1EQYS

Complex between rabbit muscle alpha-actin: human gelsolin domain 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of gelsolin segment 1-actin complex and the mechanism of filament severing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords GELSOLIN
total genus 38
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1eqyS00
4Z94G 2VIKA 3Q2BA 1X67A 5IVUA 1SVQA 3EH2A 1NMDG 5HVKB 1SVRA 3DAWB 1JHWA 3L50A 2QTVA 2LJ8A 5KYUB 5A1MA 1WM4A 3FFKA 1V6FA 5KYUA 1M2OA 5FAEA 3EH1A 2NUPA 4PKIG 3FG6A 3FFNA 3EG9B 1TVJA 3EFOB 1T44G 1AK7A 4JD2H 1KCQA 5KYWA 1M4JA 1NLVG 1TMWA 5HVKD 1MDUA 2KVKA 3FG7A 5KYYB 5KYYA 3CIPG 2NUTB 2MP4A 5KYXA 1RGIG 4CBWG 3CJCG 4KEEA 1D4XG 1F7SA 1CNUA 1Q8XA 2XFAA 3CJBG 2FF6G 4PKGG 2NUPB 1M2VA 2FH2A 1J72A 1COFA 5FAFA 1WFSA 1M2VB 1H1VG 5KYXB 1D0NA 1VKKA 2VACA 5DD2A 3A5OS 1HQZ1 2VILA 2FGHA 4LIZA 3A5NS 4BEX1 2MOTA 1QPVA 4PKHB 4S10C 1Q8GA 1UDMA 2NUTA 1AHQA 2XF1A 3EGDA 5KYWB 2FH3A 4CBXG 1PD0A 2I2QA 1C0FS 1VFQA 2FH1A 2MV2A 1T3YA 3EG9A 1SVYA 1PD1A 5L6WC 1T3XA 3EGXB 4CBUG 1AK6A 3EGXA 3A5LS 2L72A 1DEJS 1P8ZG 3A5MS 1NM1G 2HD7A 2FF3A 5KYNA 2LXXA 1P8XA 1CFYA 1YAGG 1YVNG 3TU5B 1PCXA 3CI5G 1C0GS 1EQYS 4KEFA 1WNJA 2D8BA 2LLFA 2FH4A 1ESVS 1NPHA 4KEDA 2W0IA 3EGDB 1T2LA 3EFOA
chains in the Genus database with same CATH superfamily
4Z94G 2VIKA 3Q2BA 1X67A 5IVUA 1SVQA 3EH2A 1NMDG 5HVKB 1SVRA 3DAWB 1JHWA 3L50A 2QTVA 2LJ8A 5KYUB 5A1MA 1WM4A 3FFKA 1V6FA 5KYUA 1M2OA 5FAEA 3EH1A 2NUPA 4PKIG 3FG6A 3FFNA 3EG9B 1TVJA 3EFOB 1T44G 1AK7A 4JD2H 1KCQA 5KYWA 1M4JA 1NLVG 1TMWA 5HVKD 1MDUA 2KVKA 3FG7A 5KYYB 5KYYA 3DA7A 3CIPG 2NUTB 2MP4A 5KYXA 1RGIG 4CBWG 3CJCG 4KEEA 1D4XG 1F7SA 1CNUA 1Q8XA 2XFAA 3CJBG 2FF6G 4PKGG 2NUPB 1M2VA 2FH2A 1J72A 1COFA 5FAFA 1WFSA 1M2VB 1H1VG 5KYXB 1D0NA 1VKKA 2VACA 5DD2A 3A5OS 1HQZ1 2VILA 2FGHA 4LIZA 3A5NS 4BEX1 2MOTA 1QPVA 4PKHB 4S10C 1Q8GA 1UDMA 2NUTA 1AHQA 2XF1A 3EGDA 5KYWB 2FH3A 4CBXG 1PD0A 2I2QA 1C0FS 1VFQA 2FH1A 2MV2A 1T3YA 3EG9A 1SVYA 1PD1A 5L6WC 1T3XA 3EGXB 4CBUG 1AK6A 3EGXA 3A5LS 2L72A 1DEJS 1P8ZG 3A5MS 1NM1G 2HD7A 2FF3A 5KYNA 2LXXA 1P8XA 1CFYA 1YAGG 1YVNG 3TU5B 1PCXA 3CI5G 1C0GS 1EQYS 4KEFA 1WNJA 2D8BA 2LLFA 2FH4A 1ESVS 1NPHA 4KEDA 2W0IA 3EGDB 1T2LA 3EFOA
chains in the Genus database with same CATH topology
4Z94G 2VIKA 3Q2BA 1X67A 5IVUA 1SVQA 3EH2A 1NMDG 5HVKB 1SVRA 3DAWB 1JHWA 3L50A 2QTVA 2LJ8A 5KYUB 5A1MA 1WM4A 3FFKA 1V6FA 5KYUA 1M2OA 5FAEA 3EH1A 2NUPA 4PKIG 3FG6A 3FFNA 3EG9B 1TVJA 3EFOB 1T44G 1AK7A 4JD2H 1KCQA 5KYWA 1M4JA 1NLVG 1TMWA 5HVKD 1MDUA 2KVKA 3FG7A 5KYYB 5KYYA 3DA7A 3CIPG 2NUTB 2MP4A 5KYXA 1RGIG 4CBWG 3CJCG 4KEEA 1D4XG 1F7SA 1CNUA 1Q8XA 2XFAA 3CJBG 2FF6G 4PKGG 2NUPB 1M2VA 2FH2A 1J72A 1COFA 5FAFA 1WFSA 1M2VB 1H1VG 5KYXB 1D0NA 1VKKA 2VACA 5DD2A 3A5OS 1HQZ1 2VILA 2FGHA 4LIZA 3A5NS 4BEX1 2MOTA 1QPVA 4PKHB 4S10C 1Q8GA 1UDMA 2NUTA 1AHQA 2XF1A 3EGDA 5KYWB 2FH3A 4CBXG 1PD0A 2I2QA 1C0FS 1VFQA 2FH1A 2MV2A 1T3YA 3EG9A 1SVYA 1PD1A 5L6WC 1T3XA 3EGXB 4CBUG 1AK6A 3EGXA 3A5LS 2L72A 1DEJS 1P8ZG 3A5MS 1NM1G 2HD7A 2FF3A 5KYNA 2LXXA 1P8XA 1CFYA 1YAGG 1YVNG 3TU5B 1PCXA 3CI5G 1C0GS 1EQYS 4KEFA 1WNJA 2D8BA 2LLFA 2FH4A 1ESVS 1NPHA 4KEDA 2W0IA 3EGDB 1T2LA 3EFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z94 G;  2VIK A;  3Q2B A;  1X67 A;  5IVU A;  1SVQ A;  3EH2 A;  1NMD G;  5HVK B;  1SVR A;  3DAW B;  1JHW A;  3L50 A;  2QTV A;  2LJ8 A;  5KYU B;  5A1M A;  1WM4 A;  3FFK A;  1V6F A;  5KYU A;  1M2O A;  5FAE A;  3EH1 A;  2NUP A;  4PKI G;  3FG6 A;  3FFN A;  3EG9 B;  1TVJ A;  3EFO B;  1T44 G;  1AK7 A;  4JD2 H;  1KCQ A;  5KYW A;  1M4J A;  1NLV G;  1TMW A;  5HVK D;  1MDU A;  2KVK A;  3FG7 A;  5KYY B;  5KYY A;  3CIP G;  2NUT B;  2MP4 A;  5KYX A;  1RGI G;  4CBW G;  3CJC G;  4KEE A;  1D4X G;  1F7S A;  1CNU A;  1Q8X A;  2XFA A;  3CJB G;  2FF6 G;  4PKG G;  2NUP B;  1M2V A;  2FH2 A;  1J72 A;  1COF A;  5FAF A;  1WFS A;  1M2V B;  1H1V G;  5KYX B;  1D0N A;  1VKK A;  2VAC A;  5DD2 A;  3A5O S;  1HQZ 1;  2VIL A;  2FGH A;  4LIZ A;  3A5N S;  4BEX 1;  2MOT A;  1QPV A;  4PKH B;  4S10 C;  1Q8G A;  1UDM A;  2NUT A;  1AHQ A;  2XF1 A;  3EGD A;  5KYW B;  2FH3 A;  4CBX G;  1PD0 A;  2I2Q A;  1C0F S;  1VFQ A;  2FH1 A;  2MV2 A;  1T3Y A;  3EG9 A;  1SVY A;  1PD1 A;  5L6W C;  1T3X A;  3EGX B;  4CBU G;  1AK6 A;  3EGX A;  3A5L S;  2L72 A;  1DEJ S;  1P8Z G;  3A5M S;  1NM1 G;  2HD7 A;  2FF3 A;  5KYN A;  2LXX A;  1P8X A;  1CFY A;  1YAG G;  1YVN G;  3TU5 B;  1PCX A;  3CI5 G;  1C0G S;  1EQY S;  4KEF A;  1WNJ A;  2D8B A;  2LLF A;  2FH4 A;  1ESV S;  1NPH A;  4KED A;  2W0I A;  3EGD B;  1T2L A;  3EFO A; 
#chains in the Genus database with same CATH topology
 4Z94 G;  2VIK A;  3Q2B A;  1X67 A;  5IVU A;  1SVQ A;  3EH2 A;  1NMD G;  5HVK B;  1SVR A;  3DAW B;  1JHW A;  3L50 A;  2QTV A;  2LJ8 A;  5KYU B;  5A1M A;  1WM4 A;  3FFK A;  1V6F A;  5KYU A;  1M2O A;  5FAE A;  3EH1 A;  2NUP A;  4PKI G;  3FG6 A;  3FFN A;  3EG9 B;  1TVJ A;  3EFO B;  1T44 G;  1AK7 A;  4JD2 H;  1KCQ A;  5KYW A;  1M4J A;  1NLV G;  1TMW A;  5HVK D;  1MDU A;  2KVK A;  3FG7 A;  5KYY B;  5KYY A;  3DA7 A;  3CIP G;  2NUT B;  2MP4 A;  5KYX A;  1RGI G;  4CBW G;  3CJC G;  4KEE A;  1D4X G;  1F7S A;  1CNU A;  1Q8X A;  2XFA A;  3CJB G;  2FF6 G;  4PKG G;  2NUP B;  1M2V A;  2FH2 A;  1J72 A;  1COF A;  5FAF A;  1WFS A;  1M2V B;  1H1V G;  5KYX B;  1D0N A;  1VKK A;  2VAC A;  5DD2 A;  3A5O S;  1HQZ 1;  2VIL A;  2FGH A;  4LIZ A;  3A5N S;  4BEX 1;  2MOT A;  1QPV A;  4PKH B;  4S10 C;  1Q8G A;  1UDM A;  2NUT A;  1AHQ A;  2XF1 A;  3EGD A;  5KYW B;  2FH3 A;  4CBX G;  1PD0 A;  2I2Q A;  1C0F S;  1VFQ A;  2FH1 A;  2MV2 A;  1T3Y A;  3EG9 A;  1SVY A;  1PD1 A;  5L6W C;  1T3X A;  3EGX B;  4CBU G;  1AK6 A;  3EGX A;  3A5L S;  2L72 A;  1DEJ S;  1P8Z G;  3A5M S;  1NM1 G;  2HD7 A;  2FF3 A;  5KYN A;  2LXX A;  1P8X A;  1CFY A;  1YAG G;  1YVN G;  3TU5 B;  1PCX A;  3CI5 G;  1C0G S;  1EQY S;  4KEF A;  1WNJ A;  2D8B A;  2LLF A;  2FH4 A;  1ESV S;  1NPH A;  4KED A;  2W0I A;  3EGD B;  1T2L A;  3EFO A; 
#chains in the Genus database with same CATH homology
 4Z94 G;  2VIK A;  3Q2B A;  1X67 A;  5IVU A;  1SVQ A;  3EH2 A;  1NMD G;  5HVK B;  1SVR A;  3DAW B;  1JHW A;  3L50 A;  2QTV A;  2LJ8 A;  5KYU B;  5A1M A;  1WM4 A;  3FFK A;  1V6F A;  5KYU A;  1M2O A;  5FAE A;  3EH1 A;  2NUP A;  4PKI G;  3FG6 A;  3FFN A;  3EG9 B;  1TVJ A;  3EFO B;  1T44 G;  1AK7 A;  4JD2 H;  1KCQ A;  5KYW A;  1M4J A;  1NLV G;  1TMW A;  5HVK D;  1MDU A;  2KVK A;  3FG7 A;  5KYY B;  5KYY A;  3DA7 A;  3CIP G;  2NUT B;  2MP4 A;  5KYX A;  1RGI G;  4CBW G;  3CJC G;  4KEE A;  1D4X G;  1F7S A;  1CNU A;  1Q8X A;  2XFA A;  3CJB G;  2FF6 G;  4PKG G;  2NUP B;  1M2V A;  2FH2 A;  1J72 A;  1COF A;  5FAF A;  1WFS A;  1M2V B;  1H1V G;  5KYX B;  1D0N A;  1VKK A;  2VAC A;  5DD2 A;  3A5O S;  1HQZ 1;  2VIL A;  2FGH A;  4LIZ A;  3A5N S;  4BEX 1;  2MOT A;  1QPV A;  4PKH B;  4S10 C;  1Q8G A;  1UDM A;  2NUT A;  1AHQ A;  2XF1 A;  3EGD A;  5KYW B;  2FH3 A;  4CBX G;  1PD0 A;  2I2Q A;  1C0F S;  1VFQ A;  2FH1 A;  2MV2 A;  1T3Y A;  3EG9 A;  1SVY A;  1PD1 A;  5L6W C;  1T3X A;  3EGX B;  4CBU G;  1AK6 A;  3EGX A;  3A5L S;  2L72 A;  1DEJ S;  1P8Z G;  3A5M S;  1NM1 G;  2HD7 A;  2FF3 A;  5KYN A;  2LXX A;  1P8X A;  1CFY A;  1YAG G;  1YVN G;  3TU5 B;  1PCX A;  3CI5 G;  1C0G S;  1EQY S;  4KEF A;  1WNJ A;  2D8B A;  2LLF A;  2FH4 A;  1ESV S;  1NPH A;  4KED A;  2W0I A;  3EGD B;  1T2L A;  3EFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...