1EQNA

E.coli primase catalytic core
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
315
structure length
315
Chain Sequence
RQTLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGILDDSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMASE
publication title A TOPRIM domain in the crystal structure of the catalytic core of Escherichia coli primase confirms a structural link to DNA topoisomerases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 87
structure length 315
sequence length 315
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.-:
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08275 Toprim_N DNA primase catalytic core, N-terminal domain
A PF10410 DnaB_bind DnaB-helicase binding domain of primase
A PF13155 Toprim_2 Toprim-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.20 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 1eqnA03
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 1eqnA02
3.90.980.10 Alpha Beta Alpha-Beta Complex DNA primase DNAg catalytic core, N-terminal domain DNA primase, catalytic core, N-terminal domain 1eqnA01
2Q2EA 4JCVA 4EDTA 4O6PB 3VDUA 1D3YA 4EDRA 4O6OA 3VDPA 2AU3A 2V1CA 4EDGA 1DDEA 2ZBKA 4EE1A 1EQNA 4EDVA 1T6T1 3B39A 4E2KA 4EDKA 1DD9A 3VE5A 5GUJA 1VDDA
chains in the Genus database with same CATH superfamily
2NSWA 2Q2EA 3CU7A 4JCVA 2B39A 4EDTA 4O6PB 2KC6A 3VDUA 1D3YA 2ERLA 2KK2A 4EDRA 4O6OA 2JMSA 3VDPA 2AU3A 2V1CA 4EDGA 1DDEA 2ZBKA 1ERCA 4EE1A 1EQNA 3KXRA 4EDVA 3KLSA 1T6T1 3B39A 4E2KA 4EDKA 1DD9A 2FCJA 3VE5A 2LMKA 2NSVA 5GUJA 1VDDA 2I5RA
chains in the Genus database with same CATH topology
2NSWA 2Q2EA 3CU7A 4JCVA 2B39A 4EDTA 4O6PB 2KC6A 3VDUA 1D3YA 2ERLA 2KK2A 4EDRA 4O6OA 2JMSA 3VDPA 2AU3A 2V1CA 4EDGA 1DDEA 2ZBKA 1ERCA 4EE1A 1EQNA 3KXRA 4EDVA 3KLSA 1T6T1 3B39A 4E2KA 4EDKA 1DD9A 3VE5A 2LMKA 2NSVA 5GUJA 1VDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E A;  4JCV A;  4EDT A;  4O6P B;  3VDU A;  1D3Y A;  4EDR A;  4O6O A;  3VDP A;  2AU3 A;  2V1C A;  4EDG A;  1DDE A;  2ZBK A;  4EE1 A;  1EQN A;  4EDV A;  1T6T 1;  3B39 A;  4E2K A;  4EDK A;  1DD9 A;  3VE5 A;  5GUJ A;  1VDD A; 
#chains in the Genus database with same CATH topology
 2NSW A;  2Q2E A;  3CU7 A;  4JCV A;  2B39 A;  4EDT A;  4O6P B;  2KC6 A;  3VDU A;  1D3Y A;  2ERL A;  2KK2 A;  4EDR A;  4O6O A;  2JMS A;  3VDP A;  2AU3 A;  2V1C A;  4EDG A;  1DDE A;  2ZBK A;  1ERC A;  4EE1 A;  1EQN A;  3KXR A;  4EDV A;  3KLS A;  1T6T 1;  3B39 A;  4E2K A;  4EDK A;  1DD9 A;  2FCJ A;  3VE5 A;  2LMK A;  2NSV A;  5GUJ A;  1VDD A;  2I5R A; 
#chains in the Genus database with same CATH homology
 2NSW A;  2Q2E A;  3CU7 A;  4JCV A;  2B39 A;  4EDT A;  4O6P B;  2KC6 A;  3VDU A;  1D3Y A;  2ERL A;  2KK2 A;  4EDR A;  4O6O A;  2JMS A;  3VDP A;  2AU3 A;  2V1C A;  4EDG A;  1DDE A;  2ZBK A;  1ERC A;  4EE1 A;  1EQN A;  3KXR A;  4EDV A;  3KLS A;  1T6T 1;  3B39 A;  4E2K A;  4EDK A;  1DD9 A;  3VE5 A;  2LMK A;  2NSV A;  5GUJ A;  1VDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...