1EQYS

Complex between rabbit muscle alpha-actin: human gelsolin domain 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of gelsolin segment 1-actin complex and the mechanism of filament severing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords GELSOLIN
total genus 38
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1eqyS00
1SVYA 3EH2A 2NUPA 2NUTA 2XF1A 2LJ8A 1KCQA 3CJCG 3FG7A 4PKHB 3CI5G 1V6FA 3CIPG 3A5LS 2LXXA 1TMWA 1CNUA 1SVQA 3EFOA 1CFYA 3EH1A 4Z94G 2LLFA 1T3XA 2HD7A 1QPVA 4KEFA 2NUPB 2NUTB 2KVKA 5KYWA 1HQZ1 2FH4A 1COFA 1M2VB 1Q8XA 1NPHA 1AK6A 1PD1A 1VFQA 3A5MS 3EGDA 5L6WC 1T3YA 2VILA 3EG9B 3EGXA 1PCXA 5KYYA 3EFOB 5DD2A 4CBUG 1ESVS 1T44G 1T2LA 5KYXB 1YAGG 5KYUB 1DEJS 1JHWA 5FAEA 1X67A 2FGHA 3EGDB 1PD0A 1Q8GA 3DAWB 3EG9A 2FH1A 5HVKB 4CBWG 2XFAA 1MDUA 2MOTA 1YVNG 3FFKA 3Q2BA 2W0IA 5FAFA 2VIKA 2MP4A 5IVUA 2FH2A 3TU5B 1SVRA 4JD2H 1AK7A 3CJBG 2MV2A 5KYWB 1AHQA 1NLVG 1M2OA 2I2QA 4KEDA 5A1MA 1WM4A 2FF3A 3A5OS 4CBXG 1EQYS 4LIZA 4S10C 1WNJA 3EGXB 3FFNA 2D8BA 1D4XG 1P8XA 1J72A 1VKKA 1H1VG 1NM1G 1C0FS 5HVKD 1M2VA 2VACA 1P8ZG 2FH3A 1M4JA 3FG6A 3L50A 4KEEA 1F7SA 3A5NS 1NMDG 1D0NA 5KYYB 1WFSA 4BEX1 1TVJA 4PKIG 5KYNA 1C0GS 5KYXA 2L72A 1UDMA 2FF6G 5KYUA 2QTVA 4PKGG 1RGIG
chains in the Genus database with same CATH superfamily
1SVYA 3EH2A 2NUPA 2NUTA 2XF1A 2LJ8A 1KCQA 3CJCG 3FG7A 4PKHB 3CI5G 1V6FA 3CIPG 3A5LS 2LXXA 1TMWA 1CNUA 1SVQA 3EFOA 1CFYA 3EH1A 4Z94G 2LLFA 1T3XA 2HD7A 1QPVA 4KEFA 2NUPB 2NUTB 2KVKA 5KYWA 1HQZ1 2FH4A 1COFA 1M2VB 1Q8XA 1NPHA 1AK6A 1PD1A 1VFQA 3A5MS 3EGDA 5L6WC 1T3YA 2VILA 3EG9B 3EGXA 1PCXA 5KYYA 3EFOB 5DD2A 4CBUG 1ESVS 1T44G 1T2LA 5KYXB 1YAGG 5KYUB 1DEJS 1JHWA 5FAEA 1X67A 2FGHA 3EGDB 1PD0A 1Q8GA 3DAWB 3EG9A 2FH1A 5HVKB 4CBWG 2XFAA 1MDUA 2MOTA 1YVNG 3FFKA 3Q2BA 2W0IA 5FAFA 2VIKA 2MP4A 5IVUA 2FH2A 3TU5B 1SVRA 4JD2H 1AK7A 3CJBG 2MV2A 5KYWB 1AHQA 1NLVG 1M2OA 2I2QA 4KEDA 5A1MA 1WM4A 2FF3A 3A5OS 4CBXG 1EQYS 3DA7A 4LIZA 4S10C 1WNJA 3EGXB 3FFNA 2D8BA 1D4XG 1P8XA 1J72A 1VKKA 1H1VG 1NM1G 1C0FS 5HVKD 1M2VA 2VACA 1P8ZG 2FH3A 1M4JA 3FG6A 3L50A 4KEEA 1F7SA 3A5NS 1NMDG 1D0NA 5KYYB 1WFSA 4BEX1 1TVJA 4PKIG 5KYNA 1C0GS 5KYXA 2L72A 1UDMA 2FF6G 5KYUA 2QTVA 4PKGG 1RGIG
chains in the Genus database with same CATH topology
1SVYA 3EH2A 2NUPA 2NUTA 2XF1A 2LJ8A 1KCQA 3CJCG 3FG7A 4PKHB 3CI5G 1V6FA 3CIPG 3A5LS 2LXXA 1TMWA 1CNUA 1SVQA 3EFOA 1CFYA 3EH1A 4Z94G 2LLFA 1T3XA 2HD7A 1QPVA 4KEFA 2NUPB 2NUTB 2KVKA 5KYWA 1HQZ1 2FH4A 1COFA 1M2VB 1Q8XA 1NPHA 1AK6A 1PD1A 1VFQA 3A5MS 3EGDA 5L6WC 1T3YA 2VILA 3EG9B 3EGXA 1PCXA 5KYYA 3EFOB 5DD2A 4CBUG 1ESVS 1T44G 1T2LA 5KYXB 1YAGG 5KYUB 1DEJS 1JHWA 5FAEA 1X67A 2FGHA 3EGDB 1PD0A 1Q8GA 3DAWB 3EG9A 2FH1A 5HVKB 4CBWG 2XFAA 1MDUA 2MOTA 1YVNG 3FFKA 3Q2BA 2W0IA 5FAFA 2VIKA 2MP4A 5IVUA 2FH2A 3TU5B 1SVRA 4JD2H 1AK7A 3CJBG 2MV2A 5KYWB 1AHQA 1NLVG 1M2OA 2I2QA 4KEDA 5A1MA 1WM4A 2FF3A 3A5OS 4CBXG 1EQYS 3DA7A 4LIZA 4S10C 1WNJA 3EGXB 3FFNA 2D8BA 1D4XG 1P8XA 1J72A 1VKKA 1H1VG 1NM1G 1C0FS 5HVKD 1M2VA 2VACA 1P8ZG 2FH3A 1M4JA 3FG6A 3L50A 4KEEA 1F7SA 3A5NS 1NMDG 1D0NA 5KYYB 1WFSA 4BEX1 1TVJA 4PKIG 5KYNA 1C0GS 5KYXA 2L72A 1UDMA 2FF6G 5KYUA 2QTVA 4PKGG 1RGIG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVY A;  3EH2 A;  2NUP A;  2NUT A;  2XF1 A;  2LJ8 A;  1KCQ A;  3CJC G;  3FG7 A;  4PKH B;  3CI5 G;  1V6F A;  3CIP G;  3A5L S;  2LXX A;  1TMW A;  1CNU A;  1SVQ A;  3EFO A;  1CFY A;  3EH1 A;  4Z94 G;  2LLF A;  1T3X A;  2HD7 A;  1QPV A;  4KEF A;  2NUP B;  2NUT B;  2KVK A;  5KYW A;  1HQZ 1;  2FH4 A;  1COF A;  1M2V B;  1Q8X A;  1NPH A;  1AK6 A;  1PD1 A;  1VFQ A;  3A5M S;  3EGD A;  5L6W C;  1T3Y A;  2VIL A;  3EG9 B;  3EGX A;  1PCX A;  5KYY A;  3EFO B;  5DD2 A;  4CBU G;  1ESV S;  1T44 G;  1T2L A;  5KYX B;  1YAG G;  5KYU B;  1DEJ S;  1JHW A;  5FAE A;  1X67 A;  2FGH A;  3EGD B;  1PD0 A;  1Q8G A;  3DAW B;  3EG9 A;  2FH1 A;  5HVK B;  4CBW G;  2XFA A;  1MDU A;  2MOT A;  1YVN G;  3FFK A;  3Q2B A;  2W0I A;  5FAF A;  2VIK A;  2MP4 A;  5IVU A;  2FH2 A;  3TU5 B;  1SVR A;  4JD2 H;  1AK7 A;  3CJB G;  2MV2 A;  5KYW B;  1AHQ A;  1NLV G;  1M2O A;  2I2Q A;  4KED A;  5A1M A;  1WM4 A;  2FF3 A;  3A5O S;  4CBX G;  1EQY S;  4LIZ A;  4S10 C;  1WNJ A;  3EGX B;  3FFN A;  2D8B A;  1D4X G;  1P8X A;  1J72 A;  1VKK A;  1H1V G;  1NM1 G;  1C0F S;  5HVK D;  1M2V A;  2VAC A;  1P8Z G;  2FH3 A;  1M4J A;  3FG6 A;  3L50 A;  4KEE A;  1F7S A;  3A5N S;  1NMD G;  1D0N A;  5KYY B;  1WFS A;  4BEX 1;  1TVJ A;  4PKI G;  5KYN A;  1C0G S;  5KYX A;  2L72 A;  1UDM A;  2FF6 G;  5KYU A;  2QTV A;  4PKG G;  1RGI G; 
#chains in the Genus database with same CATH topology
 1SVY A;  3EH2 A;  2NUP A;  2NUT A;  2XF1 A;  2LJ8 A;  1KCQ A;  3CJC G;  3FG7 A;  4PKH B;  3CI5 G;  1V6F A;  3CIP G;  3A5L S;  2LXX A;  1TMW A;  1CNU A;  1SVQ A;  3EFO A;  1CFY A;  3EH1 A;  4Z94 G;  2LLF A;  1T3X A;  2HD7 A;  1QPV A;  4KEF A;  2NUP B;  2NUT B;  2KVK A;  5KYW A;  1HQZ 1;  2FH4 A;  1COF A;  1M2V B;  1Q8X A;  1NPH A;  1AK6 A;  1PD1 A;  1VFQ A;  3A5M S;  3EGD A;  5L6W C;  1T3Y A;  2VIL A;  3EG9 B;  3EGX A;  1PCX A;  5KYY A;  3EFO B;  5DD2 A;  4CBU G;  1ESV S;  1T44 G;  1T2L A;  5KYX B;  1YAG G;  5KYU B;  1DEJ S;  1JHW A;  5FAE A;  1X67 A;  2FGH A;  3EGD B;  1PD0 A;  1Q8G A;  3DAW B;  3EG9 A;  2FH1 A;  5HVK B;  4CBW G;  2XFA A;  1MDU A;  2MOT A;  1YVN G;  3FFK A;  3Q2B A;  2W0I A;  5FAF A;  2VIK A;  2MP4 A;  5IVU A;  2FH2 A;  3TU5 B;  1SVR A;  4JD2 H;  1AK7 A;  3CJB G;  2MV2 A;  5KYW B;  1AHQ A;  1NLV G;  1M2O A;  2I2Q A;  4KED A;  5A1M A;  1WM4 A;  2FF3 A;  3A5O S;  4CBX G;  1EQY S;  3DA7 A;  4LIZ A;  4S10 C;  1WNJ A;  3EGX B;  3FFN A;  2D8B A;  1D4X G;  1P8X A;  1J72 A;  1VKK A;  1H1V G;  1NM1 G;  1C0F S;  5HVK D;  1M2V A;  2VAC A;  1P8Z G;  2FH3 A;  1M4J A;  3FG6 A;  3L50 A;  4KEE A;  1F7S A;  3A5N S;  1NMD G;  1D0N A;  5KYY B;  1WFS A;  4BEX 1;  1TVJ A;  4PKI G;  5KYN A;  1C0G S;  5KYX A;  2L72 A;  1UDM A;  2FF6 G;  5KYU A;  2QTV A;  4PKG G;  1RGI G; 
#chains in the Genus database with same CATH homology
 1SVY A;  3EH2 A;  2NUP A;  2NUT A;  2XF1 A;  2LJ8 A;  1KCQ A;  3CJC G;  3FG7 A;  4PKH B;  3CI5 G;  1V6F A;  3CIP G;  3A5L S;  2LXX A;  1TMW A;  1CNU A;  1SVQ A;  3EFO A;  1CFY A;  3EH1 A;  4Z94 G;  2LLF A;  1T3X A;  2HD7 A;  1QPV A;  4KEF A;  2NUP B;  2NUT B;  2KVK A;  5KYW A;  1HQZ 1;  2FH4 A;  1COF A;  1M2V B;  1Q8X A;  1NPH A;  1AK6 A;  1PD1 A;  1VFQ A;  3A5M S;  3EGD A;  5L6W C;  1T3Y A;  2VIL A;  3EG9 B;  3EGX A;  1PCX A;  5KYY A;  3EFO B;  5DD2 A;  4CBU G;  1ESV S;  1T44 G;  1T2L A;  5KYX B;  1YAG G;  5KYU B;  1DEJ S;  1JHW A;  5FAE A;  1X67 A;  2FGH A;  3EGD B;  1PD0 A;  1Q8G A;  3DAW B;  3EG9 A;  2FH1 A;  5HVK B;  4CBW G;  2XFA A;  1MDU A;  2MOT A;  1YVN G;  3FFK A;  3Q2B A;  2W0I A;  5FAF A;  2VIK A;  2MP4 A;  5IVU A;  2FH2 A;  3TU5 B;  1SVR A;  4JD2 H;  1AK7 A;  3CJB G;  2MV2 A;  5KYW B;  1AHQ A;  1NLV G;  1M2O A;  2I2Q A;  4KED A;  5A1M A;  1WM4 A;  2FF3 A;  3A5O S;  4CBX G;  1EQY S;  3DA7 A;  4LIZ A;  4S10 C;  1WNJ A;  3EGX B;  3FFN A;  2D8B A;  1D4X G;  1P8X A;  1J72 A;  1VKK A;  1H1V G;  1NM1 G;  1C0F S;  5HVK D;  1M2V A;  2VAC A;  1P8Z G;  2FH3 A;  1M4J A;  3FG6 A;  3L50 A;  4KEE A;  1F7S A;  3A5N S;  1NMD G;  1D0N A;  5KYY B;  1WFS A;  4BEX 1;  1TVJ A;  4PKI G;  5KYN A;  1C0G S;  5KYX A;  2L72 A;  1UDM A;  2FF6 G;  5KYU A;  2QTV A;  4PKG G;  1RGI G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...