2OYI B;  4Y99 C;  1RE4 C;  1URQ D;  4O9B A;  1SVF A;  3M91 A;  2IFN A;  3P7K A;  2WPQ A;  5AVS B;  1ZN5 A;  1JY2 N;  3VOP A;  4HH2 A;  1LWU C;  1RY3 A;  3RL0 B;  2Z5I A;  2I1K A;  1URQ B;  1T8Z A;  2HPC B;  1GTW A;  1LTJ C;  2HYN A;  2HFE D;  1WT6 A;  2KB7 P;  1FZC A;  1XTG B;  1FZB A;  1SQB K;  3A2A A;  1KFN A;  3HUS B;  1CSB A;  1H88 A;  1M1J B;  1RE4 A;  2NPS C;  3B5N B;  1JO5 A;  1GW4 A;  4DZO A;  3HE4 A;  3HE5 A;  1FAV A;  5AW3 B;  3M0A A;  3NMD A;  3TK1 A;  2GM4 A;  3TSI A;  3H32 A;  2WT7 A;  1GL2 C;  3M06 A;  3TNU B;  3UIA A;  4WY4 C;  1SFC C;  2KLV A;  2XKM A;  2Q3I A;  1JY2 O;  3BRV B;  1IFJ A;  1X8Y A;  1FZC C;  5AW9 B;  1J1D C;  5APX A;  3RK2 D;  3U1C A;  2WIT A;  3V4Q A;  1N86 A;  1LWU A;  3L4F A;  5CJ0 A;  5APV A;  1FU1 A;  5AVU B;  5AVW B;  1L4A B;  5APS A;  1G2C A;  1NTK K;  3LIE A;  1RF0 A;  1RE3 A;  1S9K E;  3BRT B;  2OYH B;  2R5B A;  2H7H A;  1H89 A;  1FDM A;  4JYB A;  1LTJ B;  1AFO A;  4IFD K;  3KYQ A;  2R32 A;  1URQ C;  1JMM A;  1KFM A;  1N73 C;  4B86 A;  4HYT B;  3EFG A;  4C7N B;  1IFN A;  3IR9 A;  3BAT A;  2OYI A;  3VYI A;  1IC2 A;  3OJA B;  3NFQ A;  3II6 A;  4N78 D;  2C0X A;  1MUU A;  2J59 M;  5APT A;  5CCH A;  4AUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...